Patent application title: CONCATAMERIC IMMUNOADHESION MOLECULE
Inventors:
Yong-Hoon Chung (Seoul, KR)
Ji-Woong Han (Seoul, KR)
Hye-Ja Lee (Seoul, KR)
Eun-Yong Choi (Inchun-Si, KR)
Jin Mi Kim (Seoul, KR)
Assignees:
Medexgen Co., Ltd.
IPC8 Class: AA61K39395FI
USPC Class:
4241341
Class name: Immunoglobulin, antiserum, antibody, or antibody fragment, except conjugate or complex of the same with nonimmunoglobulin material structurally-modified antibody, immunoglobulin, or fragment thereof (e.g., chimeric, humanized, cdr-grafted, mutated, etc.) antibody, immunoglobulin, or fragment thereof fused via peptide linkage to nonimmunoglobulin protein, polypeptide, or fragment thereof (i.e., antibody or immunoglobulin fusion protein or polypeptide)
Publication date: 2010-11-04
Patent application number: 20100278827
Claims:
1. A dimeric protein comprising two monomeric subunits, each monomeric
subunit comprising a concatamer of two identical soluble extracellular
domains of a protein, selected from the group consisting of cytokine
receptors, adhesion molecules, tumor necrosis factor receptors, receptor
tyrosine kinases, chemokine receptors and other cell surface proteins
which contain a soluble extracellular domain, linked to a Fc fragment of
an immunoglobulin molecule comprising a hinge region of the
immunoglobulin molecule, wherein said monomeric subunits are linked by
disulfide bonds at their respective hinge regions.
2. The dimeric protein as set forth in claim 1, wherein the immunoglobulin molecule is IgG.
3. The dimeric protein as set forth in claim 1, wherein the protein is selected from the group consisting of IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-10, IL-12, IL-17, TNF, TGF, IFN, GM-CSF, G-CSF, EPO, TPO, M-CSF, GHR, IL-13R, IL-1R, IL-2R, IL-3R, IL-4R, IL-5R, IL-6R, IL-7R, IL-9R, IL-15R, TNFR1, TGFR, IFNR, interferon-.alpha. R, -.beta. R and -.gamma. R, RM-CSFR, G-CSFR, EPOR, cMpl, gp130, Fas (Apo 1), CCR1, CSCR1-4, TrkA, TrkB, TrkC, Htk, REK7, Rse/Tyro-3, Hepatocyte growth factor R, platelet-derived growth factor R, Flt-1, CD2, CD4, CD5, CD6, CD22, CD27, CD28, CD30, CD31, CD40, CD44, CD100, CD137, CD150, LAG-3, B7, β-neurexin, CTLA-4, ICOS, ICAM-1, complement R-2 (CD21), IgER, lysosomal membrane gp-1, α2-microglobulin receptor-related proteins, and sodium-releasing peptide R.
4. The dimeric protein as set forth in claim 2, wherein the monomeric protein contains an amino acid sequence of SEQ ID NO: 6, SEQ ID NO: 18, or SEQ ID NO: 20.
5. A DNA construct encoding a monomeric protein formed by linkage of a concatamer of two identical soluble extracellular domains of a protein, selected from the group consisting of cytokine receptors, adhesion molecules, tumor necrosis factor receptors, receptor tyrosine kinases, chemokine receptors and other cell surface proteins which contain a soluble extracellular domain, to a hinge region of an Fc fragment of an immunoglobulin molecule.
6. The DNA construct as set forth in claim 5, wherein the immunoglobulin molecule is IgG.
7. The DNA construct as set forth in claim 6, wherein the protein is selected from the group consisting of IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-10, IL-12, IL-17, TNF, TGF, IFN, GM-CSF, G-CSF, EPO, TPO, M-CSF, GHR, IL-13R, IL-1R, IL-2R, IL-3R, IL-4R, IL-5R, IL-6R, IL-7R, IL-9R, IL-15R, TNFR1, TGFR, IFNR, interferon-.alpha. R, -.beta. R and -.gamma. R, RM-CSFR, G-CSFB, EPOR, cMpl, gp130, Fas (Apo 1), CCR1, CSCR1-4, TrkA, TrkB, TrkC, Htk, REK7, Rse/Tyro-3, Hepatocyte growth factor R, platelet-derived growth factor R, Flt-1, CD2, CD4, CD5, CD6, CD22, CD27, CD28, CD30, CD31, CD40, CD44, CD100, CD137, CD150, LAG-3, B7, β-neurexin, CTLA-4, ICOS, ICAM-1, complement R-2 (CD21), IgER, lysosomal membrane gp-1, α2-microglobulin receptor-related proteins, and sodium-releasing peptide R.
8. The DNA construct as set forth in claim 7, wherein the DNA construct contains a nucleotide sequence of SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 17, or SEQ ID NO: 19.
9. A recombinant expression plasmid comprising the DNA construct of claim 5 operably linked thereto.
10. The recombinant expression plasmid as set forth in claim 9, wherein the recombinant expression plasmid is a pTR11-Top10' plasmid (accession No.: KCCM 10288), a pTR22-Top10' plasmid (accession No.: KCCM 10289), a pCD22Ig plasmid (accession No.: KCCM 10402), or a pCT44Ig plasmid (accession No.: KCCM 10400).
11. A host cell transformed or transfected with the recombinant expression plasmid of claim 9.
12. The host cell as set forth in claim 11, wherein the host cell is a mammalian cell.
13. The host cell as set forth in claim 11, wherein the recombinant expression plasmid is a pTR11-Top10' plasmid (accession No.: KCCM 10288), a pTR22-Top10' plasmid (accession No.: KCCM 10289), a pCD22Ig plasmid (accession No.: KCCM 10402), or a pCT44Ig plasmid (accession No.: KCCM 10400),
14. The host cell as set forth in claim 12, wherein the host cell is a TR11Ig-CHO cell line (accession No.: KCLRF-BP-00046) or a TR22Ig-CHO cell line (accession No.: KCLRF-BP-00047).
15. A method of preparing a dimeric protein in which disulfide bonds are formed between the hinge regions of two monomeric proteins, comprising the steps ofculturing the transformed or transfected host cell of claim 11 under conditions suitable for expression of a DNA construct encoding a monomeric protein in which a concatamer of two identical soluble extracellular domains of a protein, selected from the group consisting of cytokine receptors, adhesion molecules, tumor necrosis factor receptors, receptor tyrosine kinases, chemokine receptors and other cell surface proteins which contain a soluble extracellular domain, is linked to a hinge region of an Fc fragment of an immunoglobulin molecule; andisolating and purifying a dimeric protein formed by dimerization of the produced monomeric proteins from culture medium.
16. The method as set forth in claim 15, wherein the DNA construct encoding a monomeric protein is prepared by preparing a DNA construct encoding a monomeric protein formed by joining a DNA fragment encoding an Fc fragment of an immunoglobulin molecule and a DNA fragment encoding a soluble extracellular domain of a protein; selected from the group consisting of cytokine receptors, adhesion molecules, tumor necrosis factor receptors, receptor tyrosine kinases, chemokine receptors and other cell surface proteins which contain a soluble extracellular domain; and joining the prepared DNA construct and a second DNA fragment identical to the DNA fragment encoding a soluble extracellular domain of a protein.
17. The method as set forth in claim 16, wherein the DNA construct encoding a monomeric protein contains a glycosylation motif sequence.
18. The method as set forth in claim 17, wherein the glycosylation motif sequence is inserted to a region at which two soluble extracellular domains are joined.
19. The method as set forth in claim 15, wherein the monomeric protein contains a leader sequence.
20. The method as set forth in claim 19, wherein the monomeric protein is CTLA-4, and the leader sequence has an amino acid sequence of MACLGFQRHKAQKNLAARTWPCTLLFFIPVFCKA.
21. The method as set forth in claim 20, wherein the leader sequence has an amino acid sequence of MRTWPCTLLFFIPVFCKA excluding ACLGFQRHKAQKNLAA.
22. The method as set forth in claim 15, wherein the host cell is a mammalian cell.
23. A dimeric protein comprising two monomeric subunits, each monomeric subunit comprising a concatamer of two identical soluble extracellular domains of a protein, selected from the group consisting of cytokine receptors, adhesion molecules, tumor necrosis factor receptors, receptor tyrosine kinases, chemokine receptors and other cell surface proteins which contain a soluble extracellular domain, linked to a Fc fragment of an immunoglobulin molecule comprising a hinge region of the immunoglobulin molecule, wherein said monomeric subunits are linked by disulfide bonds at their respective hinge regions and glycosylated, and having improved stability and therapeutic effects.
24. The dimeric protein as set forth in claim 23, wherein the monomeric protein contains an amino acid sequence of SEQ ID NO: 10, SEQ ID NO: 12, SEQ ID NO: 22, or SEQ ID NO: 24.
25. A DNA construct encoding a monomeric protein formed by linkage of a concatamer of two identical soluble extracellular domains of a protein, selected from the group consisting of cytokine receptors, adhesion molecules, tumor necrosis factor receptors, receptor tyrosine kinases, chemokine receptors and other cell surface proteins which contain a soluble extracellular domain, to a hinge region of a Fc fragment of an immunoglobulin molecule and containing glycosylation motif peptides.
26. The DNA construct as set forth in claim 25, wherein the DNA construct contains an amino acid sequence of SEQ ID NO: 9, SEQ ID NO: 11, SEQ ID NO: 21, or SEQ ID NO: 23.
27. A recombinant expression plasmid operably linked to the DNA construct of claim 25.
28. The recombinant expression plasmid as set forth in claim 27, wherein the recombinant expression plasmid is a pTR11Ig-MG plasmid (accession No.: KCCM 10404), a pTR22Ig-MG plasmid (accession No.: KCCM 10407), a pCD22Ig-MG plasmid (accession No.: KCCM 10401), or a pCT44Ig-MG plasmid (accession No.: KCCM 10399).
29. A host cell transformed or transfected with the recombinant expression plasmid of claim 27.
30. The host cell as set forth in claim 29, wherein the host cell is a mammalian cell.
31. A pharmaceutical composition comprising the dimeric protein of claim 1.
32. A pharmaceutical composition comprising the glycosylated dimeric protein of claim 23.
Description:
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001]This application is a continuation of application Ser. No. 11/739,288, filed Apr. 24, 2007, which is a divisional of application Ser. No. 10/363,427, which is a National Stage Application of International Application No. PCT/KR02/01427, filed Jul. 26, 2002, which was not published in English under PCT Article 21(2), entering the National Stage on Feb. 28, 2003, and which claims priority of Korean Application No. 10-2001-0045028, filed Jul. 26, 2001. The entire disclosures of application Ser. Nos. 10/363,427 and 11/739,288 are considered as being part of this application, and the entire disclosures of application Ser. Nos. 10/363,417 and 11/739,288 are expressly incorporated by reference herein in their entireties.
TECHNICAL FIELD
[0002]The present invention relates to concatameric proteins, and more specifically, concatamerized structure of biologically active protein domains where C-terminal end of extracellular soluble domain of biologically active protein is fused to N-terminal end of the same or other extracellular soluble domain of biologically active protein, and dimerization of two concatamers by coupling to hinge region of Fc fragment of immunoglobulin, and glycosylated forms of the concatameric proteins.
BACKGROUND ART
[0003]The activity of cytokine is associated with pathologic severity of inflammatory and for immune response to various antigenic stimulations. Many antigen specific antibodies and soluble receptors which could recognize cytokines are currently in use to inhibit the function of cytokines for the therapeutic purposes (WO 93/016184, WO 96/02576, WO 96/023067, WO 1997/03682, and U.S. Pat. Nos. 5,434,131, 5,656,272, 5,977,318, 6,210,661, 6,225,117). Antibodies and soluble receptors inhibit cytokine signal transduction by disturbing interaction between cytokines and their receptors on cell surface.
[0004]Soluble receptors used as functional inhibitors of cytokine that fused to heavy chains of human immunoglobulins were disclosed by Capon et al. (Nature 337:5254, 1989), and thereafter many patents were disclosed inventions related to fusion proteins of soluble receptors and immunoglobulins (U.S. Pat. Nos. 5,521,288, 5,844,095, 6,046,310, 6,090,914, 6,100,383, 6,225,448).
[0005]Generally, fusion proteins of soluble receptors and immunoglobulins have following advantages (Capon et al., Nature 337:5254, 1989)
[0006]1. Increase in total avidity to ligand by forming bivalency via dimerization.
[0007]2. Increase in blood half-life of proteins, that is, increase in molecular stability
[0008]3. Activation of effecter cells by Fc fragment of immunoglobulin heavy chain
[0009]4. Convenience of purification by using affinity column, e.g. using protein A
Most fusion proteins of receptor extracellular domain and immunoglobulin heavy chain are composed of heavy chain without CHI domain, which result in dimers not binding to light chains. This structure is more desirable for the function of proteins and receptors involving inimune response. For example, TNFR(WO92/16221, WO95/34326)-immunoglobulin fusion proteins disclosed in WO94/06476 and U.S. Pat. No. 5,447,851 have been used for the inhibition of TNF-mediated inflammation. It is well known that TNFR-immunoglobulin fusion proteins have a higher affinity than original monomeric molecules (Lesslauer et al., Eur. J. Immunol. 21:2883, 1-991; Ashkenazi et al., Proc. Natl. Acad. Sci. 88:10535, 1991; Peppe et a., J. Exp. Med. 174:1483, 1991; Mohler et al., J. Immunol. 151:1548, 1993).
[0010]For the improved inhibition of TNF mediated response, one can increase efficacy by multimerizing soluble extracellular domains of TNFR, CD2, and CTLA-4. For example, when fusion proteins of TNFR's extracellular domains bound with immunoglobulin heavy chain(heavy chain fusion protein) and with light chain(light chain fusion protein) respectively are coexpressed in the same cell, one can produce fusion proteins as a tetrameric form by linking heavy chain to heavy and light chains. This tetramer showed much more increased efficacy than monomeric or dimeric forms as presented by Scallon et al. (Cytokine 7:759, 1995).
[0011]However, this method had many difficulties for commercialization such as simultaneous expression of two different fusion genes in the same cell line, remarkably lower production yields of multimeric form; and difficulty in purifying multimeric high molecular weight forms. For these reasons, immunoglobulin fusion proteins currently in use are only heavy chain fused form.
[0012]Therefore, there is considerable demand for the development of methods of producing multimeric protein therapeutics with high yield and efficient purification procedures.
DISCLOSURE OF INVENTION
[0013]The present inventors have manufactured concatameric proteins by fusing the C-terminal end of soluble domain of biologically active protein to the N-terminal end of soluble domain of the same or other biologically active protein by using DNA recombination techniques. Also, the present inventors have dimerized this concatamers by linking it to the hinge region of Fc fragment of immunoglobulin and added more glycosylations by using DNA mutagenesis techniques. And the present inventors have found that concatamerized protein dimers and their glycosylated forms show increased efficacy and stability compared to conventional monomeric fusion proteins.
[0014]Therefore, in one aspect, the present invention provides concatameric proteins where C-terminal end of soluble domain of biologically active proteins is fused to N-terminal end of soluble domain of the same or other biologically active proteins.
[0015]In another aspect, the present invention provides dimeric proteins formed by disulfide bond at hinge region of two monomeric proteins whose concatamerized part is fused to hinge region of Fc fragment of immunoglobulin.
[0016]Also in another aspect, the present invention provides DNA constructs that encode monomeric fusion proteins whose concatamerized domain is fused to hinge region of Fc fragment of immunoglobulins.
[0017]Also in another aspect, the present invention provides DNA plasmids comprising a DNA construct that encodes monomeric fusion protein whose concatamerized part is fused to hinge region of Fc fragment of immunoglobulin.
[0018]Also in another aspect, the present invention provides host cells transfected or transformed with recombinant DNA plasmids including a DNA construct that encodes monomeric fusion protein whose concatamerized part is fused to hinge region of Fc fragment of immunoglobulin.
[0019]Also in another aspect, the present invention provides a method for culturing the host cells, which were transfected or transformed with recombinant DNA plasmids including a DNA construct that encodes monomeric fusion protein whose concatamerized part is fused to hinge region of Fc fragment of immunoglobulin, under culture condition for expression of DNA constructs encoding concatameric fusion protein coupled to hinge region of Fc fragment of immunoglobulin, and manufacturing dimeric concatamers formed by disulfide bond at hinge region of two monomeric concatamers described as above including the process of. urification of the proteins described as above from cell culture.
[0020]Also in another aspect, the present invention provides a method for culturing the host cells, which were transfected or transformed with recombinant DNA plasmids including a DNA construct that encodes monomeric fusion protein whose concatamerized part of immunomudulatory function is fused to hinge region of Fc fragment of immunoglobulin and is inserted with glycosylation motifs, under the best condition which is suitable for expression of DNA constructs that encode monomeric fusion protein whose concatamerized part of immune function is fused to hinge region of Fc fragment of immunoglobulin, and for manufacturing glycosylated dimers formed by disulfide bond at hinge region of two monomeric proteins described as above including the process of purification of the glycosylated proteins described as above from cell culture.
[0021]Also in another aspect, the present invention provides DNA primers for inserting glycosylation motif into the DNA constructs that encode monomeric fusion proteins whose concatamerized part is fused to hinge region of Fc fragment of immunoglobulins.
[0022]Also in another aspect, the present invention provides the glycosylated dimers formed by disulfide bond at hinge region of two monomeric proteins whose concatamerized part involving immune response is fused to hinge region of Fc fragment of immunoglobulins.
[0023]Also in another aspect, the present invention provides the pharmaceutical compositions comprising dimers formed by disulfide bond at hinge region of two monomeric proteins whose concatamerized part involving immune response is fused to hinge region of Fc fragment of immunoglobulins in a pharmaceutically effective amount and in a pharmaceutically acceptable carrier.
[0024]Also in another aspect, the present invention provides the pharmaceutical compositions comprising glycosylated dimers formed by disulfide bond at hinge region of two monomeric proteins whose concatamerized part involving immune response is fused to hinge region of Fc fragment of immunoglobulins in a pharmaceutically effective amount and in a pharmaceutically acceptable carrier.
BRIEF DESCRIPTION OF THE DRAWINGS
[0025]The above and other objects, features and other advantages of the present invention will be more clearly understood from the following detailed description taken in conjunction with the accompanying drawings, in which:
[0026]FIG. 1 is a schematic view showing a process of preparing a DNA construct encoding a conventional simple fusion monomeric protein through polymerase chain reaction (PCR);
[0027]FIG. 2 is a schematic view showing a process of preparing a DNA construct encoding a concatameric fusion monomeric protein according to the present invention through PCR;
[0028]FIG. 3a shows structures of [TNFR/Fc]2, [CD2/Fc]2 or [CTLA4/Fc]2 fusion proteins, which are simple fusion dimeric proteins formed through homodimerization in cells of TNFR/Fc, CD2/Fc or CTLA4/Fc fusion proteins as examples of conventional simple fusion monomeric proteins;
[0029]FIG. 3b shows structures of [TNFR-TNFR/Fc]2, [CD2-CD2/Fc]2 or [CTLA4-CTLA4/Fc]2 fusion proteins, which are concatameric fusion dimeric proteins formed through homodimerization in cells of TNFR-TNFR/Fc, CD2-CD2/Fc or CTLA4-CTLA4/Fc fusion proteins as embodiments of the concatameric fusion dimeric protein according to the present invention;
[0030]FIG. 4a shows a structure of [TNFR1-TNFR1/Fc]2, as an embodiment of a concatameric fusion dimeric protein according to the present invention;
[0031]FIG. 4b shows a structure of [TNFR2-TNFR2/Fc]2, as another embodiment of the concatameric fusion dimeric protein according to the present invention;
[0032]FIG. 4c shows a structure of [CD2-CD2/Fc]2, as a further embodiment of the concatameric fusion dimeric protein according to the present invention;
[0033]FIG. 4d shows a structure of [CTLA4-CTLA4/Fc]2, as a still further embodiment of the concatameric fusion dimeric protein according to the present invention;
[0034]FIG. 5 is a diagram showing a process of constructing a recombinant expression plasmid pTR11Ig-Top10' expressing a concatameric fusion monomeric protein TNFR1-TNFR1/Fc according to the present invention;
[0035]FIG. 6 is a diagram showing a process of constructing a recombinant expression plasmid pCD22Ig expressing a concatameric fusion monomeric protein CD2-CD2/Fc according to the present invention;
[0036]FIG. 7 is a map of a recombinant expression plasmid pTR11Ig-Top10' expressing a concatameric fusion monomeric protein TNFR1-TNFR1/Fc according to the present invention;
[0037]FIG. 8 is a map of a recombinant expression plasmid pTR22Ig-Top10' expressing a concatameric fusion monomeric protein TNFR1-TNFR1/Fc according to the present invention;
[0038]FIG. 9 is a map of a recombinant expression plasmid pCD22Ig expressing a concatameric fusion monomeric protein CD2-CD2/Fc according to the present invention;
[0039]FIG. 10 is a map of a recombinant expression plasmid pCT44Ig expressing a concatameric fusion monomeric protein CTLA4-CTLA4/Fc according to the present invention;
[0040]FIG. 11 is a map of a recombinant expression plasmid pTR11Ig-MG expressing a concatameric fusion monomeric protein mgTNFR1-TNFR1/Fc containing four glycosylation motif peptides according to the present invention;
[0041]FIG. 12 is a map of a recombinant expression plasmid pTR22Ig-MG expressing a concatameric fusion monomeric protein mgTNFR2-TNFR2/Fc containing two glycosylation motif peptides according to the present invention;
[0042]FIG. 13 is a map of a recombinant expression plasmid pCD22Ig-MG expressing a concatameric fusion monomeric protein mgCD2-CD2/Fc containing two glycosylation motif peptides according to the present invention;
[0043]FIG. 14 is a map of a recombinant expression plasmid pCT44Ig-MG expressing a concatameric fusion monomeric protein mgCTLA4-CTLA4/Fc containing three glycosylation motif peptides according to the present invention;
[0044]FIG. 15 shows a result of SDS-PAGE of purified concatameric fusion dimeric proteins [TNFR1-TNFR1/Fc]2 and [TNFR2-TNFR2/Fc]2 under reducing or non-reducing conditions;
[0045]FIG. 16 is a graph showing inhibitory effect of the conventional simple fusion dimeric proteins [TNFR1/Fc]2( ) and [TNFR2/Fc]2(◯) and the concatameric fusion dimeric proteins [TNFR1-RNFR1/Fc]2() and [TNFR2-TR2Fc]2(∇) according to the present invention against cytotoxic activity of TNF-alpha;
[0046]FIG. 17 is a graph showing inhibitory effect of the conventional simple fusion dimeric proteins [TNFR1/Fc]2( ) and [TNFR2/Fc)2(◯) and the concatameric fusion dimeric proteins [TNFR1-RNFR1/Fc]2() and [TNFR2-TR2Fc]2(∇) according to the present invention against cytotoxic activity of TNF-beta;
[0047]FIG. 18 is a graph showing inhibitory effect of the conventional simple fusion dimeric protein [CD2/Fc]2( ), the known immunosuppressive agent cyclosporin A () and the concatameric fusion dimeric protein [CD2-CD2/Fc]2(◯) according to the present invention on the proliferation of active T lymphocytes;
[0048]FIG. 19 is a graph showing inhibitory effect of the conventional simple fusion dimeric protein [CTLA4/Fc]2( ), the known immunosuppressive agent cyclosporin A () and the concatameric fusion dimeric protein [CTLA4- CTLA4/Fc]2 (◯) according to the present invention on the proliferation of active T lymphocytes;
[0049]FIG. 20 is a graph showing blood half-life of the conventional simple fusion dimeric protein [TNFR1/Fc]2( ), the concatameric dimeric protein [TNFRI-TNFR1/Fc]2 (◯) and a glycosylated concatameric fusion dimeric protein [mgTNFR1-TNFR1/Fc]2 (∇) according to the present invention;
[0050]FIG. 21 is a graph showing blood half-life of the conventional simple fusion dimeric protein [CD2/Fc]2( ), the concatameric fusion dimeric protein [CD2-CD2/Fc]2 (◯) and a glycosylated concatameric fusion dimeric protein [mgCD2-CD2/Fc]2 (∇) according to the present invention;
[0051]FIG. 22 is a graph showing blood half-life of the conventional simple fusion dimeric protein [CTLA4/Fc]2( ), the concatameric fusion dimeric protein [CTLA4-CTLA4/Fc]2 (◯) and a glycosylated concatameric fusion dimeric protein [mgCTLA4-CTLA4/Fc]2 (∇) according to the present invention; and
[0052]FIG. 23 is a graph showing inhibitory effect of PBS ( ) as a control, the conventional simple fusion dimeric proteins [TNFR1/Fc]2 (.box-solid.) and [TNFR2/Fc]2 (.tangle-solidup.), and concatameric fusion dimeric proteins [TNFR1-TNFR1/Fc]2 (×) and [TNFR2-TNFR2/Fc]2 (Δ) according to the present invention on the induction of collagen-induced arthritis (CIA) in DBA/1 mice.
BEST MODE FOR CARRYING OUT THE INVENTION
[0053]The present invention is generally directed to concatameric proteins, and more particularly, to immunoadhesion molecules. Immunoadhesion molecules are typically formed by fusion of the Fc fragment of immunoglobulin (Ig) to a ligand-binding region of a receptor or an adhesion molecule, and thus have a structure similar to that of an antibody. The typical inununoadhesion molecules known in the art have a structure of an antibody in which the variable region is substituted with a ligand-binding region of a receptor while retaining the Fc fragment. A wide variety of inununoadhesion molecules are suggested in the literature. However, immunoadhesion molecules according to the present invention have different structure with the conventional immunoadhesion molecules, and there is also no prior art predicting or describing preparation of the immunoadhesion molecules according to the present invention.
[0054]Definition of Terms
[0055]For full understanding of the characteristic structure of the immunoadhesion molecules according to the present invention, exact definitions of the terms used in the present invention are given as follows. In general, all, of the technical and scientific terms being not additionally defined in the present invention have meanings commonly used in the art. However, although having meanings commonly used in the art, the following terms are defined to give a clearer understanding of their meanings and make the scope of the present invention clear, as follows.
[0056]The term "immunoglobulin", as used herein, refers to protein molecules being produced in B cells and serving as antigen receptors specifically recognizing a wide variety of antigens. The molecules have a Y-shaped structure consisting of two identical light chains (L chains) and two identical heavy chains (H chains), in which the four chains are held together by a number of disulfide bonds, including the disulfide bridge between the H chains at the hinge region. The L and H chains comprise variable and constant regions. The L chain variable region associates with the H chain variable region, thus producing two identical antigen-binding regions. According to features of the constant regions of H chains, immunoglobulins (Ig) are classified intofive isotypes, A (IgA), D (IgD), E (IgE), G (IgG) and M (IgM). Each subtype possesses unique structural and biological properties. For example, IgG has slightly different Fc structure, compared with other isotypes. In addition; IgG and IgA have a number of subtypes. For example, the human IgG isotype has four subtypes, IgG1, IgG2, IgG3 and IgG4, which have γ1, γ2, γ3 and γ4 H chains, respectively. Biological functions of immunoglobulin molecules, such as complement activation, Fc receptor-mediated phagocytosis and antigen-dependent cytotoxicity, are mediated by structural determinants (complementarity-determining regions) in the Fc region of H chains. Such an Fc region of H chains is used for construction of dimeric proteins according to the present invention, and may be derived from all isotypes and subtypes of immunoglobulin as described above.
[0057]The term "Fe fragment of an immunoglobulin molecule", as used herein, refers to a fragment having no antigen-binding activity and being easily crystallized, which comprises a hinge region and CH2 and CH3 domains, and a portion responsible for binding of an antibody to effector materials and cells. Therefore, the Fc fragment mentioned in the present invention can be different from that described in some literatures, but includes the hinge region. Such description of the Fc fragment is given to supply convenience in describing the present invention, and will be fully understood by those of ordinary skill in the art with, reference to the specification of the present invention and the accompanying drawings.
[0058]The term "biologically active protein", as used herein, refers to a protein, peptide or polypeptide having generally physiological or pharmaceutical activities, which retains a part of its native activities after forming a concatamer or immunoadhesion molecule. The term "biological activity", as used herein, is not limited in meaning to physiological or pharmaceutical activities. For example, some concatamers, such as those containing an enzyme can catalyze a reaction in an organic solvent. Similarly, some high-molecular weight fusion molecules containing concanavalin A or an immunoglobulin molecule are useful as diagnostic agents in laboratories.
[0059]Non-limiting examples of the protein, peptide or polypeptide include hemoglobin, serum proteins (e.g., blood factors including factor VII, VIII and factor IX), immunoglobulin, cytokines (e.g., interleukin), α-, β- and γ-interferon, colony-stimulating agent (e.g., G-CSF and GM-CSF), platelet-derived growth factor (PDGF), and phospholipase activating proteins (PLAPs). Other typical biological or therapeutic proteins include insulin, plant proteins (e.g., lectin and ricin), tumor necrosis factor (TNF) and its related alleles, growth factors (e.g., tissue growth factors and endothelial growth factors such as TGFα or TGFβ), hormones (e.g., follicle-stimulating hormone, thyroid-stimulating hormone, antidiuretic hormone, pigment-concentrating or dispersing hormones and parathyroid hormone, luteinizing hormone-releasing horrnone and its derivatives, calcitonin, calcitonin gene related peptide (CGRP), synthetic enkephalin, somatomedin, erythropoietin, hypothalamus releasing factors, prolactin, chronic gonadotrophin, tissue plasminogen-activating agents, growth hormone-releasing peptide (GIMP), and thymic humoral factor (THF). The immunoglobulins include IgG, IgE, IgM, IgA, IgD and fragments thereof. Some proteins such as interleukin, interferon or colony-stimulating factor may be produced in a non-glycosylated form using DNA recombinant techniques. The non-glycosylated proteins may be useful as biologically active materials in the present invention.
[0060]In addition, the biologically active materials useful in the present invention include any polypeptide, which has bioactivity in vivo. Examples of the biologically active materials include peptides or polypeptides, fragments of an antibody, single chain-binding proteins (see U.S. Pat. No. 4,946,778), binding molecules including fusion polypeptides of antibodies or their fragments, polyclonal antibodies, monoclonal antibodies, and catalytic antibodies. Other examples of the biologically active materials include allergen proteins, such as ragweed, antigen E, honeybee venom, or allergen of mites.
[0061]In addition, the biologically active material useful in the present invention includes enzymes. Examples of the enzymes include carbohydrate-specific enzymes, proteinases, oxidoreductases, transferases, hydrolases, lyases, isomerases, and ligases. In detail, non-limiting examples of the enzymes include asparaginase, arginase, arginine deaminase, adenosine deaminase, peroxide dismutase, endotoxinase, catalase, chymotrypsin, lipase, uricase, adenosine dephosphatase, tyrosinase, and bilirubin oxidase. Examples of the carbohydrate-specific enzymes include glucose oxidase, glucodase, galactosidase, glucocerebrosidase, and glucouronidase.
[0062]The term "proteins involving immune response", as used herein, refers to all proteins mediating cell-to-cell signal transduction during cellular or Immoral immune response and thus activating or suppressing immune response. Immunity is a process of protecting "self" from "non-self" such as bacteria or viruses. Immune response is largely divided into cellular and Immoral immune response, where T and B lymphocytes play the most important role. T cells, mainly -mediating cellular immune response, directly attack and kill virus-infected cells or tumor cells, or help other immune cells by secreting cytokines functioning to induce or activate immune response or inflammation. B cells produce antibodies against non-self foreign materials (antigens) that enter a body, such as bacteria or viruses, and such immune response is called cellular immune response. Cell-to-cell signal transduction is an essential process in both cellular and humoral immune responses, in which a signal molecule, that is, a ligand, interacts with a cell surface receptor acting to transduce a specific signal into a cell.
[0063]Representative examples of the proteins involving the immune response according to the present invention include cytokines, cytokine receptors, adhesion molecules, tumor necrosis factor receptor (TNFR), enzymes, receptor tyrosine kinases, chemokine receptors, other cell surface proteins, and soluble ligands. examples of the cytokines include IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-10, IL-12, IL-17, TNF, TGF, IFN, GM-CSF, G-CSF, EPO, TPO, and M-CSF. Examples of the cytokine receptors, but are not limited to, include growth hormone receptors (GHRs), IL-13R, IL-1R, IL-2R, 1L-3R, IL-4R, IL-5R, IL-6R, IL-7R, IL-9R, IL-15R, TNFR, TGFR, IFNR (e.g., IFN-γ R α-chain and IFN-γ R β-chain), interferon-α R, -β R and -γ R, GM-CSFR, G-CSFR, EPOR, cMpl, gp130, and Fas (Apo 1). Non-limiting examples of the enzymes include influenza C hemaglutinin esterase and urokinase. The chemokine receptors are exemplified by CCR1 and CXCR1-4. Examples of the receptor tyrosine kinases, but are not limited to, include TrkA, TrkB, TrkC, Htk, REK7, Rse/Tyro-3, hepatocyte growth factor R, platelet-derived growth factor R, and Flt-1. Examples of other cell surface proteins includes CD2, CD4, CD5, CD6, CD22, CD27, CD28, CD30, CD31, CD40, CD44, CD100, CD137, CD150, LAG-3, B7, B61, β-neurexin, CTLA-4, ICOS, ICAM-1, complement R-2 (CD21), IgER, lysosomal membrane gp-1, α2-microglobulin receptor-related proteins, and sodium-releasing peptide R. Non-limiting examples of the soluble ligands include IL-10, heregulin, and keratinocyte growth factors.
[0064]Ligands for the proteins involving immune response according to the present invention and use thereof are well known to those of ordinary skill in the art, as summarized in Tables 1 to 7, below.
TABLE-US-00001 TABLE 1 Proteins involving immune response: Adhesion molecules Adhesion molecules Ligands Uses CD4 HIV gp120 Inhibition of in vivo HIV infection; and identification of CD4 domain participating in ligand binding L-Selectin GlyCAM-1, CD34 Prevention of neutrophile-mediated lung damage; determination of position in tissues of a ligand by histochemical staining; and isolation and cloning of ligands and determination of their properties E-Selectin Sialyl Lewisx Prevention of neutrophile-mediated long damage; and determination of thermodynamic properties in ligand-binding P-Selectin Sialyl Lewisx Prevention of neutrophile-mediated lung damage; and study of functions of individual of amino acid residues in binding to cell surface ICAM-1 CD11a/CD18 Phagocytosis of erythrocytes in malaria; inhibition of infection with rhinovirus; and anti-inflammation in diabetes ICAM-2 CD11a/CD18 Study of activation of T cells mediated by T cell receptor ICAM-3 CD11a/CD18 Identification of receptor domains binding to a ligand VCAM-1 VLA-4 Study of role of VLA-4 in T lymphocyte migration to dermal inflammation sites LFA-3 CD2 Study of role of CD2 in costimulation of T cells L1 Fibroblast growth factor Stimulation of nerve reproduction after repair; and functional glycoprotein receptor comparison with FGF
TABLE-US-00002 TABLE 2 Proteins involving immune response: Enzymes Enzymes Ligands Uses Influenza C 9-0-acetylated Inactive enzyme used in study of hemaglutinin sialic acid tissue-specific expression of esterase ligands Urokinase Urokinase Inactive enzyme developed to receptor inhibit cancer metastasis by disturbing urokinase activation
TABLE-US-00003 TABLE 3 Proteins involving immune response: Cytokine receptors Cytokine receptors Ligands Uses IFN-γ R IFN-γ Inhibition of IFN-mediated autoimmunity α-chain IFN-γ R IFN-γ Study of structure of submits of a ligand-receptor complex β-chain IL1R IL-1 Inhibition of IL-1-mediated inflammation IL4R IL-4 Identification of receptor domains participating in ligand binding Erythropoietin R Erythropoietin Map design of epitopes of anti-ligand antibodies cMp1 Thrombopoietin Isolation and cloning of ligands gp130 IL-6-IL6R Study of structure of subunits of a ligand-receptor complex complex
TABLE-US-00004 TABLE 4 Proteins involving immune response: Tumor necrosis factor receptors TNF receptors Ligands Uses TNF R-1 TNF, Treatment of septic shock, rheumatoid arthritis and other inflammatory lymphotoxin-α diseases; and identification of domains participating in ligand binding TNF R-2 TNF, Inhibition of TNF-enriched HIV replication; and prevention of lymphotoxin-α collagen-induced arthritis in mice Lymphotoxin- Lymphotoxin-β Study of structure of subunits of cell surface lymphotoxin-β β R Fas/Apo-1/ Fas/Apo-1/ Treatment of excessive apoptosis and related diseases (e.g., AIDS); CD95 CD95 ligand and resistance to apoptosis of lymphocytes and peripheral immune tolerance; roles of Fas ligand in T cell-mediated cytotoxicity; and isolation and cloning of ligands CD27 CD27 ligand Isolation and cloning of ligands CD30 CD30 ligand Isolation and cloning of ligands CD40 gp39 Isolation and cloning of ligands 4-1BB 4-1BB ligand Identification of tissues containing ligands by histochemical staining; isolation and cloning of ligands; and Study of structural determinant of potential ligand OX40 gp34 Isolation and cloning of ligands
TABLE-US-00005 TABLE 5 Proteins involving immune response: Receptor tyrosine kinases Receptor tyrosine tinases Ligands Uses TrkA, B, C Neutropin Determination of properties of neutropin binding Htk Htk ligand Isolation and cloning of ligands REK7 AL-1 Isolation and cloning of ligands Rse/Tyro-3 Protein S, Gas6 Identification of ligands and determination of their properties Hepatocyte growth Hepatocyte growth Identification of receptor factor R factor domains participating in ligand binding Platelet-derived Platelet-derived Identification of receptor growth factor R growth factor domains participating in ligand binding Flt-1 Vesicular Determination of properties endothelial of ligand binding of growth receptors factor (VEGF) Flk-1/KDR VEGF Evaluation of selectivity of receptors for VEGF versus placenta growth factor
TABLE-US-00006 TABLE 6 Proteins involving immune response: Other cell surface proteins Other cell surface proteins Ligands Uses B7 CD28 Study of T cell stimulation by B cells B61 Eck Roles of Eck in inflammation β-neurexin β-neurexin Determination of properties of a signal sequence from β- ligand neurexin CD2 LFA-3, CD48 Identification of ligands CD5 CD5 ligand Study of T cell stimulation by B cells CD6 ALCAM Study of binding activities of cloned ligands CD22 CD45, other Identificaiotn of ligands; study on roles of CD22 in T-B- sialoglyco- cell interaction; and determination of properties of binding proteins determinants of sialo-oligo sugar ligands CD28 B7, B7-2 Study of T cell stimulation by B cells CD31 CD31 Identification of CD31 domains related to homotype binding CD44 Hyaluronate Screening of tissues containing ligands by histochemical staining; and determination of properties of structural determinants of ligands Complement R-2 C3 fragment Inhibition of reactivity of antibody to immunosuppressive (CD21) and cancer therapeutic agents CTLA-4 B7 Identification of CTLA-4 as a secondary receptor of B7 IgE R IgE Inhibition of mast cell-binding of IgE as therapy of allergic diseases Lisosome membrane LAMP-1 ligand Design of epitope maps of anti-ligand antibodies gp-1 α2-microglobulin gp330 Determination of position of ligands in tissues by receptor-bound histochemical staining proteins Sodium-releasing Sodium- Design of epitope maps of anti-ligand antibodies; and peptide R releasing preparation of recombinant receptors for structural study peptide
TABLE-US-00007 TABLE 7 Proteins involving immune response: Soluble ligands Soluble ligands Ligands Uses IL-2 IL-2R Extension of half-life of IL-2 in the circulation system IL-10 IL-10R Therapy of septic shock and transplantation rejection; and extension of half-life of IL-10 in the circulation system Heregulin Her4/p180.sup.erbB4 Study of signal transduction by Her4 Keratinocyte Keratinocyte Determination of position of growth factor growth receptors by histochemical factor R staining
[0065]The term "soluble extracellular domain", as used herein, refers to a portion exposed to the extracellular region of an integral membrane protein penetrating the cell membrane comprising phospholipid, wherein the integral membrane protein contains one or more transmembrane domain made up predominantly of hydrophobic amino acids. Such an extracellular domain mainly comprises hydrophilic amino acids, which are typically positioned at the surface of a folded structure of a protein, and thus is soluble in an aqueous environment. For most cell surface receptor proteins, extracellular domains serve to bind specific ligands, while intracellular domains play an important role in signal transduction.
[0066]The term "concatamer-linked", as used herein, refers to a state in which two soluble domains of biologically active proteins are linked and thus form a long polypeptide.
[0067]The term "concatameric protein", as used herein, means a concatamer-linked protein. For example, the N-terminus of a soluble extracellular domain of a protein involving immune response is linked to the C-terminus of an identical soluble extracellular domain of the protein involving immune response, wherein the C-terminus of the former soluble extracellular domain is linked to the hinge region of an Fc fragment of an immunoglobulin molecule. Thus, two identical soluble extracellular domains of a protein involving immune response form a long polypeptide.
[0068]The term "simple fusion monomeric protein", as used herein, refers to a fusion protein having a monomeric structure consisting of a single polypeptide formed by linkage of a soluble extracellular domain of a protein involving immune response to the hinge region of an Fc fragment of an immunoglobulin molecule. A simple fusion monomeric protein may be designated "protein name/Fc" for convenience in the present invention. For example, a simple fusion monomeric protein produced by linkage of an soluble extracellular domain of TNFR1 protein involving immune response to an Fc fragment of an immunoglobulin molecule is designated TNFR1/Fc. If desired, the origin of the Fc fragment may be also specified in the designation. For example, in the case that the Fc fragment is derived from IgG1, the monomeric protein is called TNFR1/IgG1Fc.
[0069]The term "simple fusion dimeric protein", as used herein, refers to a fusion protein having a dimeric structure, in which two-simple fusion monomeric proteins are joined by formation of intermolecular disulfide bonds at the hinge region. Such a simple fusion dimeric protein may be designated "[protein name/Fc]2" for convenience in the present invention. For example, when fused by formation of intermolecular disulfide bonds at the hinge region of two simple fusion monomeric proteins produced by linkage of an soluble extracellular domain of TNFR1 protein and an Fc fragment of an immunoglobulin molecule, the resulting fusion protein having dimeric structure is designated [TNFR1/Fc]2. In addition, the origin of the Fc fragment may be specified in the designation, if desired. For example, in the case that the Fc fragment is derived from IgG1, the dimeric protein is designated [TNFR1/IgG1Fc]2.
[0070]The term "concatameric fusion monomeric protein", as used herein, refers to a fusion protein having a monomeric structure consisting of a single polypeptide, in which the N-terminus of a soluble extracellular domain of a protein involving immoneresponse is linked to the C-terminus of an identical soluble extracellular domain of the protein involving immune response, wherein the C-terminus of the former soluble extracellular domain is linked to the hinge region of an Fc fragment of an immunoglobulin molecule. A concatameric fusion monomeric protein may be designated "protein name-protein name/Fc". for convenience in the present invention. For example, when an soluble extracellular domain of TNFR1 of a simple fusion monomeric protein, produced by linkage of the soluble extracellular domain of TNFR1 protein involving immune response and an Fc fragment of an immunoglobulin molecule, is linked to an identical soluble extracellular domain of TNFR1, the resulting concatameric fusion monomeric protein is designated TNFR1-TNFR1/Fc. If desired, the origin of the Fc fragment may be specified in the designation. For example, in the case that the Fc fragment is derived from IgG1, the monomeric protein is designated TNFR1-TNFR1/IgG1Fc.
[0071]The term "concatameric fusion dimeric protein", as used herein, refers to a fusion protein having a dimeric structure, in which two concatameric fusion monomeric proteins are fused by formation of intermolecular disulfide bonds at the hinge region. A concatameric fusion dimeric protein may be designated "[protein name-protein name/Fc]2" for convenience in the present invention. For example, when two concatameric fusion monomeric proteins, each of which is produced by linkage of a TNFR1 soluble extracellular domain of a simple fusion monomeric protein to an identical soluble extracellular domain of TNFR1 protein involving immune response, are fused by formation of intermolecular disulfide bonds at the hinge region, the resulting fusion protein having dimeric structure is designated [TNFR1-TNFR1/Fc]2, wherein the simple fusion monomeric protein is formed by linkage of the TNFR1 soluble extracellular domain to an Fc fragment from an immunoglobulin molecule. If desired, the origin of the Fc fragment may be specified in the designation. For example, in the case that the Fc fragment is derived from IgG1, the fusion protein is designated [TNFR1-TNFR1/IgG1Fc]2.
[0072]The term "vector", as used herein, means a DNA molecule serving as a vehicle capable of stably carrying exogeneous genes into host cells. For useful application, a vector should be able to replicate, have a system for introducing itself into a host cell, and possess selectable markers. The exogeneous genes, for example, include, a DNA construct encoding a concatameric fusion monomeric protein.
[0073]The term "recombinant expression plasmid", as used herein, refers to a circular DNA molecule carrying exogeneous genes operably linked thereto to be expressed in a host cell. When introduced into a host cell, the recombinant expression plasmid has the ability to replicate regardless of host chromosomal DNA, copy itself at a high copy number, and to produce heterogeneous DNA. As generally known in the art, in order to increase the expression level of a transfected gene in a host cell, the gene should be operably linked to transcription and translation regulatory sequences functional in a host cell selected as an expression system. Preferably, the expression regulation sequences and the exogeneous genes may be carried in a single expression vector containing bacteria-selectable markers and a replication origin. In case that eukaryotic cells are used as an expression system, the expression vector should further comprise expression markers useful in the eukaryotic host cells.
[0074]The term "operably linked", as used herein, means an arrangement of elements of a vector, in which each element is capable of performing its innate function. Therefore, a control sequence operably linked to a coding sequence can influence expression of the coding sequence. A control sequence acting to induce expression of a coding sequence does not have to be adjacent to the coding sequence. For example, when an intervening sequence is present between a promoter sequence and a coding sequence, the promoter sequence may still be "operably linked" to the coding sequence.
[0075]Host cells used in the present invention may be prokaryotic or eukaryotic. In addition, host cells having high introduction efficiency of foreign DNA and having high expression levels of an introduced gene may be typically used. Examples of the host cells useful in the present invention include prokaryotic and eukaryotic cells such as E. coli, Pseudomonas sp., Bacillus sp., Streptomyces sp., fungi or yeast, insect cells such as Spodoptera frugiperda (Sf9), animal cells such as Chinese hamster ovary cells (CHO) or mouse cells, African green monkey cells such as COS 1, COS 7, human embryonic kidney cells, BSC 1, BSC 40 or BMT 10, and tissue-cultured human cells. When cloning a DNA construct encoding the fusion protein according to the present invention, host cells are preferably animal cells. When using COS cells, since SV40 large T antigen is expressed in COS cells, a plasmid carrying a SV 40 replication origin may be present as a multicopy episome and thus allows high expression of an exogeneous gene. A DNA sequence introduced into a host cell may be homogeneous or heterogeneous to the host cell, or a hybrid DNA sequence containing a homogenous or heterogeneous DNA sequence.
[0076]In order to express a DNA sequence encoding the concatameric fusion protein according to the present invention, a wide variety of combinations of host cells as an expression system and vectors may be used. Expression vectors useful for transforming eukaryotic host cells contain expression regulation sequences from, for example, SV40, bovine papillomavirus, adenovirus, adeno-associated viruses, cytomegalovirus and retroviruses. Expression vectors useful in bacterial host cells include bacterial plasmids from E. coli, which are exemplified by pBluescript, pGEX2T, pUC, pCR1, pBR322, pMB9 and derivatives thereof, plasmids having a broad range of host cells, such as RP4, phage DNAs, exemplified by a wide variety of phage derivatives including λ gt10, λ gt11 and NM989, and other DNA phages, exemplified by filamentous single-stranded DNA phages such as M13. Expression vectors useful in yeast cells include 2μ plasmid and derivatives thereof. Expression vectors useful in insect cells include pVL 941.
[0077]The term "transformation", as used herein, means introducing DNA into a suitable host cell so that the DNA is replicable, either as an extrachromosomal element, or by chromosomal integration.
[0078]The term "transfection", as used herein, refers to the taking up of an expression vector by a suitable host cell, whether any coding sequences are in fact expressed or not.
[0079]The term "signal sequence", as used herein, means an amino acid sequence mediating transport of an expressed protein to the outside of the cell membrane, and is also called a "leader sequence". Cell surface proteins or secretory proteins, which are transported to the outside of the cell membrane, have an N-terminal sequence typically cut by signal peptidase in the cell membrane. Such a N-terminal sequence is called a signal sequence or signal peptide, or a leader sequence or leader peptide. Secretory (or transported) proteins or all proteins present outside of the cell membrane or in the extracellular environment have a specific signal sequence. There is no specific homology between such signal sequences and same proteins have different signal sequences according to their origin. Secondary structure or distribution of nonpolar and charged residues is more important for proper function of the signal sequences than primary structures thereof. Although not having specific homology, the signal sequences share several common features, as follows. The signal sequences contain an N domain at their N-termini, which is a hydrophilic region comprising one or more positively charged residues, and an H-domain follows the N domain, which is a somewhat long hydrophobic region. In the case. of E. coli, the signal sequence comprises about 18-30 amino acids. The N domain contains many cationic amino acids such as Lys or Arg, and thus has a net positive charge. Many hydrophobic amino acids such as Ala or Leu are found in the H domain, and polar or charged amino acids such as Pro, Lys, Mg, Asn or Glu are rarely in the H domain. A large number of amino acids such as Ala and Leu residues form an a-helical structure to facilitate membrane penetration. A C domain is positioned between the H domain and an actually secreted portion of a protein. The C domain is less hydrophobic, and contains a sequence capable of being recognized by signal peptidase such as LebB or LspA. There have been no reports about an exact site cleaved by the signal peptidase, but the signal peptidase is typically known to mostly cleave behind the Ala-X-Ala sequende in the C domain. Preproteins containing the above-mentioned signal sequence arrive at the cell membrane through interaction with several proteins, and fold to their mature forms through cleavage of a specific region of a signal peptide. Such a signal sequence is very important in strategies to express a desired protein on the cell surface or in the extracellular environment. Foreign proteins and fusion proteins should be stably transported to the extracellular environment at high efficiency. Typically, cell surface proteins having excellent secretory ability are useful for cell surface expression of foreign proteins or fusion proteins, which typically have secretory signal sequences capable of offering excellent secretion efficiency.
[0080]Preparation of the Concatameric Fusion Dimeric Protein According to the Present Invention
[0081]The concatameric fusion dimeric protein according to the present invention is generally prepared by (a) preparing a DNA construct encoding a simple fusion monomeric protein using a gene encoding an Fc fragment of an immunoglobulin molecule and a gene encoding a soluble extracellular domain of a protein involving immune response; (b) inserting by polymerase chain reaction (PCR) a recognition sequence of a restriction enzyme into the prepared simple fusion monomeric protein-encoding DNA construct and an identical gene to the gene encoding a soluble extracellular domain of a protein involving immune response, respectively; (c) cleaving the recognition sequence of a restriction enzyme in the simple fusion monomeric protein-coding DNA construct and the gene encoding a soluble extracellular domain of a protein involving immune response using the restriction enzyme recognizing the recognition sequence; (d) ligating the cleaved DNA fragments using ligase to produce a DNA construct encoding a concatameric fusion monomeric protein (see, FIG. 2); (e) operably linking the prepared DNA construct encoding a concatameric fusion monomeric protein to a vector to produce a recombinant expression plasmid; (f) transforming or transfecting a host cell with the recombinant expression plasmid; and (g) culturing the transformant or transfectant under conditions suitable for expression of the DNA construct encoding a concatameric fusion monomeric protein and then isolating and purifying a concatameric fusion dimeric protein of interest.
[0082]A DNA fragment encoding a soluble extracellular domain of a protein involving immune response is produced by PCR using a primer containing a recognition sequence of a specific restriction enzyme and a sequence encoding a leader sequence, and a primer containing an antisense sequence encoding the 3' end of the soluble extracellular domain and a portion of the 5' end of a specific region of Fc fragment of an immunoglobulin molecule.
[0083]A DNA fragment encoding a specific region of the Fc fragment of an immunoglobulin molecule is produced by PCR using a primer having a sequence encoding a portion of the 3' end of the soluble extracellular domain of the protein involving immune response and a sequence encoding the 5' end of the specific region of the Fc fragment of an immunoglobulin molecule, and another primer having an antisense sequence encoding a recognition sequence of a specific restriction enzyme and the 3' end of a specific region of the Fc fragment of an immunoglobulin molecule.
[0084]The DNA fragment encoding a soluble extracellular domain of a protein involving the immune response and the DNA fragment encoding a specific region of Fc fragment of an immunoglobulin molecule, as described above, are mixed in a test tube. After denaturation, the DNA is re-annealed. Then, a complete double-stranded DNA fragment is produced by polymerization using DNA polymerase at the 3' end of each DNA hybrid. Using the resulting double-stranded DNA fragment, another polymerase chain reaction (PCR) is carried out with the primer having a sequence encoding a soluble extracellular domain of a protein involving immune response and the primer encoding the 3' end of a specific region of the Fc fragment of an immunoglobulin molecule, in order to amplify a immunoglobulin fusion gene comprising a sequence corresponding to the DNA fragment encoding a soluble extracellular domain of a protein involving immune response and a sequence corresponding to the DNA fragment encoding a specific region of the Fc fragment of an immunoglobulin molecule.
[0085]An recognition sequence of a restriction enzyme is introduced by PCR into the amplified immunoglobulin fusion gene and the DNA fragment having a sequence encoding a soluble extracellular domain of a protein involving the immune response. The recognition sequence is then cleaved with the restriction enzyme and the cleaved regions are ligated using ligase, thus producing a concatameric immunoglobulin fusion gene.
[0086]The immunoglobulin fusion gene may further include a signal sequence to stimulate extracellular secretion of a protein encoded thereby. For example, the CTLA-4 molecule contains a unique leader sequence having highly hydrophilic redundancy at its N-terminus, and which is abnormally long and highly water-soluble (Harper, K. et al., J. Immunol. 147:1037-1044; and Brunet, J. F. Nature 328:267-270, 1987). Generally, most cell surface proteins or secretory proteins have a leader sequence comprising 20-24 highly hydrophobic amino acids at their N-termini. However, the CTLA-4 molecule used in the present invention comprises a total of 37 residues: 16 hydrophilic amino acids at its N-terminus, and 21 highly hydrophobic amino acids typical in its transmembrane regions. In the conventional method of preparing CTLA4Ig fusion proteins, the leader sequence of the CTLA-4 molecule was substituted with a leader sequence of oncostatin M (Linsley, P. S. et al., J. Exp. Med. 174:561-569, 1991) or IL-6 (Yamada, A, et al., Microbiol. Immunol. 40:513-518, 1996). The present inventors demonstrated that a CTLA-4 molecule containing a leader sequence having a "MRTWPCTLLFFIPVFCKA" sequence instead of the amino acid sequence consisting of 16 amino acids, "ACLGFQRHKAQKNLAA", is preferable, and the secretion of an expressed protein to the extracellular environment is easily achieved, as disclosed in International Pat. Publication No. WO98/31820, of which content is incorporated herein as reference.
[0087]A recombinant expression plasmid is prepared by inserting the immunoglobulin fusion gene into a vector, and then introduced to a host cell to produce a transformant or transfectant. A concatameric fusion dimeric protein of interest may be obtained by culturing the transformant or transfectant cell and isolating and purifying a concatameric fusion protein.
[0088]A host cell useful for preparation of the concatameric fusion dimeric protein according to the present invention is preferably selected from among bone marrow cell lines, CHO cells, monkey COS cells, human embryonic kidney 293 cells, and baculovirus-infected insect cells. A polypeptide of interest, produced in such an expression system, is secreted to culture medium as an inclusion body. Then, the concatameric fusion dimeric protein can be purified by affinity chromatography using a protein A or protein G column. In fact, effective mammalian expression systems and such purification systems are very useful in expressing proteins involving immune response in a dimeric form, and isolation of such proteins.
[0089]Preparation of the Glycosylated Concatameric Fusion Dimeric Protein According to the Present Invention
[0090]Secretory proteins produced in eukaryotic cells as host cells are modified by glycosylation. Glycosylation is known to influence in vivo stability and functionality as well as physical properties of a protein. Therefore, a preferred aspect of the present invention includes facilitating production of a concatameric fusion dimeric protein of interest using recombinant DNA techniques and the above-mentioned animal cell lines as host cells, and linking additional sugar chains to a soluble extracellular domain of a protein involving immune response.
[0091]Two glycosylation patterns are known. One is O-linked glycosylation, in which an oligosaccharide is linked to a serine or threonine residue, and the other is N-linked glycosylation, in which an oligosaccharide is linked to asparagine residue. N-linked glycosylation occurs at a specific amino acid sequence, particularly, Asn-X-Ser/Thr, wherein X is any amino acid excluding proline. N-linked oligosaccharide has a structure distinct from O-linked oligosaccharide, and glycosylated residues found in the N-linked type also differ from the O-linked type. For example, N-acetylgalactosamine is invariably linked to serine or threonine in O-linked oligosaccharide, while N-acetylglucosamine is linked to asparagines in all of N-linked oligosaccharides. The O-linked oligosaccharides generally contain only 1-4 sugar residues: In contrast, the N-linked oligosaccharides comprise 5 or more sugar residues, essentially including N-acetylglucosamine and mannose.
[0092]In accordance with the present invention, to allow additional O-linked or N-linked glycosylation, one or more nucleotides in a DNA sequence encoding a soluble extracellular domain of a protein involving immune response are altered, and the resulting DNA is expressed in a suitable animal host cell to induce glycosylation using the host system. In accordance with an aspect of the present invention, the glycosylated concatameric fusion dimeric protein according to the present invention may be prepared by altering a DNA sequence encoding a soluble extracellular domain of a protein involving immune response to induce or increase N-linked glycosylation by adding the sequence Asn-X-Ser/Thr.
[0093]Alteration of a DNA sequence to introduce glycosylation may be performed according to the conventional method common in the art. In a preferred aspect of the present invention, to protect the concatameric fusion protein, especially the two soluble extracellular domains, from attack of intercellular proteinases and thus increase its half-life in serum, a DNA construct encoding a multiglycosylated concatameric fusion monomeric protein may be prepared using PCR, which introduces multiglycosylation sites to the joint region between two soluble extracellular domains. In a specific aspect of the present invention, glycosylation motif peptide sequences may be introduced into the concatameric fusion protein, as follows. A DNA fragment is prepared by performing PCR using a primer encoding a leader sequence of a soluble extracellular domain and EcoRI restriction site, and an antisense primer in which a portion of a nucleotide sequence encoding a portion of the 3' end of a first soluble extracellular domain and a portion of the 5' end of a second soluble extracellular domain is substituted with glycosylation motif sequences. Another DNA fragment is prepared by performing PCR using a primer in which a portion of a nucleotide sequence encoding a portion of the 3' end of a first soluble extracellular domain and a portion of the 5' end of a second soluble extracellulular domain is substituted with glycosylation motif sequences, and an antisense primer encoding the 3' end of Fc portion of IgG1 and XbaI restriction site. Then, secondary PCR is carried out in a test tube using the two DNA fragments.
[0094]In accordance with an embodiment of the present invention, the soluble extracellular domains useful in the present invention include soluble extracellular domains of TNFR1, TNFR2, CD2 and CTLA-4. Their application will be described in detail with reference to accompanying figures, sequence listing and examples.
[0095]Tumor necrosis factor-alpha (TNF-α), which is known as the hormone cachectin, and tumor necrosis factor-beta (TNF-β), which is also known as lymphotoxin, are multifunctional cytokines, inducing inflammation, cellular immune response, septicemia, cytotoxicity, cachexia, rheumatoid arthritis, inflammation-related diseases (Tartaglia, L. A. et al., Immunol. Today 13:151,1992), and antiviral reaction (Butler, P., Peptide Growth Factor II, 1990, Springer-Verlag, Berlin, pp. 39-70). Such actions of TNF-α and TNF-β, including cytotoxic activity, originate from their binding to TNF receptors in a trimeric form (Eck, M. J. et al., J. Biol. Chem. 267:2119, 1992). As TNF receptors, 55 kDa-type I (TNFR1 or p55) and about 75 kDa-type (TNFR2 or p75) are known (Smith, C. A. et al., Science 248:1019, 1990; Loetscher, H. et al., Cell 61:351, 1990; and Schall et al., Cell 61:361, 1990). The two receptors have similar affinity for TNF-α and TNF-β (Schall et al., Cell 61:361, 1990). Immunoglobulin fusion proteins of such soluble receptors have effects of inhibiting the action of TNF-α and TNF-β by inhibiting binding of TNF-α and INF-β to their receptors on the cell surface, which is known to be effective in reducing TNF-dependent inflammation.
[0096]Among cell surface antigens regulating immune response, the costimulatory molecule CD2 and CTLA-4, inducing secondary stimulation to give sufficient activation of T cells, when being in a soluble form, also can be used for therapy of diverse immunological diseases according to the same method as TNF receptors. Immune response is accomplished by binding of cell surface antigen molecules of antigen presenting cells (APC) to specific receptors of T lymphocytes, that is, T lymphocytes and leukocyte-function-antigen molecules of APC, and when a costimulatory signal as a secondary signal is not produced during antigen-presenting, T lymphocytes are removed by apoptosis or inhibition of clonal activation. CD2 is a leukocyte-function-antigen on. T lymphocytes, binding to LFA-3 on APC, and participates in adhesion and costimulation of leukocytes, as well as stimulating T cell activation through costimulation with CD28. CTLA-4 is expressed after activation of T lymphocytes, and its expression level is increased in the resting phase. CTLA-4 has a binding affinity to the B7 molecule of APC over 20 times higher than that of CD28, and transduces signals inhibiting T lymphocyte activation after binding to B7.
[0097]In a specific aspect of the present invention, there are provided a concatameric fusion monomeric protein TNFR1-TNFR1/Fc, designated by SEQ ID NO: 6; a concatameric fusion monomeric protein TNFR2-TNFR2/Fc, designated by SEQ ID NO: 8; a concatameric fusion monomeric protein CD2-CD2/Fc, designated by SEQ ID NO: 18; and a concatameric fusion monomeric protein CTLA4-CTLA4/Fc, designated by SEQ ID NO: 20.
[0098]In another specific aspect of the present invention, there are provided a DNA construct (TNFR1-TNFR1-IgG) encoding a concatameric fusion monomeric protein TNFR1-TNFR1/Fc, designated by SEQ ID NO: 5; a DNA construct (TNFR2-TNFR2-IgG) encoding a concatameric fusion monomeric protein TNFR2-TNFR2/Fc, designated by SEQ ID NO: 7; a DNA construct (CD2-CD2-IgG) encoding a concatameric fusion monomeric protein CD2-CD2/Fc, designated by SEQ ID NO: 17; and a DNA construct (CTLA4-CTLA4-IgG) encoding a concatameric fusion monomeric protein CTLA4-CTLA4/Fc, designated by SEQ ID NO: 19.
[0099]In a further specific aspect of the present invention, there are provided a recombinant expression plasmid pTR11Ig-Top10' operably linked to a DNA construct encoding a concatameric fusion monomeric protein TNFR1-TNFR1/Fc, designated by SEQ ID NO: 5; a recombinant expression plasmid pTR22Ig-Top10' operably linked to a DNA construct encoding a concatameric fusion monomeric protein TNFR2-TNFR2/Fc, designated by SEQ ID NO: 7; a recombinant expression plasmid pCD22Ig operably linked to a DNA construct encoding a concatameric fusion monomeric protein CD2-CD2/Fc, designated by SEQ ID NO: 17; and a recombinant expression plasmid pCT44Ig operably linked to a DNA construct encoding a concatameric fusion monomeric protein CTLA4-CTLA4/Fc, designated by SEQ ID NO: 19. The recombination expression plasmids are deposited in Korean Culture Center of Microorganisms (KCCM) and are assigned accession Nos. KCCM-10288, KCCM-10291, KCCM-10402 and KCCM-10400, respectively. The KCCM deposit will be maintained under the terms of the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purposes of Patent Procedure.
[0100]In a further specific aspect of the present invention, there are provided a mammalian host cell (e.g., TR11Ig-CHO) transformed or transfected with a recombinant expression plasmid pTR11Ig-Top10' operably linked to a DNA construct encoding a concatameric fusion monomeric protein TNFR1-TNFRI/Fc, designated by SEQ ID NO: 5; a mammalian host cell (e.g., TR22Ig-CHO) transformed or transfected with a recombinant expression plasmid pTR22Ig-Top10' operably linked to a DNA construct encoding a concatameric fusion monomeric protein TNFR2-TNFR2/Fc, designated by SEQ ID NO: 7; a mammalian host cell transformed or transfected with a recombinant expression plasmid pCD22Ig operably linked to a DNA construct encoding a concatameric fusion monomeric protein CD2-CD2/Fc, designated by SEQ ID NO: 17; and a mammalian host cell transformed or transfected with a recombinant expression plasmid pCT44Ig operably linked to a DNA construct encoding a concatameric fusion monomeric protein CTLA4-CTLA4/Fc, designated by SEQ NO: 19. Chinese hamster ovary cell line TR11Ig-CHO transfected with the recombinant expression plasmid pTR11Ig-Top10' and Chinese hamster ovary cell line TR22Ig-CHO transfected with the recombinant expression plasmid pTR22Ig-Top10' are deposited in KCCM and are assigned accession Nos. KCLRF-BP-00046 and KCLRF-BP-00047, respectively. The KCCM deposit will be maintained under the terms of the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purposes of Patent Procedure.
[0101]In a still further specific aspect of the present invention, there are provided a concatameric fusion monomeric protein mgTNFR1-TNFR1/Fc containing glycosylation motif peptides, designated by SEQ ID NO: 10; a concatameric fusion monomeric protein mgTNFR2-TNFR2/Fc containing glycosylation motif peptides, designated by SEQ ID NO: 12; a concatameric fusion monomeric protein mgCD2-CD2/Fc containing glycosylation motif peptides, designated by SEQ ID NO: 22; and a concatameric fusion monomeric protein mgCTLA4-CTLA4/Fc containing glycosylation motif peptides, designated by SEQ ID NO: 24.
[0102]In a still further specific aspect of the present invention, there are provided a DNA construct encoding a concatameric fusion monomeric protein mgTNFR1-TNF'R1/Fc containing glycosylation motif peptides, designated by SEQ ID NO: 9; a DNA construct encoding a concatameric fusion monomeric protein mgTNFR2-TNFR2/Fc containing glycosylation motif peptides, designated by SEQ ID NO: 11; a DNA construct encoding a concatameric fusion monomeric protein mgCD2-CD2/Fc containing glycosylation motif peptides, designated by SEQ ID NO: 21; and a DNA construct encoding a concatameric fusion monomeric protein mgCTLA4-CTLA4/Fc containing glycosylation motif peptides, designated by SEQ ID NO: 23. In order to produce a glycosylation motif peptide, a primer set (forward and reverse primers) is designed, which are complementary to a nucleotide sequence corresponding to the joint region between soluble extracellular domains of concatameric fusion proteins of TNFR/Fc, CD2/Fc and CTLA4/Fc, as well as containing codons encoding asparagine (N) (ATT. and AAC) or codons encoding serine (S) and threonine (T) (TCC; and ACC, ACG and ACA, respectively), with which any codon in the concatameric fusion protein gene may be substituted. When designing the primer, selection of one among a plurality of amino acid sequences may be determined depending on a condition allowing minimum substitution of the nucleotide sequence and melting temperature (Tm) of each primer.
[0103]In a still further specific aspect of the present invention, there are provided a recombinant expression plasmid pTR11Ig-MG operably linked to a DNA construct encoding a concatameric fusion monomeric protein mgTNFR1-TNFR1/Fc containing glycosylation motif peptides, designated by SEQ ID NO: 9; a recombinant expression plasmid pTR22Ig-MG operably linked to a DNA construct encoding a concatameric fusion monomeric protein mgTNFR2-1'NFR2/Fc containing glycosylation motif peptides, designated by SEQ ID NO: 11; a recombinant expression plasmid pCD22Ig-MG operably. linked to a DNA construct encoding a concatameric fusion monomeric protein mgCD2-CD2/Fc containing glycosylation motif peptides, designated by SEQ ID NO: 21,; and a recombinant expression plasmid Pct44Ig-MG operably linked to a DNA construct encoding a concatameric fusion monomeric protein mgCTLA4-CTLA4/Fc containing glycosylation motif peptides, designated by SEQ ID NO: 23. The recombination expression plasmids are deposited in Korean Culture Center of Microorganisms (KCCM) and are assigned accession Nos. KCCM-10404, KCCM-10407, KCCM-10401 and KCCM-10399, respectively. The KCCM deposit will be maintained under the terms of the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purposes of Patent Procedure.
[0104]In a still further specific aspect of the present invention, there are provided a mammalian host cell transformed or transfected with a recombinant expression plasmid pTR11Ig-MG operably linked to a DNA construct encoding a concatameric fusion monomeric protein mgTNFR1-TNFR1/Fc containing glycosylation motif peptides, designated by SEQ ID NO: 9; a mammalian host cell transformed or transfected with a recombinant expression plasmid pTR22Ig-MG operably linked to a DNA construct encoding a concatameric fusion monomeric protein mgTNFR2-TNFR2/Fc containing glycosylation motif peptides, designated by SEQ ID NO: 11; a mammalian host cell transformed or transfected with a recombinant expression plasmid pCD22Ig-MG operably linked to a DNA construct encoding a concatameric fusion monomeric protein mgCD2-CD2/Fc containing glycosylation motif peptides, designated by SEQ ID NO: 21; and a mammalian host cell transformed or transfected with a recombinant expression plasmid Pct44Ig-MG operably linked to a DNA construct encoding a concatameric fusion monomeric protein mgCTLA4-CTLA4/Fc containing glycosylation motif peptides, designated by SEQ ID NO: 23.
[0105]The concatameric fusion dimeric proteins of the present invention may be isolated from culture medium after culturing the transformants or transfectants according to the present invention. The concatameric fusion dimeric proteins may participate in immune response, as described in Table 1, above, and are thus useful as therapeutic agents, diagnostic agents and laboratory tads according to the kinds of the protein, and their.use is well known to those of ordinary skill in the art. In particular, when being used as therapeutic agents, the concatameric fusion dimeric proteins may be applied at an therapeutically effective amount common in the art, and it will be understood that such an amount may vary depending on diverse factors including activity of the used compound, patient's age, body weight, health state, sex and diet, administration time, administration route, combination of drugs, and pathogenic state of a specific disease to be prevented or treated. In addition, when being used as therapeutic agents, it will be understood that the concatameric fusion dimeric proteins according to the present invention may be applied by the typical methods and routes for administration of proteins involving immune response, which are known to those of ordinary skill in the art.
[0106]The present invention will be explained in more detail with reference to the following examples in conjunction with the accompanying drawings. However, the following examples are provided only to illustrate the present invention, and the present invention is not limited to them. For convenience in describing the present invention, information on DNA constructs, recombinant expression plasmids and transformed cell lines, which are prepared according to the Examples, below, and the used primers and accession numbers is summarized in Tables 8 and 9, below.
TABLE-US-00008 TABLE 8 Information on DNA constructs and accession Nos. SEQ ID No. Deposition of genes Deposition of cell lines DNA construct name DNA Protein Designation Accession No. Designation Accession No. TNFR1-IgG 1 2 INFR2-IgG 3 4 TNFR1-TNFR1-IgG 5 6 pTR11Ig-Top10' KCCM 10288 TR11Ig- KCLRF-BP- CHO 00046 TNFR2-TNFR2-IgG 7 8 pTR22Ig-Top10' KCCM 10291 TR22Ig- KCLRF-BP- CHO 00047 mgTNFR1-TNFR1-IgG 9 10 pTR11Ig-MG KCCM 10404 mgTNFR2-TNFR2-IgG 11 12 PTR22Ig-MG KCCM 10407 CD2-IgG 13 14 CTLA4-IgG 15 16 CD2-CD2-IgG 17 18 pCD22Ig KCCM 10402 CTLA4-CTLA4-IgG 19 20 pCT44Ig KCCM 10400 mgCD2-CD2-IgG 21 22 pCD22Ig-MG KCCM 10401 mgCTLA4-CTLA4-IgG 23 24 pCT44Ig-MG KCCM 10399
TABLE-US-00009 TABLE 9 Information for primers SEQ Primer name ID No. Description Oligo TNFR-EDF- 25 Containing 5' end of the extracellular domain of TNFR1 and an EcoRI site EcoRI Oligo TNFR-EDR- 26 Reverse primer containing 3' end of the extracellular domain of TNFR1 and IgGh the hinge region of IgG Oligo IgG1-T1F 27 Containing 5' end of the hinge region of IgG and 3' end of TNFR1 Oligo IgG1-R-XbaI 28 Reverse primer containing 3' end of the hinge region of IgG and a XbaI site Oligo TNFR2-EDR- 29 Containing 5' end of the extracellular domain of TNFR2 and an EcoRI site EcoRI Oligo TNFR2-EDR- 30 Reverse primer containing 3' end of the extracellular domain of TNFR2 and IgGh the hinge region of IgG Oligo IgG1-T2F 31 Containing 5' end of the hinge region of IgG and 3' end of TNFR2 Oligo TNFR1-CF- 32 Containing 5' end of the extracellular domain of TNFR1 and a BamHI site; BamHI and used for preparation of a concatamer Oligo TNFR1-NR- 33 Reverse primer containing 3' end of the extracellular domain of TNFR1 and a BamHI BamHI site; and used for preparation of a concatamer Oligo TNFR2-CF- 34 Containing 5' end of the extracellular domain of TNFR2 and a BamHI site; BamHI and used for preparation of a concatamer Oligo TNFR2-NR- 35 Reverse primer containing 3' end of the extracellular domain of TNFR2 and a BamHI BamHI site; and used for preparation of a concatamer Oligo mgTNFR1- 36 Primer for mutagenesis, containing a sequence capable of inserting TNFR1-IgG-F glycosylation sites into the joint region of TNFR1-TNFR1, and sequences corresponding to 3' end and 5' end of TNFR1; and used for preparation of a MG (multiglycosylation) form Oligo mgTNFR1- 37 Reverse primer for mutagenesis, containing a sequence capable of inserting TNFR1-IgG-R glycosylation sites into the joint region of TNFR1-TNFR1, and sequences corresponding to 3' end and 5' end of TNFR1; and used for preparation of a MG form Oligo mgTNFR2- 38 Primer for mutagenesis, containing a sequence capable of inserting TNFR2-IgG-F glycosylation sites into the joint region of TNFR2-TNFR2, and sequences corresponding to 3' end and 5' end of TNFR2; and used for preparation of a MG form Oligo mgTNFR2- 39 Reverse primer for mutation, containing a sequence capable of inserting TNFR2-IgG-R glycosylation sites into the joint region of TNFR2-TNFR2, and sequences corresponding to 3' end and 5' end of TNFR2; and used for preparation of a MG form Oligo CD2F-EcoRI 40 Containing 5' end of the extracellular domain of CD2 and a EcoRI site Oligo CD2R-RstI 41 Containing 3' end of the extracellular domain of CD2 and a PstI site Oligo IgG-F-PstI 42 Containing 5' end of the hinge region of IgG and a PstI site Oligo CTLA4F-EcoRI 43 Containing 5' end of the extracellular domain of CTLA-4 and a EcoRI site Oligo CTLA4R-PstI 44 Containing 3' end of the extracellular domain of CTLA-4 and a PstI site Oligo CD2-NT-F 45 Containing 5' end of the extracellular domain of CD2; and used for preparation of a concatamer Oligo CD2-CT-R 46 Reverse primer containing 3' end of the extracellular domain of CD2; and used for preparation of a concatamer Oligo CTLA4-NT-F 47 Containing 5' end of the extracellular domain of CTLA-4; and used for preparation of a concatamer Oligo CTLA4-CT-R 48 Reverse primer containing 3' end of the extracellular domain of CTLA-4; and used for preparation of a concatamer Oligo mgCD2-CD2- 49 Used for preparation of a MG (multiglycosylation) form of CD2-CD2-IgG IgG-F Oligo mgCD2-CD2- 50 Reverse primer used for preparation of a MG (multiglycosylation) form of IgG-R CD2-CD2-IgG Oligo mgCTLA4- 51 Used for preparation of a MG (multiglycosylation) form of CTLA4-CTLA4- CTLA4-IgG-F IgG Oligo mgCTLA4- 52 Reverse primer used for preparation of a MG (multiglycosylation) form of CTLA4-IgG-R CTLA4-CTLA4-IgG
Example 1
Human TNFR
A. Manufacture of a DNA Construct Encoding Simple Fusion Monomeric Protein of TNFR1/Fc (FIG. 1 and FIG. 5)
[0107]a. DNA Fragment Encoding Soluble Extracellular Domain of TNFR1
[0108]A fusion gene encoding soluble extracellular domain of type I human TNF receptor (TNFR1, p55) and Fc fragment of human immunoglobulin G1 was constructed by the Polymerase Chain Reaction (PCR) method described in the prior art (Holten et al., Biotechniques 8:528, 1990).
[0109]A DNA fragment encoding soluble extracellular domain of TNFR1 was constructed by PCR using a primer (the sequence of nucleotide of SEQ ID NO: 25) with EcoRI restriction site and the sequence encoding leader sequence (the sequence of amino acids 1-20 of SEQ ID NO: 2), and an antisense primer (the sequence of nucleotide of SEQ ID NO: 26) with the sequence encoding a part of 3' ends of the said soluble extracellular domain of TNFR1 (TNFR1 ED) and 5' ends of the hinge region of immunoglobulin G1 (IgG1). The template cDNA for this reaction was constructed by reverse transcription PCR (RT-PCR) of mRNA extracted from monocyte (T lymphocyte) of healthy adults.
[0110]After blood of healthy adults was extracted and diluted to 1:1 with RPMI-1640 (Gibco BRL, USA), the layer of T lymphocyte which formed, at upper part was obtained by density gradient centrifugation using Ficoll-hypaque (Amersham, USA). In order to make the concentration of the cell to 5×105 cells/ml, the cell was washed with RPMI-1640 for 3 times, and RPMI-1640 culture media containing 10% Fetal Bovine Serum (FBS, Gibco BRL, USA) was added, then cultured at 37° C. for two days in the 5% CO2 incubator after adding leukoagglutinin to 3.5 ug/ml (Pharmacia, USA).
[0111]The mRNAs were purified using Tri-Reagent (MRC, USA) mRNA purification kit. First, 2×107 of human T lymphocyte was washed with Phosphate Buffered Saline (PBS, pH7.2) for 3 times, and then 1 ml of Tri-Reagent was mixed for several times to dissolve RNA. After adding 0.2 ml of chloroform to this tube and mixing thoroughly, this tube was incubated at room temperature (RT) for 15 min, then centrifuged at 15,000 rpm, 4° C. for 15 min. The upper part of the solution was transferred to a 1.5 ml tube, and 0.5 ml of isopropanol was added, and then centrifuged at 15,000 rpm, 4° C. for 15 min. After the supernatant was discarded, the pellet was resuspended with 1 ml of 3° distilled water treated with 75% ethanol-25% DEPC (Sigma, USA), and then centrifuged at 15,000 rpm, 4° C. for 15 min. After the supernatant was removed completely and dried in the air to remove ethanol residue, RNA was resuspended with 50 μl of 3° distilled water treated with DEPC.
[0112]The primary cDNA was synthesized by mixing 2 μg of purified mRNA and 1 μl of oligo dT (dT30, Promega, USA) primer to 10 μM in 1.5 ml tube, heating at 70° C. for 2 min, and cooling in ice for 2 min. After that, this mixture was added with 200 U of M-MLV reverse transcriptase (Promega, USA), 10 μl of 5× reaction buffer (250 mM Tris-HCl, pH 8.3, 375 mM KCl, 15 mM MgCl2, and 50 mM DTT), 1 μl of dNTP (10 mM each, Takara, Japan), and DEPC-treated 3° distilled water to 50 μl, then reacted at 42° C. for 1 hour.
[0113]b. DNA Fragment Encoding Fc Fragment of Immunoglobulin
[0114]A DNA fragment encoding Fc fragment of immunoglobulin G1 was constructed by PCR using a primer (the sequence of nucleotide of SEQ ID NO: 27) with the sequence encoding a part of 3' ends of the said soluble extracellular domain of TNFR and 5' end of the hinge region of immunoglobulin G1 (IgG1), and an antisense primer (the sequence of nucleotide of SEQ ID NO: 28) with XbaI restriction site and the sequence encoding 3' ends of IgG1 Fc. The template cDNA for this reaction was constructed by RT-PCR of mRNA extracted from peripheral blood cell (B lymphocyte) of convalescent patients with pyrexia of unknown origin.
[0115]c. DNA Construct Encoding Simple Fusion Monomeric Protein of TNFR1/Fc
[0116]After DNA fragment encoding soluble extracellular domain of TNFR1 and DNA fragment encoding Fc fragment of immunoglobulin produced as described above were mixed in the same tube, complementary binding between the common sequence (the sequence including 3' end of soluble extracellular domain of TNFR1 and 5' end of IgG1 hinge region) was induced. Using this mixture as a template, DNA construct including DNA fragment encoding soluble extracellular domain of TNFR1 and DNA fragment encoding IgG1 Fc fragment was amplified by PCR using a primer (the sequence of nucleotide of SEQ ID NO: 25) with the sequence encoding 5' end of TNFR1 and another primer (the sequence of nucleotide of SEQ ID NO: 28) with the sequence encoding 3' end of IgG1 Fc. The constructed gene included a leader sequence to faciliate secretion of protein after expression.
[0117]d. Cloning of the DNA Construct Encoding Simple Fusion Monomeric Protein of TNFR1/Fc
[0118]DNA construct encoding simple fusion monomeric protein of TNFR1/Fc as described above was restricted with EcoRI and XbaI, and cloned by inserting into a commercially available cloning vector, pBluescript KS II (+) (Stratagene, USA), at EcoRI/XbaI site. The sequence of a total coding region was identified by DNA sequencing (SEQ ID NO: 1). This produced fusion protein was designated TNFR1/Fc as simple fusion monomeric protein, and the elliptical shape shown in FIG. 1 represents the structure of a primary expression product of the fusion gene. The deduced amino acid sequence of simple fusion monomeric of TNFR1/Fc corresponded to SEQ ID NO: 2.
B. Manufacture of a DNA Construct Encoding Simple Fusion Monomeric Protein of TNFR2/Fc (FIG. 1 and FIG. 5)
[0119]a. DNA Fragment Encoding Soluble Extracellular Domain of TNFR2
[0120]A fusion gene encoding soluble extracellular domain of type II human TNF receptor (TNFR2, p75) and Fc fragment of human immunoglobulin G1 was constructed by the same method as that of TNFR1/Fc.
[0121]A DNA fragment encoding soluble extracellular domain of TNFR2 was constructed by PCR using a primer (the sequence of nucleotide of SEQ ID NO: 29) with EcoRI restriction site and the sequence encoding leader sequence (the sequence of amino acids 1-22 of SEQ ID NO: 4), and an antisense primer (the sequence of nucleotide of SEQ ID NO: 30) with the sequence encoding a part of 3' ends of said soluble extracellular domain of TNFR2 (TNFR2-ED) and 5' ends of the hinge region of immunoglobulin G1 (IgG1). The template cDNA for this reaction was constructed by RT-PCR of mRNA extracted from monocyte (T lymphocyte) of healthy adults.
[0122]b. DNA Construct Encoding Simple Fusion Monomeric Protein of TNFR2/Fc
[0123]After DNA fragment encoding soluble extracellular domain of TNFR2 and DNA fragment encoding Fc fragment of immunoglobulin G1 produced as described above were mixed in the same tube, complementary binding between the common sequence (the sequence including 3' end of soluble extracellular domain of TNFR2 and 5' end of IgG1 hinge region) was induced. Using this mixture as a template, DNA construct including DNA fragment encoding soluble extracellular domain of TNFR2 and encoding and DNA fragment encoding IgG1 Fc fragment was amplified by PCR using a primer (the sequence of nucleotide of SEQ ID NO: 29) with the sequence encoding 5' end of TNFR2 and another primer (the sequence of nucleotide of SEQ ID NO: 28) with the sequence encoding 3' end of IgG1 Fc. The constructed gene includes a sequence to faciliate secretion of protein after expression.
[0124]c. Cloning of the DNA Construct Encoding Simple Fusion Monomeric Protein of TNFR2/Fc
[0125]DNA construct encoding simple fusion monomeric protein of TNFR2/Fc as described above was restricted with EcoRI and XbaI, and cloned by inserting into a commercially available cloning vector, pBluescript KS II (+) (Stratagene, USA), at EcoRI/XbaI site. The sequence of a total coding region was identified by DNA sequencing (SEQ ID NO: 3). This produced fusion protein was designated TNFR2/Fc as simple fusion monomeric protein, and the elliptical shape shown in FIG. 1 represents the structure of a primary expression product of the fusion gene. The deduced amino acid sequence of simple fusion monomeric of TNFR2/Fc corresponded to SEQ ID NO: 4.
C. Manufacture of a DNA Construct Encoding Concatameric Fusion Monomeric Protein of TNFR1-TNFR1/Fc (FIG. 2 and FIG. 5)
[0126]In order to manufacture a fusion gene comprising the concatameric shape in soluble extracellular domain of TNFR1, i.e. the DNA construct encoding concatameric fusion monomeric protein of TNFR1-TNFR1/Fc, BamHI restriction site was inserted respectively into the sequence of soluble extracellular domain of TNFR1 and DNA construct as produced as above encoding simple fusion monomeric protein of TNFR1/Fc by PCR, and then regions of each fragments restricted by BamHI were linked by ligase. The DNA construct, encoding simple fusion monomeric protein of TNFR1/Fc produced as above, was used as the template of this reaction.
[0127]The fragment of the soluble extracellular domain of TNFR1 with BamHI restriction site at 3' end was amplified by PCR using a primer corresponding to the nucleotide of SEQ ID NO: 25 and another primer corresponding to the nucleotide sequence of SEQ ID NO: 33, and the other fragment of simple fusion monomeric protein of TNFR1/Fc with BamHI restriction site at 5' end was amplified by PCR using a primer corresponding to the nucleotide of SEQ ID NO: 28 and another primer corresponding to the nucleotide sequence of SEQ ID NO: 32, respectively. PCR was performed by adding 1 μl of primary cDNA, 2 U of Pfu DNA polymerase (Stratagene, USA), 10 μl of 10× reaction buffer [200 mM Tris-HCl, pH 8.75, 100 mM (NH4)2SO4, 100 mM KCl, 20 mM MgCl2], 1% Triton® X-100, 1 mg/ml BSA, 3 μl primer 1 (10 μM), 3 μl primer 2 (10 μM), 2 μl dNTP (10 mM each), and 3° distilled water to 100 μl . The reaction condition was as follows; 94° C., 5 min; 95° C. , 1 min; 58° C., 1 min 30 sec; 72° C., 1 min for 31 cycles; and 72° C., 15 min to make PCR product with complete blunt end.
[0128]After electrophorized on 0.8% agarose gel, the PCR product was purified by Qiaex II gel extraction kit (Qiagen, USA). The purified PCR product was restricted by BamHI and extracted by phenol-chloroform extraction methods. Subsequently, two kinds of DNA fragments restricted by BamHI were linked by ligase.
D. Manufacture of a DNA Construct Encoding Concatameric Fusion Monomeric Protein of TNFR2-TNFR2/Fc (FIG. 2 and FIG. 5)
[0129]After a BamHI restriction site was inserted respectively into the sequence of the soluble extracellular domain of TNFR21 and the DNA construct produced as described above encoding simple fusion monomeric protein of TNFR2/Fc by PCR, a DNA construct encoding concatameric fusion monomeric protein of TNFR2-TNFR2/Fc was manufactured by linking the regions of each fragments restricted by BamHI by ligase.
[0130]A fragment of soluble extracellular domain of TNFR2 with BamHI restriction site at 3' end was amplified using a primer corresponding the sequence of SEQ ID NO: 34 and SEQ ID NO: 35. PCR was performed as that of TNFR1, except that a DNA construct encoding simple fusion monomeric protein of SEQ ID NO: 3 produced as above was used as a template. The PCR product was purified by the method as that of TNFR1.
E. DNA Construct Encoding Concatameric Fusion Monomeric Protein of TNFR1-TNFR1/Fc With Glycosylation Motif.
[0131]A DNA fragment was manufactured by PCR using an antisense primer (the sequence of nucleotide of SEQ ID NO: 37) with the sequence encoding the part (the sequence of nucleotide 565-591 of SEQ ID NO: 5) of 3' end of the first soluble extracellular domain of TNFR1, except the sequence of hydrophobic peptide region (the sequence of amino acid 497-216 of SEQ ID NO: 6) at the junction of soluble extracellular domain of TNFR1 and the part (the sequence of nucleotide 649-681 of SEQ ID NO: 5) of 5' end of the second soluble extracellular domain of TNFR1, and another primer (the sequence of nucleotide of SEQ ID NO: 25) with the sequence encoding EcoRI restriction site and leader sequence.
[0132]In addition, the total four amino acid sequences encoding glycosylation site (the sequence of amino acids 189-191, 192-194, 198-200, and 204-206 of SEQ ID NO: 10) were inserted by manufacturing the primer as above (the sequence of nucleotide of SEQ ID NO: 36 and 37) corresponding the substitution of the nucleotide 565-567 (CTG, Len), 574-576 (ACG, Thr), 652-654 (CTA, Leu), and 670-672 (AGA, Arg) of SEQ ID NO: 5 with the nucleotide of AAC (Asn, N); the nucleotide of 571-573 (TGC, Cys) and 580-582 (TTG, Leu) of SEQ ID NO: 5 with the nucleotide of ACC (Thr, T); the nucleotide of 658-660 (GAC, Asp) with the nucleotide of TCC (Ser, S).
[0133]In this reaction, the gene (the nucleotide of SEQ ID NO: 5) encoding concatameric shape of TNFR1-TNFR1/Fc was used as a template. During the primary PCR, only the half of the antisense primer was induced to bind the gene encoding concatameric shape of TNFR1-TNFR1/Fc used as a template, and, as chain reaction was proceeding, the unbound part to the template was induced to form a complete double-stranded DNA by polymerase, and then this was capable of producing the DNA fragment with state of linkage of the sequence of 5' end encoding the part of the second soluble extracellular domain and the sequence of 3' end encoding TNFR1 extracellular domain including leader sequence. Therefore, a part of the sequence of 5' end encoding the second soluble extracellular domain has the function that was capable of binding to the second DNA fragment as follows.
[0134]The second DNA fragment was manufactured by PCR using a primer (the sequence of nucleotide of SEQ ID NO: 36) with the sequence encoding the part (the sequence of nucleotide 565-591 of SEQ ID NO: 5) of 3' end of the first soluble extracellular domain of TNFR1 and the part (the sequence of nucleotide 649-681 of SEQ ID NO: 5) of 5' end of the second soluble extracellular domain of TNFR1, and an antisense primer (the sequence of nucleotide of SEQ ID NO: 28) with the sequence encoding a XbaI restriction site and 3' end of IgG1 Fc. This reaction was also performed as described above, that is, only the half of antisense primer was induced to bind the template, and consequently, DNA fragment like that described above had the sequence encoding 5' end of TNFR1 extracellular including the part of 3' end of the first soluble extracellular domain.
[0135]Subsequently, resulting from two kinds of DNA fragments as PCR described as above were mixed in the same tube, induced to bind between common sequences, and fused by PCR using primers (the sequence of nucleotide of SEQ ID NO: 25 and 28) encoding 5' and 3' end of each concatameric genes, and the product was designated mgTNFR1-TNFR1-IgG.
F. DNA Construct Encoding Concatameric Fusion Monomeric Protein of TNFR2-TNFR2/Fc With Glycosylation Motif.
[0136]A DNA fragment was manufactured by PCR using an antisense primer (the sequence of nucleotide of SEQ ID NO: 39) with the sequence encoding the part (the sequence of nucleotide 586-606 of SEQ ID NO: 7) of 3' end of first soluble extracellular domain of TNFR2, except the sequence of hydrophobic peptide region (the sequence of amino acid 203-263 of SEQ ID NO: 8) at the junction of soluble extracellular domain of TNFR2 and the part (the sequence of nucleotide 790-807 of SEQ ID NO: 7) of 5' end of second soluble extracellular domain of TNFR2, and another primer (the sequence of nucleotide of SEQ ID NO: 29) with the sequence encoding EcoRI restriction site and leader sequence.
[0137]In addition, the total two amino acid sequences encoding glycosylation site (the sequence of amino acids 199-201 and 206-208 of SEQ ID NO: 12) were inserted by manufacturing the primer as described above (the sequence of nucleotide of SEQ ID NO: 38 and 39) corresponding to the substitution of the nucleotide 595-597 (GTC, Val) and 799-801 (GGG, Gly) SEQ ID NO: 7 with the nucleotide of AAC (Asn, N).
[0138]In this reaction, the gene (the nucleotide of SEQ ID NO: 7) encoding concatameric shape of TNFR2-TNFR2/Fc was used as a template. During the primary PCR, only the half of antisense primer was induced to bind the gene encoding concatameric shape of TNFR2-TNFR2/Fc used as a template, and, as the chain reaction was proceeding, the unbound part to the template was induced to form a complete double-stranded DNA by polymerase, and thus this was capable of producing the DNA fragment with a state of linkage of the sequence of 5' end encoding the part of the second soluble extracellular domain and the sequence of 3' end encoding TNFR2 extracellular domain including the leader sequence. Therefore, a part of the sequence of 5' end encoding the second soluble extracellular domain has the function that was capable of binding to the second DNA fragment as follows.
[0139]The second DNA fragment was manufactured by PCR using a primer (the sequence of nucleotide of SEQ ID NO: 38) with the sequence encoding the part (the sequence of nucleotide 586-606 of SEQ ID NO: 7) of 3' end of the first soluble extracellular domain of TNFR2 and the part (the sequence of nucleotide 790-807 of SEQ ID NO: 7) of 5' end of the second soluble extracellular domain of TNFR2, and an antisense primer (the sequence of nucleotide of SEQ ID NO: 28) with the sequence encoding a XbaI restriction site and 3' end of IgG1 Fc. This reaction was also performed, that is, only the half of antisense primer was induced to bind the template, and consequently, DNA fragment like that described above had the sequence encoding 5' end of TNFR2 extracellular including the part of 3' end of first soluble extracellular domain.
[0140]Subsequently, resulting from two kinds of DNA fragments as PCR produced as above were mixed in the same tube, induced to bind between common sequences, and fused by PCR using primers (the sequence of nucleotide of SEQ ID NO: 29 and 28) encoding 5' and 3' end of each concatameric genes, and the product was designated mgTNFR2-TNFR2-IgG.
G. Cloning of DNA Constructs Encoding Concatameric Fusion Monomeric Protein of TNFR-TNFR/Fc and Their Glycosylated Forms
[0141]DNA constructs encoding concatameric fusion monomeric protein of TNFR-TNFR/Fc and their glycosylated forms as above were cloned by inserting into pBluescript KS II (+) (Stratagene, USA) at EcoRI/XbaI site. These produced fusion proteins were designated TNFR1-TNFR1/Fc and TNFR2-TNFR2/Fc as concatameric fusion monomeric protein, and designated mgTNFR1-TNFR1/Fc and mgTNFR2-TNFR2/Fc as their glycosylated forms. The deduced amino acid sequences corresponded to SEQ ID NO: 6, 8, 10, and 12.
[0142]After 10 μg of pBluescript KS II (+) (Stratagene, USA) used as a vector was mixed with 15 U of EcoRI, 15 U of XbaI, 5 μl of 10× reaction buffer (100 mM Tris-HCl, pH 7.5, 100 mM MgCl2, 10 mM DTT, 500nM NaCl), 5 μl of 0.1% BSA (Takara, Japan), and 3° distilled water to 50 μl, DNA was restricted by incubation at 37° C. for 2 hrs. After electrophorized on 0.8% agarose gel, the PCR product was purified by Qiaex II gel extraction kit (Qiagen, USA).
[0143]After 100 ng of pBluescript KS II (+) (Stratagene, USA) restricted by EcoRI and XbaI was mixed with 20 ng of PCR product restricted by the restriction enzyme, 0.5 U of T4 DNA ligase (Amersham, USA), 1 μl of 10× reaction buffer (300 mM Tris-HCl, pH 7.8, 100 mM MgCl2, 100 mM DTT, 10 mM ATP) and 3° distilled water were added to 10 μl, and the mixture was incubated in the water bath at 16° C. for 16 hrs. E. coli Top10 (Novex, USA) was made to competent cell by the method of rubidium chloride (RbCl, Sigma, USA) and transformed, then spread on the solid LB media including 50 μg/ml of ampicillin (Sigma, USA) and incubated at 37° C. for 16 hrs. Formed colonies were inoculated in 4 ml of liquid LB media including 50 μg/ml of ampicillin and incubated at 37° C. for 16 hrs. Plasmid was purified by the method of alkaline lysis according to Sambrook et al. (Molecular cloning, Cold Spring Harbor Laboratory press, p 1.25-1.31, p 1.63-1.69, p 7.26-7.29, 1989) from 1.5 ml of that, and the existence of cloning was confirmed by the restriction of EcoRI and XbaI.
[0144]The sequence of a total coding region was identified by the DNA sequencing method of dideoxy chain termination method (Sanger et al., Proc. Natl. Acad. Sci., 74:5483, 1977) as follows. The DNA sequencing reaction was performed according to the manual using a plasmid purified by alkaline lysis method as described above and Sequenase® ver 2.0 (Amersham, USA). After the reaction mixture as above was loaded on 6% polyacrylamide gel and electrophorized for 2 hrs at constant voltage of 1,800-2,000 V and 50° C., DNA sequence was identified by exposing to X-ray film (Kodak, USA) after the gel was dried out.
Example 2 and 3
CD2 and CTLA4
[0145]DNA fragments encoding soluble extracellular domain of CD2 and CTLA4 were constructed by PCR using a primer [CD2 (the sequence of nucleotide of SEQ ID NO: 40), and CTLA4 (the sequence of nucleotide of SEQ ID NO: 43)] with EcoRI restriction site and the coding sequence [CD2 (the sequence of nucleotide of SEQ ID NO: 13), and CTLA4 (the sequence of nucleotide of SEQ ID NO: 15)] encoding the leader sequence [CD2 (the sequence of amino acid 1-24 of SEQ ID NO: 14), and CTLA4 (the sequence of amino acid 1-21 of SEQ ID NO: 16)], and an antisense primer [CD2 (the sequence of nucleotide of SEQ ID NO: 41), and CTLA4 (the sequence of nucleotide of SEQ ID NO: 44)] with PstI restriction site and the sequence [CD2 (the sequence of nucleotide of SEQ ID NO: 13), and CTLA4 (the sequence of nucleotide of SEQ ID NO: 15)] encoding 3' end of the soluble extracellular domain of the proteins as described above. The template cDNA for this reaction was constructed by reverse transcription PCR (RT-PCR) of mRNA extracted from the monocyte (T lymphocyte) of healthy adults.
[0146]Also, a DNA fragment encoding Fc fragment of immunoglobulin G1 was constructed by PCR using a primer (the sequence of nucleotide of SEQ ID NO: 42) with PAT restriction site and the sequence encoding 5' ends of constant region of IgG1, and an antisense primer (the sequence of nucleotide of SEQ ID NO: 28) with XbaI restriction site and the sequence encoding 3' ends of IgG1 Fc. The template cDNA for this reaction was constructed by RT-PCR of mRNA extracted from peripheral blood cell (B lymphocyte) of convalescent patients with unknown fever.
[0147]Subsequently, both DNA fragment encoding soluble extracellular domain of CD2 and CTLA4 and DNA fragment encoding Fc fragment of immunoglobulin G1 produced as described above were restricted by PstI, and then the simple dimeric shape of CD2/Fc and CTLA4/Fc genes were constructed by linkages using T4 DNA ligase. The constructed genes included a leader sequence to faciliate secretion of protein after expression.
[0148]DNA constructs as described above were restricted by restriction enzyme of EcoRI and XbaI, and cloned by inserting into a commercially available cloning vector, pBluescript KS II (+) (Stratagene, USA) at EcoRI/XbaI site. The sequence of a total coding region was identified by DNA sequencing (SEQ ID NO: 13 and 15). These produced fusion proteins were designated CD2/Fc and CTLA4/Fc, and the deduced amino acid sequences of these corresponded to SEQ ID NO: 14 and 16.
[0149]PCR was performed by adding 1 μl of primary cDNA, 2 U of Pfu DNA polymerase (Stratagene, USA), 10 μl of 10× reaction buffer [200 mM Tris-HCl, pH 8.75, 100 mM (NH4)2SO4, 100 mM KCl, 20 mM MgCl2], 1% Triton® X-100, 1 mg/ml BSA, 3 μl primer 1 (10 μM), 3 μl primer 2 (10 μM), 2 μl dNTP (10 mM each), and 3° distilled water to 100 μl. The reaction condition was as follows; 94° C., 5 min; 95° C., 1 min; 58° C., 1 min 30 sec; 72° C., 1 min for 31 cycles; and 72° C., 15 min to make PCR product with complete blunt end.
[0150]The fusion genes with concatameric shape of CD2-CD2/Fc and CTLA4-CTLA4/Fc were constructed as follows.
[0151]In order to manufacture fusion gene comprising the concatameric shape in soluble extracellular domain of CD2 and CTLA4, the sequences of soluble extracellular domain of CD2 and CTLA4 were inserted by blunt-end ligation using ligase at the junction between extracellular domain and immunoglobulin of fusion genes in the shape of simple dimer with blunt end, using PstI restriction enzyme and T4 DNA polymerase. Specifically, DNA constructs were constructed by PCR using a primer [CD2 (the sequence of nucleotide of SEQ ID NO: 13) and CTLA4 (the sequence of nucleotide of SEQ ID NO: 48)] with the coding sequence [CD2 (the sequence of nucleotide of SEQ ID NO: 13) and CTLA4(the sequence of nucleotide of SEQ ID NO: 15)] encoding the end of leader sequence [CD2(the sequence of amino acid 25 of SEQ ID NO: 14) and CTLA4 (the sequence of amino acid 22 of SEQ ID NO: 16)] of soluble extracellular domain, and an antisense primer [CD2(SEQ ID NO: 46) and CTLA4(SEQ ID NO: 48)] with the sequence [CD2 (the sequence of nucleotide of SEQ ID NO: 13) and CTLA4 (the sequence of nucleotide of SEQ ID NO: 15)] encoding 3' end of soluble extracellular domain as above. The simple fusion monomeric genes [CD2/Fc (the sequence of nucleotide of SEQ ID NO: 13) and CTLA4/Fc (the sequence of nucleotide of SEQ ID NO: 15)] described as above were used as the template of this reaction.
[0152]Also CD2/Fc and CTLA4/Fc, which were inserted in pBluescript KS II (+) in the shape of simple monomeric form, were made to have 3' overhang end using the restriction enzyme of PstI. The cut end of 3' overhang was partially deleted to form a blunt end by treating T4 DNA polymerase. In order to manufacture fusion genes in the shape of concatamer in soluble extracellular domain, the soluble extracellular domains of CD2 and CTLA4 produced by PCR as described above were cloned by inserting into cut ends of simple monomeric gene made as blunt end. These produced fusion proteins were designated CD2-CD2/Fc and CTLA4-CTLA4/Fc as concatameric fusion monomeric protein, and their deduced amino acid sequences corresponded SEQ ID NO: 18 and 20, respectively.
[0153]The concatameric fusion genes in the shape of multiglycosylated form were constructed as follows.
[0154]The glycosylation motif was inserted by secondary PCR with mixing in the same tube of a DNA fragment produced by PCR using a primer including EcoRI restriction site and the soluble extracellular domain with leader sequence, and an antisense primer with the sequence encoding the part of 3' end of the first soluble extracellular domain of concatameric shape of fusion gene and the part of 5' end of the second soluble extracellular domain with the nucleotide of substituted glycosylation motif; and other DNA fragment produced by PCR using a primer with the sequence encoding the part of 3' end of the first soluble extracellular domain of concatameric shape of fusion gene and the part of 5' end of the second soluble extracellular domain with the nucleotide of substituted glycosylation motif; and an antisense primer with the sequence encoding 3' end of Fc fragment of immunoglobulin G1 and XbaI restriction site.
[0155]In the case of concatameric fusion gene of CD2/Fc and CTLA4/Fc, the glycosylation motif was inserted by PCR using modified primers as the same methods as that of TNFR/Fc described as above, but it was different from the case of TNFR/Fc that the amino acid sequence of binding to soluble extracellular domain of CD2 and CTLA4 was retained as the same.
[0156]In the process of multiglycosylatin of the concatameric fusion protein of CD2/Fc and CTLA4/Fc, the case of CD2/Fc was completed by inserting the total two glycosylation motif peptide region (the sequence of amino acid of 200-202 and 206-208 of SEQ ID NO: 22) using a manufactured primer including the substitution of the nucleotide of 598-600 (CCT, Pro) and 616-618 (GAG, Glu) of SEQ ID NO: 17 with AAT (Asn, N), and the case of CTLA4/Fc was completed by inserting the total three glycosylation motif peptide region (the sequence of amino acid of 136-138, 142-144, and 147-149 of SEQ ID NO: 24) using a manufactured primer (SEQ ID NO: 51 and 52) including the substitution of the nucleotide of 403-405 (GTA, Val) and 424-426 (CCA, Pro) of SEQ ID NO: 19 with AAT (Asn, N); the nucleotide of 409-411 (GAT, Asp) and 445-447 (GTG, Val) with ACA (Thr, T) and ACG (Thr, T), respectively. These produced fusion proteins were designated mgCD2-CD2/Fc and mgCTLA4-CTLA4/Fc as concatameric fusion monomeric protein, and their deduced amino acid sequences corresponded to SEQ ID NO: 22 and 24, respectively.
Example 4
Expression and Purification of Simple/Concatameric Fusion Dimeric Protein of TNFR/Fc
[0157]In order to express the fusion proteins in CHO-K1 cell (ATCC CCL-61, Ovary, Chinese hamster, Cricetulus griseus), after pBluescript KS II (+) plasmid DNA including TNFR/Fc fusion gene was purified from transformed E. coli, an animal cell expression vectors were constructed as TNFR/Fc fragment produced by restriction using EcoRI and XbaI was inserted at EcoRI/XbaI site of an animal cell expression vector, pCR®3 (Invitrogen, USA) plasmid. And these were designated plasmid pTR11-Top10' and plasmid pTR22-Top10', and deposited as accession numbers of KCCM 10288 and KCCM 10291, respectively, at Korean Culture Center of Microorganisms (KCCM) on Jul. 10, 2001.
[0158]Transfection was performed by mixing either the plasmid pTR11-Top10' or plasmid pTR22-Top10' DNA including TNFR/Fc fusion genes as described above with the reagent of Lipofectamin (Gibco BRL, USA). CHO-K1 cells with the concentration of 1˜3×105 cells/well were inoculated in 6-well tissue culture plate (Nunc, USA), and incubated to 50˜80% in 10% FBS-DMEM media, then the DNA-liposome complex, which was reacted for 15˜45 min with 1˜2 μg of either the plasmid pTR11-Top10' or plasmid pTR22-Top10' DNA including TNFR/Fc fusion genes as described above and 2˜25 μl of Lipofectamin (Gibco BRL, USA), were added to the cell culture plate in the serum-free DMEM media. After incubation for 5 hrs, DMEM media with 20% serum was added and cells were incubated further for 18˜24 hrs. After primary transfection, cells were incubated for 3 weeks in 10% FBS-DMEM media with 1.5 mg/ml of Geneticin (G418, Gibco BRL, USA), and formed colonies was selected for amplified incubation. The expression of fusion proteins was analyzed by ELISA using a peroxidase labeled goat anti-human IgG (KPL, USA).
[0159]ELISA was performed as follows. First, 1 mg/ml of a peroxidase labeled goat anti-human IgG (KPL, USA) was diluted to 1:2,000 with 0.1M sodium bicarbonate, 100 μl of that was aliquoted into 96-well flexible plate (Falcon, USA) and sealed with plastic wrap, then incubated at 4° C. over 16 hrs to be coated on the surface of the plate. After this, it was washed for 3 times with washing buffer (0.1% Tween-20 in 1× PBS) and dilution buffer (48.5 ml 1× PBS, 1.5 ml FBS, 50 μl Tween-20), and then was aliquoted to 1801. After 20 μl of culture supernatant was dropped in the first well, then serially diluted using a micropipette, and 0.01 μg/μl of human immunoglobulin G (Sigma, USA) as the positive control and the culture media of untransfected CHO K-1 cell as the negative was equally diluted. After dilution, 96-well ELISA plate (Falcon, USA) was wrapped with aluminum foil and incubated at 37° C. for 1 hr 30 min, washed for 3 times with washing buffer. Peroxidase conjugated goat anti-human IgG (KPL, USA) was diluted to 1:5,000 with dilution buffer, aliquoted to 100 μl, wrapped with aluminum foil, and reacted at 37° C. for 1 hr. After reaction, this plate was washed for 3 times, colorized using TMB microwell peroxidase substrate system (KPL, USA) and existence of expression was confirmed by measurement of absorbance at 655 nm wavelength using microplate reader (Bio-Rad, Model 550, Japan).
[0160]Transfectants manufactured as above were designated TR11Ig-CHO and TR22Ig-CHO and deposited as accession numbers of KCLRF-BP-00046 and KCLRF-BP-00047, respectively, at Korean Cell Line Research Foundation (KCLRF) on Jul. 7, 2001. And adaptation for transfectants as described above to one of the serum free media, CHO-S-SFM II (Gibco BRL, USA), was proceeded to purify the proteins produced by those transfectants as follows. After about 3×105 of cells were inoculated into the 6-well plate, cells were cultured at 5% CO2, 37° C. for over 16 hrs to adhere, and it was checked under a microscope that cells were adhered at about 30˜50% area of the plate, then cells were cultured in a media consisting of 10% FBS DMEM and CHO-S-SFM II in the ratio of 8:2. After culturing 3 times serial passage at this ratio, it was cultured 3 times at the ratio of 6:4; 3 times at 4:6; 3 times at 3:7; 3 times at 2:8; 3 times at 1:9; and finally cultured in 100% CHO-S-SFM II media. And the level of expression was measured by ELISA.
[0161]After these transfectant cells were cultured on a large scale in CHO-S-SFM the supernatants including each fusion proteins were centrifuged at 200×g for 12 min to remove cell debris, and proteins were purified by the method using HiTrap protein A column (Amersham, USA) as follows. After 20 mM of sodium phosphate (pH 7.0, Sigma, USA) was passed at the velocity of 1 ml/min for 2 min, 10 ml of supernatant was passed at the same velocity to bind fusion protein to protein A. After 20 mM of sodium phosphate (pH 7.0) was passed at the same velocity for 2 min to wash, 500 μl of the extracts were serially fractionated in a 1.5 ml tube as 0.1M of citric acid (pH 3.0, Sigma, USA) was passed at the the same velocity for 3 min. This was adjusted to pH 7.0 using 1M of Tris (pH 11.0, USB, USA), the existence of fusion proteins in tube was confirmed through ELISA as described above. The purified proteins were concentrated by centrifugation at 2000×g, 4° C. for 30 min using Centricon 30 (Amicon, USA)
Example 5
SDS-PAGE of Purified TNFR1-TNFR1/Fc and TNFR2-TNFR2/Fc (FIG. 15)
[0162]Proteins purified using protein A column were electrophorized by the method of SDS-PAGE in reducing condition added by DTT, reducing reagent (which destroy disulfide bond), and in a non-reducing condition excluding DTT. The result of the estimation of molecular weight on SDS-PAGE is shown in Table 10. It was possible to confirm that TNFR/Fc proteins were the shape of a dimer in the cell. The molecular weight deduced from the amino acid sequence of TNFR1-TNFR1-Ig was about 70 kDa, and was estimated as about 102 kDa on SDS-PAGE. As this difference could be regarded as a general phenomenon which generate on the electrophoresis of glycoproteins, this feature seemed to occur as the result from decrease in mobility on the electrophoresis by the site of glycosylation.
TABLE-US-00010 TABLE 10 Molecular weight of TNFR-TNFR/Fc on the SDS-PAGE. Molecular weight (kDa) Reducing Non-reducing Proteins condition condition TNFR1-TNFR1/Fc 102 200 TNFR2-TNFR2/Fc 115 220
Example 6
Experiment of Neutralization Effect of Simple/Concatameric Fusion Dimeric TNFR/Fc Fusion Proteins on the Cytotoxicity of TNFα and TNFβ
[0163]An L929 cell [ATCC, Mus musculus (mouse), NCTC clone 929 (derivative of strain L; L-929; L cell) was used for testing the effect of TNFR/Fc fusion protein on the inhibition of cytotoxicity induced by TNFα and TNFβ. This analysis was based on the TNFR activity of inhibiting cytotoxicity induced by TNF (Scallon et al., Cytokine 7:759, 1995).
[0164]L929 cells were inoculated to be 3×104 cells/well in 96-well plates, and incubated at 37° C. for 24 hrs in a CO2 incubator. Subsequently, actinomycin D (Sigma, USA) was added to 3 μg/ml, and cells were incubated for 16˜18 hrs with TNFα and TNFβ in the concentration of expressing 100% cytotoxicity (0.5˜2 ng/ml), and with serially 10 times diluted TNFR sample. Then, the cells in the 96-well plate were stained by the staining reagent, crystal violet (Wake Pure Chemical Industries, Japan) and the activity of the cells was estimated by the degree of absorbance at 595 nm wavelength using a spectrophotometer (Bio-Rad, Model-550, Japan).
[0165]As shown in Table 11 represented by IC50 of each TNFR/Fc fusion protein, concatameric fusion proteins (TNFR1-TNFR1/Ig and TNFR2-TNFR2/Ig) have shown the higher inhibitory effect on the cytotoxicity induced by two kinds of TNF than simple dimeric fusion proteins (TNFR1/Ig and TNFR2/Ig). Also, as compared with the effects of existing simple fusion dimer and concatameric shaped TNFR/Fc fusion protein dimer of the present invention on the inhibition of cytotoxicity of TNFα (FIG. 16) and TNFβ (FIG. 17), it more clearly appeared that concatameric shaped TNFR/Fc fusion protein dimers of the present invention remarkably inhibited the TNFα and TNFβ cytotoxicity.
TABLE-US-00011 TABLE 11 IC50 of cytotoxicity inhibition IC50 (ug/ml) Fusion proteins TNFα treated TNFβ treated Simple dimer [TNFR1/Fc]2 63 129 [TNFR2/Fc]2 189 469 Concatameric [TNFR1-TNFR1/Fc]2 9 20 dimer [TNFR2-TNFR2/Fc]2 15 15
Example 7
Experiment of Suppressive Effect of Simple/Concatameric Fusion Dimeric CD2/Fc Fusion Protein and CTLA4/Fc Fusion Protein on the Proliferation of Active Immune Cell
[0166]WT100B1S, a cell line of B lymphocyte which was made by transfection of pyrexia patient's B lymphocyte with Ebstein-Barr virus was incubated in RPMI 1640 supplemented with 10% FBS to use as antigen presenting cell of T lymphocyte. After centrifuged at 2,000 rpm for 2 min to precipitate, this cells were resuspended in RPMI 1640 supplemented with 10% FBS to make 5.0×105 cells/ml, then irradiated by 3,000 rd of γ-ray.
[0167]T lymphocytes were isolated from blood of healthy adult using Ficoll-hypaque (Amersham, USA), then incubated RPMI 1640 supplemented with 10% FBS to 2.0×106 cells/ml.
[0168]To perform primary Mixed Lymphocyte Reaction (MLR), each 15 ml of WT100B1S and T lymphocyte were mixed in 150 mm cell culture dish, and incubated for 3 days, then added by 15 ml of RPMI 1640 supplemented with 10% FBS and incubated for 3 days further. After incubated for total 6 days, live T lymphocytes were purified using Ficoll-hypaque (Amersham, USA) as described above, and purified T lymphocytes were stored in liquid nitrogen after freezing it by using the media comprising 45% FBS, 45% RPMI 1640, and 10% DMSO.
[0169]After T lymphocytes which were reacted by primary MLR were thawed to perform secondary MLR, the cells were washed with RPMI 1640 media for 2 times and made to be 3.0×105 cells/mi in RPMI 1640 supplemented with 10% FBS.
[0170]WT100B1S using as antigen presenting cell was newly cultured by the method as described above, then prepared by irradiation of 3,000 rd of γ-ray and to be 7.5×104 cells/ml in RPMI 1640 supplemented with 10% FBS. After 100 μl of prepared WT100B1S was added in 96-well flat bottom cell culture plate and mixed with CD2/Fc and CTLA4/Fc fusion protein at final concentration of 10, 1, 10-1, 10-2, 10-3, and 10-4μ g/ml, 100 μl of primary MLR reacted T lymphocytes as above was added. After incubated for 2 days in 5% CO2, 37° C. incubator, 100 μl of RPMI 1640 supplemented with 10% FBS was added and incubated for 2 days further. In the last 6 hrs of the total 6 days culture, cells were incubated with addition of 1.2 μCi/ml of 3H-thymidine (Amersham, USA).
[0171]At the end of culturing, supernatants were removed after centrifugation of 96-well plate was performed at 4° C., 110×g for 10 min to precipitate T lymphocytes, and pellets were washed with 200 μl of 1× PBS. Centrifugation was performed in the same condition and PBS was removed, then 200 μl of ice-cold trichloridic acid (TCA, Merck, USA) was added and mixed for 2 min, then reacted at 4° C. for 5 min to remove residue of 3H-thymidine.
[0172]After centrifugation in the same condition as described above, supernatants were removed and T lymphocytes were fixed by incubation at 4° C. for 5 min after 200 μl of ice-cold 70% ethanol was added. Supernatants were removed after centrifugation, and 3H-thymidine (Amersham, USA) residue was completely removed by treatment of 10% TCA in the same method as described above.
[0173]Cell lysis was performed by reaction with 100 μl of 2% SDS (pH 8.0) and 0.5N of NaOH at 37° C. for 30 min, and T lymphocytes were precipitated by centrifugation at 25° C., 110×g for 10 min, and then 50 μl of supernatants was transferred to 96-well sample plate (Wallac, USA). After 1.5 volume of OptiPhase SuperMix (Wallac, USA) was added into the supernatants and mixed for 5 min, the existence of T lymphocyte proliferation was confirmed by measurement of cpm value of 3H using 1450 MicroBeta TriLux microplate liquid scintillation and luminescence counter (Wallac, USA).
Example 8
Experiment of Effect on Increase of Plasma Half-Life of Glycosylated Concatameric Fusion Dimeric Proteins in Mouse
[0174]The measurement of plasma half-life of glycosylated concatameric fusion dimeric proteins, [mgTNFR1-TNFR1/Fc]2, [mgTNFR2-TNFR2/Fc]2, [mgCD2-CD2/Fc]2, and [mgCTLA4-CTLA4/Fc]2 was performed by measuring the concentration of proteins using ELISA after 5 μg of purified fusion proteins was i.p. injected into mouse (ICR, Samtako, Korea) and bloods were extracted at regular interval for 120 hrs (5 days) as maximum. As shown FIG. 20, FIG. 21, and FIG. 22, it could be seen that the plasma half-life of glycosylated concatameric fusion dimeric proteins have been increased in comparison of the corresponding simple fusion dimeric proteins of native shape, and the increase in efficacy through continuous effect could be expected.
Example 9
Experiment of Effects of Simple/Concatameric TNFR/Fc Fusion Protein Dimers on Collagen-Induced Arthritis of DBA/1 Mouse
[0175]Collagen Induced Arthritis (CIA) was developed by injection with 100 μg per DBA/1 mouse of type II collagen dissolved at 2 mg/ml concentration in 0.05M acetic acid and Arthrogen-CIA adjuvant (Chondrex, USA) into tail. Boosting was performed after 3 weeks, and incomplete Freund's adjuvant (Difco, USA) was used.
[0176]Arthritis was developed 3˜4 weeks after immunization with 100 μg of type II collagen in the DBA/1 mice. Red and swollen paws of mice had been observed 3˜5 days after onset, and inflammatory arthritis lasted more than 3-4 weeks. Although inflammation was eventually alleviated, damaged joints remained rigid permanently. The degree of arthritis was measured 2˜3 times per week on the basis of table 12 which represented subjective index of arthritis severity (measure average of five mice in each experiment). To measure the effects of simple and concatameric fusion dimeric TNFR/Fc on CIA, TNFR/Fc or PBS was i.p. injected into the mice. TNFR/Fc was injected with 10 μg at every 2 days for 19˜45 days into 5 mice per experiments (arrows in FIG. 23). PBS was injected into 5 mice as control. As shown in FIG. 7, in the case of mice injected with existing simple dimeric shaped TNFR/Fc fusion protein, it could be seen that the effect decreased to about 26-38% in comparison with the figures of arthritis index in mice injected with PBS as control, but 42-55% decreased in case of concatameric shaped dimer, [TNFR1-TNFR1/Fc]2 and [TNFR2-TNFR2/Fc]2 were injected. Therefore, it could be shown that concatameric fusion dimeric TNFR/Fc fusion proteins have remarkably decreased arthritis of mouse than existing simple fusion dimeric TNFR/Fc fusion proteins.
TABLE-US-00012 TABLE 12 Severity score of arthritis Severity score Condition of disease 0 No erythema and swelling 1 Erythema and mild swelling limited to ankle and tarsal 2 Erythema and mild swelling spread from ankle to tarsal 3 Erythema and mild swelling spread from ankle to metatarsal joint 4 Erythema and severe swelling expend to ankle, legs, and digits
[0177]The results as above represented that concatameric shaped dimeric TNFR/Fc fusion proteins were more effective in decreasing the rate of CIA development than existing simple dimeric fusion proteins, therefore, as use in arthritis therapy, concatameric shaped protein compositions could be more effective therapeutics than existing protein compositions.
[0178]The concatameric proteins, concatameric fusion dimeric proteins and their glycosylated proteins of the present invention were able to express increased efficacy and high stability, and to be produced with high yield.
INDUSTRIAL APPLICABILITY
Sequence CWU
1
5211335DNAHomo sapiensCDS(1)..(1332)TNFR1-IgG 1atg ggc ctc tcc acc gtg cct
gac ctg ctg ctg ccg ctg gtg ctc ctg 48Met Gly Leu Ser Thr Val Pro
Asp Leu Leu Leu Pro Leu Val Leu Leu 1 5
10 15gag ctg ttg gtg gga ata tac ccc tca ggg gtt att gga
ctg gtc cct 96Glu Leu Leu Val Gly Ile Tyr Pro Ser Gly Val Ile Gly
Leu Val Pro 20 25 30cac cta
ggg gac agg gag aag aga gat agt gtg tgt ccc caa gga aaa 144His Leu
Gly Asp Arg Glu Lys Arg Asp Ser Val Cys Pro Gln Gly Lys 35
40 45tat atc cac cct caa aat aat tcg att tgc
tgt acc aag tgc cac aaa 192Tyr Ile His Pro Gln Asn Asn Ser Ile Cys
Cys Thr Lys Cys His Lys 50 55 60gga
acc tac ttg tac aat gac tgt cca ggc ccg ggg cag gat acg gac 240Gly
Thr Tyr Leu Tyr Asn Asp Cys Pro Gly Pro Gly Gln Asp Thr Asp 65
70 75 80tgc agg gag tgt gag agc
ggc tcc ttc acc gct tca gaa aac cac ctc 288Cys Arg Glu Cys Glu Ser
Gly Ser Phe Thr Ala Ser Glu Asn His Leu 85
90 95aga cac tgc ctc agc tgc tcc aaa tgc cga aag gaa
atg ggt cag gtg 336Arg His Cys Leu Ser Cys Ser Lys Cys Arg Lys Glu
Met Gly Gln Val 100 105 110gag
atc tct tct tgc aca gtg gac cgg gac acc gtg tgt ggc tgc agg 384Glu
Ile Ser Ser Cys Thr Val Asp Arg Asp Thr Val Cys Gly Cys Arg 115
120 125aag aac cag tac cgg cat tat tgg agt
gaa aac ctt ttc cag tgc ttc 432Lys Asn Gln Tyr Arg His Tyr Trp Ser
Glu Asn Leu Phe Gln Cys Phe 130 135
140aat tgc agc ctc tgc ctc aat ggg acc gtg cac ctc tcc tgc cag gag
480Asn Cys Ser Leu Cys Leu Asn Gly Thr Val His Leu Ser Cys Gln Glu145
150 155 160aaa cag aac acc
gtg tgc acc tgc cat gca ggt ttc ttt cta aga gaa 528Lys Gln Asn Thr
Val Cys Thr Cys His Ala Gly Phe Phe Leu Arg Glu 165
170 175aac gag tgt gtc tcc tgt agt aac tgt aag
aaa agc ctg gag tgc acg 576Asn Glu Cys Val Ser Cys Ser Asn Cys Lys
Lys Ser Leu Glu Cys Thr 180 185
190aag ttg tgc cta ccc cag att gag aat gtt aag ggc act gag gac tca
624Lys Leu Cys Leu Pro Gln Ile Glu Asn Val Lys Gly Thr Glu Asp Ser
195 200 205ggc acc aca gca gag ccc aaa
tct tgt gac aaa act cac aca tgc cca 672Gly Thr Thr Ala Glu Pro Lys
Ser Cys Asp Lys Thr His Thr Cys Pro 210 215
220ccg tgc cca gca cct gaa ctc ctg ggg gga ccg tca gtc ttc ctc ttc
720Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe225
230 235 240ccc cca aaa ccc
aag gac acc ctc atg atc tcc cgg acc cct gag gtc 768Pro Pro Lys Pro
Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val 245
250 255aca tgc gtg gtg gtg gac gtg agc cac gaa
gac cct gag gtc aag ttc 816Thr Cys Val Val Val Asp Val Ser His Glu
Asp Pro Glu Val Lys Phe 260 265
270aac tgg tac gtg gac ggc gtg gag gtg cat aat gcc aag aca aag ccg
864Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro
275 280 285cgg gag gag cag tac aac agc
acg tac cgg gtg gtc agc gtc ctc acc 912Arg Glu Glu Gln Tyr Asn Ser
Thr Tyr Arg Val Val Ser Val Leu Thr 290 295
300gtc ctg cac cag gac tgg ctg aat ggc aag gag tac aag tgc aag gtc
960Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val305
310 315 320tcc aac aaa gcc
ctc cca gcc ccc atc gag aaa acc atc tcc aaa gcc 1008Ser Asn Lys Ala
Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala 325
330 335aaa ggg cag ccc cga gaa cca cag gtg tac
acc ctg ccc cca tcc cgg 1056Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr
Thr Leu Pro Pro Ser Arg 340 345
350gat gag ctg acc aag aac cag gtc agc ctg acc tgc ctg gtc aaa ggc
1104Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly
355 360 365ttc tat ccc agc gac atc gcc
gtg gag tgg gag agc aat ggg cag ccg 1152Phe Tyr Pro Ser Asp Ile Ala
Val Glu Trp Glu Ser Asn Gly Gln Pro 370 375
380gag aac aac tac aag acc acg cct ccc gtg ctg gac tcc gac ggc tcc
1200Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser385
390 395 400tcc ttc ctc tac
agc aag ctc acc gtg gac aag agc agg tgg cag cag 1248Ser Phe Leu Tyr
Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln 405
410 415ggg aac gtc ttc tca tgc tcc gtg atg cat
gag gct ctg cac aac cac 1296Gly Asn Val Phe Ser Cys Ser Val Met His
Glu Ala Leu His Asn His 420 425
430tac acg cag aag agc ctc tcc ctg tct ccg ggt aaa tga
1335Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 435
4402444PRTHomo sapiens 2Met Gly Leu Ser Thr Val Pro Asp Leu Leu Leu
Pro Leu Val Leu Leu 1 5 10
15Glu Leu Leu Val Gly Ile Tyr Pro Ser Gly Val Ile Gly Leu Val Pro
20 25 30His Leu Gly Asp Arg Glu
Lys Arg Asp Ser Val Cys Pro Gln Gly Lys 35 40
45Tyr Ile His Pro Gln Asn Asn Ser Ile Cys Cys Thr Lys Cys
His Lys 50 55 60Gly Thr Tyr Leu Tyr
Asn Asp Cys Pro Gly Pro Gly Gln Asp Thr Asp 65 70
75 80Cys Arg Glu Cys Glu Ser Gly Ser Phe Thr
Ala Ser Glu Asn His Leu 85 90
95Arg His Cys Leu Ser Cys Ser Lys Cys Arg Lys Glu Met Gly Gln Val
100 105 110Glu Ile Ser Ser Cys
Thr Val Asp Arg Asp Thr Val Cys Gly Cys Arg 115
120 125Lys Asn Gln Tyr Arg His Tyr Trp Ser Glu Asn Leu
Phe Gln Cys Phe 130 135 140Asn Cys Ser
Leu Cys Leu Asn Gly Thr Val His Leu Ser Cys Gln Glu145
150 155 160Lys Gln Asn Thr Val Cys Thr
Cys His Ala Gly Phe Phe Leu Arg Glu 165
170 175Asn Glu Cys Val Ser Cys Ser Asn Cys Lys Lys Ser
Leu Glu Cys Thr 180 185 190Lys
Leu Cys Leu Pro Gln Ile Glu Asn Val Lys Gly Thr Glu Asp Ser 195
200 205Gly Thr Thr Ala Glu Pro Lys Ser Cys
Asp Lys Thr His Thr Cys Pro 210 215
220Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe225
230 235 240Pro Pro Lys Pro
Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val 245
250 255Thr Cys Val Val Val Asp Val Ser His Glu
Asp Pro Glu Val Lys Phe 260 265
270Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro
275 280 285Arg Glu Glu Gln Tyr Asn Ser
Thr Tyr Arg Val Val Ser Val Leu Thr 290 295
300Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys
Val305 310 315 320Ser Asn
Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala
325 330 335Lys Gly Gln Pro Arg Glu Pro
Gln Val Tyr Thr Leu Pro Pro Ser Arg 340 345
350Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val
Lys Gly 355 360 365Phe Tyr Pro Ser
Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro 370
375 380Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp
Ser Asp Gly Ser385 390 395
400Ser Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln
405 410 415Gly Asn Val Phe Ser
Cys Ser Val Met His Glu Ala Leu His Asn His 420
425 430Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys
435 44031473DNAHomo sapiensCDS(1)..(1470)TNFR2-IgG
3atg gcg ccc gtc gcc gtc tgg gcc gcg ctg gcc gtc gga ctg gag ctc
48Met Ala Pro Val Ala Val Trp Ala Ala Leu Ala Val Gly Leu Glu Leu 1
5 10 15tgg gct gcg gcg cac gcc
ttg ccc gcc cag gtg gca ttt aca ccc tac 96Trp Ala Ala Ala His Ala
Leu Pro Ala Gln Val Ala Phe Thr Pro Tyr 20
25 30gcc ccg gag ccc ggg agc aca tgc cgg ctc aga gaa tac
tat gac cag 144Ala Pro Glu Pro Gly Ser Thr Cys Arg Leu Arg Glu Tyr
Tyr Asp Gln 35 40 45aca gct cag
atg tgc tgc agc aaa tgc tcg ccg ggc caa cat gca aaa 192Thr Ala Gln
Met Cys Cys Ser Lys Cys Ser Pro Gly Gln His Ala Lys 50
55 60gtc ttc tgt acc aag acc tcg gac acc gtg tgt gac
tcc tgt gag gac 240Val Phe Cys Thr Lys Thr Ser Asp Thr Val Cys Asp
Ser Cys Glu Asp 65 70 75
80agc aca tac acc cag ctc tgg aac tgg gtt ccc gag tgc ttg agc tgt
288Ser Thr Tyr Thr Gln Leu Trp Asn Trp Val Pro Glu Cys Leu Ser Cys
85 90 95ggc tcc cgc tgt agc
tct gac cag gtg gaa act caa gcc tgc act cgg 336Gly Ser Arg Cys Ser
Ser Asp Gln Val Glu Thr Gln Ala Cys Thr Arg 100
105 110gaa cag aac cgc atc tgc acc tgc agg ccc ggc tgg
tac tgc gcg ctg 384Glu Gln Asn Arg Ile Cys Thr Cys Arg Pro Gly Trp
Tyr Cys Ala Leu 115 120 125agc aag
cag gag ggg tgc cgg ctg tgc gcg ccg ctg cgc aag tgc cgc 432Ser Lys
Gln Glu Gly Cys Arg Leu Cys Ala Pro Leu Arg Lys Cys Arg 130
135 140ccg ggc ttc ggc gtg gcc aga cca gga act gaa
aca tca gac gtg gtg 480Pro Gly Phe Gly Val Ala Arg Pro Gly Thr Glu
Thr Ser Asp Val Val145 150 155
160tgc aag ccc tgt gcc ccg ggg acg ttc tcc aac acg act tca tcc acg
528Cys Lys Pro Cys Ala Pro Gly Thr Phe Ser Asn Thr Thr Ser Ser Thr
165 170 175gat att tgc agg ccc
cac cag atc tgt aac gtg gtg gcc atc cct ggg 576Asp Ile Cys Arg Pro
His Gln Ile Cys Asn Val Val Ala Ile Pro Gly 180
185 190aat gca agc atg gat gca gtc tgc acg tcc acg tcc
ccc acc cgg agt 624Asn Ala Ser Met Asp Ala Val Cys Thr Ser Thr Ser
Pro Thr Arg Ser 195 200 205atg gcc
cca ggg gca gta cac tta ccc cag cca gtg tcc aca cga tcc 672Met Ala
Pro Gly Ala Val His Leu Pro Gln Pro Val Ser Thr Arg Ser 210
215 220caa cac acg cag cca act cca gaa ccc agc act
gct cca agc acc tcc 720Gln His Thr Gln Pro Thr Pro Glu Pro Ser Thr
Ala Pro Ser Thr Ser225 230 235
240ttc ctg ctc cca atg ggc ccc agc ccc cca gct gaa ggg agc act ggc
768Phe Leu Leu Pro Met Gly Pro Ser Pro Pro Ala Glu Gly Ser Thr Gly
245 250 255gac gca gag ccc aaa
tct tgt gac aaa act cac aca tgc cca ccg tgc 816Asp Ala Glu Pro Lys
Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys 260
265 270cca gca cct gaa ctc ctg ggg gga ccg tca gtc ttc
ctc ttc ccc cca 864Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe
Leu Phe Pro Pro 275 280 285aaa ccc
aag gac acc ctc atg atc tcc cgg acc cct gag gtc aca tgc 912Lys Pro
Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys 290
295 300gtg gtg gtg gac gtg agc cac gaa gac cct gag
gtc aag ttc aac tgg 960Val Val Val Asp Val Ser His Glu Asp Pro Glu
Val Lys Phe Asn Trp305 310 315
320tac gtg gac ggc gtg gag gtg cat aat gcc aag aca aag ccg cgg gag
1008Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu
325 330 335gag cag tac aac agc
acg tac cgg gtg gtc agc gtc ctc acc gtc ctg 1056Glu Gln Tyr Asn Ser
Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu 340
345 350cac cag gac tgg ctg aat ggc aag gag tac aag tgc
aag gtc tcc aac 1104His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys
Lys Val Ser Asn 355 360 365aaa gcc
ctc cca gcc ccc atc gag aaa acc atc tcc aaa gcc aaa ggg 1152Lys Ala
Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly 370
375 380cag ccc cga gaa cca cag gtg tac acc ctg ccc
cca tcc cgg gat gag 1200Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro
Pro Ser Arg Asp Glu385 390 395
400ctg acc aag aac cag gtc agc ctg acc tgc ctg gtc aaa ggc ttc tat
1248Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr
405 410 415ccc agc gac atc gcc
gtg gag tgg gag agc aat ggg cag ccg gag aac 1296Pro Ser Asp Ile Ala
Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn 420
425 430aac tac aag acc acg cct ccc gtg ctg gac tcc gac
ggc tcc tcc ttc 1344Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp
Gly Ser Ser Phe 435 440 445ctc tac
agc aag ctc acc gtg gac aag agc agg tgg cag cag ggg aac 1392Leu Tyr
Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn 450
455 460gtc ttc tca tgc tcc gtg atg cat gag gct ctg
cac aac cac tac acg 1440Val Phe Ser Cys Ser Val Met His Glu Ala Leu
His Asn His Tyr Thr465 470 475
480cag aag agc ctc tcc ctg tct ccg ggt aaa tga
1473Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 485
4904490PRTHomo sapiens 4Met Ala Pro Val Ala Val Trp Ala Ala Leu
Ala Val Gly Leu Glu Leu 1 5 10
15Trp Ala Ala Ala His Ala Leu Pro Ala Gln Val Ala Phe Thr Pro Tyr
20 25 30Ala Pro Glu Pro Gly
Ser Thr Cys Arg Leu Arg Glu Tyr Tyr Asp Gln 35
40 45Thr Ala Gln Met Cys Cys Ser Lys Cys Ser Pro Gly Gln
His Ala Lys 50 55 60Val Phe Cys Thr
Lys Thr Ser Asp Thr Val Cys Asp Ser Cys Glu Asp 65 70
75 80Ser Thr Tyr Thr Gln Leu Trp Asn Trp
Val Pro Glu Cys Leu Ser Cys 85 90
95Gly Ser Arg Cys Ser Ser Asp Gln Val Glu Thr Gln Ala Cys Thr
Arg 100 105 110Glu Gln Asn Arg
Ile Cys Thr Cys Arg Pro Gly Trp Tyr Cys Ala Leu 115
120 125Ser Lys Gln Glu Gly Cys Arg Leu Cys Ala Pro Leu
Arg Lys Cys Arg 130 135 140Pro Gly Phe
Gly Val Ala Arg Pro Gly Thr Glu Thr Ser Asp Val Val145
150 155 160Cys Lys Pro Cys Ala Pro Gly
Thr Phe Ser Asn Thr Thr Ser Ser Thr 165
170 175Asp Ile Cys Arg Pro His Gln Ile Cys Asn Val Val
Ala Ile Pro Gly 180 185 190Asn
Ala Ser Met Asp Ala Val Cys Thr Ser Thr Ser Pro Thr Arg Ser 195
200 205Met Ala Pro Gly Ala Val His Leu Pro
Gln Pro Val Ser Thr Arg Ser 210 215
220Gln His Thr Gln Pro Thr Pro Glu Pro Ser Thr Ala Pro Ser Thr Ser225
230 235 240Phe Leu Leu Pro
Met Gly Pro Ser Pro Pro Ala Glu Gly Ser Thr Gly 245
250 255Asp Ala Glu Pro Lys Ser Cys Asp Lys Thr
His Thr Cys Pro Pro Cys 260 265
270Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro
275 280 285Lys Pro Lys Asp Thr Leu Met
Ile Ser Arg Thr Pro Glu Val Thr Cys 290 295
300Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn
Trp305 310 315 320Tyr Val
Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu
325 330 335Glu Gln Tyr Asn Ser Thr Tyr
Arg Val Val Ser Val Leu Thr Val Leu 340 345
350His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val
Ser Asn 355 360 365Lys Ala Leu Pro
Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly 370
375 380Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro
Ser Arg Asp Glu385 390 395
400Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr
405 410 415Pro Ser Asp Ile Ala
Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn 420
425 430Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp
Gly Ser Ser Phe 435 440 445Leu Tyr
Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn 450
455 460Val Phe Ser Cys Ser Val Met His Glu Ala Leu
His Asn His Tyr Thr465 470 475
480Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 485
49051887DNAHomo sapiensCDS(1)..(1884)TNFR1-TNFR1-IgG 5atg ggc
ctc tcc acc gtg cct gac ctg ctg ctg ccg ctg gtg ctc ctg 48Met Gly
Leu Ser Thr Val Pro Asp Leu Leu Leu Pro Leu Val Leu Leu 1
5 10 15gag ctg ttg gtg gga ata tac ccc
tca ggg gtt att gga ctg gtc cct 96Glu Leu Leu Val Gly Ile Tyr Pro
Ser Gly Val Ile Gly Leu Val Pro 20 25
30cac cta ggg gac agg gag aag aga gat agt gtg tgt ccc caa gga
aaa 144His Leu Gly Asp Arg Glu Lys Arg Asp Ser Val Cys Pro Gln Gly
Lys 35 40 45tat atc cac cct caa
aat aat tcg att tgc tgt acc aag tgc cac aaa 192Tyr Ile His Pro Gln
Asn Asn Ser Ile Cys Cys Thr Lys Cys His Lys 50 55
60gga acc tac ttg tac aat gac tgt cca ggc ccg ggg cag gat
acg gac 240Gly Thr Tyr Leu Tyr Asn Asp Cys Pro Gly Pro Gly Gln Asp
Thr Asp 65 70 75 80tgc
agg gag tgt gag agc ggc tcc ttc acc gct tca gaa aac cac ctc 288Cys
Arg Glu Cys Glu Ser Gly Ser Phe Thr Ala Ser Glu Asn His Leu
85 90 95aga cac tgc ctc agc tgc tcc
aaa tgc cga aag gaa atg ggt cag gtg 336Arg His Cys Leu Ser Cys Ser
Lys Cys Arg Lys Glu Met Gly Gln Val 100 105
110gag atc tct tct tgc aca gtg gac cgg gac acc gtg tgt ggc
tgc agg 384Glu Ile Ser Ser Cys Thr Val Asp Arg Asp Thr Val Cys Gly
Cys Arg 115 120 125aag aac cag tac
cgg cat tat tgg agt gaa aac ctt ttc cag tgc ttc 432Lys Asn Gln Tyr
Arg His Tyr Trp Ser Glu Asn Leu Phe Gln Cys Phe 130
135 140aat tgc agc ctc tgc ctc aat ggg acc gtg cac ctc
tcc tgc cag gag 480Asn Cys Ser Leu Cys Leu Asn Gly Thr Val His Leu
Ser Cys Gln Glu145 150 155
160aaa cag aac acc gtg tgc acc tgc cat gca ggt ttc ttt cta aga gaa
528Lys Gln Asn Thr Val Cys Thr Cys His Ala Gly Phe Phe Leu Arg Glu
165 170 175aac gag tgt gtc tcc
tgt agt aac tgt aag aaa agc ctg gag tgc acg 576Asn Glu Cys Val Ser
Cys Ser Asn Cys Lys Lys Ser Leu Glu Cys Thr 180
185 190aag ttg tgc cta ccc cag att gag aat gtt aag ggc
act gag gac gga 624Lys Leu Cys Leu Pro Gln Ile Glu Asn Val Lys Gly
Thr Glu Asp Gly 195 200 205tcc ggg
aac att tca ctg gtc cct cac cta ggg gac agg gag aag aga 672Ser Gly
Asn Ile Ser Leu Val Pro His Leu Gly Asp Arg Glu Lys Arg 210
215 220gat agt gtg tgt ccc caa gga aaa tat atc cac
cct caa aat aat tcg 720Asp Ser Val Cys Pro Gln Gly Lys Tyr Ile His
Pro Gln Asn Asn Ser225 230 235
240att tgc tgt acc aag tgc cac aaa gga acc tac ttg tac aat gac tgt
768Ile Cys Cys Thr Lys Cys His Lys Gly Thr Tyr Leu Tyr Asn Asp Cys
245 250 255cca ggc ccg ggg cag
gat acg gac tgc agg gag tgt gag agc ggc tcc 816Pro Gly Pro Gly Gln
Asp Thr Asp Cys Arg Glu Cys Glu Ser Gly Ser 260
265 270ttc acc gct tca gaa aac cac ctc aga cac tgc ctc
agc tgc tcc aaa 864Phe Thr Ala Ser Glu Asn His Leu Arg His Cys Leu
Ser Cys Ser Lys 275 280 285tgc cga
aag gaa atg ggt cag gtg gag atc tct tct tgc aca gtg gac 912Cys Arg
Lys Glu Met Gly Gln Val Glu Ile Ser Ser Cys Thr Val Asp 290
295 300cgg gac acc gtg tgt ggc tgc agg aag aac cag
tac cgg cat tat tgg 960Arg Asp Thr Val Cys Gly Cys Arg Lys Asn Gln
Tyr Arg His Tyr Trp305 310 315
320agt gaa aac ctt ttc cag tgc ttc aat tgc agc ctc tgc ctc aat ggg
1008Ser Glu Asn Leu Phe Gln Cys Phe Asn Cys Ser Leu Cys Leu Asn Gly
325 330 335acc gtg cac ctc tcc
tgc cag gag aaa cag aac acc gtg tgc acc tgc 1056Thr Val His Leu Ser
Cys Gln Glu Lys Gln Asn Thr Val Cys Thr Cys 340
345 350cat gca ggt ttc ttt cta aga gaa aac gag tgt gtc
tcc tgt agt aac 1104His Ala Gly Phe Phe Leu Arg Glu Asn Glu Cys Val
Ser Cys Ser Asn 355 360 365tgt aag
aaa agc ctg gag tgc acg aag ttg tgc cta ccc cag att gag 1152Cys Lys
Lys Ser Leu Glu Cys Thr Lys Leu Cys Leu Pro Gln Ile Glu 370
375 380aat gtt aag ggc act gag gac tca ggc acc aca
gca gag ccc aaa tct 1200Asn Val Lys Gly Thr Glu Asp Ser Gly Thr Thr
Ala Glu Pro Lys Ser385 390 395
400tgt gac aaa act cac aca tgc cca ccg tgc cca gca cct gaa ctc ctg
1248Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu
405 410 415ggg gga ccg tca gtc
ttc ctc ttc ccc cca aaa ccc aag gac acc ctc 1296Gly Gly Pro Ser Val
Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu 420
425 430atg atc tcc cgg acc cct gag gtc aca tgc gtg gtg
gtg gac gtg agc 1344Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val
Val Asp Val Ser 435 440 445cac gaa
gac cct gag gtc aag ttc aac tgg tac gtg gac ggc gtg gag 1392His Glu
Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu 450
455 460gtg cat aat gcc aag aca aag ccg cgg gag gag
cag tac aac agc acg 1440Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu
Gln Tyr Asn Ser Thr465 470 475
480tac cgg gtg gtc agc gtc ctc acc gtc ctg cac cag gac tgg ctg aat
1488Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn
485 490 495ggc aag gag tac aag
tgc aag gtc tcc aac aaa gcc ctc cca gcc ccc 1536Gly Lys Glu Tyr Lys
Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro 500
505 510atc gag aaa acc atc tcc aaa gcc aaa ggg cag ccc
cga gaa cca cag 1584Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro
Arg Glu Pro Gln 515 520 525gtg tac
acc ctg ccc cca tcc cgg gat gag ctg acc aag aac cag gtc 1632Val Tyr
Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val 530
535 540agc ctg acc tgc ctg gtc aaa ggc ttc tat ccc
agc gac atc gcc gtg 1680Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro
Ser Asp Ile Ala Val545 550 555
560gag tgg gag agc aat ggg cag ccg gag aac aac tac aag acc acg cct
1728Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro
565 570 575ccc gtg ctg gac tcc
gac ggc tcc tcc ttc ctc tac agc aag ctc acc 1776Pro Val Leu Asp Ser
Asp Gly Ser Ser Phe Leu Tyr Ser Lys Leu Thr 580
585 590gtg gac aag agc agg tgg cag cag ggg aac gtc ttc
tca tgc tcc gtg 1824Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe
Ser Cys Ser Val 595 600 605atg cat
gag gct ctg cac aac cac tac acg cag aag agc ctc tcc ctg 1872Met His
Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu 610
615 620tct ccg ggt aaa tga
1887Ser Pro Gly Lys6256628PRTHomo sapiens 6Met Gly
Leu Ser Thr Val Pro Asp Leu Leu Leu Pro Leu Val Leu Leu 1
5 10 15Glu Leu Leu Val Gly Ile Tyr Pro
Ser Gly Val Ile Gly Leu Val Pro 20 25
30His Leu Gly Asp Arg Glu Lys Arg Asp Ser Val Cys Pro Gln Gly
Lys 35 40 45Tyr Ile His Pro Gln
Asn Asn Ser Ile Cys Cys Thr Lys Cys His Lys 50 55
60Gly Thr Tyr Leu Tyr Asn Asp Cys Pro Gly Pro Gly Gln Asp
Thr Asp 65 70 75 80Cys
Arg Glu Cys Glu Ser Gly Ser Phe Thr Ala Ser Glu Asn His Leu
85 90 95Arg His Cys Leu Ser Cys Ser
Lys Cys Arg Lys Glu Met Gly Gln Val 100 105
110Glu Ile Ser Ser Cys Thr Val Asp Arg Asp Thr Val Cys Gly
Cys Arg 115 120 125Lys Asn Gln Tyr
Arg His Tyr Trp Ser Glu Asn Leu Phe Gln Cys Phe 130
135 140Asn Cys Ser Leu Cys Leu Asn Gly Thr Val His Leu
Ser Cys Gln Glu145 150 155
160Lys Gln Asn Thr Val Cys Thr Cys His Ala Gly Phe Phe Leu Arg Glu
165 170 175Asn Glu Cys Val Ser
Cys Ser Asn Cys Lys Lys Ser Leu Glu Cys Thr 180
185 190Lys Leu Cys Leu Pro Gln Ile Glu Asn Val Lys Gly
Thr Glu Asp Gly 195 200 205Ser Gly
Asn Ile Ser Leu Val Pro His Leu Gly Asp Arg Glu Lys Arg 210
215 220Asp Ser Val Cys Pro Gln Gly Lys Tyr Ile His
Pro Gln Asn Asn Ser225 230 235
240Ile Cys Cys Thr Lys Cys His Lys Gly Thr Tyr Leu Tyr Asn Asp Cys
245 250 255Pro Gly Pro Gly
Gln Asp Thr Asp Cys Arg Glu Cys Glu Ser Gly Ser 260
265 270Phe Thr Ala Ser Glu Asn His Leu Arg His Cys
Leu Ser Cys Ser Lys 275 280 285Cys
Arg Lys Glu Met Gly Gln Val Glu Ile Ser Ser Cys Thr Val Asp 290
295 300Arg Asp Thr Val Cys Gly Cys Arg Lys Asn
Gln Tyr Arg His Tyr Trp305 310 315
320Ser Glu Asn Leu Phe Gln Cys Phe Asn Cys Ser Leu Cys Leu Asn
Gly 325 330 335Thr Val His
Leu Ser Cys Gln Glu Lys Gln Asn Thr Val Cys Thr Cys 340
345 350His Ala Gly Phe Phe Leu Arg Glu Asn Glu
Cys Val Ser Cys Ser Asn 355 360
365Cys Lys Lys Ser Leu Glu Cys Thr Lys Leu Cys Leu Pro Gln Ile Glu 370
375 380Asn Val Lys Gly Thr Glu Asp Ser
Gly Thr Thr Ala Glu Pro Lys Ser385 390
395 400Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala
Pro Glu Leu Leu 405 410
415Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu
420 425 430Met Ile Ser Arg Thr Pro
Glu Val Thr Cys Val Val Val Asp Val Ser 435 440
445His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly
Val Glu 450 455 460Val His Asn Ala Lys
Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr465 470
475 480Tyr Arg Val Val Ser Val Leu Thr Val Leu
His Gln Asp Trp Leu Asn 485 490
495Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro
500 505 510Ile Glu Lys Thr Ile
Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln 515
520 525Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr
Lys Asn Gln Val 530 535 540Ser Leu Thr
Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val545
550 555 560Glu Trp Glu Ser Asn Gly Gln
Pro Glu Asn Asn Tyr Lys Thr Thr Pro 565
570 575Pro Val Leu Asp Ser Asp Gly Ser Ser Phe Leu Tyr
Ser Lys Leu Thr 580 585 590Val
Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val 595
600 605Met His Glu Ala Leu His Asn His Tyr
Thr Gln Lys Ser Leu Ser Leu 610 615
620Ser Pro Gly Lys62572163DNAHomo sapiensCDS(1)..(2160)TNFR2-TNFR2-IgG
7atg gcg ccc gtc gcc gtc tgg gcc gcg ctg gcc gtc gga ctg gag ctc
48Met Ala Pro Val Ala Val Trp Ala Ala Leu Ala Val Gly Leu Glu Leu 1
5 10 15tgg gct gcg gcg cac gcc
ttg ccc gcc cag gtg gca ttt aca ccc tac 96Trp Ala Ala Ala His Ala
Leu Pro Ala Gln Val Ala Phe Thr Pro Tyr 20
25 30gcc ccg gag ccc ggg agc aca tgc cgg ctc aga gaa tac
tat gac cag 144Ala Pro Glu Pro Gly Ser Thr Cys Arg Leu Arg Glu Tyr
Tyr Asp Gln 35 40 45aca gct cag
atg tgc tgc agc aaa tgc tcg ccg ggc caa cat gca aaa 192Thr Ala Gln
Met Cys Cys Ser Lys Cys Ser Pro Gly Gln His Ala Lys 50
55 60gtc ttc tgt acc aag acc tcg gac acc gtg tgt gac
tcc tgt gag gac 240Val Phe Cys Thr Lys Thr Ser Asp Thr Val Cys Asp
Ser Cys Glu Asp 65 70 75
80agc aca tac acc cag ctc tgg aac tgg gtt ccc gag tgc ttg agc tgt
288Ser Thr Tyr Thr Gln Leu Trp Asn Trp Val Pro Glu Cys Leu Ser Cys
85 90 95ggc tcc cgc tgt agc
tct gac cag gtg gaa act caa gcc tgc act cgg 336Gly Ser Arg Cys Ser
Ser Asp Gln Val Glu Thr Gln Ala Cys Thr Arg 100
105 110gaa cag aac cgc atc tgc acc tgc agg ccc ggc tgg
tac tgc gcg ctg 384Glu Gln Asn Arg Ile Cys Thr Cys Arg Pro Gly Trp
Tyr Cys Ala Leu 115 120 125agc aag
cag gag ggg tgc cgg ctg tgc gcg ccg ctg cgc aag tgc cgc 432Ser Lys
Gln Glu Gly Cys Arg Leu Cys Ala Pro Leu Arg Lys Cys Arg 130
135 140ccg ggc ttc ggc gtg gcc aga cca gga act gaa
aca tca gac gtg gtg 480Pro Gly Phe Gly Val Ala Arg Pro Gly Thr Glu
Thr Ser Asp Val Val145 150 155
160tgc aag ccc tgt gcc ccg ggg acg ttc tcc aac acg act tca tcc acg
528Cys Lys Pro Cys Ala Pro Gly Thr Phe Ser Asn Thr Thr Ser Ser Thr
165 170 175gat att tgc agg ccc
cac cag atc tgt aac gtg gtg gcc atc cct ggg 576Asp Ile Cys Arg Pro
His Gln Ile Cys Asn Val Val Ala Ile Pro Gly 180
185 190aat gca agc atg gat gca gtc tgc acg tcc acg tcc
ccc acc cgg agt 624Asn Ala Ser Met Asp Ala Val Cys Thr Ser Thr Ser
Pro Thr Arg Ser 195 200 205atg gcc
cca ggg gca gta cac tta ccc cag cca gtg tcc aca cga tcc 672Met Ala
Pro Gly Ala Val His Leu Pro Gln Pro Val Ser Thr Arg Ser 210
215 220caa cac acg cag cca act cca gaa ccc agc act
gct cca agc acc tcc 720Gln His Thr Gln Pro Thr Pro Glu Pro Ser Thr
Ala Pro Ser Thr Ser225 230 235
240ttc ctg ctc cca atg ggc ccc agc ccc cca gct gaa ggg agc gga tcc
768Phe Leu Leu Pro Met Gly Pro Ser Pro Pro Ala Glu Gly Ser Gly Ser
245 250 255aac gca act aca ccc
tac gcc ccg gag ccc ggg agc aca tgc cgg ctc 816Asn Ala Thr Thr Pro
Tyr Ala Pro Glu Pro Gly Ser Thr Cys Arg Leu 260
265 270aga gaa tac tat gac cag aca gct cag atg tgc tgc
agc aaa tgc tcg 864Arg Glu Tyr Tyr Asp Gln Thr Ala Gln Met Cys Cys
Ser Lys Cys Ser 275 280 285ccg ggc
caa cat gca aaa gtc ttc tgt acc aag acc tcg gac acc gtg 912Pro Gly
Gln His Ala Lys Val Phe Cys Thr Lys Thr Ser Asp Thr Val 290
295 300tgt gac tcc tgt gag gac agc aca tac acc cag
ctc tgg aac tgg gtt 960Cys Asp Ser Cys Glu Asp Ser Thr Tyr Thr Gln
Leu Trp Asn Trp Val305 310 315
320ccc gag tgc ttg agc tgt ggc tcc cgc tgt agc tct gac cag gtg gaa
1008Pro Glu Cys Leu Ser Cys Gly Ser Arg Cys Ser Ser Asp Gln Val Glu
325 330 335act caa gcc tgc act
cgg gaa cag aac cgc atc tgc acc tgc agg ccc 1056Thr Gln Ala Cys Thr
Arg Glu Gln Asn Arg Ile Cys Thr Cys Arg Pro 340
345 350ggc tgg tac tgc gcg ctg agc aag cag gag ggg tgc
cgg ctg tgc gcg 1104Gly Trp Tyr Cys Ala Leu Ser Lys Gln Glu Gly Cys
Arg Leu Cys Ala 355 360 365ccg ctg
cgc aag tgc cgc ccg ggc ttc ggc gtg gcc aga cca gga act 1152Pro Leu
Arg Lys Cys Arg Pro Gly Phe Gly Val Ala Arg Pro Gly Thr 370
375 380gaa aca tca gac gtg gtg tgc aag ccc tgt gcc
ccg ggg acg ttc tcc 1200Glu Thr Ser Asp Val Val Cys Lys Pro Cys Ala
Pro Gly Thr Phe Ser385 390 395
400aac acg act tca tcc acg gat att tgc agg ccc cac cag atc tgt aac
1248Asn Thr Thr Ser Ser Thr Asp Ile Cys Arg Pro His Gln Ile Cys Asn
405 410 415gtg gtg gcc atc cct
ggg aat gca agc atg gat gca gtc tgc acg tcc 1296Val Val Ala Ile Pro
Gly Asn Ala Ser Met Asp Ala Val Cys Thr Ser 420
425 430acg tcc ccc acc cgg agt atg gcc cca ggg gca gta
cac tta ccc cag 1344Thr Ser Pro Thr Arg Ser Met Ala Pro Gly Ala Val
His Leu Pro Gln 435 440 445cca gtg
tcc aca cga tcc caa cac acg cag cca act cca gaa ccc agc 1392Pro Val
Ser Thr Arg Ser Gln His Thr Gln Pro Thr Pro Glu Pro Ser 450
455 460act gct cca agc acc tcc ttc ctg ctc cca atg
ggc ccc agc ccc cca 1440Thr Ala Pro Ser Thr Ser Phe Leu Leu Pro Met
Gly Pro Ser Pro Pro465 470 475
480gct gaa ggg agc act ggc gac gca gag ccc aaa tct tgt gac aaa act
1488Ala Glu Gly Ser Thr Gly Asp Ala Glu Pro Lys Ser Cys Asp Lys Thr
485 490 495cac aca tgc cca ccg
tgc cca gca cct gaa ctc ctg ggg gga ccg tca 1536His Thr Cys Pro Pro
Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser 500
505 510gtc ttc ctc ttc ccc cca aaa ccc aag gac acc ctc
atg atc tcc cgg 1584Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu
Met Ile Ser Arg 515 520 525acc cct
gag gtc aca tgc gtg gtg gtg gac gtg agc cac gaa gac cct 1632Thr Pro
Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro 530
535 540gag gtc aag ttc aac tgg tac gtg gac ggc gtg
gag gtg cat aat gcc 1680Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val
Glu Val His Asn Ala545 550 555
560aag aca aag ccg cgg gag gag cag tac aac agc acg tac cgg gtg gtc
1728Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val
565 570 575agc gtc ctc acc gtc
ctg cac cag gac tgg ctg aat ggc aag gag tac 1776Ser Val Leu Thr Val
Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr 580
585 590aag tgc aag gtc tcc aac aaa gcc ctc cca gcc ccc
atc gag aaa acc 1824Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro
Ile Glu Lys Thr 595 600 605atc tcc
aaa gcc aaa ggg cag ccc cga gaa cca cag gtg tac acc ctg 1872Ile Ser
Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu 610
615 620ccc cca tcc cgg gat gag ctg acc aag aac cag
gtc agc ctg acc tgc 1920Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln
Val Ser Leu Thr Cys625 630 635
640ctg gtc aaa ggc ttc tat ccc agc gac atc gcc gtg gag tgg gag agc
1968Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser
645 650 655aat ggg cag ccg gag
aac aac tac aag acc acg cct ccc gtg ctg gac 2016Asn Gly Gln Pro Glu
Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp 660
665 670tcc gac ggc tcc tcc ttc ctc tac agc aag ctc acc
gtg gac aag agc 2064Ser Asp Gly Ser Ser Phe Leu Tyr Ser Lys Leu Thr
Val Asp Lys Ser 675 680 685agg tgg
cag cag ggg aac gtc ttc tca tgc tcc gtg atg cat gag gct 2112Arg Trp
Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala 690
695 700ctg cac aac cac tac acg cag aag agc ctc tcc
ctg tct ccg ggt aaa 2160Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser
Leu Ser Pro Gly Lys705 710 715
720tga
21638720PRTHomo sapiens 8Met Ala Pro Val Ala Val Trp Ala Ala Leu Ala
Val Gly Leu Glu Leu 1 5 10
15Trp Ala Ala Ala His Ala Leu Pro Ala Gln Val Ala Phe Thr Pro Tyr
20 25 30Ala Pro Glu Pro Gly Ser
Thr Cys Arg Leu Arg Glu Tyr Tyr Asp Gln 35 40
45Thr Ala Gln Met Cys Cys Ser Lys Cys Ser Pro Gly Gln His
Ala Lys 50 55 60Val Phe Cys Thr Lys
Thr Ser Asp Thr Val Cys Asp Ser Cys Glu Asp 65 70
75 80Ser Thr Tyr Thr Gln Leu Trp Asn Trp Val
Pro Glu Cys Leu Ser Cys 85 90
95Gly Ser Arg Cys Ser Ser Asp Gln Val Glu Thr Gln Ala Cys Thr Arg
100 105 110Glu Gln Asn Arg Ile
Cys Thr Cys Arg Pro Gly Trp Tyr Cys Ala Leu 115
120 125Ser Lys Gln Glu Gly Cys Arg Leu Cys Ala Pro Leu
Arg Lys Cys Arg 130 135 140Pro Gly Phe
Gly Val Ala Arg Pro Gly Thr Glu Thr Ser Asp Val Val145
150 155 160Cys Lys Pro Cys Ala Pro Gly
Thr Phe Ser Asn Thr Thr Ser Ser Thr 165
170 175Asp Ile Cys Arg Pro His Gln Ile Cys Asn Val Val
Ala Ile Pro Gly 180 185 190Asn
Ala Ser Met Asp Ala Val Cys Thr Ser Thr Ser Pro Thr Arg Ser 195
200 205Met Ala Pro Gly Ala Val His Leu Pro
Gln Pro Val Ser Thr Arg Ser 210 215
220Gln His Thr Gln Pro Thr Pro Glu Pro Ser Thr Ala Pro Ser Thr Ser225
230 235 240Phe Leu Leu Pro
Met Gly Pro Ser Pro Pro Ala Glu Gly Ser Gly Ser 245
250 255Asn Ala Thr Thr Pro Tyr Ala Pro Glu Pro
Gly Ser Thr Cys Arg Leu 260 265
270Arg Glu Tyr Tyr Asp Gln Thr Ala Gln Met Cys Cys Ser Lys Cys Ser
275 280 285Pro Gly Gln His Ala Lys Val
Phe Cys Thr Lys Thr Ser Asp Thr Val 290 295
300Cys Asp Ser Cys Glu Asp Ser Thr Tyr Thr Gln Leu Trp Asn Trp
Val305 310 315 320Pro Glu
Cys Leu Ser Cys Gly Ser Arg Cys Ser Ser Asp Gln Val Glu
325 330 335Thr Gln Ala Cys Thr Arg Glu
Gln Asn Arg Ile Cys Thr Cys Arg Pro 340 345
350Gly Trp Tyr Cys Ala Leu Ser Lys Gln Glu Gly Cys Arg Leu
Cys Ala 355 360 365Pro Leu Arg Lys
Cys Arg Pro Gly Phe Gly Val Ala Arg Pro Gly Thr 370
375 380Glu Thr Ser Asp Val Val Cys Lys Pro Cys Ala Pro
Gly Thr Phe Ser385 390 395
400Asn Thr Thr Ser Ser Thr Asp Ile Cys Arg Pro His Gln Ile Cys Asn
405 410 415Val Val Ala Ile Pro
Gly Asn Ala Ser Met Asp Ala Val Cys Thr Ser 420
425 430Thr Ser Pro Thr Arg Ser Met Ala Pro Gly Ala Val
His Leu Pro Gln 435 440 445Pro Val
Ser Thr Arg Ser Gln His Thr Gln Pro Thr Pro Glu Pro Ser 450
455 460Thr Ala Pro Ser Thr Ser Phe Leu Leu Pro Met
Gly Pro Ser Pro Pro465 470 475
480Ala Glu Gly Ser Thr Gly Asp Ala Glu Pro Lys Ser Cys Asp Lys Thr
485 490 495His Thr Cys Pro
Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser 500
505 510Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr
Leu Met Ile Ser Arg 515 520 525Thr
Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro 530
535 540Glu Val Lys Phe Asn Trp Tyr Val Asp Gly
Val Glu Val His Asn Ala545 550 555
560Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val
Val 565 570 575Ser Val Leu
Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr 580
585 590Lys Cys Lys Val Ser Asn Lys Ala Leu Pro
Ala Pro Ile Glu Lys Thr 595 600
605Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu 610
615 620Pro Pro Ser Arg Asp Glu Leu Thr
Lys Asn Gln Val Ser Leu Thr Cys625 630
635 640Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val
Glu Trp Glu Ser 645 650
655Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp
660 665 670Ser Asp Gly Ser Ser Phe
Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser 675 680
685Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His
Glu Ala 690 695 700Leu His Asn His Tyr
Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys705 710
715 72091827DNAHomo
sapiensCDS(1)..(1824)mgTNFR1-TNFR1-IgG 9atg ggc ctc tcc acc gtg cct gac
ctg ctg ctg ccg ctg gtg ctc ctg 48Met Gly Leu Ser Thr Val Pro Asp
Leu Leu Leu Pro Leu Val Leu Leu 1 5 10
15gag ctg ttg gtg gga ata tac ccc tca ggg gtt att gga ctg
gtc cct 96Glu Leu Leu Val Gly Ile Tyr Pro Ser Gly Val Ile Gly Leu
Val Pro 20 25 30cac cta ggg
gac agg gag aag aga gat agt gtg tgt ccc caa gga aaa 144His Leu Gly
Asp Arg Glu Lys Arg Asp Ser Val Cys Pro Gln Gly Lys 35
40 45tat atc cac cct caa aat aat tcg att tgc tgt
acc aag tgc cac aaa 192Tyr Ile His Pro Gln Asn Asn Ser Ile Cys Cys
Thr Lys Cys His Lys 50 55 60gga acc
tac ttg tac aat gac tgt cca ggc ccg ggg cag gat acg gac 240Gly Thr
Tyr Leu Tyr Asn Asp Cys Pro Gly Pro Gly Gln Asp Thr Asp 65
70 75 80tgc agg gag tgt gag agc ggc
tcc ttc acc gct tca gaa aac cac ctc 288Cys Arg Glu Cys Glu Ser Gly
Ser Phe Thr Ala Ser Glu Asn His Leu 85
90 95aga cac tgc ctc agc tgc tcc aaa tgc cga aag gaa atg
ggt cag gtg 336Arg His Cys Leu Ser Cys Ser Lys Cys Arg Lys Glu Met
Gly Gln Val 100 105 110gag atc
tct tct tgc aca gtg gac cgg gac acc gtg tgt ggc tgc agg 384Glu Ile
Ser Ser Cys Thr Val Asp Arg Asp Thr Val Cys Gly Cys Arg 115
120 125aag aac cag tac cgg cat tat tgg agt gaa
aac ctt ttc cag tgc ttc 432Lys Asn Gln Tyr Arg His Tyr Trp Ser Glu
Asn Leu Phe Gln Cys Phe 130 135 140aat
tgc agc ctc tgc ctc aat ggg acc gtg cac ctc tcc tgc cag gag 480Asn
Cys Ser Leu Cys Leu Asn Gly Thr Val His Leu Ser Cys Gln Glu145
150 155 160aaa cag aac acc gtg tgc
acc tgc cat gca ggt ttc ttt cta aga gaa 528Lys Gln Asn Thr Val Cys
Thr Cys His Ala Gly Phe Phe Leu Arg Glu 165
170 175aac gag tgt gtc tcc tgt agt aac tgt aag aaa agc
aac gag acc aac 576Asn Glu Cys Val Ser Cys Ser Asn Cys Lys Lys Ser
Asn Glu Thr Asn 180 185 190aag
acc tgc cta cac aac ggg tcc agg gag aag aac gat agt gtg tgt 624Lys
Thr Cys Leu His Asn Gly Ser Arg Glu Lys Asn Asp Ser Val Cys 195
200 205ccc caa gga aaa tat atc cac cct caa
aat aat tcg att tgc tgt acc 672Pro Gln Gly Lys Tyr Ile His Pro Gln
Asn Asn Ser Ile Cys Cys Thr 210 215
220aag tgc cac aaa gga acc tac ttg tac aat gac tgt cca ggc ccg ggg
720Lys Cys His Lys Gly Thr Tyr Leu Tyr Asn Asp Cys Pro Gly Pro Gly225
230 235 240cag gat acg gac
tgc agg gag tgt gag agc ggc tcc ttc acc gct tca 768Gln Asp Thr Asp
Cys Arg Glu Cys Glu Ser Gly Ser Phe Thr Ala Ser 245
250 255gaa aac cac ctc aga cac tgc ctc agc tgc
tcc aaa tgc cga aag gaa 816Glu Asn His Leu Arg His Cys Leu Ser Cys
Ser Lys Cys Arg Lys Glu 260 265
270atg ggt cag gtg gag atc tct tct tgc aca gtg gac cgg gac acc gtg
864Met Gly Gln Val Glu Ile Ser Ser Cys Thr Val Asp Arg Asp Thr Val
275 280 285tgt ggc tgc agg aag aac cag
tac cgg cat tat tgg agt gaa aac ctt 912Cys Gly Cys Arg Lys Asn Gln
Tyr Arg His Tyr Trp Ser Glu Asn Leu 290 295
300ttc cag tgc ttc aat tgc agc ctc tgc ctc aat ggg acc gtg cac ctc
960Phe Gln Cys Phe Asn Cys Ser Leu Cys Leu Asn Gly Thr Val His Leu305
310 315 320tcc tgc cag gag
aaa cag aac acc gtg tgc acc tgc cat gca ggt ttc 1008Ser Cys Gln Glu
Lys Gln Asn Thr Val Cys Thr Cys His Ala Gly Phe 325
330 335ttt cta aga gaa aac gag tgt gtc tcc tgt
agt aac tgt aag aaa agc 1056Phe Leu Arg Glu Asn Glu Cys Val Ser Cys
Ser Asn Cys Lys Lys Ser 340 345
350ctg gag tgc acg aag ttg tgc cta ccc cag att gag aat gtt aag ggc
1104Leu Glu Cys Thr Lys Leu Cys Leu Pro Gln Ile Glu Asn Val Lys Gly
355 360 365act gag gac tca ggc acc aca
gca gag ccc aaa tct tgt gac aaa act 1152Thr Glu Asp Ser Gly Thr Thr
Ala Glu Pro Lys Ser Cys Asp Lys Thr 370 375
380cac aca tgc cca ccg tgc cca gca cct gaa ctc ctg ggg gga ccg tca
1200His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser385
390 395 400gtc ttc ctc ttc
ccc cca aaa ccc aag gac acc ctc atg atc tcc cgg 1248Val Phe Leu Phe
Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg 405
410 415acc cct gag gtc aca tgc gtg gtg gtg gac
gtg agc cac gaa gac cct 1296Thr Pro Glu Val Thr Cys Val Val Val Asp
Val Ser His Glu Asp Pro 420 425
430gag gtc aag ttc aac tgg tac gtg gac ggc gtg gag gtg cat aat gcc
1344Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala
435 440 445aag aca aag ccg cgg gag gag
cag tac aac agc acg tac cgg gtg gtc 1392Lys Thr Lys Pro Arg Glu Glu
Gln Tyr Asn Ser Thr Tyr Arg Val Val 450 455
460agc gtc ctc acc gtc ctg cac cag gac tgg ctg aat ggc aag gag tac
1440Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr465
470 475 480aag tgc aag gtc
tcc aac aaa gcc ctc cca gcc ccc atc gag aaa acc 1488Lys Cys Lys Val
Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr 485
490 495atc tcc aaa gcc aaa ggg cag ccc cga gaa
cca cag gtg tac acc ctg 1536Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu
Pro Gln Val Tyr Thr Leu 500 505
510ccc cca tcc cgg gat gag ctg acc aag aac cag gtc agc ctg acc tgc
1584Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys
515 520 525ctg gtc aaa ggc ttc tat ccc
agc gac atc gcc gtg gag tgg gag agc 1632Leu Val Lys Gly Phe Tyr Pro
Ser Asp Ile Ala Val Glu Trp Glu Ser 530 535
540aat ggg cag ccg gag aac aac tac aag acc acg cct ccc gtg ctg gac
1680Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp545
550 555 560tcc gac ggc tcc
ttc ttc ctc tac agc aag ctc acc gtg gac aag agc 1728Ser Asp Gly Ser
Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser 565
570 575agg tgg cag cag ggg aac gtc ttc tca tgc
tcc gtg atg cat gag gct 1776Arg Trp Gln Gln Gly Asn Val Phe Ser Cys
Ser Val Met His Glu Ala 580 585
590ctg cac aac cac tac acg cag aag agc ctc tcc ctg tct ccg ggt aaa
1824Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys
595 600 605 tga
182710608PRTHomo sapiens 10Met Gly
Leu Ser Thr Val Pro Asp Leu Leu Leu Pro Leu Val Leu Leu 1
5 10 15Glu Leu Leu Val Gly Ile Tyr Pro
Ser Gly Val Ile Gly Leu Val Pro 20 25
30His Leu Gly Asp Arg Glu Lys Arg Asp Ser Val Cys Pro Gln Gly
Lys 35 40 45Tyr Ile His Pro Gln
Asn Asn Ser Ile Cys Cys Thr Lys Cys His Lys 50 55
60Gly Thr Tyr Leu Tyr Asn Asp Cys Pro Gly Pro Gly Gln Asp
Thr Asp 65 70 75 80Cys
Arg Glu Cys Glu Ser Gly Ser Phe Thr Ala Ser Glu Asn His Leu
85 90 95Arg His Cys Leu Ser Cys Ser
Lys Cys Arg Lys Glu Met Gly Gln Val 100 105
110Glu Ile Ser Ser Cys Thr Val Asp Arg Asp Thr Val Cys Gly
Cys Arg 115 120 125Lys Asn Gln Tyr
Arg His Tyr Trp Ser Glu Asn Leu Phe Gln Cys Phe 130
135 140Asn Cys Ser Leu Cys Leu Asn Gly Thr Val His Leu
Ser Cys Gln Glu145 150 155
160Lys Gln Asn Thr Val Cys Thr Cys His Ala Gly Phe Phe Leu Arg Glu
165 170 175Asn Glu Cys Val Ser
Cys Ser Asn Cys Lys Lys Ser Asn Glu Thr Asn 180
185 190Lys Thr Cys Leu His Asn Gly Ser Arg Glu Lys Asn
Asp Ser Val Cys 195 200 205Pro Gln
Gly Lys Tyr Ile His Pro Gln Asn Asn Ser Ile Cys Cys Thr 210
215 220Lys Cys His Lys Gly Thr Tyr Leu Tyr Asn Asp
Cys Pro Gly Pro Gly225 230 235
240Gln Asp Thr Asp Cys Arg Glu Cys Glu Ser Gly Ser Phe Thr Ala Ser
245 250 255Glu Asn His Leu
Arg His Cys Leu Ser Cys Ser Lys Cys Arg Lys Glu 260
265 270Met Gly Gln Val Glu Ile Ser Ser Cys Thr Val
Asp Arg Asp Thr Val 275 280 285Cys
Gly Cys Arg Lys Asn Gln Tyr Arg His Tyr Trp Ser Glu Asn Leu 290
295 300Phe Gln Cys Phe Asn Cys Ser Leu Cys Leu
Asn Gly Thr Val His Leu305 310 315
320Ser Cys Gln Glu Lys Gln Asn Thr Val Cys Thr Cys His Ala Gly
Phe 325 330 335Phe Leu Arg
Glu Asn Glu Cys Val Ser Cys Ser Asn Cys Lys Lys Ser 340
345 350Leu Glu Cys Thr Lys Leu Cys Leu Pro Gln
Ile Glu Asn Val Lys Gly 355 360
365Thr Glu Asp Ser Gly Thr Thr Ala Glu Pro Lys Ser Cys Asp Lys Thr 370
375 380His Thr Cys Pro Pro Cys Pro Ala
Pro Glu Leu Leu Gly Gly Pro Ser385 390
395 400Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu
Met Ile Ser Arg 405 410
415Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro
420 425 430Glu Val Lys Phe Asn Trp
Tyr Val Asp Gly Val Glu Val His Asn Ala 435 440
445Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg
Val Val 450 455 460Ser Val Leu Thr Val
Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr465 470
475 480Lys Cys Lys Val Ser Asn Lys Ala Leu Pro
Ala Pro Ile Glu Lys Thr 485 490
495Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu
500 505 510Pro Pro Ser Arg Asp
Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys 515
520 525Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val
Glu Trp Glu Ser 530 535 540Asn Gly Gln
Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp545
550 555 560Ser Asp Gly Ser Phe Phe Leu
Tyr Ser Lys Leu Thr Val Asp Lys Ser 565
570 575Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val
Met His Glu Ala 580 585 590Leu
His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 595
600 605111980DNAHomo
sapiensCDS(1)..(1977)mgTNFR2-TNFR2-IgG 11atg gcg ccc gtc gcc gtc tgg gcc
gcg ctg gcc gtc gga ctg gag ctc 48Met Ala Pro Val Ala Val Trp Ala
Ala Leu Ala Val Gly Leu Glu Leu 1 5 10
15tgg gct gcg gcg cac gcc ttg ccc gcc cag gtg gca ttt aca
ccc tac 96Trp Ala Ala Ala His Ala Leu Pro Ala Gln Val Ala Phe Thr
Pro Tyr 20 25 30gcc ccg gag
ccc ggg agc aca tgc cgg ctc aga gaa tac tat gac cag 144Ala Pro Glu
Pro Gly Ser Thr Cys Arg Leu Arg Glu Tyr Tyr Asp Gln 35
40 45aca gct cag atg tgc tgc agc aaa tgc tcg ccg
ggc caa cat gca aaa 192Thr Ala Gln Met Cys Cys Ser Lys Cys Ser Pro
Gly Gln His Ala Lys 50 55 60gtc ttc
tgt acc aag acc tcg gac acc gtg tgt gac tcc tgt gag gac 240Val Phe
Cys Thr Lys Thr Ser Asp Thr Val Cys Asp Ser Cys Glu Asp 65
70 75 80agc aca tac acc cag ctc tgg
aac tgg gtt ccc gag tgc ttg agc tgt 288Ser Thr Tyr Thr Gln Leu Trp
Asn Trp Val Pro Glu Cys Leu Ser Cys 85
90 95ggc tcc cgc tgt agc tct gac cag gtg gaa act caa gcc
tgc act cgg 336Gly Ser Arg Cys Ser Ser Asp Gln Val Glu Thr Gln Ala
Cys Thr Arg 100 105 110gaa cag
aac cgc atc tgc acc tgc agg ccc ggc tgg tac tgc gcg ctg 384Glu Gln
Asn Arg Ile Cys Thr Cys Arg Pro Gly Trp Tyr Cys Ala Leu 115
120 125agc aag cag gag ggg tgc cgg ctg tgc gcg
ccg ctg cgc aag tgc cgc 432Ser Lys Gln Glu Gly Cys Arg Leu Cys Ala
Pro Leu Arg Lys Cys Arg 130 135 140ccg
ggc ttc ggc gtg gcc aga cca gga act gaa aca tca gac gtg gtg 480Pro
Gly Phe Gly Val Ala Arg Pro Gly Thr Glu Thr Ser Asp Val Val145
150 155 160tgc aag ccc tgt gcc ccg
ggg acg ttc tcc aac acg act tca tcc acg 528Cys Lys Pro Cys Ala Pro
Gly Thr Phe Ser Asn Thr Thr Ser Ser Thr 165
170 175gat att tgc agg ccc cac cag atc tgt aac gtg gtg
gcc atc cct ggg 576Asp Ile Cys Arg Pro His Gln Ile Cys Asn Val Val
Ala Ile Pro Gly 180 185 190aat
gca agc atg gat gca aac tgc acg tcc ccg gag ccc aac agc aca 624Asn
Ala Ser Met Asp Ala Asn Cys Thr Ser Pro Glu Pro Asn Ser Thr 195
200 205tgc cgg ctc aga gaa tac tat gac cag
aca gct cag atg tgc tgc agc 672Cys Arg Leu Arg Glu Tyr Tyr Asp Gln
Thr Ala Gln Met Cys Cys Ser 210 215
220aaa tgc tcg ccg ggc caa cat gca aaa gtc ttc tgt acc aag acc tcg
720Lys Cys Ser Pro Gly Gln His Ala Lys Val Phe Cys Thr Lys Thr Ser225
230 235 240gac acc gtg tgt
gac tcc tgt gag gac agc aca tac acc cag ctc tgg 768Asp Thr Val Cys
Asp Ser Cys Glu Asp Ser Thr Tyr Thr Gln Leu Trp 245
250 255aac tgg gtt ccc gag tgc ttg agc tgt ggc
tcc cgc tgt agc tct gac 816Asn Trp Val Pro Glu Cys Leu Ser Cys Gly
Ser Arg Cys Ser Ser Asp 260 265
270cag gtg gaa act caa gcc tgc act cgg gaa cag aac cgc atc tgc acc
864Gln Val Glu Thr Gln Ala Cys Thr Arg Glu Gln Asn Arg Ile Cys Thr
275 280 285tgc agg ccc ggc tgg tac tgc
gcg ctg agc aag cag gag ggg tgc cgg 912Cys Arg Pro Gly Trp Tyr Cys
Ala Leu Ser Lys Gln Glu Gly Cys Arg 290 295
300ctg tgc gcg ccg ctg cgc aag tgc cgc ccg ggc ttc ggc gtg gcc aga
960Leu Cys Ala Pro Leu Arg Lys Cys Arg Pro Gly Phe Gly Val Ala Arg305
310 315 320cca gga act gaa
aca tca gac gtg gtg tgc aag ccc tgt gcc ccg ggg 1008Pro Gly Thr Glu
Thr Ser Asp Val Val Cys Lys Pro Cys Ala Pro Gly 325
330 335acg ttc tcc aac acg act tca tcc acg gat
att tgc agg ccc cac cag 1056Thr Phe Ser Asn Thr Thr Ser Ser Thr Asp
Ile Cys Arg Pro His Gln 340 345
350atc tgt aac gtg gtg gcc atc cct ggg aat gca agc atg gat gca gtc
1104Ile Cys Asn Val Val Ala Ile Pro Gly Asn Ala Ser Met Asp Ala Val
355 360 365tgc acg tcc acg tcc ccc acc
cgg agt atg gcc cca ggg gca gta cac 1152Cys Thr Ser Thr Ser Pro Thr
Arg Ser Met Ala Pro Gly Ala Val His 370 375
380tta ccc cag cca gtg tcc aca cga tcc caa cac acg cag cca act cca
1200Leu Pro Gln Pro Val Ser Thr Arg Ser Gln His Thr Gln Pro Thr Pro385
390 395 400gaa ccc agc act
gct cca agc acc tcc ttc ctg ctc cca atg ggc ccc 1248Glu Pro Ser Thr
Ala Pro Ser Thr Ser Phe Leu Leu Pro Met Gly Pro 405
410 415agc ccc cca gct gaa ggg agc act ggc gac
gca gag ccc aaa tct tgt 1296Ser Pro Pro Ala Glu Gly Ser Thr Gly Asp
Ala Glu Pro Lys Ser Cys 420 425
430gac aaa act cac aca tgc cca ccg tgc cca gca cct gaa ctc ctg ggg
1344Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly
435 440 445gga ccg tca gtc ttc ctc ttc
ccc cca aaa ccc aag gac acc ctc atg 1392Gly Pro Ser Val Phe Leu Phe
Pro Pro Lys Pro Lys Asp Thr Leu Met 450 455
460atc tcc cgg acc cct gag gtc aca tgc gtg gtg gtg gac gtg agc cac
1440Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His465
470 475 480gaa gac cct gag
gtc aag ttc aac tgg tac gtg gac ggc gtg gag gtg 1488Glu Asp Pro Glu
Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val 485
490 495cat aat gcc aag aca aag ccg cgg gag gag
cag tac aac agc acg tac 1536His Asn Ala Lys Thr Lys Pro Arg Glu Glu
Gln Tyr Asn Ser Thr Tyr 500 505
510cgg gtg gtc agc gtc ctc acc gtc ctg cac cag gac tgg ctg aat ggc
1584Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly
515 520 525aag gag tac aag tgc aag gtc
tcc aac aaa gcc ctc cca gcc ccc atc 1632Lys Glu Tyr Lys Cys Lys Val
Ser Asn Lys Ala Leu Pro Ala Pro Ile 530 535
540gag aaa acc atc tcc aaa gcc aaa ggg cag ccc cga gaa cca cag gtg
1680Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val545
550 555 560tac acc ctg ccc
cca tcc cgg gat gag ctg acc aag aac cag gtc agc 1728Tyr Thr Leu Pro
Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser 565
570 575ctg acc tgc ctg gtc aaa ggc ttc tat ccc
agc gac atc gcc gtg gag 1776Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro
Ser Asp Ile Ala Val Glu 580 585
590tgg gag agc aat ggg cag ccg gag aac aac tac aag acc acg cct ccc
1824Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro
595 600 605gtg ctg gac tcc gac ggc tcc
ttc ttc ctc tac agc aag ctc acc gtg 1872Val Leu Asp Ser Asp Gly Ser
Phe Phe Leu Tyr Ser Lys Leu Thr Val 610 615
620gac aag agc agg tgg cag cag ggg aac gtc ttc tca tgc tcc gtg atg
1920Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met625
630 635 640cat gag gct ctg
cac aac cac tac acg cag aag agc ctc tcc ctg tct 1968His Glu Ala Leu
His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser 645
650 655ccg ggt aaa tga
1980Pro Gly Lys12659PRTHomo sapiens 12Met Ala
Pro Val Ala Val Trp Ala Ala Leu Ala Val Gly Leu Glu Leu 1
5 10 15Trp Ala Ala Ala His Ala Leu Pro
Ala Gln Val Ala Phe Thr Pro Tyr 20 25
30Ala Pro Glu Pro Gly Ser Thr Cys Arg Leu Arg Glu Tyr Tyr Asp
Gln 35 40 45Thr Ala Gln Met Cys
Cys Ser Lys Cys Ser Pro Gly Gln His Ala Lys 50 55
60Val Phe Cys Thr Lys Thr Ser Asp Thr Val Cys Asp Ser Cys
Glu Asp 65 70 75 80Ser
Thr Tyr Thr Gln Leu Trp Asn Trp Val Pro Glu Cys Leu Ser Cys
85 90 95Gly Ser Arg Cys Ser Ser Asp
Gln Val Glu Thr Gln Ala Cys Thr Arg 100 105
110Glu Gln Asn Arg Ile Cys Thr Cys Arg Pro Gly Trp Tyr Cys
Ala Leu 115 120 125Ser Lys Gln Glu
Gly Cys Arg Leu Cys Ala Pro Leu Arg Lys Cys Arg 130
135 140Pro Gly Phe Gly Val Ala Arg Pro Gly Thr Glu Thr
Ser Asp Val Val145 150 155
160Cys Lys Pro Cys Ala Pro Gly Thr Phe Ser Asn Thr Thr Ser Ser Thr
165 170 175Asp Ile Cys Arg Pro
His Gln Ile Cys Asn Val Val Ala Ile Pro Gly 180
185 190Asn Ala Ser Met Asp Ala Asn Cys Thr Ser Pro Glu
Pro Asn Ser Thr 195 200 205Cys Arg
Leu Arg Glu Tyr Tyr Asp Gln Thr Ala Gln Met Cys Cys Ser 210
215 220Lys Cys Ser Pro Gly Gln His Ala Lys Val Phe
Cys Thr Lys Thr Ser225 230 235
240Asp Thr Val Cys Asp Ser Cys Glu Asp Ser Thr Tyr Thr Gln Leu Trp
245 250 255Asn Trp Val Pro
Glu Cys Leu Ser Cys Gly Ser Arg Cys Ser Ser Asp 260
265 270Gln Val Glu Thr Gln Ala Cys Thr Arg Glu Gln
Asn Arg Ile Cys Thr 275 280 285Cys
Arg Pro Gly Trp Tyr Cys Ala Leu Ser Lys Gln Glu Gly Cys Arg 290
295 300Leu Cys Ala Pro Leu Arg Lys Cys Arg Pro
Gly Phe Gly Val Ala Arg305 310 315
320Pro Gly Thr Glu Thr Ser Asp Val Val Cys Lys Pro Cys Ala Pro
Gly 325 330 335Thr Phe Ser
Asn Thr Thr Ser Ser Thr Asp Ile Cys Arg Pro His Gln 340
345 350Ile Cys Asn Val Val Ala Ile Pro Gly Asn
Ala Ser Met Asp Ala Val 355 360
365Cys Thr Ser Thr Ser Pro Thr Arg Ser Met Ala Pro Gly Ala Val His 370
375 380Leu Pro Gln Pro Val Ser Thr Arg
Ser Gln His Thr Gln Pro Thr Pro385 390
395 400Glu Pro Ser Thr Ala Pro Ser Thr Ser Phe Leu Leu
Pro Met Gly Pro 405 410
415Ser Pro Pro Ala Glu Gly Ser Thr Gly Asp Ala Glu Pro Lys Ser Cys
420 425 430Asp Lys Thr His Thr Cys
Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly 435 440
445Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr
Leu Met 450 455 460Ile Ser Arg Thr Pro
Glu Val Thr Cys Val Val Val Asp Val Ser His465 470
475 480Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr
Val Asp Gly Val Glu Val 485 490
495His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr
500 505 510Arg Val Val Ser Val
Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly 515
520 525Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu
Pro Ala Pro Ile 530 535 540Glu Lys Thr
Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val545
550 555 560Tyr Thr Leu Pro Pro Ser Arg
Asp Glu Leu Thr Lys Asn Gln Val Ser 565
570 575Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp
Ile Ala Val Glu 580 585 590Trp
Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro 595
600 605Val Leu Asp Ser Asp Gly Ser Phe Phe
Leu Tyr Ser Lys Leu Thr Val 610 615
620Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met625
630 635 640His Glu Ala Leu
His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser 645
650 655Pro Gly Lys131314DNAHomo
sapiensCDS(1)..(1311)CD2-IgG 13atg agc ttt cca tgt aaa ttt gta gcc agc
ttc ctt ctg att ttc aat 48Met Ser Phe Pro Cys Lys Phe Val Ala Ser
Phe Leu Leu Ile Phe Asn 1 5 10
15gtt tct tcc aaa ggt gca gtc tcc aaa gag att acg aat gcc ttg gaa
96Val Ser Ser Lys Gly Ala Val Ser Lys Glu Ile Thr Asn Ala Leu Glu
20 25 30acc tgg ggt gcc ttg ggt
cag gac atc aac ttg gac att cct agt ttt 144Thr Trp Gly Ala Leu Gly
Gln Asp Ile Asn Leu Asp Ile Pro Ser Phe 35 40
45caa atg agt gat gat att gac gat ata aaa tgg gaa aaa act
tca gac 192Gln Met Ser Asp Asp Ile Asp Asp Ile Lys Trp Glu Lys Thr
Ser Asp 50 55 60aag aaa aag att gca
caa ttc aga aaa gag aaa gag act ttc aag gaa 240Lys Lys Lys Ile Ala
Gln Phe Arg Lys Glu Lys Glu Thr Phe Lys Glu 65 70
75 80aaa gat aca tat aag cta ttt aaa aat gga
act ctg aaa att aag cat 288Lys Asp Thr Tyr Lys Leu Phe Lys Asn Gly
Thr Leu Lys Ile Lys His 85 90
95ctg aag acc gat gat cag gat atc tac aag gta tca ata tat gat aca
336Leu Lys Thr Asp Asp Gln Asp Ile Tyr Lys Val Ser Ile Tyr Asp Thr
100 105 110aaa gga aaa aat gtg ttg
gaa aaa ata ttt gat ttg aag att caa gag 384Lys Gly Lys Asn Val Leu
Glu Lys Ile Phe Asp Leu Lys Ile Gln Glu 115 120
125agg gtc tca aaa cca aag atc tcc tgg act tgt atc aac aca
acc ctg 432Arg Val Ser Lys Pro Lys Ile Ser Trp Thr Cys Ile Asn Thr
Thr Leu 130 135 140acc tgt gag gta atg
aat gga act gac ccc gaa tta aac ctg tat caa 480Thr Cys Glu Val Met
Asn Gly Thr Asp Pro Glu Leu Asn Leu Tyr Gln145 150
155 160gat ggg aaa cat cta aaa ctt tct cag agg
gtc atc aca cac aag tgg 528Asp Gly Lys His Leu Lys Leu Ser Gln Arg
Val Ile Thr His Lys Trp 165 170
175acc acc agc ctg agt gca aaa ttc aag tgc aca gca ggg aac aaa gtc
576Thr Thr Ser Leu Ser Ala Lys Phe Lys Cys Thr Ala Gly Asn Lys Val
180 185 190agc aag gaa tcc agt gtc
gag cct gtc agc tgt cct gca gag ccc aaa 624Ser Lys Glu Ser Ser Val
Glu Pro Val Ser Cys Pro Ala Glu Pro Lys 195 200
205tct tgt gac aaa act cac aca tgc cca ccg tgc cca gca cct
gaa ctc 672Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro
Glu Leu 210 215 220ctg ggg gga ccg tca
gtc ttc ctc ttc ccc cca aaa ccc aag gac acc 720Leu Gly Gly Pro Ser
Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr225 230
235 240ctc atg atc tcc cgg acc cct gag gtc aca
tgc gtg gtg gtg gac gtg 768Leu Met Ile Ser Arg Thr Pro Glu Val Thr
Cys Val Val Val Asp Val 245 250
255agc cac gaa gac cct gag gtc aag ttc aac tgg tac gtg gac ggc gtg
816Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val
260 265 270gag gtg cat aat gcc aag
aca aag ccg cgg gag gag cag tac aac agc 864Glu Val His Asn Ala Lys
Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser 275 280
285acg tac cgg gtg gtc agc gtc ctc acc gtc ctg cac cag gac
tgg ctg 912Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp
Trp Leu 290 295 300aat ggc aag gag tac
aag tgc aag gtc tcc aac aaa gcc ctc cca gcc 960Asn Gly Lys Glu Tyr
Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala305 310
315 320ccc atc gag aaa acc atc tcc aaa gcc aaa
ggg cag ccc cga gaa cca 1008Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys
Gly Gln Pro Arg Glu Pro 325 330
335cag gtg tac acc ctg ccc cca tcc cgg gat gag ctg acc aag aac cag
1056Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln
340 345 350gtc agc ctg acc tgc ctg
gtc aaa ggc ttc tat ccc agc gac atc gcc 1104Val Ser Leu Thr Cys Leu
Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala 355 360
365gtg gag tgg gag agc aat ggg cag ccg gag aac aac tac aag
acc acg 1152Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys
Thr Thr 370 375 380cct ccc gtg ctg gac
tcc gac ggc tcc ttc ttc ctc tac agc aag ctc 1200Pro Pro Val Leu Asp
Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu385 390
395 400acc gtg gac aag agc agg tgg cag cag ggg
aac gtc ttc tca tgc tcc 1248Thr Val Asp Lys Ser Arg Trp Gln Gln Gly
Asn Val Phe Ser Cys Ser 405 410
415gtg atg cat gag gct ctg cac aac cac tac acg cag aag agc ctc tcc
1296Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser
420 425 430ctg tct ccg ggt aaa
tga 1314Leu Ser Pro Gly Lys
43514437PRTHomo sapiens 14Met Ser Phe Pro Cys Lys Phe Val Ala Ser Phe
Leu Leu Ile Phe Asn 1 5 10
15Val Ser Ser Lys Gly Ala Val Ser Lys Glu Ile Thr Asn Ala Leu Glu
20 25 30Thr Trp Gly Ala Leu Gly
Gln Asp Ile Asn Leu Asp Ile Pro Ser Phe 35 40
45Gln Met Ser Asp Asp Ile Asp Asp Ile Lys Trp Glu Lys Thr
Ser Asp 50 55 60Lys Lys Lys Ile Ala
Gln Phe Arg Lys Glu Lys Glu Thr Phe Lys Glu 65 70
75 80Lys Asp Thr Tyr Lys Leu Phe Lys Asn Gly
Thr Leu Lys Ile Lys His 85 90
95Leu Lys Thr Asp Asp Gln Asp Ile Tyr Lys Val Ser Ile Tyr Asp Thr
100 105 110Lys Gly Lys Asn Val
Leu Glu Lys Ile Phe Asp Leu Lys Ile Gln Glu 115
120 125Arg Val Ser Lys Pro Lys Ile Ser Trp Thr Cys Ile
Asn Thr Thr Leu 130 135 140Thr Cys Glu
Val Met Asn Gly Thr Asp Pro Glu Leu Asn Leu Tyr Gln145
150 155 160Asp Gly Lys His Leu Lys Leu
Ser Gln Arg Val Ile Thr His Lys Trp 165
170 175Thr Thr Ser Leu Ser Ala Lys Phe Lys Cys Thr Ala
Gly Asn Lys Val 180 185 190Ser
Lys Glu Ser Ser Val Glu Pro Val Ser Cys Pro Ala Glu Pro Lys 195
200 205Ser Cys Asp Lys Thr His Thr Cys Pro
Pro Cys Pro Ala Pro Glu Leu 210 215
220Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr225
230 235 240Leu Met Ile Ser
Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val 245
250 255Ser His Glu Asp Pro Glu Val Lys Phe Asn
Trp Tyr Val Asp Gly Val 260 265
270Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser
275 280 285Thr Tyr Arg Val Val Ser Val
Leu Thr Val Leu His Gln Asp Trp Leu 290 295
300Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro
Ala305 310 315 320Pro Ile
Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro
325 330 335Gln Val Tyr Thr Leu Pro Pro
Ser Arg Asp Glu Leu Thr Lys Asn Gln 340 345
350Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp
Ile Ala 355 360 365Val Glu Trp Glu
Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 370
375 380Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu
Tyr Ser Lys Leu385 390 395
400Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser
405 410 415Val Met His Glu Ala
Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 420
425 430Leu Ser Pro Gly Lys 435151134DNAHomo
sapiensCDS(1)..(1131)CTLA4-IgG 15atg agg acc tgg ccc tgc act ctc ctg ttt
ttt ctt ctc ttc atc cct 48Met Arg Thr Trp Pro Cys Thr Leu Leu Phe
Phe Leu Leu Phe Ile Pro 1 5 10
15gtc ttc tgc aaa gca atg cac gtg gcc cag cct gct gtg gta ctg gcc
96Val Phe Cys Lys Ala Met His Val Ala Gln Pro Ala Val Val Leu Ala
20 25 30agc agc cga ggc atc gcc
agc ttt gtg tgt gag tat gca tct cca ggc 144Ser Ser Arg Gly Ile Ala
Ser Phe Val Cys Glu Tyr Ala Ser Pro Gly 35 40
45aaa gcc act gag gtc cgg gtg aca gtg ctt cgg cag gct gac
agc cag 192Lys Ala Thr Glu Val Arg Val Thr Val Leu Arg Gln Ala Asp
Ser Gln 50 55 60gtg act gaa gtc tgt
gcg gca acc tac atg atg ggg aat gag ttg acc 240Val Thr Glu Val Cys
Ala Ala Thr Tyr Met Met Gly Asn Glu Leu Thr 65 70
75 80ttc cta gat gat tcc atc tgc acg ggc acc
tcc agt gga aat caa gtg 288Phe Leu Asp Asp Ser Ile Cys Thr Gly Thr
Ser Ser Gly Asn Gln Val 85 90
95aac ctc act atc caa gga ctg agg gcc atg gac acg gga ctc tac atc
336Asn Leu Thr Ile Gln Gly Leu Arg Ala Met Asp Thr Gly Leu Tyr Ile
100 105 110tgc aag gtg gag ctc atg
tac cca ccg cca tac tac ctg ggc ata ggc 384Cys Lys Val Glu Leu Met
Tyr Pro Pro Pro Tyr Tyr Leu Gly Ile Gly 115 120
125aac gga acc cag att tat gta att gat cca gaa ccg tgc cca
gat tct 432Asn Gly Thr Gln Ile Tyr Val Ile Asp Pro Glu Pro Cys Pro
Asp Ser 130 135 140gca gag ccc aaa tct
tgt gac aaa act cac aca tgc cca ccg tgc cca 480Ala Glu Pro Lys Ser
Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro145 150
155 160gca cct gaa ctc ctg ggg gga ccg tca gtc
ttc ctc ttc ccc cca aaa 528Ala Pro Glu Leu Leu Gly Gly Pro Ser Val
Phe Leu Phe Pro Pro Lys 165 170
175ccc aag gac acc ctc atg atc tcc cgg acc cct gag gtc aca tgc gtg
576Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val
180 185 190gtg gtg gac gtg agc cac
gaa gac cct gag gtc aag ttc aac tgg tac 624Val Val Asp Val Ser His
Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr 195 200
205gtg gac ggc gtg gag gtg cat aat gcc aag aca aag ccg cgg
gag gag 672Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg
Glu Glu 210 215 220cag tac aac agc acg
tac cgg gtg gtc agc gtc ctc acc gtc ctg cac 720Gln Tyr Asn Ser Thr
Tyr Arg Val Val Ser Val Leu Thr Val Leu His225 230
235 240cag gac tgg ctg aat ggc aag gag tac aag
tgc aag gtc tcc aac aaa 768Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys
Cys Lys Val Ser Asn Lys 245 250
255gcc ctc cca gcc ccc atc gag aaa acc atc tcc aaa gcc aaa ggg cag
816Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln
260 265 270ccc cga gaa cca cag gtg
tac acc ctg ccc cca tcc cgg gat gag ctg 864Pro Arg Glu Pro Gln Val
Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu 275 280
285acc aag aac cag gtc agc ctg acc tgc ctg gtc aaa ggc ttc
tat ccc 912Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe
Tyr Pro 290 295 300agc gac atc gcc gtg
gag tgg gag agc aat ggg cag ccg gag aac aac 960Ser Asp Ile Ala Val
Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn305 310
315 320tac aag acc acg cct ccc gtg ctg gac tcc
gac ggc tcc ttc ttc ctc 1008Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser
Asp Gly Ser Phe Phe Leu 325 330
335tac agc aag ctc acc gtg gac aag agc agg tgg cag cag ggg aac gtc
1056Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val
340 345 350ttc tca tgc tcc gtg atg
cat gag gct ctg cac aac cac tac acg cag 1104Phe Ser Cys Ser Val Met
His Glu Ala Leu His Asn His Tyr Thr Gln 355 360
365aag agc ctc tcc ctg tct ccg ggt aaa tga
1134Lys Ser Leu Ser Leu Ser Pro Gly Lys 370
37516377PRTHomo sapiens 16Met Arg Thr Trp Pro Cys Thr Leu Leu Phe Phe Leu
Leu Phe Ile Pro 1 5 10
15Val Phe Cys Lys Ala Met His Val Ala Gln Pro Ala Val Val Leu Ala
20 25 30Ser Ser Arg Gly Ile Ala Ser
Phe Val Cys Glu Tyr Ala Ser Pro Gly 35 40
45Lys Ala Thr Glu Val Arg Val Thr Val Leu Arg Gln Ala Asp Ser
Gln 50 55 60Val Thr Glu Val Cys Ala
Ala Thr Tyr Met Met Gly Asn Glu Leu Thr 65 70
75 80Phe Leu Asp Asp Ser Ile Cys Thr Gly Thr Ser
Ser Gly Asn Gln Val 85 90
95Asn Leu Thr Ile Gln Gly Leu Arg Ala Met Asp Thr Gly Leu Tyr Ile
100 105 110Cys Lys Val Glu Leu Met
Tyr Pro Pro Pro Tyr Tyr Leu Gly Ile Gly 115 120
125Asn Gly Thr Gln Ile Tyr Val Ile Asp Pro Glu Pro Cys Pro
Asp Ser 130 135 140Ala Glu Pro Lys Ser
Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro145 150
155 160Ala Pro Glu Leu Leu Gly Gly Pro Ser Val
Phe Leu Phe Pro Pro Lys 165 170
175Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val
180 185 190Val Val Asp Val Ser
His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr 195
200 205Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys
Pro Arg Glu Glu 210 215 220Gln Tyr Asn
Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His225
230 235 240Gln Asp Trp Leu Asn Gly Lys
Glu Tyr Lys Cys Lys Val Ser Asn Lys 245
250 255Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys
Ala Lys Gly Gln 260 265 270Pro
Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu 275
280 285Thr Lys Asn Gln Val Ser Leu Thr Cys
Leu Val Lys Gly Phe Tyr Pro 290 295
300Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn305
310 315 320Tyr Lys Thr Thr
Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu 325
330 335Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg
Trp Gln Gln Gly Asn Val 340 345
350Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln
355 360 365Lys Ser Leu Ser Leu Ser Pro
Gly Lys 370 375171854DNAHomo
sapiensCDS(1)..(1851)CD2-CD2-IgG 17atg agc ttt cca tgt aaa ttt gta gcc
agc ttc ctt ctg att ttc aat 48Met Ser Phe Pro Cys Lys Phe Val Ala
Ser Phe Leu Leu Ile Phe Asn 1 5 10
15gtt tct tcc aaa ggt gca gtc tcc aaa gag att acg aat gcc ttg
gaa 96Val Ser Ser Lys Gly Ala Val Ser Lys Glu Ile Thr Asn Ala Leu
Glu 20 25 30acc tgg ggt gcc
ttg ggt cag gac atc aac ttg gac att cct agt ttt 144Thr Trp Gly Ala
Leu Gly Gln Asp Ile Asn Leu Asp Ile Pro Ser Phe 35
40 45caa atg agt gat gat att gac gat ata aaa tgg gaa
aaa act tca gac 192Gln Met Ser Asp Asp Ile Asp Asp Ile Lys Trp Glu
Lys Thr Ser Asp 50 55 60aag aaa aag
att gca caa ttc aga aaa gag aaa gag act ttc aag gaa 240Lys Lys Lys
Ile Ala Gln Phe Arg Lys Glu Lys Glu Thr Phe Lys Glu 65
70 75 80aaa gat aca tat aag cta ttt aaa
aat gga act ctg aaa att aag cat 288Lys Asp Thr Tyr Lys Leu Phe Lys
Asn Gly Thr Leu Lys Ile Lys His 85 90
95ctg aag acc gat gat cag gat atc tac aag gta tca ata tat
gat aca 336Leu Lys Thr Asp Asp Gln Asp Ile Tyr Lys Val Ser Ile Tyr
Asp Thr 100 105 110aaa gga aaa
aat gtg ttg gaa aaa ata ttt gat ttg aag att caa gag 384Lys Gly Lys
Asn Val Leu Glu Lys Ile Phe Asp Leu Lys Ile Gln Glu 115
120 125agg gtc tca aaa cca aag atc tcc tgg act tgt
atc aac aca acc ctg 432Arg Val Ser Lys Pro Lys Ile Ser Trp Thr Cys
Ile Asn Thr Thr Leu 130 135 140acc tgt
gag gta atg aat gga act gac ccc gaa tta aac ctg tat caa 480Thr Cys
Glu Val Met Asn Gly Thr Asp Pro Glu Leu Asn Leu Tyr Gln145
150 155 160gat ggg aaa cat cta aaa ctt
tct cag agg gtc atc aca cac aag tgg 528Asp Gly Lys His Leu Lys Leu
Ser Gln Arg Val Ile Thr His Lys Trp 165
170 175acc acc agc ctg agt gca aaa ttc aag tgc aca gca
ggg aac aaa gtc 576Thr Thr Ser Leu Ser Ala Lys Phe Lys Cys Thr Ala
Gly Asn Lys Val 180 185 190agc
aag gaa tcc agt gtc gag cct gtc agc tgt cct aaa gag att acg 624Ser
Lys Glu Ser Ser Val Glu Pro Val Ser Cys Pro Lys Glu Ile Thr 195
200 205aat gcc ttg gaa acc tgg ggt gcc ttg
ggt cag gac atc aac ttg gac 672Asn Ala Leu Glu Thr Trp Gly Ala Leu
Gly Gln Asp Ile Asn Leu Asp 210 215
220att cct agt ttt caa atg agt gat gat att gac gat ata aaa tgg gaa
720Ile Pro Ser Phe Gln Met Ser Asp Asp Ile Asp Asp Ile Lys Trp Glu225
230 235 240aaa act tca gac
aag aaa aag att gca caa ttc aga aaa gag aaa gag 768Lys Thr Ser Asp
Lys Lys Lys Ile Ala Gln Phe Arg Lys Glu Lys Glu 245
250 255act ttc aag gaa aaa gat aca tat aag cta
ttt aaa aat gga act ctg 816Thr Phe Lys Glu Lys Asp Thr Tyr Lys Leu
Phe Lys Asn Gly Thr Leu 260 265
270aaa att aag cat ctg aag acc gat gat cag gat atc tac aag gta tca
864Lys Ile Lys His Leu Lys Thr Asp Asp Gln Asp Ile Tyr Lys Val Ser
275 280 285ata tat gat aca aaa gga aaa
aat gtg ttg gaa aaa ata ttt gat ttg 912Ile Tyr Asp Thr Lys Gly Lys
Asn Val Leu Glu Lys Ile Phe Asp Leu 290 295
300aag att caa gag agg gtc tca aaa cca aag atc tcc tgg act tgt atc
960Lys Ile Gln Glu Arg Val Ser Lys Pro Lys Ile Ser Trp Thr Cys Ile305
310 315 320aac aca acc ctg
acc tgt gag gta atg aat gga act gac ccc gaa tta 1008Asn Thr Thr Leu
Thr Cys Glu Val Met Asn Gly Thr Asp Pro Glu Leu 325
330 335aac ctg tat caa gat ggg aaa cat cta aaa
ctt tct cag agg gtc atc 1056Asn Leu Tyr Gln Asp Gly Lys His Leu Lys
Leu Ser Gln Arg Val Ile 340 345
350aca cac aag tgg acc acc agc ctg agt gca aaa ttc aag tgc aca gca
1104Thr His Lys Trp Thr Thr Ser Leu Ser Ala Lys Phe Lys Cys Thr Ala
355 360 365ggg aac aaa gtc agc aag gaa
tcc agt gtc gag cct gtc agc tgt cct 1152Gly Asn Lys Val Ser Lys Glu
Ser Ser Val Glu Pro Val Ser Cys Pro 370 375
380gca gag ccc aaa tct tgt gac aaa act cac aca tgc cca ccg tgc cca
1200Ala Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro385
390 395 400gca cct gaa ctc
ctg ggg gga ccg tca gtc ttc ctc ttc ccc cca aaa 1248Ala Pro Glu Leu
Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys 405
410 415ccc aag gac acc ctc atg atc tcc cgg acc
cct gag gtc aca tgc gtg 1296Pro Lys Asp Thr Leu Met Ile Ser Arg Thr
Pro Glu Val Thr Cys Val 420 425
430gtg gtg gac gtg agc cac gaa gac cct gag gtc aag ttc aac tgg tac
1344Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr
435 440 445gtg gac ggc gtg gag gtg cat
aat gcc aag aca aag ccg cgg gag gag 1392Val Asp Gly Val Glu Val His
Asn Ala Lys Thr Lys Pro Arg Glu Glu 450 455
460cag tac aac agc acg tac cgg gtg gtc agc gtc ctc acc gtc tgt cac
1440Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Cys His465
470 475 480cag gac tgg ctg
aat ggc aag gag tac aag tgc aag gtc tcc aac aaa 1488Gln Asp Trp Leu
Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys 485
490 495gcc ctc cca gcc ccc atc gag aaa acc atc
tcc aaa gcc aaa ggg cag 1536Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile
Ser Lys Ala Lys Gly Gln 500 505
510ccc cga gaa cca cag gtg tac acc ctg ccc cca tcc cgg gat gag ctg
1584Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu
515 520 525acc aag aac cag gtc agc ctg
acc tgc ctg gtc aaa ggc ttc tat ccc 1632Thr Lys Asn Gln Val Ser Leu
Thr Cys Leu Val Lys Gly Phe Tyr Pro 530 535
540agc gac atc gcc gtg gag tgg gag agc aat ggg cag ccg gag aac aac
1680Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn545
550 555 560tac aag acc acg
cct ccc gtg ctg gac tcc gac ggc tcc ttc ttc ctc 1728Tyr Lys Thr Thr
Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu 565
570 575tac agc aag ctc acc gtg gac aag agc agg
tgg cag cag ggg aac gtc 1776Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg
Trp Gln Gln Gly Asn Val 580 585
590ttc tca tgc tcc gtg atg cat gag gct ctg cac aac cac tac acg cag
1824Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln
595 600 605aag agc ctc tcc ctg tct ccg
ggt aaa tga 1854Lys Ser Leu Ser Leu Ser Pro
Gly Lys 610 61518617PRTHomo sapiens 18Met Ser Phe Pro
Cys Lys Phe Val Ala Ser Phe Leu Leu Ile Phe Asn 1 5
10 15Val Ser Ser Lys Gly Ala Val Ser Lys Glu
Ile Thr Asn Ala Leu Glu 20 25
30Thr Trp Gly Ala Leu Gly Gln Asp Ile Asn Leu Asp Ile Pro Ser Phe
35 40 45Gln Met Ser Asp Asp Ile Asp
Asp Ile Lys Trp Glu Lys Thr Ser Asp 50 55
60Lys Lys Lys Ile Ala Gln Phe Arg Lys Glu Lys Glu Thr Phe Lys Glu
65 70 75 80Lys Asp Thr
Tyr Lys Leu Phe Lys Asn Gly Thr Leu Lys Ile Lys His 85
90 95Leu Lys Thr Asp Asp Gln Asp Ile Tyr
Lys Val Ser Ile Tyr Asp Thr 100 105
110Lys Gly Lys Asn Val Leu Glu Lys Ile Phe Asp Leu Lys Ile Gln Glu
115 120 125Arg Val Ser Lys Pro Lys
Ile Ser Trp Thr Cys Ile Asn Thr Thr Leu 130 135
140Thr Cys Glu Val Met Asn Gly Thr Asp Pro Glu Leu Asn Leu Tyr
Gln145 150 155 160Asp Gly
Lys His Leu Lys Leu Ser Gln Arg Val Ile Thr His Lys Trp
165 170 175Thr Thr Ser Leu Ser Ala Lys
Phe Lys Cys Thr Ala Gly Asn Lys Val 180 185
190Ser Lys Glu Ser Ser Val Glu Pro Val Ser Cys Pro Lys Glu
Ile Thr 195 200 205Asn Ala Leu Glu
Thr Trp Gly Ala Leu Gly Gln Asp Ile Asn Leu Asp 210
215 220Ile Pro Ser Phe Gln Met Ser Asp Asp Ile Asp Asp
Ile Lys Trp Glu225 230 235
240Lys Thr Ser Asp Lys Lys Lys Ile Ala Gln Phe Arg Lys Glu Lys Glu
245 250 255Thr Phe Lys Glu Lys
Asp Thr Tyr Lys Leu Phe Lys Asn Gly Thr Leu 260
265 270Lys Ile Lys His Leu Lys Thr Asp Asp Gln Asp Ile
Tyr Lys Val Ser 275 280 285Ile Tyr
Asp Thr Lys Gly Lys Asn Val Leu Glu Lys Ile Phe Asp Leu 290
295 300Lys Ile Gln Glu Arg Val Ser Lys Pro Lys Ile
Ser Trp Thr Cys Ile305 310 315
320Asn Thr Thr Leu Thr Cys Glu Val Met Asn Gly Thr Asp Pro Glu Leu
325 330 335Asn Leu Tyr Gln
Asp Gly Lys His Leu Lys Leu Ser Gln Arg Val Ile 340
345 350Thr His Lys Trp Thr Thr Ser Leu Ser Ala Lys
Phe Lys Cys Thr Ala 355 360 365Gly
Asn Lys Val Ser Lys Glu Ser Ser Val Glu Pro Val Ser Cys Pro 370
375 380Ala Glu Pro Lys Ser Cys Asp Lys Thr His
Thr Cys Pro Pro Cys Pro385 390 395
400Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro
Lys 405 410 415Pro Lys Asp
Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val 420
425 430Val Val Asp Val Ser His Glu Asp Pro Glu
Val Lys Phe Asn Trp Tyr 435 440
445Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu 450
455 460Gln Tyr Asn Ser Thr Tyr Arg Val
Val Ser Val Leu Thr Val Cys His465 470
475 480Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys
Val Ser Asn Lys 485 490
495Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln
500 505 510Pro Arg Glu Pro Gln Val
Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu 515 520
525Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe
Tyr Pro 530 535 540Ser Asp Ile Ala Val
Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn545 550
555 560Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser
Asp Gly Ser Phe Phe Leu 565 570
575Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val
580 585 590Phe Ser Cys Ser Val
Met His Glu Ala Leu His Asn His Tyr Thr Gln 595
600 605Lys Ser Leu Ser Leu Ser Pro Gly Lys 610
615191509DNAHomo sapiensCDS(1)..(1506)CTLA4-CTLA4-IgG 19atg agg
acc tgg ccc tgc act ctc ctg ttt ttt ctt ctc ttc atc cct 48Met Arg
Thr Trp Pro Cys Thr Leu Leu Phe Phe Leu Leu Phe Ile Pro 1
5 10 15gtc ttc tgc aaa gca atg cac gtg
gcc cag cct gct gtg gta ctg gcc 96Val Phe Cys Lys Ala Met His Val
Ala Gln Pro Ala Val Val Leu Ala 20 25
30agc agc cga ggc atc gcc agc ttt gtg tgt gag tat gca tct cca
ggc 144Ser Ser Arg Gly Ile Ala Ser Phe Val Cys Glu Tyr Ala Ser Pro
Gly 35 40 45aaa gcc act gag gtc
cgg gtg aca gtg ctt cgg cag gct gac agc cag 192Lys Ala Thr Glu Val
Arg Val Thr Val Leu Arg Gln Ala Asp Ser Gln 50 55
60gtg act gaa gtc tgt gcg gca acc tac atg atg ggg aat gag
ttg acc 240Val Thr Glu Val Cys Ala Ala Thr Tyr Met Met Gly Asn Glu
Leu Thr 65 70 75 80ttc
cta gat gat tcc atc tgc acg ggc acc tcc agt gga aat caa gtg 288Phe
Leu Asp Asp Ser Ile Cys Thr Gly Thr Ser Ser Gly Asn Gln Val
85 90 95aac ctc act atc caa gga ctg
agg gcc atg gac acg gga ctc tac atc 336Asn Leu Thr Ile Gln Gly Leu
Arg Ala Met Asp Thr Gly Leu Tyr Ile 100 105
110tgc aag gtg gag ctc atg tac cca ccg cca tac tac ctg ggc
ata ggc 384Cys Lys Val Glu Leu Met Tyr Pro Pro Pro Tyr Tyr Leu Gly
Ile Gly 115 120 125aac gga acc cag
att tat gta att gat cca gaa ccg tgc cca gat tcg 432Asn Gly Thr Gln
Ile Tyr Val Ile Asp Pro Glu Pro Cys Pro Asp Ser 130
135 140gat aac atg cac gtg gcc cag cct gct gtg gta ctg
gcc agc agc cga 480Asp Asn Met His Val Ala Gln Pro Ala Val Val Leu
Ala Ser Ser Arg145 150 155
160ggc atc gcc agc ttt gtg tgt gag tat gca tct cca ggc aaa gcc act
528Gly Ile Ala Ser Phe Val Cys Glu Tyr Ala Ser Pro Gly Lys Ala Thr
165 170 175gag gtc cgg gtg aca
gtg ctt cgg cag gct gac agc cag gtg act gaa 576Glu Val Arg Val Thr
Val Leu Arg Gln Ala Asp Ser Gln Val Thr Glu 180
185 190gtc tgt gcg gca acc tac atg atg ggg aat gag ttg
acc ttc cta gat 624Val Cys Ala Ala Thr Tyr Met Met Gly Asn Glu Leu
Thr Phe Leu Asp 195 200 205gat tcc
atc tgc acg ggc acc tcc agt gga aat caa gtg aac ctc act 672Asp Ser
Ile Cys Thr Gly Thr Ser Ser Gly Asn Gln Val Asn Leu Thr 210
215 220atc caa gga ctg agg gcc atg gac acg gga ctc
tac atc tgc aag gtg 720Ile Gln Gly Leu Arg Ala Met Asp Thr Gly Leu
Tyr Ile Cys Lys Val225 230 235
240gag ctc atg tac cca ccg cca tac tac ctg ggc ata ggc aac gga acc
768Glu Leu Met Tyr Pro Pro Pro Tyr Tyr Leu Gly Ile Gly Asn Gly Thr
245 250 255cag att tat gta att
gat cca gaa ccg tgc cca gat tct gca gag ccc 816Gln Ile Tyr Val Ile
Asp Pro Glu Pro Cys Pro Asp Ser Ala Glu Pro 260
265 270aaa tct tgt gac aaa act cac aca tgc cca ccg tgc
cca gca cct gaa 864Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys
Pro Ala Pro Glu 275 280 285ctc ctg
ggg gga ccg tca gtc ttc ctc ttc ccc cca aaa ccc aag gac 912Leu Leu
Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp 290
295 300acc ctc atg atc tcc cgg acc cct gag gtc aca
tgc gtg gtg gtg gac 960Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr
Cys Val Val Val Asp305 310 315
320gtg agc cac gaa gac cct gag gtc aag ttc aac tgg tac gtg gac ggc
1008Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly
325 330 335gtg gag gtg cat aat
gcc aag aca aag ccg cgg gag gag cag tac aac 1056Val Glu Val His Asn
Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn 340
345 350agc acg tac cgg gtg gtc agc gtc ctc acc gtc tgt
cac cag gac tgg 1104Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Cys
His Gln Asp Trp 355 360 365ctg aat
ggc aag gag tac aag tgc aag gtc tcc aac aaa gcc ctc cca 1152Leu Asn
Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro 370
375 380gcc ccc atc gag aaa acc atc tcc aaa gcc aaa
ggg cag ccc cga gaa 1200Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys
Gly Gln Pro Arg Glu385 390 395
400cca cag gtg tac acc ctg ccc cca tcc cgg gat gag ctg acc aag aac
1248Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn
405 410 415cag gtc agc ctg acc
tgc ctg gtc aaa ggc ttc tat ccc agc gac atc 1296Gln Val Ser Leu Thr
Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile 420
425 430gcc gtg gag tgg gag agc aat ggg cag ccg gag aac
aac tac aag acc 1344Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn
Asn Tyr Lys Thr 435 440 445acg cct
ccc gtg ctg gac tcc gac ggc tcc ttc ttc ctc tac agc aag 1392Thr Pro
Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys 450
455 460ctc acc gtg gac aag agc agg tgg cag cag ggg
aac gtc ttc tca tgc 1440Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly
Asn Val Phe Ser Cys465 470 475
480tcc gtg atg cat gag gct ctg cac aac cac tac acg cag aag agc ctc
1488Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu
485 490 495tcc ctg tct ccg ggt
aaa tga 1509Ser Leu Ser Pro Gly
Lys 50020502PRTHomo sapiens 20Met Arg Thr Trp Pro Cys Thr Leu
Leu Phe Phe Leu Leu Phe Ile Pro 1 5 10
15Val Phe Cys Lys Ala Met His Val Ala Gln Pro Ala Val Val
Leu Ala 20 25 30Ser Ser Arg
Gly Ile Ala Ser Phe Val Cys Glu Tyr Ala Ser Pro Gly 35
40 45Lys Ala Thr Glu Val Arg Val Thr Val Leu Arg
Gln Ala Asp Ser Gln 50 55 60Val Thr
Glu Val Cys Ala Ala Thr Tyr Met Met Gly Asn Glu Leu Thr 65
70 75 80Phe Leu Asp Asp Ser Ile Cys
Thr Gly Thr Ser Ser Gly Asn Gln Val 85
90 95Asn Leu Thr Ile Gln Gly Leu Arg Ala Met Asp Thr Gly
Leu Tyr Ile 100 105 110Cys Lys
Val Glu Leu Met Tyr Pro Pro Pro Tyr Tyr Leu Gly Ile Gly 115
120 125Asn Gly Thr Gln Ile Tyr Val Ile Asp Pro
Glu Pro Cys Pro Asp Ser 130 135 140Asp
Asn Met His Val Ala Gln Pro Ala Val Val Leu Ala Ser Ser Arg145
150 155 160Gly Ile Ala Ser Phe Val
Cys Glu Tyr Ala Ser Pro Gly Lys Ala Thr 165
170 175Glu Val Arg Val Thr Val Leu Arg Gln Ala Asp Ser
Gln Val Thr Glu 180 185 190Val
Cys Ala Ala Thr Tyr Met Met Gly Asn Glu Leu Thr Phe Leu Asp 195
200 205Asp Ser Ile Cys Thr Gly Thr Ser Ser
Gly Asn Gln Val Asn Leu Thr 210 215
220Ile Gln Gly Leu Arg Ala Met Asp Thr Gly Leu Tyr Ile Cys Lys Val225
230 235 240Glu Leu Met Tyr
Pro Pro Pro Tyr Tyr Leu Gly Ile Gly Asn Gly Thr 245
250 255Gln Ile Tyr Val Ile Asp Pro Glu Pro Cys
Pro Asp Ser Ala Glu Pro 260 265
270Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu
275 280 285Leu Leu Gly Gly Pro Ser Val
Phe Leu Phe Pro Pro Lys Pro Lys Asp 290 295
300Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val
Asp305 310 315 320Val Ser
His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly
325 330 335Val Glu Val His Asn Ala Lys
Thr Lys Pro Arg Glu Glu Gln Tyr Asn 340 345
350Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Cys His Gln
Asp Trp 355 360 365Leu Asn Gly Lys
Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro 370
375 380Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly
Gln Pro Arg Glu385 390 395
400Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn
405 410 415Gln Val Ser Leu Thr
Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile 420
425 430Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn
Asn Tyr Lys Thr 435 440 445Thr Pro
Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys 450
455 460Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly
Asn Val Phe Ser Cys465 470 475
480Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu
485 490 495Ser Leu Ser Pro
Gly Lys 500211854DNAHomo sapiensCDS(1)..(1851)mgCD2-CD2-IgG
21atg agc ttt cca tgt aaa ttt gta gcc agc ttc ctt ctg att ttc aat
48Met Ser Phe Pro Cys Lys Phe Val Ala Ser Phe Leu Leu Ile Phe Asn 1
5 10 15gtt tct tcc aaa ggt gca
gtc tcc aaa gag att acg aat gcc ttg gaa 96Val Ser Ser Lys Gly Ala
Val Ser Lys Glu Ile Thr Asn Ala Leu Glu 20
25 30acc tgg ggt gcc ttg ggt cag gac atc aac ttg gac att
cct agt ttt 144Thr Trp Gly Ala Leu Gly Gln Asp Ile Asn Leu Asp Ile
Pro Ser Phe 35 40 45caa atg agt
gat gat att gac gat ata aaa tgg gaa aaa act tca gac 192Gln Met Ser
Asp Asp Ile Asp Asp Ile Lys Trp Glu Lys Thr Ser Asp 50
55 60aag aaa aag att gca caa ttc aga aaa gag aaa gag
act ttc aag gaa 240Lys Lys Lys Ile Ala Gln Phe Arg Lys Glu Lys Glu
Thr Phe Lys Glu 65 70 75
80aaa gat aca tat aag cta ttt aaa aat gga act ctg aaa att aag cat
288Lys Asp Thr Tyr Lys Leu Phe Lys Asn Gly Thr Leu Lys Ile Lys His
85 90 95ctg aag acc gat gat
cag gat atc tac aag gta tca ata tat gat aca 336Leu Lys Thr Asp Asp
Gln Asp Ile Tyr Lys Val Ser Ile Tyr Asp Thr 100
105 110aaa gga aaa aat gtg ttg gaa aaa ata ttt gat ttg
aag att caa gag 384Lys Gly Lys Asn Val Leu Glu Lys Ile Phe Asp Leu
Lys Ile Gln Glu 115 120 125agg gtc
tca aaa cca aag atc tcc tgg act tgt atc aac aca acc ctg 432Arg Val
Ser Lys Pro Lys Ile Ser Trp Thr Cys Ile Asn Thr Thr Leu 130
135 140acc tgt gag gta atg aat gga act gac ccc gaa
tta aac ctg tat caa 480Thr Cys Glu Val Met Asn Gly Thr Asp Pro Glu
Leu Asn Leu Tyr Gln145 150 155
160gat ggg aaa cat cta aaa ctt tct cag agg gtc atc aca cac aag tgg
528Asp Gly Lys His Leu Lys Leu Ser Gln Arg Val Ile Thr His Lys Trp
165 170 175acc acc agc ctg agt
gca aaa ttc aag tgc aca gca ggg aac aaa gtc 576Thr Thr Ser Leu Ser
Ala Lys Phe Lys Cys Thr Ala Gly Asn Lys Val 180
185 190agc aag gaa tcc agt gtc gag aat gtc agc tgt cct
aaa aat att acg 624Ser Lys Glu Ser Ser Val Glu Asn Val Ser Cys Pro
Lys Asn Ile Thr 195 200 205aat gcc
ttg gaa acc tgg ggt gcc ttg ggt cag gac atc aac ttg gac 672Asn Ala
Leu Glu Thr Trp Gly Ala Leu Gly Gln Asp Ile Asn Leu Asp 210
215 220att cct agt ttt caa atg agt gat gat att gac
gat ata aaa tgg gaa 720Ile Pro Ser Phe Gln Met Ser Asp Asp Ile Asp
Asp Ile Lys Trp Glu225 230 235
240aaa act tca gac aag aaa aag att gca caa ttc aga aaa gag aaa gag
768Lys Thr Ser Asp Lys Lys Lys Ile Ala Gln Phe Arg Lys Glu Lys Glu
245 250 255act ttc aag gaa aaa
gat aca tat aag cta ttt aaa aat gga act ctg 816Thr Phe Lys Glu Lys
Asp Thr Tyr Lys Leu Phe Lys Asn Gly Thr Leu 260
265 270aaa att aag cat ctg aag acc gat gat cag gat atc
tac aag gta tca 864Lys Ile Lys His Leu Lys Thr Asp Asp Gln Asp Ile
Tyr Lys Val Ser 275 280 285ata tat
gat aca aaa gga aaa aat gtg ttg gaa aaa ata ttt gat ttg 912Ile Tyr
Asp Thr Lys Gly Lys Asn Val Leu Glu Lys Ile Phe Asp Leu 290
295 300aag att caa gag agg gtc tca aaa cca aag atc
tcc tgg act tgt atc 960Lys Ile Gln Glu Arg Val Ser Lys Pro Lys Ile
Ser Trp Thr Cys Ile305 310 315
320aac aca acc ctg acc tgt gag gta atg aat gga act gac ccc gaa tta
1008Asn Thr Thr Leu Thr Cys Glu Val Met Asn Gly Thr Asp Pro Glu Leu
325 330 335aac ctg tat caa gat
ggg aaa cat cta aaa ctt tct cag agg gtc atc 1056Asn Leu Tyr Gln Asp
Gly Lys His Leu Lys Leu Ser Gln Arg Val Ile 340
345 350aca cac aag tgg acc acc agc ctg agt gca aaa ttc
aag tgc aca gca 1104Thr His Lys Trp Thr Thr Ser Leu Ser Ala Lys Phe
Lys Cys Thr Ala 355 360 365ggg aac
aaa gtc agc aag gaa tcc agt gtc gag cct gtc agc tgt cct 1152Gly Asn
Lys Val Ser Lys Glu Ser Ser Val Glu Pro Val Ser Cys Pro 370
375 380gca gag ccc aaa tct tgt gac aaa act cac aca
tgc cca ccg tgc cca 1200Ala Glu Pro Lys Ser Cys Asp Lys Thr His Thr
Cys Pro Pro Cys Pro385 390 395
400gca cct gaa ctc ctg ggg gga ccg tca gtc ttc ctc ttc ccc cca aaa
1248Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys
405 410 415ccc aag gac acc ctc
atg atc tcc cgg acc cct gag gtc aca tgc gtg 1296Pro Lys Asp Thr Leu
Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val 420
425 430gtg gtg gac gtg agc cac gaa gac cct gag gtc aag
ttc aac tgg tac 1344Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys
Phe Asn Trp Tyr 435 440 445gtg gac
ggc gtg gag gtg cat aat gcc aag aca aag ccg cgg gag gag 1392Val Asp
Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu 450
455 460cag tac aac agc acg tac cgg gtg gtc agc gtc
ctc acc gtc tgt cac 1440Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val
Leu Thr Val Cys His465 470 475
480cag gac tgg ctg aat ggc aag gag tac aag tgc aag gtc tcc aac aaa
1488Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys
485 490 495gcc ctc cca gcc ccc
atc gag aaa acc atc tcc aaa gcc aaa ggg cag 1536Ala Leu Pro Ala Pro
Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln 500
505 510ccc cga gaa cca cag gtg tac acc ctg ccc cca tcc
cgg gat gag ctg 1584Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser
Arg Asp Glu Leu 515 520 525acc aag
aac cag gtc agc ctg acc tgc ctg gtc aaa ggc ttc tat ccc 1632Thr Lys
Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro 530
535 540agc gac atc gcc gtg gag tgg gag agc aat ggg
cag ccg gag aac aac 1680Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly
Gln Pro Glu Asn Asn545 550 555
560tac aag acc acg cct ccc gtg ctg gac tcc gac ggc tcc ttc ttc ctc
1728Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu
565 570 575tac agc aag ctc acc
gtg gac aag agc agg tgg cag cag ggg aac gtc 1776Tyr Ser Lys Leu Thr
Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val 580
585 590ttc tca tgc tcc gtg atg cat gag gct ctg cac aac
cac tac acg cag 1824Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn
His Tyr Thr Gln 595 600 605aag agc
ctc tcc ctg tct ccg ggt aaa tga 1854Lys Ser
Leu Ser Leu Ser Pro Gly Lys 610 61522617PRTHomo
sapiens 22Met Ser Phe Pro Cys Lys Phe Val Ala Ser Phe Leu Leu Ile Phe Asn
1 5 10 15Val Ser Ser Lys
Gly Ala Val Ser Lys Glu Ile Thr Asn Ala Leu Glu 20
25 30Thr Trp Gly Ala Leu Gly Gln Asp Ile Asn Leu
Asp Ile Pro Ser Phe 35 40 45Gln
Met Ser Asp Asp Ile Asp Asp Ile Lys Trp Glu Lys Thr Ser Asp 50
55 60Lys Lys Lys Ile Ala Gln Phe Arg Lys Glu
Lys Glu Thr Phe Lys Glu 65 70 75
80Lys Asp Thr Tyr Lys Leu Phe Lys Asn Gly Thr Leu Lys Ile Lys
His 85 90 95Leu Lys Thr
Asp Asp Gln Asp Ile Tyr Lys Val Ser Ile Tyr Asp Thr 100
105 110Lys Gly Lys Asn Val Leu Glu Lys Ile Phe
Asp Leu Lys Ile Gln Glu 115 120
125Arg Val Ser Lys Pro Lys Ile Ser Trp Thr Cys Ile Asn Thr Thr Leu 130
135 140Thr Cys Glu Val Met Asn Gly Thr
Asp Pro Glu Leu Asn Leu Tyr Gln145 150
155 160Asp Gly Lys His Leu Lys Leu Ser Gln Arg Val Ile
Thr His Lys Trp 165 170
175Thr Thr Ser Leu Ser Ala Lys Phe Lys Cys Thr Ala Gly Asn Lys Val
180 185 190Ser Lys Glu Ser Ser Val
Glu Asn Val Ser Cys Pro Lys Asn Ile Thr 195 200
205Asn Ala Leu Glu Thr Trp Gly Ala Leu Gly Gln Asp Ile Asn
Leu Asp 210 215 220Ile Pro Ser Phe Gln
Met Ser Asp Asp Ile Asp Asp Ile Lys Trp Glu225 230
235 240Lys Thr Ser Asp Lys Lys Lys Ile Ala Gln
Phe Arg Lys Glu Lys Glu 245 250
255Thr Phe Lys Glu Lys Asp Thr Tyr Lys Leu Phe Lys Asn Gly Thr Leu
260 265 270Lys Ile Lys His Leu
Lys Thr Asp Asp Gln Asp Ile Tyr Lys Val Ser 275
280 285Ile Tyr Asp Thr Lys Gly Lys Asn Val Leu Glu Lys
Ile Phe Asp Leu 290 295 300Lys Ile Gln
Glu Arg Val Ser Lys Pro Lys Ile Ser Trp Thr Cys Ile305
310 315 320Asn Thr Thr Leu Thr Cys Glu
Val Met Asn Gly Thr Asp Pro Glu Leu 325
330 335Asn Leu Tyr Gln Asp Gly Lys His Leu Lys Leu Ser
Gln Arg Val Ile 340 345 350Thr
His Lys Trp Thr Thr Ser Leu Ser Ala Lys Phe Lys Cys Thr Ala 355
360 365Gly Asn Lys Val Ser Lys Glu Ser Ser
Val Glu Pro Val Ser Cys Pro 370 375
380Ala Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro385
390 395 400Ala Pro Glu Leu
Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys 405
410 415Pro Lys Asp Thr Leu Met Ile Ser Arg Thr
Pro Glu Val Thr Cys Val 420 425
430Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr
435 440 445Val Asp Gly Val Glu Val His
Asn Ala Lys Thr Lys Pro Arg Glu Glu 450 455
460Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Cys
His465 470 475 480Gln Asp
Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys
485 490 495Ala Leu Pro Ala Pro Ile Glu
Lys Thr Ile Ser Lys Ala Lys Gly Gln 500 505
510Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp
Glu Leu 515 520 525Thr Lys Asn Gln
Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro 530
535 540Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln
Pro Glu Asn Asn545 550 555
560Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu
565 570 575Tyr Ser Lys Leu Thr
Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val 580
585 590Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn
His Tyr Thr Gln 595 600 605Lys Ser
Leu Ser Leu Ser Pro Gly Lys 610 615231509DNAHomo
sapiensCDS(1)..(1506)mgCTLA4-CTLA4-IgG 23atg agg acc tgg ccc tgc act ctc
ctg ttt ttt ctt ctc ttc atc cct 48Met Arg Thr Trp Pro Cys Thr Leu
Leu Phe Phe Leu Leu Phe Ile Pro 1 5 10
15gtc ttc tgc aaa gca atg cac gtg gcc cag cct gct gtg gta
ctg gcc 96Val Phe Cys Lys Ala Met His Val Ala Gln Pro Ala Val Val
Leu Ala 20 25 30agc agc cga
ggc atc gcc agc ttt gtg tgt gag tat gca tct cca ggc 144Ser Ser Arg
Gly Ile Ala Ser Phe Val Cys Glu Tyr Ala Ser Pro Gly 35
40 45aaa gcc act gag gtc cgg gtg aca gtg ctt cgg
cag gct gac agc cag 192Lys Ala Thr Glu Val Arg Val Thr Val Leu Arg
Gln Ala Asp Ser Gln 50 55 60gtg act
gaa gtc tgt gcg gca acc tac atg atg ggg aat gag ttg acc 240Val Thr
Glu Val Cys Ala Ala Thr Tyr Met Met Gly Asn Glu Leu Thr 65
70 75 80ttc cta gat gat tcc atc tgc
acg ggc acc tcc agt gga aat caa gtg 288Phe Leu Asp Asp Ser Ile Cys
Thr Gly Thr Ser Ser Gly Asn Gln Val 85
90 95aac ctc act atc caa gga ctg agg gcc atg gac acg gga
ctc tac atc 336Asn Leu Thr Ile Gln Gly Leu Arg Ala Met Asp Thr Gly
Leu Tyr Ile 100 105 110tgc aag
gtg gag ctc atg tac cca ccg cca tac tac ctg ggc ata ggc 384Cys Lys
Val Glu Leu Met Tyr Pro Pro Pro Tyr Tyr Leu Gly Ile Gly 115
120 125aac gga acc cag att tat gta aat gat aca
gaa ccg tgc aat gat tcg 432Asn Gly Thr Gln Ile Tyr Val Asn Asp Thr
Glu Pro Cys Asn Asp Ser 130 135 140gat
aac aat cac acg gcc cag cct gct gtg gta ctg gcc agc agc cga 480Asp
Asn Asn His Thr Ala Gln Pro Ala Val Val Leu Ala Ser Ser Arg145
150 155 160ggc atc gcc agc ttt gtg
tgt gag tat gca tct cca ggc aaa gcc act 528Gly Ile Ala Ser Phe Val
Cys Glu Tyr Ala Ser Pro Gly Lys Ala Thr 165
170 175gag gtc cgg gtg aca gtg ctt cgg cag gct gac agc
cag gtg act gaa 576Glu Val Arg Val Thr Val Leu Arg Gln Ala Asp Ser
Gln Val Thr Glu 180 185 190gtc
tgt gcg gca acc tac atg atg ggg aat gag ttg acc ttc cta gat 624Val
Cys Ala Ala Thr Tyr Met Met Gly Asn Glu Leu Thr Phe Leu Asp 195
200 205gat tcc atc tgc acg ggc acc tcc agt
gga aat caa gtg aac ctc act 672Asp Ser Ile Cys Thr Gly Thr Ser Ser
Gly Asn Gln Val Asn Leu Thr 210 215
220atc caa gga ctg agg gcc atg gac acg gga ctc tac atc tgc aag gtg
720Ile Gln Gly Leu Arg Ala Met Asp Thr Gly Leu Tyr Ile Cys Lys Val225
230 235 240gag ctc atg tac
cca ccg cca tac tac ctg ggc ata ggc aac gga acc 768Glu Leu Met Tyr
Pro Pro Pro Tyr Tyr Leu Gly Ile Gly Asn Gly Thr 245
250 255cag att tat gta att gat cca gaa ccg tgc
cca gat tct gca gag ccc 816Gln Ile Tyr Val Ile Asp Pro Glu Pro Cys
Pro Asp Ser Ala Glu Pro 260 265
270aaa tct tgt gac aaa act cac aca tgc cca ccg tgc cca gca cct gaa
864Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu
275 280 285ctc ctg ggg gga ccg tca gtc
ttc ctc ttc ccc cca aaa ccc aag gac 912Leu Leu Gly Gly Pro Ser Val
Phe Leu Phe Pro Pro Lys Pro Lys Asp 290 295
300acc ctc atg atc tcc cgg acc cct gag gtc aca tgc gtg gtg gtg gac
960Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp305
310 315 320gtg agc cac gaa
gac cct gag gtc aag ttc aac tgg tac gtg gac ggc 1008Val Ser His Glu
Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly 325
330 335gtg gag gtg cat aat gcc aag aca aag ccg
cgg gag gag cag tac aac 1056Val Glu Val His Asn Ala Lys Thr Lys Pro
Arg Glu Glu Gln Tyr Asn 340 345
350agc acg tac cgg gtg gtc agc gtc ctc acc gtc tgt cac cag gac tgg
1104Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Cys His Gln Asp Trp
355 360 365ctg aat ggc aag gag tac aag
tgc aag gtc tcc aac aaa gcc ctc cca 1152Leu Asn Gly Lys Glu Tyr Lys
Cys Lys Val Ser Asn Lys Ala Leu Pro 370 375
380gcc ccc atc gag aaa acc atc tcc aaa gcc aaa ggg cag ccc cga gaa
1200Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu385
390 395 400cca cag gtg tac
acc ctg ccc cca tcc cgg gat gag ctg acc aag aac 1248Pro Gln Val Tyr
Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn 405
410 415cag gtc agc ctg acc tgc ctg gtc aaa ggc
ttc tat ccc agc gac atc 1296Gln Val Ser Leu Thr Cys Leu Val Lys Gly
Phe Tyr Pro Ser Asp Ile 420 425
430gcc gtg gag tgg gag agc aat ggg cag ccg gag aac aac tac aag acc
1344Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr
435 440 445acg cct ccc gtg ctg gac tcc
gac ggc tcc ttc ttc ctc tac agc aag 1392Thr Pro Pro Val Leu Asp Ser
Asp Gly Ser Phe Phe Leu Tyr Ser Lys 450 455
460ctc acc gtg gac aag agc agg tgg cag cag ggg aac gtc ttc tca tgc
1440Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys465
470 475 480tcc gtg atg cat
gag gct ctg cac aac cac tac acg cag aag agc ctc 1488Ser Val Met His
Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu 485
490 495tcc ctg tct ccg ggt aaa tga
1509Ser Leu Ser Pro Gly Lys
50024502PRTHomo sapiens 24Met Arg Thr Trp Pro Cys Thr Leu Leu Phe Phe Leu
Leu Phe Ile Pro 1 5 10
15Val Phe Cys Lys Ala Met His Val Ala Gln Pro Ala Val Val Leu Ala
20 25 30Ser Ser Arg Gly Ile Ala Ser
Phe Val Cys Glu Tyr Ala Ser Pro Gly 35 40
45Lys Ala Thr Glu Val Arg Val Thr Val Leu Arg Gln Ala Asp Ser
Gln 50 55 60Val Thr Glu Val Cys Ala
Ala Thr Tyr Met Met Gly Asn Glu Leu Thr 65 70
75 80Phe Leu Asp Asp Ser Ile Cys Thr Gly Thr Ser
Ser Gly Asn Gln Val 85 90
95Asn Leu Thr Ile Gln Gly Leu Arg Ala Met Asp Thr Gly Leu Tyr Ile
100 105 110Cys Lys Val Glu Leu Met
Tyr Pro Pro Pro Tyr Tyr Leu Gly Ile Gly 115 120
125Asn Gly Thr Gln Ile Tyr Val Asn Asp Thr Glu Pro Cys Asn
Asp Ser 130 135 140Asp Asn Asn His Thr
Ala Gln Pro Ala Val Val Leu Ala Ser Ser Arg145 150
155 160Gly Ile Ala Ser Phe Val Cys Glu Tyr Ala
Ser Pro Gly Lys Ala Thr 165 170
175Glu Val Arg Val Thr Val Leu Arg Gln Ala Asp Ser Gln Val Thr Glu
180 185 190Val Cys Ala Ala Thr
Tyr Met Met Gly Asn Glu Leu Thr Phe Leu Asp 195
200 205Asp Ser Ile Cys Thr Gly Thr Ser Ser Gly Asn Gln
Val Asn Leu Thr 210 215 220Ile Gln Gly
Leu Arg Ala Met Asp Thr Gly Leu Tyr Ile Cys Lys Val225
230 235 240Glu Leu Met Tyr Pro Pro Pro
Tyr Tyr Leu Gly Ile Gly Asn Gly Thr 245
250 255Gln Ile Tyr Val Ile Asp Pro Glu Pro Cys Pro Asp
Ser Ala Glu Pro 260 265 270Lys
Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu 275
280 285Leu Leu Gly Gly Pro Ser Val Phe Leu
Phe Pro Pro Lys Pro Lys Asp 290 295
300Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp305
310 315 320Val Ser His Glu
Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly 325
330 335Val Glu Val His Asn Ala Lys Thr Lys Pro
Arg Glu Glu Gln Tyr Asn 340 345
350Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Cys His Gln Asp Trp
355 360 365Leu Asn Gly Lys Glu Tyr Lys
Cys Lys Val Ser Asn Lys Ala Leu Pro 370 375
380Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg
Glu385 390 395 400Pro Gln
Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn
405 410 415Gln Val Ser Leu Thr Cys Leu
Val Lys Gly Phe Tyr Pro Ser Asp Ile 420 425
430Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr
Lys Thr 435 440 445Thr Pro Pro Val
Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys 450
455 460Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn
Val Phe Ser Cys465 470 475
480Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu
485 490 495Ser Leu Ser Pro Gly
Lys 5002533DNAArtificial SequencePCR primer, oligonucleotide
TNFR1-EDF-EcoRI 25ccggaattcc ggtctggcat gggcctctcc acc
33 2637DNAArtificial SequencePCR primer, oligonucleotide
TNFR1-EDR-IgGh 26cacaagattt gggctctgct gtggtgcctg agtcctc
37 2737DNAArtificial SequencePCR primer, oligonucleotide
IgG1-T1F 27gaggactcag gcaccacagc agagcccaaa tcttgtg
37 2834DNAArtificial SequencePCR primer, oligonucleotide
IgG1-R-XbaI 28gctctagagc tcatttaccc ggagacaggg agag
34 2933DNAArtificial SequencePCR primer, oligonucleotide
TNFR2-EDF-EcoRI 29ccggaattcc gggcacccat ggcgcccgtc gcc
33 3037DNAArtificial SequencePCR primer, oligonucleotide
TNFR2-EDR-IgGh 30cacaagattt gggctctgcg tcgccagtgc tcccttc
37 3137DNAArtificial SequencePCR primer, oligonucleotide
IgG-T2F 31gaagggagca ctggcgacgc agagcccaaa tcttgtg
37 3237DNAArtificial SequencePCR primer, oligonucleotide
TNFR1-CF-BamHI 32cgcggatccg ggaacatttc actggtccct cacctag
37 3339DNAArtificial SequencePCR primer, oligonucleotide
TNFR1-NR-BamHI 33cgcggatccg tcctcagtgc ccttaacatt ctcaatctg
39 3436DNAArtificial SequencePCR primer, oligonucleotide
TNFR2-CF-BamHI 34cgcggatcca acgcaactac accctacgcc ccggag
36 3531DNAArtificial SequencePCR primer, oligonucleotide
TNFR2-NR-BamHI 35cgcggatccg ctcccttcag ctggggggct g
31 3663DNAArtificial SequencePCR primer, oligonucleotide
mgTNFR1-TNFR1-IgG-F 36aaaagcaacg agaccaacaa gacctgccta cacaacgggt
ccagggagaa gaacgatagt 60 gtg
633762DNAArtificial SequencePCR primer,
oligonucleotide mgTNFR1-TNFR1-IgG-R 37ctccctggac ccgttgtgta ggcaggtctt
gttggtctcg ttgcttttct tacagttact 60 ac
623845DNAArtificial SequencePCR
primer, oligonucleotide mgTNFR2-TNFR2-IgG-F 38atggatgcaa actgcacgtc
cccggagccc aacagcacat gccgg 45 3942DNAArtificial
SequencePCR primer, oligonucleotide mgTNFR2-TNFR2-IgG-R 39gcatgtgctg
ttgggctccg gggacgtgca gtttgcatcc at 42
4036DNAArtificial SequencePCR primer, oligonucleotide CD2F-EcoRI
40ccggaattca tgagctttcc atgtaaattt gtagcc
36 4130DNAArtificial SequencePCR primer, oligonucleotide CD2R-PstI
41ctctgcagga cagctgacag gctcgacact
30 4225DNAArtificial SequencePCR primer, oligonucleotide IgG-F-PstI
42atctgcagag cccaaatctt gtgac
25 4324DNAArtificial SequencePCR primer, oligonucleotide CTLA4F-EcoRI
43ccggaattca tgaggacctg gccc
24 4430DNAArtificial SequencePCR primer, oligonucleotide CTLA4R-PstI
44ctctgcagaa tctgggcacg gttcaggatc
30 4519DNAArtificial SequencePCR primer, oligonucleotide CD2-NT-F
45taaagagatt acgaatgcc
19 4618DNAArtificial SequencePCR primer, oligonucleotide CD2-CT-R
46tgcaggacag ctgacagg
18 4723DNAArtificial SequencePCR primer, oligonucleotide CTLA4-NT-F
47ggataatcat gcacgtggcc cag
23 4818DNAArtificial SequencePCR primer, oligonucleotide CTLA4-CT-R
48tgcagaatct gggcacgg
18 4943DNAArtificial SequencePCR primer, oligonucleotide mgCD2-CD2-IgG-F
49cagtgtcgag aatgtcagct gtcctaaaaa tattacgaat gcc
43 5043DNAArtificial SequencePCR primer, oligonucleotide mgCD2-CD2-IgG-R
50ggcattcgta atatttttag gacagctgac attctcgaca ctg
43 5164DNAArtificial SequencePCR primer, oligonucleotide
mgCTLA4-CTLA4-IgG-F 51atttatgtaa acgatacaga accgtgcaat gattcggata
acaaccacac agcccagcct 60 gctg
64 5263DNAArtificial SequencePCR primer,
oligonucleotide mgCTLA4-CTLA4-IgG-R 52aggctgggct gtgtggttgt tatccgaatc
attgcacggt tctgtatcgt ttacataaat 60 ctg
63
User Contributions:
Comment about this patent or add new information about this topic: