Patent application title: Antibody Fusion Proteins with a Modified FcRn Binding Site
Inventors:
Kin-Ming Lo (Lexington, MA, US)
Pascal A. Stein (Boston, MA, US)
IPC8 Class: AC07K14565FI
USPC Class:
Class name:
Publication date: 2015-10-01
Patent application number: 20150274797
Abstract:
Disclosed are antibody fusion proteins with a modified FcRn binding site
and nucleic acid molecules encoding them. The antibody fusion protein
include two polypeptide chains, wherein the first polypeptide chain
includes a biologically active molecule linked to at least a portion of
an immunoglobulin constant region. The second polypeptide chain includes
at least a portion of an immunoglobulin constant region. One of the
polypeptide chains includes a mutation in the FcRn binding site that
reduces binding to FcRn. Also disclosed are methods of producing the
fusion proteins and methods of using the fusion proteins for treating
diseases and conditions alleviated by the administration of the fusion
proteins.Claims:
1-37. (canceled)
38. A protein comprising two polypeptide chains, wherein the first polypeptide chain comprises wild-type native mature human interferon-.beta. having one or more mutations selected from the group consisting of C17S, C17A, C17V, C17M, F50H, L57A, L130A, H131A, K136A, H140A, and H140T and at least a portion of an IgG constant region, the second polypeptide chain comprises at least a portion of an IgG constant region, and one of the polypeptide chains comprises a substitution corresponding to position 435 in the IgG FcRn binding site, wherein the substitution is H435A, wherein the human interferon-.beta. is linked to the amino-terminus of the IgG constant region.
Description:
REFERENCE TO RELATED APPLICATIONS
[0001] This application claims the benefit of and priority to U.S. Provisional Patent Application No. 61/171,650, filed Apr. 22, 2009, the complete disclosure of which is incorporated herein by reference.
BACKGROUND
[0002] An antibody fusion protein linking a protein of interest to an immunoglobulin constant region possesses both the biological activity of the linked protein as well as the advantages associated with the presence of the immunoglobulin moiety. The creation of such fusion proteins helps to ensure the efficient production and secretion of proteins of interest. Furthermore, these fusion proteins often exhibit novel properties such as increased circulating that are of significant therapeutic advantage.
[0003] In adult mammals, FcRn, also known as the neonatal Fc receptor, plays a key role in maintaining serum antibody levels by acting as a protective receptor that binds and salvages antibodies of the IgG isotype from degradation. IgG molecules are endocytosed by endothelial cells, and if they bind to FcRn, are recycled out into circulation. In contrast, IgG molecules that do not bind to FcRn enter the cells and are targeted to the lysosomal pathway where they are degraded. A variant IgG1 in which His435 is mutated to alanine results in the selective loss of FcRn binding and a significantly reduced serum half-life (Firan et al. 2001, International Immunology 13:993).
[0004] The Fc portion of an IgG molecules includes two identical polypeptide chains, with each polypeptide chain engaging a single FcRn molecule through its FcRn binding site (Martin et al., 1999, Biochemistry 38:12639). Earlier studies indicate that each Fc portion requires both FcRn binding sites for serum persistence. A heterodimeric Fc fragment containing a wild-type FcRn-binding polypeptide chain and a mutated non-FcRn-binding polypeptide chain has a significantly reduced serum half-life compared to a homodimeric wild-type Fc fragment (Kim et al., 1994, Scand. J. Immunol. 40:457-465). Such a heterodimeric Fc fragment containing only one FcRn binding site is recycled less efficiently than a homodimeric wild-type Fc fragment and is preferentially trafficked to lysosomes for degradation (Tesar et al., 2006, Traffic 7:1127). These observations have direct relevance to the effective application of therapeutics involving FcRn binding partners including IgG antibodies or their Fc portions. For example, U.S. Pat. No. 7,348,004 describes a fusion protein that specifically requires intact FcRn binding or even enhanced FcRn binding for its improved biological properties such as increased serum half-life and enhanced bioavailability.
[0005] More recent studies have identified the expression of FcRn in phagocytes and suggested a novel role of FcRn in IgG-mediated phagocytosis (Vidarsson et al. 2006, Blood 108:3573). IgG-opsonized pathogens are internalized into phagosomes by FcRn, providing an effective means to mark pathogens for ingestion and destruction by phagocytes. The IgG1 variant with a H435A mutation exhibits significantly reduced opsonization activity.
SUMMARY OF THE INVENTION
[0006] The present invention is based in part on the surprising discovery that an antibody fusion protein with a mutation in one of its constituent immunoglobulin constant region polypeptide chains that reduces or eliminates FcRn binding exhibits comparable biological properties such as prolonged circulating half-life as corresponding fusion proteins without the mutation. Furthermore, given the role of FcRn in IgG-mediated phagocytosis, it is contemplated that the antibody fusion protein with a mutation that reduces FcRn binding may have low opsonization activity leading to reduced immunogenicity.
[0007] The present invention provides methods and compositions for expressing soluble, biologically active antibody fusion proteins with a mutation in the FcRn binding site that reduces FcRn binding. The fusion protein includes two polypeptide chains. The first polypeptide chain includes a biologically active molecule linked to at least a portion of an immunoglobulin constant region, and the second polypeptide chain includes at least a portion of an inummoglobulin constant region. The amino acid sequence of the portion of the immunoglobulin constant region of one of the polypeptide chains differs from the amino acid sequence of the portion of the immunoglobulin constant region of the second polypeptide chain in that it contains a mutation in the FcRn binding site. The difference can be an amino acid deletion, insertion, substitution, or modification. In one embodiment, the difference is an amino acid substitution. In a further embodiment, the amino acid substitution is H435A.
[0008] The invention relates to fusion proteins linking a biologically active molecule to at least a portion of an immunoglobulin constant region. The biologically active molecule may be linked to the amino-terminus of the immunoglobulin constant region. Alternatively, the biologically active molecule may be linked to the carboxy-terminus of the immunoglobulin constant region. In a further embodiment, the fusion protein may include two biologically active molecules linked to two polypeptide chains of at least a portion of an immunoglobulin constant region.
[0009] The invention relates to fusion proteins that include at least a portion of the immunoglobulin constant region. It is contemplated that the portion of the immunoglobulin constant region can be an Fc fragment. In various embodiments, the Fc fragment is the Fc fragment of an IgG1, IgG2, IgG3, or IgG4. In another embodiment, the fusion protein includes an immunoglobulin variable region in at least one of the polypeptide chains.
[0010] The present invention contemplates the use of any biologically active molecule as the therapeutic molecule of the invention. For example, the biologically active molecule can be a human interferon, such as interferon-β. To improve folding and to reduce aggregation, an interferon-β sequence can include an amino acid alteration of at least one of positions 17, 50, 57, 130, 131, 136, and 140 corresponding to native, mature interferon-β. The alteration can be an amino acid substitution. In one embodiment, the amino acid substitution is selected from the group consisting of C17S, C17A, C17V, C17M, F50M, L57A, L130A, H131A, K136A, H140A, and H140T. In another embodiment, the biologically active molecule is a growth factor such as human erythropoietin. In yet another embodiment, the biologically active molecule is a hormone such as human growth hormone. Alternatively, the biologically active molecule can be a polypeptide, a small molecule, or a nucleic acid.
[0011] The invention also provides methods for encoding and expressing fusion proteins of the invention. For example, one aspect of the invention relates to a nucleic acid encoding a polypeptide chain that includes a biologically active molecule and at least a portion of an immunoglobulin constant region comprising a mutation that reduces FcRn binding. In another aspect, the invention relates to a composition of one nucleic acid encoding a polypeptide chain that includes a biologically active molecule and at least a portion of an immunoglobulin constant region, and a second nucleic acid encoding a second polypeptide chain that includes at least a portion of an immunoglobulin constant region. One of the nucleic acid sequences contains a mutation in the FcRn binding site. In one embodiment, the mutation is an amino acid substitution. In a further embodiment, the amino acid substitution is H435A. In another aspect, the nucleic acid molecule or the nucleic acid composition of the invention can be incorporated within a replicable expression vector, which can then be introduced into a host cell and be recombined with and integrated into the host cell genome. The replicable expression vector can include the aforementioned nucleic acid or the nucleic acid composition. In another embodiment, the invention encompasses the host cells containing the aforementioned nucleic acid or the nucleic acid composition.
[0012] The invention herein provides for a pharmaceutical composition comprising the aforementioned fusion proteins and a pharmaceutically acceptable carrier. Depending on the intended use or mode of administration, solid or liquid pharmaceutically acceptable carriers can be employed in the pharmaceutical composition.
[0013] A further aspect of the invention relates to methods for treating a mammal with a disease or condition alleviated by the administration of any of the aforementioned fusion proteins. In one embodiment, the disease or condition is viral infection. In another embodiment, the disease or condition is anemia, while in yet another embodiment, the disease or condition is multiple sclerosis.
[0014] Other embodiments and details of the invention are presented herein below.
DESCRIPTION OF DRAWINGS
[0015] FIGS. 1A-1D schematically illustrate how a biologically active molecule (circle) may be linked to the Fc subunits of an antibody, shown here as a hinge (small rectangle), a CH2 domain and a CH3 domain (large rectangle). One of the Fc subunits includes a mutation in the FcRn binding site (diamond). The biologically active molecule may be linked to the N-terminus (FIGS. 1A and 1B) or the C-terminus (FIGS. 1C and 1D) of the Fc subunit.
[0016] FIGS. 2A-2F illustrate a subset of ways in which two biologically active molecules may be linked to the Fc subunits of an antibody. One of the Fc subunits includes a mutation in the FcRn binding site. The two biologically active molecules may be same or different (black or white circles).
[0017] FIGS. 3A-3H show how a biologically active molecule may be linked to an antibody that include a constant region (rectangles) and a variable region (stippled rectangle) of the heavy chain. The antibody fusion protein may include a single variable region (FIGS. 3A-3D), or the antibody fusion protein may include two variable regions (FIGS. 3E-3H). One of the heavy chains includes a mutation in the FcRn binding site.
[0018] FIGS. 4A-4F show how two biologically active molecules may be linked to an antibody that include a constant region (rectangles) and a variable region (stippled rectangle) of the heavy chain. The two biologically active molecules may be same or different (black or white circles). One of the heavy chains includes a mutation in the FcRn binding site.
[0019] FIGS. 5A-5D show a subset of ways in which a biologically active molecule may be linked to an intact immunoglobulin such as an IgG. The constant regions of the heavy and light chains are shown as rectangles and the variable regions are shown as stippled rectangles. One of the heavy chains includes a mutation in the FcRn binding site. The biologically active molecule may be linked to the heavy chain (FIGS. 5A and 5B) or the light chain (FIGS. 5C and 5D).
[0020] FIGS. 6A-6F illustrate how two biologically active molecules can be linked to an intact immunoglobulin such as an IgG. One of the heavy chains includes a mutation in the Ran binding site. The biologically active molecules may be linked to the heavy chains (FIGS. 6A and 6B) or the light chains (FIGS. 6C and 6D). Alternatively, one of the biologically active molecule may be linked to the heavy chain and the other biologically active molecule is linked to the light chain (FIGS. 6E and 6F).
[0021] FIGS. 7A-7F illustrate how two different biologically active molecules can be linked to an intact immunoglobulin such as an IgG. One of the heavy chains includes a mutation in the FcRn binding site.
[0022] FIG. 8 shows an SDS-PAGE analysis of huFcγ4h-mono-L-DI-IFNβ produced by transient coexpression of the human Fcγ4h chain and the human Fcγ4b-Linker-DI-IFNβ chain in 293T cells under reducing (left panel) and nonreducing conditions (middle panel). In the left panel, lane 2 shows that both the Fcγγ4h chain and the Fcγ4h-Linker-DI-IFNβ chain were expressed, while lane 1 is a control showing the expression of Fcγ4h alone. In the middle panel, the transient coexpression of the human Fcγ4h chain and the human Fcγ4h-Linker-DI-IFNβ chain was analyzed under nonreducing conditions. Duplicate samples of the Fcγ4h chain (the two lanes labeled 1a and 1b) or the coexpression of the Fcγ4h chain and the Fcγ4h-Linker-DI-IFNβ chain (the two lanes labeled 2a and 2b) were analyzed. The right panel shows that coexpression of Fc and Fc-IL-2 chains from two stably transfected clones (the two lanes labeled 3 and 4) gave the normal and expected ratio of naked Fc homodimer Fc/Fc-IL2 heterodimer: Fc-IL2 homodimer on SDS-PAGE. under non-reducing conditions.
[0023] FIG. 9 shows an SDS-PAGE analysis of conditioned media from a number of stable NS0 clones coexpressing the Fcγ4h chain and the Fcγ4h-Linker-DI-IFNβ chain under non-reducing conditions. All the clones produced the Fcγ4h homodimer and Fcγ4h/Fcγ4h-IFNγ heterodimer, but little or no Fcγ4h-IFNβ homodimer.
[0024] FIG. 10 shows the biological activities of purified Fcγ4h-mono-L-DI-IFNβ (squares) and Fcγ4h-mono-L-DI-IFNβ variant containing the H435A substitution (triangles) in a cytopathic effect (CPE) inhibition assay. The human epithelial lung carcinoma line A549 was used as a host for the encephalomyocarditis virus (EMCV). Rebif (circles) was used as the positive control.
[0025] FIG. 11 compares the pharmacokinetic profiles of intravenously administered huFcγ4h-mono-L-DI-IFNβ (diamonds) and huFcγ4h-mono-L-DI-IFNβ variant containing the H435A substitution in the form of the huFcγ4h(H435A)/huFcγ4h-L-DI-IFNβ heterodimer (squares). Mice (n=3) were injected intravenously with 25 μg of total protein/mouse. Serum concentrations of the injected protein at different time points were determined by anti-hu Fe ELISA.
[0026] FIG. 12 compares the pharmacokinetic profiles of intravenously administered huFcγ4h-mono-L-DI-IFNβ (diamonds) and huFcγ4h-mono-L-DI-IFNβ variant containing the H435A substitution in the form of the huFcγ4h(H435A)/huFcγ4h-L-DI-IFNβ heterodimer (squares). Mice (n=3) were injected intravenously with 25 μg of total protein/mouse. Serum concentrations of the injected protein at different time points were determined by an ELISA consisting of anti-hu (H&L) capture and anti-hu IFN-β detection.
[0027] FIG. 13 is a Western blot analysis of the mouse serum samples from the intravenous pharmacokinetics studies under reducing conditions. Top left: huFcγ4h-mono-L-DI-IFNβ probed with anti-hu Fc; bottom left: huFcγ4h-mono-L-DI-IFNβ variant containing the H435A substitution probed with anti-hu Fc; top right: huFcγ4h-mono-L-DI-IFNβ probed with anti-hu IFNβ; bottom right: huFcγ4h-mono-L-DI-IFNβ variant containing the H435A substitution probed with anti-hu IFNβ.
[0028] FIG. 14 compares the pharmacokinetic profiles of subcutaneously administered huFcγ4h-mono-L-DI-IFNβ (diamonds) and huFcγ4h-mono-L-DI-IFNβ variant containing the H435A substitution in the form of the huFcγ4h(H435A)/huFcγ4h-L-DI-IFNβ heterodimer (squares). Mice (n=3) were injected subcutaneously with 50 μs of total protein/mouse. Serum concentrations of the injected protein at different time points were determined by anti-hu Fc ELISA.
[0029] FIG. 15 compares the pharmacokinetic profiles of subcutaneously administered huFcγ4h-mono-L-DI-IFNβ (diamonds) and huFcγ4h-mono-L-DI-IFNβ variant containing the H435A substitution in the form of the huFcγ4h(H435A)/huFcγ4h-L-DI-IFNβ heterodimer (squares), Mice (n=3) were injected subcutaneously with 50 μg of total protein/mouse. Serum concentrations of the injected protein at different time points were determined by an ELISA consisting of anti-hu (H&L) capture and anti-hu IFNβ detection.
[0030] FIG. 16 is a Western blot analysis of the mouse serum samples from the subcutaneous pharmacokinetics studies under reducing conditions. Top left: huFcγ4h-mono-L-DI-IFNβ probed with anti-hu Fc; bottom left: huFcγ4h-mono-L-DI-IFNβ variant containing the H435A substitution probed with anti-hu Fc; top right: hyFcγ4h-mono-L-DI-IFNβ probed with anti-hu IFNβ; bottom right: huFcγ4h-mono-L-DI-IFNβ variant containing the H435A substitution probed with anti-hu IFNβ.
[0031] FIG. 17 compares the antibody titers of mice that were immunized with huFcγ4h-mono-L-DI-IFNγ (circles) or huFcγ4h-mono-L-DI-IFNβ variant containing the H435A substitution (diamonds) following boost injections. Mouse antibody titers were determined by ELISA.
DETAILED DESCRIPTION
Definitions
[0032] An "effective amount" or "pharmaceutically effective amount" of a therapeutic or composition contemplated herein is an amount sufficient to produce a desired effect, e.g., reducing the severity of disease symptoms. The pharmaceutically effective amount will vary depending upon the subject and disease condition being treated, the weight and age of the subject, the severity of the disease condition, the manner of administration and the like. For example, certain compositions of the present invention may be administered in a sufficient amount to produce a reasonable benefit/risk ratio applicable to such treatment.
[0033] The term "nucleic acid" as used herein refers to a polymer containing at least two deoxyribonucleotides or ribonucleotides in either single- or double-stranded form and includes DNA and RNA. DNA may be in the form of, e.g., plasmid DNA, pre-condensed DNA, a PCR product, vectors (P1, PAC, BAC, YAC, artificial chromosomes), expression cassettes, chromosomal DNA, or derivatives and combinations of these groups. RNA may be in the form of mRNA, tRNA, rRNA, tRNA, vRNA, and combinations thereof. Nucleic acids include nucleic acids containing known nucleotide analogs or modified backbone residues or linkages, which are synthetic, naturally occurring, and non-naturally occurring, and which have similar binding properties as the reference nucleic acid. Examples of such analogs include, without limitation, phosphorothioates, phosphoramidates, methyl phosphonates, chiral-methyl phosphonates, 2'-O-methyl ribonucleotides, and peptide nucleic acids (PNAs). "Nucleotides" contain a deoxyribose (DNA) or ribose (RNA), a sugar, a nitrogenous base, and a phosphate group or analog thereof. Nucleotides are linked together through the phosphate groups. "Bases" include purines and pyrimidines, which further include natural compounds adenine, thymine, guanine, cytosine, uracil, inosine, and natural analogs, and synthetic derivatives of purines and pyrimidines, which include, but are not limited to, modifications which place new reactive groups such as, but not limited to, amines, alcohols, thiols, carboxylates, and alkylhalides.
[0034] The term "small molecule" refers to a molecule with a molecular weight of less than 1 kDa. The small molecule can be any of a variety of molecules, naturally occurring or synthetic. The biological active molecule can be a small organic molecule, a small inorganic molecule, a sugar molecule, a lipid molecule, or the like. The small molecule can be a drug.
[0035] The term "pharmaceutically acceptable excipient" refers to a pharmaceutically acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, or solvent, used in formulating pharmaceutical products. Each excipient must be "acceptable" in the sense of being compatible with the subject composition and its components and not injurious to the patient. Some examples of materials which may serve as pharmaceutically acceptable excipients include: (1) sugars, such as lactose, glucose and sucrose; (2) starches, such as corn starch and potato starch; (3) cellulose, and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; (4) powdered tragacanth; (5) malt; (6) gelatin; (7) talc; (8) excipients, such as cocoa butter and suppository waxes; (9) oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; (10) glycols, such as propylene glycol; (11) polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol; (12) esters, such as ethyl oleate and ethyl laurate; (13) agar; (14) buffering agents, such as magnesium hydroxide and aluminum hydroxide; (15) alginic acid; (16) pyrogen-free water; (17) isotonic saline; (18) Ringer's solution; (19) ethyl alcohol; (20) phosphate buffer solutions; and (21) other non-toxic compatible substances employed in pharmaceutical formulations.
Antibody Fusion Proteins
[0036] Antibody fusion proteins linking a protein of interest to an immunoglobulin constant region, for example, an immunoglobulin Fc region, possess both the biological activity of the linked protein as well as the advantages associated with the presence of the immunoglobulin moiety. Such fusion proteins exhibit enhanced stability and increased bioavailability compared to the biologically active molecule alone. Additionally, the presence of the Fc fragment can significantly improve protein production. This is believed to occur, in part, because the Fc moiety of the fusion protein is designed for efficient secretion of the fusion protein, and, in part, because the fusion proteins can be produced in and secreted from host cells that naturally express the immunoglobulin such that the fusion protein is readily secreted from the host cell. Finally, the Fc fragment can further be exploited to aid in the purification of the fused polypeptide.
[0037] In adult mammals, FcRn acts as a protective receptor that binds and salvages IgG from degradation. Numerous studies support a correlation between the affinity for FcRn binding and the serum half-life of an antibody. Surprisingly, the present invention provides that antibody fusion proteins with a mutation reducing FcRn binding exhibit comparable biological properties such as prolonged circulating half-life as corresponding fusion proteins without the mutation. Furthermore, given the role of FcRn in IgG mediated opsonization, it is contemplated that the antibody fusion protein with a mutation that reduces affinity for FcRn may exhibit reduced immunogenicity.
[0038] Consequently, the present invention provides for antibody fusion proteins comprised of two polypeptide chains. The first polypeptide chain includes a biologically active molecule linked to at least a portion of an immunoglobulin constant region, and the second polypeptide chain includes at least a portion of an immunoglobulin constant region. The amino acid sequence of the portion of the immunoglobulin constant region of one of the polypeptide chains differs from the amino acid sequence of the portion of the immunoglobulin constant region of the second polypeptide chain in that it contains a mutation in the FcRn binding site.
[0039] The invention also provides methods and compositions for expressing soluble, biologically active antibody fusion proteins with a mutation in the FcRn binding site that reduces FcRn binding. In particular, the invention provides nucleic acid molecules that encode a polypeptide chain that includes a biologically active molecule and at least a portion of an immunoglobulin constant region comprising a mutation that reduces FcRn binding. In another aspect, the invention relates to a composition of one nucleic acid encoding a polypeptide chain that includes a biologically active molecule and at least a portion of an immunoglobulin constant region, and a second nucleic acid encoding a second polypeptide chain that includes at least a portion of an inummoglobulin constant region. One of the nucleic acid sequences contains a. mutation in the FcRn binding site.
[0040] The invention also provides methods for treating a disease or condition alleviated by the administration of the antibody fusion proteins by administering to a mammal an effective amount of the antibody fusion protein of the invention.
Antibody Fusion Protein Structural Variants
[0041] The invention discloses antibody fusion proteins comprised of two polypeptide chains. The first polypeptide chain includes a biologically active molecule linked to at least a portion of an immunoglobulin constant region, and the second polypeptide chain includes at least a portion of an immunoglobulin constant region. One of the polypeptide chains comprises a mutation in FcRn binding.
[0042] FIG. 1 illustrates a subset of ways in which a biologically active molecule may be linked to the immunoglobulin constant region, for example, the Fc subunit, of an antibody. The biologically active molecule can be linked to the N-terminus of the immunoglobulin constant region (FIGS. 1A and 1B) or to the C-terminus of the immunoglobulin constant region (FIGS. 1C and 1D). The biologically active molecule can be linked to the immunoglobulin constant region with a mutation in FcRn binding or linked to the immunoglobulin constant region without the mutation.
[0043] The antibody fusion protein can include at least two biologically active molecules. As illustrated in FIG. 2, the biologically active molecules may be linked to the N-terminus of the immunoglobulin constant region (FIG. 2A) or to the C-terminus of the immunoglobulin constant region (FIG. 2B), or one of the biologically active molecule can be linked to the N-terminus of the immunoglobulin constant region and the second biologically active molecule linked to the C-terminus of the immunoglobulin constant region (FIG. 2C). The two biologically active molecules may be the same or different. FIGS. 2D-2F illustrate how two different biologically active molecules can be linked to the immunoglobulin constant regions.
[0044] The invention also features antibody fusion proteins comprised of two polypeptide chains, wherein at least one of the peptide chains comprise an antibody variable domain. FIG. 3 illustrates a subset of ways in which a biologically active molecule can be linked to immunoglobulin. regions comprised of an antibody variable domain. The biologically active molecule can be linked to either the N-terminus or the C-terminus of one of the polypeptide chains comprised of an antibody variable domain (FIGS. 3A-3D). Alternatively, both peptide chains can comprise an antibody variable domain (FIGS. 3E-3H).
[0045] FIG. 4 shows how two biologically active molecules can be linked to an antibody that include a constant region and a variable region of the heavy chain. The biologically active molecule can be linked to the N-terminus, the C-terminus, or the N-terminus and C-terminus of the immunoglobulin regions (FIGS. 4A-4C). Different biologically active molecules can be linked to the immunoglobulin regions (FIGS. 4D-4F).
[0046] The fusion protein of the invention can include a biologically active molecule linked to an intact antibody, for example, an IgG. FIG. 5 depicts a subset of ways in which a biologically active molecule can be linked to an antibody. The biologically active molecule can be linked to the N-terminus or the C-terminus of the immunoglobulin heavy chain (FIGS. 5A and 5B). Alternatively, the biologically active molecule can be linked to the N-terminus or the C-terminus of the immunoglobulin light chain (FIGS. 5C and 5D).
[0047] FIG. 6 illustrates how two biologically active molecules can be linked to an intact antibody. The biologically active molecules can be linked to the N-terminus or the C-terminus of the immunoglobulin heavy chain (FIGS. 6A and 6B). Alternatively, the biologically active molecule can be linked to the N-terminus or the C-terminus of the immunoglobulin light chain (FIGS. 6C and 6D). One of the biologically active molecules can be linked to the immunoglobulin heavy chain, and the second biologically active molecule can be linked to the immunoglobulin light chain (FIGS. 6E and 6F). FIG. 7 shows how different biologically active molecules can be linked to the intact antibody (FIGS. 7A-7F).
Antibody Fusion Protein Biological Properties
[0048] As mentioned previously, antibody fusion proteins of the invention can demonstrate comparable biological properties such as prolonged circulating half-life as corresponding fusion proteins without the mutation. For example, FIGS. 11 to 16 demonstrate that human Fcγ4-IFNβ with the H435A mutation displayed similar serum stability as human Fcγ4-IFNβ without the mutation vivo. Fcγ4-IFNβ with the H425A mutation intravenously injected into mice exhibited similar circulating half-life as antibody fusion proteins without the mutation (FIGS. 11 and 12). Similarly Fcγ4-IFNβ with the H435A mutation injected subcutaneously into mice exhibited similar circulating half-life as antibody fusion proteins without the mutation (FIGS. 14 and 15).
[0049] Derivatives of the antibody fusion proteins of the invention are contemplated and can be made by altering their amino acid sequences by substitutions, additions, and/or deletions/truncations or by introducing chemical modifications that result in functionally equivalent molecules. It will be understood by one of skill in the art that certain amino acids in a sequence of any protein may be substituted for other amino acids without adversely affecting the activity of the protein. Derivatives, analogs or mutants resulting from such changes and the use of such derivatives are within the scope of the present invention.
FcRn Binding Site Mutations
[0050] The present invention provides antibody fusion proteins with a mutation in the FcRn binding site of one polypeptide chain comprising the Fc. While the other polypeptide chain comprising the Fc retains the intrinsic binding affinity to FcRn, the mutation results in reduced binding avidity of the antibody fusion protein to the FcRn receptor. Reduced binding is characterized by low affinity with an affinity constant KA of lower than 106 M31 1. If necessary, FcRn binding can be reduced by varying the binding conditions. Binding conditions such as the concentration of the molecules, ionic strength of the solutions, temperature, time allowed for binding can be determined by one skilled in the art.
[0051] The region of the Fc portion of IgG that binds to the FcRn receptor has been described based on X-ray crystallography (Burmeister et al., 1994, Nature 372:379). IgG residues that are involved in binding to FcRn are located at the CH2-CH3 domain interface of the Fc region. The major contact sites include amino acid residues 248, 250-257, 272, 285, 288, 290, 291, 308-311, and 314 of the CH2 domain and amino acid residues 385-387, 428, and 433-436 of the CH3 domain.
[0052] Using this knowledge, the Fc fragment of the antibody fusion protein can be modified according to well recognized procedures such as site-directed mutagenesis to generate modified antibody fusion proteins with reduced affinity for FcRn. The modifications can be substitutions, additions, and/or deletions/truncations. For example, the immunoglobulin constant region of the antibody fusion protein may contain an alteration at position 435, corresponding to a histidine in the native IgG1 Fc fragment. The amino acid alteration may replace the histidine with alanine (H435A) through methods known in the art.
[0053] In addition to an alteration at position 435, the invention also contemplates antibody fusion proteins with other altered residues. For example, the antibody fusion protein may be altered at one or more of positions 233, 234, 235, 236, 253, 254, 255, 288, 415, 433, 435, and 436. Examples of modifications that reduce or abrogate binding to FcRn include, but are not limited to, the following: E233A, L234A, L235A, G236A, I253A, S254A, R255A, K288A, S415A, H433A, H435A, Y436A. It is contemplated that additional amino acid residues not listed above may also be mutated to reduce FcRn binding. Furthermore, in addition to alanine, other amino acid residues may be substituted for the wild type amino acids at the positions specific above. The mutations may be introduced singly, or combinations of two, three or more of such mutations may be introduced together. Furthermore, one of the polypeptide chains of the antibody fusion protein may be mutated to reduce FcRn binding or both polypeptide chains may be mutated. Any of the mutations described herein can be used regardless of the biologically active molecule.
Immunoglobulin Regions
[0054] The antibody fusion protein of the invention includes at least a portion of an immunoglobulin constant region. Intact immunoglobulins include four protein chains that associate covalently--two heavy chains and two light chains. Each chain is further comprised of one variable region and one constant region. Depending upon the immunoglobulin isotype, the heavy chain constant region contains 3 or 4 constant region domains (e.g. CH1, CH2, C3, CH4) and a hinge region. The domains are named sequentially as follows: CH1-hinge-CH2--CH3(--CH4).
[0055] The portion of an immunoglobulin constant region can include a portion of an IgG, an IgA, an IgM, an IgD, or an IgE. In one embodiment, the immunoglobulin is an IgG, in another embodiment, the immunoglobulin is IgG1. In another embodiment, the immunoglobulin is IgG2. In another embodiment, the immunoglobulin is IgG3, while in yet another embodiment, the immunoglobulin is IgG4. The choice of appropriate immunoglobulin heavy chain constant regions is discussed in detail in U.S. Pat. Nos. 5,541,087, and 5,726,044. The choice of particular immunoglobulin heavy chain constant region sequences from certain immunoglobulin classes and subclasses to achieve a particular result is considered to be within the level of one skilled in the art.
[0056] The portion of an immunoglobulin constant region can include the entire heavy chain constant region, or a fragment or analog thereof In one embodiment, the portion of an immunoglobulin constant region is an Fc fragment. For example, an immunoglobulin Fe fragment may include 1) a CH2 domain; 2) a CH3 domain; 3) a CH4 domain; 4) a CH2 domain and a CH3 domain; 5) a CH2 domain and a CH4 domain; 6) a CH3 domain and a CH4 domain; or 7) a combination of an immunoglobulin hinge region and/or a CH2 domain and/or CH3 domain and/or a CH4 domain. In one embodiment, the immunoglobulin Fc region includes at least an immunoglobulin hinge region, while in another embodiment the immunoglobulin Fc region includes at least one immunoglobulin constant heavy region, for example, a CH2 domain or a CH3 domain, and depending on the type of immunoglobulin used to generate the Fc region, optionally a CH4 domain. In another embodiment, the Fc region includes a hinge region, a CH2 domain and a CH3 domain, and preferably lacks the CH1 domain, while in another embodiment, the Fc region includes a hinge region and a CG2 domain. In yet another embodiment, the Fc region includes a hinge region and a CH3 domain.
[0057] The immunoglobulin Fc fragment may be from any immunoglobulin class. For example, the immunoglobulin class may be IgG (IgG γ1) (γ subclasses 1, 2, 3, or 4). Other classes of immunoglobulin such as IgA (Igα), IgD (Igδ), IgE (Igε), and IgM (Igμ), can also be used. The choice of appropriate immunoglobulin heavy chain constant regions is discussed in detail in U.S. Pat. Nos. 5,541,087, and 5,726,044. It is understood that a person skilled in the art will know how to choose the particular immunoglobulin heavy chain constant region from certain immunoglobulin classes and subclasses to achieve a particular result.
[0058] It is contemplated that the Fc fragment used in the generation of the fusion proteins can be adapted to the specific applications. For example, the Fc fragment can be derived from an immunoglobulin γ1 iso type or variants thereof. The use of human γ1 as the Fc fragment sequence has several advantages. For example, an Fc fragment derived from an immunoglobulin γ1 isotype can be used when targeting the fusion protein to the liver is desired. Additionally, if the antibody fusion protein is to be used as a biopharmaceutical, the Fcγ1 domain may confer effector function activities to the fusion protein. The effector function activities include the biological activities such as placental transfer and increased serum half-life. The immunoglobulin Fc fragment also provides for detection by anti-Fc ELISA and purification through binding to Staphylococcus aureus protein A ("Protein A").
[0059] Alternatively, the Fc fragment of the antibody fusion protein is derived from an immunoglobulin γ4 isotype. Because the immunoglobulin γ4 isotype is ineffective in mediating effector functions and displays vastly reduced binding to Fcγ receptor, it is contemplated that the antibody fusion proteins with immunoglobulin γ4 as the Fc region may exhibit reduced immune effector functions and enhanced circulating half-life when administered to a mammal.
[0060] The immunoglobulin Fc fragment may combine multiple inummoglobulin classes or subclasses. For example, the fragment may combine an IgG1 hinge region and IgG2 CH2 and CH3 domain (see, e.g., U.S. Pat. No. 7,148,326). In some embodiments, portions of a domain are combined from different isotypes to create a strand exchange engineered domain ("SEED") with altered dimerization properties, as described in U.S. Patent Application Publication No. 2007/0287170.
[0061] In one embodiment, the antibody fusion protein includes at least one antibody variable domain. The antibody variable domain may be heavy chain variable domain or light chain variable domain.
[0062] It is understood that portions of an immunoglobulin constant region for use in the present invention can include mutants or analogs thereof, or can include chemically modified immunoglobulin constant regions (e.g. pegylated), or fragments thereof. A person skilled in the art can prepare such variants using well-known molecular biology techniques.
Biologically Active Molecules
[0063] The invention relates to antibody fusion proteins that include two polypeptide chains. The first polypeptide chain includes a biologically active molecule linked to at least a portion of an immunoglobulin constant region, and the second polypeptide chain includes at least a portion of an immunoglobulin constant region. The biologically active molecule may be linked to the amino-terminus of the immunoglobulin constant region. Alternatively, the biologically active molecule may be linked to the carboxy terminus of the immunoglobulin constant region. In an embodiment, the second polypeptide chain may also include a biologically active molecule.
[0064] The invention contemplates the use of any biologically active molecule capable of exerting a biological effect when administered to a mammal. The biologically active molecule can include but is not limited to polypeptides, nucleic acids, small molecules. Other examples of biologically active molecules include but are not limited to hormones, antiviral agents, hemostatic agents, peptides, proteins, chemotherapeutics, vitamins, co-factors, nucleosides, nucleotides, oligonucleotides, enzymatic nucleic acids, antisense nucleic acids, triplex forming oligonucleotides, and aptamers.
Cytokines
[0065] In one embodiment, the biologically active molecule is a cytokine. Cytokines are factors that support the growth and maturation of cells, including lymphocytes. Examples of cytokines include, but are not limited to, interleukin-1 (IL-1), IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12, IL-13, IL-14, IL-15, IL-16, IL-17, IL-18, lymphokine inhibitory factor, macrophage colony stimulating factor, platelet derived growth factor, stem cell factor, tumor necrosis factor, granulocyte colony stimulating factor, and granulocyte macrophage colony stimulating factor.
[0066] In a specific embodiment, the biologically active molecule can include human interferons, for example, interferon-β. The interferon-P moiety can be a wild-type mature human interferon-β protein, or a sequence at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% identical to wild-type mature human interferon-β. For example, the biologically active molecule can incorporate a human interferon-β moiety with one or more mutations, e.g. to improve the protein folding properties of the fusion protein, to reduce aggregation, or to improve protein expression. For example, the interferon-β moiety of the antibody fusion protein can contain alterations at one, two, three, four, or more of positions 17, 50, 57, 130, 131, 136, and 140 corresponding to the native mature interferon-β. The amino acid alterations at these positions can be generated by amino acid substitutions, amino acid deletions, or amino acid modifications through methods known in the artkiterations introduced at these residues are believed to alleviate noncovalent aggregation. In one example, the cysteine at position 17 is substituted with either a serine (C17S), an alanine (C17A), a valine (C17V), or a methionine (C17M). In some embodiments, the phenylalanine at position 50 is replaced with histidine (F50H). In some embodiments, the leucine at position 57 is replaced by alanine (L57A), while in other embodiments, the leucine at position 130 is replaced by alanine (L130A). In some embodiments, the histidine at position 131 is replaced by alanine (H131A), while in other embodiments the lysine at position 136 is replaced by alanine (K136A). In some embodiments, the histidine at position 140 is replaced with either an alanine (H140A) or threonine (H140T). While certain amino acid substitutions have been enumerated, the invention is not limited to these alterations. Any suitable amino acid capable of conferring the appropriate properties on the fusion protein may be substituted in place of the original amino acid residues at positions 17, 50, 57, 130, 131, 136, and 140 of the native mature interferon-β. The present invention also contemplates an interferon-β moiety of the antibody fusion protein having a combination of one, two, three, four, five, six, or seven of the alterations at positions 17, 50, 57, 130, 131, 136, and 140 as disclosed herein.
Growth Factors
[0067] in one embodiment, the biologically active agent is a growth factor. The biologically active molecule can be any agent capable of inducing cell growth and proliferation. Examples of growth factors include, but are not limited to, hepatocyte growth factor, fibroblast growth factor, keratinocyte growth factor, nerve growth factor, tumor growth factor-α, epidermal growth factor, VEGF, insulin growth factor, and insulin-like growth factor I and II.
[0068] In a specific embodiment, the biologically active molecule is any agent that can induce erythrocytes to proliferate. Thus one example of a biologically active molecule contemplated by the invention is human erythropoietin.
Hormones
[0069] In one embodiment, the biologically active molecule is a hormone. Hormones alter cell growth, function, and metabolism. Examples of hormones include, but are not limited to, pituitary hormones, e.g., chorionic gonadotropin, cosyntropin, menotropins, somatotropin, iorticotropin, protirelin, thyrotropin, vasopressin, lypressin; adrenal hormones, e.g., beclomethasone dipropionate, betamethasone, dexamethasone, triamcinolone; pancreatic hormones, e.g., glucagon, insulin; parathyroid hormone, e.g., dihydrochysterol; thyroid hormones, e.g., calcitonin, thyroglobulin, teriparatide acetate; steroid hormones, e.g., glucocorticoids, estrogens, progestins, androgens, tetrahydrodesoxycaricosterone; gastrointestinal hormones: cholecystokinin, enteroglycan, galanin, gastrins, pentagastrin, tetragastrin, motilin, peptide YY, and secretin. In a specific embodiment, the biologically active molecule is human growth hormone.
Nucleic Acids
[0070] In one embodiment, the biologically active molecule is a nucleic acid such as DNA or RNA. For example, the biologically active molecule can be a nucleic acid molecule that is used in RNA interference such as antisense RNA, short interfering RNA (siRNA), double-stranded RNA (dsRNA), micro-RNA (miRNA), and short hairpin RNA (shRNA). The nucleic acid molecule should be about 6 to about 60 nucleotides in length. For example, in some embodiments, the nucleic acid molecule is about 15 to about 50, about 25 to about 45, or about 30 to about 40 nucleotides in length.
[0071] The oligonucleotides can be DNA or RNA or mixtures or derivatives or modified versions thereof, single-stranded or double-stranded. The oligonucleotide can be modified at the base moiety, sugar moiety, or phosphate backbone, for example, to improve stability of the molecule, hybridization, etc. The oligonucleotide may include other appended groups such as polypeptides (e.g. for targeting host cell receptors in vivo), or agents facilitating transport across the cell membrane (see, e.g., Letsinger et al. (1989) Proc. Natl. Acad. Sci. USA 86:6553; Lemaitre et al. (1987) Proc. Natl. Acad. Sci. USA 84:648; and WO 88/09810) or the blood-brain barrier (see, e.g., WO 89/10134), hybridization-triggered cleavage agents (see, e.g., Krol et al. (1988) BioTechniques 6:958) or intercalating agents (see, e.g., Zon (1988) Pharm. Res. 5:539). To this end, the oligonucleotide may be conjugated to another molecule, e.g., a polypeptide, hybridization triggered cross-linking agent, transport agent, or hybridization-triggered cleavage agent.
Small Molecules
[0072] The invention also contemplates the use of any therapeutic small molecule or drug as the biologically active molecule. The biologically active molecule can be, for example, a lipid molecule. The biologically active molecule can be a sugar molecule. The biologically active molecule can be a small organic molecule or a small inorganic molecule.
Production of Modified Antibody Fusion Proteins
[0073] It is understood that the present invention can exploit conventional recombinant DNA methodologies to generate the antibody fusion proteins useful in the practice of the invention. The antibody fusion constructs preferably are generated at the DNA level, and the resulting DNAs integrated into expression vectors, and expressed to produce the fusion proteins of the invention.
[0074] The invention provides nucleic acids encoding a biologically active molecule linked to at least a portion of an immunoglobulin constant region comprising a mutation in the FcRn binding site. In one embodiment, the mutation is a codon substitution replacing the histidine at position 435 of the immunoglobulin constant region with an alanine (H435A). The invention also provides compositions of nucleic acids: the first nucleic acid encodes a biologically active molecule and at least a portion of an immunoglobulin constant region; the second nucleic acid encodes at least a portion of an immunoglobulin constant region. One of the nucleic acids encodes an immunoglobulin constant region with a mutation affecting FcRn binding. In one embodiment, the mutation is a codon substitution replacing the histidine at position 435 of the immunoglobulin constant region with an alanine (H435A). The nucleic acids can also include additional sequences or elements known in the art (e.g., promoters, enhancers, poly A sequences, or affinity tags).
[0075] Nucleic acids and nucleic acid compositions according to the invention can be readily synthesized using recombinant techniques well known in the art. For example, nucleic acids can be synthesized by standard methods, e.g., by use of an automated DNA synthesizer.
[0076] For recombinant protein production, the nucleic acid or the nucleic acid composition is inserted into appropriate expression vehicles, i.e. vectors which contains the necessary elements for the transcription and translation of the inserted coding sequence. As used herein, the term "vector" is understood to mean any nucleic acid including a nucleotide sequence competent to be incorporated into a host cell and to be recombined with and integrated into the host cell genome, or to replicate autonomously as an episome. Such vectors include linear nucleic acids, plasmids, phagemids, cosmids, RNA vectors, viral vectors and the like. Non-limiting examples of a viral vector include a retrovirus, an adenovirus and an adeno-associated virus.
[0077] A useful expression vector is pdCs (Lo et al. (1988) Protein Engineering 11:495), which transcription utilizes the enhancer/promoter of the human cytomegalovirus and the SV40 polyadenylation signal. The enhancer and promoter sequence of the human cytomegalovirus used is derived from nucleotides -601 to +7 of the sequence provided in Boshart et al. (1985) Cell 41:521. The vector also contains the mutant dihydrofolate reductase gene as a selection marker (Simonsen and Levinson (1983) Proc. Nat. Acad. Sci. USA 80:2495).
[0078] An appropriate isolated host cell can be transformed or transfected with the DNA sequence of the invention, and utilized for the expression and/or secretion of the target protein. Exemplary isolated host cells for use in the invention include immortal hybridoma cells, NS/0 myeloma cells, 293 cells, Chinese hamster ovary cells, HeLa cells, and COS cells.
Methods of Using the Antibody Fusion Proteins
[0079] The invention also provides pharmaceutical compositions comprising the antibody fusion protein with a mutation in the FcRn binding site and a pharmaceutically acceptable carrier or excipient. The term "pharmaceutically acceptable excipient" is art-recognized and refers to a pharmaceutically-acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, or solvent, used in formulating pharmaceutical products. Each excipient must be "acceptable" in the sense of being compatible with the subject composition and its components and not injurious to the patient. Examples of suitable pharmaceutical carriers are described in. Remington's Pharmaceutical Sciences by E. W. Martin. Examples of excipients can include (1) sugars, such as lactose, glucose and sucrose; (2) starches, such as corn starch and potato starch; (3) cellulose, and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; (4) powdered tragacanth; (5) malt; (6) gelatin; (7) talc; (8) excipients, such as cocoa butter and suppository waxes; (9) oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; (10) glycols, such as propylene glycol; (11) polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol; (12) esters, such as ethyl oleate and ethyl laurate; (13) agar; (14) buffering agents, such as magnesium hydroxide and aluminum hydroxide; (15) alginic acid; (16) pyrogen-free water; (17) isotonic saline; (18) Ringer's solution; (19) ethyl alcohol; (20) phosphate buffer solutions; and (21) other non-toxic compatible substances employed in pharmaceutical formulations.
[0080] Compositions of the present invention may be administered by any route which is compatible with the particular molecules. It is contemplated that the compositions of the present invention may be provided to a mammal by any suitable means, directly (e.g., locally, as by injection, implantation or topical administration to a tissue locus) or systemically (e.g., parenterally or orally). Where the composition is to be provided parenterally, such as by intravenous, subcutaneous, ophthalmic, intraperitoneal, intramuscular, buccal, rectal, vaginal, intraorbital, intracerebral, intracranial, intraspinal, intraventricular, intrathecal, intracistemal, intracapsular, intranasal or by aerosol administration, the composition preferably includes part of an aqueous or physiologically compatible fluid suspension or solution. Thus, the carrier or vehicle is physiologically acceptable so that in addition to delivery of the desired composition to the patient, it does not otherwise adversely affect the patient's electrolyte and/or volume balance. The fluid medium for the agent thus can include normal physiologic saline.
[0081] The present invention provides methods of treating various cancers, viral diseases, other diseases, related conditions and causes thereof by administering the DNA, RNA or proteins of the invention to a mammal having such condition. Related conditions may include, but are not limited to inflammatory conditions or an autoimmune disease, such as multiple sclerosis, arthritis, psoriasis, lupus erythematosus; a variety of malignancies, such as acute myeloid leukemia, multiple myeloma, Hodgkin's disease, basal cell carcinoma, cervical dysplasia and osteosarcoma; a variety of viral infections, including viral hepatitis, herpes zoster and genitalis, papilloma viruses, viral encephalitis, and cytomegalovirus pneumonia; anemia; and hemostatic disorders.
[0082] The optimal dose of the fusion protein of the invention will depend upon the disease being treated and upon the existence of side effects. The optimal dosages can be determined using routine experimentation. Dosages per administration can range from 0.1 mg/m2-100 mg/2, 1 mg/m2-20 mg/m2, and 2mg/m2, and 2 mg/m2-6 mg/m2. Administration of the fusion protein may be by periodic bolus injections, or by continuous intravenous or intraperitoneal administration from an external reservoir (for example, from an intravenous bag) or internal (for example, from a bioerodable implant). Furthermore, it is contemplated that the fusion proteins of the invention also may be administered to the intended recipient together with a plurality of different biologically active molecules. It is contemplated, however, that the optimal combination of fusion protein and other molecules, modes of administration, dosages may be determined by routine experimentation well within the level of skill in the art.
[0083] It is contemplated that the antibody fusion protein of the invention can also be used to treat a mammal with a disease or condition in combination with at least one other known agent to treat said disease or condition.
EXAMPLES
Example 1
Construction of DNA Sequences for the Expression of huFcγ4h-Mono-L-DI-IFNβ
[0084] The huFcγ4h-mono-L-DI-IFNβ (huFcγ4 hinge mutant-linker monomeric de-immunized interferon-β) antibody fusion protein is a heterodimer consisting of a human Fcγ4h chain and a human Fc-γ4h-Linker-DI-IFNβ chain. The protein was produced in mammalian cells by coexpressing the human Fcγ4h chain and the human Fc-γ4h-Linker-DI-IFNβ chain, the transcription units of which were contained in one single plasmid or two separate plasmids.
[0085] The DNA encoding the huFcγ4h (huFcγ4 hinge mutant) was derived from the human IgG4 genomic sequence and then engineered to contain a modified γ1 hinge region in order to minimize half-molecule formation. The formation of IgG4 half molecules that did not form covalent disulphide bonds at the hinge regions was previously reported (Angal et al. (1993) Mol. Immunol. 30:105).
Construction of DNA Sequence Encoding the Fc Fragment of the Human Immumoglobulin-Gamma 4 (Fcγ4)
[0086] The genomic sequence encoding human IgG4 was obtained from cellular DNA isolated from HeLa cells. The sequence is highly conserved with the published IgG4 sequence--Locus HUMIGCD2 (Accession K01316) in GenBank, except for the difference of 3 amino acid residues in the CH3 region. The published sequence contains R409, E419, V422, whereas our sequence contains K409, Q419, I422. Interestingly, K409 and Q419 are also found in human IgG1, IgG2 and IgG3; and I422 is found in human IgG3. Such allotypic determinants consisting of amino acid substitutions from other IgG subclasses are known as isoallotypes, and isoallotypes of the human IgG4 gene have previously been reported (Brusco et al. (1998) Eur. J. Immunogenetics 25:349-355). The amino acid sequence of the Fcγ4 fragment is shown in SEQ ID NO: 1.
TABLE-US-00001 SEQ ID NO: 1: Peptide sequences of the huFeγ4 (γ4 hinge region underlined, and K409, Q419, I422 in bold) ESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQ EDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKE YKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCL VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFELYSKLTVDKSRWQ QGNIFSCSVMHEALHNHYTQKSISISPGK
Modification of the Hinge Region of Fcγ4
[0087] The γ4 hinge region with the amino acid sequence "ESKYGPPCPSCP" (SEQ ID NO: 7) was replaced by a modified γ1 hinge region with the amino acid sequence "EPKSSDKTHTCPPCP" (SEQ ID NO: 8) (Lo et al. (1998) Protein Engineering 11:495-500) to minimize the formation of half-molecules (U.S. Pat. No. 7,148,321).
[0088] In order to modify the hinge region of Fcγ4, the AflII-StuI fragment 5' CTTAAGCGAGTCCAAATATGGTCCCCCATGCCCATCATGCCCAG (SEQ ID NO: 9) containing the native γ4 hinge exon (bold) was replaced by the corresponding AflII-StuI fragment 5'-CTTAAGCGAGCCCAAATCTTCTGACAAAACTCACACATGCCCACCGTGCCCAG (SEQ ID NO: 10) containing the modified γ1 hinge exon (bold) with a Cys to Ser substitution (underlined) that eliminates the Cys residue that normally pairs with the light chain. Since the StuI sites in both the γ1 and γ4 exons are C-methylated and the StuI restriction endonuclease is methylation sensitive, both plasmids had to be isolated from a DNA cytosine methylase (DCM) negative strain of bacteria before they could be digested with the StuI enzyme. The resulting Fcγ4 with the modified γ1 hinge region was designated Fcγ4h (γ4h: gamma-4-hinge mutant).
Cloning and De-Immunization of IFN-β
[0089] The coding sequence for mature IFN-β was PCR amplified from human placental DNA (Sigma, Poole, UK). The cloned PCR products were sequenced to identify an IFN-β clone, the amino acid sequence of which completely matches with the published wild type IFN-β sequence--Locus XM--005410 in GenBank.
[0090] The de-immunized IFN-β (DI-IFNβ) contains three amino acid substitutions (L57A, H131A, H130A) to remove potential T helper cell epitopes and one amino acid substitution (C17S) to minimize covalent aggregation. The DNA encoding DI-IFNβ was cloned into the mammalian expression vector pdCs-huFc (Lo et al. (1998) Protein Engineering 11 :495-500), which had been modified such that the IFN-β sequence is fused to the C-terminus of human Fcγ4h via a 15 amino acid flexible linker with the amino acid sequence G4SG4SG3SG. The linker-DI-IFNβ was denoted as L-DI-IFNβ, the sequence of which is shown in SEQ ID NO: 2 (linker underlined, and C17S, L57A, H131A, and H140A in bold).
TABLE-US-00002 SEQ ID NO: 2: Peptide sequences of L-DI-IFNβ GGGGSGGGGSGGGSGMSYNLLGFLQRSSNFQSQKLLWQLNGRLEYCLKDR MNEDIPEEIKQLQQFQKEDAAATIYEMLQNIFAIFRQDSSSTGWNETIEN LLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILAYLKAK EYSACAWTIVRVEILRNFYFINRLTGYLRN
Adaptation of a Genomic Leader as the Signal Peptide for Secretion
[0091] A genomic signal peptide sequence (438-bp) from a mouse immunoglobulin light chain gene was used for the secretion of both the huFcγ4h and huFcγ4h-L-DI-IFNβ chains. The gene sequence encoding the -2 amino acid residue (the -1 amino acid being the C-terminal residue of the signal peptide) of the signal peptide was mutagenized from a serine residue to a leucine residue (AGC to TTA) so that the DNA encoding the end of the signal peptide is CTTAAGC, where CTTAAG is a created AflII site (Lo et al. (1988) Protein Engineering 11:495:500). In addition, the Kozak consensus sequence CCACCATGG was introduced for optimal ribosome binding for translation initiation at ATG (Kozak et al. (1986) Cell 44:283-292). This was achieved by mutating the first amino acid residue after the initiation codon from AAG to GAG to give the sequence
TABLE-US-00003 (SEQ ID NO: 11) TCTAGACCACCATGGAG,
where the Kozak consensus sequence is underlined and TCTAGA is an XbaI site. Therefore, the signal peptide contains a substitution at the first amino acid residue after the initiation codon and another substitution at the amino acid residue at the -2 position. Since the signal peptide is cleaved off by signal peptidase inside the cell and does not appear in the secreted protein, these mutations do not affect the amino acid composition of the Fcγ4h and Fcγ4h-L-DI-IFNβ products.
The Peptide and DNA Sequences of the huFcγ4h and huFcγ4h-L-DI-IFNβ Chains
[0092] The coding regions for the entire huFcγ4h and huFcγ4h-L-DI-IFNβ chains were completely sequenced. The peptide and DNA sequences of the huFcγ4h and huFcγ4h-L-DI-IFNβ chains are shown and SEQ ID NO: 3 to SEQ ID NO: 6. In order to facilitate ligation of the DNA fragments encoding huFcγ4h and L-DI-IFNβ, a SmaI site was created by using the PGK sequence (Lo et al. (1998) Protein Engineering 11:495-500) found in human IgG4 (Locus CAC20457 in GenPept), and also in IgG1 and IgG2; in addition, a lysine to alanine substitution at the C-terminal residue of CH3 was introduced to minimize potential cleavage at the junction. Importantly, the resultant sequence at the CH3-L-DI-IFNβ junction does not create any potential T cell epitope.
TABLE-US-00004 SEQ ID NO: 3: Peptide sequence of the huFcγ4h (signal peptide underlined) MELPVRLLVLMFWIPASLSEPKSSDKTHTCPPCPAPEFLGGPSVFLFPPK PKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQF NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREP QVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNHYTQKSLSLSPG K SEQ ID NO: 4: DNA sequence of the huFcγ4h chain from the translation initiation codon to the translation stop codon (coding sequence in upper case and non-coding sequence in lower case) ATGGAGTTGCCTGTTAGGCTGTTGGTGCTGATGTTCTGGATTCCTGgtga ggagagagggaagtgagggaggagaatggacagggagcaggagcactgaa tcccattgctcattccatgtattctggcatgggtgagaagatgggtctta tcctccagcatggggcctctggggtgaatacttgttagagggaggttcca gatgggaacatgtgctataatgaagattatgaaatggatgcctgggatgg tctaagtaatgcctagaagtgactagacacttgcaattcactttttttgg taagaagagatttttaggctataaaaaaatgttatgtaaaaataaacatc acagttgaaataaaaaaaaatataaggatgttcatgaattttgtgtataa ctatgtatttctctctcattgtttcagCTTCCTTAAGCGAGCCCAAATCT TCTGACAAAACTCACACATGCCCACCGTGCCCAGgtaagccagcccaggc ctcgccctccagctcaaggcgggacaggtgccctagagtaacctgcatcc agggacaggccccagccgggtgctgacgcatccacctccatctcttcctc agCACCTGAGTTCCTGGGGGGACCATCAGTCTTCCTGTTCCCCCCAAAAC CCAAGGACACTCTCATGATCTCCCGGACCCCTGAGGTCACGTGCGTGGTG GTGGACGTGAGCCAGGAAGACCCCGAGGTCCAGTTCAACTGGTACGTGGA TGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTTCA ACAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGG CTGAACGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGGCCTCCCGTC CTCCATCGAGAAAACCATCTCCAAAGCCAAAGgtgggacccacggggtgc gagggccacatggacagaggtcagctcggcccaccctctgccctgggagt gaccgctgtgccaacctctgtccctacagGGCAGCCCCGAGAGCCACAGG TGTACACCCTGCCCCCATCCCAGGAGGAGATGACCAAGAACCAGGTCAGC CTGACCTGCCTGGTCAAAGGCTTCTACCCCAGCGACATCGCCGTGGAGTG GGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGC TGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAG AGCAGGTGGGAGCAGGGGAACATCTTCTCATGCTCCGTGATGCATGAGGC TCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCCCCGGGTAAAT GA SEQ ID NO: 5: Peptide sequence of the huFcγ4h-L- DI-IFNβ (the signal peptide and the K to A substitution at the end of CH3 are underlined; and L-DI-IFNβ in bold) MELPVRLLVLMFWIPASLSEPKSSDKTHTCPPCPAPEFLGGPSVFLFPPK PKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNKTKPREEQFN STYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQ VYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV LDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNHYTQKSLSLSPGA GGGGSGGGGSGGGSGMSYNLLGFLQRSSNFQSQKLLWQLNGRLEYCLKDR MNFDIPEEIKQLQQFQKEDAAATIYEMLQNIFAIFRQDSSSTGWNETIVE NLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILAYLKA KEYSACAWTIVRVEILRNFYFINRLTGYLRN SEQ ID NO: 6: DNA sequence of the hnFcγ4h-L-DI- IFNβ chain from the translation initiation codon to the translation stop codon (coding sequence in upper case and non-coding sequence in lower case) ATGGAGTTGCCTGTTAGGCTGTTGGTGCTGATGTTCTGGATTCCTGgtga ggagagagggaagtgagggaggagaatggacagggagcaggagcactgaa tcccattgctcattccatgtattctggcatgggtgagaagatgggtctta tcctccagcatggggcctctggggtgaatacttgttagagggaggttcca gatgggaacatgtgctataatgaagattatgaaatggatgcctgggatgg tctaagtaatgcctagaagtgactagacacttgcaattcactttttttgg taagaagagatttttaggctataaaaaaatgttatgtaaaaataaacatc acagttgaaataaaaaaaaatataaggatgttcatgaattttgtgtataa ctatgtatttctctctcattgtttcagCTTCCTTAAGCGAGCCCAAATCT TCTGACAAAACTCACACATGCCCACCGTGCCCAGgtaagccagcccaggc ctcgccctccagctcaaggcgggacaggtgccctagagtagcctgcatcc agggacaggccccagccgggtgctgacgcatccacctccatctcttcctc agCACCTGAGTTCCTGGGGGGACCATCAGTCTTCCTGTTCCCCCCAAAAC CCAAGGACACTCTCATGATCTCCCGGACCCCTGAGGTCACGTGCGTGGTG GTGGACGTGAGCCAGGAAGACCCCGAGGTCCAGTTCAACTGGTACGTGGA TGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTTCA ACAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGG CTGAACGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGGCCTCCCGTC CTCCATCGAGAAAACCATCTCCAAAGCCAAAGgtgggacccacggggtgc gagggccacatggacagaggtcagctcggcccaccctctgccctgggagt gaccgctgtgccaacctctgtccctacagGGCAGCCCCGAGAGCCACAGG TGTACACCCTGCCCCCATCCCAGGAGGAGATGACCAAGAACCAGGTCAGC CTGACCTGCCTGGTCAAAGGCTTCTACCCCAGCGACATCGCCGTGGAGTG GGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGC TGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAG AGCAGGTGGCAGCAGGGGAACATCTTCTCATGCTCCGTGATGCATGAGGC TCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCCCCGGGTGCAG GGGGCGGGGGCAGCGGGGGCGGAGGATCCGGCGGGGGCTCGGGTATGAGC TACAACTTGCTTGGATTCCTACAAAGAAGCAGCAATTTTCAGAGTCAGAA GCTCCTGTGGCAATTGAATGGGAGGCTTGAATATTGCCTCAAGGACAGGA TGAACTTTGACATCCCTGAGGAGATTAAGCAGCTGCAGCAGTTCCAGAAG GAGGACGCCGCAGCCACCATCTATGAGATGCTCCAGAACATCTTTGCTAT TTTCAGACAAGATTCATCTAGCACTGGCTGGAATGAGACTATTGTTGAGA ACCTCCTGGCTAATGTCTATCATCAGATAAACCATCTGAAGACAGTCCTG GAAGAAAAACTGGAGAAAGAAGATTTCACCAGGGGAAAACTCATGAGCAG TCTGCACCTGAAAAGATATTATGGGAGGATTCTGGCCTACCTGAAGGCCA AGGAGTACAGTGCCTGTGCCTGGACCATAGTCAGAGTGGAAATCCTAAGG AACTTTTACTTCATTAACAGACTTACAGGTTACCTCCGAAACTGA
Example 2
Construction of DNA Sequences for the Expression of huFcγ4h-Mono-L-DI-IFNβ Variants Containing H435A Substitution in γ4
[0093] DNA sequences for the expression of huFcγ4h-mono-L-DI-IFNβ variants containing the H435A substitution (Kabat numbering) in γ4 were constructed. These include DNA sequences encoding the heterodimers huFcγ4h(H435A)/huFcγ4h-L-DI-IFNβ, huFcγ4h/huFcγ4h(H435A)-L-DI-IFNβ and huFcg4h(H435A)/huFcγ4h(H435A)-L-DI-IFNβ/ The mutation from the CAC codon to GCG encoding the H435A substitution in the naked huFcγ4h chain or the huFcγ4h-L-DI-IFNβ fusion protein chain was introduced by overlapping PCR (Daugherty et al. (1991) Nucleic Acids Res. 19:2471-2476) with mutagenic primers, using forward primer 5'-G GCTCTGCACAACGCGTACACGCAGAAGAG (SEQ ID NO: 12), where GCG encodes the alanine substitution, and reverse primer 5'-CTCTTCTGCGTGTACGCGTT GTGCAGAGCC (SEQ ID NO: 13), where CGC is the anti-codon of the alanine substitution.
Example 3
Expression of Fusion Proteins
[0094] The huFcγ4h-mono-L-DI-IFNβ heterodirner was produced in mammalian cells by coexpressing the human Fcγ4h chain and the human Fcγ4h-Linker-DI-IFNβ chain, the transcription units of which were contained in one single plasmid or two separate plasmids. For rapid analysis of protein expression, the plasmid pdCs-Fcγ4h and pdCs-Fc Fcγ4h-Linker-DI-IFNβ or variants were introduced into human kidney 293T cells (GenHunter Corporation, Nashville, Tenn.) by transient transfection using lipofectamine (Invitrogen, Carlsbad, Calif.).
[0095] Mouse myeloma NS/0 and Chinese hamster ovary cells were used to obtain stably transfected clones Which express the huFcγ4h-mono-L-DI-IFNβ heterodimer. For high level expression, the plasmid pdCs containing both the human Fcγ4h chain and the human Fcγ4h-Linker-DI-IFNβ chain transcription units was introduced into the mouse myeloma NS/0 cells by electroporation. NS/0 cells were grown in Dulbecco's modified Eagle's medium supplemented with 10% heat-inactivated fetal bovine serum, 2 mM glutamine and penicillin/streptomycin. About 5×106 cells were washed once with PBS and resuspended in 0.5 ml PBS. 10 μg of linearized plasmid DNA were then incubated with the cells in a Gene Pulser Cuvette (0.4 cm electrode gap, BioRad) on ice for 10 min. Electroporation was performed using a Gene Pulser (BioRad, Hercules, Calif.) with settings at 0.25 V and 500 μF. Cells were allowed to recover for 10 min on ice, after which they were resuspended in growth medium and plated onto two 96 well plates. Stably transfected clones were selected by their growth in the presence of 100 nM methotrexate (MTX), which was added to the growth medium two days post-transfection. The cells were fed every 3 days for two to three more times, and MTX-resistant clones appeared in 2 to 3 weeks. Supernatants from clones were assayed by anti-Fc ELISA to identify high producers. High producing clones were isolated and propagated in growth medium containing 100 nM MTX. The growth medium typically used was H-SFM or CD medium (Invitrogen, Carlsbad, Calif.).
[0096] For routine characterization by gel electrophoresis, the huFc-IFNβ fusion protein secreted into the medium was captured on Protein A Sepharose beads (Repligen, Cambridge, Mass.) and then eluted by boiling the sample in protein sample buffer, with or without a reducing agent such as β-mercaptoethanol. The samples were analyzed by SDS-PAGE (sodium dodecyl sulfate-polyacrylamide gel electrophoresis) and the protein bands were visualized by Coomassie staining. FIG. 8 shows the huFcγ4h-mono-L-DI-IFNβ produced by transient coexpression of human Fcγ4h chain and the human Fcγ4h-Linker-DI-IFNβ in 293T cells. Lane 2 of the SDS-PAGE analysis under reducing conditions (left panel) shows that both the Fcγ4h chain and the Fcγ4h-Linker-DI-IFNβ chain were expressed, and the naked Fc was expressed at a higher level than the fusion protein. When these two chains were coexpressed at these levels, one would expect that the non-reduced gel should show a ratio of naked Fc homodimer Fc/Fc-IFNβ heterodimer: Fc-IFNβ homodimer according to the binomial a2+2ab+b2, where a and b are the relative expression levels of the naked Fc chain and the fusion protein chain, respectively, as seen on the reduced gel. Surprisingly, SDS-PAGE analysis under non-reducing conditions (middle panel) shows that very little Fc-IFNβ homodimer ("(Fc-X)2") was produced, in sharp contrast to the more normal pattern (ratio according to a2+2ab+b2) that was obtained with coexpression of Fc and Fc-IL-2 analyzed also under non-reducing conditions (right panel). Stable clones coexpressing the Fcγ4h chain and the Fcγ4h-Linker-DI-IFNβ chain had a similar lack of the Fc-IFNβ homodimer (FIG. 9), suggesting that the production of the Fc-IFNβ homodimer in the cell is unfavorable, probably due to protein folding since IFNβ itself tends to aggregate.
Example 4
Purification of huFcγ4h-Mono-L-DI-IFNβ
[0097] Purification of Fc-containing fusion proteins was performed based on the affinity of the Fc protein moiety for Protein A. Briefly, cell supernatant containing the fusion protein was loaded onto a pre-equilibrated Protein A Sepharose column and the column was washed extensively in same buffer (150 mM sodium phosphate, 100 mM NaCl at neutral pH). Bound protein was eluted at a low pH (pH 2.5-3) in the same buffer and eluate fractions were immediately neutralized. The huFcγ4h-mono-L-DI-IFNβ heterodimer could be readily separated from the Fcγ4h homodimer based on the affinity of IFNβ protein for Cibacron Blue 3GA (Blue Sepharose Fast Flow column; Pharmacia). Culture supernatant containing the expressed fusion protein was adjusted to 1 M NaCl and loaded onto the Blue Sepharose Fast Flow column which had been pre-equilibrated with Buffer A (Buffer A: 20 mM Sodium Phosphate (pH 7.2) 1 M NaCl). The column was washed with 10 column volumes of Buffer A, followed by 15 column volumes of a 1:1 mixture of Buffer A:Buffer B (Buffer B: 20 mM Sodium Phosphate (pH 7.2), 50% (v/v) Ethylene Glycol). The heterodimer was elated in 100% Buffer B and 1 ml fractions were collected into tubes containing 0.5 ml Buffer A. The purified huFcγ4h-mono-L-DI-IFNβ was analyzed by size exclusion chromatography (SEC) and further confirmed by a Western blot probed with an anti-IFNβ antibody.
Example 5
Expression of Immunoglobulin- and huFc-Mono-Ligand Variants Containing Signle Substitution that Abrogates FcRn Binding
[0098] A huFc-mono-L-DI-IFNβ variant derived from an Fc-SEED (see WO2007/110205) was produced in the form of huFc-AG2(H435A)/huFc-GA2-L-DI-IFNβ. Additional variants that were produced include IgG subclass and ligand variants, such as huFcγ1(H435A)/huFcγ1-IL2 and deimmunized KS-γ1(H435A)/KS-γ1-IL2, a class of whole IgG fusion proteins known as immunocytokines (Davis et al. (2003) Cancer Immunol. Immunother. 52:297-308).
[0099] In addition to H435, H310 was also reported to be involved in FcRn binding (Kim et al. (1999) Eur. J. Immunol. 29:2819-2825). Hence another huFcγ4h-mono-L-DI-IFNγ variant containing the H310A substitution was produced in the form of a huFcγ4h(H310A)/huFcγ4h-L-DI-IFNγ heterodimer.
Example 6
Activity of huFc-IFNβ Proteins in Cell-Based Bioassays
[0100] The activity of the Fc-IFNβ fusion proteins was determined in an antiviral assay. Viral replication is often toxic to cells, resulting in cell lysis, an effect known as a cytopathic effect (CPE). Interferons act on pathways that inhibit viral proliferation, protecting cells from CPE. The antiviral activity of IFNβ could be assayed by measuring the extent to which CPE is reduced (CPER), as described in "Lymphokines and Interferons: A Practical Approach," edited by M. J. Clemens, A. G. Morris, and A. J. H. Gearin, I.R.L. Press, Oxford, 1987. The antiviral activities of purified Fcγ4h-mono-L-DI-IFNβ and Fcγ4h-mono-L-DI-IFNβ variant containing the H435A substitution were compared to Rebif using the human epithelial lung carcinoma line A549 (ATCC #CCL-185) as a host for the encephalornyocarditis virus (EMCV; ATCC #VR 129B). The effective dose (ED50) was set as the amount of protein that led to 50% CPER (i.e. 50% of the cells are protected), determined relative to uninfected control cells. On a molar basis, both Fcγ4h-mono-L-DI-IFNβ and Fcγ4h-mono-L-DI-IFNβ variant were found to be at least as potent as Rebif in this CPE assay (FIG. 10).
Example 7
Pharmacokinetics of huFc-IFNβ Proteins
[0101] The pharmacokinetics (PK) of huFc-IFNβ heterodimeric fusion proteins and variants were determined in Balb/c mice (n=3). For intravenous administration, 25 μg of the heterodimeric fusion protein were injected into the tail vein of each mouse. Blood was collected into heparin-coated tubes immediately following injection (t=0 min), and at 30 min, 1 hr, 2 hrs, 4 hrs, 8 hrs, 24 hrs, 48 hrs, 72 hrs and 96 hrs post-injection by retro-orbital bleeding. For subcutaneous administration, 50 μg of the heterodimeric fusion protein were injected per mouse. Blood was collected into heparin-coated tubes 1, 2, 4, 8, 24, 48, 72 and 96 hrs post-injection by retro-orbital bleeding. Cells were removed by centrifugation (4 min at 12,500 g) and the concentration of the fusion protein in the plasma was determined by an anti-huFc ELISA consisting of an anti-(H&L) (AffiniPure Goat anti-Human IgG (H+L), Jackson Immuno Research Laboratories, West Grove, Pa.) capture and anti-Fc (HRP-conjugated (Fab')2 dimer goat anti-human IgG Fc, Jackson Immuno Research Laboratories, West Grove, Pa.) detection, and an anti-huFc-IFNβ ELISA consisting of an anti-(H&L) capture and anti-huIFNβ (Goat anti-human IFN-β Biotinylated, R&D Systems, Minneapolis, Minn.) detection. Furthermore, the integrity of the circulating fusion protein was confirmed by an immunoblot of the PK serum samples probed with an anti-huFc antibody or an anti-huIFNβ antibody.
[0102] FIGS. 11 and 12 compare the pharmacokinetic profiles of intravenously administered huFcγ4h-mono-L-DI-IFNβ and an huFcγ4h-mono-L-DI-IFNβ variant containing the H435A substitution in the form of the huFcγ4h(H435A)/huFcγ4h-L-DI-IFNβ heterodimer, as determined by anti-huFc ELISA and anti-huFc-IFNβ ELISA, respectively. The huFcγ4h-mono-L-DI-IFNβ has a circulating half-life of 48 hr, which is many times longer than that of IFNβ, which was in minutes. Surprisingly, the huFcγ4h-mono-L-DI-IFNβ variant containing the H435A substitution has a circulating half-life of 46 hr, which is essentially identical to that of huFcγ4h-mono-L-DI-IFNβ, within experimental error. The H435A variant also has an AUC (area under the curve) about two-thirds of that of the wild-type, which is several hundred times that of IFNβ. The anti-huFc-IFNβ ELISA detected specifically the fusion protein and not any cleaved fragments without the N-terminal Fc or C-terminal IFNβ moieties. Furthermore, Western blot analyses of the intravenous PK samples under reducing conditions using either anti-huFc antibody or anti-huIFNβ antibody as probes confirmed that the fusion proteins stayed intact in vivo (FIG. 13). In the top left section of FIG. 13, the upper arrow denotes the huFcγ4h-L-DI-IFNβ polypeptide chain, and the bottom arrow denotes the huFcγ4h chain. Similarly, in the bottom left section of FIG. 13, the upper arrow denotes the huFcγ4h-L-DI-IFNβ polypeptide chain, and the bottom arrow denotes the huFcγ4h(H435A) chain.
[0103] FIGS. 14 and 15 compare the pharmacokinetic profiles of the same two molecules administered subcutaneously. The huFcγ4h-mono-L-DI-IFNβ and the huFcγ4h-mono-L-DI-IFNβ variant containing the H435A substitution have a similar circulating half-life, which is many times longer than that of IFNβ. Surprisingly, the huFcγ4h-mono-L-DI-IFNβ variant containing the H435A substitution has a circulating half-life of 46 hr, which is essentially identical to that of huFcγ4h-mono-L-DI-IFNβ, within experimental error. The H435A variant also has an AUC (area under the curve) about two-thirds of that of the wild-type, which is several hundred times that of IFNβ. The anti-hu Fc ELISA and anti-hu IFNβ ELISA detected the two ends of the fusion protein molecule. Furthermore, Western blot analyses of the subcutaneous PK samples under reducing conditions using either anti-hu Fc antibody or anti-hu IFNβ antibody as probes confirmed that the fusion proteins stayed intact in vivo (FIG. 16). In the top left panel of FIG. 16, the upper arrow denotes the huFcγ4h-L-DI-IFNβ polypeptide chain, and the bottom arrow denotes the huFcγ4h chain. Similarly, in the bottom left panel of FIG. 16, the upper arrow denotes the huFcγ4h-L-DI-IFNβ polypeptide chain, and the bottom arrow denotes the huFcγ4h(H435A) chain.
Example 8
Reduced Immunogenicity of Immunoglobulin- and huFc-Mono-Ligand Variants Containing Single Substitution that Abrogates FcRn Binding
[0104] To demonstrate the reduced immunogenicity of immunoglobulin- or huFc-mono-ligand variants containing a single substitution that abrogates FcRn binding of only one polypeptide chain, mice were immunized with huFcγ4h-mono-L-DI-IFNβ or huFcγ4h-mono-L-DI-IFNβ variant containing the H435A mutation. Antibody titers were compared at appropriate times after immunization.
[0105] Two groups of female, 8-weeks-old Balb/C mice (5 mice per group) were injected subcutaneously with 33 μg/mouse of huFcγ4h-mono-L-DI-IFNβ or huFcγ4h-mono-L-DI-IFNβ variant containing the H435A mutation, respectively. On day 15, mice received a subcutaneous boost injection of 33 μg/mouse of huFcγ4h-mono-L-DI-IFNβ or huFcγ4h-mono-L-DI-IFNβ variant containing the H435A mutation. Mouse antibody titers were determined on Day 26 by ELISA. This consisted of coating the wells of a 96-well plate with 1 μg of goat anti-mouse IgG (H+L) (Jackson ImmunoResearch Laboratories, West Grove, Pa., cat #115-005-062) by incubation overnight at 4° C. in PBS followed by washing four times with PBS 0.05% Tween. Next, the goat anti-mouse IgG (H+L)-coated plate was blocked with 1% milk, washed four times with PBS 0.05% Tween, dried, and stored at -20° C. For capturing mouse antibodies, serum was initially diluted 1:1000 followed by serial dilutions of 1:2 in PBS 0.05% Tween and added to the goat anti-mouse IgG (H+L)-coated wells for one hour at 37° C. The wells were then washed four times with PBS 0.05% Tween. The captured antibodies were detected by adding the immunogens, huFcγ4h-mono-L-DI-IFNβ or huFcγ4h-mono-L-DI-IFNβ variant containing the H435A mutation at 0.5 μg/ml, and a 1:2.0,000 dilution of F(ab)2 Goat anti-hu-IgG-Fc-HRP (Jackson ImmunoResearch Laboratories, cat #109-036-098) in PBS 0.05% Tween. The plate was incubated for one hour at room temperature followed by four washes with PBS 0.05% Tween. Signal detection was carried out using 100 μl of 3',3',5',5'-Tetramethylbenzidine (TMB), and after 15 minutes, the reaction was stopped with 100 μl of 2N H2SO4.
[0106] FIG. 17 compares the antibody titers of mice that were immunized with huFcγ4h-mono-L-DI-IFNβ or huFcγ4h-mono-L-DI-IFNβ variant containing the H435A mutation. Mice that received the huFcγ4h-mono-L-DI-IFNβ variant containing the H435A mutation (diamonds) had lower titer than mice immunized with huFcγ4h-mono-L-DI-IFNβ (circles) indicating that that the variant had reduced immunogenicity. The comparison between groups was analyzed by Sigma-Plot using Paired-t-test. The difference between two groups was statistically significant (Normality test: p=0.288, t=5.422 with 7 degrees of freedom (p=<0.001)).
Example 9
Determining Immunogenicity by In Vitro T Cell Assay
[0107] To show that the huFc-mono-ligand variant containing the H435A mutation is less immunogenic than the wild-type counterpart, we use a human T cell proliferation assay that involves culturing and maturation of monocyte derived dendritic cells (DC), loading and presentation of antigen on DC, and determination of antigen-induced response in CD4+ cells. Human peripheral blood mononuclear cells (PBMC) from healthy donors serve as a source of DC and autologous T cells. Typically PBMC are isolated by Ficoll-Hypaque gradient from leukopack samples and monocytes are purified using MACS CD14 isolation kit (Miltenyi Biotec Inc. Auburn, Calif.) and cultured with GM-CSF and IL-4 for 5 days. Immature DC are loaded with the different antigens, such as huFcγ4h-mono-L-DI-IFNβ, the huFcγ4h-mono-L-DI-IFNβ variant containing the H435A mutation, as well as tetanus toxoid. Since IFNβ has a very potent immunosuppressive effect, the huFcγ4h-mono-L-DI-IFNβ and the huFcγ4h-mono-L-DI-IFNβ variant have to be heat treated at a moderately high temperature so that the more heat-sensitive IFNβ moiety is inactivated while the more heat stable Fc remains in its native form. A useful temperature range for this selective inactivation is from 56° C. to 65° C. Alternatively, fusion proteins containing inactive IFNβ moiety can be produced recombinantly through amino acid substitutions.
[0108] After the DC are incubated with the antigens for 24 hours, they are stimulated for 24 hours with TNF-α, IL-1β, IL-6, and PGE2 to induce DC maturation. Autologous CD4+ T cells that are prepared from the same human PBMC using MACS CD4 isolation kit (Miltenyi Biotec Inc, Auburn, Calif.) are labeled with carboxyfluorescein diacetate and succinimidyl ester (CFSE) using CellTrace USE Proliferation Kit (Invitrogen). DC and T cells are then co-cultured for 6-7 days, after which the percentage of dividing T cells are determined on FACS. Autologous T cell proliferation stimulated by the DC-presented peptides from the huFcγ4h-mono-L-DI-IFNβ variant are expected to be lower than those against the corresponding wild-type Fc fusion protein.
Sequence CWU
1
1
141229PRTArtificial SequenceDescription of Artificial Sequence Synthetic
polypeptide 1Glu Ser Lys Tyr Gly Pro Pro Cys Pro Ser Cys Pro Ala Pro
Glu Phe 1 5 10 15
Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr
20 25 30 Leu Met Ile Ser Arg
Thr Pro Glu Val Thr Cys Val Val Val Asp Val 35
40 45 Ser Gln Glu Asp Pro Glu Val Gln Phe
Asn Trp Tyr Val Asp Gly Val 50 55
60 Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln
Phe Asn Ser 65 70 75
80 Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu
85 90 95 Asn Gly Lys Glu
Tyr Lys Cys Lys Val Ser Asn Lys Gly Leu Pro Ser 100
105 110 Ser Ile Glu Lys Thr Ile Ser Lys Ala
Lys Gly Gln Pro Arg Glu Pro 115 120
125 Gln Val Tyr Thr Leu Pro Pro Ser Gln Glu Glu Met Thr Lys
Asn Gln 130 135 140
Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala 145
150 155 160 Val Glu Trp Glu Ser
Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 165
170 175 Pro Pro Val Leu Asp Ser Asp Gly Ser Phe
Phe Leu Tyr Ser Lys Leu 180 185
190 Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Ile Phe Ser Cys
Ser 195 200 205 Val
Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 210
215 220 Leu Ser Pro Gly Lys 225
2181PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 2Gly Gly Gly Gly Ser Gly Gly Gly Gly
Ser Gly Gly Gly Ser Gly Met 1 5 10
15 Ser Tyr Asn Leu Leu Gly Phe Leu Gln Arg Ser Ser Asn Phe
Gln Ser 20 25 30
Gln Lys Leu Leu Trp Gln Leu Asn Gly Arg Leu Glu Tyr Cys Leu Lys
35 40 45 Asp Arg Met Asn
Phe Asp Ile Pro Glu Glu Ile Lys Gln Leu Gln Gln 50
55 60 Phe Gln Lys Glu Asp Ala Ala Ala
Thr Ile Tyr Glu Met Leu Gln Asn 65 70
75 80 Ile Phe Ala Ile Phe Arg Gln Asp Ser Ser Ser Thr
Gly Trp Asn Glu 85 90
95 Thr Ile Val Glu Asn Leu Leu Ala Asn Val Tyr His Gln Ile Asn His
100 105 110 Leu Lys Thr
Val Leu Glu Glu Lys Leu Glu Lys Glu Asp Phe Thr Arg 115
120 125 Gly Lys Leu Met Ser Ser Leu His
Leu Lys Arg Tyr Tyr Gly Arg Ile 130 135
140 Leu Ala Tyr Leu Lys Ala Lys Glu Tyr Ser Ala Cys Ala
Trp Thr Ile 145 150 155
160 Val Arg Val Glu Ile Leu Arg Asn Phe Tyr Phe Ile Asn Arg Leu Thr
165 170 175 Gly Tyr Leu Arg
Asn 180 3251PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 3Met Glu Leu Pro Val Arg
Leu Leu Val Leu Met Phe Trp Ile Pro Ala 1 5
10 15 Ser Leu Ser Glu Pro Lys Ser Ser Asp Lys Thr
His Thr Cys Pro Pro 20 25
30 Cys Pro Ala Pro Glu Phe Leu Gly Gly Pro Ser Val Phe Leu Phe
Pro 35 40 45 Pro
Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr 50
55 60 Cys Val Val Val Asp Val
Ser Gln Glu Asp Pro Glu Val Gln Phe Asn 65 70
75 80 Trp Tyr Val Asp Gly Val Glu Val His Asn Ala
Lys Thr Lys Pro Arg 85 90
95 Glu Glu Gln Phe Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val
100 105 110 Leu His
Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser 115
120 125 Asn Lys Gly Leu Pro Ser Ser
Ile Glu Lys Thr Ile Ser Lys Ala Lys 130 135
140 Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro
Pro Ser Gln Glu 145 150 155
160 Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe
165 170 175 Tyr Pro Ser
Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu 180
185 190 Asn Asn Tyr Lys Thr Thr Pro Pro
Val Leu Asp Ser Asp Gly Ser Phe 195 200
205 Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp
Gln Gln Gly 210 215 220
Asn Ile Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr 225
230 235 240 Thr Gln Lys Ser
Leu Ser Leu Ser Pro Gly Lys 245 250
41352DNAArtificial SequenceDescription of Artificial Sequence Synthetic
polynucleotide 4atggagttgc ctgttaggct gttggtgctg atgttctgga ttcctggtga
ggagagaggg 60aagtgaggga ggagaatgga cagggagcag gagcactgaa tcccattgct
cattccatgt 120attctggcat gggtgagaag atgggtctta tcctccagca tggggcctct
ggggtgaata 180cttgttagag ggaggttcca gatgggaaca tgtgctataa tgaagattat
gaaatggatg 240cctgggatgg tctaagtaat gcctagaagt gactagacac ttgcaattca
ctttttttgg 300taagaagaga tttttaggct ataaaaaaat gttatgtaaa aataaacatc
acagttgaaa 360taaaaaaaaa tataaggatg ttcatgaatt ttgtgtataa ctatgtattt
ctctctcatt 420gtttcagctt ccttaagcga gcccaaatct tctgacaaaa ctcacacatg
cccaccgtgc 480ccaggtaagc cagcccaggc ctcgccctcc agctcaaggc gggacaggtg
ccctagagta 540gcctgcatcc agggacaggc cccagccggg tgctgacgca tccacctcca
tctcttcctc 600agcacctgag ttcctggggg gaccatcagt cttcctgttc cccccaaaac
ccaaggacac 660tctcatgatc tcccggaccc ctgaggtcac gtgcgtggtg gtggacgtga
gccaggaaga 720ccccgaggtc cagttcaact ggtacgtgga tggcgtggag gtgcataatg
ccaagacaaa 780gccgcgggag gagcagttca acagcacgta ccgtgtggtc agcgtcctca
ccgtcctgca 840ccaggactgg ctgaacggca aggagtacaa gtgcaaggtc tccaacaaag
gcctcccgtc 900ctccatcgag aaaaccatct ccaaagccaa aggtgggacc cacggggtgc
gagggccaca 960tggacagagg tcagctcggc ccaccctctg ccctgggagt gaccgctgtg
ccaacctctg 1020tccctacagg gcagccccga gagccacagg tgtacaccct gcccccatcc
caggaggaga 1080tgaccaagaa ccaggtcagc ctgacctgcc tggtcaaagg cttctacccc
agcgacatcg 1140ccgtggagtg ggagagcaat gggcagccgg agaacaacta caagaccacg
cctcccgtgc 1200tggactccga cggctccttc ttcctctaca gcaagctcac cgtggacaag
agcaggtggc 1260agcaggggaa catcttctca tgctccgtga tgcatgaggc tctgcacaac
cactacacgc 1320agaagagcct ctccctgtcc ccgggtaaat ga
13525432PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 5Met Glu Leu Pro Val Arg Leu Leu Val
Leu Met Phe Trp Ile Pro Ala 1 5 10
15 Ser Leu Ser Glu Pro Lys Ser Ser Asp Lys Thr His Thr Cys
Pro Pro 20 25 30
Cys Pro Ala Pro Glu Phe Leu Gly Gly Pro Ser Val Phe Leu Phe Pro
35 40 45 Pro Lys Pro Lys
Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr 50
55 60 Cys Val Val Val Asp Val Ser Gln
Glu Asp Pro Glu Val Gln Phe Asn 65 70
75 80 Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys
Thr Lys Pro Arg 85 90
95 Glu Glu Gln Phe Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val
100 105 110 Leu His Gln
Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser 115
120 125 Asn Lys Gly Leu Pro Ser Ser Ile
Glu Lys Thr Ile Ser Lys Ala Lys 130 135
140 Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro
Ser Gln Glu 145 150 155
160 Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe
165 170 175 Tyr Pro Ser Asp
Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu 180
185 190 Asn Asn Tyr Lys Thr Thr Pro Pro Val
Leu Asp Ser Asp Gly Ser Phe 195 200
205 Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln
Gln Gly 210 215 220
Asn Ile Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr 225
230 235 240 Thr Gln Lys Ser Leu
Ser Leu Ser Pro Gly Ala Gly Gly Gly Gly Ser 245
250 255 Gly Gly Gly Gly Ser Gly Gly Gly Ser Gly
Met Ser Tyr Asn Leu Leu 260 265
270 Gly Phe Leu Gln Arg Ser Ser Asn Phe Gln Ser Gln Lys Leu Leu
Trp 275 280 285 Gln
Leu Asn Gly Arg Leu Glu Tyr Cys Leu Lys Asp Arg Met Asn Phe 290
295 300 Asp Ile Pro Glu Glu Ile
Lys Gln Leu Gln Gln Phe Gln Lys Glu Asp 305 310
315 320 Ala Ala Ala Thr Ile Tyr Glu Met Leu Gln Asn
Ile Phe Ala Ile Phe 325 330
335 Arg Gln Asp Ser Ser Ser Thr Gly Trp Asn Glu Thr Ile Val Glu Asn
340 345 350 Leu Leu
Ala Asn Val Tyr His Gln Ile Asn His Leu Lys Thr Val Leu 355
360 365 Glu Glu Lys Leu Glu Lys Glu
Asp Phe Thr Arg Gly Lys Leu Met Ser 370 375
380 Ser Leu His Leu Lys Arg Tyr Tyr Gly Arg Ile Leu
Ala Tyr Leu Lys 385 390 395
400 Ala Lys Glu Tyr Ser Ala Cys Ala Trp Thr Ile Val Arg Val Glu Ile
405 410 415 Leu Arg Asn
Phe Tyr Phe Ile Asn Arg Leu Thr Gly Tyr Leu Arg Asn 420
425 430 61895DNAArtificial
SequenceDescription of Artificial Sequence Synthetic polynucleotide
6atggagttgc ctgttaggct gttggtgctg atgttctgga ttcctggtga ggagagaggg
60aagtgaggga ggagaatgga cagggagcag gagcactgaa tcccattgct cattccatgt
120attctggcat gggtgagaag atgggtctta tcctccagca tggggcctct ggggtgaata
180cttgttagag ggaggttcca gatgggaaca tgtgctataa tgaagattat gaaatggatg
240cctgggatgg tctaagtaat gcctagaagt gactagacac ttgcaattca ctttttttgg
300taagaagaga tttttaggct ataaaaaaat gttatgtaaa aataaacatc acagttgaaa
360taaaaaaaaa tataaggatg ttcatgaatt ttgtgtataa ctatgtattt ctctctcatt
420gtttcagctt ccttaagcga gcccaaatct tctgacaaaa ctcacacatg cccaccgtgc
480ccaggtaagc cagcccaggc ctcgccctcc agctcaaggc gggacaggtg ccctagagta
540gcctgcatcc agggacaggc cccagccggg tgctgacgca tccacctcca tctcttcctc
600agcacctgag ttcctggggg gaccatcagt cttcctgttc cccccaaaac ccaaggacac
660tctcatgatc tcccggaccc ctgaggtcac gtgcgtggtg gtggacgtga gccaggaaga
720ccccgaggtc cagttcaact ggtacgtgga tggcgtggag gtgcataatg ccaagacaaa
780gccgcgggag gagcagttca acagcacgta ccgtgtggtc agcgtcctca ccgtcctgca
840ccaggactgg ctgaacggca aggagtacaa gtgcaaggtc tccaacaaag gcctcccgtc
900ctccatcgag aaaaccatct ccaaagccaa aggtgggacc cacggggtgc gagggccaca
960tggacagagg tcagctcggc ccaccctctg ccctgggagt gaccgctgtg ccaacctctg
1020tccctacagg gcagccccga gagccacagg tgtacaccct gcccccatcc caggaggaga
1080tgaccaagaa ccaggtcagc ctgacctgcc tggtcaaagg cttctacccc agcgacatcg
1140ccgtggagtg ggagagcaat gggcagccgg agaacaacta caagaccacg cctcccgtgc
1200tggactccga cggctccttc ttcctctaca gcaagctcac cgtggacaag agcaggtggc
1260agcaggggaa catcttctca tgctccgtga tgcatgaggc tctgcacaac cactacacgc
1320agaagagcct ctccctgtcc ccgggtgcag ggggcggggg cagcgggggc ggaggatccg
1380gcgggggctc gggtatgagc tacaacttgc ttggattcct acaaagaagc agcaattttc
1440agagtcagaa gctcctgtgg caattgaatg ggaggcttga atattgcctc aaggacagga
1500tgaactttga catccctgag gagattaagc agctgcagca gttccagaag gaggacgccg
1560cagccaccat ctatgagatg ctccagaaca tctttgctat tttcagacaa gattcatcta
1620gcactggctg gaatgagact attgttgaga acctcctggc taatgtctat catcagataa
1680accatctgaa gacagtcctg gaagaaaaac tggagaaaga agatttcacc aggggaaaac
1740tcatgagcag tctgcacctg aaaagatatt atgggaggat tctggcctac ctgaaggcca
1800aggagtacag tgcctgtgcc tggaccatag tcagagtgga aatcctaagg aacttttact
1860tcattaacag acttacaggt tacctccgaa actga
1895712PRTArtificial SequenceDescription of Artificial Sequence Synthetic
peptide 7Glu Ser Lys Tyr Gly Pro Pro Cys Pro Ser Cys Pro 1
5 10 815PRTArtificial SequenceDescription
of Artificial Sequence Synthetic peptide 8Glu Pro Lys Ser Ser Asp
Lys Thr His Thr Cys Pro Pro Cys Pro 1 5
10 15 944DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 9cttaagcgag tccaaatatg
gtcccccatg cccatcatgc ccag 441053DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
10cttaagcgag cccaaatctt ctgacaaaac tcacacatgc ccaccgtgcc cag
531117DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 11tctagaccac catggag
171230DNAArtificial SequenceDescription of Artificial
Sequence Synthetic primer 12ggctctgcac aacgcgtaca cgcagaagag
301330DNAArtificial SequenceDescription of
Artificial Sequence Synthetic primer 13ctcttctgcg tgtacgcgtt
gtgcagagcc 301415PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 14Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Ser Gly 1 5
10 15
User Contributions:
Comment about this patent or add new information about this topic: