Patents - stay tuned to the technology

Inventors list

Assignees list

Classification tree browser

Top 100 Inventors

Top 100 Assignees

Patent application title: ANTI-SIRP ALPHA ANTIBODIES

Inventors:
IPC8 Class: AC07K1628FI
USPC Class: 4241331
Class name: Drug, bio-affecting and body treating compositions immunoglobulin, antiserum, antibody, or antibody fragment, except conjugate or complex of the same with nonimmunoglobulin material structurally-modified antibody, immunoglobulin, or fragment thereof (e.g., chimeric, humanized, cdr-grafted, mutated, etc.)
Publication date: 2022-05-05
Patent application number: 20220135677



Abstract:

The present invention relates to anti-SIRP.alpha. antibodies, as well as use of these antibodies in the treatment of diseases such as cancer and infectious disease.

Claims:

1. An isolated therapeutic antibody, comprising: a variable region that binds to human SIRP.alpha.V1 protein having the sequence of SEQ ID NO: 34 with an EC.sub.50 of 10 nM or less, wherein the variable region discriminates between human SIRP isoforms comprising a proline in the SIRP IgV domain at a position corresponding to Pro.sub.74 of SEQ ID NO: 34 and human SIRP isoforms in which the proline corresponding to residue 74 of SEQ ID NO: 34 is replaced by alanine.

2. An isolated therapeutic antibody according to claim 1, wherein the antibody inhibits binding of human SIRP.alpha. having the sequence of SEQ ID NO: 34 to human CD47 with an IC.sub.50 of of 10 nM or less.

3. An isolated therapeutic antibody according to claim 1, wherein the antibody binds to a cell expressing human SIRP.alpha.V2 protein with an EC.sub.50 of 10 nM or less.

4. An isolated therapeutic antibody according to claim 3, wherein the antibody binds to a cell expressing human SIRP.alpha.V1 protein having the sequence of SEQ ID NO: 34 with an EC.sub.50 of 1 nM or less, and binds to a cell expressing human SIRP.alpha.V2 protein with an EC.sub.50 of 1 nM or less.

5. An isolated therapeutic antibody of claim 1, wherein the antibody is an IgG.

6. An isolated therapeutic antibody of claim 5, wherein each of the two variable regions of the IgG binds to human SIRP.alpha.V1 protein having the sequence of SEQ ID NO: 34 with an EC.sub.50 of 10 nM or less and discriminates between human SIRP isoforms comprising a proline in the SIRP IgV domain at a position corresponding to Pro.sub.74 of SEQ ID NO: 34 and human SIRP isoforms in which the proline corresponding to residue 74 of SEQ ID NO: 34 is replaced by alanine.

7. An isolated therapeutic antibody of claim 5, wherein the antibody exhibits a T20 "humanness" score of at least 79.

8. An isolated therapeutic antibody of claim 6, wherein the antibody exhibits a T20 "humanness" score of at least 79.

9. An isolated therapeutic antibody of claim 4, wherein the antibody is an IgG.

10. An isolated therapeutic antibody of claim 9, wherein each of the two variable regions of the IgG binds to human SIRP.alpha.V1 protein having the sequence of SEQ ID NO: 34 with an EC.sub.50 of 10 nM or less and discriminates between human SIRP isoforms comprising a proline in the SIRP IgV domain at a position corresponding to Pro.sub.74 of SEQ ID NO: 34 and human SIRP isoforms in which the proline corresponding to residue 74 of SEQ ID NO: 34 is replaced by alanine.

11. An isolated therapeutic antibody of claim 9, wherein the antibody exhibits a T20 "humanness" score of at least 79.

12. An isolated therapeutic antibody of claim 10, wherein the antibody exhibits a T20 "humanness" score of at least 79.

13. A composition comprising: the therapeutic antibody of claim 1 and a pharmaceutically acceptable carrier or diluent.

14. A composition comprising: the therapeutic antibody of claim 4 and a pharmaceutically acceptable carrier or diluent.

15. A composition comprising: the therapeutic antibody of claim 5 and a pharmaceutically acceptable carrier or diluent.

16. A composition comprising: the therapeutic antibody of claim 6 and a pharmaceutically acceptable carrier or diluent.

17. A composition comprising: the therapeutic antibody of claim 7 and a pharmaceutically acceptable carrier or diluent.

18. A composition comprising: the therapeutic antibody of claim 8 and a pharmaceutically acceptable carrier or diluent.

19. A composition comprising: the therapeutic antibody of claim 9 and a pharmaceutically acceptable carrier or diluent.

20. A composition comprising: the therapeutic antibody of claim 10 and a pharmaceutically acceptable carrier or diluent.

21. A composition comprising: the therapeutic antibody of claim 11 and a pharmaceutically acceptable carrier or diluent.

22. A composition comprising: the therapeutic antibody of claim 12 and a pharmaceutically acceptable carrier or diluent.

Description:

[0001] The present application is a divisional of U.S. patent application Ser. No. 17/107,334, filed on Nov. 30, 2020, which is a divisional of U.S. patent application Ser. No. 15/953,201, filed Apr. 13, 2018, now U.S. Pat. No. 10,851,164, which claims the benefit of Netherlands Patent Application No. 2018708, filed Apr. 13, 2017, and of Netherlands Patent Application No. 2019166, filed Jul. 3, 2017, each of which is hereby incorporated by reference in its entirety including all tables, figures, and claims.

REFERENCE TO SEQUENCE LISTING SUBMITTED VIA EFS-WEB

[0002] This application includes an electronically submitted sequence listing in .txt format. The .txt file contains a sequence listing entitled "ABE-0007-DV2_SeqListing.txt" created on Jan. 14, 2022, and is 233 kilobytes in size. The sequence listing contained in this .txt file is part of the specification and is hereby incorporated by reference herein in its entirety.

FIELD OF THE INVENTION

[0003] The present invention relates to anti-SIRP.alpha. antibodies, as well as use of these antibodies in the treatment of diseases.

BACKGROUND OF THE INVENTION

[0004] Signal regulatory protein alpha (SIRP.alpha.) is membrane glycoprotein from the SIRP family. Members of the SIRP family share certain common structural motifs. These include a transmembrane segment and an N-terminal extracellular domain that contains three Ig-like loops connected by three pairs of disulfide bonds. The C-terminal intracellular domain, however, differs between SIRP family members. SIRP.alpha. has an extended intracellular domain containing four tyrosine residues that form two immunoreceptor tyrosine-based inhibitory motifs (ITIMs), while SIRP.beta.1 contains a lysine residue in the transmembrane domain followed by a short intracellular tail lacking ITIMs serving as a receptor for DAP12. Eight SIRP.alpha. single nucleotide polymorphisms have been identified, with the most prevalent being SIRP.alpha.V1 and SIRP.alpha.V2 (Takenaka et al., Nat. Immunol. 2007, 8:1313-23).

[0005] "Eat-me" signals (i.e. "altered self') are extracellular players specifically produced by and displayed on the surface of apoptotic cells, but not healthy cells, and are key to the initiation of phagocytosis by activating phagocytic receptors and subsequent signaling cascades. Eat-me signals require extracellular trafficking in order to be displayed on apoptotic cells. A particular category of eat-me signals is provided by membrane-anchored proteins such as phosphatidylserine (PtdSer) and calreticulin (CRT). Externalized PtdSer binds to its receptors on phagocytes to facilitate clearance of apoptotic cells (a process known as efferocytosis). Likewise, CRT is upregulated on the surface of apoptotic cells and binds to LDL-receptor-related protein 1 (LRP1) on the phagocyte thereby mediating engulfment.

[0006] SIRP.alpha. is broadly expressed on phagocytes (e.g., macrophages, granulocytes, and dendritic cells) and acts as an inhibitory receptor through its interaction with a transmembrane protein CD47. This interaction mediates a response referred to as the "don't eat me" signal. This interaction negatively regulates effector function of innate immune cells such as host cell phagocytosis. As CD47 is often present on tumor cells, this "don't eat me" signal is thought to contribute to the resistance of tumors to phagocyte-dependent clearance. Despite the similarities in the extracellular domains of SIRP.alpha. and SIRP.beta.1 functional differences exist among the SIRP family members. For example, SIRP.beta.1 does not bind CD47 at detectable levels and so does not mediate the "don't eat me" signal. Instead, SIRP.beta.1 is involved in the activation of myeloid cells.

[0007] Disruption of CD47-SIRP.alpha. signalling (e.g., by antagonistic monoclonal antibodies that bind to either CD47 or SIRP.alpha.) reportedly results in enhanced phagocytosis of both solid and hematopoietic tumor cells, including increased phagocytosis of glioblastoma cells in vitro and significant anti-tumor activity in vivo.

SUMMARY OF THE INVENTION

[0008] In a first aspect, the invention provides anti-SIRP.alpha. antibodies and antigen binding fragments thereof comprising the structural and functional features specified below.

[0009] In various embodiments, the invention provides an antibody or antigen binding fragment thereof that binds to human SIRP.alpha. comprising one, two, or all three of (i), (ii) and (iii): (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1 or an amino acid sequence differing from SEQ ID NO: 1 by 1, 2, 3, or more conservative substitutions; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2 or an amino acid sequence differing from SEQ ID NO: 2 by 1, 2, 3, or more conservative substitutions; and/or (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3 or an amino acid sequence differing from SEQ ID NO: 3 by 1, 2, 3, or more conservative substitutions.

[0010] In various other embodiments, the invention provides an antibody or antigen binding fragment thereof that binds to human SIRP.alpha. comprising one, two, or all three of (i), (ii) and (iii): (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 69 or an amino acid sequence differing from SEQ ID NO: 1 by 1, 2, 3, or more conservative substitutions; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 70 or an amino acid sequence differing from SEQ ID NO: 2 by 1, 2, 3, or more conservative substitutions; and/or (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 71 or an amino acid sequence differing from SEQ ID NO: 3 by 1, 2, 3, or more conservative substitutions.

[0011] In certain embodiments, the antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising an amino acid sequence selected from the group consisting of:

[0012] SEQ ID NO: 75 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0013] SEQ ID NO: 78 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0014] SEQ ID NO: 80 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0015] SEQ ID NO: 82 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0016] SEQ ID NO: 84 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0017] SEQ ID NO: 86 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0018] SEQ ID NO: 88 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0019] SEQ ID NO: 102 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0020] SEQ ID NO: 7 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0021] SEQ ID NO: 10 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0022] SEQ ID NO: 12 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0023] SEQ ID NO: 14 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0024] SEQ ID NO: 16 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0025] SEQ ID NO: 18 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto, and

[0026] SEQ ID NO: 30 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto.

[0027] In various embodiments, the invention also provides an antibody or antigen binding fragment thereof that binds to human SIRP.alpha. comprising one, two, or all three of (i), (ii) and (iii): (i) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4 or an amino acid sequence differing from SEQ ID NO: 4 by 1, 2, 3, or more conservative substitutions; (ii) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5 or an amino acid sequence differing from SEQ ID NO: 5 by 1, 2, 3, or more conservative substitutions; and/or (iii) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6 or an amino acid sequence differing from SEQ ID NO: 6 by 1, 2, 3, or more conservative substitutions.

[0028] In various other embodiments, the invention also provides an antibody or antigen binding fragment thereof that binds to human SIRP.alpha. comprising one, two, or all three of (i), (ii) and (iii): (i) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 72 or an amino acid sequence differing from SEQ ID NO: 4 by 1, 2, 3, or more conservative substitutions; (ii) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 73 or an amino acid sequence differing from SEQ ID NO: 5 by 1, 2, 3, or more conservative substitutions; and/or (iii) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 74 or an amino acid sequence differing from SEQ ID NO: 6 by 1, 2, 3, or more conservative substitutions.

[0029] In certain embodiments, the antibody or antigen binding fragment thereof comprises a light chain variable region comprising an amino acid sequence selected from the group consisting of:

[0030] SEQ ID NO: 76 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0031] SEQ ID NO: 90 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0032] SEQ ID NO: 92 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0033] SEQ ID NO: 94 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0034] SEQ ID NO: 96 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0035] SEQ ID NO: 98 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0036] SEQ ID NO: 100 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0037] SEQ ID NO: 104 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0038] SEQ ID NO: 8 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0039] SEQ ID NO: 20 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0040] SEQ ID NO: 22 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0041] SEQ ID NO: 24 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0042] SEQ ID NO: 26 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0043] SEQ ID NO: 28 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto, and

[0044] SEQ ID NO: 32 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto.

[0045] In various embodiments, the invention provides an antibody or antigen binding fragment thereof that binds to human SIRP.alpha. comprising:

[0046] (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1 or an amino acid sequence differing from SEQ ID NO: 1 by 1, 2, 3, or more conservative substitutions; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2 or an amino acid sequence differing from SEQ ID NO: 2 by 1, 2, 3, or more conservative substitutions; and/or (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3 or an amino acid sequence differing from SEQ ID NO: 3 by 1, 2, 3, or more conservative substitutions;

[0047] and

[0048] (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4 or an amino acid sequence differing from SEQ ID NO: 4 by 1, 2, 3, or more conservative substitutions; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5 or an amino acid sequence differing from SEQ ID NO: 5 by 1, 2, 3, or more conservative substitutions; and/or (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6 or an amino acid sequence differing from SEQ ID NO: 6 by 1, 2, 3, or more conservative substitutions.

[0049] In various other embodiments, the invention provides an antibody or antigen binding fragment thereof that binds to human SIRP.alpha. comprising:

[0050] (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 69 or an amino acid sequence differing from SEQ ID NO: 1 by 1, 2, 3, or more conservative substitutions; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 70 or an amino acid sequence differing from SEQ ID NO: 2 by 1, 2, 3, or more conservative substitutions; and/or (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 71 or an amino acid sequence differing from SEQ ID NO: 3 by 1, 2, 3, or more conservative substitutions;

[0051] and

[0052] (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 72 or an amino acid sequence differing from SEQ ID NO: 4 by 1, 2, 3, or more conservative substitutions; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 73 or an amino acid sequence differing from SEQ ID NO: 5 by 1, 2, 3, or more conservative substitutions; and/or (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6 or an amino acid sequence differing from SEQ ID NO: 74 by 1, 2, 3, or more conservative substitutions.

[0053] In still other embodiments, the invention provides an antibody or antigen binding fragment thereof that binds to human SIRP.alpha. comprising:

a heavy chain variable region comprising an amino acid sequence selected from the group consisting of:

[0054] SEQ ID NO: 7 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0055] SEQ ID NO: 10 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0056] SEQ ID NO: 12 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0057] SEQ ID NO: 14 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0058] SEQ ID NO: 16 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0059] SEQ ID NO: 18 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto, and

[0060] SEQ ID NO: 30 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto; and a light chain variable region comprising an amino acid sequence selected from the group consisting of:

[0061] SEQ ID NO: 8 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0062] SEQ ID NO: 20 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0063] SEQ ID NO: 22 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0064] SEQ ID NO: 24 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0065] SEQ ID NO: 26 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto, and

[0066] SEQ ID NO: 28 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto, and

[0067] SEQ ID NO: 32 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto.

[0068] In still other embodiments, the invention provides an antibody or antigen binding fragment thereof that binds to human SIRP.alpha. comprising:

[0069] a heavy chain variable region comprising an amino acid sequence selected from the group consisting of:

[0070] SEQ ID NO: 75 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0071] SEQ ID NO: 78 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0072] SEQ ID NO: 80 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0073] SEQ ID NO: 82 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0074] SEQ ID NO: 84 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0075] SEQ ID NO: 86 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0076] SEQ ID NO: 88 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto; and

[0077] SEQ ID NO: 102 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto, and

[0078] a light chain variable region comprising an amino acid sequence selected from the group consisting of:

[0079] SEQ ID NO: 76 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0080] SEQ ID NO: 90 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0081] SEQ ID NO: 92 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0082] SEQ ID NO: 94 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0083] SEQ ID NO: 96 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0084] SEQ ID NO: 98 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0085] SEQ ID NO: 100 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto, and

[0086] SEQ ID NO: 104 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0087] In this context, "sequence similarity" is based on the extent of identity combined with the extent of conservative changes. The percentage of "sequence similarity" is the percentage of amino acids or nucleotides which is either identical or conservatively changed viz. "sequence similarity"=percent sequence identity)+percent conservative changes). Thus, for the purpose of this invention "conservative changes" and "identity" are considered to be species of the broader term "similarity". Thus, whenever the term sequence "similarity" is used it embraces sequence "identity" and "conservative changes". According to certain embodiments the conservative changes are disregarded and the percent sequence similarity refers to percent sequence identity. In certain embodiments, the changes in a sequence permitted by the referenced percent sequence identity are all or nearly all conservative changes; that is, when a sequence is 90% identical, the remaining 10% are all or nearly all conservative changes. The term "nearly all" in this context refers to at least 75% of the permitted sequence changes are conservative changes, more preferably at least 85%, still more preferably at least 90%, and most preferably at least 95%. In certain embodiments of antibody heavy and/or light chains, the permitted sequence changes are within the framework regions and not in the CDRs.

[0088] Preferably said antibody has a heavy chain according to SEQ ID NO: 7. Further preferably said antibody has a light chain according to SEQ ID NO: 8. More preferably, the heavy chain is chosen from any of SEQ ID NO: 10, 12, 14, 16, 18, or 30. More preferably, the light chain is chosen from any of SEQ ID NO: 20, 22, 24, 26, 28, or 32.

[0089] Alternatively, said antibody has a heavy chain according to SEQ ID NO: 75. Further preferably said antibody has a light chain according to SEQ ID NO: 76. More preferably, the heavy chain is chosen from any of SEQ ID NO: 78, 80, 82, 84, 86, 88 or 102. More preferably, the light chain is chosen from any of SEQ ID NO: 90, 92, 94, 96, 98, 100 or 104.

[0090] In any of the above embodiments, the antibody or antigen binding fragment thereof may be isolated, as that term is defined herein.

[0091] In any of the above embodiments, the antibody or antigen binding fragment thereof is a recombinant antibody, as that term is defined herein.

[0092] In any of the above embodiments, the antibody or antigen binding fragment thereof is a full-length antibody, as that term is defined herein.

[0093] Antibodies or antigen binding fragments of the present invention may be obtained from a variety of species. For example, the antibodies of the present invention may comprise immunoglobulin sequences which are rabbit, mouse, rat, guinea pig, chicken, goat, sheep, donkey, human, llama or camelid sequences, or combinations of such sequences (so-called chimeric antibodies). Most preferably, the antibodies or antigen binding fragments are human or humanized antibodies or antigen binding fragments.

[0094] The term antibody includes antigen-binding portions, i.e., "antigen binding sites," (e.g., fragments, subsequences, complementarity determining regions (CDRs)) that retain capacity to bind antigen, including (i) a Fab fragment, a monovalent fragment consisting of the V.sub.L, V.sub.H, C.sub.L and C.sub.H1 domains; (ii) a F(ab').sub.2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the V.sub.H and C.sub.H1 domains; (iv) a Fv fragment consisting of the V.sub.L and V.sub.H domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546), which consists of a VH domain; and (vi) an isolated complementarity determining region (CDR). Single chain antibodies are also included by reference in the term "antibody." Preferred therapeutic antibodies are intact IgG antibodies. The term "intact IgG" as used herein is meant as a polypeptide belonging to the class of antibodies that are substantially encoded by a recognized immunoglobulin gamma gene. In humans this class comprises IgG1, IgG2, IgG3, and IgG4. In mice this class comprises IgG1, IgG2a, IgG2b, and IgG3. The known Ig domains in the IgG class of antibodies are V.sub.H, C.gamma.1, C.gamma.2, C.gamma.3, V.sub.L, and C.sub.L.

[0095] In any of the above embodiments, the antibody or antigen binding fragment thereof is a human or humanized antibody comprising two heavy chains and two light chains. In one embodiment, the antibody is an IgG. In preferred embodiments, antibody is an IgG1, IgG2, or IgG4, and preferably a human IgG1, IgG2, or IgG4.

[0096] In any of the above-mentioned embodiments, the antibody or antigen binding fragment thereof of the invention can comprise any of the light chain variable regions described above and a human kappa or lambda light chain constant domain and an IgG1, IgG2, or IgG4 heavy chain constant domain. Exemplary light (kappa) and heavy (IgG2 and IgG4) constant region sequences which may be used in accordance with the invention are recited in SEQ ID NOs: 63, 65, 67 (each a nucleotide sequence), 64, 66, and 68 (each a polypeptide sequence).

[0097] By way of example only, in various embodiments such antibody or antigen binding fragment thereof comprises one of the following combinations of heavy chain sequence/light chain variable region sequences:

SEQ ID NO: 10/SEQ ID NO: 20 (referred to herein as hSIRP.alpha..50A.H1L1) SEQ ID NO: 10/SEQ ID NO: 22 (referred to herein as hSIRP.alpha..50A.H1L2) SEQ ID NO: 10/SEQ ID NO: 24 (referred to herein as hSIRP.alpha..50A.H1L3) SEQ ID NO: 10/SEQ ID NO: 26 (referred to herein as hSIRP.alpha..50A.H1L4) SEQ ID NO: 10/SEQ ID NO: 28 (referred to herein as hSIRP.alpha..50A.H1L5) SEQ ID NO: 12/SEQ ID NO: 20 (referred to herein as hSIRP.alpha..50A.H2L1) SEQ ID NO: 12/SEQ ID NO: 22 (referred to herein as hSIRP.alpha..50A.H2L2) SEQ ID NO: 12/SEQ ID NO: 24 (referred to herein as hSIRP.alpha..50A.H2L3) SEQ ID NO: 12/SEQ ID NO: 26 (referred to herein as hSIRP.alpha..50A.H2L4) SEQ ID NO: 12/SEQ ID NO: 28 (referred to herein as hSIRP.alpha..50A.H2L5) SEQ ID NO: 14/SEQ ID NO: 20 (referred to herein as hSIRP.alpha..50A.H3L1) SEQ ID NO: 14/SEQ ID NO: 22 (referred to herein as hSIRP.alpha..50A.H3L2) SEQ ID NO: 14/SEQ ID NO: 24 (referred to herein as hSIRP.alpha..50A.H3L3) SEQ ID NO: 14/SEQ ID NO: 26 (referred to herein as hSIRP.alpha..50A.H3L4) SEQ ID NO: 14/SEQ ID NO: 28 (referred to herein as hSIRP.alpha..50A.H3L5) SEQ ID NO: 16/SEQ ID NO: 20 (referred to herein as hSIRP.alpha..50A.H4L1) SEQ ID NO: 16/SEQ ID NO: 22 (referred to herein as hSIRP.alpha..50A.H4L2) SEQ ID NO: 16/SEQ ID NO: 24 (referred to herein as hSIRP.alpha..50A.H4L3) SEQ ID NO: 16/SEQ ID NO: 26 (referred to herein as hSIRP.alpha..50A.H4L4) SEQ ID NO: 16/SEQ ID NO: 28 (referred to herein as hSIRP.alpha..50A.H4L5) SEQ ID NO: 18/SEQ ID NO: 20 (referred to herein as hSIRP.alpha..50A.H5L1) SEQ ID NO: 18/SEQ ID NO: 22 (referred to herein as hSIRP.alpha..50A.H5L2) SEQ ID NO: 18/SEQ ID NO: 24 (referred to herein as hSIRP.alpha..50A.H5L3) SEQ ID NO: 18/SEQ ID NO: 26 (referred to herein as hSIRP.alpha..50A.H5L4) SEQ ID NO: 18/SEQ ID NO: 28 (referred to herein as hSIRP.alpha..50A.H5L5) SEQ ID NO: 78/SEQ ID NO: 90 (referred to herein as hSIRP.alpha..40A.H1L1) SEQ ID NO: 78/SEQ ID NO: 92 (referred to herein as hSIRP.alpha..40A.H1L2) SEQ ID NO: 78/SEQ ID NO: 94 (referred to herein as hSIRP.alpha..40A.H1L3) SEQ ID NO: 78/SEQ ID NO: 96 (referred to herein as hSIRP.alpha..40A.H1L4) SEQ ID NO: 78/SEQ ID NO: 98 (referred to herein as hSIRP.alpha..40A.H1L5) SEQ ID NO: 78/SEQ ID NO: 100 (referred to herein as hSIRP.alpha..40A.H1L6) SEQ ID NO: 80/SEQ ID NO: 90 (referred to herein as hSIRP.alpha..40A.H2L1) SEQ ID NO: 80/SEQ ID NO: 92 (referred to herein as hSIRP.alpha..40A.H2L2) SEQ ID NO: 80/SEQ ID NO: 94 (referred to herein as hSIRP.alpha..40A.H2L3) SEQ ID NO: 80/SEQ ID NO: 96 (referred to herein as hSIRP.alpha..40A.H2L4) SEQ ID NO: 80/SEQ ID NO: 98 (referred to herein as hSIRP.alpha..40A.H2L5) SEQ ID NO: 80/SEQ ID NO: 100 (referred to herein as hSIRP.alpha..40A.H2L6) SEQ ID NO: 82/SEQ ID NO: 90 (referred to herein as hSIRP.alpha..40A.H3L1) SEQ ID NO: 82/SEQ ID NO: 92 (referred to herein as hSIRP.alpha..40A.H3L2) SEQ ID NO: 82/SEQ ID NO: 94 (referred to herein as hSIRP.alpha..40A.H3L3) SEQ ID NO: 82/SEQ ID NO: 96 (referred to herein as hSIRP.alpha..40A.H3L4) SEQ ID NO: 82/SEQ ID NO: 98 (referred to herein as hSIRP.alpha..40A.H3L5) SEQ ID NO: 82/SEQ ID NO: 100 (referred to herein as hSIRP.alpha..40A.H3L6) SEQ ID NO: 84/SEQ ID NO: 90 (referred to herein as hSIRP.alpha..40A.H4L1) SEQ ID NO: 84/SEQ ID NO: 92 (referred to herein as hSIRP.alpha..40A.H4L2) SEQ ID NO: 84/SEQ ID NO: 94 (referred to herein as hSIRP.alpha..40A.H4L3) SEQ ID NO: 84/SEQ ID NO: 96 (referred to herein as hSIRP.alpha..40A.H4L4) SEQ ID NO: 84/SEQ ID NO: 98 (referred to herein as hSIRP.alpha..40A.H4L5) SEQ ID NO: 84/SEQ ID NO: 100 (referred to herein as hSIRP.alpha..40A.H4L6) SEQ ID NO: 86/SEQ ID NO: 90 (referred to herein as hSIRP.alpha..40A.H5L1) SEQ ID NO: 86/SEQ ID NO: 92 (referred to herein as hSIRP.alpha..40A.H5L2) SEQ ID NO: 86/SEQ ID NO: 94 (referred to herein as hSIRP.alpha..40A.H5L3) SEQ ID NO: 86/SEQ ID NO: 96 (referred to herein as hSIRP.alpha..40A.H5L4) SEQ ID NO: 86/SEQ ID NO: 98 (referred to herein as hSIRP.alpha..40A.H5L5) SEQ ID NO: 86/SEQ ID NO: 100 (referred to herein as hSIRP.alpha..40A.H5L6) SEQ ID NO: 88/SEQ ID NO: 90 (referred to herein as hSIRP.alpha..40A.H6L1) SEQ ID NO: 88/SEQ ID NO: 92 (referred to herein as hSIRP.alpha..40A.H6L2) SEQ ID NO: 88/SEQ ID NO: 94 (referred to herein as hSIRP.alpha..40A.H6L3) SEQ ID NO: 88/SEQ ID NO: 96 (referred to herein as hSIRP.alpha..40A.H6L4) SEQ ID NO: 88/SEQ ID NO: 98 (referred to herein as hSIRP.alpha..40A.H6L5) SEQ ID NO: 88/SEQ ID NO: 100 (referred to herein as hSIRP.alpha..40A.H6L6) or, in each case, at least 90%, 95%, 97%, 98%, or 99% similar or identical to a respective SEQ ID NO.

[0098] In some preferred embodiments, the antibody or antigen binding fragment is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 10 and each light chain comprises SEQ ID NO: 20, or, in each case, at least 90%, 95%, 97%, 98%, or 99% similar or identical to a respective SEQ ID NO, and most preferably each light chain comprises a human kappa light chain or a human lambda light chain constant domain; and each heavy chain comprises a human IgG1, IgG2, or IgG4 constant region.

[0099] In other preferred embodiments, the antibody or antigen binding fragment is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 16 and each light chain comprises SEQ ID NO: 28, or, in each case, at least 90%, 95%, 97%, 98%, or 99% similar or identical to a respective SEQ ID NO, and most preferably each light chain comprises a human kappa light chain or a human lambda light chain constant domain; and each heavy chain comprises a human IgG1, IgG2, or IgG4 constant region.

[0100] In still other preferred embodiments, the antibody or antigen binding fragment is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 18 and each light chain comprises SEQ ID NO: 20, or, in each case, at least 90%, 95%, 97%, 98%, or 99% similar or identical to a respective SEQ ID NO, and most preferably each light chain comprises a human kappa light chain or a human lambda light chain constant domain; and each heavy chain comprises a human IgG1, IgG2, or IgG4 constant region.

[0101] In some preferred embodiments, the antibody or antigen binding fragment is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 80 and each light chain comprises SEQ ID NO: 90, or, in each case, at least 90%, 95%, 97%, 98%, or 99% similar or identical to a respective SEQ ID NO, and most preferably each light chain comprises a human kappa light chain or a human lambda light chain constant domain; and each heavy chain comprises a human IgG1, IgG2, or IgG4 constant region.

[0102] In some preferred embodiments, the antibody or antigen binding fragment is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 80 and each light chain comprises SEQ ID NO: 92, or, in each case, at least 90%, 95%, 97%, 98%, or 99% similar or identical to a respective SEQ ID NO, and most preferably each light chain comprises a human kappa light chain or a human lambda light chain constant domain; and each heavy chain comprises a human IgG1, IgG2, or IgG4 constant region.

[0103] In some preferred embodiments, the antibody or antigen binding fragment is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 80 and each light chain comprises SEQ ID NO: 96, or, in each case, at least 90%, 95%, 97%, 98%, or 99% similar or identical to a respective SEQ ID NO, and most preferably each light chain comprises a human kappa light chain or a human lambda light chain constant domain; and each heavy chain comprises a human IgG1, IgG2, or IgG4 constant region.

[0104] In one embodiment, the anti-SIRP.alpha. antibody of the invention comprises a full length antibody structure having two light chains and two heavy chains as recited above, wherein each light chain comprises a human kappa light chain or a human lambda light chain constant domain; and each heavy chain comprises a human IgG1 constant region.

[0105] In one embodiment, the anti-SIRP.alpha. antibody of the invention comprises a full length antibody structure having two light chains and two heavy chains as recited above, wherein each light chain comprises a human kappa light chain or a human lambda light chain constant domain; and each heavy chain comprises a human IgG2 constant region.

[0106] In one embodiment, the anti-SIRP.alpha. antibody of the invention comprises a full-length antibody structure having two light chains and two heavy chains as recited above, wherein each light chain comprises a human kappa light chain or a human lambda light chain constant domain; and each heavy chain comprises a human IgG4 constant region.

[0107] In certain embodiments, the antibodies or antigen binding fragments of the present invention have one, two, three, four, or more, and preferably each of, the following functional characteristics:

[0108] binds human SIRP.alpha.V1 protein having the sequence of SEQ ID NO: 34 with an EC.sub.50<1 nM; and exhibits at least a 100-fold higher EC.sub.50 for SIRP.alpha.V1(P74A) having the sequence of SEQ ID NO: 62; and optionally also at least a 100-fold higher EC.sub.50 for human SIRP.beta.1 protein having the sequence of SEQ ID NO: 38 (in each case wherein the reduced EC.sub.50 is relative to the EC.sub.50 for human SIRP.alpha.V1 protein having the sequence of

[0109] SEQ ID NO: 34, and in each case preferably when measured by cellular ELISA (CELISA) as described hereinafter;

[0110] binds to a cell expressing human SIRP.alpha.V1 protein with an EC.sub.50<10 nM, preferably <5 nM, more preferably <1.5 nM, still more preferably <1.0 nM, even more preferably <0.5 nM, and most preferably about 0.3 nM or less;

[0111] binds to a cell expressing human SIRP.alpha.V2 protein with an EC.sub.50<10 nM, preferably <5 nM, more preferably <1.5 nM, still more preferably <1.0 nM, even more preferably <0.5 nM, and most preferably about 0.3 nM or less;

[0112] does not appreciably bind to SIRP.beta.1 protein at an antibody concentration of 50 nM, preferably 67 nM, and more preferably 100 nM; or alternatively at a concentration that is 10-fold greater, preferably 50-fold greater, more preferably 100-fold greater, and still more preferably 200-fold greater than the antibody's EC.sub.50 for SIRP.alpha.V1 or SIRP.alpha.V2;

[0113] inhibits binding between human SIRP.alpha. and CD47 with an IC.sub.50<10.0 nM, more preferably <5.0 nM, still more preferably <2.5 nM, and most preferably about 1.0 nM or less; and

[0114] exhibits a T20 "humanness" score of at least 79, and more preferably 85.

[0115] Preferably, the anti-SIRP.alpha. antibodies or antigen binding fragments of the invention do not appreciably bind to one or both of SIRP.alpha.V1(P74A) and SIRP.beta.1 protein at an antibody concentration of 100 nM or alternatively at an antibody concentration that is 200-fold greater than the antibody's EC50 for SIRP.alpha.V1 or SIRP.alpha.V2, while binding to a cell expressing human SIRP.alpha.V1 protein with an EC50<10 nM. Most preferably, each light chain comprises a human kappa light chain or a human lambda light chain constant domain; and each heavy chain comprises a human IgG1, IgG2, or IgG4 constant region.

[0116] In certain embodiments, the anti-SIRP.alpha. antibody or antigen binding fragment thereof of the invention can be conjugated to at least one therapeutic agent. In one embodiment, the therapeutic agent is a second antibody or fragment thereof, an immunomodulator, a hormone, a cytotoxic agent, an enzyme, a radionuclide, or a second antibody conjugated to at least one immunomodulator, enzyme, radioactive label, hormone, antisense oligonucleotide, or cytotoxic agent, or a combination thereof.

[0117] The invention also provides isolated polypeptides comprising the amino acid sequence of any one of SEQ ID NOs: 75, 78, 80, 82, 84, 86, 88, 76, 90, 92, 94, 96, 98, 100, 102, 104, 7, 10, 12, 14, 16, 18, 30, 8, 20, 22, 24, 26, 28, and 32 or a fragment of any said sequences, or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0118] The invention also provides isolated nucleic acids encoding anyone of the anti-SIRP.alpha. antibodies or antigen binding fragments of the invention.

[0119] In one embodiment, the invention provides an isolated nucleic acid which encodes an amino acid sequence selected from the group consisting of:

[0120] SEQ ID NO: 75 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0121] SEQ ID NO: 78 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0122] SEQ ID NO: 80 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0123] SEQ ID NO: 82 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0124] SEQ ID NO: 84 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0125] SEQ ID NO: 86 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0126] SEQ ID NO: 88 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0127] SEQ ID NO: 102 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0128] SEQ ID NO: 10 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0129] SEQ ID NO: 12 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0130] SEQ ID NO: 14 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0131] SEQ ID NO: 16 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0132] SEQ ID NO: 18 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto, and

[0133] SEQ ID NO: 30 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto.

[0134] In certain embodiments, the amino acid sequence of SEQ ID NO: 10 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 9 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0135] In certain embodiments, the amino acid sequence of SEQ ID NO: 12 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 11 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0136] In certain embodiments, the amino acid sequence of SEQ ID NO: 14 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 13 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0137] In certain embodiments, the amino acid sequence of SEQ ID NO: 16 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 15 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0138] In certain embodiments, the amino acid sequence of SEQ ID NO: 18 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 17 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0139] In certain embodiments, the amino acid sequence of SEQ ID NO: 30 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 29 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0140] In certain embodiments, the amino acid sequence of SEQ ID NO: 78 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 77 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0141] In certain embodiments, the amino acid sequence of SEQ ID NO: 80 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 79 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0142] In certain embodiments, the amino acid sequence of SEQ ID NO: 82 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 81 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0143] In certain embodiments, the amino acid sequence of SEQ ID NO: 84 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 83 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0144] In certain embodiments, the amino acid sequence of SEQ ID NO: 86 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 85 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0145] In certain embodiments, the amino acid sequence of SEQ ID NO: 88 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 87 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0146] In certain embodiments, the amino acid sequence of SEQ ID NO: 102 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 101 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0147] In one embodiment, the invention provides an isolated nucleic acid which encodes an amino acid sequence selected from the group consisting of:

[0148] SEQ ID NO: 76 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0149] SEQ ID NO: 90 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0150] SEQ ID NO: 92 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0151] SEQ ID NO: 94 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0152] SEQ ID NO: 96 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0153] SEQ ID NO: 98 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0154] SEQ ID NO: 100 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0155] SEQ ID NO: 104 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0156] SEQ ID NO: 8 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0157] SEQ ID NO: 20 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0158] SEQ ID NO: 22 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0159] SEQ ID NO: 24 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0160] SEQ ID NO: 26 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto,

[0161] SEQ ID NO: 28 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto, and

[0162] SEQ ID NO: 32 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto.

[0163] In certain embodiments, the amino acid sequence of SEQ ID NO: 20 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 19 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0164] In certain embodiments, the amino acid sequence of SEQ ID NO: 22 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 21 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0165] In certain embodiments, the amino acid sequence of SEQ ID NO: 24 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 23 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0166] In certain embodiments, the amino acid sequence of SEQ ID NO: 26 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 25 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0167] In certain embodiments, the amino acid sequence of SEQ ID NO: 28 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 27 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0168] In certain embodiments, the amino acid sequence of SEQ ID NO: 32 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 31 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0169] In certain embodiments, the amino acid sequence of SEQ ID NO: 90 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 89 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0170] In certain embodiments, the amino acid sequence of SEQ ID NO: 92 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 91 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0171] In certain embodiments, the amino acid sequence of SEQ ID NO: 94 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 93 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0172] In certain embodiments, the amino acid sequence of SEQ ID NO: 96 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 95 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0173] In certain embodiments, the amino acid sequence of SEQ ID NO: 98 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 97 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0174] In certain embodiments, the amino acid sequence of SEQ ID NO: 100 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 99 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0175] In certain embodiments, the amino acid sequence of SEQ ID NO: 104 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% similar or identical thereto is encoded by a nucleic acid sequence of SEQ ID NO: 103 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0176] In certain embodiments, the isolated nucleic acids of the present invention can optionally comprise a leader sequence.

[0177] Such nucleic acids can comprise one or more of the following nucleic acid sequences:

[0178] a nucleic acid sequence of SEQ ID NO: 77 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0179] a nucleic acid sequence of SEQ ID NO: 79 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0180] a nucleic acid sequence of SEQ ID NO: 81 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0181] a nucleic acid sequence of SEQ ID NO: 83 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0182] a nucleic acid sequence of SEQ ID NO: 85 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0183] a nucleic acid sequence of SEQ ID NO: 87 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0184] a nucleic acid sequence of SEQ ID NO: 101 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0185] a nucleic acid sequence of SEQ ID NO: 89 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0186] a nucleic acid sequence of SEQ ID NO: 91 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0187] a nucleic acid sequence of SEQ ID NO: 93 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0188] a nucleic acid sequence of SEQ ID NO: 95 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0189] a nucleic acid sequence of SEQ ID NO: 97 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0190] a nucleic acid sequence of SEQ ID NO: 99 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0191] a nucleic acid sequence of SEQ ID NO: 101 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0192] a nucleic acid sequence of SEQ ID NO: 103 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0193] a nucleic acid sequence of SEQ ID NO: 9 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0194] a nucleic acid sequence of SEQ ID NO: 11 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0195] a nucleic acid sequence of SEQ ID NO: 13 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0196] a nucleic acid sequence of SEQ ID NO: 15 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0197] a nucleic acid sequence of SEQ ID NO: 17 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0198] a nucleic acid sequence of SEQ ID NO: 29 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0199] a nucleic acid sequence of SEQ ID NO: 19 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0200] a nucleic acid sequence of SEQ ID NO: 21 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0201] a nucleic acid sequence of SEQ ID NO: 23 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0202] a nucleic acid sequence of SEQ ID NO: 25 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0203] a nucleic acid sequence of SEQ ID NO: 27 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto, and/or

[0204] a nucleic acid sequence of SEQ ID NO: 31 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0205] In certain embodiments, the nucleic acid can encode a human or humanized antibody, and includes nucleic acid sequences for both heavy and light chains. In one embodiment, the antibody is an IgG. In preferred embodiments, antibody is an IgG1, IgG2, or IgG4, and preferably a human IgG1, IgG2, or IgG4. In certain embodiments, the light chain sequence comprises a human kappa light chain or a human lambda light chain constant domain sequence; and each heavy chain sequence comprises a human IgG1, IgG2, or IgG4 constant region sequence.

[0206] Preferably, such nucleic acids comprise the following combination heavy chain and light chain variable region nucleic acid sequences:

SEQ ID NO: 9/SEQ ID NO: 19 (referred to herein as hSIRP.alpha..50A.H1L1) SEQ ID NO: 9/SEQ ID NO: 21 (referred to herein as hSIRP.alpha..50A.H1L2) SEQ ID NO: 9/SEQ ID NO: 23 (referred to herein as hSIRP.alpha..50A.H1L3) SEQ ID NO: 9/SEQ ID NO: 25 (referred to herein as hSIRP.alpha..50A.H1L4) SEQ ID NO: 9/SEQ ID NO: 27 (referred to herein as hSIRP.alpha..50A.H1L5) SEQ ID NO: 11/SEQ ID NO: 19 (referred to herein as hSIRP.alpha..50A.H2L1) SEQ ID NO: 11/SEQ ID NO: 21 (referred to herein as hSIRP.alpha..50A.H2L2) SEQ ID NO: 11/SEQ ID NO: 23 (referred to herein as hSIRP.alpha..50A.H2L3) SEQ ID NO: 11/SEQ ID NO: 25 (referred to herein as hSIRP.alpha..50A.H2L4) SEQ ID NO: 11/SEQ ID NO: 27 (referred to herein as hSIRP.alpha..50A.H2L5) SEQ ID NO: 13/SEQ ID NO: 19 (referred to herein as hSIRP.alpha..50A.H3L1) SEQ ID NO: 13/SEQ ID NO: 21 (referred to herein as hSIRP.alpha..50A.H3L2) SEQ ID NO: 13/SEQ ID NO: 23 (referred to herein as hSIRP.alpha..50A.H3L3) SEQ ID NO: 13/SEQ ID NO: 25 (referred to herein as hSIRP.alpha..50A.H3L4) SEQ ID NO: 13/SEQ ID NO: 27 (referred to herein as hSIRP.alpha..50A.H3L5) SEQ ID NO: 15/SEQ ID NO: 19 (referred to herein as hSIRP.alpha..50A.H4L1) SEQ ID NO: 15/SEQ ID NO: 21 (referred to herein as hSIRP.alpha..50A.H4L2) SEQ ID NO: 15/SEQ ID NO: 23 (referred to herein as hSIRP.alpha..50A.H4L3) SEQ ID NO: 15/SEQ ID NO: 25 (referred to herein as hSIRP.alpha..50A.H4L4) SEQ ID NO: 15/SEQ ID NO: 27 (referred to herein as hSIRP.alpha..50A.H4L5) SEQ ID NO: 17/SEQ ID NO: 19 (referred to herein as hSIRP.alpha..50A.H5L1) SEQ ID NO: 17/SEQ ID NO: 21 (referred to herein as hSIRP.alpha..50A.H5L2) SEQ ID NO: 17/SEQ ID NO: 23 (referred to herein as hSIRP.alpha..50A.H5L3) SEQ ID NO: 17/SEQ ID NO: 25 (referred to herein as hSIRP.alpha..50A.H5L4) SEQ ID NO: 17/SEQ ID NO: 27 (referred to herein as hSIRP.alpha..50A.H5L5) SEQ ID NO: 77/SEQ ID NO: 89 (referred to herein as hSIRP.alpha..40A.H1L1) SEQ ID NO: 77/SEQ ID NO: 91 (referred to herein as hSIRP.alpha..40A.H1L2) SEQ ID NO: 77/SEQ ID NO: 93 (referred to herein as hSIRP.alpha..40A.H1L3) SEQ ID NO: 77/SEQ ID NO: 95 (referred to herein as hSIRP.alpha..40A.H1L4) SEQ ID NO: 77/SEQ ID NO: 97 (referred to herein as hSIRP.alpha..40A.H1L5) SEQ ID NO: 77/SEQ ID NO: 99 (referred to herein as hSIRP.alpha..40A.H1L6) SEQ ID NO: 79/SEQ ID NO: 89 (referred to herein as hSIRP.alpha..40A.H2L1) SEQ ID NO: 79/SEQ ID NO: 91 (referred to herein as hSIRP.alpha..40A.H2L2) SEQ ID NO: 79/SEQ ID NO: 93 (referred to herein as hSIRP.alpha..40A.H2L3) SEQ ID NO: 79/SEQ ID NO: 95 (referred to herein as hSIRP.alpha..40A.H2L4) SEQ ID NO: 79/SEQ ID NO: 97 (referred to herein as hSIRP.alpha..40A.H2L5) SEQ ID NO: 79/SEQ ID NO: 99 (referred to herein as hSIRP.alpha..40A.H2L6) SEQ ID NO: 81/SEQ ID NO: 89 (referred to herein as hSIRP.alpha..40A.H3L1) SEQ ID NO: 81/SEQ ID NO: 91 (referred to herein as hSIRP.alpha..40A.H3L2) SEQ ID NO: 81/SEQ ID NO: 93 (referred to herein as hSIRP.alpha..40A.H3L3) SEQ ID NO: 81/SEQ ID NO: 95 (referred to herein as hSIRP.alpha..40A.H3L4) SEQ ID NO: 81/SEQ ID NO: 97 (referred to herein as hSIRP.alpha..40A.H3L5) SEQ ID NO: 81/SEQ ID NO: 99 (referred to herein as hSIRP.alpha..40A.H3L6) SEQ ID NO: 83/SEQ ID NO: 89 (referred to herein as hSIRP.alpha..40A.H4L1) SEQ ID NO: 83/SEQ ID NO: 91 (referred to herein as hSIRP.alpha..40A.H4L2) SEQ ID NO: 83/SEQ ID NO: 93 (referred to herein as hSIRP.alpha..40A.H4L3) SEQ ID NO: 83/SEQ ID NO: 95 (referred to herein as hSIRP.alpha..40A.H4L4) SEQ ID NO: 83/SEQ ID NO: 97 (referred to herein as hSIRP.alpha..40A.H4L5) SEQ ID NO: 83/SEQ ID NO: 99 (referred to herein as hSIRP.alpha..40A.H4L6) SEQ ID NO: 85/SEQ ID NO: 89 (referred to herein as hSIRP.alpha..40A.H5L1) SEQ ID NO: 85/SEQ ID NO: 91 (referred to herein as hSIRP.alpha..40A.H5L2) SEQ ID NO: 85/SEQ ID NO: 93 (referred to herein as hSIRP.alpha..40A.H5L3) SEQ ID NO: 85/SEQ ID NO: 95 (referred to herein as hSIRP.alpha..40A.H5L4) SEQ ID NO: 85/SEQ ID NO: 97 (referred to herein as hSIRP.alpha..40A.H5L5) SEQ ID NO: 85/SEQ ID NO: 99 (referred to herein as hSIRP.alpha..40A.H5L6) SEQ ID NO: 87/SEQ ID NO: 89 (referred to herein as hSIRP.alpha..40A.H6L1) SEQ ID NO: 87/SEQ ID NO: 91 (referred to herein as hSIRP.alpha..40A.H6L2) SEQ ID NO: 87/SEQ ID NO: 93 (referred to herein as hSIRP.alpha..40A.H6L3) SEQ ID NO: 87/SEQ ID NO: 95 (referred to herein as hSIRP.alpha..40A.H6L4) SEQ ID NO: 87/SEQ ID NO: 97 (referred to herein as hSIRP.alpha..40A.H6L5) SEQ ID NO: 87/SEQ ID NO: 99 (referred to herein as hSIRP.alpha..40A.H6L6) or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO.

[0207] In some preferred embodiments, the nucleic acid comprises SEQ ID NO: 9 and SEQ ID NO: 19 or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO.

[0208] In some preferred embodiments, the nucleic acid comprises SEQ ID NO: 15 and SEQ ID NO: 27 or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO.

[0209] In some preferred embodiments, the nucleic acid comprises SEQ ID NO: 17 and SEQ ID NO: 19 or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO.

[0210] In some preferred embodiments, the nucleic acid comprises SEQ ID NO: 79 and SEQ ID NO: 89 or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO.

[0211] In some preferred embodiments, the nucleic acid comprises SEQ ID NO: 79 and SEQ ID NO: 91 or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO.

[0212] In some preferred embodiments, the nucleic acid comprises SEQ ID NO: 79 and SEQ ID NO: 95 or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO.

[0213] The invention also provides expression vectors comprising one or more nucleic acids of the present invention. An expression vector is a DNA molecule comprising the regulatory elements necessary for transcription of a target nucleic acid in a host cell. Typically, the target nucleic acid is placed under the control of certain regulatory elements including constitutive or inducible promoters, tissue-specific regulatory elements, and enhancer elements. Such a target nucleic acid is said to be "operably linked to" the regulatory elements when the regulating element controls the expression of the gene.

[0214] These isolated nucleic acids and the expression vectors comprising them may be used to express the antibodies of the invention or antigen binding fragments thereof in recombinant host cells. Thus, the invention also provides host cells comprising an expression vector of the present invention.

[0215] Such expression vectors can comprise one or more of the following nucleic acid sequences operably linked to regulatory elements:

[0216] a nucleic acid sequence of SEQ ID NO: 77 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0217] a nucleic acid sequence of SEQ ID NO: 79 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0218] a nucleic acid sequence of SEQ ID NO: 81 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0219] a nucleic acid sequence of SEQ ID NO: 83 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0220] a nucleic acid sequence of SEQ ID NO: 85 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0221] a nucleic acid sequence of SEQ ID NO: 87 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0222] a nucleic acid sequence of SEQ ID NO: 101 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0223] a nucleic acid sequence of SEQ ID NO: 89 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0224] a nucleic acid sequence of SEQ ID NO: 91 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0225] a nucleic acid sequence of SEQ ID NO: 93 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0226] a nucleic acid sequence of SEQ ID NO: 95 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0227] a nucleic acid sequence of SEQ ID NO: 97 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0228] a nucleic acid sequence of SEQ ID NO: 99 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0229] a nucleic acid sequence of SEQ ID NO: 103 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0230] a nucleic acid sequence of SEQ ID NO: 11 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0231] a nucleic acid sequence of SEQ ID NO: 13 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0232] a nucleic acid sequence of SEQ ID NO: 15 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0233] a nucleic acid sequence of SEQ ID NO: 17 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0234] a nucleic acid sequence of SEQ ID NO: 29 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0235] a nucleic acid sequence of SEQ ID NO: 19 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0236] a nucleic acid sequence of SEQ ID NO: 21 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0237] a nucleic acid sequence of SEQ ID NO: 23 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0238] a nucleic acid sequence of SEQ ID NO: 25 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0239] a nucleic acid sequence of SEQ ID NO: 27 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto, and/or

[0240] a nucleic acid sequence of SEQ ID NO: 31 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0241] In certain embodiments, the expression vector comprises nucleic acid sequences encoding both a heavy chain sequence and a light chain sequence of an anti-SIRP.alpha. antibody of the present invention. Preferably, such expression vectors comprise the following combination heavy chain and light chain variable region nucleic acid sequences:

SEQ ID NO: 9/SEQ ID NO: 19 (referred to herein as hSIRP.alpha..50A.H1L1) SEQ ID NO: 9/SEQ ID NO: 21 (referred to herein as hSIRP.alpha..50A.H1L2) SEQ ID NO: 9/SEQ ID NO: 23 (referred to herein as hSIRP.alpha..50A.H1L3) SEQ ID NO: 9/SEQ ID NO: 25 (referred to herein as hSIRP.alpha..50A.H1L4) SEQ ID NO: 9/SEQ ID NO: 27 (referred to herein as hSIRP.alpha..50A.H1L5) SEQ ID NO: 11/SEQ ID NO: 19 (referred to herein as hSIRP.alpha..50A.H2L1) SEQ ID NO: 11/SEQ ID NO: 21 (referred to herein as hSIRP.alpha..50A.H2L2) SEQ ID NO: 11/SEQ ID NO: 23 (referred to herein as hSIRP.alpha..50A.H2L3) SEQ ID NO: 11/SEQ ID NO: 25 (referred to herein as hSIRP.alpha..50A.H2L4) SEQ ID NO: 11/SEQ ID NO: 27 (referred to herein as hSIRP.alpha..50A.H2L5) SEQ ID NO: 13/SEQ ID NO: 19 (referred to herein as hSIRP.alpha..50A.H3L1) SEQ ID NO: 13/SEQ ID NO: 21 (referred to herein as hSIRP.alpha..50A.H3L2) SEQ ID NO: 13/SEQ ID NO: 23 (referred to herein as hSIRP.alpha..50A.H3L3) SEQ ID NO: 13/SEQ ID NO: 25 (referred to herein as hSIRP.alpha..50A.H3L4) SEQ ID NO: 13/SEQ ID NO: 27 (referred to herein as hSIRP.alpha..50A.H3L5) SEQ ID NO: 15/SEQ ID NO: 19 (referred to herein as hSIRP.alpha..50A.H4L1) SEQ ID NO: 15/SEQ ID NO: 21 (referred to herein as hSIRP.alpha..50A.H4L2) SEQ ID NO: 15/SEQ ID NO: 23 (referred to herein as hSIRP.alpha..50A.H4L3) SEQ ID NO: 15/SEQ ID NO: 25 (referred to herein as hSIRP.alpha..50A.H4L4) SEQ ID NO: 15/SEQ ID NO: 27 (referred to herein as hSIRP.alpha..50A.H4L5) SEQ ID NO: 17/SEQ ID NO: 19 (referred to herein as hSIRP.alpha..50A.H5L1) SEQ ID NO: 17/SEQ ID NO: 21 (referred to herein as hSIRP.alpha..50A.H5L2) SEQ ID NO: 17/SEQ ID NO: 23 (referred to herein as hSIRP.alpha..50A.H5L3) SEQ ID NO: 17/SEQ ID NO: 25 (referred to herein as hSIRP.alpha..50A.H5L4) SEQ ID NO: 17/SEQ ID NO: 27 (referred to herein as hSIRP.alpha..50A.H5L5) SEQ ID NO: 77/SEQ ID NO: 89 (referred to herein as hSIRP.alpha..40A.H1L1) SEQ ID NO: 77/SEQ ID NO: 91 (referred to herein as hSIRP.alpha..40A.H1L2) SEQ ID NO: 77/SEQ ID NO: 93 (referred to herein as hSIRP.alpha..40A.H1L3) SEQ ID NO: 77/SEQ ID NO: 95 (referred to herein as hSIRP.alpha..40A.H1L4) SEQ ID NO: 77/SEQ ID NO: 97 (referred to herein as hSIRP.alpha..40A.H1L5) SEQ ID NO: 77/SEQ ID NO: 99 (referred to herein as hSIRP.alpha..40A.H1L6) SEQ ID NO: 79/SEQ ID NO: 89 (referred to herein as hSIRP.alpha..40A.H2L1) SEQ ID NO: 79/SEQ ID NO: 91 (referred to herein as hSIRP.alpha..40A.H2L2) SEQ ID NO: 79/SEQ ID NO: 93 (referred to herein as hSIRP.alpha..40A.H2L3) SEQ ID NO: 79/SEQ ID NO: 95 (referred to herein as hSIRP.alpha..40A.H2L4) SEQ ID NO: 79/SEQ ID NO: 97 (referred to herein as hSIRP.alpha..40A.H2L5) SEQ ID NO: 79/SEQ ID NO: 99 (referred to herein as hSIRP.alpha..40A.H2L6) SEQ ID NO: 81/SEQ ID NO: 89 (referred to herein as hSIRP.alpha..40A.H3L1) SEQ ID NO: 81/SEQ ID NO: 91 (referred to herein as hSIRP.alpha..40A.H3L2) SEQ ID NO: 81/SEQ ID NO: 93 (referred to herein as hSIRP.alpha..40A.H3L3) SEQ ID NO: 81/SEQ ID NO: 95 (referred to herein as hSIRP.alpha..40A.H3L4) SEQ ID NO: 81/SEQ ID NO: 97 (referred to herein as hSIRP.alpha..40A.H3L5) SEQ ID NO: 81/SEQ ID NO: 99 (referred to herein as hSIRP.alpha..40A.H3L6) SEQ ID NO: 83/SEQ ID NO: 89 (referred to herein as hSIRP.alpha..40A.H4L1) SEQ ID NO: 83/SEQ ID NO: 91 (referred to herein as hSIRP.alpha..40A.H4L2) SEQ ID NO: 83/SEQ ID NO: 93 (referred to herein as hSIRP.alpha..40A.H4L3) SEQ ID NO: 83/SEQ ID NO: 95 (referred to herein as hSIRP.alpha..40A.H4L4) SEQ ID NO: 83/SEQ ID NO: 97 (referred to herein as hSIRP.alpha..40A.H4L5) SEQ ID NO: 83/SEQ ID NO: 99 (referred to herein as hSIRP.alpha..40A.H4L6) SEQ ID NO: 85/SEQ ID NO: 89 (referred to herein as hSIRP.alpha..40A.H5L1) SEQ ID NO: 85/SEQ ID NO: 91 (referred to herein as hSIRP.alpha..40A.H5L2) SEQ ID NO: 85/SEQ ID NO: 93 (referred to herein as hSIRP.alpha..40A.H5L3) SEQ ID NO: 85/SEQ ID NO: 95 (referred to herein as hSIRP.alpha..40A.H5L4) SEQ ID NO: 85/SEQ ID NO: 97 (referred to herein as hSIRP.alpha..40A.H5L5) SEQ ID NO: 85/SEQ ID NO: 99 (referred to herein as hSIRP.alpha..40A.H5L6) SEQ ID NO: 87/SEQ ID NO: 89 (referred to herein as hSIRP.alpha..40A.H6L1) SEQ ID NO: 87/SEQ ID NO: 91 (referred to herein as hSIRP.alpha..40A.H6L2) SEQ ID NO: 87/SEQ ID NO: 93 (referred to herein as hSIRP.alpha..40A.H6L3) SEQ ID NO: 87/SEQ ID NO: 95 (referred to herein as hSIRP.alpha..40A.H6L4) SEQ ID NO: 87/SEQ ID NO: 97 (referred to herein as hSIRP.alpha..40A.H6L5) SEQ ID NO: 87/SEQ ID NO: 99 (referred to herein as hSIRP.alpha..40A.H6L6) or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO.

[0242] In any of the above embodiments, the expression vector can encode for expression a human or humanized antibody, and includes nucleic acid sequences for both heavy and light chains. In one embodiment, the antibody is an IgG. In preferred embodiments, antibody is an IgG1, IgG2, or IgG4, and preferably a human IgG1, IgG2, or IgG4. In certain embodiments, the light chain sequence comprises a human kappa light chain or a human lambda light chain constant domain sequence; and each heavy chain sequence comprises a human IgG4 constant region sequence.

[0243] In some preferred embodiments, the expression vector encodes for expression a human or humanized antibody, wherein the heavy chain nucleic acid sequence comprises SEQ ID NO: 9 and the light chain nucleic acid sequence comprises SEQ ID NO: 19, or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO, and is most preferably an IgG1, IgG2, or IgG4 isotype.

[0244] In some preferred embodiments, the expression vector encodes for expression a human or humanized antibody, wherein the heavy chain nucleic acid sequence comprises SEQ ID NO: 15 and the light chain nucleic acid sequence comprises SEQ ID NO: 27, or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO, and is most preferably an IgG1, IgG2, or IgG4 isotype.

[0245] In some preferred embodiments, the expression vector encodes for expression a human or humanized antibody, wherein the heavy chain nucleic acid sequence comprises SEQ ID NO: 17 and the light chain nucleic acid sequence comprises SEQ ID NO: 19, or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO, and is most preferably an IgG1, IgG2, or IgG4 isotype.

[0246] In some preferred embodiments, the expression vector encodes for expression a human or humanized antibody, wherein the heavy chain nucleic acid sequence comprises SEQ ID NO: 79 and the light chain nucleic acid sequence comprises SEQ ID NO: 89, or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO, and is most preferably an IgG1, IgG2, or IgG4 isotype.

[0247] In some preferred embodiments, the expression vector encodes for expression a human or humanized antibody, wherein the heavy chain nucleic acid sequence comprises SEQ ID NO: 79 and the light chain nucleic acid sequence comprises SEQ ID NO: 91, or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO, and is most preferably an IgG1, IgG2, or IgG4 isotype.

[0248] In some preferred embodiments, the expression vector encodes for expression a human or humanized antibody, wherein the heavy chain nucleic acid sequence comprises SEQ ID NO: 79 and the light chain nucleic acid sequence comprises SEQ ID NO: 95, or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO, and is most preferably an IgG1, IgG2, or IgG4 isotype.

[0249] In one embodiment, the host cell is Chinese hamster ovary (CHO) cell. In one embodiment, the host cell is a mammalian cell (e.g., a human cell such as an HEK293 cell, a hamster cell such as a CHO cell, etc.), a bacterial cell (e.g., an E. coli cell) a yeast cell (e.g., a Pichia pastoris cell, etc.), a plant cell (e.g., a Nicotiana benthamiana cell), etc. . . . Mammalian cells are preferred due to glycosylation patterns that are most favorable.

[0250] The invention also provides pharmaceutical compositions comprising an antibody or antigen binding fragment of the invention and a pharmaceutically acceptable carrier or diluent.

[0251] In one embodiment, the composition comprises one or more further therapeutic agents. In one embodiment, the further therapeutic agent is selected from the group consisting of: an anti-CD27 antibody or an antigen binding fragment thereof; an anti-LAG3 antibody or an antigen binding fragment thereof; an anti-APRIL antibody or an antigen binding fragment thereof; an anti-TIGIT antibody or antigen biding fragment thereof; an anti-VISTA antibody or an antigen binding fragment thereof; an anti-BTLA antibody or an antigen binding fragment thereof; an anti-TIM3 antibody or an antigen binding fragment thereof; an anti-CTLA4 antibody or an antigen binding fragment thereof; an anti-HVEM antibody or an antigen binding fragment thereof; an anti-CD70 antibody or an antigen binding fragment thereof; an anti-CD137 antibody or an antigen binding fragment thereof; an anti-OX40 antibody or an antigen binding fragment thereof; an anti-CD28 antibody or an antigen binding fragment thereof; thereof; an anti-PD1 antibody or an antigen binding fragment thereof; an anti-PDL1 antibody or an antigen binding fragment thereof; an anti-PDL2 antibody or an antigen binding fragment thereof; an anti-GITR antibody or an antigen binding fragment thereof; an anti-ICOS antibody or an antigen binding fragment thereof; an anti-ILT2 antibody or antigen binding fragment thereof; an anti-ILT3 antibody or antigen binding fragment thereof; an anti-ILT4 antibody or antigen binding fragment thereof; and an anti-ILT5 antibody or an antigen binding fragment thereof; an anti 4-1BB antibody or an antigen binding fragment thereof; an anti-NKG2A antibody or an antigen binding fragment thereof; an anti-NKG2C antibody or an antigen binding fragment thereof; an anti-NKG2E antibody or an antigen binding fragment thereof; an anti-TSLP antibody or an antigen binding fragment thereof; an anti-IL-10 antibody or an antigen binding fragment thereof; IL-10 or PEGylated IL-10; an agonist (e.g., an agonistic antibody or antigen-binding fragment thereof, or a soluble fusion) of a TNF receptor protein; an Immunoglobulin-like protein; a cytokine receptor; an integrin; a signaling lymphocytic activation molecules (SLAM proteins); an activating NK cell receptor; a Toll like receptor; OX40; CD2; CD7; CD27; CD28; CD30; CD40; ICAM-1; LFA-1 (CD1 1a/CD18); 4-1BB (CD137); B7-H3; ICOS (CD278); GITR; BAFFR; LIGHT; HVEM (LIGHTR); KIRDS2; SLAMF7; NKp80 (KLRF1); NKp44; NKp30; NKp46; CD19; CD4; CD8alpha; CD8beta; IL2R beta; IL2R gamma; IL7R alpha; ITGA4; VLA1; CD49a; ITGA4; IA4; CD49D; ITGA6; VLA-6; CD49f; ITGAD; CD1 1d; ITGAE; CD103; ITGAL; ITGAM; CD1 1b; ITGAX; CD1 1c; ITGB1; CD29; ITGB2; CD18; ITGB7; NKG2D; NKG2C; TNFR2; TRANCE/RANKL; DNAM1 (CD226); SLAMF4 (CD244; 2B4); CD84; CD96 (Tactile); CEACAM1; CRTAM; Ly9 (CD229); CD160 (BY55); PSGL1; CD100 (SEMA4D); CD69; SLAMF6 (NTB-A; Ly108); SLAM (SLAMF1, CD150, IPO-3); SLAM7; BLAME (SLAMF8); SELPLG (CD162); LTBR; LAT; GADS; PAG/Cbp; CD19a; a ligand that specifically binds with CD83; an inhibitor of CD47, PD-1; PD-L2; CTLA4; TIM3; LAG3; CEACAM (e.g.; CEACAM-1, -3 and/or -5); VISTA; BTLA; TIGIT; LAIR1; IDO; TDO; CD160; TGFR beta; and a cyclic dinculeotide or other STING pathway agonist.

[0252] The invention also comprises a combination comprising an antibody or antigen binding fragment of the invention and a second antibody that induces ADCC, wherein said antibody or antigen binding fragment of the invention enhances the antibody-mediated destruction of cells by the second antibody. Antibody-dependent cell-mediated cytotoxicity (ADCC) is a mechanism of cell-mediated immune defense whereby an effector cell of the immune system actively lyses a target cell, whose membrane-surface antigens have been bound by specific antibodies. ADCC is often thought of as being mediated by natural killer (NK) cells, but dendritic cells, macrophages, monocytes, and granulocytes can also mediate ADCC.

[0253] The invention also comprises a combination comprising an antibody or antigen binding fragment of the invention and a second antibody that induces ADCP, wherein said antibody or antigen binding fragment of the invention enhances the antibody-mediated phagocytosis of cells by the second antibody. Antibody-dependent cell-mediated phagocytosis (ADCP) is a mechanism of cell-mediated immune defense whereby target cells are killed via granulocyte, monocyte, dendritic cell, or macrophage-mediated phagocytosis.

[0254] Natural killer (NK) cells play a major role in cancer immunotherapies that involve tumor-antigen targeting by monoclonal antibodies (mAbs). In the context of targeting cells, NK cells can be "specifically activated" through certain Fc receptors that are expressed on their cell surface. NK cells can express Fc.gamma.RIIIA and/or Fc.gamma.RIIC, which can bind to the Fc portion of immunoglobulins, transmitting activating signals within NK cells. Once activated through Fc receptors by antibodies bound to target cells, NK cells are able to lyse target cells without priming, and secrete cytokines like interferon gamma to recruit adaptive immune cells. Likewise, tumor-associated macrophages (TAMs) express surface receptors that bind the Fc fragment of antibodies and enable them to engage in Ab-dependent cellular cytotoxicity/phagocytosis (ADCC/ADCP). Because SIRP.alpha./CD47 signalling induces a "don't eat me" response that reduces ADCC/ADCP, blocking of this signaling by the anti-SIRP.alpha. antibodies or antigen binding fragments of the invention can enhance ADCC of tumor cells bearing the antigenic determinant to which the therapeutic antibody is directed.

[0255] This ADCC/ADCP as a mode of action may be utilized in the treatment of various cancers and infectious diseases. An exemplary list of ADCC/ADCP-inducing antibodies and antibody conjugates that can be combined with the antibodies or antigen binding fragments of the present invention includes, but is not limited to, Rituximab, ublituximab, margetuximab, IMGN-529, SCT400, veltuzumab, Obinutuzumab, ADCT-502, Hul4.18K322A, Hu3F8, Dinituximab, Trastuzumab, Cetuximab, Rituximab-RLI, c.60C3-RLI, Hul4.18-IL2, KM2812, AFM13, and (CD20).sub.2xCD16, erlotinib (Tarceva), daratumumab, alemtuzumab, pertuzumab, brentuximab, elotuzumab, ibritumomab, ifabotuzumab, farletuzumab, otlertuzumab, carotuximab, epratuzumab, inebilizumab, lumretuzumab, 4G7SDIE, AFM21, AFM22, LY-3022855, SNDX-6352, AFM-13, BI-836826, BMS-986012, BVX-20, mogamulizumab, ChiLob-7/4, leukotuximab, isatuximab, DS-8895, FPA144, GM102, GSK-2857916, IGN523, IT1208, ADC-1013, CAN-04, XOMA-213, PankoMab-GEX, chKM-4927, IGN003, IGN004, IGN005, MDX-1097, MOR202, MOR-208, oportuzumab, ensituximab, vedotin (Adcetris), ibritumomab tiuxetan, ABBV-838, HuMax-AXL-ADC, and ado-trastuzumab emtansine (Kadcyla). An exemplary list of target antigens for such ADCC/ADCP-inducing antibodies includes, but is not limited to, AMHR2, AXL, BCMA, CA IX, CD4, CD16, CD19, CD20, CD22, CD30, CD37, CD38, CD40, CD52, CD98, CSF1R, GD2, CCR4, CS1, EpCam, EGFR, EGFRvIII, Endoglin, EPHA2, EphA3, FGFR2b, folate receptor alpha, fucosyl-GM1, HER2, HER3, IL1RAP, kappa myeloma antigen, MS4A1, prolactin receptor, TA-MUC1, and PSMA.

[0256] In certain embodiments, the second antibody or antigen binding fragment thereof induces ADCP. By way of example only, such antibodies may be selected from the group consisting of Rituximab, ublituximab, margetuximab, IMGN-529, SCT400, veltuzumab, Obinutuzumab, Trastuzumab, Cetuximab, alemtuzumab, ibritumomab, farletuzumab, inebilizumab, lumretuzumab, 4G7SDIE, BMS-986012, BVX-20, mogamulizumab, ChiLob-7/4, GM102, GSK-2857916, PankoMab-GEX, chKM-4927, MDX-1097, MOR202, and MOR-208.

[0257] In embodiments where the antibodies or antigen binding fragments of the present invention are combined with one or more ADCC/ADCP-inducing antibodies and antibody conjugates, such combinations may also be used optionally in association with a further therapeutic agent or therapeutic procedure. In one embodiment, the further therapeutic agent is selected from the group consisting of: an anti-LAG3 antibody or an antigen binding fragment thereof; an anti-APRIL antibody or an antigen binding fragment thereof; an anti-TIGIT antibody or an antigen binding fragment thereof; an anti-VISTA antibody or an antigen binding fragment thereof; an anti-BTLA antibody or an antigen binding fragment thereof; an anti-TIM3 antibody or an antigen binding fragment thereof; an anti-CTLA4 antibody or an antigen binding fragment thereof; an anti-HVEM antibody or an antigen binding fragment thereof; an anti-CD70 antibody or an antigen binding fragment thereof; an anti-CD137 antibody or an antigen binding fragment thereof; an anti-OX40 antibody or an antigen binding fragment thereof; an anti-CD28 antibody or an antigen binding fragment thereof; thereof; an anti-PD1 antibody or an antigen binding fragment thereof; an anti-PDL1 antibody or an antigen binding fragment thereof; an anti-PDL2 antibody or an antigen binding fragment thereof; an anti-GITR antibody or an antigen binding fragment thereof; an anti-ICOS antibody or an antigen binding fragment thereof; an anti-ILT2 antibody or antigen binding fragment thereof; an anti-ILT3 antibody or antigen binding fragment thereof; an anti-ILT4 antibody or antigen binding fragment thereof; an anti-ILT5 antibody or an antigen binding fragment thereof; and an anti-4-1BB antibody or an antigen binding fragment thereof; an anti-NKG2A antibody or an antigen binding fragment thereof; an anti-NKG2C antibody or an antigen binding fragment thereof; an anti-NKG2E antibody or an antigen binding fragment thereof; an anti-TSLP antibody or an antigen binding fragment thereof; an anti-IL-10 antibody or an antigen binding fragment thereof; and IL-10 or PEGylated IL-10.

[0258] The invention also provides a vessel or injection device comprising anyone of the anti-SIRP.alpha. antibodies or antigen binding fragments of the invention.

[0259] The invention also provides a method of producing an anti-SIRP.alpha. antibody or antigen binding fragment of the invention comprising: culturing a host cell comprising a polynucleotide encoding a heavy chain and/or light chain of an antibody of the invention (or an antigen binding fragment thereof) under conditions favorable to expression of the polynucleotide; and optionally, recovering the antibody or antigen binding fragment from the host cell and/or culture medium. In one embodiment, the polynucleotide encoding the heavy chain and the polynucleotide encoding the light chain are in a single vector. In another embodiment, the polynucleotide encoding the heavy chain and the polynucleotide encoding the light chain are in different vectors.

[0260] The invention also provides a method of treating cancer in a subject in need thereof, comprising administering to the subject an effective amount of an anti-SIRP.alpha. antibody or antigen binding fragment of the invention, optionally in association with a further therapeutic agent or therapeutic procedure.

[0261] In one embodiment, the subject to be treated is a human subject. In one embodiment, the further therapeutic agent is selected from the group consisting of: an anti-LAG3 antibody or an antigen binding fragment thereof; an anti-APRIL antibody or an antigen binding fragment thereof; an an anti-TIGIT antibody or an antigen binding fragment thereof; an anti-VISTA antibody or an antigen binding fragment thereof; an anti-BTLA antibody or an antigen binding fragment thereof; an anti-TIM3 antibody or an antigen binding fragment thereof; an anti-CTLA4 antibody or an antigen binding fragment thereof; an anti-HVEM antibody or an antigen binding fragment thereof; an anti-CD70 antibody or an antigen binding fragment thereof; an anti-CD137 antibody or an antigen binding fragment thereof; an anti-OX40 antibody or an antigen binding fragment thereof; an anti-CD28 antibody or an antigen binding fragment thereof; thereof; an anti-PD1 antibody or an antigen binding fragment thereof; an anti-PDL1 antibody or an antigen binding fragment thereof; an anti-PDL2 antibody or an antigen binding fragment thereof; an anti-GITR antibody or an antigen binding fragment thereof; an anti-ICOS antibody or an antigen binding fragment thereof; an anti-ILT2 antibody or antigen binding fragment thereof; an anti-ILT3 antibody or antigen binding fragment thereof; an anti-ILT4 antibody or antigen binding fragment thereof; an anti-ILT5 antibody or an antigen binding fragment thereof; and an anti-4-1BB antibody or an antigen binding fragment thereof; an anti-NKG2A antibody or an antigen binding fragment thereof; an anti-NKG2C antibody or an antigen binding fragment thereof; an anti-NKG2E antibody or an antigen binding fragment thereof; an anti-TSLP antibody or an antigen binding fragment thereof; an anti-IL-10 antibody or an antigen binding fragment thereof; and IL-10 or PEGylated IL-10.

[0262] The invention also provides a method of treating an infection or infectious disease in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment of the invention, optionally in association with a further therapeutic agent or therapeutic procedure. In one embodiment, the subject to be treated is a human subject.

[0263] In one embodiment, the further therapeutic agent is selected from the group consisting of: an anti-LAG3 antibody or an antigen binding fragment thereof; an anti-APRIL antibody or an antigen binding fragment thereof; an an anti-TIGIT antibody or an antigen binding fragment thereof; an anti-VISTA antibody or an antigen binding fragment thereof; an anti-BTLA antibody or an antigen binding fragment thereof; an anti-TIM3 antibody or an antigen binding fragment thereof; an anti-CTLA4 antibody or an antigen binding fragment thereof; an anti-HVEM antibody or an antigen binding fragment thereof; an anti-CD70 antibody or an antigen binding fragment thereof; an anti-CD137 antibody or an antigen binding fragment thereof; an anti-OX40 antibody or an antigen binding fragment thereof; an anti-CD28 antibody or an antigen binding fragment thereof; thereof; an anti-PD1 antibody or an antigen binding fragment thereof; an anti-PDL1 antibody or an antigen binding fragment thereof; an anti-PDL2 antibody or an antigen binding fragment thereof; an anti-GITR antibody or an antigen binding fragment thereof; an anti-ICOS antibody or an antigen binding fragment thereof; an anti-ILT2 antibody or antigen binding fragment thereof; an anti-ILT3 antibody or antigen binding fragment thereof; an anti-ILT4 antibody or antigen binding fragment thereof; an anti-ILT5 antibody or an antigen binding fragment thereof; and an anti-4-1BB antibody or an antigen binding fragment thereof; an anti-NKG2A antibody or an antigen binding fragment thereof; an anti-NKG2C antibody or an antigen binding fragment thereof; an anti-NKG2E antibody or an antigen binding fragment thereof; an anti-TSLP antibody or an antigen binding fragment thereof; an anti-IL-10 antibody or an antigen binding fragment thereof; and IL-10 or PEGylated IL-10.

[0264] The invention also provides a method for detecting the presence of a SIRP.alpha. peptide or a fragment thereof in a sample comprising contacting the sample with an antibody or antigen binding fragment thereof of the invention and detecting the presence of a complex between the antibody or fragment and the peptide; wherein detection of the complex indicates the presence of the SIRP.alpha. peptide.

BRIEF DESCRIPTION OF THE FIGURES

[0265] FIG. 1 depicts cross-reactivity of commercially available anti-hSIRP.alpha. antibodies with hSIRP.beta.1 and allele-specific binding to hSIRP.alpha.V1 and hSIRP.alpha.V2.

[0266] FIG. 2 depicts reactivity of KWAR23 antibody with hSIRP.alpha.V1, hSIRP.alpha.V2, hSIRP.beta.1, and hSIRP.gamma..

[0267] FIG. 3 depicts reactivity of antibody clone hSIRP.alpha..50A for various hSIRP.alpha. alleles.

[0268] FIG. 4 depicts the ability of hSIRP.alpha..50A antibody to block recombinant hCD47/Fc-protein binding to cell surface expressed hSIRP.alpha..

[0269] FIG. 5A depicts binding of hSIRP?0.50A antibody to primary CD14+ enriched monocytes from a human donor.

[0270] FIG. 5B depicts binding of hSIRP?0.50A antibody to primary CD14+ enriched monocytes from a second human donor.

[0271] FIG. 5C depicts the ability of hSIRP?0.50A antibody to block hCD47 binding to to primary CD14+ enriched monocytes from a human donor.

[0272] FIG. 5D depicts the ability of hSIRP?0.50A antibody to block hCD47 binding to to primary CD14+ enriched monocytes from a second human donor.

[0273] FIG. 6A depicts binding of hSIRP.alpha..50A antibody to primary human granulocytes.

[0274] FIG. 6B depicts phagocytosis of tumor cells by primary human granulocytes in the presence of rituximab plus or minus the hSIRP.alpha..50A antibody.

[0275] FIG. 6C depicts phagocytosis of tumor cells by primary human granulocytes in the presence of daratumumab plus or minus the hSIRP.alpha..50A antibody.

[0276] FIG. 6D depicts phagocytosis of tumor cells by primary human granulocytes in the presence of alemtuzumab plus or minus the hSIRP.alpha..50A antibody.

[0277] FIG. 6E depicts phagocytosis of tumor cells by primary human granulocytes in the presence of cetuximab plus or minus the hSIRP.alpha..50A antibody.

[0278] FIG. 7 depicts phagocytosis of tumor cells by human macrophages in the presence of the indicated antibody (rituximab or daratumumab) plus or minus the hSIRP.alpha..50A antibody.

[0279] FIG. 8 depicts blocking of the hSIRP.alpha./hCD47 interaction by mouse hSIRP.alpha..50A and humanized hSIRP.alpha..50A antibodies to hSIRP.alpha..

[0280] FIG. 9 depicts depicts hSIRP.alpha..50A antibody binding to hSIRP.alpha.V1, hSIRP.alpha.V2, hSIRP.beta.1, hSIRP.alpha.-V.beta.C1.alpha.C2.alpha., hSIRP.alpha.-V.alpha.C1.beta.C2.alpha., and hSIRP.alpha.-V.alpha.C1.alpha.C2.beta..

[0281] FIG. 10A depicts an alignment of the hSIRP.alpha. and hSIRP.beta.1 IgV domain amino acid sequences (SEQ ID NOS: 133-135).

[0282] FIG. 10B depicts loss of hSIRP.alpha..50A antibody binding to hSIRP.alpha.V1(P74A).

[0283] FIG. 11 depicts binding of hSIRP.alpha..40A and hSIRP.alpha..50A antibodies to hSIRP.alpha.V1, hSIRP.alpha.V2, hSIRP.beta.1, hSIRP.beta.L, and hSIRP.gamma..

[0284] FIG. 12 depicts binding of hSIRP.alpha..40A and hSIRP.alpha..50A antibodies to hSIRP.alpha.V1, hSIRP.alpha.V2, hSIRP.alpha.V3, hSIRP.alpha.V4, hSIRP.alpha.V5, hSIRP.alpha.V6, hSIRP.alpha.V8, and hSIRP.alpha.V9.

[0285] FIG. 13 depicts the ability of hSIRP.alpha..40A and hSIRP.alpha..50A antibodies to block recombinant hCD47/Fc-protein binding to cell surface expressed hSIRP.alpha..

[0286] FIG. 14A depicts binding of hSIRP?0.40A antibody to primary CD14+ enriched monocytes from a human donor.

[0287] FIG. 14B depicts binding of hSIRP?0.40A antibody to primary CD14+ enriched monocytes from a second human donor.

[0288] FIG. 14C depicts the ability of hSIRP?0.40A antibody to block hCD47 binding to to primary CD14+ enriched monocytes from a human donor.

[0289] FIG. 14D depicts the ability of hSIRP?0.40A antibody to block hCD47 binding to to primary CD14+ enriched monocytes from a second human donor.

[0290] FIG. 15A depicts binding of hSIRP.alpha..40A and hSIRP.alpha..50A antibodies to primary human granulocytes.

[0291] FIG. 15B depicts phagocytosis of Ramos cells by primary human granulocytes in the presence of rituximab plus or minus the hSIRP.alpha..40A and hSIRP.alpha..50A antibodies.

[0292] FIG. 16 depicts enhancement of rituximab-induced Raji cell phagocytosis by hSIRP.alpha..40A and hSIRP.alpha..50A antibodies.

[0293] FIG. 17 depicts binding of mouse hSIRP.alpha..40A and humanized hSIRP.alpha..40A antibodies to hSIRP.alpha..

[0294] FIG. 18 depicts the blockade of hCD47 binding to hSIRP.alpha. in the presence of humanized hSIRP.alpha..40A antibody variants.

[0295] FIG. 19 depicts binding of hSIRP.alpha..40A and hSIRP.alpha..50A antibodies to hSIRP.alpha.V1, hSIRP.alpha.V2, hSIRP.beta.1, hSIRP-V.gamma.C1.beta.C2.beta., hSIRP-V.beta.C1.gamma.C2.beta., and hSIRP-V.beta.C1.beta.C2.gamma..

[0296] FIG. 20 depicts loss of hSIRP.alpha..40A and hSIRP.alpha..50A antibody binding to hSIRP.alpha.V1(P74A).

[0297] FIG. 21 depicts the ability of chimeric hSIRP.alpha..40A antibody variants to affect rituximab-mediated phagocytosis.

[0298] FIG. 22 depicts the ability of humanized hSIRP.alpha..40A antibody variants to affect rituximab-mediated phagocytosis.

[0299] FIG. 23A depicts the ability of mouse hSIRP.alpha..50A and chimeric hSIRP.alpha..50A hIgG2 and hIgG4 antibody variants to affect rituximab-mediated phagocytosis.

[0300] FIG. 23B depicts the ability of chimeric hSIRP.alpha..50A hIgG2 and hIgG4 antibody variants to affect rituximab-mediated phagocytosis.

[0301] FIG. 23C depicts the ability of chimeric hSIRP.alpha..50A hIgG2 and hIgG4 antibody variants to affect daratumumab-mediated phagocytosis.

[0302] FIG. 23D depicts the ability of mouse hSIRP.alpha..50A and chimeric hSIRP.alpha..50A hIgG2 antibody variants to affect rituximab-mediated phagocytosis in granulocytes.

[0303] FIG. 24A depicts the ability of mouse hSIRP.alpha..50A and chimeric hSIRP.alpha..50A.hIgG 1.N297Q, hSIRP.alpha..50A.hIgG4.N297Q or hSIRP.alpha..50A.hIgG2 antibody variants to affect rituximab-mediated phagocytosis.

[0304] FIG. 24B depicts the ability of mouse hSIRP.alpha..50A and chimeric hSIRP.alpha..50A.hIgG 1.N297Q, hSIRP.alpha..50A.hIgG4.N297Q or hSIRP.alpha..50A.hIgG2 antibody variants to affect daratumumab-mediated phagocytosis.

[0305] FIG. 25 depicts the ability of chimeric hSIRP.alpha..50A.hIgG1.N297Q, hSIRP.alpha..50A hIgG1.L234A.L235A.P329G, and hSIRP.alpha..50A hIgG2 or hIgG4 antibody variants to affect rituximab-mediated phagocytosis.

DETAILED DESCRIPTION

Abbreviations

[0306] Throughout the detailed description and examples of the invention the following abbreviations will be used:

[0307] ADCC Antibody-dependent cellular cytotoxicity

[0308] ADCP Antibody-dependent cellular phagocytosis

[0309] CDC Complement-dependent cytotoxicity

[0310] CDR Complementarity determining region in the immunoglobulin variable regions, defined using the Kabat numbering system

[0311] CHO Chinese hamster ovary

[0312] EC50 Concentration at which 50% of the total binding signal is observed

[0313] ELISA Enzyme-linked immunosorbant assay

[0314] FR Antibody framework region: the immunoglobulin variable regions excluding the CDR regions.

[0315] HRP Horseradish peroxidase

[0316] IFN interferon

[0317] IC50 concentration resulting in 50% inhibition

[0318] IgG Immunoglobulin G

[0319] Kabat An immunoglobulin alignment and numbering system pioneered by Elvin A. Kabat ((1991) Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md.)

[0320] mAb or Mab or MAb Monoclonal antibody

[0321] SEB Staphylococcus Enterotoxin B

[0322] TT Tetanus toxoid

[0323] V region The segment of Ig chains which is variable in sequence between different antibodies. It extends to Kabat residue 109 in the light chain and 113 in the heavy chain.

[0324] VH Immunoglobulin heavy chain variable region

[0325] VK Immunoglobulin kappa light chain variable region

[0326] VL Immunoglobulin light chain variable region

Definitions

[0327] So that the invention may be more readily understood, certain technical and scientific terms are specifically defined below. Unless specifically defined elsewhere in this document, all other technical and scientific terms used herein have the meaning commonly understood by one of ordinary skill in the art to which this invention belongs.

[0328] As used herein, including the appended claims, the singular forms of words such as "a," "an," and "the," include their corresponding plural references unless the context clearly dictates otherwise.

[0329] "Administration" and "treatment," as it applies to an animal, human, experimental subject, cell, tissue, organ, or biological fluid, refers to contact of an exogenous pharmaceutical, therapeutic, diagnostic agent, or composition to the animal, human, subject, cell, tissue, organ, or biological fluid. Treatment of a cell encompasses contact of a reagent to the cell, as well as contact of a reagent to a fluid, where the fluid is in contact with the cell. "Administration" and "treatment" also means in vitro and ex vivo treatments, e.g., of a cell, by a reagent, diagnostic, binding compound, or by another cell.

[0330] "Treat" or "treating" means to administer a therapeutic agent, such as a composition containing any of the antibodies or antigen-binding fragments of the present invention, internally or externally to a subject or patient having one or more disease symptoms, or being suspected of having a disease, for which the agent has therapeutic activity. Typically, the agent is administered in an amount effective to alleviate one or more disease symptoms in the treated subject or population, whether by inducing the regression of or inhibiting the progression of such symptom(s) by any clinically measurable degree. The amount of a therapeutic agent that is effective to alleviate any particular disease symptom may vary according to factors such as the disease state, age, and weight of the patient, and the ability of the drug to elicit a desired response in the subject. Whether a disease symptom has been alleviated can be assessed by any clinical measurement typically used by physicians or other skilled healthcare providers to assess the severity or progression status of that symptom.

[0331] "Recombinant expression" of a protein means the transcription and translation of an exogenous gene in a host organism to generate the protein, which is referred to herein as a "recombinant protein."

SIRP.alpha. and Associated Proteins

[0332] SIRP.alpha. belongs to a class of membrane proteins known as "paired receptors" that contain several genes coding for proteins (e.g., SIRP.alpha., SIRP.beta.1, and SIRP.gamma.) with similar extracellular regions but different transmembrane and/or cytoplasmic regions having opposite (activating or inhibitory) signaling abilities. Like SIRP.alpha., there are several examples of paired receptors on NK cells and some on myeloid cells, including the SIRP and CD200 receptor families (Hatherley et al., Mol Cell. 2008; 31: 266-277).

[0333] SIRP.alpha. contains an extracellular region that can be subdivided into three separate domains: the Ig-like (immunoglobulin-like) V-type (IgV), Ig-like C1-type (IgC1), and Ig-like C2-type (IgC2) domain. The IgV domain is also known as the ligand-binding N-terminal domain of SIRP.alpha.. Like SIRP.alpha., also the related proteins SIRP.beta.1 and SIRP.gamma. comprise an extracellular region that can be subdivided into an IgV, IgC1, and IgC2 domain. However, SIRP.alpha., SIRP.beta.1 and SIRP.gamma. have different cytoplasmic regions. SIRP.beta.1 has a very short cytoplasmic region of only 6 amino acids and lacks signalling motifs for association with phosphatases. Instead, this protein associates with DNAX activation protein 12 (DAP12), a dimeric adaptor protein that binds an amino acid with a basic side chain in the transmembrane region of SIRP.beta.1 and is able to transmit activating signals through its immunoreceptor tyrosine-based activation motif (ITAM). SIRP.gamma. also has a short cytoplasmic region of 4 amino acids, but it lacks a charged amino-acid side chain in the transmembrane region and therefore does not associate with DAP12. Hence, SIRP.gamma. is annotated as a non-signalling protein (Barclay, A. N. and Brown, M. H., Nat Rev Immunol. 2006; 6: 457-464).

[0334] The major ligand of SIRP.gamma. is CD47, which consists of one extracellular IgV domain, a five times transmembrane-spanning domain, and a short cytoplasmic tail. CD47 functions as a cellular ligand with binding mediated through the NH2-terminal IgV domain of SIRP.gamma.. Evidence that CD47 contributes to recognition of self comes from the observation that splenic macrophages derived from CD47-expressing mice clear infused blood cells from CD47.sup.-/- mice (Oldenborg et al., Science. 2000; 288: 2051-2054).

[0335] In addition to CD47, two other SIRP.gamma. ligands have been reported, known as surfactant proteins A and D (Sp-A and Sp-D), both of which belong to the collectin family. Sp-D has been reported to bind to the membrane-proximal IgC2 domain of SIRP.gamma. in a calcium- and saccharide-dependent manner. It is thought that Sp-A and Sp-D help maintain an anti-inflammatory environment in the lung by stimulating SIRP.gamma. on alveolar macrophages (Gardai et al., Cell. 2003; 115: 13-23).

[0336] The amino acid sequence of eight human SIRP.gamma. variants are listed in SEQ ID NOs: 34, 36, 44, 46, 48, 50, 52, and 54; exemplary nucleic acid sequences encoding these variants are listed in SEQ ID NOs: 33, 35, 43, 45, 47, 49, 51, and 53, respectively.

[0337] For comparison, the amino acid sequence of human SIRP.beta.1 and SIRP.gamma. are listed in SEQ ID NOs: 38 and 40, respectively, and exemplary nucleic acid sequences in SEQ ID NOs: 37 and 39, respectively.

[0338] The amino acid sequence of human CD47 is listed in SEQ ID NO: 42, and an exemplary nucleic acid sequence in SEQ ID NO: 41.

[0339] Modified SIRP.gamma. polypeptides hSIRP.alpha.-V.beta.C1.alpha.C2.alpha., hSIRP.alpha.-V.alpha.C1.beta.C2.alpha., hSIRP.alpha.-V.alpha.C1.alpha.C2.beta., and hSIRP.alpha.V1(P74A) discussed hereinafter are listed in SEQ ID NOs: 56, 58, 60, and 62; exemplary nucleic acid sequences encoding these variants are listed in SEQ ID NOs: 55, 57, 59, and 61, respectively.

Anti-SIRP.alpha. Antibodies and Antigen-Binding Fragments Thereof

[0340] The present invention provides antibodies or antigen-binding fragments thereof that bind human SIRP.alpha. and uses of such antibodies or fragments. In some embodiments, the anti-SIRP.alpha. antibodies are isolated.

[0341] Whether an antibody specifically binds to a polypeptide sequence (e.g., human SIRP.alpha., hSIRP.beta.1, etc.) can be determined using any assay known in the art. Examples of assays known in the art to determining binding affinity include surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g. KinExa or OCTET).

[0342] As used herein, the term "antibody" refers to any form of antibody that exhibits the desired biological activity. The term antibody includes antigen-binding portions, i.e., "antigen binding sites," (e.g., fragments, subsequences, complementarity determining regions (CDRs)) that retain capacity to bind antigen, including (i) a Fab fragment, a monovalent fragment consisting of the V.sub.L, V.sub.H, C.sub.L and C.sub.H1 domains; (ii) a F(ab').sub.2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the V.sub.H and C.sub.H1 domains; (iv) a Fv fragment consisting of the V.sub.L and V.sub.H domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546), which consists of a VH domain; and (vi) an isolated complementarity determining region (CDR). Single chain antibodies are also included by reference in the term "antibody." Preferred therapeutic antibodies are intact IgG antibodies. The term "intact IgG" as used herein is meant as a polypeptide belonging to the class of antibodies that are substantially encoded by a recognized immunoglobulin gamma gene. In humans this class comprises IgG1, IgG2, IgG3, and IgG4. In mice this class comprises IgG1, IgG2a, IgG2b, IgG3. The known Ig domains in the IgG class of antibodies are V.sub.H, C.gamma.1, C.gamma.2, C.gamma.3, V.sub.L, and C.sub.L.

[0343] The present invention includes anti-SIRP.alpha. antigen-binding fragments and methods of use thereof.

[0344] As used herein, a "full length antibody" is, in the case of an IgG, a bivalent molecule comprising two heavy chains and two light chains. Each heavy chain comprises a V.sub.H domain followed by a constant domain (C.sub.H1), a hinge region, and two more constant (C.sub.H2 and C.sub.H3) domains; while each light chain comprises one V.sub.L domain and one constant (C.sub.L) domain. A full length antibody in the case of an IgM is a decavalent or dodecavalent molecule comprising 5 or 6 linked immunoglobulins in which immunoglobulin each monomer has two antigen binding sites formed of a heavy and light chain.

[0345] As used herein, unless otherwise indicated, "antibody fragment" or "antigen-binding fragment" refers to antigen-binding fragments of antibodies, i.e. antibody fragments that retain the ability to bind specifically to the antigen bound by the full-length antibody, e.g. fragments that retain one or more CDR regions. Examples of antigen-binding fragments include, but are not limited to, Fab, Fab', F(ab').sub.2, and Fv fragments; diabodies; linear antibodies; single-chain antibody molecules, e.g., sc-Fv; nanobodies and multispecific antibodies formed from antibody fragments.

[0346] The present invention includes anti-SIRP.alpha. Fab fragments and methods of use thereof. A "Fab fragment" is comprised of one light chain and the C.sub.H1 and variable regions of one heavy chain. The heavy chain of a Fab molecule cannot form a disulfide bond with another heavy chain molecule. A "Fab fragment" can be the product of papain cleavage of an antibody.

[0347] The present invention includes anti-SIRP.alpha. antibodies and antigen-binding fragments thereof which comprise an Fc region and methods of use thereof. An "Fc" region contains two heavy chain fragments comprising the C.sub.H3 and C.sub.H2 domains of an antibody. The two heavy chain fragments are held together by two or more disulfide bonds and by hydrophobic interactions of the C.sub.H3 domains.

[0348] The present invention includes anti-SIRP.alpha. Fab' fragments and methods of use thereof. A "Fab' fragment" contains one light chain and a portion or fragment of one heavy chain that contains the V.sub.H domain and the C.sub.H1 domain and also the region between the C.sub.H1 and C H2 domains, such that an interchain disulfide bond can be formed between the two heavy chains of two Fab' fragments to form a F(ab') 2 molecule.

[0349] The present invention includes anti-SIRP.alpha. F(ab').sub.2 fragments and methods of use thereof. A "F(ab').sub.2 fragment" contains two light chains and two heavy chains containing a portion of the constant region between the C.sub.H1 and C.sub.H2 domains, such that an interchain disulfide bond is formed between the two heavy chains. A F(ab') 2 fragment thus is composed of two Fab' fragments that are held together by a disulfide bond between the two heavy chains. An "F(ab').sub.2 fragment" can be the product of pepsin cleavage of an antibody.

[0350] The present invention includes anti-SIRP.alpha. Fv fragments and methods of use thereof. The "Fv region" comprises the variable regions from both the heavy and light chains, but lacks the constant regions.

[0351] The present invention includes anti-SIRP.alpha. scFv fragments and methods of use thereof. The term "single-chain Fv" or "scFv" antibody refers to antibody fragments comprising the VH and V.sub.L domains of an antibody, wherein these domains are present in a single polypeptide chain. Generally, the Fv polypeptide further comprises a polypeptide linker between the V.sub.H and V.sub.L domains which enables the scFv to form the desired structure for antigen-binding. For a review of scFv, see Pluckthun (1994) THE PHARMACOLOGY OF MONOCLONAL ANTIBODIES, vol. 113, Rosenburg and Moore eds. Springer-Verlag, New York, pp. 269-315. See also, International Patent Application Publication No. WO 88/01649 and U.S. Pat. Nos. 4,946,778 and 5,260,203.

[0352] The present invention includes anti-SIRP.alpha. domain antibodies and methods of use thereof. A "domain antibody" is an immunologically functional immunoglobulin fragment containing only the variable region of a heavy chain or the variable region of a light chain. In some instances, two or more V.sub.H regions are covalently joined with a peptide linker to create a bivalent domain antibody. The two V.sub.H regions of a bivalent domain antibody may target the same or different antigens.

[0353] The present invention includes anti-SIRP.alpha. bivalent antibodies and methods of use thereof. A "bivalent antibody" comprises two antigen-binding sites. In some instances, the two binding sites have the same antigen specificities. However, bivalent antibodies may be bispecific (see below).

[0354] The present invention includes anti-SIRP.alpha. diabodies and methods of use thereof. As used herein, the term "diabodies" refers to small antibody fragments with two antigen-binding sites, which fragments comprise a heavy chain variable domain (V.sub.H) connected to a light chain variable domain (V.sub.L) in the same polypeptide chain (V.sub.H-V.sub.L or V.sub.L-V.sub.H). By using a linker that is too short to allow pairing between the two domains on the same chain, the domains are forced to pair with the complementary domains of another chain and create two antigen-binding sites. Diabodies are described more fully in, e.g., EP 404,097; WO 93/11161; and Holliger et al. (1993) Proc. Natl. Acad. Sci. USA 90: 6444-6448. Duobodies are described in Labrijn et al., 2013, Proc. Natl. Acad. Sci. USA 110 (13): 5145-5150. For a review of engineered antibody variants generally see Holliger and Hudson (2005) Nat. Biotechnol. 23:1126-1136.

[0355] Typically, an antibody or antigen-binding fragment of the invention which is modified in some way retains at least 10% of its binding activity (when compared to the parental antibody) when that activity is expressed on a molar basis. Preferably, an antibody or antigen-binding fragment of the invention retains at least 20%, 50%, 70%, 80%, 90%, 95% or 100% or more of the SIRP.alpha. binding affinity as the parental antibody. It is also intended that an antibody or antigen-binding fragment of the invention can include conservative or non-conservative amino acid substitutions (referred to as "conservative variants" or "function conserved variants" of the antibody) that do not substantially alter its biologic activity.

[0356] The present invention includes isolated anti-SIRP.alpha. antibodies and antigen-binding fragments thereof and methods of use thereof. Herein, the term "isolated" is not intended to refer to a complete absence of such biological molecules or to an absence of water, buffers, or salts or to components of a pharmaceutical formulation that includes the antibodies or fragments. An "isolated" antibody, antigen-binding fragment, nucleic acid, etc., is one which has been identified and separated and/or recovered from one or more components of its natural environment. In preferred embodiments, the antibody, antigen-binding fragment, nucleic acid, etc., is purified to 75% by weight or more, more preferably to 90% by weight or more, still more preferably to 95% by weight or more, an still more preferably to 98% by weight or more. Thus, "isolated" biological molecules are at least partially free of other biological molecules from the cells or cell cultures in which they are produced. Such biological molecules include nucleic acids, proteins, lipids, carbohydrates, or other material such as cellular debris and growth medium. An isolated antibody or antigen-binding fragment may further be at least partially free of expression system components such as biological molecules from a host cell or of the growth medium thereof.

[0357] The present invention includes anti-SIRP.alpha. chimeric antibodies (e.g., human constant domain/mouse variable domain) and methods of use thereof. As used herein, a "chimeric antibody" is an antibody having the variable domain from a first antibody and the constant domain from a second antibody, where the first and second antibodies are from different species. (U.S. Pat. No. 4,816,567; and Morrison et al., (1984) Proc. Natl. Acad. Sci. USA 81: 6851-6855). Typically, the variable domains are obtained from an antibody from an experimental animal (the "parental antibody"), such as a rodent, and the constant domain sequences are obtained from human antibodies, so that the resulting chimeric antibody will be less likely to elicit an adverse immune response in a human subject than the parental (e.g., mouse) antibody.

[0358] The present invention includes anti-SIRP.alpha. humanized antibodies and antigen-binding fragments thereof (e.g., rat or mouse antibodies that have been humanized) and methods of use thereof. As used herein, the term "humanized antibody" refers to forms of antibodies that contain sequences from both human and non-human (e.g., mouse or rat) antibodies. In general, the humanized antibody will comprise substantially of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin, and all or substantially all of the framework (FR) regions are those of a human immunoglobulin sequence. The humanized antibody may optionally comprise at least a portion of a human immunoglobulin constant region (Fc). For more details about humanized antibodies, see, e.g., Jones et al., Nature, 321:522-525 (1986); Reichmann et al., Nature, 332:323-329 (1988); Presta, Curr. Op. Struct. Biol., 2:593-596 (1992); and Clark, Immunol. Today 21: 397-402 (2000).

[0359] In general, the basic antibody structural unit comprises a tetramer. Each tetramer includes two identical pairs of polypeptide chains, each pair having one "light" (about 25 kDa) and one "heavy" chain (about 50-70 kDa). The amino-terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition. The carboxy-terminal portion of the heavy chain may define a constant region primarily responsible for effector function. Typically, human light chains are classified as kappa and lambda light chains. Furthermore, human heavy chains are typically classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively. Within light and heavy chains, the variable and constant regions are joined by a "J" region of about 12 or more amino acids, with the heavy chain also including a "D" region of about 10 more amino acids. See generally, Fundamental Immunology Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989).

[0360] The variable regions of each light/heavy chain pair form the antibody binding site. Thus, in general, an intact antibody has two binding sites. Except in bifunctional or bispecific antibodies, the two binding sites are, in general, the same.

[0361] Typically, the variable domains of both the heavy and light chains comprise three hypervariable regions, also called complementarity determining regions (CDRs), located within relatively conserved framework regions (FR). The CDRs are usually aligned by the framework regions, enabling binding to a specific epitope. In general, from N-terminal to C-terminal, both light and heavy chains variable domains comprise FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4. The assignment of amino acids to each domain is, generally, in accordance with the definitions of Sequences of Proteins of Immunological Interest, Kabat, et al.; National Institutes of Health, Bethesda, Md.; 5.sup.th ed.; NIH Publ. No. 91-3242 (1991); Kabat (1978) Adv. Prot. Chem. 32:1-75; Kabat, et al., (1977) J. Biol. Chem. 252:6609-6616; Chothia, et al., (1987) J Mol. Biol. 196:901-917 or Chothia, et al., (1989) Nature 342:878-883.

[0362] As used herein, the term "hypervariable region" refers to the amino acid residues of an antibody or antigen-binding fragment thereof that are responsible for antigen-binding. The hypervariable region comprises amino acid residues from a "complementarity determining region" or "CDR" (i.e. CDRL1, CDRL2 and CDRL3 in the light chain variable domain and CDRH1, CDRH2 and CDRH3 in the heavy chain variable domain). See Kabat et al. (1991) Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (defining the CDR regions of an antibody by sequence); see also Chothia and Lesk (1987) J. Mol. Biol. 196: 901-917 (defining the CDR regions of an antibody by structure). As used herein, the term "framework" or "FR" residues refers to those variable domain residues other than the hypervariable region residues defined herein as CDR residues.

[0363] "Isolated nucleic acid molecule" or "isolated polynucleotide" means a DNA or RNA of genomic, mRNA, cDNA, or synthetic origin or some combination thereof which is not associated with all or a portion of a polynucleotide in which the isolated polynucleotide is found in nature, or is linked to a polynucleotide to which it is not linked in nature. For purposes of this disclosure, it should be understood that "a nucleic acid molecule comprising" a particular nucleotide sequence does not encompass intact chromosomes. Isolated nucleic acid molecules "comprising" specified nucleic acid sequences may include, in addition to the specified sequences, coding sequences for up to ten or even up to twenty or more other proteins or portions or fragments thereof, or may include operably linked regulatory sequences that control expression of the coding region of the recited nucleic acid sequences, and/or may include vector sequences.

[0364] The phrase "control sequences" refers to DNA sequences necessary for the expression of an operably linked coding sequence in a particular host organism. The control sequences that are suitable for prokaryotes, for example, include a promoter, optionally an operator sequence, and a ribosome binding site. Eukaryotic cells are known to use promoters, polyadenylation signals, and enhancers.

[0365] A nucleic acid or polynucleotide is "operably linked" when it is placed into a functional relationship with another nucleic acid sequence. For example, DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide; a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation. Generally, but not always, "operably linked" means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading phase. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice.

[0366] As used herein, the expressions "cell," "cell line," and "cell culture" are used interchangeably and all such designations include progeny. Thus, the words "transformants" and "transformed cells" include the primary subject cell and cultures derived therefrom without regard for the number of transfers. It is also understood that not all progeny will have precisely identical DNA content, due to deliberate or inadvertent mutations. Mutant progeny that have the same function or biological activity as screened for in the originally transformed cell are included. Where distinct designations are intended, it will be clear from the context.

[0367] As used herein, "germline sequence" refers to a sequence of unrearranged immunoglobulin DNA sequences. Any suitable source of unrearranged immunoglobulin sequences may be used. Human germline sequences may be obtained, for example, from JOINSOLVER germline databases on the website for the National Institute of Arthritis and Musculoskeletal and Skin Diseases of the United States National Institutes of Health. Mouse germline sequences may be obtained, for example, as described in Giudicelli et al. (2005) Nucleic Acids Res. 33: D256-D261.

[0368] Physical and Functional Properties of the Exemplary Anti-SIRP.alpha. Antibodies

[0369] The present invention provides anti-SIRP.alpha. antibodies and antigen-binding fragments thereof having specified structural and functional features, and methods of use of the antibodies or antigen-binding fragments thereof in the treatment or prevention of disease (e.g., cancer or infectious disease).

[0370] As stated above, antibodies and fragments that bind to the same epitope as any of the anti-SIRP.alpha. antibodies or antigen-binding fragments thereof of the present invention also form part of the present invention. In one embodiment, the invention provides an antibody or antigen binding fragment thereof that binds to the same epitope of human SIRP.alpha. as an antibody comprising one of the following combinations of heavy chain sequence/light chain sequence (or in each case an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto):

[0371] SEQ ID NO: 10/SEQ ID NO: 20 (referred to herein as hSIRP.alpha..50A.H1L1)

[0372] SEQ ID NO: 10/SEQ ID NO: 22 (referred to herein as hSIRP.alpha..50A.H1L2)

[0373] SEQ ID NO: 10/SEQ ID NO: 24 (referred to herein as hSIRP.alpha..50A.H1L3)

[0374] SEQ ID NO: 10/SEQ ID NO: 26 (referred to herein as hSIRP.alpha..50A.H1L4)

[0375] SEQ ID NO: 10/SEQ ID NO: 28 (referred to herein as hSIRP.alpha..50A.H1L5)

[0376] SEQ ID NO: 12/SEQ ID NO: 20 (referred to herein as hSIRP.alpha..50A.H2L1)

[0377] SEQ ID NO: 12/SEQ ID NO: 22 (referred to herein as hSIRP.alpha..50A.H2L2)

[0378] SEQ ID NO: 12/SEQ ID NO: 24 (referred to herein as hSIRP.alpha..50A.H2L3)

[0379] SEQ ID NO: 12/SEQ ID NO: 26 (referred to herein as hSIRP.alpha..50A.H2L4)

[0380] SEQ ID NO: 12/SEQ ID NO: 28 (referred to herein as hSIRP.alpha..50A.H2L5)

[0381] SEQ ID NO: 14/SEQ ID NO: 20 (referred to herein as hSIRP.alpha..50A.H3L1)

[0382] SEQ ID NO: 14/SEQ ID NO: 22 (referred to herein as hSIRP.alpha..50A.H3L2)

[0383] SEQ ID NO: 14/SEQ ID NO: 24 (referred to herein as hSIRP.alpha..50A.H3L3)

[0384] SEQ ID NO: 14/SEQ ID NO: 26 (referred to herein as hSIRP.alpha..50A.H3L4)

[0385] SEQ ID NO: 14/SEQ ID NO: 28 (referred to herein as hSIRP.alpha..50A.H3L5)

[0386] SEQ ID NO: 16/SEQ ID NO: 20 (referred to herein as hSIRP.alpha..50A.H4L1)

[0387] SEQ ID NO: 16/SEQ ID NO: 22 (referred to herein as hSIRP.alpha..50A.H4L2)

[0388] SEQ ID NO: 16/SEQ ID NO: 24 (referred to herein as hSIRP.alpha..50A.H4L3)

[0389] SEQ ID NO: 16/SEQ ID NO: 26 (referred to herein as hSIRP.alpha..50A.H4L4)

[0390] SEQ ID NO: 16/SEQ ID NO: 28 (referred to herein as hSIRP.alpha..50A.H4L5)

[0391] SEQ ID NO: 18/SEQ ID NO: 20 (referred to herein as hSIRP.alpha..50A.H5L1)

[0392] SEQ ID NO: 18/SEQ ID NO: 22 (referred to herein as hSIRP.alpha..50A.H5L2)

[0393] SEQ ID NO: 18/SEQ ID NO: 24 (referred to herein as hSIRP.alpha..50A.H5L3)

[0394] SEQ ID NO: 18/SEQ ID NO: 26 (referred to herein as hSIRP.alpha..50A.H5L4)

[0395] SEQ ID NO: 18/SEQ ID NO: 28 (referred to herein as hSIRP.alpha..50A.H5L5)

[0396] SEQ ID NO: 78/SEQ ID NO: 90 (referred to herein as hSIRP.alpha..40A.H1L1)

[0397] SEQ ID NO: 78/SEQ ID NO: 92 (referred to herein as hSIRP.alpha..40A.H1L2)

[0398] SEQ ID NO: 78/SEQ ID NO: 94 (referred to herein as hSIRP.alpha..40A.H1L3)

[0399] SEQ ID NO: 78/SEQ ID NO: 96 (referred to herein as hSIRP.alpha..40A.H1L4)

[0400] SEQ ID NO: 78/SEQ ID NO: 98 (referred to herein as hSIRP.alpha..40A.H1L5)

[0401] SEQ ID NO: 78/SEQ ID NO: 100 (referred to herein as hSIRP.alpha..40A.H1L6)

[0402] SEQ ID NO: 80/SEQ ID NO: 90 (referred to herein as hSIRP.alpha..40A.H2L1)

[0403] SEQ ID NO: 80/SEQ ID NO: 92 (referred to herein as hSIRP.alpha..40A.H2L2)

[0404] SEQ ID NO: 80/SEQ ID NO: 94 (referred to herein as hSIRP.alpha..40A.H2L3)

[0405] SEQ ID NO: 80/SEQ ID NO: 96 (referred to herein as hSIRP.alpha..40A.H2L4)

[0406] SEQ ID NO: 80/SEQ ID NO: 98 (referred to herein as hSIRP.alpha..40A.H2L5)

[0407] SEQ ID NO: 80/SEQ ID NO: 100 (referred to herein as hSIRP.alpha..40A.H2L6)

[0408] SEQ ID NO: 82/SEQ ID NO: 90 (referred to herein as hSIRP.alpha..40A.H3L1)

[0409] SEQ ID NO: 82/SEQ ID NO: 92 (referred to herein as hSIRP.alpha..40A.H3L2)

[0410] SEQ ID NO: 82/SEQ ID NO: 94 (referred to herein as hSIRP.alpha..40A.H3L3)

[0411] SEQ ID NO: 82/SEQ ID NO: 96 (referred to herein as hSIRP.alpha..40A.H3L4)

[0412] SEQ ID NO: 82/SEQ ID NO: 98 (referred to herein as hSIRP.alpha..40A.H3L5)

[0413] SEQ ID NO: 82/SEQ ID NO: 100 (referred to herein as hSIRP.alpha..40A.H3L6)

[0414] SEQ ID NO: 84/SEQ ID NO: 90 (referred to herein as hSIRP.alpha..40A.H4L1)

[0415] SEQ ID NO: 84/SEQ ID NO: 92 (referred to herein as hSIRP.alpha..40A.H4L2)

[0416] SEQ ID NO: 84/SEQ ID NO: 94 (referred to herein as hSIRP.alpha..40A.H4L3)

[0417] SEQ ID NO: 84/SEQ ID NO: 96 (referred to herein as hSIRP.alpha..40A.H4L4)

[0418] SEQ ID NO: 84/SEQ ID NO: 98 (referred to herein as hSIRP.alpha..40A.H4L5)

[0419] SEQ ID NO: 84/SEQ ID NO: 100 (referred to herein as hSIRP.alpha..40A.H4L6)

[0420] SEQ ID NO: 86/SEQ ID NO: 90 (referred to herein as hSIRP.alpha..40A.H5L1)

[0421] SEQ ID NO: 86/SEQ ID NO: 92 (referred to herein as hSIRP.alpha..40A.H5L2)

[0422] SEQ ID NO: 86/SEQ ID NO: 94 (referred to herein as hSIRP.alpha..40A.H5L3)

[0423] SEQ ID NO: 86/SEQ ID NO: 96 (referred to herein as hSIRP.alpha..40A.H5L4)

[0424] SEQ ID NO: 86/SEQ ID NO: 98 (referred to herein as hSIRP.alpha..40A.H5L5)

[0425] SEQ ID NO: 86/SEQ ID NO: 100 (referred to herein as hSIRP.alpha..40A.H5L6)

[0426] SEQ ID NO: 88/SEQ ID NO: 90 (referred to herein as hSIRP.alpha..40A.H6L1)

[0427] SEQ ID NO: 88/SEQ ID NO: 92 (referred to herein as hSIRP.alpha..40A.H6L2)

[0428] SEQ ID NO: 88/SEQ ID NO: 94 (referred to herein as hSIRP.alpha..40A.H6L3)

[0429] SEQ ID NO: 88/SEQ ID NO: 96 (referred to herein as hSIRP.alpha..40A.H6L4)

[0430] SEQ ID NO: 88/SEQ ID NO: 98 (referred to herein as hSIRP.alpha..40A.H6L5)

[0431] SEQ ID NO: 88/SEQ ID NO: 100 (referred to herein as hSIRP.alpha..40A.H6L6).

[0432] There are several methods available for mapping antibody epitopes on target antigens, including: H/D-Ex mass spectrometry, crosslinking coupled mass spectrometry, X-ray crystallography, pepscan analysis and site directed mutagenesis. For example, HDX (Hydrogen Deuterium Exchange) coupled with proteolysis and mass spectrometry can be used to determine the epitope of an antibody on a specific antigen Y. HDX-MS relies on the accurate measurement and comparison of the degree of deuterium incorporation by an antigen when incubated in D.sub.2O on its own and in presence of its antibody at various time intervals. Deuterium is exchanged with hydrogen on the amide backbone of the proteins in exposed areas whereas regions of the antigen bound to the antibody will be protected and will show less or no exchange after analysis by LC-MS/MS of proteolytic fragments. Crosslinking coupled mass spectrometry begins by binding the antibody and the antigen with a mass labeled chemical crosslinker. Next the presence of the complex is confirmed using high mass MALDI detection. Because after crosslinking chemistry the Ab/Ag complex is extremely stable, many various enzymes and digestion conditions can be applied to the complex to provide many different overlapping peptides. Identification of these peptides is performed using high resolution mass spectrometry and MS/MS techniques. Identification of the crosslinked peptides is determined using mass tag linked to the cross-linking reagents. After MS/MS fragmentation and data analysis, both epitope and paratope are determined in the same experiment.

[0433] The scope of the present invention also includes isolated anti-SIRP.alpha. antibodies and antigen-binding fragments thereof (e.g., humanized antibodies), comprising a variant of an immunoglobulin chain set forth herein, wherein the variant exhibits one or more of the following properties:

[0434] binds human SIRP.alpha.V1 protein having the sequence of SEQ ID NO: 34 with an EC.sub.50<1 nM; and exhibits at least a 100-fold higher EC.sub.50 for SIRP.alpha.V1(P74A) having the sequence of SEQ ID NO: 62; and optionally also at least a 100-fold higher EC.sub.50 for human SIRP.beta.1 protein having the sequence of SEQ ID NO: 38 (in each case wherein the reduced EC.sub.50 is relative to the EC.sub.50 for human SIRP.alpha.V1 protein having the sequence of

[0435] SEQ ID NO: 34, and in each case preferably when measured by cellular ELISA (CELISA) as described hereinafter;

[0436] binds to a cell expressing human SIRP.alpha.V1 protein with an EC.sub.50<10 nM, preferably <5 nM, more preferably <1.5 nM, still more preferably <1.0 nM, even more preferably <0.5 nM, and most preferably about 0.3 nM or less;

[0437] binds to a cell expressing human SIRP.alpha.V2 protein with an EC.sub.50<10 nM, preferably <5 nM, more preferably <1.5 nM, still more preferably <1.0 nM, even more preferably <0.5 nM, and most preferably about 0.3 nM or less;

[0438] does not appreciably bind to SIRP.beta.1 protein at an antibody concentration of 50 nM, preferably 67 nM, and more preferably 100 nM; or alternatively at a concentration that is 10-fold greater, preferably 50-fold greater, more preferably 100-fold greater, and still more preferably 200-fold greater than the antibody's EC.sub.50 for SIRP.alpha.V1 or SIRP.alpha.V2;

[0439] inhibits binding between human SIRP.alpha. and CD47 with an IC.sub.50<10.0 nM, more preferably <5.0 nM, still more preferably <2.5 nM, and most preferably about 1.0 nM or less; and

[0440] exhibits a T20 "humanness" of at least 79, and more preferably 85%.

[0441] In other embodiments, the invention provides antibodies or antigen-binding fragment thereof that bind human SIRP.alpha. (e.g., humanized antibodies) and have V.sub.H domains and V.sub.L domains with at least 90% sequence identity with SEQ ID NOs: 75, 78, 80, 82, 84, 86, 88, 102, 7, 10, 12, 14, 16, 18, and 30; and 76, 90, 92, 94, 96, 98, 100, 104, 8, 20, 22, 24, 26, 28, and 32. In other embodiments, the invention provides antibodies or antigen-binding fragment thereof that bind human SIRP.alpha. (e.g., humanized antibodies) and have V.sub.H domains and V.sub.L domains with at least 95% sequence identity with SEQ ID NOs: 75, 78, 80, 82, 84, 86, 88, 102, 7, 10, 12, 14, 16, 18, and 30; and 76, 90, 92, 94, 96, 98, 100, 104, 8, 20, 22, 24, 26, 28, and 32. In other embodiments, the invention provides antibodies or antigen-binding fragment thereof that bind human SIRP.alpha. (e.g., humanized antibodies) and have V.sub.H domains and V.sub.L domains with at least 97% sequence identity with SEQ ID NOs: 75, 78, 80, 82, 84, 86, 88, 102, 7, 10, 12, 14, 16, 18, and 30; and 76, 90, 92, 94, 96, 98, 100, 104, 8, 20, 22, 24, 26, 28, and 32. In other embodiments, the invention provides antibodies or antigen-binding fragment thereof that bind human SIRP.alpha. (e.g., humanized antibodies) and have V.sub.H domains and V.sub.L domains with at least 98% sequence identity with SEQ ID NOs: 75, 78, 80, 82, 84, 86, 88, 102, 7, 10, 12, 14, 16, 18, and 30; and 76, 90, 92, 94, 96, 98, 100, 104, 8, 20, 22, 24, 26, 28, and 32. In other embodiments, the invention provides antibodies or antigen-binding fragment thereof that bind human SIRP.alpha. (e.g., humanized antibodies) and have V.sub.H domains and V.sub.L domains with at least 99% sequence identity with SEQ ID NOs: 75, 78, 80, 82, 84, 86, 88, 102, 7, 10, 12, 14, 16, 18, and 30; and 76, 90, 92, 94, 96, 98, 100, 104, 8, 20, 22, 24, 26, 28, and 32. Preferably, in each case, the sequence differences between SEQ ID NOs: 75, 78, 80, 82, 84, 86, 88, 102, 7, 10, 12, 14, 16, 18, and 30; and 76, 90, 92, 94, 96, 98, 100, 104, 8, 20, 22, 24, 26, 28, and 32 and the variants consist of conservative substitutions and are most preferably limited to substitutions within the framework residues.

[0442] The following references relate to BLAST algorithms often used for sequence analysis: BLAST ALGORITHMS: Camacho, C. et al. (2009): BMC Bioinformatics 10:421; Altschul et al. (2005) FEBS J. 272(20): 5101-5109; Altschul, S. F., et al., (1990) J. Mol. Biol. 215:403-410; Gish, W., et al., (1993) Nature Genet. 3:266-272; Madden, T. L., et al., (1996) Meth. Enzymol. 266:131-141; Altschul, S. F., et al., (1997) Nucleic Acids Res. 25:3389-3402; Zhang, J., et al., (1997) Genome Res. 7:649-656; Wootton, J. C., et al., (1993) Comput. Chem. 17:149-163; Hancock, J. M. et al., (1994) Comput. Appl. Biosci. 10:67-70; ALIGNMENT SCORING SYSTEMS: Dayhoff, M. O., et al., "A model of evolutionary change in proteins." in Atlas of Protein Sequence and Structure, (1978) vol. 5, suppl. 3. M. O. Dayhoff (ed.), pp. 345-352, Natl. Biomed. Res. Found., Washington, D.C.; Schwartz, R. M., et al., "Matrices for detecting distant relationships." in Atlas of Protein Sequence and Structure, (1978) vol. 5, suppl. 3." M. O. Dayhoff (ed.), pp. 353-358, Natl. Biomed. Res. Found., Washington, D.C.; Altschul, S.F., (1991) J. Mol. Biol. 219:555-565; States, D. J., et al., (1991) Methods 3:66-70; Henikoff, S., et al., (1992) Proc. Natl. Acad. Sci. USA 89:10915-10919; Altschul, S. F., et al., (1993) J. Mol. Evol. 36:290-300; ALIGNMENT STATISTICS: Karlin, S., et al., (1990) Proc. Natl. Acad. Sci. USA 87:2264-2268; Karlin, S., et al., (1993) Proc. Natl. Acad. Sci. USA 90:5873-5877; Dembo, A., et al., (1994) Ann. Prob. 22:2022-2039; and Altschul, S.F. "Evaluating the statistical significance of multiple distinct local alignments." in Theoretical and Computational Methods in Genome Research (S. Suhai, ed.), (1997) pp. 1-14, Plenum, New York. In the present application, percent identity comparisons are preferably performed by a BLAST algorithm wherein the parameters of the algorithm are selected to give the largest match between the respective sequences over the entire length of the respective reference sequences (e.g. expect threshold: 10; word size: 6; max matches in a query range: 0; BLOSUM 62 matrix; gap costs: existence 11, extension 1; conditional compositional score matrix adjustment).

[0443] "Conservatively modified variants" or "conservative substitution" refers to substitutions of amino acids in a protein with other amino acids having similar characteristics (e.g. charge, side-chain size, hydrophobicity/hydrophilicity, backbone conformation and rigidity, etc.), such that the changes can frequently be made without altering the biological activity of the protein. Those of skill in this art recognize that, in general, single amino acid substitutions in non-essential regions of a polypeptide do not substantially alter biological activity (see, e.g., Watson et al. (1987) Molecular Biology of the Gene, The Benjamin/Cummings Pub. Co., p. 224 (4th Ed.)). In addition, substitutions of structurally or functionally similar amino acids are less likely to disrupt biological activity. Exemplary conservative substitutions are set forth the following Table 1.

TABLE-US-00001 TABLE 1 Exemplary Conservative Amino Acid Substitutions Original residue Conservative substitution Ala (A) Gly; Ser Arg (R) Lys; His Asn (N) Gln; His Asp (D) Glu; Asn Cys (C) Ser; Ala Gln (Q) Asn Glu (E) Asp; Gln Gly (G) Ala His (H) Asn; Gln Ile (I) Leu; Val Leu (L) Ile; Val Lys (K) Arg; His Met (M) Leu; Ile; Tyr Phe (F) Tyr; Met; Leu Pro (P) Ala Ser (S) Thr Thr (T) Ser Trp (W) Tyr; Phe Tyr (Y) Trp; Phe Val (V) Ile; Leu

[0444] Function-conservative variants of the antibodies of the invention are also contemplated by the present invention. "Function-conservative variants," as used herein, refers to antibodies or fragments in which one or more amino acid residues have been changed without altering a desired property, such an antigen affinity and/or specificity. Such variants include, but are not limited to, replacement of an amino acid with one having similar properties, such as the conservative amino acid substitutions of Table 1. Also provided are isolated polypeptides comprising the V.sub.L domains of the anti-SIRP.alpha. antibodies of the invention (e.g., SEQ ID NOs: 76, 90, 92, 94, 96, 98, 100, 8, 20, 22, 24, 26, 28, and 32), and isolated polypeptides comprising the V.sub.H domains of the anti-SIRP.alpha. antibodies of the invention (e.g., SEQ ID NOs: 75, 78, 80, 82, 84, 86, 88, 7, 10, 12, 14, 16, 18, and 30) having up to 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more amino acid substitutions, and preferably conservative substitutions.

[0445] The present invention further comprises the polynucleotides encoding any of the polypeptides or immunoglobulin chains of anti-SIRP.alpha. antibodies and antigen-binding fragments thereof of the invention. For example, the present invention includes the polynucleotides encoding the amino acids described in any one of SEQ ID NOs: 75, 78, 80, 82, 84, 86, 88, 102, 7, 10, 12, 14, 16, 18, and 30; and SEQ ID NOs: 76, 90, 92, 94, 96, 98, 100, 104, 8, 20, 22, 24, 26, 28, and 32.

[0446] In one embodiment, an isolated polynucleotide, for example DNA, encoding the polypeptide chains of the isolated antibodies or antigen-binding fragments set forth herein is provided. In one embodiment, the isolated polynucleotide encodes an antibody or antigen-binding fragment thereof comprising at least one mature immunoglobulin light chain variable (VL) domain according to the invention and/or at least one mature immunoglobulin heavy chain variable (VH) domain according to the invention. In some embodiments, the isolated polynucleotide encodes both a light chain and a heavy chain on a single polynucleotide molecule, and in other embodiments the light and heavy chains are encoded on separate polynucleotide molecules. In another embodiment, the polynucleotides further encodes a signal sequence.

[0447] This present invention also provides vectors, e.g., expression vectors, such as plasmids, comprising the isolated polynucleotides of the invention, wherein the polynucleotide is operably linked to control sequences that are recognized by a host cell when the host cell is transfected with the vector. Also provided are host cells comprising a vector of the present invention and methods for producing the antibody or antigen-binding fragment thereof or polypeptide disclosed herein comprising culturing a host cell harboring an expression vector or a nucleic acid encoding the immunoglobulin chains of the antibody or antigen-binding fragment thereof in culture medium, and isolating the antigen or antigen-binding fragment thereof from the host cell or culture medium.

Binding Affinity

[0448] By way of example, and not limitation, the antibodies and antigen-binding fragments disclosed herein may bind human SIRP.alpha. bivalently with a K.sub.D value of 10.times.10.sup.-9M or lower) as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g. KinExa or bio-layer interferometry (OCTET)). In one embodiment, the antibodies and antigen-binding fragments disclosed herein may bind human SIRP.alpha. or bivalently with a K.sub.D value of about 5-10.times.10.sup.-9 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g. KinExa or OCTET). Affinity is calculated as K.sub.D=k.sub.off/k.sub.on (k.sub.off is the dissociation rate constant, K. is the association rate constant and K.sub.D is the equilibrium constant). Affinity can be determined at equilibrium by measuring the fraction bound (r) of labeled ligand at various concentrations (c). The data are graphed using the Scatchard equation: r/c=K(n-r): where r=moles of bound ligand/mole of receptor at equilibrium; c=free ligand concentration at equilibrium; K=equilibrium association constant; and n=number of ligand binding sites per receptor molecule. By graphical analysis, r/c is plotted on the Y-axis versus r on the X-axis, thus producing a Scatchard plot. Antibody affinity measurement by Scatchard analysis is well known in the art. See, e.g., van Erp et al., J. Immunoassay 12: 425-43, 1991; Nelson and Griswold, Comput. Methods Programs Biomed. 27: 65-8, 1988.

Humanness

[0449] For purposes of this document, "humanness" is measured using the T20 score analyzer to quantify the humanness of the variable region of monoclonal antibodies as described in Gao S H, Huang K, Tu H, Adler A S. Monoclonal antibody humanness score and its applications. BMC Biotechnology. 2013: 13:55. doi:10.1186/1472-6750-13-55).

[0450] A web-based tool is provided to calculate the T20 score of antibody sequences using the T20 Cutoff Human Databases: http://abAnalyzer.lakepharma.com. In computing a T20 score, an input VH, VK, or VL variable region protein sequence is first assigned Kabat numbering, and CDR residues are identified. The full-length sequence or the framework only sequence (with CDR residues removed) is compared to every sequence in a respective antibody database using the blastp protein-protein BLAST algorithm. The sequence identity between each pairwise comparison is isolated, and after every sequence in the database has been analyzed, the sequences are sorted from high to low based on the sequence identity to the input sequence. The percent identity of the Top 20 matched sequences is averaged to obtain the T20 score.

[0451] For each chain type (VH, VK, VL) and sequence length (full-length or framework only) in the "All Human Databases," each antibody sequence was scored with its respective database using the T20 score analyzer. The T20 score was obtained for the top 20 matched sequences after the input sequence itself was excluded (the percent identity of sequences 2 through 21 were averaged since sequence 1 was always the input antibody itself). The T20 scores for each group were sorted from high to low. The decrease in score was roughly linear for most of the sequences; however the T20 scores for the bottom .about.15% of antibodies started decreasing sharply. Therefore, the bottom 15 percent of sequences were removed and the remaining sequences formed the T20 Cutoff Human Databases, where the T20 score cutoff indicates the lowest T20 score of a sequence in the new database.

[0452] As used herein, a "Human" antibody is one that has a T20 humanness score of at least 79%, and more preferably at least 85%.

Ability of Anti-hSIRP.alpha. Antibodies to Block Binding to CD47

[0453] In some embodiments, the anti-SIRP.alpha. antibodies or antigen binding fragments of the invention are able to block binding of human SIRP.alpha. to human CD47. The ability to block binding of human SIRP.alpha. to human CD47 can be determined using any method known in the art. In one embodiment, the ability of the antibodies to block binding of human SIRP.alpha. to human CD47 is determined using an ELISA assay.

Methods of Making Antibodies and Antigen-Binding Fragments Thereof

[0454] Thus, the present invention includes methods for making an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the present invention comprising culturing a hybridoma cell that expresses the antibody or fragment under condition favorable to such expression and, optionally, isolating the antibody or fragment from the hybridoma and/or the growth medium (e.g. cell culture medium).

[0455] The anti-SIRP.alpha. antibodies disclosed herein may also be produced recombinantly (e.g., in an E. coli/T7 expression system, a mammalian cell expression system or a lower eukaryote expression system). In this embodiment, nucleic acids encoding the antibody immunoglobulin molecules of the invention (e.g., V.sub.H or V.sub.L) may be inserted into a pET-based plasmid and expressed in the E. coli/T7 system. For example, the present invention includes methods for expressing an antibody or antigen-binding fragment thereof or immunoglobulin chain thereof in a host cell (e.g., bacterial host cell such as E. coli such as BL21 or BL21DE3) comprising expressing T7 RNA polymerase in the cell which also includes a polynucleotide encoding an immunoglobulin chain that is operably linked to a T7 promoter. For example, in an embodiment of the invention, a bacterial host cell, such as a E. coli, includes a polynucleotide encoding the T7 RNA polymerase gene operably linked to a lac promoter and expression of the polymerase and the chain is induced by incubation of the host cell with IPTG (isopropyl-beta-D-thiogalactopyrano side).

[0456] There are several methods by which to produce recombinant antibodies which are known in the art. One example of a method for recombinant production of antibodies is disclosed in U.S. Pat. No. 4,816,567.

[0457] Transformation can be by any known method for introducing polynucleotides into a host cell. Methods for introduction of heterologous polynucleotides into mammalian cells are well known in the art and include dextran-mediated transfection, calcium phosphate precipitation, polybrene-mediated transfection, protoplast fusion, electroporation, encapsulation of the polynucleotide(s) in liposomes, biolistic injection and direct microinjection of the DNA into nuclei. In addition, nucleic acid molecules may be introduced into mammalian cells by viral vectors. Methods of transforming cells are well known in the art. See, for example, U.S. Pat. Nos. 4,399,216; 4,912,040; 4,740,461 and 4,959,455.

[0458] Thus, the present invention includes recombinant methods for making an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the present invention, or an immunoglobulin chain thereof, comprising introducing a polynucleotide encoding one or more immunoglobulin chains of the antibody or fragment (e.g., heavy and/or light immunoglobulin chain); culturing the host cell (e.g., CHO or Pichia or Pichia pastoris) under condition favorable to such expression and, optionally, isolating the antibody or fragment or chain from the host cell and/or medium in which the host cell is grown.

[0459] Anti-SIRP.alpha. antibodies can also be synthesized by any of the methods set forth in U.S. Pat. No. 6,331,415.

[0460] Eukaryotic and prokaryotic host cells, including mammalian cells as hosts for expression of the antibodies or fragments or immunoglobulin chains disclosed herein are well known in the art and include many immortalized cell lines available from the American Type Culture Collection (ATCC). These include, inter alia, Chinese hamster ovary (CHO) cells, NSO, SP2 cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells (e.g., Hep G2), A549 cells, 3T3 cells, HEK-293 cells and a number of other cell lines. Mammalian host cells include human, mouse, rat, dog, monkey, pig, goat, bovine, horse and hamster cells. Cell lines of particular preference are selected through determining which cell lines have high expression levels. Other cell lines that may be used are insect cell lines, such as Sf9 cells, amphibian cells, bacterial cells, plant cells and fungal cells. Fungal cells include yeast and filamentous fungus cells including, for example, Pichia pastoris, Pichia finlandica, Pichia trehalophila, Pichia koclamae, Pichia membranaefaciens, Pichia minuta (Ogataea minuta, Pichia lindneri), Pichia opuntiae, Pichia thermotolerans, Pichia salictaria, Pichia guercuum, Pichia pijperi, Pichia stiptis, Pichia methanolica, Pichia sp., Saccharomyces cerevisiae, Saccharomyces sp., Hansenula polymorpha, Kluyveromyces sp., Kluyveromyces lactis, Candida albicans, Aspergillus nidulans, Aspergillus niger, Aspergillus oryzae, Trichoderma reesei, Chrysosporium lucknowense, Fusarium sp., Fusarium gramineum, Fusarium venenatum, Physcomitrella patens and Neurospora crassa. Pichia sp., any Saccharomyces sp., Hansenula polymorpha, any Kluyveromyces sp., Candida albicans, any Aspergillus sp., Trichoderma reesei, Chrysosporium lucknowense, any Fusarium sp., Yarrowia lipolytica, and Neurospora crassa. When recombinant expression vectors encoding the heavy chain or antigen-binding portion or fragment thereof, and/or the light chain or antigen-binding fragment thereof are introduced into mammalian host cells, the antibodies are produced by culturing the host cells for a period of time sufficient to allow for expression of the antibody or fragment or chain in the host cells or secretion into the culture medium in which the host cells are grown.

[0461] Antibodies and antigen-binding fragments thereof and immunoglobulin chains can be recovered from the culture medium using standard protein purification methods. Further, expression of antibodies and antigen-binding fragments thereof and immunoglobulin chains of the invention (or other moieties therefrom) from production cell lines can be enhanced using a number of known techniques. For example, the glutamine synthetase gene expression system (the GS system) is a common approach for enhancing expression under certain conditions. The GS system is discussed in whole or part in connection with European Patent Nos. 0216846, 0256055, and 0323997 and 0338841. Thus, in an embodiment of the invention, the mammalian host cells (e.g., CHO) lack a glutamine synthetase gene and are grown in the absence of glutamine in the medium wherein, however, the polynucleotide encoding the immunoglobulin chain comprises a glutamine synthetase gene which complements the lack of the gene in the host cell.

[0462] The present invention includes methods for purifying an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the present invention comprising introducing a sample comprising the antibody or fragment to a purification medium (e.g., cation exchange medium, anion exchange medium, hydrophobic exchange medium, affinity purification medium (e.g., protein-A, protein-G, protein-A/G, protein-L)) and either collecting purified antibody or fragment from the flow-through fraction of said sample that does not bind to the medium; or, discarding the flow-through fraction and eluting bound antibody or fragment from the medium and collecting the eluate. In an embodiment of the invention, the medium is in a column to which the sample is applied. In an embodiment of the invention, the purification method is conducted following recombinant expression of the antibody or fragment in a host cell, e.g., wherein the host cell is first lysed and, optionally, the lysate is purified of insoluble materials prior to purification on a medium.

[0463] In general, glycoproteins produced in a particular cell line or transgenic animal will have a glycosylation pattern that is characteristic for glycoproteins produced in the cell line or transgenic animal. Therefore, the particular glycosylation pattern of an antibody will depend on the particular cell line or transgenic animal used to produce the antibody. However, all antibodies encoded by the nucleic acid molecules provided herein, or comprising the amino acid sequences provided herein, comprise the instant invention, independent of the glycosylation pattern the antibodies may have. Similarly, in particular embodiments, antibodies with a glycosylation pattern comprising only non-fucosylated N-glycans may be advantageous, because these antibodies have been shown to typically exhibit more potent efficacy than their fucosylated counterparts both in vitro and in vivo (See for example, Shinkawa et al., J. Biol. Chem. 278: 3466-3473 (2003); U.S. Pat. Nos. 6,946,292 and 7,214,775). These antibodies with non-fucosylated N-glycans are not likely to be immunogenic because their carbohydrate structures are a normal component of the population that exists in human serum IgG.

[0464] The present invention includes bispecific and bifunctional antibodies and antigen-binding fragments having a binding specificity for SIRP.alpha. and another antigen such as, for example, CD19, CD20, CD22, CD24, CD25, CD30, CD33, CD38, CD44, CD52, CD56, CD70, CD96, CD97, CD99, CD117, CD123, c-Met, CEA, EGFR, EpCAM, HER2, HER3, PSMA, PTHR2, mesothelin, PD-1, PD-L1, TIM3, and methods of use thereof. A bispecific or bifunctional antibody is an artificial hybrid antibody having two different heavy/light chain pairs and two different binding sites. Bispecific antibodies can be produced by a variety of methods including fusion of hybridomas or linking of Fab' fragments. See, e.g., Songsivilai, et al., (1990) Clin. Exp. Immunol. 79: 315-321, Kostelny, et al., (1992) J Immunol. 148:1547-1553. In addition, bispecific antibodies may be formed as "diabodies" (Holliger, et al., (1993) PNAS USA 90:6444-6448) or as "Janusins" (Traunecker, et al., (1991) EMBO J. 10:3655-3659 and Traunecker, et al., (1992) Int. J. Cancer Suppl. 7:51-52). Included are "Duobodies," which are bispecific antibodies with normal IgG structures (Labrijn et al., 2013, Proc. Natl. Acad. Sci. USA 110 (13): 5145-5150).

[0465] The present invention further includes anti-SIRP.alpha. antigen-binding fragments of the anti-SIRP.alpha. antibodies disclosed herein. The antibody fragments include F(ab).sub.2 fragments, which may be produced by enzymatic cleavage of an IgG by, for example, pepsin. Fab fragments may be produced by, for example, reduction of F(ab).sub.2 with dithiothreitol or mercaptoethylamine.

[0466] Immunoglobulins may be assigned to different classes depending on the amino acid sequences of the constant domain of their heavy chains. In some embodiments, different constant domains may be appended to humanized V.sub.L and V.sub.H regions derived from the CDRs provided herein. There are at least five major classes of immunoglobulins: IgA, IgD, IgE, IgG and IgM, and several of these may be further divided into subclasses (isotypes), e.g. IgG1, IgG2, IgG3 and IgG4; IgA1 and IgA2. The invention comprises antibodies and antigen-binding fragments of any of these classes or subclasses of antibodies.

[0467] In one embodiment, the antibody or antigen-binding fragment comprises a heavy chain constant region, e.g. a human constant region, such as .gamma.1, .gamma.2, .gamma.3, or .gamma.4 human heavy chain constant region or a variant thereof. In another embodiment, the antibody or antigen-binding fragment comprises a light chain constant region, e.g. a human light chain constant region, such as lambda or kappa human light chain region or variant thereof. By way of example, and not limitation the human heavy chain constant region can be .gamma.4 and the human light chain constant region can be kappa. In an alternative embodiment, the Fc region of the antibody is .gamma.4 with a Ser228Pro mutation (Schuurman, J et. al., Mol. Immunol. 38: 1-8, 2001).

[0468] In one embodiment, the antibody or antigen-binding fragment comprises a heavy chain constant region of the IgG1 subtype. In one embodiment, the antibody or antigen-binding fragment comprises a heavy chain constant region of the IgG2 subtype. In one embodiment, the antibody or antigen-binding fragment comprises a heavy chain constant region of the IgG4 subtype.

[0469] Antibody Engineering

[0470] Further included are embodiments in which the anti-SIRP.alpha. antibodies and antigen-binding fragments thereof are engineered antibodies to include modifications to framework residues within the variable domains the antibody, e.g. to improve the properties of the antibody or fragment. Typically, such framework modifications are made to decrease the immunogenicity of the antibody or fragment. This is usually accomplished by replacing non-CDR residues in the variable domains (i.e. framework residues) in a parental (e.g. rodent) antibody or fragment with analogous residues from the immune repertoire of the species in which the antibody is to be used, e.g. human residues in the case of human therapeutics. Such an antibody or fragment is referred to as a "humanized" antibody or fragment. In some cases, it is desirable to increase the affinity, or alter the specificity of an engineered (e.g. humanized) antibody. One approach is to mutate one or more framework residues to the corresponding germline sequence. More specifically, an antibody or fragment that has undergone somatic mutation can contain framework residues that differ from the germline sequence from which the antibody is derived. Such residues can be identified by comparing the antibody or fragment framework sequences to the germline sequences from which the antibody or fragment is derived. Another approach is to revert to the original parental (e.g., rodent) residue at one or more positions of the engineered (e.g. humanized) antibody, e.g. to restore binding affinity that may have been lost in the process of replacing the framework residues. (See, e.g., U.S. Pat. Nos. 5,693,762, 5,585,089 and 5,530,101).

[0471] In certain embodiments, the anti-SIRP.alpha. antibodies and antigen-binding fragments thereof are engineered (e.g. humanized) to include modifications in the framework and/or CDRs to improve their properties. Such engineered changes can be based on molecular modelling. A molecular model for the variable region for the parental (non-human) antibody sequence can be constructed to understand the structural features of the antibody and used to identify potential regions on the antibody that can interact with the antigen. Conventional CDRs are based on alignment of immunoglobulin sequences and identifying variable regions. Kabat et al., (1991) Sequences of Proteins of Immunological Interest, Kabat, et al.; National Institutes of Health, Bethesda, Md.; 5.sup.th ed.; NIH Publ. No. 91-3242; Kabat (1978) Adv. Prot. Chem. 32:1-75; Kabat, et al., (1977) J. Biol. Chem. 252:6609-6616. Chothia and coworkers carefully examined conformations of the loops in crystal structures of antibodies and proposed hypervariable loops. Chothia, et al., (1987) J Mol. Biol. 196:901-917 or Chothia, et al., (1989) Nature 342:878-883. There are variations between regions classified as "CDRs" and "hypervariable loops". Later studies (Raghunathan et al, (2012) J. Mol Recog. 25, 3, 103-113) analyzed several antibody-antigen crystal complexes and observed that the antigen binding regions in antibodies do not necessarily conform strictly to the "CDR" residues or "hypervariable" loops. The molecular model for the variable region of the non-human antibody can be used to guide the selection of regions that can potentially bind to the antigen. In practice the potential antigen binding regions based on the model differ from the conventional "CDR"s or "hypervariable" loops. Commercial scientific software such as Discovery Studio (BIOVIA, Dassault Systems)) can be used for molecular modeling. Human frameworks can be selected based on best matches with the non-human sequence both in the frameworks and in the CDRs. For FR4 (framework 4) in VH, VJ regions for the human germlines are compared with the corresponding non-human region. In the case of FR4 (framework 4) in VL, J-kappa and J-Lambda regions of human germline sequences are compared with the corresponding non-human region. Once suitable human frameworks are identified, the CDRs are grafted into the selected human frameworks. In some cases, certain residues in the VL-VH interface can be retained as in the non-human (parental) sequence. Molecular models can also be used for identifying residues that can potentially alter the CDR conformations and hence binding to antigen. In some cases, these residues are retained as in the non-human (parental) sequence. Molecular models can also be used to identify solvent exposed amino acids that can result in unwanted effects such as glycosylation, deamidation and oxidation. Developability filters can be introduced early on in the design stage to eliminate/minimize these potential problems.

[0472] Another type of framework modification involves mutating one or more residues within the framework region, or even within one or more CDR regions, to remove T cell epitopes to thereby reduce the potential immunogenicity of the antibody. This approach is also referred to as "deimmunization" and is described in further detail in U.S. Pat. No. 7,125,689.

[0473] In particular embodiments, it will be desirable to change certain amino acids containing exposed side-chains to another amino acid residue in order to provide for greater chemical stability of the final antibody, so as to avoid deamidation or isomerization. The deamidation of asparagine may occur on NG, DG, NG, NS, NA, NT, QG or QS sequences and result in the creation of an isoaspartic acid residue that introduces a kink into the polypeptide chain and decreases its stability (isoaspartic acid effect). Isomerization can occur at DG, DS, DA or DT sequences. In certain embodiments, the antibodies of the present disclosure do not contain deamidation or asparagine isomerism sites.

[0474] For example, an asparagine (Asn) residue may be changed to Gln or Ala to reduce the potential for formation of isoaspartate at any Asn-Gly sequences, particularly within a CDR. A similar problem may occur at a Asp-Gly sequence. Reissner and Aswad (2003) Cell. Mol. Life Sci. 60:1281. Isoaspartate formation may debilitate or completely abrogate binding of an antibody to its target antigen. See, Presta (2005) J. Allergy Clin. Immunol. 116:731 at 734. In one embodiment, the asparagine is changed to glutamine (Gln). It may also be desirable to alter an amino acid adjacent to an asparagine (Asn) or glutamine (Gln) residue to reduce the likelihood of deamidation, which occurs at greater rates when small amino acids occur adjacent to asparagine or glutamine. See, Bischoff & Kolbe (1994) J. Chromatog. 662:261. In addition, any methionine residues (typically solvent exposed Met) in CDRs may be changed to Lys, Leu, Ala, or Phe or other amino acids in order to reduce the possibility that the methionine sulfur would oxidize, which could reduce antigen-binding affinity and also contribute to molecular heterogeneity in the final antibody preparation. Id. Additionally, in order to prevent or minimize potential scissile Asn-Pro peptide bonds, it may be desirable to alter any Asn-Pro combinations found in a CDR to Gln-Pro, Ala-Pro, or Asn-Ala. Antibodies with such substitutions are subsequently screened to ensure that the substitutions do not decrease the affinity or specificity of the antibody for SIRP.alpha., or other desired biological activity to unacceptable levels.

TABLE-US-00002 TABLE 2 Exemplary stabilizing CDR variants CDR Residue Stabilizing Variant Sequence Asn-Gly Gln-Gly, Ala-Gly, or Asn-Ala (N-G) (Q-G), (A-G), or (N-A) Asp-Gly Glu-Gly, Ala-Gly or Asp-Ala (D-G) (E-G), (A-G), or (D-A) Met Lys, Leu, Ala, or Phe (M) (K), (L), (A), or (F) Asn Gln or Ala (N) (Q) or (A) Asn-Pro Gin-Pro, Ala-Pro, or Asn-Ala (N-P) (Q-P), (A-P), or (N-A)

[0475] Another type of framework modification involves mutating one or more residues within the framework regions to prevent aggregation. The risk of an antibody to aggregate can be assessed using the spatial aggregation propensity--See, Chennamsetty, N et al (2010) J. Phys. Chem. 114, 6614-6624. The method requires the calculation of the Solvent Accessible Area (SAA) for each atom. The molecular aggregation score is then calculated as the sum of all atomic scores. For a given radius and size of molecule, this is an approximate indication of its overall tendency to aggregate. Residues with a high aggregation score are replaced by residues with a lower score (e.g. more hydrophilic amino acids).

Antibody Engineering of the Fc Region

[0476] The antibodies (e.g., humanized antibodies) and antigen-binding fragments thereof disclosed herein can also be engineered to include modifications within the Fc region, typically to alter one or more properties of the antibody, such as serum half-life, complement fixation, Fc receptor binding, and/or effector function (e.g., antigen-dependent cellular cytotoxicity). Furthermore, the antibodies and antigen-binding fragments thereof disclosed herein can be chemically modified (e.g., one or more chemical moieties can be attached to the antibody) or be modified to alter its glycosylation, again to alter one or more properties of the antibody or fragment. Each of these embodiments is described in further detail below. The numbering of residues in the Fc region is that of the EU index of Kabat.

[0477] The antibodies and antigen-binding fragments thereof disclosed herein also include antibodies and fragments with modified (or blocked) Fc regions to provide altered effector functions. See, e.g., U.S. Pat. No. 5,624,821; WO2003/086310; WO2005/120571; WO2006/0057702. Such modifications can be used to enhance or suppress various reactions of the immune system, with possible beneficial effects in diagnosis and therapy. Alterations of the Fc region include amino acid changes (substitutions, deletions and insertions), glycosylation or deglycosylation, and adding multiple Fc regions. Changes to the Fc can also alter the half-life of antibodies in therapeutic antibodies, enabling less frequent dosing and thus increased convenience and decreased use of material. See Presta (2005) J. Allergy Clin. Immunol. 116:731 at 734-35.

[0478] In one embodiment, the antibody or antigen-binding fragment of the invention is an IgG4 isotype antibody or fragment comprising a Serine to Proline mutation at a position corresponding to position 228 (S228P; EU index; SEQ ID NO: 66) in the hinge region of the heavy chain constant region. This mutation has been reported to abolish the heterogeneity of inter-heavy chain disulfide bridges in the hinge region (Angal et al (1993). Mol. Immunol. 30:105-108; position 241 is based on the Kabat numbering system).

[0479] In one embodiment of the invention, the hinge region of CH1 is modified such that the number of cysteine residues in the hinge region is increased or decreased. This approach is described further in U.S. Pat. No. 5,677,425. The number of cysteine residues in the hinge region of CH1 is altered, for example, to facilitate assembly of the light and heavy chains or to increase or decrease the stability of the antibody.

[0480] In another embodiment, the Fc hinge region of an antibody or antigen-binding fragment of the invention is mutated to decrease the biological half-life of the antibody or fragment. More specifically, one or more amino acid mutations are introduced into the CH2-CH3 domain interface region of the Fc-hinge fragment such that the antibody or fragment has impaired Staphylococcyl protein A (SpA) binding relative to native Fc-hinge domain SpA binding. This approach is described in further detail in U.S. Pat. No. 6,165,745.

[0481] In another embodiment, the antibody or antigen-binding fragment of the invention is modified to increase its biological half-life. Various approaches are possible. For example, one or more of the following mutations can be introduced: T252L, T254S, T256F, as described in U.S. Pat. No. 6,277,375. Alternatively, to increase the biological half-life, the antibody can be altered within the CH1 or CL region to contain a salvage receptor binding epitope taken from two loops of a CH2 domain of an Fc region of an IgG, as described in U.S. Pat. Nos. 5,869,046 and 6,121,022.

[0482] In yet other embodiments, the Fc region is altered by replacing at least one amino acid residue with a different amino acid residue to alter the effector function(s) of the antibody or antigen-binding fragment. For example, one or more amino acids selected from amino acid residues 234, 235, 236, 237, 297, 318, 320 and 322 can be replaced with a different amino acid residue such that the antibody has an altered affinity for an effector ligand and retains the antigen-binding ability of the parent antibody. The effector ligand to which affinity is altered can be, for example, an Fc receptor or the C1 component of complement. This approach is described in further detail in U.S. Pat. Nos. 5,624,821 and 5,648,260.

[0483] In another example, one or more amino acids selected from amino acid residues 329, 331 and 322 can be replaced with a different amino acid residue such that the antibody has altered C1q binding and/or reduced or abolished complement dependent cytotoxicity (CDC). This approach is described in further detail in U.S. Pat. No. 6,194,551.

[0484] In another example, one or more amino acid residues within amino acid positions 231 and 239 are altered to thereby alter the ability of the antibody to fix complement. This approach is described further in PCT Publication WO 94/29351.

[0485] The proteins of the invention, which are preferably antibodies and most preferably IgG antibodies or fragments thereof, may have altered (e.g., relative to an unmodified antibody) Fc.gamma.R binding properties (examples of binding properties include but are not limited to, binding specificity, equilibrium dissociation constant (K.sub.D), dissociation and association rates (k.sub.off and k.sub.on respectively), binding affinity and/or avidity) and that certain alterations are more or less desirable. It is known in the art that the equilibrium dissociation constant (K.sub.D) is defined as k.sub.off/k.sub.on, and K.sub.a is the reciprocal of K.sub.D.

[0486] The affinities and binding properties of an Fc region for its ligand, may be determined by a variety of in vitro assay methods (biochemical or immunological based assays) known in the art for determining Fc-Fc.gamma.R interactions, i.e., specific binding of an Fc region to an Fc.gamma.R including but not limited to, equilibrium methods (e.g., enzyme-linked immuno absorbent assay (ELISA) or radioimmunoassay (RIA)), or kinetics (e.g. BIACORE.RTM., Octet.RTM., or KinExa.RTM. analysis), and other methods such as indirect binding assays, competitive inhibition assays, fluorescence resonance energy transfer (FRET), gel electrophoresis and chromatography (e.g., gel filtration). These and other methods may utilize a label on one or more of the components being examined and/or employ a variety of detection methods including but not limited to chromogenic, fluorescent, luminescent, or isotopic labels.

[0487] In certain embodiments, the proteins of the present invention bind to one or more human Fc.gamma.Rs selected from the group consisting of Fc.gamma.RI, Fc.gamma.RIIB, Fc.gamma.RIIC, Fc.gamma.RIIIA-F158, and Fc.gamma.RIIIA-V158 with an affinity at least 10-fold, preferably at least 30-fold, and more preferably at least 100-fold, less than equivalent protein having a wild-type human IgG1 heavy chain constant domain (SEQ ID NO: 119) Fc region or a wild-type human IgG4 heavy chain constant domain (SEQ ID NO: 66) Fc region.

[0488] In various embodiments, the proteins of the invention comprise an immunoglobulin Fc region comprising an immunoglobulin C2 region and an immunoglobulin C3 region and an immunoglobulin hinge region. By way of example, the immunoglobulin Fc region may be an IgG Fc region, an IgE Fc region, or an IgA Fc region. In certain preferred embodiments, the protein comprises two immunoglobulin Fc regions, each immunoglobulin Fc region comprising an immunoglobulin C2 region and an immunoglobulin C3 region and an immunoglobulin hinge region, wherein the hinge region of one of the immunoglobulin Fc regions is bound to the hinge region of the other immunoglobulin Fc region to form a dimeric Fc structure. Most preferably, such a protein is a human or humanized IgG protein.

[0489] In certain embodiments, the proteins of the invention comprise a mutated IgG4 Fc region, and preferably the protein is an IgG comprising two mutated IgG4 Fc regions to form a dimeric Fc structure. By way of example, a mutated IgG4 Fc region may comprise one of the mutations, or mutational combinations, recited in Table 3. The numbering system of the constant region referred to in this table is that of the EU index as set forth in Kabat et al. (1991, NIH Publication 91-3242, National Technical Information Service, Springfield, Va.). In the table, the first letter and number represent the unmodified amino acid and its position and the second letter represents the substituted amino acid at said position. For those entries that include combinations of more than one mutation, each mutation in the combination is separated by a "/".

TABLE-US-00003 TABLE 3 N297Q L235E N297Q/L235E F234A Q268A F234A/L235A/G237A/ P238A F234A/L235A/.DELTA.G236/ F234A/L235A/G237A/ F234A/L235A/.DELTA.G236/ G237A/P238A P238A/Q268A G237A/P238A/Q268A F234A/L235A L235E/P329G L235A/G237A/E318A F234A/L235A/G237A/ F234A/L235A/.DELTA.G236/ F234A/L235A/G237A/ P238S G237A/P238S P238S/Q268A F234A/L235A/.DELTA.G236/ G237A/P238S/Q268A

[0490] In certain embodiments, the proteins of the invention comprise a mutated IgG1 Fc region, and preferably the protein is an IgG comprising two mutated IgG1 Fc regions to form a dimeric Fc structure. By way of example, a mutated IgG1 Fc region may comprise one of the mutations recited in Table 4. The numbering system of the constant region referred to in this table is that of the EU index as set forth in Kabat et al. (1991, NIH Publication 91-3242, National Technical Information Service, Springfield, Va.). In the table, the first letter and number represent the unmodified amino acid and its position and the second letter represents the substituted amino acid at said position.

TABLE-US-00004 TABLE 4 K222Y P232K A231K E233N E233Q E233R E233S E233T E233H E233A E233V E233L E233F E233M E233Y E233W E233G L234D L234E L234N L234Q L234T L234H L234F L234K L234R L234S L234A L234M L234V L235E L235T L235F L235K L235R L235A L235M L235W L235N L235Q L235H L235V G236A G236N G236R G236H G236L G236F G236P G237A G237E G237N G237Q G237K G237R G237S G237T G237H G237L G237I G237F G237M G237Y G237P P238K P238N P238R P238S P238T P238Y P238G P238A S239A S239N S239F S239K S239R S239V S239W S239P S239H S239Y D249H V240A F241W F241L F243W F243L F243E P244H P245A P247V P247G V253I V263I V263T V263M V264D V264E V264K V264F V264M V264H V264W V264G V264Q V264A V264L D265A D265E D265Q D265S D265H D265V D265L D265F D265M D265Y D265N D265G V266T V266M V266A S267G S267H S267N S267P S267R S267T S267F S267W E269A E269K E269S E269V E269F E269I E269M E269W E269H E269T E269L E269N E269Y E269R E269P E269G D270A D270N D270E D270Q D270T D270H D270R D270S D270L D270I D270F D270W D270P D270G P271H P271Q P271K P271R P271S P271V P271F P271W D280L D280W D280P E293F E294A E293Y E294K E294R E294S E294V E294L E294F Q295A Q295W Q295P Q295G Y296E Y296Q Y296D Y296N Y296S Y296T Y296L Y296I Y296A Y296V Y296M N297S N297D N297Q N297A S298T S298N S298K S298R T299A T299H T299D T299E T299N T299Q T299K T299R T299I T299F T299M T299Y T299W T299S T299V T299P T299G Y300E Y300K Y300R Y300S Y300P Y300W V303A V303D W313F E318A E318V E318Q E318H E318L E318Y K320A K322A K322E N325A N325V N325H N325K N325Y N325W N325P N325G N325Q N325D N325E N325L N325I A327Q A327E A327N A327L A327I A327F A327W L328N L328F L328H L328R L328T L328V L328I L328P L328M L328E L328A P329A P329F P329D P329N P329Q P329K P329S P329T P329H P329V P329L P329M P329Y P329W P329G P329R A330L A330R A330P A330T A330V A330F A330H P331A P331S P331N P331E I332K I332N I332Q I332T I332H I332Y I332A I332R E333N E333R I336E I336Y S337H

[0491] In certain embodiments, a mutated IgG1 Fc region may comprise one of the mutational combinations recited in Table 5. The numbering system of the constant region referred to in this table is that of the EU index as set forth in Kabat et al. (1991, NIH Publication 91-3242, National Technical Information Service, Springfield, Va.). In the table, the first letter and number represent the unmodified amino acid and its position and the second letter represents the substituted amino acid at said position. For each of the combinations of more than one mutation, each mutation in the combination is separated by a "I" and deletions are indicated by a

TABLE-US-00005 TABLE 5 C220S/C226S/C229S/P238S C226S/C229S/E233P/L234V/ E233P/L234V/L235A L235A E233P/L234V/L235A/.DELTA.G236 E233P/L234V/L235A/.DELTA.G236/ L234A/L235A A327G/A330S/P331S L235A/G237A L235A/G237A/E318S/K320S/ L235A/G237A/P331A K322S L234F/L235E L234F/L235E/D265A L234F/L235E/D265A/ N297Q/P331S L234F/L235E/N297Q L234F/L235E/P329G L234F/L235A/K322Q/ M252Y/S254T/T256E L234F/L235Q/K322Q/M252Y/ L234F/L235Q/P331G/M252Y/ G236R/L328R S254T/T256E S254T/T256E S239D/D265I/N297D/I332E S239D/D265L/N297D/I332E S239D/D265F/N297D/I332E S239D/D265Y/N297D/I332E S239D/D265T/N297D/I332E S239D/N297D/A330Y/I332E S239D/F241S/F243H/V262T/ V264E/N297D/I332E D265A/P331S V264T/N297D/K326E/I332E D265A/N297Q N297D/D265Y/T299L/I332E N297D/D265Y/I332E N297D/I332E/Y296D N297D/I332E N297D/I332E/Y296E N297D/I332E/Y296N N297D/I332E/Y296Q N297D/I332E/Y296H N297D/I332E/Y296T N297D/I332E/T299V N297D/I332E/T299I N297D/I332E/T299L N297D/I332E/T299F N297D/I332E/T299H N297D/I332E/T299E N297D/I332E/A330Y N297D/I332E/S298A/A330Y N297E/D265F/I332E N297E/I332E F241E/F243R/V262E/V264R F241E/F243Q/V262T/V264E F241L/F243L/V262I/V264I F241W/F243W F241W/F243W/V262A/V264A F241L/V262I F243L/V262I/V264W F241Y/F243Y/V262T/V264T F241E/F243R/V262E/V264R F241E/F243Q/V262T/V264E F241R/F243Q/V262T/V264R F241E/F243Y/V262T/V264R P244H/P245A/P247V F241E/F243R/V262E/V264R/ F241E/F243Y/V262T/V264R F241E/F243Y/V262T/V264R/ I332E I332E S239E/D265G S239E/D265N S239E/D265Q M252Y/S254T/T256E S267Q/A327S S267L/A327S N297S/I332E S239N/I332N S239N/I332Q S239Q/I332N S239Q/I332Q S298N/Y300S S298N/T299A/Y300S N297Q/S298N/Y300S E318S/K320S/K322S E318S/K320S/K322S/P311A L328E/I332E L328N/I332E L234A/L235A/G237A/P238A/ L234A/L235A/G237A/P238S/ L234A/L235A/G237A/P238A/ H268A/A330S/P331S H268A/A330S/P331S H268A/A330S/P331S L328Q/I332E L328H/I332E

[0492] In certain embodiments, the proteins of the invention comprise a wild type or mutated IgG2 Fc region, and preferably the protein is an IgG comprising two wild type or mutated IgG2 Fc regions to form a dimeric Fc structure. A mutated IgG2 Fc region may comprise one of the mutations, or mutational combinations, recited in Table 6. The numbering system of the constant region referred to in this table is that of the EU index as set forth in Kabat et al. (1991, NIH Publication 91-3242, National Technical Information Service, Springfield, Va.). In the table, the first letter and number represent the unmodified amino acid and its position and the second letter represents the substituted amino acid at said position. For those entries that include combinations of more than one mutation, each mutation in the combination is separated by a "I".

TABLE-US-00006 TABLE 6 V234A G237A A235E/G237A V234A/A235E/G237A V234A/G237A V234A/G237A/P238S H268Q/V309L/A330S/P331S V234A/G237A/H268A/V309L/ V234A/G237A/H268Q/V309L/ A330S/P331S A330S/P331S V234A/G237A/P238S/H268A/ P233S/V234A/G237A/P238S P233S/V234A/G237A/H268A/ V309L/A330S/P331S V309L/A330S/P331S P233S/V234A/G237A/H268Q/ P233S/V234A/G237A/P238S/ V309L/A330S/P331S H268A/V309L/A330S/P331S

Production of Antibodies with Modified Glycosylation

[0493] In still another embodiment, the antibodies or antigen-binding fragments of the invention comprise a particular glycosylation pattern. For example, an afucosylated or an aglycosylated antibody or fragment can be made (i.e., the antibody lacks fucose or glycosylation, respectively). The glycosylation pattern of an antibody or fragment may be altered to, for example, increase the affinity or avidity of the antibody or fragment for a SIRP.alpha. antigen. Such modifications can be accomplished by, for example, altering one or more of the glycosylation sites within the antibody or fragment sequence. For example, one or more amino acid substitutions can be made that result in removal of one or more of the variable region framework glycosylation sites to thereby eliminate glycosylation at that site. Such deglycosylation may increase the affinity or avidity of the antibody or fragment for antigen. See, e.g., U.S. Pat. Nos. 5,714,350 and 6,350,861.

[0494] Antibodies and antigen-binding fragments disclosed herein may further include those produced in lower eukaryote host cells, in particular fungal host cells such as yeast and filamentous fungi have been genetically engineered to produce glycoproteins that have mammalian- or human-like glycosylation patterns (See for example, Choi et al, (2003) Proc. Natl. Acad. Sci. 100: 5022-5027; Hamilton et al., (2003) Science 301: 1244-1246; Hamilton et al., (2006) Science 313: 1441-1443; Nett et al., Yeast 28(3):237-52 (2011); Hamilton et al., Curr Opin Biotechnol. 18(5): 387-92 (2007)). A particular advantage of these genetically modified host cells over currently used mammalian cell lines is the ability to control the glycosylation profile of glycoproteins that are produced in the cells such that compositions of glycoproteins can be produced wherein a particular N-glycan structure predominates (see, e.g., U.S. Pat. Nos. 7,029,872 and 7,449,308). These genetically modified host cells have been used to produce antibodies that have predominantly particular N-glycan structures (See for example, Li et al., (2006) Nat. Biotechnol. 24: 210-215).

[0495] In particular embodiments, the antibodies and antigen-binding fragments thereof disclosed herein further include those produced in lower eukaryotic host cells and which comprise fucosylated and non-fucosylated hybrid and complex N-glycans, including bisected and multiantennary species, including but not limited to N-glycans such as GlcNAc.sub.(1-4)Man.sub.3GlcNAc.sub.2; Gal.sub.(1-4)GlcNAc.sub.(1-4)Man.sub.3GlcNAc.sub.2; NANA.sub.(1-4)Gal.sub.(1-4)GlcNAc.sub.(1-4)Man.sub.3GlcNAc.sub.2.

[0496] In particular embodiments, the antibodies and antigen-binding fragments thereof provided herein may comprise antibodies or fragments having at least one hybrid N-glycan selected from the group consisting of GlcNAcMan.sub.5GlcNAc.sub.2; GalGlcNAcMan.sub.5GlcNAc.sub.2; and NANAGalGlcNAcMan.sub.5GlcNAc.sub.2. In particular aspects, the hybrid N-glycan is the predominant N-glycan species in the composition.

[0497] In particular embodiments, the antibodies and antigen-binding fragments thereof provided herein comprise antibodies and fragments having at least one complex N-glycan selected from the group consisting of GlcNAcMan.sub.3GlcNAc.sub.2; GalGlcNAcMan.sub.3GlcNAc.sub.2; NANAGalGlcNAcMan.sub.3GlcNAc.sub.2; GlcNAc.sub.2Man.sub.3GlcNAc.sub.2; GalGlcNAc.sub.2Man.sub.3GlcNAc.sub.2; Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2; NANAGal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2; and NANA.sub.2Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2. In particular aspects, the complex N-glycan are the predominant N-glycan species in the composition. In further aspects, the complex N-glycan is a particular N-glycan species that comprises about 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97%, 98%, 99%, or 100% of the complex N-glycans in the composition. In one embodiment, the antibody and antigen binding fragments thereof provided herein comprise complex N-glycans, wherein at least 50%, 60%, 70%, 80%, 90%, 95%, 97%, 98%, 99%, or 100% of the complex N-glycans comprise the structure NANA.sub.2Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2, wherein such structure is afucosylated. Such structures can be produced, e.g., in engineered Pichia pastoris host cells.

[0498] In particular embodiments, the N-glycan is fucosylated. In general, the fucose is in an .alpha.1,3-linkage with the GlcNAc at the reducing end of the N-glycan, an .alpha.1,6-linkage with the GlcNAc at the reducing end of the N-glycan, an .alpha.1,2-linkage with the Gal at the non-reducing end of the N-glycan, an .alpha.1,3-linkage with the GlcNac at the non-reducing end of the N-glycan, or an .alpha.1,4-linkage with a GlcNAc at the non-reducing end of the N-glycan.

[0499] Therefore, in particular aspects of the above the glycoprotein compositions, the glycoform is in an .alpha.1,3-linkage or .alpha.1,6-linkage fucose to produce a glycoform selected from the group consisting of Man.sub.5GlcNAc.sub.2(Fuc), GlcNAcMan.sub.5GlcNAc.sub.2(Fuc), Man.sub.3GlcNAc.sub.2(Fuc), GlcNAcMan.sub.3GlcNAc.sub.2(Fuc), GlcNAc.sub.2Man.sub.3GlcNAc.sub.2(Fuc), GalGlcNAc.sub.2Man.sub.3GlcNAc.sub.2(Fuc), Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2(Fuc), NANAGal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2(Fuc), and NANA.sub.2Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2(Fuc); in an .alpha..sub.1,3-linkage or .alpha..sub.1,4-linkage fucose to produce a glycoform selected from the group consisting of GlcNAc(Fuc)Man.sub.5GlcNAc.sub.2, GlcNAc(Fuc)Man.sub.3GlcNAc.sub.2, GlcNAc.sub.2(Fuc.sub.1-2)Man.sub.3GlcNAc.sub.2, GalGlcNAc.sub.2(Fuc.sub.1-2)Man.sub.3GlcNAc.sub.2, Gal.sub.2GlcNAc.sub.2(Fuc.sub.1-2)Man.sub.3GlcNAc.sub.2, NANAGal.sub.2GlcNAc.sub.2(Fuc.sub.1-2)Man.sub.3GlcNAc.sub.2, and NANA.sub.2Gal.sub.2GlcNAc.sub.2(Fuc.sub.1-2)Man.sub.3GlcNAc.sub.2; or in an .alpha..sub.1,2-linkage fucose to produce a glycoform selected from the group consisting of Gal(Fuc)GlcNAc.sub.2Man.sub.3GlcNAc.sub.2, Gal.sub.2(Fuc.sub.1-2)GlcNAc.sub.2Man.sub.3GlcNAc.sub.2, NANAGal.sub.2(Fuc.sub.1-2)GlcNAc.sub.2Man.sub.3GlcNAc.sub.2, and NANA.sub.2Gal.sub.2(Fuc.sub.1-2)GlcNAc.sub.2Man.sub.3GlcNAc.sub.2.

[0500] In further aspects, the antibodies (e.g., humanized antibodies) or antigen-binding fragments thereof comprise high mannose N-glycans, including but not limited to, Man.sub.8GlcNAc.sub.2, Man.sub.7GlcNAc.sub.2, Man.sub.6GlcNAc.sub.2, Man.sub.5GlcNAc.sub.2, Man.sub.4GlcNAc.sub.2, or N-glycans that consist of the Man.sub.3GlcNAc.sub.2 N-glycan structure.

[0501] In further aspects of the above, the complex N-glycans further include fucosylated and non-fucosylated bisected and multiantennary species.

[0502] As used herein, the terms "N-glycan" and "glycoform" are used interchangeably and refer to an N-linked oligosaccharide, for example, one that is attached by an asparagine-N-acetylglucosamine linkage to an asparagine residue of a polypeptide. N-linked glycoproteins contain an N-acetylglucosamine residue linked to the amide nitrogen of an asparagine residue in the protein. The predominant sugars found on glycoproteins are glucose, galactose, mannose, fucose, N-acetylgalactosamine (GalNAc), N-acetylglucosamine (GlcNAc) and sialic acid (e.g., N-acetyl-neuraminic acid (NANA)). The processing of the sugar groups occurs co-translationally in the lumen of the ER and continues post-translationally in the Golgi apparatus for N-linked glycoproteins.

[0503] N-glycans have a common pentasaccharide core of Man.sub.3GlcNAc.sub.2 ("Man" refers to mannose; "Glc" refers to glucose; and "NAc" refers to N-acetyl; GlcNAc refers to N-acetylglucosamine). Usually, N-glycan structures are presented with the non-reducing end to the left and the reducing end to the right. The reducing end of the N-glycan is the end that is attached to the Asn residue comprising the glycosylation site on the protein. N-glycans differ with respect to the number of branches (antennae) comprising peripheral sugars (e.g., GlcNAc, galactose, fucose and sialic acid) that are added to the Man.sub.3GlcNAc.sub.2 ("Man3") core structure which is also referred to as the "trimannose core", the "pentasaccharide core" or the "paucimannose core". N-glycans are classified according to their branched constituents (e.g., high mannose, complex or hybrid). A "high mannose" type N-glycan has five or more mannose residues. A "complex" type N-glycan typically has at least one GlcNAc attached to the 1,3 mannose arm and at least one GlcNAc attached to the 1,6 mannose arm of a "trimannose" core. Complex N-glycans may also have galactose ("Gal") or N-acetylgalactosamine ("GalNAc") residues that are optionally modified with sialic acid or derivatives (e.g., "NANA" or "NeuAc", where "Neu" refers to neuraminic acid and "Ac" refers to acetyl). Complex N-glycans may also have intrachain substitutions comprising "bisecting" GlcNAc and core fucose ("Fuc"). Complex N-glycans may also have multiple antennae on the "trimannose core," often referred to as "multiple antennary glycans." A "hybrid" N-glycan has at least one GlcNAc on the terminal of the 1,3 mannose arm of the trimannose core and zero or more mannoses on the 1,6 mannose arm of the trimannose core. The various N-glycans are also referred to as "glycoforms."

[0504] With respect to complex N-glycans, the terms "G-2", "G-1", "GO", "G1", "G2", "A1", and "A2" mean the following. "G-2" refers to an N-glycan structure that can be characterized as Man.sub.3GlcNAc.sub.2; the term "G-1" refers to an N-glycan structure that can be characterized as GlcNAcMan.sub.3GlcNAc.sub.2; the term "GO" refers to an N-glycan structure that can be characterized as GlcNAc.sub.2Man.sub.3GlcNAc.sub.2; the term "G1" refers to an N-glycan structure that can be characterized as GalGlcNAc.sub.2Man.sub.3GlcNAc.sub.2; the term "G2" refers to an N-glycan structure that can be characterized as Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2; the term "A1" refers to an N-glycan structure that can be characterized as NANAGal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2; and, the term "A2" refers to an N-glycan structure that can be characterized as NANA.sub.2Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2. Unless otherwise indicated, the terms G-2'', "G-1", "GO", "G1", "G2", "A1", and "A2" refer to N-glycan species that lack fucose attached to the GlcNAc residue at the reducing end of the N-glycan. When the term includes an "F", the "F" indicates that the N-glycan species contains a fucose residue on the GlcNAc residue at the reducing end of the N-glycan. For example, G0F, G1F, G2F, A1F, and A2F all indicate that the N-glycan further includes a fucose residue attached to the GlcNAc residue at the reducing end of the N-glycan. Lower eukaryotes such as yeast and filamentous fungi do not normally produce N-glycans that produce fucose.

[0505] With respect to multiantennary N-glycans, the term "multiantennary N-glycan" refers to N-glycans that further comprise a GlcNAc residue on the mannose residue comprising the non-reducing end of the 1,6 arm or the 1,3 arm of the N-glycan or a GlcNAc residue on each of the mannose residues comprising the non-reducing end of the 1,6 arm and the 1,3 arm of the N-glycan. Thus, multiantennary N-glycans can be characterized by the formulas GlcNAc.sub.(2-4)Man.sub.3GlcNAc.sub.2, Gal.sub.(1-4)GlcNAc.sub.(2-4)Man.sub.3GlcNAc.sub.2, or NANA.sub.(1-4)Gal.sub.(1-4)GlcNAc.sub.(2-4)Man.sub.3GlcNAc.sub.2. The term "1-4" refers to 1, 2, 3, or 4 residues.

[0506] With respect to bisected N-glycans, the term "bisected N-glycan" refers to N-glycans in which a GlcNAc residue is linked to the mannose residue at the reducing end of the N-glycan. A bisected N-glycan can be characterized by the formula GlcNAc.sub.3Man.sub.3GlcNAc.sub.2 wherein each mannose residue is linked at its non-reducing end to a GlcNAc residue. In contrast, when a multiantennary N-glycan is characterized as GlcNAc.sub.3Man.sub.3GlcNAc.sub.2, the formula indicates that two GlcNAc residues are linked to the mannose residue at the non-reducing end of one of the two arms of the N-glycans and one GlcNAc residue is linked to the mannose residue at the non-reducing end of the other arm of the N-glycan.

[0507] In certain embodiments, the proteins of the invention comprise an aglycosylated Fc region. By way of example, an IgG1 Fc region may be aglycosylayed by deleting or substituting residue N297.

Antibody Physical Properties

[0508] The antibodies and antigen-binding fragments thereof disclosed herein may further contain one or more glycosylation sites in either the light or heavy chain immunoglobulin variable region. Such glycosylation sites may result in increased immunogenicity of the antibody or fragment or an alteration of the pK of the antibody due to altered antigen-binding (Marshall et al. (1972) Annu Rev Biochem 41:673-702; Gala and Morrison (2004) J Immunol 172:5489-94; Wallick et al (1988) J Exp Med 168:1099-109; Spiro (2002) Glycobiology 12:43R-56R; Parekh et al (1985) Nature 316:452-7; Mimura et al. (2000) Mol Immunol 37:697-706). Glycosylation has been known to occur at motifs containing an N-X-S/T sequence.

[0509] Each antibody or antigen-binding fragment will have a unique isoelectric point (pI), which generally falls in the pH range between 6 and 9.5. The pI for an IgG1 antibody typically falls within the pH range of 7-9.5 and the pI for an IgG4 antibody typically falls within the pH range of 6-8.

[0510] Each antibody or antigen-binding fragment will have a characteristic melting temperature, with a higher melting temperature indicating greater overall stability in vivo (Krishnamurthy R and Manning M C (2002) Curr Pharm Biotechnol 3:361-71). In general, the T.sub.M1 (the temperature of initial unfolding) may be greater than 60.degree. C., greater than 65.degree. C., or greater than 70.degree. C. The melting point of an antibody or fragment can be measured using differential scanning calorimetry (Chen et al (2003) Pharm Res 20:1952-60; Ghirlando et al (1999) Immunol Lett 68:47-52) or circular dichroism (Murray et al. (2002) J. Chromatogr Sci 40:343-9).

[0511] In a further embodiment, antibodies and antigen-binding fragments thereof are selected that do not degrade rapidly. Degradation of an antibody or fragment can be measured using capillary electrophoresis (CE) and MALDI-MS (Alexander A J and Hughes D E (1995) Anal Chem 67:3626-32).

[0512] In a further embodiment, antibodies and antigen-binding fragments thereof are selected that have minimal aggregation effects, which can lead to the triggering of an unwanted immune response and/or altered or unfavorable pharmacokinetic properties. Generally, antibodies and fragments are acceptable with aggregation of 25% or less, 20% or less, 15% or less, 10% or less, or 5% or less. Aggregation can be measured by several techniques, including size-exclusion column (SEC), high performance liquid chromatography (HPLC), and light scattering.

Antibody Conjugates

[0513] The anti-SIRP.alpha. antibodies and antigen-binding fragments thereof disclosed herein may also be conjugated to a chemical moiety. The chemical moiety may be, inter alia, a polymer, a radionucleotide or a cytotoxic factor. In particular embodiments, the chemical moiety is a polymer which increases the half-life of the antibody or fragment in the body of a subject. Suitable polymers include, but are not limited to, hydrophilic polymers which include but are not limited to polyethylene glycol (PEG) (e.g., PEG with a molecular weight of 2 kDa, 5 kDa, 10 kDa, 12 kDa, 20 kDa, 30 kDa or 40 kDa), dextran and monomethoxypolyethylene glycol (mPEG). Lee, et al., (1999) (Bioconj. Chem. 10:973-981) discloses PEG conjugated single-chain antibodies. Wen, et al., (2001) (Bioconj. Chem. 12:545-553) disclose conjugating antibodies with PEG which is attached to a radiometal chelator (diethylenetriaminpentaacetic acid (DTPA)).

[0514] The antibodies and antigen-binding fragments thereof disclosed herein may also be conjugated with labels such as .sup.99Tc, .sup.90Y, .sup.111In, .sup.32P, .sup.14C, .sup.125I, .sup.3H, .sup.131I, .sup.11C, .sup.15O, .sup.13N, .sup.18F, .sup.35S, .sup.51Cr, .sup.57To, .sup.226Ra, .sup.60Co, .sup.59Fe, .sup.57Se, .sup.152Eu, .sup.67CU, .sup.217Ci, .sup.211At, .sup.212Pb, .sup.47Sc, .sup.109Pd, .sup.234Th, and .sup.40K, .sup.157Gd, .sup.55Mn, .sup.52Tr, and .sup.56Fe.

[0515] The antibodies and antigen-binding fragments disclosed herein may also be PEGylated, for example to increase its biological (e.g., serum) half-life. To PEGylate an antibody or fragment, the antibody or fragment, typically is reacted with a reactive form of polyethylene glycol (PEG), such as a reactive ester or aldehyde derivative of PEG, under conditions in which one or more PEG groups become attached to the antibody or antibody fragment. In particular embodiments, the PEGylation is carried out via an acylation reaction or an alkylation reaction with a reactive PEG molecule (or an analogous reactive water-soluble polymer). As used herein, the term "polyethylene glycol" is intended to encompass any of the forms of PEG that have been used to derivatize other proteins, such as mono (C1-C10) alkoxy- or aryloxy-polyethylene glycol or polyethylene glycol-maleimide. In certain embodiments, the antibody or fragment to be PEGylated is an aglycosylated antibody or fragment. Methods for PEGylating proteins are known in the art and can be applied to the antibodies of the invention. See, e.g., EP 0 154 316 and EP 0 401 384.

[0516] The antibodies and antigen-binding fragments disclosed herein may also be conjugated with fluorescent or chemilluminescent labels, including fluorophores such as rare earth chelates, fluorescein and its derivatives, rhodamine and its derivatives, isothiocyanate, phycoerythrin, phycocyanin, allophycocyanin, o-phthaladehyde, fluorescamine, .sup.152Eu, dansyl, umbelliferone, luciferin, luminal label, isoluminal label, an aromatic acridinium ester label, an imidazole label, an acridimium salt label, an oxalate ester label, an aequorin label, 2,3-dihydrophthalazinediones, biotin/avidin, spin labels and stable free radicals.

[0517] The antibodies and antigen-binding fragments thereof of the invention may also be conjugated to a cytotoxic factor such as diptheria toxin, Pseudomonas aeruginosa exotoxin A chain, ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins and compounds (e.g., fatty acids), dianthin proteins, Phytoiacca americana proteins PAPI, PAPII, and PAP-S, Momordica charantia inhibitor, curcin, crotin, Saponaria officinalis inhibitor, mitogellin, restrictocin, phenomycin, and enomycin.

[0518] Any method known in the art for conjugating the antibodies and antigen-binding fragments thereof of the invention to the various moieties may be employed, including those methods described by Hunter, et al., (1962) Nature 144:945; David, et al., (1974) Biochemistry 13:1014; Pain, et al., (1981) J. Immunol. Meth. 40:219; and Nygren, J., (1982) Histochem. and Cytochem. 30:407. Methods for conjugating antibodies and fragments are conventional and very well known in the art.

Therapeutic Uses of Anti-SIRP.alpha. Antibodies

[0519] Further provided are methods for treating subjects, including human subjects, in need of treatment with the isolated antibodies or antigen-binding fragments thereof disclosed herein. In one embodiment of the invention, such subject suffers from an infection or an infectious disease.

[0520] In another embodiment of the invention, such subject suffers from cancer. In one embodiment the cancer is, e.g., osteosarcoma, rhabdomyosarcoma, neuroblastoma, kidney cancer, leukemia, renal transitional cell cancer, bladder cancer, Wilm's cancer, ovarian cancer, pancreatic cancer, breast cancer, prostate cancer, bone cancer, lung cancer (e.g., non-small cell lung cancer), gastric cancer, colorectal cancer, cervical cancer, synovial sarcoma, head and neck cancer, squamous cell carcinoma, multiple myeloma, renal cell cancer, retinoblastoma, hepatoblastoma, hepatocellular carcinoma, melanoma, rhabdoid tumor of the kidney, Ewing's sarcoma, chondrosarcoma, brain cancer, glioblastoma, meningioma, pituitary adenoma, vestibular schwannoma, a primitive neuroectodermal tumor, medulloblastoma, astrocytoma, anaplastic astrocytoma, oligodendroglioma, ependymoma, choroid plexus papilloma, polycythemia vera, thrombocythemia, idiopathic myelfibrosis, soft tissue sarcoma, thyroid cancer, endometrial cancer, carcinoid cancer or liver cancer, breast cancer or gastric cancer. In an embodiment of the invention, the cancer is metastatic cancer, e.g., of the varieties described above.

[0521] Cancers that may be treated by the antibodies or antigen-binding fragments, compositions and methods of the invention include, but are not limited to: Cardiac: sarcoma (angiosarcoma, fibrosarcoma, rhabdomyosarcoma, liposarcoma), myxoma, rhabdomyoma, fibroma, lipoma and teratoma; Lung: bronchogenic carcinoma (squamous cell, undifferentiated small cell, undifferentiated large cell, adenocarcinoma), alveolar (bronchiolar) carcinoma, bronchial adenoma, sarcoma, lymphoma, chondromatous hamartoma, mesothelioma; Gastrointestinal: esophagus (squamous cell carcinoma, adenocarcinoma, leiomyosarcoma, lymphoma), stomach (carcinoma, lymphoma, leiomyosarcoma), pancreas (ductal adenocarcinoma, insulinoma, glucagonoma, gastrinoma, carcinoid tumors, vipoma), small bowel (adenocarcinoma, lymphoma, carcinoid tumors, Karposi's sarcoma, leiomyoma, hemangioma, lipoma, neurofibroma, fibroma), large bowel (adenocarcinoma, tubular adenoma, villous adenoma, hamartoma, leiomyoma) colorectal; Genitourinary tract: kidney (adenocarcinoma, Wilm's tumor [nephroblastoma], lymphoma, leukemia), bladder and urethra (squamous cell carcinoma, transitional cell carcinoma, adenocarcinoma), prostate (adenocarcinoma, sarcoma), testis (seminoma, teratoma, embryonal carcinoma, teratocarcinoma, choriocarcinoma, sarcoma, interstitial cell carcinoma, fibroma, fibroadenoma, adenomatoid tumors, lipoma); Liver: hepatoma (hepatocellular carcinoma), cholangiocarcinoma, hepatoblastoma, angiosarcoma, hepatocellular adenoma, hemangioma; Bone: osteogenic sarcoma (osteosarcoma), fibrosarcoma, malignant fibrous histiocytoma, chondrosarcoma, Ewing's sarcoma, malignant lymphoma (reticulum cell sarcoma), multiple myeloma, malignant giant cell tumor chordoma, osteochronfroma (osteocartilaginous exostoses), benign chondroma, chondroblastoma, chondromyxofibroma, osteoid osteoma and giant cell tumors; Nervous system: skull (osteoma, hemangioma, granuloma, xanthoma, osteitis deformans), meninges (meningioma, meningiosarcoma, gliomatosis), brain (astrocytoma, medulloblastoma, glioma, ependymoma, germinoma [pinealoma], glioblastoma multiform, oligodendroglioma, schwannoma, retinoblastoma, congenital tumors), spinal cord neurofibroma, meningioma, glioma, sarcoma); Gynecological: uterus (endometrial carcinoma), cervix (cervical carcinoma, pre tumor cervical dysplasia), ovaries (ovarian carcinoma [serous cystadenocarcinoma, mucinous cystadenocarcinoma, unclassified carcinoma], granulosa thecal cell tumors, Sertoli-Leydig cell tumors, dysgerminoma, malignant teratoma), vulva (squamous cell carcinoma, intraepithelial carcinoma, adenocarcinoma, fibrosarcoma, melanoma), vagina (clear cell carcinoma, squamous cell carcinoma, botryoid sarcoma (embryonal rhabdomyosarcoma), fallopian tubes (carcinoma), breast; Hematologic: blood (myeloid leukemia [acute and chronic], acute lymphoblastic leukemia, chronic lymphocytic leukemia, myeloproliferative diseases, multiple myeloma, myelodysplastic syndrome), Hodgkin's disease, non Hodgkin's lymphoma [malignant lymphoma]; Skin: malignant melanoma, basal cell carcinoma, squamous cell carcinoma, Karposi's sarcoma, moles dysplastic nevi, lipoma, angioma, dermatofibroma, keloids, psoriasis; and Adrenal glands: neuroblastoma. Thus, the term "cancerous cell" as provided herein, includes a cell afflicted by any one of the above-identified conditions.

[0522] In one embodiment, cancers that may be treated by the antibodies or antigen-binding fragments thereof disclosed herein, compositions and methods of the invention include, but are not limited to: breast cancer, gastric cancer, esophageal cancer, gastroesophageal junction carcinoma, colorectal cancer, head and neck cancer, non-small cell lung cancer, osteosarcoma, neuroblastoma, bladder cancer, cervical cancer, endometrial cancer, ovarian cancer, lung cancer, squamous cell carcinoma, melanoma, pancreatic cancer, prostate cancer, small cell lung cancer, kidney cancer, renal cell carcinoma, thyroid cancer, glioblastoma multiforme, fallopian tube cancer, peritoneal cancer, angiosarcoma, hepatocellular carcinoma, choriocarcinoma, soft tissue sarcoma, chronic lymphocytic leukemia, chronic myelocytic leukemia, non-Hodgkin's lymphoma, B-cell non-hodgkin's lymphoma, diffuse large B-cell lymphoma, follicular lymphoma, mantle cell lymphoma, myelodysplastic syndrome, acute myelocytic leukemia, T-cell lymphoma, natural killer cell lymphoma, extranodal marginal zone B-cell lymphoma, acute lymphocytic leukemia, multiple myeloma.

[0523] In one embodiment, the antibodies or antigen-binding fragments thereof disclosed herein may be used for the treatment of infections and infectious diseases. As used herein, the term "infection" refers to any state in at least one cell of an organism (i.e., a subject) is infected by an infectious agent (e.g., a subject has an intracellular pathogen infection, e.g., a chronic intracellular pathogen infection). As used herein, the term "infectious agent" refers to a foreign biological entity (i.e. a pathogen) that induces CD47 expression (e.g., increased CD47 expression) in at least one cell of the infected organism. For example, infectious agents include, but are not limited to bacteria, viruses, protozoans, and fungi.

[0524] Intracellular pathogens are of particular interest. Infectious diseases are disorders caused by infectious agents. Some infectious agents cause no recognizable symptoms or disease under certain conditions, but have the potential to cause symptoms or disease under changed conditions. The subject methods can be used in the treatment of chronic pathogen infections, for example including but not limited to viral infections, e.g. retrovirus, lentivirus, hepadna virus, herpes viruses, pox viruses, human papilloma viruses, etc.; intracellular bacterial infections, e.g. Mycobacterium, Chlamydophila, Ehrlichia, Rickettsia, Brucella, Legionella, Francisella, Listeria, Coxiella, Neisseria, Salmonella, Yersinia sp, Helicobacter pylori etc.; and intracellular protozoan pathogens, e.g. Plasmodium sp, Trypanosoma sp., Giardia sp., Toxoplasma sp., Leishmania sp., etc.

[0525] In an embodiment, the invention provides methods for treating subjects using an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention, wherein the subject suffers from a viral infection. In one embodiment, the viral infection is an infection with a virus selected from the group consisting of human immunodeficiency virus (HIV), hepatitis virus (A, B, or C), herpes virus (e.g., VZV, HSV-I, HAV-6, HSV-II, and CMV, Epstein Barr virus), adenovirus, influenza virus, flaviviruses, echovirus, rhinovirus, coxsackie virus, coronavirus, respiratory syncytial virus, mumps virus, rotavirus, measles virus, rubella virus, parvovirus, vaccinia virus, HTLV virus, dengue virus, papillomavirus, molluscum virus, poliovirus, rabies virus, JC virus or arboviral encephalitis virus.

[0526] In an embodiment, the invention provides methods for treating subjects using an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention, wherein the subject suffers from a bacterial infection. In one embodiment, the bacterial infection is infection with a bacteria selected from the group consisting of Chlamydia, rickettsial bacteria, mycobacteria, staphylococci, streptococci, pneumonococci, meningococci and gonococci, klebsiella, proteus, serratia, pseudomonas, Legionella, Corynebacterium diphtheriae, Salmonella, bacilli, Vibrio cholerae, Clostridium tetan, Clostridium botulinum, Bacillus anthricis, Yersinia pestis, Mycobacterium leprae, Mycobacterium lepromatosis, and Borriella.

[0527] In an embodiment, the invention provides methods for treating subjects using an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention, wherein the subject suffers from a fungal infection. In one embodiment, the fungal infection is an infection with a fungus selected from the group consisting of Candida (albicans, krusei, glabrata, tropicalis, etc.), Cryptococcus neoformans, Aspergillus (fumigatus, niger, etc.), Genus Mucorales (mucor, absidia, rhizopus), Sporothrix schenkii, Blastomyces dermatitidis, Paracoccidioides brasiliensis, Coccidioides immitis and Histoplasma capsulatum.

[0528] In an embodiment, the invention provides methods for treating subjects using an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention, wherein the subject suffers from a parasitic infection. In one embodiment, the parasitic infection is infection with a parasite selected from the group consisting of Entamoeba histolytica, Balantidium coli, Naegleria fowleri, Acanthamoeba, Giardia lambia, Cryptosporidium, Pneumocystis carinii, Plasmodium vivax, Babesia microti, Trypanosoma brucei, Trypanosoma cruzi, Leishmania donovani, Toxoplasma gondii and Nippostrongylus brasiliensis.

[0529] A "subject" may be a mammal such as a human, dog, cat, horse, cow, mouse, rat, monkey (e.g., cynomolgous monkey, e.g., Macaca fascicularis) or rabbit. In preferred embodiments of the invention, the subject is a human subject.

[0530] The term "in association with" indicates that the components administered in a method of the present invention (e.g., an anti-SIRP.alpha. antibody (e.g., humanized antibody) or antigen-binding fragment thereof along with an anti-cancer agent can be formulated into a single composition for simultaneous delivery or formulated separately into two or more compositions (e.g., a kit). Each component can be administered to a subject at a different time than when the other component is administered; for example, each administration may be given non-simultaneously (e.g., separately or sequentially) at several intervals over a given period of time. Moreover, the separate components may be administered to a subject by the same or by a different route.

[0531] In particular embodiments, the antibodies or antigen-binding fragments thereof disclosed herein may be used alone, or in association with other, further therapeutic agents and/or therapeutic procedures, for treating or preventing any disease such as cancer, e.g., as discussed herein, in a subject in need of such treatment or prevention. Compositions, e.g., pharmaceutical compositions comprising a pharmaceutically acceptable carrier, comprising such antibodies and fragments in association with further therapeutic agents are also part of the present invention.

[0532] Therefore, the present invention provides a method of treating cancer in a human subject, comprising administering to the subject an effective amount of the antibody or antigen binding fragment disclosed herein, optionally in association with a further therapeutic agent or therapeutic procedure. The present invention also provides a method of treating an infection or infectious disease in a human subject, comprising administering to the subject an effective amount of the antibody or antigen binding fragment disclosed herein, optionally in association with a further therapeutic agent or therapeutic procedure. The present invention also provides a method of increasing the activity of an immune cell, comprising administering to a subject in need thereof an effective amount of an antibody or antigen binding fragment disclosed herein. In one embodiment, the method is used for: the treatment of cancer; the treatment of an infection or infectious disease; or as a vaccine adjuvant.

[0533] In particular embodiments, the antibodies or antigen-binding fragments thereof disclosed herein may be used alone, or in association with tumor vaccines. Examples of tumor vaccines include but are not limited to vaccines for Human Papillomavirus (HPV) infection caused cancer such as Gardasil.RTM., Gardisil9.RTM. and Cervarix.RTM.; vaccines that prevent hepatitis B virus caused liver cancer such as Engerix-B.RTM. and Recombivax HB.RTM.; oncolytic virus therapy that triggers immune response such as Imlygic.RTM.; DNA vaccines such as Synchotrope MA2M plasmid DNA vaccine and ZYC101; mammaglobin-a DNA vaccine (see Clinical Cancer Res. 2014 20(23):5964-75); vector based vaccines such as PSA-TRICOM (prostvac), PANVAC-VF, Listeria monocytogenes-based vaccines (see, e.g., Therapeutic Advances in Vaccines, 2014, 2(5) 137-148), Listeria-based vaccines (Listeria expressing one or more cancer vaccines such as Listeria-mesothelin (e.g., CRS-207), ADXS-HPV, Axalimogene Filolisbac, Listeria-HER2/Neu, Listeria-EGFRvIII), Adeno-CEA; allogeneic vaccines such as GVAX, BLP-25 (anti-Ankara-mucin 1), Belagenpumatucel-L, TG4010, CIMAvax epidermal growth factor vaccine, NY-ESO, GM.CD40L-CCL21; autologous vaccines such as:Adeno-CD40L, BCG, INGN-225, Dendritic cell vaccines such as Provenge(Sipuleucel-T), rF-CEA-MUC1-TRICOM (panvac-DC); antigen vaccines such as MUC-1 (stimuvax), NY-ESO-1, GP-100, MAGE-A3 (melanoma antigen encoding gene A3), INGN-225 (see Pharmacology & Therapeutics 153 (2015) 1-9).

[0534] Eat-me signals could be elevated by cytotoxic therapies like radiotherapy or chemotherapeutic agents including, but not limited to anthracyclines (doxorubicin, epirubicin, daunorubicin, idarubicin, mitoxantrone), oxaliplatin, bortezomib, cyclophosphamide, bleomycin, vorinostat, paclitaxel, 5-fluorouracil, cytarabine, prednisolone, docetaxel, mitomycin C, topotecan/camptothecin, etoposide, zoledronic acid, methotrexate, ibrutinib, aflibercept, bevacizumab, toremifene, vinblastine, vincristine, idelalisib, mercaptopurine, thalidomide, sorafenib. Thus, in certain embodiments, the antibodies or antigen-binding fragments thereof disclosed herein may be used in association with chemotherapeutic agents, in association with radiation therapy, etc. In particular embodiments, the antibodies or antigen-binding fragments thereof disclosed herein may be used alone, or in association with targeted therapies. Examples of targeted therapies include: hormone therapies, signal transduction inhibitors (e.g., EGFR inhibitors, such as cetuximab (Erbitux) and erlotinib (Tarceva)); CD20 inhibitors (e.g., rituximab (Rituxan) and ofatumumab (Arzerra)); CD38 inhibitors (e.g., daratumumab (DARZALEX)); CD52 inhibitors (e.g., alemtuzumab (Campath)); HER2 inhibitors (e.g., trastuzumab (Herceptin) and pertuzumab (Perjeta)); BCR-ABL inhibitors (such as imatinib (Gleevec) and dasatinib (Sprycel)); ALK inhibitors (such as crizotinib (Xalkori) and ceritinib (Zykadia)); BRAF inhibitors (such as vemurafenib (Zelboraf) and dabrafenib (Tafinlar)), gene expression modulators (e.g., decitabine (Dacogen) and Vorinostat (Zolinza)), apoptosis inducers (e.g., bortezomib (Velcade) and carfilzomib (Kyprolis)), angiogenesis inhibitors (e.g., bevacizumab (Avastin) and ramucirumab (Cyramza)), immunomodulatory imide drugs (e.g., thalidomide, lenalidomide, pomalidomide, and apremilast), monoclonal antibodies attached to toxins (e.g., brentuximab vedotin (Adcetris) and ado-trastuzumab emtansine (Kadcyla)).

[0535] The antibodies or antigen-binding fragments thereof disclosed herein may preferably find use in association with targeted therapies in which antibodies are employed to mediate ADCC/ADCP. Functional bioassays are available to analyze the mode of action of an antibody drug and to distinguish ADCP as a mode of action from ADCC. By way of example, an antibody-dependent cell-mediated cytotoxicity (ADCC) assay typically utilizes normal human peripheral blood mononuclear cells (PBMCs) or effector cells isolated thereof. Assay variation can be reduced by using selective donor pools with defined Fc.gamma. receptor Ha (Fc.gamma.RIIa/CD32a), IIIa (Fc.gamma.RIIIa/CD16a) or IIIb (Fc.gamma.RIIIb/CD16b) gene copy number variation (CNV) or genotypes such as Fc.gamma.RIIIa-158 V/V versus V/F or F/F, Fc.gamma.RIIIa-131 H/H versus H/R or R/R, and the Fc.gamma.RIIIb-NA1 and -NA2 polymorphic variants. Alternatively, effector cells such as PBMCs, PBMC-derived natural killer (NK) cells, granulocytes, monocytes, monocyte-derived macrophages, or dendritic cells (DCs) can be replaced with a Fc.gamma.RIIIa-expressing cell line (for example, engineered NK92). Killing of the target cells can be assessed by measuring the release of specific probes from pre-labelled target cells, using .sup.51chromium (Cr.sup.51) or fluorescent dyes such as calcein-acetoxymethyl (calcein-AM), carboxyfluorescein succinimidyl ester (CFSE), 2',7'-bis-(2-carboxyethyl)-5-(and-6)-carboxyfluorescein (BCECF), europium (Eu) or propidium iodide (PI), or by measuring the release of cytosolic enzymes such as lactate dehydrogenase (LDH) or the release of nucleoside triphosphate (ATP).

[0536] In contrast, antibody-dependent cellular phagocytosis (ADCP) may be assessed by measuring the destruction of target cells via granulocyte, monocyte, dendritic cell, or macrophage-mediated phagocytosis. ADCP assays use PBMC-derived cells or myeloid cell lines such as HL-60, THP-1, and U937 cells differentiated into macrophages or granulocytes. Stimuli that are commonly used to induce macrophage differentiation in monocytic cell lines include phorbol-12-myristate-13-acetate (PMA), 1,25-dihydroxyvitamin D3 (VD3), and retinoic acid (RA). RA is also known to induce terminal granulocytic differentiation of for example HL-60 cells. Phagocytosis of the target cells can be assessed by monitoring effector cells for the internalization of specific probes from target cells pre-labelled with fluorescent dyes such as cell proliferation dye eFluor450, CFSE, and pH-sensitive dyes including pHrodo and CypHer5E. Phagocytosis is measured by an increase in fluorescently labelled effector cells using flow cytometry or fluorescence microscopy. "Reporter gene" assays are also available to assess ADCP. In order to measure ADCP function in a reporter gene assay, target cells are first incubated with a titration of an antibody of interest. Once the antibody is bound to its cognate target on the target cell surface, engineered Jurkat effector cells are added. If ADCP pathway activation ensues, the Jurkat cells produce a luciferase product by expression of the reporter gene NFAT-RE-luc2. Luciferase activity is then measured following a 4-24 hour induction period, after addition of the luciferase assay reagent. The dose-dependent response in the microtiter plate-based assay can be used to quantify the relative biological activity of the therapeutic antibody compared to the dose-response curve of a suitable reference item.

[0537] In particular embodiments, the anti-SIRP.alpha. antibodies or antigen-binding fragments thereof of the invention may be used in combination with an anti-cancer therapeutic agent or immunomodulatory drug such as an immunomodulatory receptor inhibitor, e.g., an antibody or antigen-binding fragment thereof that specifically binds to the receptor.

[0538] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with one or more of:

[0539] an agonist (e.g., an agonistic antibody or antigen-binding fragment thereof, or a soluble fusion) of a TNF receptor protein, an Immunoglobulin-like protein, a cytokine receptor, an integrin, a signaling lymphocytic activation molecules (SLAM proteins), an activating NK cell receptor, a Toll like receptor, OX40, CD2, CD7, CD27, CD28, CD30, CD40, ICAM-1, LFA-1 (CD1 1a/CD18), 4-1BB (CD137), B7-H3, ICOS (CD278), GITR, BAFFR, LIGHT, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD19, CD4, CD8alpha, CD8beta, IL2R beta, IL2R gamma, IL7R alpha, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD1 1d, ITGAE, CD103, ITGAL, ITGAM, CD1 1b, ITGAX, CD1 1c, ITGB1, CD29, ITGB2, CD18, ITGB7, NKG2D, NKG2C, TNFR2, TRANCE/RANKL, DNAM1 (CD226), SLAMF4 (CD244, 2B4), CD84, CD96 (Tactile), CEACAM1, CRTAM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Ly108), SLAM (SLAMF1, CD150, IPO-3), SLAM7, BLAME (SLAMF8), SELPLG (CD162), LTBR, LAT, GADS, PAG/Cbp, CD19a, and a ligand that specifically binds with CD83; or

[0540] an inhibitor of CD47, PD-1, PD-L1, PD-L2, CTLA4, TIM3, LAGS, CEACAM (e.g., CEACAM-1, -3 and/or -5), VISTA, BTLA, TIGIT, LAIR1, IDO, TDO, CD160 and/or TGFR beta.

[0541] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with one or more cyclic dinculeotides or other STING pathway agonists. STING (stimulator of interferon genes, also known as TMEM173, MITA, ERIS, and MPYS) is a transmembrane protein localized to the ER that undergoes a conformational change in response to direct binding of cyclic dinucleotides (CDNs), resulting in a downstream signaling cascade involving TBK1 activation, IRF-3 phosphorylation, and production of IFN-.beta. and other cytokines. The STING pathway in tumor-resident host antigen presenting c3ellss is involved in the induction of a spontaneous CD8+ T cell response against tumor-derived antigens. Activation of this pathway and the subsequent production of IFN-.beta. also reportedly contributes to the anti-tumor effect of radiation. STING agonists and their uses are described in, for example, US20060040887, US20080286296, US20120041057, US20140205653, WO2014179335, WO 2014179760, US20150056224, WO 2015185565, WO 2016096174, WO 2016145102, WO 2017011444, WO 2017027645, WO 2017027646, WO 2017123657, WO 2017123669, WO 2017175147, WO 2017175156, WO 2018045204, WO 2018009648, WO 2018006652, WO 2018013887, WO 2018013908, US20180002369, US20180092937, and US20180093964.

[0542] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with one or more of: anti-CD47 antibody, anti-PD-1 antibody (e.g., nivolumab, pembrolizumab, anti-PDL1 antibody, anti-TIGIT antibody, anti-APRIL antibody, anti-CTLA4 antibody, anti-CS1 antibody (e.g., elotuzumab), anti-KIR2DL1/2/3 antibody (e.g., lirilumab), anti-CD137 antibody (e.g., urelumab), anti-GITR antibody (e.g., TRX518), anti-PD-L1 antibody (e.g., BMS-936559, MSB0010718C or MPDL3280A), anti-PD-L2 antibody, anti-ILT1 antibody, anti-ILT2 antibody, anti-ILT3 antibody, anti-ILT4 antibody, anti-ILT5 antibody, anti-ILT6 antibody, anti-ILT7 antibody, anti-ILT8 antibody, anti-CD40 antibody, anti-OX40 antibody, anti-ICOS, anti-KIR2DL1 antibody, anti-KIR2DL2/3 antibody, anti-KIR2DL4 antibody, anti-KIR2DL5A antibody, anti-KIR2DL5B antibody, anti-KIR3DL1 antibody, anti-KIR3DL2 antibody, anti-KIR3DL3 antibody, anti-NKG2A antibody, anti-NKG2C antibody, anti-NKG2E antibody, anti-4-1BB antibody (e.g., PF-05082566), anti-TSLP antibody, anti-IL-10 antibody, IL-10 or PEGylated IL-10, or any small organic molecule inhibitor of such targets.

[0543] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-CD20 antibody (e.g., rituximab, ofatumumab, ocrelizumab, obinutuzumab, ocaratuzumab, ublituximab, veltuzumab, ibritumomab tiuxetan, tositumomab, BVX-20, SCT-400 or PRO131921).

[0544] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-CD38 antibody (e.g., daratumumab, isatuximab or MOR202).

[0545] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-EGFR antibody (e.g., cetuximab, CetuGEX, panitumumab, nimotuzumab, depatuxizumab or AFM-21).

[0546] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-HER2 antibody (e.g., trastuzumab, TrasGEX, pertuzumab, margetuximab or ADCT-502).

[0547] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-HER3 antibody (e.g., lumretuzumab, patritumab or LJM716).

[0548] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-CD19 antibody (e.g., inebilizumab, blinatumomab, DI-B4, MDX-1342, MEDI-551, MOR208 or 4-G7SDIE).

[0549] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-CD52 antibody (e.g., alemtuzumab).

[0550] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-EpCAM antibody (e.g., adecatumumab, catumaxomab, edrecolomab or ING-1).

[0551] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-SLAMF7 antibody (e.g., elotuzumab or ABBV-838).

[0552] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-PD-1 antibody (e.g., nivolumab or pembrolizumab).

[0553] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-PD-L1 antibody (e.g., BMS-936559, MSB0010718C or MPDL3280A).

[0554] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-CTLA4 antibody (e.g., ipilimumab or tremelimumab).

[0555] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-CD137 antibody (e.g., urelumab).

[0556] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-GITR antibody (e.g., TRX518 or FPA154).

[0557] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-OX40 antibody (e.g., MEDI6469, MOXR0916 or INCAGN1949).

[0558] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-CD40 antibody (e.g., lucatumumab, dacetuzmumab, APX005M, ChiLob7/4, CP-870,893 or JNJ-64457107) In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-CS1 antibody.

[0559] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-KIR2DL1/2/3 antibody.

[0560] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-CD137 (e.g., urelumab) antibody.

[0561] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-GITR (e.g., TRX518) antibody.

[0562] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-PD-L2 antibody.

[0563] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-ITL1 antibody.

[0564] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-ITL2 antibody.

[0565] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-ITL3 antibody.

[0566] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-ITL4 antibody.

[0567] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-ITL5 antibody.

[0568] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-ITL6 antibody.

[0569] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-ITL7 antibody.

[0570] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-ITL8 antibody.

[0571] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-CD40 antibody.

[0572] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-OX40 antibody.

[0573] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-KIR2DL1 antibody.

[0574] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-KIR2DL2/3 antibody.

[0575] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-KIR2DL4 antibody.

[0576] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-KIR2DL5A antibody.

[0577] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-KIR2DL5B antibody.

[0578] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-KIR3DL1 antibody.

[0579] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-KIR3DL2 antibody.

[0580] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-KIR3DL3 antibody.

[0581] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-NKG2A antibody.

[0582] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-NKG2C antibody.

[0583] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-ICOS antibody.

[0584] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-4-1BB antibody.

[0585] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-IL-10 antibody.

[0586] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with an anti-TSLP antibody.

[0587] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with IL-10 or PEGylated IL-10.

[0588] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with one or more of an inhibitor (e.g., a small organic molecule or an antibody or antigen-binding fragment thereof) such as: an MTOR (mammalian target of rapamycin) inhibitor, a cytotoxic agent, a platinum agent, an EGFR inhibitor, a VEGF inhibitor, a microtubule stabilizer, a taxane, a CD20 inhibitor, a CD52 inhibitor, a CD30 inhibitor, a RANK (Receptor activator of nuclear factor kappa-B) inhibitor, a RANKL (Receptor activator of nuclear factor kappa-B ligand) inhibitor, an ERK inhibitor, a MAP Kinase inhibitor, an AKT inhibitor, a MEK inhibitor, a PI3K inhibitor, a HER1 inhibitor, a HER2 inhibitor, a HER3 inhibitor, a HER4 inhibitor, a Bcl2 inhibitor, a CD22 inhibitor, a CD79b inhibitor, an ErbB2 inhibitor, or a farnesyl protein transferase inhibitor.

[0589] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with any one or more of: 13-cis-retinoic acid, 3-[5-(methylsulfonylpiperadinemethyl)-indolyl]-quinolone, 4-hydroxytamoxifen, 5-deooxyuridine, 5'-deoxy-5-fluorouridine, 5-fluorouracil, 6-mecaptopurine, 7-hydroxystaurosporine, A-443654, abirateroneacetate, abraxane, ABT-578, acolbifene, ADS-100380, ALT-110, altretamine, amifostine, aminoglutethimide, amrubicin, Amsacrine, anagrelide, anastrozole, angiostatin, AP-23573, ARQ-197, arzoxifene, AS-252424, AS-605240, asparaginase, AT-9263, atrasentan, axitinib, AZD1152, Bacillus Calmette-Guerin (BCG) vaccine, batabulin, BC-210, besodutox, bevacizumab, bicalutamide, Bio111, BIO140, bleomycin, BMS-214662, BMS-247550, BMS-275291, BMS-310705, bortezomib, buserelin, busulfan, calcitriol, camptothecin, canertinib, capecitabine, carboplatin, carmustine, CC8490, Cediranib, CG-1521, CG-781, chlamydocin, chlorambucil, chlorotoxin, cilengitide, cimitidine, cisplatin, cladribine, clodronate, COL-3, CP-724714, cyclophosphamide, cyproterone, cyproteroneacetate, cytarabine, cytosinearabinoside, dacarbazine, dacinostat, dactinomycin, dalotuzumab, danusertib, dasatanib, daunorubicin, decatanib, deguelin, denileukin, deoxycoformycin, depsipeptide, diarylpropionitrile, diethylstilbestrol, diftitox, docetaxel, dovitinib, doxorubicin, droloxifene, edotecarin, yttrium-90 labeled-edotreotide, edotreotide, EKB-569, EMD121974, endostatin, enzalutamide, enzastaurin, epirubicin, epithilone B, ERA-923, Erbitux, erlotinib, estradiol, estramustine, etoposide, everolimus, exemestane, ficlatuzumab, finasteride, flavopiridol, floxuridine, fludarabine, fludrocortisone, fluoxymesterone, flutamide, FOLFOX regimen, Fulvestrant, galeterone, gefitinib, gemcitabine, gimatecan, goserelin, goserelin acetate, gossypol, GSK461364, GSK690693, HMR-3339, hydroxyprogesteronecaproate, hydroxyurea, IC87114, idarubicin, idoxyfene, ifosfamide, IM862, imatinib, IMC-1C11, INCB24360, INO1001, interferon, interleukin-12, ipilimumab, irinotecan, JNJ-16241199, ketoconazole, KRX-0402, thalidomide, lenalidomide, pomalidomide, apremilast,lapatinib, lasofoxifene, letrozole, leucovorin, leuprolide, leuprolide acetate, levamisole, liposome entrapped paclitaxel, lomustine, lonafarnib, lucanthone, LY292223, LY292696, LY293646, LY293684, LY294002, LY317615, marimastat, mechlorethamine, medroxyprogesteroneacetate, megestrolacetate, melphalan, mercaptopurine, mesna, methotrexate, mithramycin, mitomycin, mitotane, mitoxantrone, tozasertib, MLN8054, neovastat, Neratinib, neuradiab, nilotinib, nilutimide, nolatrexed, NVP-BEZ235, oblimersen, octreotide, ofatumumab, oregovomab, orteronel, oxaliplatin, paclitaxel, palbociclib, pamidronate, panitumumab, pazopanib, PD0325901, PD184352, PEG-interferon, pemetrexed, pentostatin, perifosine, phenylalaninemustard, PI-103, pictilisib, PIK-75, pipendoxifene, PKI-166, plicamycin, porfimer, prednisone, procarbazine, progestins, PX-866, R-763, raloxifene, raltitrexed, razoxin, ridaforolimus, rituximab, romidepsin, RTA744, rubitecan, scriptaid, Sdx102, seliciclib, selumetinib, semaxanib, SF1126, sirolimus, SN36093, sorafenib, spironolactone, squalamine, SR13668, streptozocin, SU6668, suberoylanalide hydroxamic acid, sunitinib, synthetic estrogen, talampanel, talimogene laherparepvec, tamoxifen, temozolomide, temsirolimus, teniposide, tesmilifene, testosterone, tetrandrine, TGX-221, thalidomide, thioguanine, thiotepa, tremelimumab, tipifarnib, tivozanib, TKI-258, TLK286, topotecan, toremifene citrate, trabectedin, trastuzumab, tretinoin, trichostatin A, triciribinephosphate monohydrate, triptorelin pamoate, TSE-424, uracil mustard, valproic acid, valrubicin, vandetanib, vatalanib, VEGF trap, vinblastine, vincristine, vindesine, vinorelbine, vitaxin, vitespan, vorinostat, VX-745, wortmannin, Xr311, zanolimumab, ZK186619, ZK-304709, ZM336372, ZSTK474.

[0590] Non-limiting examples of suitable anti-cancer agents to be used in combination with an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention include cytostatic agents, immune modulating imide drugs, cytotoxic agents, targeted therapeutic agents (small molecules, biologics, siRNA and microRNA) against cancer and neoplastic diseases,

[0591] 1) anti-metabolites (such as methotrexate, 5-fluorouracil, gemcitabine, fludarabine, capecitabine);

[0592] 2) alkylating agents, such as temozolomide, cyclophosphamide,

[0593] 3) DNA interactive and DNA damaging agents, such as cisplatin, oxaliplatin, doxorubicin,

[0594] 4) Ionizing irradiation, such as radiation therapy,

[0595] 5) topoisomerase II inhibitors, such as etoposide, doxorubicin,

[0596] 6) topoisomerase I inhibitors, such as irinotecan, topotecan,

[0597] 7) tubulin interacting agents, such as paclitaxel, docetaxel, Abraxane, epothilones,

[0598] 8) kinesin spindle protein inhibitors,

[0599] 9) spindle checkpoint inhibitors,

[0600] 10) Poly(ADP-ribose) polymerase (PARP) inhibitors, such as olaparib, MK-4827 and veliparib

[0601] 11) Matrix metalloprotease (MMP) inhibitors

[0602] 12) Protease inhibitors, such as cathepsin D and cathepsin K inhibitors

[0603] 13) Proteosome or ubiquitination inhibitors, such as bortezomib,

[0604] 14) Activator of mutant p53 to restore its wild-type p53 activity

[0605] 15) Adenoviral-p53

[0606] 16) Bcl-2 inhibitors, such as ABT-263

[0607] 17) Heat shock protein (HSP) modulators, such as geldanamycin and 17-AAG

[0608] 18) Histone deacetylase (HDAC) inhibitors, such as vorinostat (SAHA),

[0609] 19) sex hormone modulating agents,

[0610] a. anti-estrogens, such as tamoxifen, fulvestrant,

[0611] b. selective estrogen receptor modulators (SERM), such as raloxifene,

[0612] c. anti-androgens, such as bicalutamide, flutamide

[0613] d. LHRH agonists, such as leuprolide,

[0614] e. 5.alpha.-reductase inhibitors, such as finasteride,

[0615] f. Cytochrome P450 C17 lyase (CYP450c17, also called 17aC);

[0616] g. aromatase inhibitors, such as letrozole, anastrozole, exemestane,

[0617] 20) EGFR kinase inhibitors, such as geftinib, erlotinib, laptinib

[0618] 21) dual erbB1 and erbB2 inhibitors, such as Lapatinib

[0619] 22) multi-targeted kinases (serine/threonine and/or tyrosine kinase) inhibitors,

[0620] a. ABL kinase inhibitors, imatinib and nilotinib, dasatinib

[0621] b. VEGFR-1, VEGFR-2, PDGFR, KDR, FLT, c-Kit, Tie2, Raf, MEK and ERK inhibitors, such as sunitinib, sorafenib, Vandetanib, pazopanib, PLX-4032, Axitinib, PTK787, GSK-1120212

[0622] c. Polo-like kinase inhibitors

[0623] d. Aurora kinase inhibitors

[0624] e. JAK inhibitor

[0625] f. c-MET kinase inhibitors

[0626] g. Cyclin-dependent kinase inhibitors, such as CDK1 and CDK2 inhibitor Dinaciclib SCH 727965 (see Parry et al, Molecular Cancer Therapeutics 9 (8): 2344-53 (2010)) and CDK4/6 inhibitors, such as Ribociclib, Palbociclib, Abemaciclib, and Trilaciclib.

[0627] h. PI3K and mTOR inhibitors, such as GDC-0941, BEZ-235, BKM-120 and AZD-8055

[0628] i. Rapamycin and its analogs, such as Temsirolimus, everolimus, and deforolimus

[0629] 23) and other anti-cancer (also know as anti-neoplastic) agents include but are not limited to ara-C, adriamycin, cytoxan, Carboplatin, Uracil mustard, Clormethine, Ifosfsmide, Melphalan, Chlorambucil, Pipobroman, Triethylenemelamine, Triethylenethiophosphoramine, Busulfan, Carmustine, Lomustine, Streptozocin, Dacarbazine, Floxuridine, Cytarabine, 6-Mercaptopurine, 6-Thioguanine, Fludarabine phosphate, Pentostatine, Vinblastine, Vincristine, Vindesine, Vinorelbine, Navelbine, Bleomycin, Dactinomycin, Daunorubicin, Doxorubicin, Epirubicin, teniposide, cytarabine, pemetrexed, Idarubicin, Mithramycin, Deoxycoformycin, Mitomycin-C, L-Asparaginase, Teniposide, Ethinylestradiol, Diethylstilbestrol, Testosterone, Prednisone, Fluoxymesterone, Dromostanolone propionate, Testolactone, Megestrolacetate, Methylprednisolone, Methyltestosterone, Prednisolone, Triamcinolone, Chlorotrianisene, Hydroxyprogesterone, Aminoglutethimide, Estramustine, Flutamide Medroxyprogesteroneacetate, Toremifene, goserelin, Carboplatin, Hydroxyurea, Amsacrine, Procarbazine, Mitotane, Mitoxantrone, Levamisole, Drolloxafine, Hexamethylmelamine, Bexxar, Zevalin, Trisenox, Profimer, Thiotepa, Altretamine, Doxil, Ontak, Depocyt, Aranesp, Neupogen, Neulasta, Kepivance.

[0630] 24) Farnesyl protein transferase inhibitors, such as, SARASAR.TM. (4-[2-[4-[(11R)-3,10-dibromo-8-chloro-6, 11-dihydro-5H-benzo[5,6]cyclohepta[1,2-b]pyridin-11-yl-]-1-piperidinyl]-2- -oxoethyl]-piperidinecarboxamide, tipifarnib

[0631] 25) interferons, such as Intron A, Peg-Intron,

[0632] 26) anti-erbB1 antibodies, such as cetuximab, panitumumab,

[0633] 27) anti-erbB2 antibodies, such as trastuzumab,

[0634] 28) anti-CD52 antibodies, such as Alemtuzumab,

[0635] 29) anti-CD20 antibodies, such as Rituximab

[0636] 30) anti-CD33 antibodies, such as Gemtuzumab ozogamicin

[0637] 31) anti-VEGF antibodies, such as Avastin,

[0638] 32) TRIAL ligands, such as Lexatumumab, mapatumumab, and AMG-655

[0639] 33) anti-CTLA-4 antibodies, such as ipilimumab

[0640] 34) antibodies against CTA1, CEA, CD5, CD19, CD22, CD30, CD44, CD44V6, CD55, CD56, EpCAM, FAP, MHCII, HGF, IL-6, MUC1, PSMA, TAL6, TAG-72, TRAILR, VEGFR, IGF-2, FGF,

[0641] 35) anti-IGF-1R antibodies, such as dalotuzumab (MK-0646) and robatumumab (SCH 717454).

[0642] "Estrogen receptor modulators" refers to compounds that interfere with or inhibit the binding of estrogen to the receptor, regardless of mechanism. Examples of estrogen receptor modulators include, but are not limited to, tamoxifen, raloxifene, idoxifene, LY353381, LY117081, toremifene, fulvestrant, 4-[7-(2,2-dimethyl-1-oxopropoxy-4-methyl-2-[4-[2-(1-piperidinyl)ethoxy]ph- enyl]-2H-1-benzopyran-3-yl]-phenyl-2,2-dimethylpropanoate, 4,4'-dihydroxybenzophenone-2,4-dinitrophenyl-hydrazone, and SH646.

[0643] "Androgen receptor modulators" refers to compounds which interfere or inhibit the binding of androgens to the receptor, regardless of mechanism. Examples of androgen receptor modulators include finasteride and other 5.alpha.-reductase inhibitors, nilutamide, flutamide, bicalutamide, liarozole, and abiraterone acetate.

[0644] "Retinoid receptor modulators" refers to compounds which interfere or inhibit the binding of retinoids to the receptor, regardless of mechanism. Examples of such retinoid receptor modulators include bexarotene, tretinoin, 13-cis-retinoic acid, 9-cis-retinoic acid, .alpha.-difluoromethylornithine, ILX23-7553, trans-N-(4'-hydroxyphenyl) retinamide, and N-4-carboxyphenyl retinamide.

[0645] "Cytotoxic/cytostatic agents" refer to compounds which cause cell death or inhibit cell proliferation primarily by interfering directly with the cell's functioning or inhibit or interfere with cell myosis, including alkylating agents, tumor necrosis factors, intercalators, hypoxia activatable compounds, microtubule inhibitors/microtubule-stabilizing agents, inhibitors of mitotic kinesins, histone deacetylase inhibitors, inhibitors of kinases involved in mitotic progression, inhibitors of kinases involved in growth factor and cytokine signal transduction pathways, antimetabolites, biological response modifiers, hormonal/anti-hormonal therapeutic agents, haematopoietic growth factors, monoclonal antibody targeted therapeutic agents, topoisomerase inhibitors, proteosome inhibitors, ubiquitin ligase inhibitors, and aurora kinase inhibitors.

[0646] Examples of cytotoxic/cytostatic agents include, but are not limited to, platinum coordinator compounds, sertenef, cachectin, ifosfamide, tasonermin, lonidamine, carboplatin, altretamine, prednimustine, dibromodulcitol, ranimustine, fotemustine, nedaplatin, oxaliplatin, temozolomide, heptaplatin, estramustine, improsulfan tosilate, trofosfamide, nimustine, dibrospidium chloride, pumitepa, lobaplatin, satraplatin, profiromycin, cisplatin, irofulven, dexifosfamide, cis-aminedichloro(2-methyl-pyridine)platinum, benzylguanine, glufosfamide, GPX100, (trans, trans, trans)-bis-mu-(hexane-1,6-diamine)-mu-[diamine-platinum(II)]bis[diamine(c- hloro)platinum (Th]tetrachloride, diarizidinylspermine, arsenic trioxide, 1-(11-dodecylamino-10-hydroxyundecyl)-3,7-dimethylxanthine, zorubicin, idarubicin, daunorubicin, bisantrene, mitoxantrone, pirarubicin, pinafide, valrubicin, amrubicin, antineoplaston, 3'-deamino-3'-morpholino-13-deoxo-10-hydroxycarminomycin, annamycin, galarubicin, elinafide, MEN10755, 4-demethoxy-3-deamino-3-aziridinyl-4-methylsulphonyl-daunorubicin (see WO 00/50032).

[0647] An example of a hypoxia activatable compound is tirapazamine.

[0648] Examples of proteosome inhibitors include but are not limited to lactacystin and MLN-341 (Velcade).

[0649] Examples of microtubule inhibitors/microtubule-stabilising agents include taxanes in general. Specific compounds include paclitaxel (Taxol.RTM.), vindesine sulfate, 3',4'-didehydro-4'-deoxy-8'-norvincaleukoblastine, docetaxol (Taxotere.RTM.), rhizoxin, dolastatin, mivobulin isethionate, auristatin, cemadotin, RPR109881, BMS184476, vinflunine, cryptophycin, 2,3,4,5,6-pentafluoro-N-(3-fluoro-4-methoxyphenyl) benzene sulfonamide, anhydrovinblastine, N,N-dimethyl-L-valyl-L-valyl-N-methyl-L-valyl-L-prolyl-L-proline-t-butyla- mide, TDX258, the epothilones (see for example U.S. Pat. Nos. 6,284,781 and 6,288,237) and BMS188797.

[0650] Some examples of topoisomerase inhibitors are topotecan, hycaptamine, irinotecan, rubitecan, 6-ethoxypropionyl-3',4'-O-exo-benzylidene-chartreusin, 9-methoxy-N,N-dimethyl-5-nitropyrazolo[3,4,5-kl]acridine-2-(6H) propanamine, 1-amino-9-ethyl-5-fluoro-2,3-dihydro-9-hydroxy-4-methyl-1H,12H-benzo[de]p- yrano[3',4':b,7]-indolizino[1,2b]quinoline-10,13(9H,15H)dione, lurtotecan, 7-[2-(N-isopropylamino)ethyl]-(20S)camptothecin, BNP1350, BNPI1100, BN80915, BN80942, etoposide phosphate, teniposide, sobuzoxane, 2'-dimethylamino-2'-deoxy-etoposide, GL331, N-[2-(dimethylamino)ethyl]-9-hydroxy-5,6-dimethyl-6H-pyrido[4,3-b]carbazo- le-1-carboxamide, asulacrine, (5a, 5aB, 8aa, 9b)-9-[2-[N-[2-(dimethylamino)ethyl]-N-methylamino]ethyl]-5-[4-hydro0xy-3- ,5-dimethoxyphenyl]-5,5a,6,8,8a,9-hexohydrofuro(3',4':6,7)naphtho(2,3-d)-1- ,3-dioxol-6-one, 2,3-(methylenedioxy)-5-methyl-7-hydroxy-8-methoxybenzo[c]-phenanthridiniu- m, 6,9-bis[(2-aminoethyl)amino]benzo[g]isoguinoline-5,10-dione, 5-(3-aminopropylamino)-7,10-dihydroxy-2-(2-hydroxyethylaminomethyl)-6H-py- razolo[4,5,1-de]acridin-6-one, N-[1-[2(diethylamino)ethylamino]-7-methoxy-9-oxo-9H-thioxanthen-4-ylmethy- l]formamide, N-(2-(dimethylamino)ethyl)acridine-4-carboxamide, 6-[[2-(dimethylamino)ethyl]amino]-3-hydroxy-7H-indeno[2,1-c] quinolin-7-one, and dimesna.

[0651] Examples of inhibitors of mitotic kinesins, and in particular the human mitotic kinesin KSP, are described in Publications WO03/039460, WO03/050064, WO03/050122, WO03/049527, WO03/049679, WO03/049678, WO04/039774, WO03/079973, WO03/099211, WO03/105855, WO03/106417, WO04/037171, WO04/058148, WO04/058700, WO04/126699, WO05/018638, WO05/019206, WO05/019205, WO05/018547, WO05/017190, US2005/0176776. In an embodiment inhibitors of mitotic kinesins include, but are not limited to inhibitors of KSP, inhibitors of MKLP1, inhibitors of CENP-E, inhibitors of MCAK and inhibitors of Rab6-KIFL.

[0652] Examples of "histone deacetylase inhibitors" include, but are not limited to, SAHA, TSA, oxamflatin, PXD101, MG98 and scriptaid. Further reference to other histone deacetylase inhibitors may be found in the following manuscript; Miller, T. A. et al. J. Med. Chem. 46(24):5097-5116 (2003).

[0653] "Inhibitors of kinases involved in mitotic progression" include, but are not limited to, inhibitors of aurora kinase, inhibitors of Polo-like kinases (PLK; in particular inhibitors of PLK-1), inhibitors of bub-1 and inhibitors of bub-R1. An example of an "aurora kinase inhibitor" is VX-680.

[0654] "Antiproliferative agents" includes antisense RNA and DNA oligonucleotides such as G3139, ODN698, RVASKRAS, GEM231, and INX3001, and antimetabolites such as enocitabine, carmofur, tegafur, pentostatin, doxifluridine, trimetrexate, fludarabine, capecitabine, galocitabine, cytarabine ocfosfate, fosteabine sodium hydrate, raltitrexed, paltitrexid, emitefur, tiazofurin, decitabine, nolatrexed, pemetrexed, nelzarabine, 2'-deoxy-2'-methylidenecytidine, 2'-fluoromethylene-2'-deoxycytidine, N-[5-(2,3-dihydro-benzofuryl)sulfonyl]-N'-(3,4-dichlorophenyl)urea, N6-[4-deoxy-4-[N2-[2(E),4(E)-tetradecadienoyl]glycylamino]-L-glycero-B-L-- manno-heptopyranosyl]adenine, aplidine, ecteinascidin, troxacitabine, 4-[2-amino-4-oxo-4,6,7,8-tetrahydro-3H-pyrimidino[5,4-b][1,4]thiazin-6-yl- -(S)-ethyl]-2,5-thienoyl-L-glutamic acid, aminopterin, 5-flurouracil, alanosine, 11-acetyl-8-(carbamoyloxymethyl)-4-formyl-6-methoxy-14-oxa-1,11-diazatetr- acyclo(7.4.1.0.0)-tetradeca-2,4,6-trien-9-yl acetic acid ester, swainsonine, lometrexol, dexrazoxane, methioninase, 2'-cyano-2'-deoxy-N4-palmitoyl-1-B-D-arabino furanosyl cytosine, 3-aminopyridine-2-carboxaldehyde thiosemicarbazone and trastuzumab.

[0655] Examples of monoclonal antibody targeted therapeutic agents include those therapeutic agents which have cytotoxic agents or radioisotopes attached to a cancer cell specific or target cell specific monoclonal antibody. Examples include Bexxar.

[0656] "Prenyl-protein transferase inhibitor" refers to a compound which inhibits any one or any combination of the prenyl-protein transferase enzymes, including farnesyl-protein transferase (FPTase), geranylgeranyl-protein transferase type I (GGPTase-I), and geranylgeranyl-protein transferase type-II (GGPTase-II, also called Rab GGPTase).

[0657] Examples of prenyl-protein transferase inhibitors can be found in the following publications and patents: WO 96/30343, WO 97/18813, WO 97/21701, WO 97/23478, WO 97/38665, WO 98/28980, WO 98/29119, WO 95/32987, U.S. Pat. Nos. 5,420,245, 5,523,430, 5,532,359, 5,510,510, 5,589,485, 5,602,098, European Patent Publ. 0 618 221, European Patent Publ. 0 675 112, European Patent Publ. 0 604 181, European Patent Publ. 0 696 593, WO 94/19357, WO 95/08542, WO 95/11917, WO 95/12612, WO 95/12572, WO 95/10514, U.S. Pat. No. 5,661,152, WO 95/10515, WO 95/10516, WO 95/24612, WO 95/34535, WO 95/25086, WO 96/05529, WO 96/06138, WO 96/06193, WO 96/16443, WO 96/21701, WO 96/21456, WO 96/22278, WO 96/24611, WO 96/24612, WO 96/05168, WO 96/05169, WO 96/00736, U.S. Pat. No. 5,571,792, WO 96/17861, WO 96/33159, WO 96/34850, WO 96/34851, WO 96/30017, WO 96/30018, WO 96/30362, WO 96/30363, WO 96/31111, WO 96/31477, WO 96/31478, WO 96/31501, WO 97/00252, WO 97/03047, WO 97/03050, WO 97/04785, WO 97/02920, WO 97/17070, WO 97/23478, WO 97/26246, WO 97/30053, WO 97/44350, WO 98/02436, and U.S. Pat. No. 5,532,359. For an example of the role of a prenyl-protein transferase inhibitor on angiogenesis see European J. of Cancer, Vol. 35, No. 9, pp. 1394-1401 (1999).

[0658] "Angiogenesis inhibitors" refers to compounds that inhibit the formation of new blood vessels, regardless of mechanism. Examples of angiogenesis inhibitors include, but are not limited to, tyrosine kinase inhibitors, such as inhibitors of the tyrosine kinase receptors Flt-1 (VEGFR1) and Flk-1/KDR (VEGFR2), inhibitors of epidermal-derived, fibroblast-derived, or platelet derived growth factors, MMP (matrix metalloprotease) inhibitors, integrin blockers, interferon-a, interleukin-12, pentosan polysulfate, cyclooxygenase inhibitors, including nonsteroidal anti-inflammatories (NSAIDs) like aspirin and ibuprofen as well as selective cyclooxy-genase-2 inhibitors like celecoxib and rofecoxib (PNAS, Vol. 89, p. 7384 (1992); JNCI, Vol. 69, p. 475 (1982); Arch. Opthalmol., Vol. 108, p. 573 (1990); Anat. Rec., Vol. 238, p. 68 (1994); FEBS Letters, Vol. 372, p. 83 (1995); Clin, Orthop. Vol. 313, p. 76 (1995); J. Mol. Endocrinol., Vol. 16, p. 107 (1996); Jpn. J. Pharmacol., Vol. 75, p. 105 (1997); Cancer Res., Vol. 57, p. 1625 (1997); Cell, Vol. 93, p. 705 (1998); Intl. J. Mol. Med., Vol. 2, p. 715 (1998); J. Biol. Chem., Vol. 274, p. 9116 (1999)), steroidal anti-inflammatories (such as corticosteroids, mineralocorticoids, dexamethasone, prednisone, prednisolone, methylpred, betamethasone), carboxyamidotriazole, combretastatin A-4, squalamine, 6-O-chloroacetyl-carbonyl)-fumagillol, thalidomide, angiostatin, troponin-1, angiotensin II antagonists (see Fernandez et al., J. Lab. Clin. Med. 105: 141-145 (1985)), and antibodies to VEGF (see, Nature Biotechnology, Vol. 17, pp. 963-968 (October 1999); Kim et al., Nature, 362, 841-844 (1993); WO 00/44777; and WO 00/61186).

[0659] Other examples of angiogenesis inhibitors include, but are not limited to, endostatin, ukrain, ranpirnase, IM862, 5-methoxy-4-[2-methyl-3-(3-methyl-2-butenyl)oxiranyl]-1-oxaspiro[2,5]oct-- 6-yl(chloroacetyl)carbamate, acetyldinanaline, 5-amino-1-[ [3,5-dichloro-4-(4-chlorobenzoyl)phenyl]methyl]-1H-1,2,3-triazole-4-carbo- xamide,CM101, squalamine, combretastatin, RPI4610, NX31838, sulfated mannopentaose phosphate, 7,7-(carbonyl-bis[imino-N-methyl-4,2-pyrrolocarbonylimino[N-methyl-4,2-py- rrole]-carbonylimino]-bis-(1,3-naphthalene disulfonate), and 3-[(2,4-dimethylpyrrol-5-yl)methylene]-2-indolinone (SU5416).

[0660] Other therapeutic agents that modulate or inhibit angiogenesis and may also be used in combination with the compounds of the instant invention include agents that modulate or inhibit the coagulation and fibrinolysis systems (see review in Clin. Chem. La. Med. 38:679-692 (2000)). Examples of such agents that modulate or inhibit the coagulation and fibrinolysis pathways include, but are not limited to, heparin (see Thromb. Haemost. 80:10-23 (1998)), low molecular weight heparins and carboxypeptidase U inhibitors (also known as inhibitors of active thrombin activatable fibrinolysis inhibitor [TAFIa]) (see Thrombosis Res. 101:329-354 (2001)). TAFIa inhibitors have been described in U.S. Ser. Nos. 60/310,927 (filed Aug. 8, 2001) and 60/349,925 (filed Jan. 18, 2002).

[0661] "Agents that interfere with cell cycle checkpoints" refer to compounds that inhibit protein kinases that transduce cell cycle checkpoint signals, thereby sensitizing the cancer cell to DNA damaging agents. Such agents include inhibitors of ATR, ATM, the CHK11 and CHK12 kinases and cdk and cdc kinase inhibitors and are specifically exemplified by 7-hydroxystaurosporin, flavopiridol, CYC202 (Cyclacel) and BMS-387032.

[0662] "Agents that interfere with receptor tyrosine kinases (RTKs)" refer to compounds that inhibit RTKs and therefore mechanisms involved in oncogenesis and tumor progression. Such agents include inhibitors of c-Kit, Eph, PDGF, Flt3 and c-Met. Further agents include inhibitors of RTKs as described by Bume-Jensen and Hunter, Nature, 411:355-365, 2001.

[0663] "Inhibitors of cell proliferation and survival signalling pathway" refer to compounds that inhibit signal transduction cascades downstream of cell surface receptors. Such agents include inhibitors of serine/threonine kinases (including but not limited to inhibitors of Akt such as described in WO 02/083064, WO 02/083139, WO 02/083140, US 2004-0116432, WO 02/083138, US 2004-0102360, WO 03/086404, WO 03/086279, WO 03/086394, WO 03/084473, WO 03/086403, WO 2004/041162, WO 2004/096131, WO 2004/096129, WO 2004/096135, WO 2004/096130, WO 2005/100356, WO 2005/100344, US 2005/029941, US 2005/44294, US 2005/43361, 60/734188, 60/652737, 60/670469), inhibitors of Raf kinase (for example PLX-4032), inhibitors of MEK (for example Arry-162, RO-4987655 and GSK-1120212), inhibitors of mTOR (for example AZD-8055, BEZ-235 and everolimus), and inhibitors of PI3K (for example GDC-0941, BKM-120).

[0664] As used above, "integrin blockers" refers to compounds which selectively antagonize, inhibit or counteract binding of a physiological ligand to the .alpha..sub.v.beta..sub.3integrin, to compounds which selectively antagonize, inhibit or counteract binding of a physiological ligand to the .alpha.v.beta.5 integrin, to compounds which antagonize, inhibit or counteract binding of a physiological ligand to both the .alpha..sub.v.beta..sub.3 integrin and the .alpha..sub.v.beta..sub.5 integrin, and to compounds which antagonize, inhibit or counteract the activity of the particular integrin(s) expressed on capillary endothelial cells. The term also refers to antagonists of the .alpha..sub.v.beta..sub.6, .alpha..sub.v.beta..sub.8, .alpha..sub.1.beta..sub.1, .alpha..sub.2.beta..sub.1, .alpha..sub.5.beta..sub.1, .alpha..sub.6.beta..sub.1, and .alpha..sub.6.beta..sub.4 integrins. The term also refers to antagonists of any combination of .alpha..sub.v.beta..sub.3, .alpha..sub.v.beta..sub.5, .alpha..sub.v.beta..sub.8, .alpha..sub.1.beta..sub.1, .alpha..sub.2.beta..sub.1, .alpha..sub.5.beta..sub.1, .alpha..sub.6.beta..sub.1, and .alpha..sub.6.beta..sub.4 integrins.

[0665] Some specific examples of tyrosine kinase inhibitors include N-(trifluoromethylphenyl)-5-methylisoxazol-4-carboxamide, 3-[(2,4-dimethylpyrrol-5-yl)methylidenyl)indolin-2-one, 17-(allylamino)-17-demethoxygeldanamycin, 4-(3-chloro-4-fluorophenylamino)-7-methoxy-6-[3-(4-morpholinyl)propoxyl]q- uinazoline, N-(3-ethynylphenyl)-6,7-bis(2-methoxyethoxy)-4-quinazolinamine, BIBX1382, 2,3,9,10,11,12-hexahydro-10-(hydroxymethyl)-10-hydroxy-9-methyl-9,12-epox- y-1H-diindolo[1,2,3-fg:3`',2`,1'-kl]pyrrolo[3,4-i][1,6]benzodiazocin-1-one- , SH268, genistein, STI571, CEP2563, 4-(3-chlorophenylamino)-5,6-dimethyl-7H-pyrrolo[2,3-d]pyrimidinemethane sulfonate, 4-(3-bromo-4-hydroxyphenyl)amino-6,7-dimethoxyquinazoline, 4-(4'-hydroxyphenyl)amino-6,7-dimethoxyquinazoline, SU6668, STI571A, N-4-chlorophenyl-4-(4-pyridylmethyl)-1-phthalazinamine, and EMD121974.

[0666] Combinations of the instantly claimed antibodies or antigen binding fragments with PPAR-.gamma. (i.e., PPAR-gamma) agonists and PPAR-.delta. (i.e., PPAR-delta) agonists may be useful in the treatment of certain malignancies. PPAR-.gamma. and PPAR-.delta. are the nuclear peroxisome proliferator-activated receptors .gamma. and .delta.. The expression of PPAR-.gamma. on endothelial cells and its involvement in angiogenesis has been reported in the literature (see J. Cardiovasc. Pharmacol. 1998; 31: 909-913; J. Biol. Chem. 1999; 274: 9116-9121; Invest. Ophthalmol Vis. Sci. 2000; 41: 2309-2317). More recently, PPAR-.gamma. agonists have been shown to inhibit the angiogenic response to VEGF in vitro; both troglitazone and rosiglitazone maleate inhibit the development of retinal neovascularization in mice. (Arch. Ophthamol. 2001; 119: 709-717). Examples of PPAR-.gamma. agonists and PPAR-.gamma./.alpha. agonists include, but are not limited to, Lynparza.RTM., Rucaparib.RTM., Talazoparib.RTM., niraparib, Veliparib.RTM., thiazolidinediones (such as DRF2725, CS-011, troglitazone, rosiglitazone, and pioglitazone), fenofibrate, gemfibrozil, clofibrate, GW2570, SB219994, AR-H039242, JTT-501, MCC-555, GW2331, GW409544, NN2344, KRP297, NP0110, DRF4158, NN622, GI262570, PNU182716, DRF552926, 2-[(5,7-dipropyl-3-trifluoromethyl-1,2-benzisoxazol-6-yl)oxy]-2-methylpro- pionic acid, and 2(R)-7-(3-(2-chloro-4-(4-fluorophenoxy) phenoxy)propoxy)-2-ethylchromane-2-carboxylic acid.

[0667] The antibody or antigen binding fragment of the instant invention may also be useful for treating or preventing breast cancer in combination with aromatase inhibitors. Examples of aromatase inhibitors include but are not limited to: anastrozole, letrozole and exemestane.

[0668] The antibody or antigen binding fragment of the instant invention may also be useful for treating cancer in combination with the following chemotherapeutic agents: abarelix (Plenaxis depot.RTM.); aldesleukin (Prokine.RTM.); Aldesleukin (Proleukin.RTM.); Alemtuzumab (Campath.RTM.); alitretinoin (Panretin.RTM.); allopurinol (Zyloprim.RTM.); altretamine (Hexalen.RTM.); amifostine (Ethyol.RTM.); anastrozole (Arimidex.RTM.); arsenic trioxide (Trisenox.RTM.); asparaginase (Elspar.RTM.); azacitidine (Vidaza.RTM.); bendamustine hydrochloride (Treanda.RTM.); bevacuzimab (Avastin.RTM.); bexarotene capsules (Targretin.RTM.); bexarotene gel (Targretin.RTM.); bleomycin (Blenoxane.RTM.); bortezomib (Velcade.RTM.); brefeldin A; busulfan intravenous (Busulfex.RTM.); busulfan oral (Myleran.RTM.); calusterone (Methosarb.RTM.); capecitabine (Xeloda.RTM.); carboplatin (Paraplatin.RTM.); carmustine (BCNU.RTM., BiCNU.RTM.); carmustine (Gliadel.RTM.); carmustine with Polifeprosan 20 Implant (Gliadel Wafer.RTM.); celecoxib (Celebrex.RTM.); cetuximab (Erbitux.RTM.); chlorambucil (Leukeran.RTM.); cisplatin (Platinol.RTM.); cladribine (Leustatin.RTM., 2-CdA.RTM.); clofarabine (Clolar.RTM.); cyclophosphamide (Cytoxan.RTM., Neosar.RTM.); cyclophosphamide (Cytoxan Injection.RTM.); cyclophosphamide (Cytoxan Tablet.RTM.); cytarabine (Cytosar-U.RTM.); cytarabine liposomal (DepoCyt.RTM.); dacarbazine (DTIC-Dome.RTM.); dactinomycin, actinomycin D (Cosmegen.RTM.); dalteparin sodium injection (Fragmin.RTM.); daratumumab (DARZALEX.RTM.); Darbepoetin alfa (Aranesp.RTM.); dasatinib (Sprycel.RTM.); daunorubicin liposomal (DanuoXome.RTM.); daunorubicin, daunomycin (Daunorubicin.RTM.); daunorubicin, daunomycin (Cerubidine.RTM.); degarelix (Firmagon.RTM.); Denileukin diftitox (Ontak.RTM.); dexrazoxane (Zinecard.RTM.); dexrazoxane hydrochloride (Totect.RTM.); didemnin B; 17-DMAG; docetaxel (Taxotere.RTM.); doxorubicin (Adriamycin PFS.RTM.); doxorubicin (Adriamycin.RTM., Rubex.RTM.); doxorubicin (Adriamycin PFS Injection.RTM.); doxorubicin liposomal (Doxil.RTM.); dromostanolone propionate (Dromostanolone.RTM.); dromostanolone propionate (Masterone Injection.RTM.); eculizumab injection (Soliris.RTM.); Elliott's B Solution (Elliott's B Solution.RTM.); eltrombopag (Promacta.RTM.); epirubicin (Ellence.RTM.); Epoetin alfa (Epogen.RTM.); erlotinib (Tarceva.RTM.); estramustine (Emcyt.RTM.); ethinyl estradiol; etoposide phosphate (Etopophos.RTM.); etoposide, VP-16 (Vepesid.RTM.); everolimus tablets (Afinitor.RTM.); exemestane (Aromasin.RTM.); ferumoxytol (Feraheme Injection.RTM.); Filgrastim (Neupogen.RTM.); floxuridine (intraarterial) (FUDR.RTM.); fludarabine (Fludara.RTM.); fluorouracil, 5-FU (Adrucil.RTM.); fulvestrant (Faslodex.RTM.); gefitinib (Iressa.RTM.); geldanamycin; gemcitabine (Gemzar.RTM.); gemtuzumab ozogamicin (Mylotarg.RTM.); goserelin acetate (Zoladex Implant.RTM.); goserelin acetate (Zoladex.RTM.); histrelin acetate (Histrelin implant.RTM.); hydroxyurea (Hydrea.RTM.); Ibritumomab Tiuxetan (Zevalin.RTM.); idarubicin (Idamycin.RTM.); ifosfamide (IFEX.RTM.); imatinib mesylate (Gleevec.RTM.); interferon alfa 2a (Roferon A.RTM.); Interferon alfa-2b (Intron A.RTM.); iobenguane I 123 injection (AdreView.RTM.); irinotecan (Camptosar.RTM.); ixabepilone (Ixempra.RTM.); lapatinib tablets (Tykerb.RTM.); lenalidomide (Revlimid.RTM.); letrozole (Femara.RTM.); leucovorin (Wellcovorin.RTM., Leucovorin.RTM.); Leuprolide Acetate (Eligard.RTM.); levamisole (Ergamisol.RTM.); lomustine, CCNU (CeeBU.RTM.); meclorethamine, nitrogen mustard (Mustargen.RTM.); megestrol acetate (Megace.RTM.); melphalan, L-PAM (Alkeran.RTM.); mercaptopurine, 6-MP (Purinethol.RTM.); mesna (Mesnex.RTM.); mesna (Mesnex tabs.RTM.); methotrexate (Methotrexate.RTM.); methoxsalen (Uvadex.RTM.); 8-methoxypsoralen; mitomycin C (Mutamycin.RTM.); mitotane (Lysodren.RTM.); mitoxantrone (Novantrone.RTM.); mitramycin; nandrolone phenpropionate (Durabolin-50.RTM.); nelarabine (Arranon.RTM.); nilotinib (Tasigna.RTM.); Nofetumomab (Verluma.RTM.); ofatumumab (Arzerra.RTM.); Oprelvekin (Neumega.RTM.); oxaliplatin (Eloxatin.RTM.); paclitaxel (Paxene.RTM.); paclitaxel (Taxol.RTM.); paclitaxel protein-bound particles (Abraxane.RTM.); palifermin (Kepivance.RTM.); pamidronate (Aredia.RTM.); panitumumab (Vectibix.RTM.); pazopanib tablets (Votrienttm.RTM.); pegademase (Adagen (Pegademase Bovine).RTM.); pegaspargase (Oncaspar.RTM.); Pegfilgrastim (Neulasta.RTM.); pemetrexed disodium (Alimta.RTM.); pentostatin (Nipent.RTM.); pipobroman (Vercyte.RTM.); plerixafor (Mozobil.RTM.); plicamycin, mithramycin (Mithracin.RTM.); porfimer sodium (Photofrin.RTM.); pralatrexate injection (Folotyn.RTM.); procarbazine (Matulane.RTM.); quinacrine (Atabrine.RTM.); rapamycin; Rasburicase (Elitek.RTM.); raloxifene hydrochloride (Evista.RTM.); Rituximab (Rituxan.RTM.); romidepsin (Istodax.RTM.); romiplostim (Nplate.RTM.); sargramostim (Leukine.RTM.); Sargramostim (Prokine.RTM.); sorafenib (Nexavar.RTM.); streptozocin (Zanosar.RTM.); sunitinib maleate (Sutent.RTM.); talc (Sclerosol.RTM.); tamoxifen (Nolvadex.RTM.); temozolomide (Temodar.RTM.); temsirolimus (Torisel.RTM.); teniposide, VM-26 (Vumon.RTM.); testolactone (Teslac.RTM.); thioguanine, 6-TG (Thioguanine.RTM.); thiopurine; thiotepa (Thioplex.RTM.); topotecan (Hycamtin.RTM.); toremifene (Fareston.RTM.); Tositumomab (Bexxar.RTM.); Tositumomab/I-131 tositumomab (Bexxar.RTM.); trans-retinoic acid; Trastuzumab (Herceptin.RTM.); tretinoin, ATRA (Vesanoid.RTM.); triethylenemelamine; Uracil Mustard (Uracil Mustard Capsules.RTM.); valrubicin (Valstar.RTM.); vinblastine (Velban.RTM.); vincristine (Oncovin.RTM.); vinorelbine (Navelbine.RTM.); vorinostat (Zolinza.RTM.); wortmannin; and zoledronate (Zometa.RTM.).

[0669] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is in association with one or more antiemetics including, but not limited to: casopitant (GlaxoSmithKline), Netupitant (MGI-Helsinn) and other NK-1 receptor antagonists, palonosetron (sold as Aloxi by MGI Pharma), aprepitant (sold as Emend by Merck and Co.; Rahway, N.J.), diphenhydramine (sold as Benadryl.RTM. by Pfizer; New York, N.Y.), hydroxyzine (sold as Atarax.RTM. by Pfizer; New York, N.Y.), metoclopramide (sold as Reglan.RTM. by AH Robins Co,; Richmond, Va.), lorazepam (sold as Ativan.RTM. by Wyeth; Madison, N.J.), alprazolam (sold as Xanax.RTM. by Pfizer; New York, N.Y.), haloperidol (sold as Haldol.RTM. by Ortho-McNeil; Raritan, N.J.), droperidol (Inapsine.RTM.), dronabinol (sold as Marinol.RTM. by Solvay Pharmaceuticals, Inc.; Marietta, Ga.), dexamethasone (sold as Decadron.RTM. by Merck and Co.; Rahway, N.J.), methylprednisolone (sold as Medrol.RTM. by Pfizer; New York, N.Y.), prochlorperazine (sold as Compazine.RTM. by Glaxosmithkline; Research Triangle Park, NC), granisetron (sold as Kytril.RTM. by Hoffmann-La Roche Inc.; Nutley, N.J.), ondansetron (sold as Zofran.RTM. by Glaxosmithkline; Research Triangle Park, NC), dolasetron (sold as Anzemet.RTM. by Sanofi-Aventis; New York, N.Y.), tropisetron (sold as Navoban.RTM. by Novartis; East Hanover, N.J.).

[0670] Other side effects of cancer treatment include red and white blood cell deficiency. Accordingly, in an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof is in association with an agent which treats or prevents such a deficiency, such as, e.g., filgrastim, PEG-filgrastim, erythropoietin, epoetin alfa or darbepoetin alfa.

[0671] In an embodiment of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention is administered in association with anti-cancer radiation therapy. For example, in an embodiment of the invention, the radiation therapy is external beam therapy (EBT): a method for delivering a beam of high-energy X-rays to the location of the tumor. The beam is generated outside the patient (e.g., by a linear accelerator) and is targeted at the tumor site. These X-rays can destroy the cancer cells and careful treatment planning allows the surrounding normal tissues to be spared. No radioactive sources are placed inside the patient's body. In an embodiment of the invention, the radiation therapy is proton beam therapy: a type of conformal therapy that bombards the diseased tissue with protons instead of X-rays. In an embodiment of the invention, the radiation therapy is conformal external beam radiation therapy: a procedure that uses advanced technology to tailor the radiation therapy to an individual's body structures. In an embodiment of the invention, the radiation therapy is brachytherapy: the temporary placement of radioactive materials within the body, usually employed to give an extra dose--or boost--of radiation to an area.

[0672] In an embodiment of the invention, a surgical procedure is administered in association with an anti-SIRP.alpha. antibody or antigen-binding fragment thereof is surgical tumorectomy.

Experimental and Diagnostic Uses

[0673] The anti-SIRP.alpha. antibodies and antigen-binding fragments thereof disclosed herein may be used as affinity purification agents. In this process, the anti-SIRP.alpha. antibodies and antigen-binding fragments thereof are immobilized on a solid phase such a Sephadex, glass or agarose resin or filter paper, using methods well known in the art. The immobilized antibody or fragment is contacted with a sample containing the SIRP.alpha. protein (or a fragment thereof) to be purified, and thereafter the support is washed with a suitable solvent that will remove substantially all the material in the sample except the SIRP.alpha. protein, which is bound to the immobilized antibody or fragment. Finally, the support is washed with a solvent which elutes the bound SIRP.alpha. (e.g., protein A). Such immobilized antibodies and fragments form part of the present invention.

[0674] Further provided are antigens for generating secondary antibodies which are useful for example for performing Western blots and other immunoassays discussed herein.

[0675] Anti-SIRP.alpha. antibodies (e.g., humanized antibodies) and antigen-binding fragments thereof may also be useful in diagnostic assays for SIRP.alpha. protein, e.g., detecting its expression in specific cells, tissues, or serum, e.g., myeloid cells such as monocytes, macrophages, neutrophils, basophils, eosinophils, and dendritic cells. Such diagnostic methods may be useful in various disease diagnoses.

[0676] The present invention includes ELISA assays (enzyme-linked immunosorbent assay) incorporating the use of an anti-SIRP.alpha. antibody or antigen-binding fragment thereof disclosed herein.

[0677] For example, such a method comprises the following steps:

(a) coat a substrate (e.g., surface of a microtiter plate well, e.g., a plastic plate) with anti-SIRP.alpha. antibody or antigen-binding fragment thereof; (b) apply a sample to be tested for the presence of SIRP.alpha. to the substrate; (c) wash the plate, so that unbound material in the sample is removed; (d) apply detectably labeled antibodies (e.g., enzyme-linked antibodies) which are also specific to the SIRP.alpha. antigen; (e) wash the substrate, so that the unbound, labeled antibodies are removed; (f) if the labeled antibodies are enzyme linked, apply a chemical which is converted by the enzyme into a fluorescent signal; and (g) detect the presence of the labeled antibody.

[0678] Detection of the label associated with the substrate indicates the presence of the SIRP.alpha. protein.

[0679] In a further embodiment, the labeled antibody or antigen-binding fragment thereof is labeled with peroxidase which react with ABTS (e.g., 2,2'-azino-bis(3-ethylbenzthiazoline-6-sulphonic acid)) or 3,3',5,5'-Tetramethylbenzidine to produce a color change which is detectable. Alternatively, the labeled antibody or fragment is labeled with a detectable radioisotope (e.g., .sup.3H) which can be detected by scintillation counter in the presence of a scintillant.

[0680] An anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention may be used in a Western blot or immune-protein blot procedure. Such a procedure forms part of the present invention and includes e.g.:

[0681] (1) optionally transferring proteins from a sample to be tested for the presence of SIRP.alpha. (e.g., from a PAGE or SDS-PAGE electrophoretic separation of the proteins in the sample) onto a membrane or other solid substrate using a method known in the art (e.g., semi-dry blotting or tank blotting); contacting the membrane or other solid substrate to be tested for the presence of bound SIRP.alpha. or a fragment thereof with an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention.

[0682] (2) washing the membrane one or more times to remove unbound anti-SIRP.alpha. antibody or fragment and other unbound substances; and

[0683] (3) detecting the bound anti-SIRP.alpha. antibody or fragment.

[0684] Such a membrane may take the form of a nitrocellulose or vinyl-based (e.g., polyvinylidene fluoride (PVDF)) membrane to which the proteins to be tested for the presence of SIRP.alpha. in a non-denaturing PAGE (polyacrylamide gel electrophoresis) gel or SDS-PAGE (sodium dodecyl sulfate polyacrylamide gel electrophoresis) gel have been transferred (e.g., following electrophoretic separation in the gel). Before contacting the membrane with the anti-SIRP.alpha. antibody or fragment, the membrane is optionally blocked, e.g., with non-fat dry milk or the like so as to bind non-specific protein binding sites on the membrane.

[0685] Detection of the bound antibody or fragment indicates that the SIRP.alpha. protein is present on the membrane or substrate and in the sample. Detection of the bound antibody or fragment may be by binding the antibody or fragment with a secondary antibody (an anti-immunoglobulin antibody) which is detectably labeled and, then, detecting the presence of the secondary antibody.

[0686] The anti-SIRP.alpha. antibodies and antigen-binding fragments thereof disclosed herein may also be used for immunohistochemistry. Such a method forms part of the present invention and comprises, e.g.,

[0687] (1) contacting a cell (e.g., a sample containing myeloid cells such as monocytes, macrophages, neutrophils, basophils, eosinophils, and dendritic cells) to be tested for the presence of SIRP.alpha. protein with an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention; and

[0688] (2) detecting the antibody or fragment on or in the cell.

[0689] If the antibody or fragment itself is detectably labeled, it can be detected directly. Alternatively, the antibody or fragment may be bound by a detectably labeled secondary antibody which is detected.

[0690] Certain anti-SIRP.alpha. antibodies and antigen-binding fragments thereof disclosed herein may also be used for in vivo tumor imaging. Such a method may include injection of a radiolabeled anti-SIRP.alpha. antibody or antigen-binding fragment thereof into the body of a patient to be tested for the presence of a tumor associated with SIRP.alpha. expression (e.g., which expresses SIRP.alpha., for example, on the tumor cell surface) followed by nuclear imaging of the body of the patient to detect the presence of the labeled antibody or fragment e.g., at loci comprising a high concentration of the antibody or fragment which are bound to the tumor. The detection of the loci indicates the presence of the SIRP.alpha..sup.+ tumor and tumor cells.

[0691] Imaging techniques include SPECT imaging (single photon emission computed tomography) or PET imaging (positron emission tomography). Labels include e.g., iodine-123 (.sup.123I) and technetium-99m (.sup.99mTc), e.g., in conjunction with SPECT imaging or .sup.11C, .sup.13N, .sup.15O or .sup.18F, e.g., in conjunction with PET imaging or Indium-111 (See e.g., Gordon et al., (2005) International Rev. Neurobiol. 67:385-440).

Pharmaceutical Compositions and Administration

[0692] To prepare pharmaceutical or sterile compositions of the anti-SIRP.alpha. antibodies and antigen-binding fragments of the invention, the antibody or antigen-binding fragment thereof is admixed with a pharmaceutically acceptable carrier or excipient. See, e.g., Remington's Pharmaceutical Sciences and U.S. Pharmacopeia: National Formulary, Mack Publishing Company, Easton, Pa. (1984).

[0693] Formulations of therapeutic and diagnostic agents may be prepared by mixing with acceptable carriers, excipients, or stabilizers in the form of, e.g., lyophilized powders, slurries, aqueous solutions or suspensions (see, e.g., Hardman, et al. (2001) Goodman and Gilman's The Pharmacological Basis of Therapeutics, McGraw-Hill, New York, N.Y.; Gennaro (2000) Remington: The Science and Practice of Pharmacy, Lippincott, Williams, and Wilkins, New York, N.Y.; Avis, et al. (eds.) (1993) Pharmaceutical Dosage Forms: Parenteral Medications, Marcel Dekker, N.Y.; Lieberman, et al. (eds.) (1990) Pharmaceutical Dosage Forms: Tablets, Marcel Dekker, N.Y.; Lieberman, et al. (eds.) (1990) Pharmaceutical Dosage Forms: Disperse Systems, Marcel Dekker, N.Y.; Weiner and Kotkoskie (2000) Excipient Toxicity and Safety, Marcel Dekker, Inc., New York, N.Y.).

[0694] Toxicity and therapeutic efficacy of the antibodies of the invention, administered alone or in combination with another therapeutic agent, can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD.sub.50 (the dose lethal to 50% of the population) and the ED.sub.50 (the dose therapeutically effective in 50% of the population). The dose ratio between toxic and therapeutic effects is the therapeutic index (LD.sub.50/ED.sub.50). The data obtained from these cell culture assays and animal studies can be used in formulating a range of dosage for use in human. The dosage of such compounds lies preferably within a range of circulating concentrations that include the ED.sub.50 with little or no toxicity. The dosage may vary within this range depending upon the dosage form employed and the route of administration.

[0695] In a further embodiment, a further therapeutic agent that is administered to a subject in association with an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention in accordance with the Physicians' Desk Reference 2003 (Thomson Healthcare; 57th edition (Nov. 1, 2002)).

[0696] The mode of administration can vary. Routes of administration include oral, rectal, transmucosal, intestinal, parenteral; intramuscular, subcutaneous, intradermal, intramedullary, intrathecal, direct intraventricular, intravenous, intraperitoneal, intranasal, intraocular, inhalation, insufflation, topical, cutaneous, transdermal, or intra-arterial.

[0697] In particular embodiments, the anti-SIRP.alpha. antibodies or antigen-binding fragments thereof of the invention can be administered by an invasive route such as by injection. In further embodiments of the invention, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof, or pharmaceutical composition thereof, is administered intravenously, subcutaneously, intramuscularly, intraarterially, intratumorally, or by inhalation, aerosol delivery. Administration by non-invasive routes (e.g., orally; for example, in a pill, capsule or tablet) is also within the scope of the present invention.

[0698] The present invention provides a vessel (e.g., a plastic or glass vial, e.g., with a cap or a chromatography column, hollow bore needle or a syringe cylinder) comprising any of the antibodies or antigen-binding fragments of the invention or a pharmaceutical composition thereof. The present invention also provides an injection device comprising any of the antibodies or antigen-binding fragments of the invention or a pharmaceutical composition thereof. An injection device is a device that introduces a substance into the body of a patient via a parenteral route, e.g., intramuscular, subcutaneous or intravenous. For example, an injection device may be a syringe (e.g., pre-filled with the pharmaceutical composition, such as an auto-injector) which, for example, includes a cylinder or barrel for holding fluid to be injected (e.g., antibody or fragment or a pharmaceutical composition thereof), a needle for piecing skin and/or blood vessels for injection of the fluid; and a plunger for pushing the fluid out of the cylinder and through the needle bore. In an embodiment of the invention, an injection device that comprises an antibody or antigen-binding fragment thereof of the present invention or a pharmaceutical composition thereof is an intravenous (IV) injection device. Such a device includes the antibody or fragment or a pharmaceutical composition thereof in a cannula or trocar/needle which may be attached to a tube which may be attached to a bag or reservoir for holding fluid (e.g., saline; or lactated ringer solution comprising NaCl, sodium lactate, KCl, CaCl.sub.2) and optionally including glucose) introduced into the body of the patient through the cannula or trocar/needle. The antibody or fragment or a pharmaceutical composition thereof may, in an embodiment of the invention, be introduced into the device once the trocar and cannula are inserted into the vein of a subject and the trocar is removed from the inserted cannula. The IV device may, for example, be inserted into a peripheral vein (e.g., in the hand or arm); the superior vena cava or inferior vena cava, or within the right atrium of the heart (e.g., a central IV); or into a subclavian, internal jugular, or a femoral vein and, for example, advanced toward the heart until it reaches the superior vena cava or right atrium (e.g., a central venous line). In an embodiment of the invention, an injection device is an autoinjector; a jet injector or an external infusion pump. A jet injector uses a high-pressure narrow jet of liquid which penetrate the epidermis to introduce the antibody or fragment or a pharmaceutical composition thereof to a patient's body. External infusion pumps are medical devices that deliver the antibody or fragment or a pharmaceutical composition thereof into a patient's body in controlled amounts. External infusion pumps may be powered electrically or mechanically. Different pumps operate in different ways, for example, a syringe pump holds fluid in the reservoir of a syringe, and a moveable piston controls fluid delivery, an elastomeric pump holds fluid in a stretchable balloon reservoir, and pressure from the elastic walls of the balloon drives fluid delivery. In a peristaltic pump, a set of rollers pinches down on a length of flexible tubing, pushing fluid forward. In a multi-channel pump, fluids can be delivered from multiple reservoirs at multiple rates.

[0699] The pharmaceutical compositions disclosed herein may also be administered with a needleless hypodermic injection device; such as the devices disclosed in U.S. Pat. Nos. 6,620,135; 6,096,002; 5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824 or 4,596,556. Such needleless devices comprising the pharmaceutical composition are also part of the present invention. The pharmaceutical compositions disclosed herein may also be administered by infusion. Examples of well-known implants and modules for administering the pharmaceutical compositions include those disclosed in: U.S. Pat. No. 4,487,603, which discloses an implantable micro-infusion pump for dispensing medication at a controlled rate; U.S. Pat. No. 4,447,233, which discloses a medication infusion pump for delivering medication at a precise infusion rate; U.S. Pat. No. 4,447,224, which discloses a variable flow implantable infusion apparatus for continuous drug delivery; U.S. Pat. No. 4,439,196, which discloses an osmotic drug delivery system having multi-chamber compartments. Many other such implants, delivery systems, and modules are well known to those skilled in the art and those comprising the pharmaceutical compositions of the present invention are within the scope of the present invention.

[0700] Alternately, one may administer the anti-SIRP.alpha. antibody or antigen-binding fragment of the invention in a local rather than systemic manner, for example, via injection of the antibody or fragment directly into a tumor. Furthermore, one may administer the antibody or fragment in a targeted drug delivery system, for example, in a liposome coated with a tissue-specific antibody, targeting, for example, a tumor. The liposomes will be targeted to and taken up selectively by the afflicted tissue. Such methods and liposomes are part of the present invention.

[0701] The administration regimen depends on several factors, including the serum or tissue turnover rate of the therapeutic antibody or antigen-binding fragment, the level of symptoms, the immunogenicity of the therapeutic antibody, and the accessibility of the target cells in the biological matrix. Preferably, the administration regimen delivers sufficient therapeutic antibody or fragment to effect improvement in the target disease state, while simultaneously minimizing undesired side effects. Accordingly, the amount of biologic delivered depends in part on the particular therapeutic antibody and the severity of the condition being treated. Guidance in selecting appropriate doses of therapeutic antibodies or fragments is available (see, e.g., Wawrzynczak (1996) Antibody Therapy, Bios Scientific Pub. Ltd, Oxfordshire, UK; Kresina (ed.) (1991) Monoclonal Antibodies, Cytokines and Arthritis, Marcel Dekker, New York, N.Y.; Bach (ed.) (1993) Monoclonal Antibodies and Peptide Therapy in Autoimmune Diseases, Marcel Dekker, New York, N.Y.; Baert, et al. (2003) New Engl. J. Med. 348:601-608; Milgrom et al. (1999) New Engl. J. Med. 341:1966-1973; Slamon et al. (2001) New Engl. J. Med. 344:783-792; Beniaminovitz et al. (2000) New Engl. J. Med. 342:613-619; Ghosh et al. (2003) New Engl. J. Med. 348:24-32; Lipsky et al. (2000) New Engl. J. Med. 343:1594-1602).

[0702] Determination of the appropriate dose is made by the clinician, e.g., using parameters or factors known or suspected in the art to affect treatment. Generally, the dose begins with an amount somewhat less than the optimum dose and it is increased by small increments thereafter until the desired or optimum effect is achieved relative to any negative side effects. Important diagnostic measures include those of symptoms of, e.g., the inflammation or level of inflammatory cytokines produced. In general, it is desirable that a biologic that will be used is derived from the same species as the animal targeted for treatment, thereby minimizing any immune response to the reagent. In the case of human subjects, for example, humanized and fully human antibodies may be desirable.

[0703] Antibodies or antigen-binding fragments thereof disclosed herein may be provided by continuous infusion, or by doses administered, e.g., daily, 1-7 times per week, weekly, bi-weekly, monthly, bimonthly, quarterly, semiannually, annually etc. Doses may be provided, e.g., intravenously, subcutaneously, topically, orally, nasally, rectally, intramuscular, intracerebrally, intraspinally, or by inhalation. A total weekly dose is generally at least 0.05 .mu.g/kg body weight, more generally at least 0.2 .mu.g/kg, 0.5 .mu.g/kg, 1 .mu.g/kg, 10 .mu.g/kg, 100 .mu.g/kg, 0.25 mg/kg, 1.0 mg/kg, 2.0 mg/kg, 5.0 mg/mL, 10 mg/kg, 25 mg/kg, 50 mg/kg or more (see, e.g., Yang, et al. (2003) New Engl. J. Med. 349:427-434; Herold, et al. (2002) New Engl. J. Med. 346:1692-1698; Liu, et al. (1999) J. Neurol. Neurosurg. Psych. 67: 451-456; Portielji, et al. (20003) Cancer Immunol. Immunother. 52: 151-144). Doses may also be provided to achieve a pre-determined target concentration of anti-SIRP.alpha. antibody in the subject's serum, such as 0.1, 0.3, 1, 3, 10, 30, 100, 300 .mu.g/mL or more. In other embodiments, An anti-SIRP.alpha. antibody of the present invention is administered, e.g., subcutaneously or intravenously, on a weekly, biweekly, "every 4 weeks," monthly, bimonthly, or quarterly basis at 10, 20, 50, 80, 100, 200, 500, 1000 or 2500 mg/subject.

[0704] As used herein, the term "effective amount" refer to an amount of an anti-SIRP.alpha. or antigen-binding fragment thereof of the invention that, when administered alone or in combination with an additional therapeutic agent to a cell, tissue, or subject, is effective to cause a measurable improvement in one or more symptoms of disease, for example cancer or the progression of cancer. An effective dose further refers to that amount of the antibody or fragment sufficient to result in at least partial amelioration of symptoms, e.g., tumor shrinkage or elimination, lack of tumor growth, increased survival time. When applied to an individual active ingredient administered alone, an effective dose refers to that ingredient alone. When applied to a combination, an effective dose refers to combined amounts of the active ingredients that result in the therapeutic effect, whether administered in combination, serially or simultaneously. An effective amount of a therapeutic will result in an improvement of a diagnostic measure or parameter by at least 10%; usually by at least 20%; preferably at least about 30%; more preferably at least 40%, and most preferably by at least 50%. An effective amount can also result in an improvement in a subjective measure in cases where subjective measures are used to assess disease severity.

Kits

[0705] Further provided are kits comprising one or more components that include, but are not limited to, an anti-SIRP.alpha. antibody or antigen-binding fragment, as discussed herein in association with one or more additional components including, but not limited to a pharmaceutically acceptable carrier and/or a therapeutic agent, as discussed herein. The antibody or fragment and/or the therapeutic agent can be formulated as a pure composition or in combination with a pharmaceutically acceptable carrier, in a pharmaceutical composition.

[0706] In one embodiment, the kit includes an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention or a pharmaceutical composition thereof in one container (e.g., in a sterile glass or plastic vial) and/or a therapeutic agent and a pharmaceutical composition thereof in another container (e.g., in a sterile glass or plastic vial).

[0707] In another embodiment, the kit comprises a combination of the invention, including an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention along with a pharmaceutically acceptable carrier, optionally in combination with one or more therapeutic agents formulated together, optionally, in a pharmaceutical composition, in a single, common container.

[0708] If the kit includes a pharmaceutical composition for parenteral administration to a subject, the kit can include a device for performing such administration. For example, the kit can include one or more hypodermic needles or other injection devices as discussed above.

[0709] The kit can include a package insert including information concerning the pharmaceutical compositions and dosage forms in the kit. Generally, such information aids patients and physicians in using the enclosed pharmaceutical compositions and dosage forms effectively and safely. For example, the following information regarding a combination of the invention may be supplied in the insert: pharmacokinetics, pharmacodynamics, clinical studies, efficacy parameters, indications and usage, contraindications, warnings, precautions, adverse reactions, overdosage, proper dosage and administration, how supplied, proper storage conditions, references, manufacturer/distributor information and patent information.

[0710] The kit can also comprise a second therapeutic, for example one or more of: anti-CD47 antibody, anti-APRIL antibody, anti-PD-1 antibody (e.g., nivolumab, pembrolizumab, anti-PDL1 antibody, anti-TIGIT antibody, anti-CTLA4 antibody, anti-CS1 antibody (e.g., elotuzumab), anti-KIR2DL1/2/3 antibody (e.g., lirilumab), anti-CD137 antibody (e.g., urelumab), anti-GITR antibody (e.g., TRX518), anti-PD-L1 antibody (e.g., BMS-936559, MSB0010718C or MPDL3280A), anti-PD-L2 antibody, anti-ILT1 antibody, anti-ILT2 antibody, anti-ILT3 antibody, anti-ILT4 antibody, anti-ILT5 antibody, anti-ILT6 antibody, anti-ILT7 antibody, anti-ILT8 antibody, anti-CD40 antibody, anti-OX40 antibody, anti-ICOS, anti-KIR2DL1 antibody, anti-KIR2DL2/3 antibody, anti-KIR2DL4 antibody, anti-KIR2DL5A antibody, anti-KIR2DL5B antibody, anti-KIR3DL1 antibody, anti-KIR3DL2 antibody, anti-KIR3DL3 antibody, anti-NKG2A antibody, anti-NKG2C antibody, anti-NKG2E antibody, anti-4-1BB antibody (e.g., PF-05082566), anti-TSLP antibody, anti-IL-10 antibody, IL-10 or PEGylated IL-10, or any small organic molecule inhibitor of such targets; an antibody or antigen binding fragment thereof binds to an antigen selected from the group consisting of AMHR2, AXL, BCMA, CA IX, CD4, CD16, CD19, CD20, CD22, CD30, CD37, CD38, CD40, CD52, CD98, CSF1R, GD2, CCR4, CS1, EpCam, EGFR, EGFRvIII, Endoglin, EPHA2, EphA3, FGFR2b, folate receptor alpha, fucosyl-GM1, HER2, HER3, IL1RAP, kappa myeloma antigen, MS4A1, prolactin receptor, TA-MUC1, and PSMA; Rituximab, ublituximab, margetuximab, IMGN-529, SCT400, veltuzumab, Obinutuzumab, ADCT-502, Hul4.18K322A, Hu3F8, Dinituximab, Trastuzumab, Cetuximab, Rituximab-RLI, c.60C3-RLI, Hul4.18-IL2, KM2812, AFM13, and (CD20).sub.2.times.CD16, erlotinib (Tarceva), daratumumab, alemtuzumab, pertuzumab, brentuximab, elotuzumab, ibritumomab, ifabotuzumab, farletuzumab, otlertuzumab, carotuximab, epratuzumab, inebilizumab, lumretuzumab, 4G7SDIE, AFM21, AFM22, LY-3022855, SNDX-6352, AFM-13, BI-836826, BMS-986012, BVX-20, mogamulizumab, ChiLob-7/4, leukotuximab, isatuximab, DS-8895, FPA144, GM102, GSK-2857916, IGN523, IT1208, ADC-1013, CAN-04, XOMA-213, PankoMab-GEX, chKM-4927, IGN003, IGN004, IGN005, MDX-1097, MOR202, MOR-208, oportuzumab, ensituximab, vedotin (Adcetris), ibritumomab tiuxetan, ABBV-838, HuMax-AXL-ADC, and ado-trastuzumab emtansine (Kadcyla); radiotherapy or chemotherapeutic agents including, but not limited to Anthracyclines (Doxorubicin, Epirubicin, Daunorubicin, Idarubicin, Mitoxantrone), Oxaliplatin, Bortezomib, Cyclophosphamide, Bleomycin, Vorinostat, Paclitaxel, 5-Fluorouracil, Cytarabine, Prednisolone, Docetaxel, Mitomycin C, Topotecan/Camptothecin, Etoposide, Zoledronic acid, Methotrexate, Ibrutinib, Aflibercept, Bevacizumab, Toremifene, Vinblastine, Vincristine, Idelalisib, Mercaptopurine, Thalidomide, Sorafenib; a cyclic dinculeotide or other STING pathway agonist; etc.

Detection Kits and Therapeutic Kits

[0711] As a matter of convenience, an anti-SIRP.alpha. antibody or antigen-binding fragment thereof of the invention can be provided in a kit, i.e., a packaged combination of reagents in predetermined amounts with instructions for performing the diagnostic or detection assay. Where the antibody or fragment is labeled with an enzyme, the kit will include substrates and cofactors required by the enzyme (e.g., a substrate precursor which provides the detectable chromophore or fluorophore). In addition, other additives may be included such as stabilizers, buffers (e.g., a block buffer or lysis buffer) and the like. The relative amounts of the various reagents may be varied widely to provide for concentrations in solution of the reagents which substantially optimize the sensitivity of the assay. Particularly, the reagents may be provided as dry powders, usually lyophilized, including excipients which on dissolution will provide a reagent solution having the appropriate concentration.

[0712] Also provided are diagnostic or detection reagents and kits comprising one or more such reagents for use in a variety of detection assays, including for example, immunoassays such as ELISA (sandwich-type or competitive format). The kit's components may be pre-attached to a solid support, or may be applied to the surface of a solid support when the kit is used. In some embodiments of the invention, the signal generating means may come pre-associated with an antibody or fragment of the invention or may require combination with one or more components, e.g., buffers, antibody-enzyme conjugates, enzyme substrates, or the like, prior to use. Kits may also include additional reagents, e.g., blocking reagents for reducing nonspecific binding to the solid phase surface, washing reagents, enzyme substrates, and the like. The solid phase surface may be in the form of a tube, a bead, a microtiter plate, a microsphere, or other materials suitable for immobilizing proteins, peptides, or polypeptides. In particular aspects, an enzyme that catalyzes the formation of a chemilluminescent or chromogenic product or the reduction of a chemilluminescent or chromogenic substrate is a component of the signal generating means. Such enzymes are well known in the art. Kits may comprise any of the capture agents and detection reagents described herein. Optionally the kit may also comprise instructions for carrying out the methods of the invention.

[0713] Also provided is a kit comprising an anti-SIRP.alpha. antibody (e.g., humanized antibody) or antigen-binding fragment thereof packaged in a container, such as a vial or bottle, and further comprising a label attached to or packaged with the container, the label describing the contents of the container and providing indications and/or instructions regarding use of the contents of the container to treat one or more disease states as described herein.

[0714] In one aspect, the kit is for treating cancer and comprises an anti-SIRP.alpha. antibody (e.g., humanized antibody) or antigen-binding fragment thereof and a further therapeutic agent or a vaccine. The kit may optionally further include a syringe for parenteral, e.g., intravenous, administration. In another aspect, the kit comprises an anti-SIRP.alpha. antibody (e.g., humanized antibody) or antigen-binding fragment thereof and a label attached to or packaged with the container describing use of the antibody or fragment with the vaccine or further therapeutic agent. In yet another aspect, the kit comprises the vaccine or further therapeutic agent and a label attached to or packaged with the container describing use of the vaccine or further therapeutic agent with the anti-SIRP.alpha. antibody or fragment. In certain embodiments, an anti-SIRP.alpha. antibody and vaccine or further therapeutic agent are in separate vials or are combined together in the same pharmaceutical composition.

[0715] As discussed above in the combination therapy section, concurrent administration of two therapeutic agents does not require that the agents be administered at the same time or by the same route, as long as there is an overlap in the time period during which the agents are exerting their therapeutic effect. Simultaneous or sequential administration is contemplated, as is administration on different days or weeks.

[0716] The therapeutic and detection kits disclosed herein may also be prepared that comprise at least one of the antibody, peptide, antigen-binding fragment, or polynucleotide disclosed herein and instructions for using the composition as a detection reagent or therapeutic agent. Containers for use in such kits may typically comprise at least one vial, test tube, flask, bottle, syringe or other suitable container, into which one or more of the detection and/or therapeutic composition(s) may be placed, and preferably suitably aliquoted. Where a second therapeutic agent is also provided, the kit may also contain a second distinct container into which this second detection and/or therapeutic composition may be placed. Alternatively, a plurality of compounds may be prepared in a single pharmaceutical composition, and may be packaged in a single container means, such as a vial, flask, syringe, bottle, or other suitable single container. The kits disclosed herein will also typically include a means for containing the vial(s) in close confinement for commercial sale, such as, e.g., injection or blow-molded plastic containers into which the desired vial(s) are retained. Where a radiolabel, chromogenic, fluorigenic, or other type of detectable label or detecting means is included within the kit, the labeling agent may be provided either in the same container as the detection or therapeutic composition itself, or may alternatively be placed in a second distinct container means into which this second composition may be placed and suitably aliquoted. Alternatively, the detection reagent and the label may be prepared in a single container means, and in most cases, the kit will also typically include a means for containing the vial(s) in close confinement for commercial sale and/or convenient packaging and delivery.

[0717] A device or apparatus for carrying out the detection or monitoring methods described herein is also provided. Such an apparatus may include a chamber or tube into which sample can be input, a fluid handling system optionally including valves or pumps to direct flow of the sample through the device, optionally filters to separate plasma or serum from blood, mixing chambers for the addition of capture agents or detection reagents, and optionally a detection device for detecting the amount of detectable label bound to the capture agent immunocomplex. The flow of sample may be passive (e.g., by capillary, hydrostatic, or other forces that do not require further manipulation of the device once sample is applied) or active (e.g., by application of force generated via mechanical pumps, electroosmotic pumps, centrifugal force, or increased air pressure), or by a combination of active and passive forces.

[0718] In further embodiments, also provided is a processor, a computer readable memory, and a routine stored on the computer readable memory and adapted to be executed on the processor to perform any of the methods described herein. Examples of suitable computing systems, environments, and/or configurations include personal computers, server computers, hand-held or laptop devices, multiprocessor systems, microprocessor-based systems, set top boxes, programmable consumer electronics, network PCs, minicomputers, mainframe computers, distributed computing environments that include any of the above systems or devices, or any other systems known in the art.

Preferred Embodiments

[0719] Embodiment 1. An antibody or antigen binding fragment thereof that binds to human SIRP.alpha., wherein the antibody or antigen binding fragment comprises one or more, and optionally each, of:

[0720] a. a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO:69 or an amino acid sequence differing from SEQ ID NO: 1 by 1, 2, or 3 conservative substitutions,

[0721] b. a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO:70 or an amino acid sequence differing from SEQ ID NO: 2 by 1, 2, or 3 conservative substitutions,

[0722] c. a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO:71 or an amino acid sequence differing from SEQ ID NO: 3 by 1, 2, or 3 conservative substitutions,

[0723] d. a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO:72 or an amino acid sequence differing from SEQ ID NO: 4 by 1, 2, or 3 conservative substitutions,

[0724] e. a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO:73 or an amino acid sequence differing from SEQ ID NO: 5 by 1, 2, or 3 conservative substitutions, and

[0725] f. a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO:74 or an amino acid sequence differing from SEQ ID NO: 6 by 1, 2, or 3 conservative substitutions. or wherein the antibody or antigen binding fragment comprises one or more, and optionally each, of:

[0726] g. a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO:1 or an amino acid sequence differing from SEQ ID NO: 1 by 1, 2, or 3 conservative substitutions,

[0727] h. a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO:2 or an amino acid sequence differing from SEQ ID NO: 2 by 1, 2, or 3 conservative substitutions,

[0728] i. a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO:3 or an amino acid sequence differing from SEQ ID NO: 3 by 1, 2, or 3 conservative substitutions,

[0729] j. a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO:4 or an amino acid sequence differing from SEQ ID NO: 4 by 1, 2, or 3 conservative substitutions,

[0730] k. a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO:5 or an amino acid sequence differing from SEQ ID NO: 5 by 1, 2, or 3 conservative substitutions, and

[0731] l. a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO:6 or an amino acid sequence differing from SEQ ID NO: 6 by 1, 2, or 3 conservative substitutions.

[0732] Embodiment 2. The antibody or antigen binding fragment of embodiment 1, wherein the antibody or antigen binding fragment comprises

[0733] each of a heavy chain sequence comprising the amino acid sequence of SEQ ID NO:69 or an amino acid sequence differing from SEQ ID NO: 69 by 1, 2, or 3 conservative substitutions; the amino acid sequence of SEQ ID NO:70 or an amino acid sequence differing from SEQ ID NO: 70 by 1, 2, or 3 conservative substitutions; and the amino acid sequence of SEQ ID NO: 71 or an amino acid sequence differing from SEQ ID NO: 71 by 1, 2, or 3 conservative substitutions; and/or

[0734] each of a light chain sequence comprising the amino acid sequence of SEQ ID NO: 72 or an amino acid sequence differing from SEQ ID NO: 72 by 1, 2, or 3 conservative substitutions; the amino acid sequence of SEQ ID NO: 73 or an amino acid sequence differing from SEQ ID NO: 73 by 1, 2, or 3 conservative substitutions; and the amino acid sequence of SEQ ID NO: 74 or an amino acid sequence differing from SEQ ID NO: 74 by 1, 2, or 3 conservative substitutions; or wherein the antibody or antigen binding fragment comprises

[0735] each of a heavy chain sequence comprising the amino acid sequence of SEQ ID NO:1 or an amino acid sequence differing from SEQ ID NO: 1 by 1, 2, or 3 conservative substitutions; the amino acid sequence of SEQ ID NO:2 or an amino acid sequence differing from SEQ ID NO: 2 by 1, 2, or 3 conservative substitutions; and the amino acid sequence of SEQ ID NO:3 or an amino acid sequence differing from SEQ ID NO: 3 by 1, 2, or 3 conservative substitutions; and/or

[0736] each of a light chain sequence comprising the amino acid sequence of SEQ ID NO:4 or an amino acid sequence differing from SEQ ID NO: 4 by 1, 2, or 3 conservative substitutions; the amino acid sequence of SEQ ID NO:5 or an amino acid sequence differing from SEQ ID NO: 5 by 1, 2, or 3 conservative substitutions; and the amino acid sequence of SEQ ID NO:6 or an amino acid sequence differing from SEQ ID NO: 6 by 1, 2, or 3 conservative substitutions.

[0737] Embodiment 3. The antibody or antigen binding fragment of embodiment 2, wherein the antibody or antigen binding fragment comprises one or both of:

[0738] a heavy chain variable region comprising an amino acid sequence selected from the group consisting of:

[0739] SEQ ID NO: 75 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0740] SEQ ID NO: 78 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0741] SEQ ID NO: 80 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0742] SEQ ID NO: 82 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0743] SEQ ID NO: 84 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0744] SEQ ID NO: 86 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0745] SEQ ID NO: 88 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto, and

[0746] SEQ ID NO: 102 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto; and

[0747] a light chain variable region comprising an amino acid sequence selected from the group consisting of:

[0748] SEQ ID NO: 76 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0749] SEQ ID NO: 90 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0750] SEQ ID NO: 92 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0751] SEQ ID NO: 94 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0752] SEQ ID NO: 96 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0753] SEQ ID NO: 98 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0754] SEQ ID NO: 100 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto, and

[0755] SEQ ID NO: 104 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto; or wherein the antibody or antigen binding fragment comprises one or both of:

[0756] a heavy chain variable region comprising an amino acid sequence selected from the group consisting of:

[0757] SEQ ID NO: 7 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0758] SEQ ID NO: 10 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0759] SEQ ID NO: 12 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0760] SEQ ID NO: 14 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0761] SEQ ID NO: 16 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0762] SEQ ID NO: 18 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto, and

[0763] SEQ ID NO: 30 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto; and

[0764] a light chain variable region comprising an amino acid sequence selected from the group consisting of:

[0765] SEQ ID NO: 8 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0766] SEQ ID NO: 20 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0767] SEQ ID NO: 22 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0768] SEQ ID NO: 24 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0769] SEQ ID NO: 26 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto, and

[0770] SEQ ID NO: 28 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto, and

[0771] SEQ ID NO: 32 or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0772] Embodiment 4. The antibody or antigen binding fragment of embodiment 3, wherein the antibody or fragment thereof has the following characteristics:

[0773] binds to a cell expressing human SIRP.alpha.V1 protein with an EC.sub.50<10 nM, preferably <5 nM, more preferably <1.5 nM, still more preferably <1.0 nM, even more preferably <0.5 nM, and most preferably about 0.3 nM or less;

[0774] binds to a cell expressing human SIRP.alpha.V2 protein with an EC.sub.50<10 nM, preferably <5 nM, more preferably <1.5 nM, still more preferably <1.0 nM, even more preferably <0.5 nM, and most preferably about 0.3 nM or less;

[0775] does not appreciably bind to SIRP.beta.1 protein at an antibody concentration of 50 nM, preferably 67 nM, and more preferably 100 nM; or alternatively at a concentration that is 10-fold greater, preferably 50-fold greater, more preferably 100-fold greater, and still more preferably 200-fold greater than the antibody's EC.sub.50 for SIRP.alpha.V1 or SIRP.alpha.V2;

[0776] inhibits binding between human SIRP.alpha. and CD47 with an IC.sub.50<10.0 nM, more preferably <5.0 nM, still more preferably <2.5 nM, and most preferably about 1.0 nM or less; and

[0777] exhibits a T20 "humanness" score of at least 79, and more preferably 85.

[0778] Embodiment 5. The antibody or antigen binding fragment of embodiment 1, wherein the antibody or antigen binding fragment thereof comprises one of the following combinations of heavy chain sequence/light chain sequence:

SEQ ID NO: 78/SEQ ID NO: 90,

SEQ ID NO: 78/SEQ ID NO: 92,

SEQ ID NO: 78/SEQ ID NO: 94,

SEQ ID NO: 78/SEQ ID NO: 96,

SEQ ID NO: 78/SEQ ID NO: 98,

SEQ ID NO: 78/SEQ ID NO: 100,

SEQ ID NO: 80/SEQ ID NO: 90,

SEQ ID NO: 80/SEQ ID NO: 92,

SEQ ID NO: 80/SEQ ID NO: 94,

SEQ ID NO: 80/SEQ ID NO: 96,

SEQ ID NO: 80/SEQ ID NO: 98,

SEQ ID NO: 80/SEQ ID NO: 100,

SEQ ID NO: 82/SEQ ID NO: 90,

SEQ ID NO: 82/SEQ ID NO: 92,

SEQ ID NO: 82/SEQ ID NO: 94,

SEQ ID NO: 82/SEQ ID NO: 96,

SEQ ID NO: 82/SEQ ID NO: 98,

SEQ ID NO: 82/SEQ ID NO: 100,

SEQ ID NO: 84/SEQ ID NO: 90,

SEQ ID NO: 84/SEQ ID NO: 92,

SEQ ID NO: 84/SEQ ID NO: 94,

SEQ ID NO: 84/SEQ ID NO: 96,

SEQ ID NO: 84/SEQ ID NO: 98,

SEQ ID NO: 84/SEQ ID NO: 100,

SEQ ID NO: 86/SEQ ID NO: 90,

SEQ ID NO: 86/SEQ ID NO: 92,

SEQ ID NO: 86/SEQ ID NO: 94,

SEQ ID NO: 86/SEQ ID NO: 96,

SEQ ID NO: 86/SEQ ID NO: 98,

SEQ ID NO: 86/SEQ ID NO: 100,

SEQ ID NO: 88/SEQ ID NO: 90,

SEQ ID NO: 88/SEQ ID NO: 92,

SEQ ID NO: 88/SEQ ID NO: 94,

SEQ ID NO: 88/SEQ ID NO: 96,

SEQ ID NO: 88/SEQ ID NO: 98,

SEQ ID NO: 88/SEQ ID NO: 100,

SEQ ID NO: 10/SEQ ID NO: 20,

SEQ ID NO: 10/SEQ ID NO: 22,

SEQ ID NO: 10/SEQ ID NO: 24,

SEQ ID NO: 10/SEQ ID NO: 26,

SEQ ID NO: 10/SEQ ID NO: 28,

SEQ ID NO: 12/SEQ ID NO: 20,

SEQ ID NO: 12/SEQ ID NO: 22,

SEQ ID NO: 12/SEQ ID NO: 24,

SEQ ID NO: 12/SEQ ID NO: 26,

SEQ ID NO: 12/SEQ ID NO: 28,

SEQ ID NO: 14/SEQ ID NO: 20,

SEQ ID NO: 14/SEQ ID NO: 22,

SEQ ID NO: 14/SEQ ID NO: 24,

SEQ ID NO: 14/SEQ ID NO: 26,

SEQ ID NO: 14/SEQ ID NO: 28,

SEQ ID NO: 16/SEQ ID NO: 20,

SEQ ID NO: 16/SEQ ID NO: 22,

SEQ ID NO: 16/SEQ ID NO: 24,

SEQ ID NO: 16/SEQ ID NO: 26,

SEQ ID NO: 16/SEQ ID NO: 28,

SEQ ID NO: 18/SEQ ID NO: 20,

SEQ ID NO: 18/SEQ ID NO: 22,

SEQ ID NO: 18/SEQ ID NO: 24,

SEQ ID NO: 18/SEQ ID NO: 26,

SEQ ID NO: 18/SEQ ID NO: 28,

[0779] or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID.

[0780] Embodiment 6. The antibody or antigen binding fragment of one of embodiments 1-5, wherein the antibody is an intact IgG.

[0781] Embodiment 7. The antibody or antigen binding fragment of one of embodiments 1-6, wherein the antibody comprises a wild-type or mutated IgG2 Fc region.

[0782] Embodiment 8. The antibody or antigen binding fragment of one of embodiments 1-6, wherein the antibody comprises a mutated IgG1 Fc region.

[0783] Embodiment 9. The antibody or antigen binding fragment of one of embodiments 1-6, wherein the antibody comprises a mutated IgG4 Fc region.

[0784] Embodiment 10. An antibody or antigen binding fragment thereof that binds to the same epitope of human SIRP.alpha. as an antibody as an antibody according to embodiment 5.

[0785] Embodiment 11. The antibody or antigen binding fragment of any of embodiments 1-10, wherein the antibody or antigen binding fragment is humanized.

[0786] Embodiment 12. The antibody or antigen binding fragment of any of embodiments 1-11 that is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 10 and each light chain comprises SEQ ID NO: 20.

[0787] Embodiment 13. The antibody or antigen binding fragment of any of embodiments 1-11 that is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 16 and each light chain comprises SEQ ID NO: 28.

[0788] Embodiment 14. The antibody or antigen binding fragment of any of embodiments 1-11 that is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 18 and each light chain comprises SEQ ID NO: 20.

[0789] Embodiment 15. The antibody or antigen binding fragment of any of embodiments 1-11 that is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 80 and each light chain comprises SEQ ID NO: 90.

[0790] Embodiment 16. The antibody or antigen binding fragment of any of embodiments 1-11 that is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 80 and each light chain comprises SEQ ID NO: 92.

[0791] Embodiment 17. The antibody or antigen binding fragment of any of embodiments 1-11 that is a humanized antibody that comprises two heavy chains and two light chains, wherein each heavy chain comprises SEQ ID NO: 80 and each light chain comprises SEQ ID NO: 95.

[0792] Embodiment 18. The antibody or antigen binding fragment of any one of embodiments 1-17 that comprises a glycosylation pattern characteristic of expression by a mammalian cell, and optionally is glycosylated by expression from a CHO cell.

[0793] Embodiment 19. An isolated polypeptide comprising the amino acid sequence of any one of SEQ ID NOs: 75, 78, 80, 82, 84, 86, 88, 76, 90, 92, 94, 96, 98, 100, 102, 104, 7, 10, 12, 14, 16, 18, 30, 8, 20, 22, 24, 26, 28, and 32, or an amino acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0794] Embodiment 20. An isolated nucleic acid encoding any one of the antibodies or antigen binding fragments of embodiments 1-18, or any one of the polypeptides of embodiment 19.

[0795] Embodiment 21. An isolated nucleic acid of embodiment 20 comprising:

[0796] a nucleic acid sequence of SEQ ID NO: 77 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0797] a nucleic acid sequence of SEQ ID NO: 79 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0798] a nucleic acid sequence of SEQ ID NO: 81 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0799] a nucleic acid sequence of SEQ ID NO: 83 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0800] a nucleic acid sequence of SEQ ID NO: 85 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0801] a nucleic acid sequence of SEQ ID NO: 87 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0802] a nucleic acid sequence of SEQ ID NO: 101 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0803] a nucleic acid sequence of SEQ ID NO: 89 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0804] a nucleic acid sequence of SEQ ID NO: 91 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0805] a nucleic acid sequence of SEQ ID NO: 93 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0806] a nucleic acid sequence of SEQ ID NO: 95 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0807] a nucleic acid sequence of SEQ ID NO: 97 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0808] a nucleic acid sequence of SEQ ID NO: 99 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0809] a nucleic acid sequence of SEQ ID NO: 103 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0810] a nucleic acid sequence of SEQ ID NO: 9 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0811] a nucleic acid sequence of SEQ ID NO: 11 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0812] a nucleic acid sequence of SEQ ID NO: 13 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0813] a nucleic acid sequence of SEQ ID NO: 15 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0814] a nucleic acid sequence of SEQ ID NO: 17 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0815] a nucleic acid sequence of SEQ ID NO: 29 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0816] a nucleic acid sequence of SEQ ID NO: 19 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0817] a nucleic acid sequence of SEQ ID NO: 21 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0818] a nucleic acid sequence of SEQ ID NO: 23 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0819] a nucleic acid sequence of SEQ ID NO: 25 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto,

[0820] a nucleic acid sequence of SEQ ID NO: 27 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto, and/or

[0821] a nucleic acid sequence of SEQ ID NO: 31 or a nucleic acid sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0822] Embodiment 22. An expression vector comprising the isolated nucleic acid of embodiment 20 or 21.

[0823] Embodiment 23. An expression vector of embodiment 22, encoding both a heavy chain sequence and a light chain sequence of an anti-SIRP.alpha. antibody, the expression vectors comprising the following a first nucleic acid sequence/second nucleic acid sequence selected from the group consisting of:

SEQ ID NO: 77/SEQ ID NO: 89,

SEQ ID NO: 77/SEQ ID NO: 91,

SEQ ID NO: 77/SEQ ID NO: 93,

SEQ ID NO: 77/SEQ ID NO: 95,

SEQ ID NO: 77/SEQ ID NO: 97,

SEQ ID NO: 77/SEQ ID NO: 99,

SEQ ID NO: 79/SEQ ID NO: 89,

SEQ ID NO: 79/SEQ ID NO: 91,

SEQ ID NO: 79/SEQ ID NO: 93,

SEQ ID NO: 79/SEQ ID NO: 95,

SEQ ID NO: 79/SEQ ID NO: 97,

SEQ ID NO: 79/SEQ ID NO: 99,

SEQ ID NO: 81/SEQ ID NO: 89,

SEQ ID NO: 81/SEQ ID NO: 91,

SEQ ID NO: 81/SEQ ID NO: 93,

SEQ ID NO: 81/SEQ ID NO: 95,

SEQ ID NO: 81/SEQ ID NO: 97,

SEQ ID NO: 81/SEQ ID NO: 99,

SEQ ID NO: 83/SEQ ID NO: 89,

SEQ ID NO: 83/SEQ ID NO: 91,

SEQ ID NO: 83/SEQ ID NO: 93,

SEQ ID NO: 83/SEQ ID NO: 95,

SEQ ID NO: 83/SEQ ID NO: 97,

SEQ ID NO: 83/SEQ ID NO: 99,

SEQ ID NO: 85/SEQ ID NO: 89,

SEQ ID NO: 85/SEQ ID NO: 91,

SEQ ID NO: 85/SEQ ID NO: 93,

SEQ ID NO: 85/SEQ ID NO: 95,

SEQ ID NO: 85/SEQ ID NO: 97,

SEQ ID NO: 85/SEQ ID NO: 99,

SEQ ID NO: 87/SEQ ID NO: 89,

SEQ ID NO: 87/SEQ ID NO: 91,

SEQ ID NO: 87/SEQ ID NO: 93,

SEQ ID NO: 87/SEQ ID NO: 95,

SEQ ID NO: 87/SEQ ID NO: 97,

SEQ ID NO: 87/SEQ ID NO: 99,

SEQ ID NO: 9/SEQ ID NO: 19,

SEQ ID NO: 9/SEQ ID NO: 21,

SEQ ID NO: 9/SEQ ID NO: 23,

SEQ ID NO: 9/SEQ ID NO: 25,

SEQ ID NO: 9/SEQ ID NO: 27,

SEQ ID NO: 11/SEQ ID NO: 19,

SEQ ID NO: 11/SEQ ID NO: 21,

SEQ ID NO: 11/SEQ ID NO: 23,

SEQ ID NO: 11/SEQ ID NO: 25,

SEQ ID NO: 11/SEQ ID NO: 27,

SEQ ID NO: 13/SEQ ID NO: 19,

SEQ ID NO: 13/SEQ ID NO: 21,

SEQ ID NO: 13/SEQ ID NO: 23,

SEQ ID NO: 13/SEQ ID NO: 25,

SEQ ID NO: 13/SEQ ID NO: 27,

SEQ ID NO: 15/SEQ ID NO: 19,

SEQ ID NO: 15/SEQ ID NO: 21,

SEQ ID NO: 15/SEQ ID NO: 23,

SEQ ID NO: 15/SEQ ID NO: 25,

SEQ ID NO: 15/SEQ ID NO: 27,

SEQ ID NO: 17/SEQ ID NO: 19,

SEQ ID NO: 17/SEQ ID NO: 21,

SEQ ID NO: 17/SEQ ID NO: 23,

SEQ ID NO: 17/SEQ ID NO: 25, and

SEQ ID NO: 17/SEQ ID NO: 27,

[0824] or, in each case, at least 90%, 95%, 97%, 98%, or 99% identical to a respective SEQ ID NO.

[0825] Embodiment 24. A host cell comprising expression vector of embodiment 22 or 23.

[0826] Embodiment 25. A host cell of embodiment 24 which produces a full length anti-SIRP.alpha. antibody.

[0827] Embodiment 26. The host cell of one of embodiments 24 or 25, which is a bacterial cell, a human cell, a mammalian cell, a Pichia cell, a plant cell, an HEK293 cell, or a Chinese hamster ovary cell.

[0828] Embodiment 27. A composition comprising the antibody or antigen binding fragment of any one of embodiments 1-18 and a pharmaceutically acceptable carrier or diluent.

[0829] Embodiment 28. The composition of embodiment 27, further comprising a second antibody or antigen binding fragment thereof that induces ADCC and/or ADCP, wherein said antibody or antigen binding fragment of the invention enhances the antibody-mediated destruction of cells by the second antibody.

[0830] Embodiment 29. The composition according to embodiment 28, wherein the second antibody or antigen binding fragment thereof binds to an antigen selected from the group consisting of AMHR2, AXL, BCMA, CA IX, CD4, CD16, CD19, CD20, CD22, CD30, CD37, CD38, CD40, CD52, CD98, CSF1R, GD2, CCR4, CS1, EpCam, EGFR, EGFRvIII, Endoglin, EPHA2, EphA3, FGFR2b, folate receptor alpha, fucosyl-GM1, HER2, HER3, IL1RAP, kappa myeloma antigen, MS4A1, prolactin receptor, TA-MUC1, and PSMA.

[0831] Embodiment 30. The composition according to embodiment 29, wherein the second antibody or antigen binding fragment thereof is selected from the group consisting of Rituximab, ublituximab, margetuximab, IMGN-529, SCT400, veltuzumab, Obinutuzumab, ADCT-502, Hul4.18K322A, Hu3F8, Dinituximab, Trastuzumab, Cetuximab, Rituximab-RLI, c.60C3-RLI, Hul4.18-IL2, KM2812, AFM13, (CD20)2xCD16, erlotinib (Tarceva), daratumumab, alemtuzumab, pertuzumab, brentuximab, elotuzumab, ibritumomab, ifabotuzumab, farletuzumab, otlertuzumab, carotuximab, epratuzumab, inebilizumab, lumretuzumab, 4G7SDIE, AFM21, AFM22, LY-3022855, SNDX-6352, AFM-13, BI-836826, BMS-986012, BVX-20, mogamulizumab, ChiLob-7/4, leukotuximab, isatuximab, DS-8895, FPA144, GM102, GSK-2857916, IGN523, IT1208, ADC-1013, CAN-04, XOMA-213, PankoMab-GEX, chKM-4927, IGN003, IGN004, IGN005, MDX-1097, MOR202, MOR-208, oportuzumab, ensituximab, vedotin (Adcetris), ibritumomab tiuxetan, ABBV-838, HuMax-AXL-ADC, and ado-trastuzumab emtansine (Kadcyla).

[0832] Embodiment 31. The composition according to embodiment 28, wherein the second antibody or antigen binding fragment thereof induces ADCP.

[0833] Embodiment 32. The composition according to embodiment 31, wherein the second antibody or antigen binding fragment thereof is selected from the group consisting of Rituximab, ublituximab, margetuximab, IMGN-529, SCT400, veltuzumab, Obinutuzumab, Trastuzumab, Cetuximab, alemtuzumab, ibritumomab, farletuzumab, inebilizumab, lumretuzumab, 4G7SDIE, BMS-986012, BVX-20, mogamulizumab, ChiLob-7/4, GM102, GSK-2857916, PankoMab-GEX, chKM-4927, MDX-1097, MOR202, and MOR-208.

[0834] Embodiment 33. The composition of embodiment 27, further comprising one or more agents selected from the group consisting of anti-CD27 antibody, anti-CD47 antibody, anti-APRIL antibody, anti-PD-1 antibody, anti-PD-L1 antibody, anti-TIGIT antibody, anti-CTLA4 antibody, anti-CS1 antibody, anti-KIR2DL1/2/3 antibody, anti-CD137 antibody, anti-GITR antibody, anti-PD-L2 antibody, anti-ILT1 antibody, anti-ILT2 antibody, anti-ILT3 antibody, anti-ILT4 antibody, anti-ILT5 antibody, anti-ILT6 antibody, anti-ILT7 antibody, anti-ILT8 antibody, anti-CD40 antibody, anti-OX40 antibody, anti-ICOS, anti-KIR2DL1 antibody, anti-KIR2DL2/3 antibody, anti-KIR2DL4 antibody, anti-KIR2DL5A antibody, anti-KIR2DL5B antibody, anti-KIR3DL1 antibody, anti-KIR3DL2 antibody, anti-KIR3DL3 antibody, anti-NKG2A antibody, anti-NKG2C antibody, anti-NKG2E antibody, anti-4-1BB antibody, anti-TSLP antibody, anti-IL-10 antibody, IL-10 PEGylated IL-10, an agonist (e.g., an agonistic antibody or antigen-binding fragment thereof, or a soluble fusion) of a TNF receptor protein, an Immunoglobulin-like protein, a cytokine receptor, an integrin, a signaling lymphocytic activation molecules (SLAM proteins), an activating NK cell receptor, a Toll like receptor, OX40, CD2, CD7, CD27, CD28, CD30, CD40, ICAM-1, LFA-1 (CD1 1a/CD18), 4-1BB (CD137), B7-H3, ICOS (CD278), GITR, BAFFR, LIGHT, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD19, CD4, CD8alpha, CD8beta, IL2R beta, IL2R gamma, IL7R alpha, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD1 1d, ITGAE, CD103, ITGAL, ITGAM, CD1 1b, ITGAX, CD1 1c, ITGB1, CD29, ITGB2, CD18, ITGB7, NKG2D, NKG2C, TNFR2, TRANCE/RANKL, DNAM1 (CD226), SLAMF4 (CD244, 2B4), CD84, CD96 (Tactile), CEACAM1, CRTAM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Ly108), SLAM (SLAMF1, CD150, IPO-3), SLAM7, BLAME (SLAMF8), SELPLG (CD162), LTBR, LAT, GADS, PAG/Cbp, CD19a, a ligand that specifically binds with CD83, inhibitor of CD47, an inhibitor of PD-1, an an inhibitor of PD-L1, an inhibitor of PD-L2, an inhibitor of CTLA4, an inhibitor of TIM3, an inhibitor of LAGS, an inhibitor of CEACAM (e.g., CEACAM-1, -3 and/or -5), an inhibitor of VISTA, an inhibitor of BTLA, an inhibitor of TIGIT, an inhibitor of LAIR1, an inhibitor of IDO, an inhibitor of TDO, an inhibitor of CD160 an inhibitor of TGFR beta, and a cyclic dinculeotide or other STING pathway agonist.

[0835] Embodiment 34. A method of producing an antibody or antigen binding fragment comprising:

[0836] culturing a host cell comprising a polynucleotide encoding the heavy chain and/or the light chain of any one of the antibodies or antigen binding fragments of embodiments 1-18 under conditions favorable to expression of the polynucleotide; and optionally, recovering the antibody or antigen binding fragment from the host cell and/or culture medium.

[0837] Embodiment 35. A method for detecting the presence of a SIRP.alpha. peptide or a fragment thereof in a sample comprising contacting the sample with an antibody or fragment of any of embodiments 1-18 and detecting the presence of a complex between the antibody or fragment and the peptide; wherein detection of the complex indicates the presence of the SIRP.alpha. peptide.

[0838] Embodiment 36. An antibody or antigen binding fragment according to any one of embodiments 1-18 or a composition according to any one of embodiments 21-25, for the treatment of cancer or an infectious disease.

[0839] Embodiment 37. An antibody or antigen binding fragment of embodiments 1-18 or a composition according to any one of embodiments 27-33 for decreasing SIRP.alpha./CD47 signalling in a human subject.

[0840] Embodiment 38. A method of treating cancer in a human subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment of any one of embodiments 1-18, or an expression vector according to one of embodiments 22 or 23, or a host cell according to one of embodiments 24-26, or a composition according one of embodiments 27-33, optionally in association with a further therapeutic agent or therapeutic procedure.

[0841] Embodiment 39. A method of treating cancer in a human subject, comprising:

administering to the subject an effective amount of (i) an antibody or antigen binding fragment thereof that induces ADCC and/or ADCP; and (ii) an antibody or antigen binding fragment of any one of embodiments 1-18, or an expression vector according to one of embodiments 22 or 23, or a host cell according to one of embodiments 24-26, or a composition according one of embodiments 27-33, optionally in association with a further therapeutic agent or therapeutic procedure, wherein the administration of (ii) enhances the antibody-mediated destruction of cells by the antibody or antigen binding fragment thereof that induces ADCC and/or ADCP.

[0842] Embodiment 40. The method according to embodiment 39, wherein the antibody or antigen binding fragment thereof that induces ADCC and/or ADCP binds to an antigen selected from the group consisting of AMHR2, AXL, BCMA, CA IX, CD4, CD16, CD19, CD20, CD22, CD30, CD37, CD38, CD40, CD52, CD98, CSF1R, GD2, CCR4, CS1, EpCam, EGFR, EGFRvIII, Endoglin, EPHA2, EphA3, FGFR2b, folate receptor alpha, fucosyl-GM1, HER2, HER3, IL1RAP, kappa myeloma antigen, MS4A1, prolactin receptor, TA-MUC1, and PSMA.

[0843] Embodiment 41. The method according to embodiment 40, wherein the antibody or antigen binding fragment thereof that induces ADCC and/or ADCP is selected from the group consisting of Rituximab, ublituximab, margetuximab, IMGN-529, SCT400, veltuzumab, Obinutuzumab, ADCT-502, Hul4.18K322A, Hu3F8, Dinituximab, Trastuzumab, Cetuximab, Rituximab-RLI, c.60C3-RLI, Hul4.18-IL2, KM2812, AFM13, (CD20)2xCD16, erlotinib (Tarceva), daratumumab, alemtuzumab, pertuzumab, brentuximab, elotuzumab, ibritumomab, ifabotuzumab, farletuzumab, otlertuzumab, carotuximab, epratuzumab, inebilizumab, lumretuzumab, 4G7SDIE, AFM21, AFM22, LY-3022855, SNDX-6352, AFM-13, BI-836826, BMS-986012, BVX-20, mogamulizumab, ChiLob-7/4, leukotuximab, isatuximab, DS-8895, FPA144, GM102, GSK-2857916, IGN523, IT1208, ADC-1013, CAN-04, XOMA-213, PankoMab-GEX, chKM-4927, IGN003, IGN004, IGN005, MDX-1097, MOR202, MOR-208, oportuzumab, ensituximab, vedotin (Adcetris), ibritumomab tiuxetan, ABBV-838, HuMax-AXL-ADC, and ado-trastuzumab emtansine (Kadcyla).

[0844] Embodiment 42. The method according to embodiment 39 or 40, wherein the second antibody or antigen binding fragment thereof induces ADCP.

[0845] Embodiment 43. The method according to embodiment 42, wherein the second antibody or antigen binding fragment thereof is selected from the group consisting of Rituximab, ublituximab, margetuximab, IMGN-529, SCT400, veltuzumab, Obinutuzumab, Trastuzumab, Cetuximab, alemtuzumab, ibritumomab, farletuzumab, inebilizumab, lumretuzumab, 4G7SDIE, BMS-986012, BVX-20, mogamulizumab, ChiLob-7/4, GM102, GSK-2857916, PankoMab-GEX, chKM-4927, MDX-1097, MOR202, and MOR-208.

[0846] Embodiment 44. A method of treating an infection or infectious disease in a human subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment of any one of embodiments 1-18, or an expression vector according to one of embodiments 22 or 23, or a host cell according to one of embodiments 24-26, or a composition according one of embodiments 27-33, optionally in association with a further therapeutic agent or therapeutic procedure.

[0847] Embodiment 45. An antibody having one or more of the following characteristics:

[0848] binds human SIRP.alpha.V1 protein having the sequence of SEQ ID NO: 34 with an EC.sub.50<1 nM; exhibits at least a 100-fold higher EC.sub.50 for SIRP.alpha.V1(P74A) having the sequence of SEQ ID NO: 62; and exhibits at least a 100-fold higher EC.sub.50 for human SIRP.beta.1 protein having the sequence of SEQ ID NO: 38, preferably when measured by cellular ELISA;

[0849] binds to a cell expressing human SIRP.alpha.V1 protein with an EC.sub.50<10 nM, preferably <5 nM, more preferably <1.5 nM, still more preferably <1.0 nM, even more preferably <0.5 nM, and most preferably about 0.3 nM or less;

[0850] binds to a cell expressing human SIRP.alpha.V2 protein with an EC.sub.50<10 nM, preferably <5 nM, more preferably <1.5 nM, still more preferably <1.0 nM, even more preferably <0.5 nM, and most preferably about 0.3 nM or less;

[0851] does not appreciably bind to SIRP.beta.1 protein at an antibody concentration of 50 nM, preferably 67 nM, and more preferably 100 nM; or alternatively at a concentration that is 10-fold greater, preferably 50-fold greater, more preferably 100-fold greater, and still more preferably 200-fold greater than the antibody's EC.sub.50 for SIRP.alpha.V1 or SIRP.alpha.V2;

[0852] inhibits binding between human SIRP.alpha. and CD47 with an IC.sub.50<10.0 nM, more preferably <5.0 nM, still more preferably <2.5 nM, and most preferably about 1.0 nM or less; and

[0853] exhibits a T20 "humanness" score of at least 79, and more preferably 85.

[0854] Embodiment 46. The antibody or antigen binding fragment of embodiment 45 that binds human SIRP.alpha.V1 protein having the sequence of SEQ ID NO: 34 with an EC.sub.50<1 nM; exhibits at least a 100-fold higher EC.sub.50 for SIRP.alpha.V1(P74A) having the sequence of SEQ ID NO: 62; and exhibits at least a 100-fold higher EC.sub.50 for human SIRP.beta.1 protein having the sequence of SEQ ID NO: 38.

[0855] Embodiment 47. The antibody or antigen binding fragment of embodiment 45 or 46 that comprises one or two light chains comprising SEQ ID NO: 20 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto and one or two heavy chains comprising SEQ ID NO: 10 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0856] Embodiment 48. The antibody or antigen binding fragment of embodiment 45 or 46 that comprises one or two light chains comprising SEQ ID NO: 28 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto and one or two heavy chains comprising SEQ ID NO: 16 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0857] Embodiment 49. The antibody or antigen binding fragment of embodiment 45 or 46 that comprises one or two light chains comprising SEQ ID NO: 20 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto and and one or two heavy chains comprising SEQ ID NO: 18 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0858] Embodiment 50. The antibody or antigen binding fragment of embodiment 45 or 46 that comprises one or two light chains comprising SEQ ID NO: 90 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto and one or two heavy chains comprising SEQ ID NO: 80 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0859] Embodiment 51. The antibody or antigen binding fragment of embodiment 45 or 46 that comprises one or two light chains comprising SEQ ID NO: 92 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto and one or two heavy chains comprising SEQ ID NO: 80 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0860] Embodiment 52. The antibody or antigen binding fragment of embodiment 45 or 46 that comprises one or two light chains comprising SEQ ID NO: 96 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto and and one or two heavy chains comprising SEQ ID NO: 80 or a sequence at least 90%, 95%, 97%, 98%, or 99% identical thereto.

[0861] Embodiment 53. The antibody or antigen binding fragment of one of embodiments 45-52, wherein the antibody is an intact IgG.

[0862] Embodiment 54. The antibody or antigen binding fragment of one of embodiments 45-52, wherein the antibody comprises a wild-type or mutated IgG2 Fc region.

[0863] Embodiment 55. The antibody or antigen binding fragment of one of embodiments 45-52, wherein the antibody comprises a mutated IgG1 Fc region.

[0864] Embodiment 56. The antibody or antigen binding fragment of one of embodiments 45-52, wherein the antibody comprises a mutated IgG4 Fc region.

[0865] Embodiment 57. An antibody or antigen binding fragment thereof that binds to the same epitope of human SIRP.alpha. as an antibody as an antibody according to one of embodiments 45-52.

[0866] Embodiment 58. The antibody or antigen binding fragment of any of embodiments 45-52, wherein the antibody or antigen binding fragment is humanized.

[0867] Embodiment 59. A composition comprising the antibody or antigen binding fragment of any one of embodiments 45-52 and a pharmaceutically acceptable carrier or diluent.

[0868] Embodiment 60. An antibody or antigen binding fragment according to any one of embodiments 45-52 or a composition according to embodiment 59, for the treatment of cancer or an infectious disease.

[0869] Embodiment 61. An antibody or antigen binding fragment according to any one of embodiments 45-52 or a composition according to embodiment 59 for decreasing SIRP.alpha./CD47 signalling in a human subject.

[0870] Embodiment 62. A method of treating cancer in a human subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment according to any one of embodiments 45-52 or a composition according to embodiment 59, optionally in association with a further therapeutic agent or therapeutic procedure.

[0871] Embodiment 63. A method of treating an infection or infectious disease in a human subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment according to any one of embodiments 45-52 or a composition according to embodiment 59, optionally in association with a further therapeutic agent or therapeutic procedure.

General Methods

[0872] Standard methods in molecular biology are described Sambrook, Fritsch and Maniatis (1982 & 1989 2.sup.nd Edition, 2001 3.sup.rd Edition) Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Sambrook and Russell (2001) Molecular Cloning, 3.sup.rd ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Wu (1993) Recombinant DNA, Vol. 217, Academic Press, San Diego, Calif.). Standard methods also appear in Ausbel, et al. (2001) Current Protocols in Molecular Biology, Vols. 1-4, John Wiley and Sons, Inc. New York, N.Y., which describes cloning in bacterial cells and DNA mutagenesis (Vol. 1), cloning in mammalian cells and yeast (Vol. 2), glycoconjugates and protein expression (Vol. 3), and bioinformatics (Vol. 4).

[0873] Methods for protein purification including immunoprecipitation, chromatography, electrophoresis, centrifugation, and crystallization are described (Coligan, et al. (2000) Current Protocols in Protein Science, Vol. 1, John Wiley and Sons, Inc., New York). Chemical analysis, chemical modification, post-translational modification, production of fusion proteins, glycosylation of proteins are described (see, e.g., Coligan, et al. (2000) Current Protocols in Protein Science, Vol. 2, John Wiley and Sons, Inc., New York; Ausubel, et al. (2001) Current Protocols in Molecular Biology, Vol. 3, John Wiley and Sons, Inc., NY, NY, pp. 16.0.5-16.22.17; Sigma-Aldrich, Co. (2001) Products for Life Science Research, St. Louis, Mo.; pp. 45-89; Amersham Pharmacia Biotech (2001) BioDirectory, Piscataway, N.J., pp. 384-391). Production, purification, and fragmentation of polyclonal and monoclonal antibodies are described (Coligan, et al. (2001) Current Protcols in Immunology, Vol. 1, John Wiley and Sons, Inc., New York; Harlow and Lane (1999) Using Antibodies, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Harlow and Lane, supra). Standard techniques for characterizing ligand/receptor interactions are available (see, e.g., Coligan, et al. (2001) Current Protocols in Immunology, Vol. 4, John Wiley, Inc., New York).

[0874] Monoclonal, polyclonal, and humanized antibodies can be prepared (see, e.g., Sheperd and Dean (eds.) (2000) Monoclonal Antibodies, Oxford Univ. Press, New York, N.Y.; Kontermann and Dubel (eds.) (2001) Antibody Engineering, Springer-Verlag, New York; Harlow and Lane (1988) Antibodies A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., pp. 139-243; Carpenter, et al. (2000) J. Immunol. 165:6205; He, et al. (1998) J. Immunol. 160:1029; Tang et al. (1999) J. Biol. Chem. 274:27371-27378; Baca et al. (1997) J. Biol. Chem. 272:10678-10684; Chothia et al. (1989) Nature 342:877-883; Foote and Winter (1992) J. Mol. Biol. 224:487-499; U.S. Pat. No. 6,329,511).

[0875] An alternative to humanization is to use human antibody libraries displayed on phage or human antibody libraries in transgenic mice (Vaughan et al. (1996) Nature Biotechnol. 14:309-314; Barbas (1995) Nature Medicine 1:837-839; Mendez et al. (1997) Nature Genetics 15:146-156; Hoogenboom and Chames (2000) Immunol. Today 21:371-377; Barbas et al. (2001) Phage Display: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Kay et al. (1996) Phage Display of Peptides and Proteins: A Laboratory Manual, Academic Press, San Diego, Calif.; de Bruin et al. (1999) Nature Biotechnol. 17:397-399).

[0876] Single chain antibodies and diabodies are described (see, e.g., Malecki et al. (2002) Proc. Natl. Acad. Sci. USA 99:213-218; Conrath et al. (2001) J. Biol. Chem. 276:7346-7350; Desmyter et al. (2001) J. Biol. Chem. 276:26285-26290; Hudson and Kortt (1999) J. Immunol. Methods 231:177-189; and U.S. Pat. No. 4,946,778). Bifunctional antibodies are provided (see, e.g., Mack, et al. (1995) Proc. Natl. Acad. Sci. USA 92:7021-7025; Carter (2001) J. Immunol. Methods 248:7-15; Volkel, et al. (2001) Protein Engineering 14:815-823; Segal, et al. (2001) J. Immunol. Methods 248:1-6; Brennan, et al. (1985) Science 229:81-83; Raso, et al. (1997) J. Biol. Chem. 272:27623; Morrison (1985) Science 229:1202-1207; Traunecker, et al. (1991) EMBO J. 10:3655-3659; and U.S. Pat. Nos. 5,932,448, 5,532,210, and 6,129,914).

[0877] Bispecific antibodies are also provided (see, e.g., Azzoni et al. (1998) J. Immunol. 161:3493; Kita et al. (1999) J. Immunol. 162:6901; Merchant et al. (2000) J. Biol. Chem. 74:9115; Pandey et al. (2000) J. Biol. Chem. 275:38633; Zheng et al. (2001) J. Biol Chem. 276:12999; Propst et al. (2000) J. Immunol. 165:2214; Long (1999) Ann. Rev. Immunol. 17:875). Purification of antigen is not necessary for the generation of antibodies. Animals can be immunized with cells bearing the antigen of interest. Splenocytes can then be isolated from the immunized animals, and the splenocytes can fused with a myeloma cell line to produce a hybridoma (see, e.g., Meyaard et al. (1997) Immunity 7:283-290; Wright et al. (2000) Immunity 13:233-242; Preston et al., supra; Kaithamana et al. (1999) J. Immunol. 163:5157-5164).

[0878] Antibodies can be conjugated, e.g., to small drug molecules, enzymes, liposomes, polyethylene glycol (PEG). Antibodies are useful for therapeutic, diagnostic, kit or other purposes, and include antibodies coupled, e.g., to dyes, radioisotopes, enzymes, or metals, e.g., colloidal gold (see, e.g., Le Doussal et al. (1991) J. Immunol. 146:169-175; Gibellini et al. (1998) J. Immunol. 160:3891-3898; Hsing and Bishop (1999) J. Immunol. 162:2804-2811; Everts et al. (2002) J. Immunol. 168:883-889).

[0879] Methods for flow cytometry, including fluorescence activated cell sorting (FACS), are available (see, e.g., Owens, et al. (1994) Flow Cytometry Principles for Clinical Laboratory Practice, John Wiley and Sons, Hoboken, N.J.; Givan (2001) Flow Cytometry, 2.sup.nd ed.; Wiley-Liss, Hoboken, N.J.; Shapiro (2003) Practical Flow Cytometry, John Wiley and Sons, Hoboken, N.J.). Fluorescent reagents suitable for modifying nucleic acids, including nucleic acid primers and probes, polypeptides, and antibodies, for use, e.g., as diagnostic reagents, are available (Molecular Probes (2003) Catalogue, Molecular Probes, Inc., Eugene, Oreg.; Sigma-Aldrich (2003) Catalogue, St. Louis, Mo.).

[0880] Standard methods of histology of the immune system are described (see, e.g., Muller-Harmelink (ed.) (1986) Human Thymus: Histopathology and Pathology, Springer Verlag, New York, N.Y.; Hiatt, et al. (2000) Color Atlas of Histology, Lippincott, Williams, and Wilkins, Phila, Pa.; Louis, et al. (2002) Basic Histology: Text and Atlas, McGraw-Hill, New York, N.Y.).

[0881] Software packages and databases for determining, e.g., antigenic fragments, leader sequences, protein folding, functional domains, glycosylation sites, and sequence alignments, are available (see, e.g., GenBank, Vector NTI.RTM. Suite (Informax, Inc, Bethesda, Md.); GCG Wisconsin Package (Accelrys, Inc., San Diego, Calif.); DeCypher.RTM. (TimeLogic Corp., Crystal Bay, Nev.); Menne, et al. (2000) Bioinformatics 16: 741-742; Menne, et al. (2000) Bioinformatics Applications Note 16:741-742; Wren, et al. (2002) Comput. Methods Programs Biomed. 68:177-181; von Heijne (1983) Eur. J. Biochem. 133:17-21; von Heijne (1986) Nucleic Acids Res. 14:4683-4690).

EXAMPLES

[0882] The following examples serve to illustrate the present invention. These examples are in no way intended to limit the scope of the invention.

Example 1: Specificity of Commercial hSIRP.alpha. Antibodies

[0883] The specificity of various commercially available monoclonal anti-hSIRP.alpha. antibodies (Table 7) for binding to hSIRP.alpha. variant 1 (hSIRP.alpha.V1; GenBank accession: NM_001040022.1) (SEQ ID NO: 34), hSIRP.alpha. variant 2 (hSIRP.alpha.V2; GenBank accession: D86043.1) (SEQ ID NO: 36), hSIRP.beta.1 (GenBank accession: NM_006065.4) (SEQ ID NO: 38), hSIRP.beta.1 transcript variant 3/hSIRP.beta.L (NCBI accession: NM_001135844.3) (SEQ ID NO: 117), and hSIRP.gamma. (NCBI accession: NM_018556.3) (SEQ ID NO: 40) was evaluated by cellular ELISA (CELISA). Reactivity was confirmed using CHO-K1 cells (ATCC CCL-61) that had been transiently transfected, using Lipofectamine 2000, with cDNA encoding the full length open reading frame of hSIRP.alpha.V1, hSIRP.alpha.V2, hSIRP.beta.1, hSIRP.beta.L, and hSIRP.gamma. subcloned into the pCI-neo vector (Promega, Madison, Wis.). CHO-K1.hSIRP.alpha.V1, CHO-K1.hSIRP.alpha.V2, CHO-K1.hSIRP.beta.1, CHO-K1.hSIRP.beta.L, and CHO-K1.hSIRP.gamma. cells were seeded in culture medium (DMEM-F12 (Gibco) supplemented with 5% New Born Calf Serum (BioWest) and Pen/Strep (Gibco)) in 96-well flat-bottom tissue culture plates and incubated at 37.degree. C., 5% CO.sub.2 and 95% humidity for 24 hours. Subsequently, culture medium was removed and cells were incubated for 1 hour at 37.degree. C., 5% CO.sub.2 and 95% humidity with purified hSIRP.gamma. antibodies (used at 10 .mu.g/mL and dilutions thereof). Next, cells were washed with PBS-T and incubated for 1 hour at 37.degree. C., 5% CO.sub.2 and 95% humidity with goat-anti-mouse IgG-HRP (Southern Biotech). Subsequently, cells were washed three times with PBS-T and immunoreactivity against hSIRP.alpha.V1, hSIRP.alpha.V2, hSIRP.beta.1, hSIRP.beta.L, and hSIRP.gamma. was visualized with TMB Stabilized Chromogen (Invitrogen). Reactions were stopped with 0.5 M H.sub.2SO.sub.4 and absorbances were read at 450 and 610 nm. EC.sub.50 values, the concentration at which 50% of the total binding signal is observed, were calculated using GraphPad Prism 6 (GraphPad Software, Inc.).

TABLE-US-00007 TABLE 7 Commercially available hSIRP.alpha. antibodies used for comparison with antibodies generated herein. Target Clone Cat. # Company Species Reactivity Isotype hSIRP.alpha. SE5A5 323802 Biolegend mouse human IgG1 hSIRP.alpha. 7B3 LS-C340387 LifeSpan Biosciences mouse human IgG1 hSIRP.alpha. 1B5 LS-C338479 LifeSpan Biosciences mouse human IgG1 hSIRP.alpha. 1C6 LS-C338477 LifeSpan Biosciences mouse human IgG1 hSIRP.alpha. 27 sc-136067 Santa Cruz mouse human, mouse, rat IgG1 Biotechnology hSIRP.alpha. SE7C2 sc-23863 Santa Cruz mouse human IgG1 Biotechnology hSIRP.alpha. P3C4 LS-C179629-100 CliniSciences mouse human IgG2a hSIRP.alpha. 2A4A5 W172-3 MBL International mouse human IgG2a hSIRP.alpha. 15-414 LS-C58098 LifeSpan Biosciences mouse human IgG2a hSIRP.alpha. 1H1 LS-C338476 LifeSpan Biosciences mouse human IgG2a hSIRP.alpha. C-7 sc-376884 Santa Cruz mouse human IgG2a Biotechnology hSIRP.alpha. 03 11612-MM03-100 Sino Biological Inc. mouse human IgG2b hSIRP.alpha. 5E10 LS C83566 LifeSpan Biosciences mouse human IgG2b hSIRP.alpha. 602411 MAB4546 R&D mouse human IgG2b hSIRP.alpha. EPR16264 ab191419 Abcam rabbit human, mouse, rat IgG hSIRP.alpha. D6I3M 13379S Cell Signaling rabbit human, mouse, rat, IgG Technology monkey hSIRP.alpha. 001 50956- Sino Biological Inc. rabbit mouse, human IgG R001_100ug hSIRP.alpha. REA144 130-099-768 Miltenyi Biotec human human IgG1 hSIRP.alpha. KWAR23 TAB-453CT Creative Biolabs human human IgG4

[0884] As depicted in FIG. 1 and the following Table 8, commercially available hSIRP.alpha. antibodies cross-react with at least hSIRP.beta.1, hSIRP.beta.L, or hSIRP.gamma. or demonstrate allele-specific binding to hSIRP.alpha.V2. The KWAR23 antibody cross-reacts with all members of the SIRP receptor family tested: it binds to hSIRP.alpha.V1, hSIRP.alpha.V2, hSIRP.beta.1, hSIRP.beta.L, and hSIRP.gamma..

TABLE-US-00008 TABLE 8 hSIRP.alpha.V1 hSIRP.alpha.V2 hSIRP.beta.1 hSIRP.gamma. hSIRP.beta.L binding binding binding binding binding EC50 EC50 EC50 EC50 EC50 Antibody (nM) (nM) (nM) (nM) (nM) hSIRP.alpha..50A 1.626 1.627 nd 1.475 0.639 anti-hSIRP.alpha. (clone SE5A5) 0.372 0.186 0.185 0.200 0.122 anti-hSIRP.alpha. (clone 7B3) 0.187 0.300 0.255 nd 0.206 anti-hSIRP.alpha. (clone 1B5) nd 0.122 nd nd nd anti-hSIRP.alpha. (clone 1C6) 0.739 0.167 2.965 15.589 2.008 anti-hSIRP.alpha. (clone 27) nd nd nd nd nd anti-hSIRP.alpha. (clone SE7C2) 1.269* 0.300 nd 1.525 26.818* anti-hSIRP.alpha. (clone P3C4) 0.288 2.154 0.383 0.365 0.136 anti-hSIRP.alpha. (clone 2A4A5) nd 1.005 8.633 nd 12.156* anti-hSIRP.alpha. (clone 15-414) nd nd nd nd nd anti-hSIRP.alpha. (clone 1H1) nd 0.204 nd nd nd anti-hSIRP.alpha. (clone C-7) nd nd nd nd nd anti-hSIRP.alpha. (clone 03) 96.016* 15.059* 16.043* 17.303* 9.109* anti-hSIRP.alpha. (clone 5E10) nd nd nd nd nd anti-hSIRP.alpha. (clone 602411) 0.068 nd 0.081 3.622 0.060 anti-hSIRP.alpha. (clone EPR16264) nd 2.450* nd nd nd anti-hSIRP.alpha. (clone D6I3M) 18.690* 8.762* nd nd nd anti-hSIRP.alpha. (clone 001) 18.081* nd nd 0.494 6.253* anti-hSIRP.alpha. (clone REA144) 5.243* 3.274* 4.534* 3.212* 2.147* KWAR23 0.067 0.062 0.140 0.043 0.097 Values indicated with * were extrapolated; nd, not detected

Example 2: Immunization and Selection of Anti-hSIRP.alpha. Antibodies

[0885] To generate SIRP.alpha. antibodies that bind to all known SIRP.alpha. alleles and are not binding SIRP.beta.1 mice were immunized with a pCI-neo expression construct encoding hSIRP.alpha.V1 and hSIRP.alpha.V2. Mice were immunized by gene gun immunization using a Helios Gene gun (BioRad, Hercules, Calif.) and DNA coated gold bullets (BioRad) following manufacturer's instructions. Briefly, 1 .mu.m gold particles were coated with pCI-neo-hSIRP.alpha.V1 or pCI-neo-hSIRP.alpha.V2 cDNA and commercial expression vectors for mouse Flt3L and mouse GM-CSF in a 2:1:1 ratio (both from Aldevron, Fargo, N. Dak.). A total of 1 .mu.g of plasmid DNA was used to coat 500 .mu.g of gold particles. Specifically, 7-8 weeks old female BALB/C mice (Harlan) were immunized in the ears with a gene gun, receiving 3 administration cycles in both ears.

[0886] For positive and negative B-cell selection and CELISA purposes, CHO-K1.hSIRP.alpha.V1, CHO-K1.hSIRP.alpha.V2, CHO-K1.hSIRP.beta.1, and CHO-K1.hCD47 stable cell lines were generated by transfecting CHO-K1 cells with pCI-neo vector encoding the full length open reading frame of hSIRP.alpha.V1, hSIRP.alpha.V2, hSIRP.beta.1, and hCD47 (NCBI accession: NM_001777.3) (SEQ ID NO: 42), respectively. Stable clones were obtained by limiting dilution.

[0887] Antibody titer was assessed by CELISA, using the CHO-K1.hSIRP.alpha.V1 and CHO-K1.hSIRP.alpha.V2 stable cell lines. These hSIRP.alpha.-expressing CHO-K1 cell lines were maintained in DMEM-F12 (Gibco) supplemented with 10% Fetal Bovine Serum (Hyclone) and 80U Pen/Strep (Gibco). Cells were seeded into 96-well flat-bottom tissue culture plates at 8.times.10.sup.4 cells/well and cultured at 37.degree. C., 5% CO.sub.2 and 95% humidity until cell layers were confluent. Cells were incubated with each sample of the diluted mouse sera for 1 hour at 37.degree. C., 5% CO.sub.2 and 95% humidity. Next, cells were washed with Phosphate buffered Saline (PBS)/0.05% Tween-20 (PBS-T) and incubated with goat-anti-mouse IgG-HRP conjugate (Southern Biotech) for 1 hour at 37.degree. C., 5% CO.sub.2 and 95% humidity. Subsequently, cells were washed three times with PBS-T and anti-hSIRP.alpha. immunoreactivity was visualized with TMB Stabilized Chromogen (Invitrogen). Reactions were stopped with 0.5 M H.sub.2SO.sub.4 and absorbances were read at 450 and 610 nm. The anti-hSIRP.alpha. titer was higher than 1:2,500 in each individual mouse serum sample as detected after two DNA immunizations. All mice that demonstrated reactivity against hSIRP.alpha.V1 and hSIRP.alpha.V2 were immunized for a final, third time and sacrificed 14 days later. Erythrocyte-depleted spleen and lymph-node cell populations were prepared as described previously (Steenbakkers et al., 1992, J. Immunol. Meth. 152: 69-77; Steenbakkers et al., 1994, Mol. Biol. Rep. 19: 125-134) and frozen at -180.degree. C.

[0888] To select anti-hSIRP.alpha. antibody producing B-cells, a selection strategy was designed and developed that preferentially bound B-cells expressing antibodies that bind to hSIRP.alpha.V1 and hSIRP.alpha.V2. Splenocytes and lymph nodes were harvested from the hSIRP.alpha.V1/V2 immunized mice and isolated cells were incubated with CHO-K1.hSIRP.beta.1 that were seeded into T25 culture flasks and irradiated at 30 Gray. After 1 hour unbound cells were gently removed by moving the flask back and forth. Medium containing unbound cells was then transferred to a new T25 flask containing irradiated CHO-K1.hSIRP.beta.1 cells. This procedure was followed for in total three times on ice in order to negatively select hSIRP.beta.1-reactive B-cells. Next, medium containing unbound B-cells was incubated with CHO-K1.hSIRP.alpha.V1 and CHO-K1.hSIRP.alpha.V2 cells that were irradiated at 3,000 Gray. After 1.5 hours incubation on ice unbound cells were removed with multiple wash steps using culture medium. Subsequently, T25 flasks containing CHO-K1.hSIRP.alpha.V1 and CHO-K1.hSIRP.alpha.V2 cells with bound lymphocytes were harvested with Trypsin-EDTA (Sigma). Bound B-cells were cultured, as described by Steenbakkers et al., 1994, Mol. Biol. Rep. 19: 125-134. Briefly, selected B-cells were mixed with 10% (v/v) T-cell supernatant and 50,000 irradiated (25 Gray) EL-4 B5 feeder cells in a final volume of 200 .mu.l medium in 96-well flat-bottom tissue culture plates. On day eight, supernatants were screened for hSIRP.alpha.V1 and hSIRP.alpha.V2 reactivity by CELISA as described below.

[0889] CHO-K1.hSIRP.alpha.V1, CHO-K1.hSIRP.alpha.V2, and CHO-K1.hSIRP.beta.1 were seeded in culture medium (DMEM-F12 (Gibco) supplemented with 10% Fetal Bovine Serum (Hyclone) and 80U Pen/Strep (Gibco)) in 96-well flat-bottom tissue culture plates and cultured at 37.degree. C., 5% CO.sub.2 and 95% humidity until they were confluent. Subsequently, culture medium was removed and cells were incubated for 1 hour at 37.degree. C., 5% CO.sub.2 and 95% humidity with supernatants from the B-cell cultures. Next, cells were washed with PBS-T and incubated for 1 hour at 37.degree. C., 5% CO.sub.2 and 95% humidity with goat-anti-mouse IgG-HRP conjugate (Southern Biotech). Subsequently, cells were washed three times with PBS-T and anti-hSIRP.alpha.V1, anti-hSIRP.alpha.V2, and anti-hSIRP.beta.1 immunoreactivity was visualized with TMB Stabilized Chromogen (Invitrogen). Reactions were stopped with 0.5 M H.sub.2SO.sub.4 and absorbances were read at 450 and 610 nm.

[0890] Immunoreactivity to human SIRP.gamma. was assessed by ELISA using recombinant hSIRP.gamma./Fc-protein (R&D Systems, Cat.#4486-SB-050; SEQ ID NO: 108) coated 96-well MaxiSorp flat-bottom plates. Protein coated 96-well plates were blocked in PBS/1% bovine serum albumin (BSA) for 1 hour at room temperature (RT). PBS/1% BSA was removed and plates were incubated for 1 hour at RT with supernatants from the B-cell cultures. Next, plates were washed with PBS-T and incubated for 1 hour at RT with goat-anti-mouse IgG-HRP conjugate (Southern Biotech). Subsequently, wells were washed three times with PBS-T and anti-hSIRP.gamma. immunoreactivity was visualized with TMB Stabilized Chromogen (Invitrogen). Reactions were stopped with 0.5 M H.sub.2SO.sub.4 and absorbances were read at 450 and 610 nm.

[0891] B-cell clones from the hSIRP.alpha. reactive supernatants, which were not or which were minimally reactive to hSIRP.beta.1 were immortalized by mini-electrofusion following published procedures (Steenbakkers et al., 1992, J. Immunol. Meth. 152: 69-77; Steenbakkers et al., 1994, Mol. Biol. Rep. 19:125-34) with some minor deviations (e.g. pronase reaction was omitted). Briefly, B-cells were mixed with 10.sup.6 Sp2/0-Ag14 murine myeloma cells (ATCC CRL-1581) in Electrofusion Isomolar Buffer (Eppendorf). Electrofusions were performed in a 50 .mu.L fusion chamber by an alternating electric field of 15 s, 1 MHz, 23 Vrms AC followed by a square, high field DC pulse of 10 .mu.s, 180 Volt DC and again by an alternating electric field of 15 s, 1 MHz, 23 Vrms AC. Content of the chamber was transferred to hybridoma selective medium and plated in a 96-well plate under limiting dilution conditions. On day 10 following the electrofusion, hybridoma supernatants were screened for hSIRP.alpha.V1, hSIRP.alpha.V2, hSIRP.beta.1, and hSIRP.gamma. binding activity by CELISA and ELISA, as described above. Hybridomas that secreted antibodies in the supernatant that specifically bound hSIRP.alpha.V1 and hSIRP.alpha.V2 were both frozen at -180.degree. C. (-1 batch) and subcloned by limited dilution to safeguard their integrity and stability. Stable hybridomas were frozen at -180.degree. C. (-LD1 batch) until cell layers were confluent.

[0892] Further selection of the hybridomas was performed by assessing the blocking abilities of the hSIRP.alpha.V1/hCD47 interaction in CELISA format. For the assessment of hCD47 blockade CHO-K1.hCD47 cells were seeded in 384-well flat-bottom tissue culture plates and incubated at 37.degree. C., 5% CO.sub.2 and 95% humidity in culture medium. Recombinant hSIRP.alpha./Fc-protein (R&D Systems, Cat.#4546-SA-050; SEQ ID NO: 107) was pre-incubated with a dilution series of the hybridoma supernatants containing hSIRP.alpha. reactive antibodies and control antibodies (at 10 .mu.g/mL and dilutions thereof) for 30 minutes at 37.degree. C., 5% CO.sub.2 and 95% humidity. Confluent CHO-K1.hCD47 cells were washed with PBS-T and incubated for 1 hour with the mixtures containing hSIRP.alpha. reactive antibodies and recombinant hSIRP.alpha./Fc-protein at 37.degree. C., 5% CO.sub.2 and 95% humidity. Next, cells were washed with PBS-T followed by addition of goat-anti-human IgG-HRP conjugate (Jackson Immuno Research) to the cells, which was incubated for 1 hour at 37.degree. C., 5% CO.sub.2 and 95% humidity. Subsequently cells were washed three times with PBS-T and binding of hSIRP.alpha./Fc-protein was visualized with TMB Stabilized Chromogen (Invitrogen). Reactions were stopped with 0.5 M H.sub.2SO.sub.4 and absorbances were read at 450 and 610 nm.

[0893] Selected stable hybridomas were cultured in serum-free media for 7 days; supernatants were harvested and antibodies were purified using MabSelect Sure Protein A resin according to the manufacturer's instructions (GE Healthcare). Antibody concentrations were quantified using spectrophotometry. Supernatants of the hybridoma cultures were used to isotype the hybridomas. In short, isotyping was done using a mouse monoclonal antibody isotyping kit (Biorad) based on a dipstick with immobilized goat-anti-mouse antibody bands to each of the common mouse isotypes and light chains. Recovered antibodies were all identified as mouse IgG1. Antibody sequences were elucidated by sequencing of variable regions of the mouse IgG1 hybridoma material performed at LakePharma, using the following method: the total RNA of the hybridoma cells was extracted, which allowed cDNA synthesis. Rapid Amplification of cDNA Ends (RACE) was performed that allowed cloning of positive fragments in a TOPO (Thermo Fisher Scientific) vector. TOPO clones were sequenced and sequences were annotated using VBASE2 (Retter et al., VBASE2, an integrative V gene database. Nucleic Acids Res. 2005 Jan. 1; 33(Database issue):D671-4).

Example 3: Characterization of hSIRP.alpha. Antibodies

[0894] The binding specificity of antibody hSIRP.alpha..50A to hSIRP.alpha. was compared antibody KWAR23 (Canadian Patent 2939293 A1), in a CELISA format. CHO-K1 cells were transiently transfected with hSIRP.alpha.V1, hSIRP.alpha.V2, hSIRP.beta.1, and hSIRP.gamma. (GenBank accession: NM_018556.3) (SEQ ID NO: 39) cDNAs. Subsequently, hSIRP.alpha. binding was assessed by CELISA using CHO-K1.hSIRP.alpha.V1, CHO-K1.hSIRP.alpha.V2, CHO-K1.hSIRP.beta.1, and CHO-K1.hSIRP.gamma. cells. Detection of bound antibody was performed with goat-anti-mouse IgG-HRP (Southern Biotech) for mouse antibodies including hSIRP.alpha..50A and control antibodies or, alternatively, with goat-anti-human IgG-HRP conjugate (Jackson Immuno Research) for the KWAR23 antibody. KWAR23 (SEQ ID NO: 130; SEQ ID NO: 131) was expressed as a chimeric human IgG4 kappa antibody in CHO cells. As shown in FIG. 2 and the following Table 9, KWAR23 antibody cross-reacts with all members of the SIRP receptor family tested: it binds to hSIRP.alpha.V1, hSIRP.alpha.V2, hSIRP.beta.1, and hSIRP.gamma.. EC.sub.50 values represent the concentration at which 50% of the total binding signal is observed (average and SD were calculated from values of two independent experiments).

TABLE-US-00009 TABLE 9 hSIRP.alpha.V1 binding EC50 (nM) hSIRP.alpha.V2 binding EC50 (nM) Antibody Average SD Average SD KWAR23 0.081 0.001 0.051 0.004 hSIRP.alpha..50A 1.365 0.164 1.296 0.186 anti-hSIRP.alpha. (clone SE5A5) 0.304 0.200 anti-hSIRP.gamma. (clone LSB2.20) nd nd hSIRP.beta.1 binding EC50 (nM) hSIRP.gamma. binding EC50 (nM) Antibody Average SD Average SD KWAR23 0.161 0.007 0.040 0.002 hSIRP.alpha..50A nd nd 1.249 0.179 anti-hSIRP.alpha. (clone SE5A5) 0.192 0.168 anti-hSIRP.gamma. (clone LSB2.20) nd 0.265 Empty squares indicate n = 1 measurements. nd, not detected

[0895] In addition, the specificity of hSIRP.alpha..50A for all known of hSIRP.alpha. alleles (allelic variants as described by Takenaka et al., 2007, Nat Immunol. 8:1313-1323) was further investigated by CELISA using the same strategy as above. To this end, hSIRP.alpha..50A binding was assessed using CHO-K1 cells that were transiently transfected with cDNAs encoding full length hSIRP.alpha.V1, hSIRP.alpha.V2, hSIRP.alpha.V3 (NA07056_V3) (SEQ ID NO: 43), hSIRP.alpha.V4 (NA11832_V4) (SEQ ID NO: 45), hSIRP.alpha.V5 (NA18502_V5) (SEQ ID NO: 47), hSIRP.alpha.V6 (NA18507_V6) (SEQ ID NO: 49), hSIRP.alpha.V8 (NA18570_V8) (SEQ ID NO: 51), and hSIRP.alpha.V9 (NA18943_V9) (SEQ ID NO: 53). FIG. 3 and the following Table 10 demonstrate the reactivity of antibody clone hSIRP.alpha..50A for each of these hSIRP.alpha. alleles. EC50 values represent the concentration at which 50% of the total binding signal is observed (average and SD were calculated from values of two independent experiments).

TABLE-US-00010 TABLE 10 Antibody anti-hSIRP.alpha. hSIRP.alpha..50A (clone SE5A5) hSIRP.alpha.V1 EC50 (nM) 0.936 0.327 SD 0.285 0.107 hSIRP.alpha.V2 EC50 (nM) 0.665 0.200 SD 0.106 0.046 hSIRP.alpha.V3 EC50 (nM) 0.688 0.226 SD 0.097 0.052 hSIRP.alpha.V4 EC50 (nM) 0.824 0.256 SD 0.280 0.085 hSIRP.alpha.V5 EC50 (nM) 0.765 0.276 SD 0.210 0.086 hSIRP.alpha.V6 EC50 (nM) 0.954 0.098 SD 0.437 0.050 hSIRP.alpha.V8 EC50 (nM) 0.644 0.300 SD 0.066 0.061 hSIRP.alpha.V9 EC50 (nM) 0.733 0.260 SD 0.205 0.079

Example 4: hCD47 Blocking Ability of hSIRP.alpha..50A

[0896] The hSIRP.alpha..50A antibody was analyzed by flow cytometry for its ability to block recombinant hCD47/Fc-protein (R&D Systems, Cat.#4670-CD-050; SEQ ID NO: 109) binding to cell surface expressed hSIRP.alpha.. For this purpose, THP-1 (ATCC TIB-202) and U-937 (ATCC CRL-1593.2) monocyte cell lines were used as the source of hSIRP.alpha. in the assay. THP-1 and U-937 cells were seeded in 96-well round bottomed tissue culture plates and incubated for 45 minutes with FcR Blocking Reagent (Miltenyi Biotec) and hSIRP.alpha..50A antibody (200 .mu.g/mL and dilutions thereof) in PBS/1% BSA at 4.degree. C. Next, cells were washed three times with PBS/1% BSA and incubated with DyLight 488-labeled recombinant hCD47/Fc-protein for 30 minutes at 4.degree. C. After this labeling procedure, cells were washed two times, resuspended in PBS/1% BSA containing 0.1 .mu.g/mL DAPI (BioLegend), and analysed by flow cytometry on the FACSCanto II (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC).

[0897] As depicted in FIG. 4 and the following Table 11, binding of recombinant hCD47 fused to an Fc domain of human IgG1 was monitored in the presence of increasing amounts of the hSIRP.alpha..50A antibody. Antibody hSIRP.alpha..50A blocked the hSIRP.alpha./hCD47 interaction, using the flow cytometry-based method described above. IC50 values for the blockade of hCD47 were calculated from this data. IC50 values represent the concentration at which half of the inhibition is observed.

TABLE-US-00011 TABLE 11 THP-1 U-937 Antibody IC50 (nM) IC50 (nM) hSIRP.alpha..50A 4.605 7.164

[0898] Next, the binding of hSIRP.alpha..50A to hSIRP.alpha. expressed on primary human CD14.sup.+ monocytes was investigated. In addition, the ability of hSIRP.alpha..50A to block the interaction between hSIRP.alpha. and recombinant hCD47/Fc-protein was assessed. For this purpose, CD14+ monocytes were isolated from Ficoll-purified human peripheral blood mononuclear cells (PBMCs) using RosetteSep human monocyte enrichment cocktail (Stemcell). The percentage of monocytes present after the enrichment was determined by flow cytometry on the FACSVerse (BD Biosciences) based on CD14 staining using an APC-Cy7-conjugated mouse-anti-human CD14 detection antibody (BD Biosciences). Subsequently, CD14+ enriched PBMCs were seeded in 96-well round bottomed tissue culture plates and incubated for 40 minutes with FcR Blocking Reagent (Miltenyi Biotec) containing hSIRP.alpha..50A antibody (25 .mu.g/mL and dilutions thereof) in PBS/1% BSA at 4.degree. C. Next, cells were washed three times with PBS/1% BSA and incubated with a FITC-labeled goat-anti-mouse Ig (BD Biosciences) detection antibody in PBS/1% BSA for 40 minutes at 4.degree. C. After this labeling procedure, cells were washed two times, resuspended in PBS/1% BSA containing 0.1m/mL DAPI (BioLegend), and analysed by flow cytometry on the FACSVerse (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC).

[0899] FIGS. 5A and B and the following Table 12 indicates that hSIRP.alpha..50A binds to primary human CD14+ enriched monocytes. EC50 values represent the concentration at which 50% of the total binding signal is observed. To assess the blocking ability of hSIRP.alpha..50A, CD14+ enriched monocytes cells were seeded in 96-well round bottomed tissue culture plates and incubated for 45 minutes with FcR Blocking Reagent (Miltenyi Biotec) and hSIRP.alpha..50A antibody (200m/mL and dilutions thereof) in PBS/1% BSA at 4.degree. C. Thereafter, cells were washed three times with PBS/1% BSA and incubated with 10m/mL DyLight 488-labeled recombinant hCD47/Fc-protein for 45 minutes at 4.degree. C. After this labeling procedure, cells were washed two times, resuspended in PBS/1% BSA containing 0.1m/mL DAPI (BioLegend), and analysed by flow cytometry on the FACSVerse (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC). FIGS. 5 C and D and the following Table 12 demonstrates the ability of antibody hSIRP.alpha..50A to block the hSIRP.alpha./hCD47 interaction. IC50 values for the blockade of hCD47 were calculated from this data. IC50 values represent the concentration at which half of the inhibition is observed.

TABLE-US-00012 TABLE 12 Donor 1 Donor 2 Antibody EC50 (nM) IC50 (nM) EC50 (nM) IC50 (nM) hSIRP.alpha..50A 7.381 4.618 3.081 1.035

Example 5: Functionality of hSIRP.alpha..50A mAb in the Human Granulocyte Phagocytosis Assay

[0900] To confirm the functionality of hSIRP.alpha..50A in primary immune cells, granulocytes (e.g. effector cells) were isolated from healthy human donor EDTA blood. First, the EDTA blood of each donor was pooled and centrifuged at 300 g for 6 minutes at 20.degree. C. Next, plasma was removed by aspiration, and the remaining blood cells were gently resuspended. Cells were recovered in red blood cell (RBC) lysis buffer (155 mM NH4C1; 10 mM KHCO3) and incubated for 10 minutes on ice. Next, cells were centrifuged at 300 g for 7 minutes. Supernatants containing lysed RBCs were removed by aspiration, and the remaining blood cells were gently resuspended in RBC lysis buffer and kept on ice for 1 minute. RBC lysis was neutralized by adding assay medium (IMDM (Gibco) supplemented with 10% Fetal Bovine Serum (Gibco) and Pen/Strep (Gibco)). Blood cells were centrifuged at 300 g for 6 minutes and supernatants were removed by aspiration to remove remaining RBCs as much as possible. Subsequently, erythrocyte-lysed blood cells were resuspended in assay medium containing 10 ng/mL IFN.gamma. and cells were incubated for 1 hour at 37.degree. C., 5% CO.sub.2 and 95% humidity. Non-adherent blood cells containing human granulocytes were collected by mild washing of the tissue culture plate with assay medium (monocytes are depleted due to adherence to the plastic surface). The percentage of granulocytes present in the cell suspension was determined by flow cytometry on the FACSCanto II (BD Biosciences) based on high forward scatter (FSC) and side scatter (SSC). Binding of hSIRP.alpha..50A to human granulocytes was assessed by incubating the cells for 30 minutes at 4.degree. C. with hSIRP.alpha..50A antibody (25 .mu.g/mL and dilutions thereof) in PBS/1% BSA containing 10% autologous serum (PBS/1% BSA/10% serum). Next, cells were washed three times with PBS/1% BSA/10% serum and incubated for 30 minutes at 4.degree. C. with a FITC-labeled goat-anti-mouse Ig (BD Biosciences) detection antibody. After this labeling procedure, cells were washed two times, resuspended in PBS/1% BSA/10% serum and analysed by flow cytometry on the FACSCanto II (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC). FIG. 6A shows that hSIRP.alpha..50A binds to primary human granulocytes. EC50 values represent the concentration at which 50% of the total binding signal is observed.

[0901] Next, target cells were fluorescently labeled with either cell proliferation dye eFluor450 (eBioscience) in the case of Raji (ECACC 85011429), Daudi (ECACC 85011437), Ramos (ECACC 85030802), and BJAB (DSMZ ACC-757) lymphoma cells or, alternatively, with Vybrant DiD cell-labeling solution (Thermo Fisher Scientific) for FaDu cells. Labeling was performed according to manufacturer's instructions. Labeled target cells were co-cultured for 2-3 hours at 37.degree. C., 5% CO.sub.2 and 95% humidity with isolated primary human granulocytes in a 1:1 ratio (7.5*10.sup.4 cells of each target and effector per well of a 96-well round bottomed tissue culture plate) in the presence of 0.1 .mu.g/mL rituximab (anti-hCD20). In addition, cells were co-cultured with 0.1 .mu.g/mL rituximab in presence of 10 .mu.g/mL hSIRP.alpha..50A. Phagocytosis was assayed by determining the percentage of granulocytes positive for eFluor450 (or DID) using flow cytometry on the FACSCanto II (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC).

[0902] Compared to the mouse IgG1 isotype control, hSIRP.alpha..50A potently enhances tumor cell phagocytosis induced by rituximab (FIG. 6B). The same procedure was followed with other existing therapeutic antibodies such as 0.05 .mu.g/mL daratumumab (anti-hCD38), 0.1 .mu.g/mL alemtuzumab (anti-hCD52), and 0.1 .mu.g/mL cetuximab (anti-hEGFR) (FIG. 6C-E). These data demonstrate that hSIRP.alpha..50A enhances antibody-mediated tumor cell phagocytosis by human granulocytes.

Example 6: Functionality of hSIRP.alpha..50A mAb in the Human Macrophage Phagocytosis Assay

[0903] Blockade of CD47 by hSIRP.alpha..50A enhances the phagocytosis of human lymphoma cells tumor cells by human macrophages. Human macrophages were generated by first enriching CD14+ monocytes from Ficoll-purified human peripheral blood mononuclear cells (PBMCs) using RosetteSep human monocyte enrichment cocktail (Stemcell). Monocytes were seeded into CellCarrier 96-well flat-bottom microplates (Perkin Elmer) and cultured in macrophage medium (IMDM (Gibco) supplemented with 8.5% Fetal Bovine Serum (Gibco) and Pen/Strep (Gibco)) containing 50 ng/mL human monocyte colony stimulating factor (M-CSF) for 7 days at 37.degree. C., 5% CO.sub.2 and 95% humidity to promote differentiation into macrophages. These monocyte-derived macrophages (MDMs) become adherent allowing other cells to be washed away. Human Raji, Daudi, Ramos, and BJAB lymphoma cells were counted and labeled with cell proliferation dye eFluor450 (eBioscience) following manufacturer's instructions. After labeling, the lymphoma cells were mixed with assay medium (RPMI (Gibco) supplemented with 10% Fetal Bovine Serum (Gibco) and Pen/Strep (Gibco)) containing 10 .mu.g/mL anti-hSIRP.alpha. antibodies, respective isotype controls and either 0.1 .mu.g/mL rituximab (anti-hCD20) or 0.05 .mu.g/mL daratumumab (anti-hCD38). The lymphoma cells were then added to the individual wells containing MDMs at a ratio of 2.5:1 tumor cells per phagocyte, mixed and incubated at 37.degree. C., 5% CO.sub.2 and 95% humidity for 2 hours. After the incubation, the wells were washed with PBS to remove most of the non-phagocytosed tumor cells, and cells were fixed with 2% formaldehyde for 10 min at RT. The wells were then washed and maintained in PBS/3% BSA in dark at 4.degree. C. overnight. Lymphoma cells present in the wells were stained with biotin-conjugated anti-human CD19 clone HIB19 (eBioscience) for 1 hour at RT, and subsequently were counterstained with Alexa Fluor 488-conjugated streptavidin (Thermo Fisher Scientific) for 1 hour at RT. Next, nuclei were stained with DRAQ5 (Thermo Fisher Scientific) for 10 minutes at RT, mixture was removed, and PBS was added to each well. Cells were analysed with the Operetta automated fluorescence microscope (Perkin Elmer). Data were processed and analysed with Columbus V2.6 software.

[0904] As shown in FIG. 7, hSIRP.alpha..50A enhances rituximab and daratumumab-mediated phagocytosis activity. The phagocytosis of human lymphoma cells was quantified using a phagocytosis index, as follows: (number of tumor cells inside macrophages/number of macrophages)*100; counting at least 200 macrophages per sample.

Example 7: Humanized Antibody Design and CDR Grafting

[0905] The mouse hSIRP.alpha..50A antibody was humanized using CDR-grafting technology (see e.g. U.S. Pat. No. 5,225,539 and Williams, D. G. et al., 2010, Antibody Engineering, volume 1, Chapter 21).

[0906] First, human germline sequences were identified using IgBLAST (Ye J. et al., 2013, Nucleic Acids Res. 41:W34-40). For the hSIRP.alpha..50A VH human germline sequence, V-gene IGHV1/OR15-2*02 was identified (75.2% identity) and for the VL human germline sequence IGKV1-27*01 was identified (74.0% identity). These two germline sequences were used to directly graft the mouse CDRs, resulting in the following two cDNA constructs: SEQ ID NO: 17 (VH) and SEQ ID NO: 25 (VL).

[0907] Next, a database was constructed containing all human sequences available in the IMGT database (Lefranc, M.-P. et al., 1999, Nucleic Acid Res. 27:209-212) identifying 85,848 individual sequences. These sequences were queried using TBLASTN (2.2.31+) to identify template sequences that demonstrated the highest identify to the framework of hSIRP.alpha..50A VH and VL sequences. Three VH and three VL sequences were identified that demonstrated a similarity score of 75% or higher and that displayed similar CDR lengths, preferably identical to those in hSIRP.alpha..50A VH CDR1, CDR2, CDR3 and VL CDR1, CDR2 and CDR3, respectively.

[0908] For the heavy chain, the frameworks encoded by GenBank (Benson, D. A. et al., 2013, Nucleic Acids Res. 41(D1): D36-42) accession # AB066948, AB067235, and U84168 were selected as templates for straight grafting of the hSIRP.alpha..50A VH CDRs, resulting in the following cDNA constructs: SEQ ID NO: 9, 11 and 13, respectively. For the light chain, the frameworks encoded by GenBank accession # JF894288, AB363321, and L12101 were selected as templates for straight grafting of the hSIRP.alpha..50A VL CDRs, resulting in the following cDNA constructs: SEQ ID NO: 19, 21 and 23. Framework and CDR definition were those as described by Kabat et al. ("Sequences of Proteins of Immunological Interest", Kabat, E., et al., US Department of Health and Human Services, (1983)).

[0909] To understand the effect of humanized framework residues on the structure of the Fv, a homology model of the mouse hSIRP.alpha..50A Fv was made using the `Antibody Modeling Cascade` (default parameters) within Discovery Studio 4.5. The homology model was built on basis of PDB ID 1CIC, for the light chain and Fv, and PDB ID 4QOX for the heavy chain. The CDRs were grafted in silico to study residues that are close to any of the CDRs and which might affect the loop conformation, referred as Vernier residues. Residues that might affect the loop conformation, and which are within <5 .ANG. to the CDR surface were identified and substituted with the mouse amino acid at this position. The resulting templates were checked for the presence of post translational modification (PTM) motifs using Discovery Studio 4.5 and where possible (i.e. non-CDR, non-Vernier residues) changed to prevent a PTM. For the heavy chain, removal of the predicted sequence PTM motifs and structural considerations (i.e. rigidity of the backbone) in the hSIRP.alpha..50A VH resulted in the design of one additional construct: SEQ ID NO: 15. For the light chain the PTM removal resulted in the following construct: SEQ ID NO: 27.

[0910] CDRs were grafted on each of the identified templates, expressed as a human IgG4 (SEQ ID NO: 65), kappa (SEQ ID NO: 63) antibody cloned in the pcDNA3.1(+) vector (Thermo Fisher Scientific) and for transient transfection in FreeStyle 293-F human embryonic kidney cells (HEK293T/17, ATCC CRL-11268). In each case, an IgG4 version carrying the stabilizing Adair mutation (Angal S. et al., 1993, Mol Immunol. 30: 105-108), where Serine 228 is converted to Proline, was used.

Example 8: Synthesis, Expression and Purification of Humanized Constructs

[0911] Plasmids encoding the heavy chain and light chain constructs were mixed in a 1:1 ratio (30m in total) and transiently expressed by transfection into FreeStyle 293-F cells using 293fectin transfection reagent (Invitrogen) following the manufacturer's instructions. Supernatants (30 ml) were harvested after 7 days and antibodies were purified using MabSelect Sure Protein A resin according to the manufacturer's instructions (GE Healthcare). Buffer was exchanged for 10 mM Histidine, 100 mM NaCl pH 5.5 buffer using Zeba desalting columns (Thermo Fisher Scientific). The concentration of purified antibodies was determined based on OD280 (Nanodrop ND-1000). Endotoxin level was determined by LAL-test according to the manufacturer's instructions (Lonza).

Example 9: Binding of Humanized SIRP.alpha. Antibodies

[0912] Binding of the humanized antibodies to hSIRP.gamma. was studied in CELISA format.

[0913] Binding of the hSIRP.gamma. antibodies to human SIRP.alpha.V1, SIRP.alpha.V2, hSIRP.beta.1, and hSIRP.gamma. was confirmed using CHO-K1 cells that had been transiently transfected with cDNA encoding the full length open reading frame of each of these respective targets subcloned into the pCI-neo vector. CHO-K1.hSIRP.alpha.V1, CHO-K1.hSIRP.alpha.V2, CHO-K1.hSIRP.beta.1, and CHO-K1.hSIRP.gamma. cells were seeded in culture medium (DMEM-F12 (Gibco) supplemented with 5% New Born Calf Serum (BioWest) and Pen/Strep (Gibco)) in 96-well flat-bottom tissue culture plates and incubated at 37.degree. C., 5% CO.sub.2 and 95% humidity until cell layers were confluent. Subsequently, culture medium was removed and cells were incubated for 1 hour at 37.degree. C., 5% CO.sub.2 and 95% humidity with purified hSIRP.gamma. antibodies (10m/mL and dilutions thereof). Next, cells were washed with PBS-T and incubated for 1 hour at 37.degree. C., 5% CO.sub.2 and 95% humidity with goat-anti-human IgG-HRP conjugate (Jackson Immuno Research) or goat-anti-mouse IgG-HRP (Southern Biotech). Subsequently, cells were washed three times with PBS-T and anti-hSIRP.gamma. immunoreactivity was visualized with TMB Stabilized Chromogen (Invitrogen). Reactions were stopped with 0.5 M H.sub.2SO.sub.4 and absorbances were read at 450 and 610 nm. EC50 values, the concentration at which 50% of the total binding signal is observed, were calculated using GraphPad Prism 6 (GraphPad Software, Inc.). In Table 13 the EC50 values of the humanized hSIRP.gamma. antibodies are depicted.

[0914] Table 13: Binding of humanized and parental hSIRP.alpha..50A antibodies to CHO-K1.hSIRP.alpha.V1, CHO-K1.hSIRP.alpha.V2, CHO-K1.hSIRP.beta.1, and CHO-K1.hSIRP.gamma. cells. EC50 values represent the concentration at which 50% of the total binding signal is observed (average and SD were calculated from values of two independent experiments).

TABLE-US-00013 TABLE 13 hSIRP.alpha.V1 binding hSIRP.alpha.V2 binding hSIRP.beta.1 binding hSIRP.gamma. binding EC50 (nM) EC50 (nM) EC50 (nM) EC50 (nM) Antibody Average SD Average SD Average SD Average SD hSIRP.alpha..50H 0.883 0.212 0.864 0.109 nd nd 1.485* 0.120 1L1 hSIRP.alpha..50H 0.781 0.104 0.816 0.161 nd nd 1.259* 0.155 1L2 hSIRP.alpha..50H 1.094 0.112 1.107 0.238 nd nd 2.579* 0.672 1L3 hSIRP.alpha..50H 1.488 0.259 1.621 0.320 nd nd 7.435* 0.208 1L4 hSIRP.alpha..50H 0.962 0.235 0.848 0.239 nd nd 1.013* 0.115 1L5 hSIRP.alpha..50H 1.097 0.286 1.056 0.303 nd nd 1.424* 0.080 3L1 hSIRP.alpha..50H 1.055 0.347 0.999 0.450 nd nd 1.502* 0.305 3L2 hSIRP.alpha..50H 1.159 0.417 1.160 0.429 nd nd 2.471* 0.530 3L3 hSIRP.alpha..50H 1.261 0.317 1.520 0.333 nd nd 5.175* 0.210 3L4 hSIRP.alpha..50H 0.878 0.097 0.868 0.190 nd nd 1.199* 0.120 3L5 hSIRP.alpha..50H 0.683 0.027 0.681 0.156 nd nd 0.950* 0.171 4L1 hSIRP.alpha..50H 0.737 0.110 0.651 0.147 nd nd 0.871* 0.062 4L2 hSIRP.alpha..50H 0.933 0.078 0.898 0.133 nd nd 1.596* 0.144 4L3 hSIRP.alpha..50H 1.197 0.175 1.240 0.238 nd nd 1.980* 0.681 4L4 hSIRP.alpha..50H 0.701 0.136 0.661 0.161 nd nd 0.808* 0.038 4L5 hSIRP.alpha..50H 0.731 0.039 0.709 0.063 nd nd 1.028* 0.087 5L1 hSIRP.alpha..50H 0.675 0.086 0.572 0.023 nd nd 0.822* 0.046 5L2 hSIRP.alpha..50H 1.029 0.084 0.796 0.004 nd nd 1.612* 0.247 5L3 hSIRP.alpha..50H 1.169 0.197 1.115 0.060 nd nd 4.028* 0.342 5L4 hSIRP.alpha..50H 0.681 0.066 0.611 0.030 nd nd 0.868* 0.028 5L5 hSIRP.alpha..50A 1.365 0.164 1.296 0.186 nd nd 1.249* 0.179 Note that variants with the H2 heavy chain could not be expressed in FreeStyle 293-F cells; values indicated with * were extrapolated; nd, not detected

[0915] Binding of the parental and humanized hSIRP.gamma. antibodies to hSIRP.gamma. was further assessed using NK-92MI cells (ATCC CRL-2408), an interleukin-2 (IL-2) independent natural killer cell line derived from the NK-92 cell line. NK-92MI cells were seeded in 96-well round bottomed tissue culture plates and incubated for 30 minutes with the humanized hSIRP.alpha..50A antibody variants (100m/mL and dilutions thereof) in PBS/1% BSA at 4.degree. C. Next, cells were washed three times with PBS/1% BSA and incubated for 30 minutes at 4.degree. C. with a FITC-labeled mouse-anti-human IgG4 (Abcam) or donkey-anti-mouse IgG (Jackson Immuno Research) detection antibody in PBS/1% BSA. After this labeling procedure, cells were washed two times, resuspended in PBS/1% BSA and analysed by flow cytometry on the FACSCanto II (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC).

Example 10: Blockade of hCD47 Binding to hSIRP.gamma. by Humanized hSIRP.alpha..50A Antibodies

[0916] hCD47 blockade was assessed by flow cytometry for the full panel of humanized hSIRP.alpha..50A antibodies. To this end, HEK293 cells (ATCC CRL-1573) were transiently transfected using Lipofectamine 2000 (Invitrogen) with the pCI-neo vector encoding the full length open reading frame of human SIRP.alpha.V1. The transfected cells were cultured at 37.degree. C., 5% CO.sub.2 and 95% humidity in medium (DMEM-F12 (Gibco) with 10% Fetal Bovine Serum (Gibco) and Pen/Strep (Gibco)) until confluent. Subsequently, cells were dissociated and seeded in 96-well round bottomed tissue culture plates and incubated for 30 minutes with the humanized hSIRP.alpha..50A antibody variants (100m/mL and dilutions thereof) in PBS/1% BSA at 4.degree. C. Next, cells were washed three times with PBS/1% BSA and incubated with recombinant hCD47/Fc-protein (ModiQuest; SEQ ID NO: 42) for 30 minutes at 4.degree. C. Afterwards, cells were washed three times with PBS/1% BSA and incubated for 30 minutes at 4.degree. C. with a mouse-anti-human IgG1 Hinge-FITC (Southern Biotech) detection antibody. After this labeling procedure, cells were washed two times, resuspended in PBS/1% BSA and analysed by flow cytometry on the FACSCanto II (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC) and plotted using GraphPad Prism 6 (GraphPad Software, Inc.) (FIG. 8).

[0917] As depicted in FIG. 8, binding of recombinant hCD47 fused to an Fc domain of human IgG1 was monitored in the presence of increasing amounts of the humanized hSIRP.alpha..50A antibody variants. All antibody variants blocked the hSIRP.alpha./hCD47 interaction.

Example 11: Binding Domain of hSIRP.alpha..50A

[0918] To identify the binding region of hSIRP.alpha..50A, several SIRP.alpha. exchange-mutants were designed based on the human SIRP.alpha.V1 and hSIRP.beta.1 amino acid sequence. Based on the fold of SIRP.alpha., the extracellular region can be subdivided into three separate domains: the Ig-like (immunoglobulin-like) V-type (IgV), Ig-like C1-type (IgC1), and Ig-like C2-type (IgC2) domain. The IgV domain is also known as the ligand-binding N-terminal domain of SIRP.alpha. (which binds to CD47). The human SIRP.alpha.V1/31 mutants were designed on the basis of the full length hSIRP.alpha.V1 sequence (SEQ ID NO: 33) and each individual Ig-like domain was substituted for the equivalent domain of human SIRP.beta.1 (SEQ ID NO: 37). The cDNAs encoding the constructs, hSIRP.alpha.-V.beta.C1.alpha.C2.alpha.(SEQ ID NO: 55), hSIRP.alpha.-V.alpha.C1.beta.C2.alpha.(SEQ ID NO: 57), and hSIRP.alpha.-V.alpha.C1.alpha.C2.beta. (SEQ ID NO: 59) were synthesized (GeneArt) and subcloned into the pCI-neo vector. Binding of hSIRP.alpha..50A to the exchange mutants was tested using CELISA. To this end, CHO-K1 cells were transiently transfected, using Lipofectamine 2000, with the pCI-neo vectors encoding hSIRP.alpha.V1, hSIRP.alpha.V2, hSIRP.beta.1, hSIRP.alpha.-V.beta.C1.alpha.C2.alpha., hSIRP.alpha.-V.alpha.C1.beta.C2.alpha., and hSIRP.alpha.-VaC1.alpha.C2.beta., respectively. The transfected cells were cultured at 37.degree. C., 5% CO.sub.2 and 95% humidity in medium (DMEM-F12 (Gibco) with 5% New Born Calf serum (Biowest) and Pen/Strep (Gibco)) until confluent. Subsequently, cells were trypsinized and seeded in 96-well flat-bottom tissue culture plates and cultured at 37.degree. C., 5% CO.sub.2 and 95% humidity in culture medium until confluent. Then, culture medium was removed and cells were incubated for 1 hour at 37.degree. C., 5% CO.sub.2 and 95% humidity with hSIRP.alpha..50A and anti-hSIRP.alpha. clone SE5A5 antibodies. Next, cells were washed with PBS-T and incubated for 1 hour at 37.degree. C., 5% CO.sub.2 and 95% humidity with goat-anti-mouse IgG-HRP conjugate (Southern Biotech). After that, cells were washed three times with PBS-T and anti-hSIRP.alpha. immunoreactivity was visualized with TMB Stabilized Chromogen (Invitrogen). Reactions were stopped with 0.5 M H.sub.2SO.sub.4 and absorbances were read at 450 and 610 nm.

[0919] The antibody of the present invention demonstrated loss of binding to the hSIRP.alpha.-V.beta.C1.alpha.C2.alpha.mutant, indicating that hSIRP.alpha..50A binds to the IgV domain of hSIRP.alpha. (FIG. 9; Table 14). EC50 values represent the concentration at which 50% of the total binding signal is observed (average and SD were calculated from values of two independent experiments).

TABLE-US-00014 TABLE 14 Antibody anti-hSIRP.alpha. hSIRP.alpha..50A (clone SE5A5) hSIRP.alpha.V1 EC50 (nM) 0.321 0.117 SD 0.018 0.001 hSIRP.alpha.V2 EC50 (nM) 0.215 0.084 SD 0.012 0.012 hSIRP.beta.1 EC50 (nM) nd 0.180 SD nd 0.025 hSIRP.alpha.-V.beta.C1.alpha.C2.alpha. EC50 (nM) nd 0.121 SD nd 0.003 hSIRP.alpha.-V.alpha.C1.beta.C2.alpha. EC50 (nM) 0.345 0.135 SD 0.008 0.013 hSIRP.alpha.-V.alpha.C1.alpha.C2.beta. EC50 (nM) 0.408 0.127 SD 0.039 0.028

[0920] To pinpoint the amino acids for interaction of hSIRP.alpha..50A with the IgV domain, several point mutants of hSIRP.alpha.V1 were generated based on single amino acid differences between hSIRP.alpha.V1/V2 and hSIRP.beta.1. FIG. 10A shows an alignment of the hSIRP.alpha. and hSIRP.beta.1 IgV domain. Amino acids in the hSIRP.alpha. IgV domain that are altered in hSIRP.beta.1 were mutated by using the QuikChange II Site-Directed Mutagenesis Kit (Stratagene) and the full length hSIRP.alpha.V1 sequence (SEQ ID NO: 33) as donor cDNA. Binding of hSIRP.alpha..50A to hSIRP.alpha.V1 point mutants was tested using CELISA. To this end, CHO-K1 cells were transiently transfected, using Lipofectamine 2000, with cDNA encoding the full length open reading frame of hSIRP.alpha.V1 and mutants thereof, and hSIRP.beta.1 subcloned into the pCI-neo vector. Transfected cells were seeded in culture medium (DMEM-F12 (Gibco) supplemented with 5% New Born Calf Serum (BioWest) and Pen/Strep (Gibco)) in 96-well flat-bottom tissue culture plates and incubated at 37.degree. C., 5% CO.sub.2 and 95% humidity for 24 hours. Subsequently, culture medium was removed and cells were incubated for 1 hour at 37.degree. C., 5% CO.sub.2 and 95% humidity with purified hSIRP.alpha. antibodies (used at 10m/mL and dilutions thereof). Next, cells were washed with PBS-T and incubated for 1 hour at 37.degree. C., 5% CO.sub.2 and 95% humidity with goat-anti-mouse IgG-HRP (Southern Biotech). Subsequently, cells were washed three times with PBS-T and immunoreactivity against hSIRP.alpha.V1, hSIRP.alpha.V1 mutants, and hSIRP.beta.1 was visualized with TMB Stabilized Chromogen (Invitrogen). Reactions were stopped with 0.5 M H.sub.2SO.sub.4 and absorbances were read at 450 and 610 nm. EC50 values, the concentration at which 50% of the total binding signal is observed, were calculated using GraphPad Prism 6 (GraphPad Software, Inc.) (average and SD were calculated from values of two independent experiments). As shown in FIG. 10B and the following Table 15, the Proline at position 74 (P74) constitutes a crucial amino acid for the specific binding of hSIRP.alpha..50A to hSIRP.alpha.V1. Expression of hSIRP.alpha.V1(P74A) (SEQ ID NO: 61), where P74 is converted to Alanine, on CHO-K1 cells results in loss of hSIRP.alpha..50A antibody binding. This proline is absent in the IgV domain sequence of hSIRP.beta.1.

TABLE-US-00015 TABLE 15 hSIRP.alpha.V1 hSIRP.beta.1 hSIRP.alpha.V1(P74A) binding binding binding EC50 (nM) EC50 (nM) EC50 (nM) Antibody Average SD Average SD Average SD hSIRP.alpha..50A 0.535 0.152 nd nd nd nd anti-hSIRP.alpha. 0.164 0.008 0.156 0.009 0.150 0.013 (clone SE5A5)

Example 12: Characterization of hSIRP.alpha..40A and hSIRP.alpha..50A Antibodies

[0921] The binding specificity of antibodies hSIRP.alpha..40A and hSIRP.alpha..50A to hSIRP.alpha. were compared in a CELISA format. In short, CHO-K1 cells were transiently transfected with hSIRP.alpha.V1, hSIRP.alpha.V2, hSIRP.beta.1, hSIRP.beta.L, and hSIRP.gamma. cDNAs. Subsequently, hSIRP.alpha. binding was assessed by CELISA using CHO-K1.hSIRP.alpha.V1, CHO-K1.hSIRP.alpha.V2, CHO-K1.hSIRP.beta.1, CHO-K1.hSIRP.beta.3L, and CHO-K1.hSIRP.gamma. cells. Detection of bound antibody was done with goat-anti-mouse IgG-HRP (Southern Biotech). As shown in FIG. 11 and the following Table 16, hSIRP.alpha..40A and hSIRP.alpha..50A antibodies bind to hSIRP.alpha.V1, hSIRP.alpha.V2, hSIRP.beta.L, and hSIRP.gamma., but do not display detectable hSIRP.beta.1 binding. EC.sub.50 values represent the concentration at which 50% of the total binding signal is observed (average and SD were calculated from values of two independent experiments).

TABLE-US-00016 TABLE 16 hSIRP.alpha.V1 binding hSIRP.alpha.V2 binding hSIRP.beta.1 binding hSIRP.gamma. binding hSIRP.beta.L binding EC50 (nM) EC50 (nM) EC50 (nM) EC50 (nM) EC50 (nM) Antibody Average SD Average SD Average SD Average SD Average SD hSIRP.alpha..40A 0.109 0.036 0.088 0.002 nd nd 0.099 0.055 0.141 0.078 hSIRP.alpha..50A 1.428 0.371 1.156 0.127 nd nd 1.990 0.827 0.632 0.277 nd, not detected

[0922] In addition, the specificity of hSIRP.alpha..40A for all known of hSIRP.alpha. alleles (allelic variants as described by Takenaka et al., Nat Immunol. 8:1313-1323 (2007) was further investigated by CELISA using the same strategy as above. To this end, hSIRP.alpha..40A binding was assessed using CHO-K1 cells that were transiently transfected with cDNAs encoding full length hSIRP.alpha.V1, hSIRP.alpha.V2, hSIRP.alpha.V3 (NA07056_V3) (SEQ ID NO: 44), hSIRP.alpha.V4 (NA11832_V4) (SEQ ID NO: 46), hSIRP.alpha.V5 (NA18502_V5) (SEQ ID NO: 48), hSIRP.alpha.V6 (NA18507_V6) (SEQ ID NO: 50), hSIRP.alpha.V8 (NA18570_V8) (SEQ ID NO: 52), and hSIRP.alpha.V9 (NA18943_V9) (SEQ ID NO: 54). FIG. 12 and the following Table 17 demonstrates the reactivity of antibody clone hSIRP.alpha..40A for each of these hSIRP.alpha. alleles. EC50 values represent the concentration at which 50% of the total binding signal is observed (average and SD were calculated from values of two independent experiments).

TABLE-US-00017 TABLE 17 Antibody hSIRP.alpha..40A hSIRP.alpha..50A hSIRP.alpha.V1 EC50 (nM) 0.134 1.690 hSIRP.alpha.V2 EC50 (nM) 0.089 1.066 hSIRP.alpha.V3 EC50 (nM) 0.107 1.767 hSIRP.alpha.V4 EC50 (nM) 0.100 1.297 hSIRP.alpha.V5 EC50 (nM) 0.115 1.260 hSIRP.alpha.V6 EC50 (nM) 0.136 2.219 hSIRP.alpha.V8 EC50 (nM) 0.089 1.508 hSIRP.alpha.V9 EC50 (nM) 0.115 1.367

Example 13: hCD47 Blocking Ability of hSIRP.alpha..40A

[0923] The hSIRP.alpha..40A antibody was analyzed by flow cytometry for its ability to block recombinant hCD47/Fc-protein (R&D Systems, Cat.#4670-CD-050; SEQ ID NO: 109) binding to cell surface expressed hSIRP.alpha.. For this purpose, THP-1 (ATCC TIB-202) and U-937 (ATCC CRL-1593.2) monocyte cell lines were used as the source of hSIRP.alpha. in the assay. THP-1 and U-937 cells were seeded in 96-well round bottomed tissue culture plates and incubated for 45 minutes with FcR Blocking Reagent (Miltenyi Biotec) and hSIRP.alpha..40A antibody (100 .mu.g/mL and dilutions thereof) in PBS/1% BSA at 4.degree. C. Next, cells were washed three times with PBS/1% BSA and incubated with DyLight 488-labeled recombinant hCD47/Fc-protein for 30 minutes at 4.degree. C. After this labeling procedure, cells were washed two times, resuspended in PBS/1% BSA containing 0.1 .mu.g/mL DAPI (BioLegend), and analysed by flow cytometry on the FACSCanto II (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC).

[0924] As depicted in FIG. 13 and the following Table 18, binding of recombinant hCD47 fused to an Fc domain of human IgG1 was monitored in the presence of increasing amounts of the hSIRP.alpha..40A antibody. Antibody hSIRP.alpha..40A blocked the hSIRP.alpha./hCD47 interaction, using the flow cytometry-based method described above. IC50 values for the blockade of hCD47 were calculated from this data. IC50 values represent the concentration at which half of the inhibition is observed.

TABLE-US-00018 TABLE 18 THP-1 U-937 Antibody IC50 (nM) IC50 (nM) hSIRP.alpha..40A 0.646 1.344 hSIRP.alpha..50A 7.833 19.501

[0925] Next, the binding of hSIRP.alpha..40A to hSIRP.alpha. expressed on primary human CD14.sup.+ monocytes was investigated. In addition, the ability of hSIRP.alpha..40A to block the interaction between hSIRP.alpha. and recombinant hCD47/Fc-protein was assessed. For this purpose, CD14+ monocytes were isolated from Ficoll-purified human peripheral blood mononuclear cells (PBMCs) using RosetteSep human monocyte enrichment cocktail (Stemcell). The percentage of monocytes present after the enrichment was determined by flow cytometry on the FACSVerse (BD Biosciences) based on CD14 staining using an APC-Cy7-conjugated mouse-anti-human CD14 detection antibody (BD Biosciences). Subsequently, CD14+ enriched PBMCs were seeded in 96-well round bottomed tissue culture plates and incubated for 40 minutes with FcR Blocking Reagent (Miltenyi Biotec) containing hSIRP.alpha..40A antibody (20m/mL and dilutions thereof) in PBS/1% BSA at 4.degree. C. Next, cells were washed three times with PBS/1% BSA and incubated with an Alexa Fluor 647-labeled goat-anti-mouse IgG (Invitrogen) detection antibody in PBS/1% BSA for 40 minutes at 4.degree. C. After this labeling procedure, cells were washed two times, resuspended in PBS/1% BSA containing 0.1m/mL DAPI (BioLegend), and analysed by flow cytometry on the FACSVerse (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC).

[0926] FIGS. 14A and B shows that hSIRP.alpha..40A binds to primary human CD14+ enriched monocytes. EC50 values represent the concentration at which 50% of the total binding signal is observed. To assess the blocking ability of hSIRP.alpha..40A, CD14+ enriched monocytes cells were seeded in 96-well round bottomed tissue culture plates and incubated for 45 minutes with FcR Blocking Reagent (Miltenyi Biotec) and hSIRP.alpha..40A antibody (20m/mL and dilutions thereof) in PBS/1% BSA at 4.degree. C. Thereafter, cells were washed three times with PBS/1% BSA and incubated with 10 .mu.g/mL DyLight 488-labeled recombinant hCD47/Fc-protein for 45 minutes at 4.degree. C. After this labeling procedure, cells were washed two times, resuspended in PBS/1% BSA containing 0.1 .mu.g/mL DAPI (BioLegend), and analysed by flow cytometry on the FACSVerse (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC). FIGS. 14 C and D demonstrates the ability of antibody hSIRP.alpha..40A to block the hSIRP.alpha./hCD47 interaction. IC50 values for the blockade of hCD47 were calculated from this data. IC50 values represent the concentration at which half of the inhibition is observed.

Example 14: Functionality of hSIRP.alpha..40A mAb in the Human Granulocyte Phagocytosis Assay

[0927] To confirm the functionality of hSIRP.alpha..40A in primary immune cells, granulocytes (e.g. effector cells) were isolated from healthy human donor EDTA blood. First, the EDTA blood of each donor was pooled and centrifuged at 300 g for 6 minutes at 20.degree. C. Next, plasma was removed by aspiration, and the remaining blood cells were gently resuspended. Cells were recovered in red blood cell (RBC) lysis buffer (155 mM NH4C1; 10 mM KHCO3) and incubated for 10 minutes on ice. Next, cells were centrifuged at 300 g for 7 minutes. Supernatants containing lysed RBCs were removed by aspiration, and the remaining blood cells were gently resuspended in RBC lysis buffer and kept on ice for 1 minute. RBC lysis was neutralized by adding assay medium (IMDM (Gibco) supplemented with 10% Fetal Bovine Serum (Gibco) and Pen/Strep (Gibco)). Blood cells were centrifuged at 300 g for 6 minutes and supernatants were removed by aspiration to remove remaining RBCs as much as possible. Subsequently, erythrocyte-lysed blood cells were resuspended in assay medium containing 10 ng/mL IFN.gamma. and cells were incubated for 1 hour at 37.degree. C., 5% CO.sub.2 and 95% humidity. Non-adherent blood cells containing human granulocytes were collected by mild washing of the tissue culture plate with assay medium (monocytes are depleted due to adherence to the plastic surface). The percentage of granulocytes present in the cell suspension was determined by flow cytometry on the FACSCanto II (BD Biosciences) based on high forward scatter (FSC) and side scatter (SSC). Binding of hSIRP.alpha..40A to human granulocytes was assessed by incubating the cells for 30 minutes at 4.degree. C. with hSIRP.alpha..40A antibody (25 .mu.g/mL and dilutions thereof) in PBS/1% BSA containing 10% autologous serum (PBS/1% BSA/10% serum). Next, cells were washed three times with PBS/1% BSA/10% serum and incubated for 30 minutes at 4.degree. C. with a FITC-labeled goat-anti-mouse Ig (BD Biosciences) detection antibody. After this labeling procedure, cells were washed two times, resuspended in PBS/1% BSA/10% serum and analysed by flow cytometry on the FACSCanto II (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC). FIG. 15A and the following Table 19 shows that hSIRP.alpha..40A binds to primary human granulocytes. EC50 values represent the concentration at which 50% of the total binding signal is observed.

TABLE-US-00019 TABLE 19 Donor 1 Antibody EC50 (nM) hSIRP.alpha..40A 1.227 hSIRP.alpha..50A 4.298

[0928] Next, Ramos (ECACC 85030802) target cells were fluorescently labeled with cell proliferation dye eFluor450 (eBioscience). Labeling was performed according to manufacturer's instructions. Labeled target cells were co-cultured for 2-3 hours at 37.degree. C., 5% CO.sub.2 and 95% humidity with isolated primary human granulocytes in a 1:1 ratio (7.5*10.sup.4 cells of each target and effector per well of a 96-well round bottomed tissue culture plate) in the presence of 0.1 .mu.g/mL rituximab (anti-hCD20). In addition, cells were co-cultured with 0.1 .mu.g/mL rituximab in presence of 10 .mu.g/mL hSIRP.alpha..40A. Phagocytosis was assayed by determining the percentage of granulocytes positive for eFluor450 using flow cytometry on the FACSCanto II (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC).

[0929] Compared to the mouse IgG1 isotype control, hSIRP.alpha..40A potently enhances tumor cell phagocytosis induced by rituximab (FIG. 15B).

Example 15: Functionality of hSIRP.alpha..40A mAb in the Human Macrophage Phagocytosis Assay

[0930] Blockade of CD47 by hSIRP.alpha..40A enhances the phagocytosis of human lymphoma cells tumor cells by human macrophages. Human macrophages were generated by first enriching CD14+ monocytes from Ficoll-purified human peripheral blood mononuclear cells (PBMCs) using RosetteSep human monocyte enrichment cocktail (Stemcell). Monocytes were seeded into CellCarrier 96-well flat-bottom microplates (Perkin Elmer) and cultured in macrophage medium (IMDM (Gibco) supplemented with 8.5% Fetal Bovine Serum (Gibco) and Pen/Strep (Gibco)) containing 50 ng/mL human monocyte colony stimulating factor (M-CSF) for 7 days at 37.degree. C., 5% CO.sub.2 and 95% humidity to promote differentiation into macrophages. These monocyte-derived macrophages (MDMs) become adherent allowing other cells to be washed away. Human Raji lymphoma cells were counted and labeled with cell proliferation dye eFluor450 (eBioscience) following manufacturer's instructions. After labeling, the lymphoma cells were mixed with assay medium (RPMI (Gibco) supplemented with 10% Fetal Bovine Serum (Gibco) and Pen/Strep (Gibco)) containing 100 .mu.g/mL anti-hSIRP.alpha. antibodies and dilutions thereof, the respective isotype control antibody, and 1 .mu.g/mL rituximab (anti-hCD20). The lymphoma cells were then added to the individual wells containing MDMs at a ratio of 2.5:1 tumor cells per phagocyte, mixed and incubated at 37.degree. C., 5% CO.sub.2 and 95% humidity for 2 hours. After the incubation, the wells were washed with PBS to remove most of the non-phagocytosed tumor cells, and cells were fixed with 2% formaldehyde for 10 min at RT. The wells were then washed and maintained in PBS/3% BSA in dark at 4.degree. C. overnight. Lymphoma cells present in the wells were stained with biotin-conjugated anti-human CD19 clone HIB19 (eBioscience) for 1 hour at RT, and subsequently were counterstained with Alexa Fluor 488-conjugated streptavidin (Thermo Fisher Scientific) for 1 hour at RT. Next, nuclei were stained with DRAQ5 (Thermo Fisher Scientific) for 10 minutes at RT, mixture was removed, and PBS was added to each well. Cells were analysed with the Operetta automated fluorescence microscope (Perkin Elmer). Data were processed and analysed with Columbus V2.6 software.

[0931] As shown in FIG. 16, hSIRP.alpha..40A enhances rituximab-mediated phagocytosis activity. The phagocytosis of human lymphoma cells was quantified using a phagocytosis index, as follows: (number of tumor cells inside macrophages/number of macrophages)*100; counting at least 200 macrophages per sample.

Example 16: Humanized Antibody Design and CDR Grafting

[0932] The mouse hSIRP.alpha..40A antibody was humanized using CDR-grafting technology (see e.g. U.S. Pat. No. 5,225,539 and Williams, D. G. et al., 2010, Antibody Engineering, volume 1, Chapter 21). First, human germline sequences were identified using IgBLAST (Ye J. et al., Nucleic Acids Res. 41:W34-40 (2013). For the hSIRP.alpha..40A VH human germline sequence, V-gene IGHV1-46*01 was identified (62.2% identity) and for the VL human germline sequence IGKV1-39*01 was identified (68.4% identity). These two germline sequences were used as template to graft the mouse CDRs, resulting in the following two cDNA constructs: SEQ ID NO: 87 (VH) and SEQ ID NO: 99 (VL).

[0933] Next, a database was constructed containing all human sequences available in the IMGT database (Lefranc, M.-P. et al., Nucleic Acid Res. 27:209-212 (1999)) identifying 85,848 individual sequences. These sequences were queried using TBLASTN (2.2.31+) to identify template sequences that demonstrated the highest identify to the framework of hSIRP.alpha..40A VH and VL sequences. Four VH and four VL sequences were identified that demonstrated a similarity score of 80% or higher and that displayed similar CDR lengths, preferably identical to those in hSIRP.alpha..40A VH CDR1, CDR2, CDR3 and VL CDR1, CDR2 and CDR3, respectively.

[0934] For the heavy chain, the frameworks encoded by GenBank (Benson, D. A. et al., Nucleic Acids Res. 41(D1):D36-42 (2013)) accession # L39130, DJ031925, DJ326840, and EF177968 were selected as templates for grafting of the hSIRP.alpha..40A VH CDRs, resulting in the following cDNA constructs: SEQ ID NO: 77, 79, 81 and 83, respectively. For the light chain, the frameworks encoded by GenBank accession # AY731031, DQ840993, AY942002 and DQ535171 were selected as templates for straight grafting of the hSIRP.alpha..40A VL CDRs, resulting in the following cDNA constructs: SEQ ID NO: 89, 91, 93 and 95. Additionally, a database was constructed containing all humanized antibody sequences available in the public domain, identifying 300 sequences. These sequences were queried using BLASTP (2.2.31+) to identify template sequences that demonstrated the highest identify to the framework of hSIRP.alpha..40A VH and VL sequences. For the heavy chain, the framework of Gemtuzumab was selected as template, for grafting of the hSIRP.alpha..40A VH CDRs, resulting in the following cDNA construct: SEQ ID NO: 85. For the light chain, the framework of Alacizumab was selected as template, for grafting of the hSIRP.alpha..40A VL CDRs, resulting in the following cDNA construct: SEQ ID NO: 97

[0935] Framework and CDR definition were those as described by Kabat et al. ("Sequences of Proteins of Immunological Interest", Kabat, E., et al., US Department of Health and Human Services, (1983)).

[0936] To study the effect of humanized framework residues on the structure of the Fv, a homology model of the mouse hSIRP.alpha..40A Fv was made using the `Antibody Modeling Cascade` (default parameters) within Discovery Studio 4.5. The homology model was built on basis of PDB ID 3UMT, for the light chain, PDB ID 1EHL for the heavy chain, and PDB ID 3BGF for the Fv. The CDRs were grafted in silico to study residues that are close to any of the CDRs and which might affect the loop conformation, referred to as Vernier residues. Residues that might affect the loop conformation, and which are within <5 .ANG. to the CDR surface were identified and substituted with the mouse amino acid at this position. The resulting templates were checked for the presence of post translational modification (PTM) motifs using Discovery Studio 4.5 and where possible (i.e. non-CDR, non-Vernier residues) changed to prevent a PTM. The VH CDR2 contained a glycosylation site that was removed by an aspargine to serine mutation.

[0937] CDRs were grafted on each of the identified templates, expressed as a human IgG2 (SEQ ID NO: 68), kappa (SEQ ID NO: 64) antibody cloned in the pcDNA3.1(+) vector (Thermo Fisher Scientific) and for transient transfection in FreeStyle 293-F human embryonic kidney cells (HEK293T/17, ATCC CRL-11268).

Example 17: Synthesis, Expression and Purification of Chimeric and Humanized Constructs

[0938] Plasmids encoding the heavy chain and light chain humanized constructs were mixed in a 1:1 ratio (30m in total) and transiently expressed by transfection into FreeStyle 293-F cells using 293fectin transfection reagent (Invitrogen) following the manufacturer's instructions. Supernatants (30 ml) were harvested after 7 days, filtered over a 0.22 .mu.m filter, and antibodies were purified using MabSelect Sure Protein A resin according to the manufacturer's instructions (GE Healthcare). Buffer was exchanged for 10 mM Histidine, 100 mM NaCl pH 5.5 buffer using Zeba desalting columns (Thermo Fisher Scientific). The concentration of purified antibodies was determined based on OD280 (Nanodrop ND-1000). Endotoxin level was determined by LAL-test according to the manufacturer's instructions (Lonza).

Example 18: Binding of Humanized SIRP.alpha. Antibodies

[0939] Binding of the parental and humanized antibodies to hSIRP.alpha. was assessed by flow cytometry using the CHO-K1.hSIRP.alpha.V1 stable cell line. CHO-K1.hSIRP.alpha.V1 cells were seeded in 96-well round bottomed tissue culture plates and incubated for 40 minutes with the humanized hSIRP.alpha..40A antibody variants (20 .mu.g/mL and dilutions thereof) in PBS/1% BSA at 4.degree. C. Next, cells were washed three times with PBS/1% BSA and incubated for 40 minutes at 4.degree. C. with either an Alexa Fluor 647-labeled goat-anti-mouse IgG (Invitrogen), or an Alexa Fluor 647-labeled donkey-anti-human IgG (Jackson Immuno Research) detection antibody in PBS/1% BSA. After this labeling procedure, cells were washed two times, resuspended in PBS/1% BSA, containing 0.1 .mu.g/mL DAPI (BioLegend), and analysed by flow cytometry on the FACSVerse (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC). EC50 values, the concentration at which 50% of the total binding signal is observed, were calculated using GraphPad Prism 6 (GraphPad Software, Inc.) (FIG. 17 and Table 20).

TABLE-US-00020 TABLE 20 hSIRP.alpha.V1 Antibody EC50 (nM) hSIRP.alpha..40A 0.022 hSIRP.alpha..40H1L1 nd hSIRP.alpha..40H1L2 nd hSIRP.alpha..40H1L3 nd hSIRP.alpha..40H1L4 nd hSIRP.alpha..40H1L5 nd hSIRP.alpha..40H1L6 nd hSIRP.alpha..40H2L1 0.264 hSIRP.alpha..40H2L2 0.298 hSIRP.alpha..40H2L3 0.300 hSIRP.alpha..40H2L4 0.315 hSIRP.alpha..40H2L5 0.284 hSIRP.alpha..40H2L6 0.251 hSIRP.alpha..40H3L1 1.644 hSIRP.alpha..40H3L2 1.404 hSIRP.alpha..40H3L3 1.501 hSIRP.alpha..40H3L4 0.693 hSIRP.alpha..40H3L5 2.302 hSIRP.alpha..40H3L6 0.833 hSIRP.alpha..40H4L1 3.308 hSIRP.alpha..40H4L2 3.360 hSIRP.alpha..40H4L3 3.072 hSIRP.alpha..40H4L4 3.471 hSIRP.alpha..40H4L5 4.828 hSIRP.alpha..40H4L6 3.028 hSIRP.alpha..40H5L1 2.011 hSIRP.alpha..40H5L2 1.919 hSIRP.alpha..40H5L3 2.268 hSIRP.alpha..40H5L4 0.869 hSIRP.alpha..40H5L5 2.954 hSIRP.alpha..40H5L6 2.197 hSIRP.alpha..40H6L1 2.349 hSIRP.alpha..40H6L2 3.002 hSIRP.alpha..40H6L3 3.014 hSIRP.alpha..40H6L4 1.279 hSIRP.alpha..40H6L5 3.785 hSIRP.alpha..40H6L6 2.677 nd, not detected

Example 19: Blockade of hCD47 Binding to hSIRP.alpha. by Humanized hSIRP.alpha..40A Antibodies

[0940] hCD47 blockade was assessed by flow cytometry for the full panel of humanized hSIRP.alpha..40A antibodies. To this end, the U-937 (ATCC CRL-1593.2) monocyte cell line was used as the source of hSIRP.alpha. in the assay. U-937 cells were seeded in 96-well round bottomed tissue culture plates and incubated for 45 minutes with FcR Blocking Reagent (Miltenyi Biotec) and the parental or humanized hSIRP.alpha..40A antibody variants (20 .mu.g/mL and dilutions thereof) in PBS/1% BSA at 4.degree. C. Next, cells were washed three times with PBS/1% BSA and incubated with 10 .mu.g/mL DyLight 488-labeled recombinant hCD47/Fc-protein for 30 minutes at 4.degree. C. After this labeling procedure, cells were washed two times, resuspended in PBS/1% BSA containing 0.1 .mu.g/mL DAPI (BioLegend), and analysed by flow cytometry on the FACSVerse (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC) and plotted using GraphPad Prism 6 (GraphPad Software, Inc.).

[0941] As depicted in FIG. 18 and the following Table 21, binding of recombinant hCD47 fused to an Fc domain of human IgG1 was monitored in the presence of increasing amounts of the humanized hSIRP.alpha..40A antibody variants. Humanized hSIRP.alpha..40A blocked the hSIRP.alpha./hCD47 interaction, using the flow cytometry-based method described above. IC50 values for the blockade of hCD47 were calculated from this data. IC50 values represent the concentration at which half of the inhibition is observed.

TABLE-US-00021 TABLE 21 U-937 Antibody IC50 (nM) hSIRP.alpha..40A 1.122 hSIRP.alpha..40H1L1 nd hSIRP.alpha..40H1L2 nd hSIRP.alpha..40H1L3 nd hSIRP.alpha..40H1L4 nd hSIRP.alpha..40H1L5 nd hSIRP.alpha..40H1L6 nd hSIRP.alpha..40H2L1 0.638 hSIRP.alpha..40H2L2 0.773 hSIRP.alpha..40H2L3 0.685 hSIRP.alpha..40H2L4 0.718 hSIRP.alpha..40H2L5 0.745 hSIRP.alpha..40H2L6 0.901 hSIRP.alpha..40H3L1 0.980* hSIRP.alpha..40H3L2 nd h5IRP.alpha..40H3L3 2.625* hSIRP.alpha..40H3L4 1.784* hSIRP.alpha..40H3L5 2.435* hSIRP.alpha..40H3L6 97.762* hSIRP.alpha..40H4L1 10.002* hSIRP.alpha..40H4L2 7.579* hSIRP.alpha..40H4L3 75.422* hSIRP.alpha..40H4L4 3.153* hSIRP.alpha..40H4L5 5.171* hSIRP.alpha..40H4L6 3.512* hSIRP.alpha..40H5L1 34.977* hSIRP.alpha..40H5L2 nd hSIRP.alpha..40H5L3 nd hSIRP.alpha..40H5L4 10.772* hSIRP.alpha..40H5L5 nd hSIRP.alpha..40H5L6 0.247* hSIRP.alpha..40H6L1 2.391* hSIRP.alpha..40H6L2 20.427* hSIRP.alpha..40H6L3 9.208* hSIRP.alpha..40H6L4 3.797* hSIRP.alpha..40H6L5 20.421* hSIRP.alpha..40H6L6 9.750* Values indicated with * were extrapolated; nd, not detected

Example 20: Binding domain of hSIRP.alpha..40A

[0942] To identify the binding region of hSIRP.alpha..40A, several SIRP.beta.1 exchange-mutants were designed based on the human SIRP.beta.1 and SIRP.gamma. amino acid sequences. Based on the fold of SIRP.alpha./.beta.1/.gamma., the extracellular region can be subdivided into three separate domains: the Ig-like (immunoglobulin-like) V-type (IgV), Ig-like C1-type (IgC1), and Ig-like C2-type (IgC2) domain. The IgV domain is also known as the ligand-binding N-terminal domain of SIRP.alpha. and SIRP.gamma. (which binds to CD47). The human SIRP.beta.1/.gamma. mutants were designed based on the full length hSIRP.beta.1 sequence (SEQ ID NO: 38) and each individual Ig-like domain was substituted for the equivalent domain of human SIRP.gamma. (SEQ ID NO: 40). The cDNAs encoding the constructs, hSIRP-V.gamma.C1.beta.C2.beta. (SEQ ID NO: 110), hSIRP-V.beta.C1.gamma.C2.beta. (SEQ ID NO: 112), and hSIRP-V.beta.C1.beta.C2.gamma. (SEQ ID NO: 114) were synthesized (GeneArt) and subcloned into the pCI-neo vector. Binding of hSIRP.alpha..40A to the exchange mutants was tested using CELIS A. To this end, CHO-K1 cells were transiently transfected, using Lipofectamine 2000, with the pCI-neo vectors encoding hSIRP.alpha.V1, hSIRP.alpha.V2, hSIRP.beta.1, hSIRP-V.gamma.C1.beta.C2.beta., hSIRP-V.beta.C1.gamma.C2.beta., and hSIRP-V.beta.C1.beta.C2.gamma., respectively. The transfected cells were cultured at 37.degree. C., 5% CO.sub.2 and 95% humidity in medium (DMEM-F12 (Gibco) with 5% New Born Calf serum (Biowest) and Pen/Strep (Gibco)) until confluent. Subsequently, cells were trypsinized and seeded in 96-well flat-bottom tissue culture plates and cultured at 37.degree. C., 5% CO.sub.2 and 95% humidity in culture medium until confluent. Then, culture medium was removed and cells were incubated for 1 hour at 37.degree. C., 5% CO.sub.2 and 95% humidity with hSIRP.alpha..40A, hSIRP.alpha..50A, and anti-hSIRP.gamma. clone SE5A5 antibodies. Next, cells were washed with PBS-T and incubated for 1 hour at 37.degree. C., 5% CO.sub.2 and 95% humidity with goat-anti-mouse IgG-HRP conjugate (Southern Biotech). After that, cells were washed three times with PBS-T and anti-hSIRP.gamma. immunoreactivity was visualized with TMB Stabilized Chromogen (Invitrogen). Reactions were stopped with 0.5 M H.sub.2SO.sub.4 and absorbances were read at 450 and 610 nm.

[0943] The antibody of the present invention demonstrated gain of binding to the hSIRP-V.gamma.C1.beta.C2.beta. mutant, indicating that hSIRP.alpha..40A binds to the IgV domain of hSIRP.gamma. and hSIRP.gamma. (FIG. 19 and Table 22). EC50 values represent the concentration at which 50% of the total binding signal is observed (average and SD were calculated from values of two independent experiments).

TABLE-US-00022 TABLE 22 Antibody anti-hSIRP.alpha. hSIRP.alpha..40A hSIRP.alpha..50A (clone SE5A5) hSIRP.alpha.V1 EC50 (nM) 0.133 0.968 0.350 SD 0.065 0.432 0.136 hSIRP.alpha.V2 EC50 (nM) 0.101 0.821 0.224 SD 0.051 0.183 0.076 hSIRP.beta.1 EC50 (nM) nd nd 0.249 SD nd nd 0.091 hSIRP- EC50 (nM) 0.123 2.524 0.287 V.gamma.C1.beta.C2.beta. SD 0.040 0.609 0.026 hSIRP- EC50 (nM) nd nd 0.309 V.beta.C1.gamma.C2.beta. SD nd nd 0.140 hSIRP- EC50 (nM) nd nd 0.231 V.beta.C1.beta.C2.gamma. SD nd nd 0.079 nd, not detected

[0944] To pinpoint the amino acids for interaction of hSIRP.alpha..40A with the IgV domain, several point mutants of hSIRP.alpha.V1 were generated based on single amino acid differences between hSIRP.alpha.V1/V2 and hSIRP.beta.1. The following sequence alignment shows an alignment of the hSIRP.alpha. and hSIRP.beta.1 IgV domain.

Sequence Alignment of the IgV Domain:

TABLE-US-00023 ##STR00001##

[0946] Amino acids in the hSIRP.alpha. IgV domain that are altered in hSIRP.beta.1 were mutated by using the QuikChange II Site-Directed Mutagenesis Kit (Stratagene) and the full length hSIRP.alpha.V1 sequence (SEQ ID NO: 33) as donor cDNA. Binding of hSIRP.alpha..40A to hSIRP.alpha.V1 point mutants was tested using CELISA. To this end, CHO-K1 cells were transiently transfected, using Lipofectamine 2000, with cDNA encoding the full length open reading frame of hSIRP.alpha.V1 and mutants thereof, and hSIRP.beta.1 subcloned into the pCI-neo vector. Transfected cells were seeded in culture medium (DMEM-F12 (Gibco) supplemented with 5% New Born Calf Serum (BioWest) and Pen/Strep (Gibco)) in 96-well flat-bottom tissue culture plates and incubated at 37.degree. C., 5% CO.sub.2 and 95% humidity for 24 hours. Subsequently, culture medium was removed and cells were incubated for 1 hour at 37.degree. C., 5% CO.sub.2 and 95% humidity with purified hSIRP.alpha. antibodies (used at 10m/mL and dilutions thereof). Next, cells were washed with PBS-T and incubated for 1 hour at 37.degree. C., 5% CO.sub.2 and 95% humidity with goat-anti-mouse IgG-HRP (Southern Biotech). Subsequently, cells were washed three times with PBS-T and immunoreactivity against hSIRP.alpha.V1, hSIRP.alpha.V1 mutants, and hSIRP.beta.1 was visualized with TMB Stabilized Chromogen (Invitrogen). Reactions were stopped with 0.5 M H.sub.2SO.sub.4 and absorbances were read at 450 and 610 nm. EC50 values, the concentration at which 50% of the total binding signal is observed, were calculated using GraphPad Prism 6 (GraphPad Software, Inc.) (average and SD were calculated from values of two independent experiments).

[0947] As shown in FIG. 20 and the following Table 23, the Proline at position 74 (P74) constitutes a crucial amino acid for the specific binding of hSIRP.alpha..40A to hSIRP.alpha.V1. Expression of hSIRP.alpha.V1(P74A) (SEQ ID NO: 61), where P74 is converted to Alanine, on CHO-K1 cells results in loss of hSIRP.alpha..40A antibody binding. This proline is not present in the IgV domain sequence of hSIRP.beta.1, and could play a role in the correct conformation of the IgV domain.

TABLE-US-00024 TABLE 23 hSIRP.alpha.V1 hSIRP.beta.1 hSIRP.alpha.V1(P74A) binding binding binding EC50 (nM) EC50 (nM) EC50 (nM) Antibody Average SD Average SD Average SD hSIRP.alpha..40A 0.065 0.006 nd nd nd nd hSIRP.alpha..50A 0.534 0.152 nd nd nd nd anti-hSIRP.alpha. 0.163 0.008 0.156 0.009 0.149 0.013 (clone SE5A5) nd, not detected

Example 21: Functionality of Chimeric hSIRP.alpha..40A mAb Variants in the Human Macrophage Phagocytosis Assay

[0948] The functionality of hSIRP.alpha..40A variable domains, grafted on different Fc constant domains, was assessed by an in vitro phagocytosis assay using human macrophages. Experimental conditions for the human macrophage phagocytosis assay were similar as explained in Example 15 above. Labelled Raji lymphoma cells were mixed with assay medium containing either 10 .mu.g/mL or 1 .mu.g/mL chimeric hSIRP.alpha..40A antibody variants and 1 .mu.g/mL rituximab and then added to MDMs at a ratio of 2.5:1 tumor cells per phagocyte. Cells were incubated at 37.degree. C., 5% CO.sub.2 and 95% humidity for 2 hours.

[0949] Analysis was performed with the Operetta automated fluorescence microscope (Perkin Elmer) and data were processed and analysed with Columbus V2.6 software. The phagocytosis of human lymphoma cells was quantified using a phagocytosis index, as follows: (number of tumor cells inside macrophages/number of macrophages)*100; counting at least 200 macrophages per sample.

[0950] As shown in FIG. 21, the wild-type (WT) chimeric hSIRP.alpha..40A.hIgG4 antibody does not enhance rituximab-mediated phagocytosis, whereas inert chimeric hSIRP.alpha..40A.hIgG1 (SEQ ID NO: 119) antibody variants containing N297Q (SEQ ID NO: 126), L234A.L235A (LALA) (SEQ ID NO: 123), or L234A.L235A.P329G (LALAPG) (SEQ ID NO: 125) mutations enhance rituximab-mediated phagocytosis activity in a concentration-dependent manner. Likewise, hSIRP.alpha..40A.hIgG2 and the inert chimeric hSIRP.alpha..40A.hIgG2 antibody variant containing V234A.G237A.P238S.H268A.V309L.A330S.P331S (Sigma) (SEQ ID NO: 122) mutations enhance rituximab-mediated phagocytosis activity in a concentration-dependent manner.

Example 22: Functionality of Humanized hSIRP.alpha..40A mAb Variants in the Human Macrophage Phagocytosis Assay

[0951] The functionality of a selected set of the humanized hSIRP.alpha..40A antibody variants was assessed by an in vitro phagocytosis assay using human macrophages. Experimental conditions for the human macrophage phagocytosis assay were similar as explained in Example 6.

[0952] As shown in FIG. 22, the humanized hSIRP.alpha..40A antibody variants enhance rituximab-mediated phagocytosis activity in a concentration-dependent manner similar to antibody KWAR23 grafted on a hIgG2 Fc.

Example 23: Functionality of Chimeric hSIRP.alpha..50A mAb Variants in the Human Macrophage Phagocytosis Assay

[0953] The functionality of hSIRP.alpha..50A variable domains, grafted on different Fc constant domains, was assessed by in vitro phagocytosis assays using human macrophages. As shown in FIG. 23A, the chimeric hSIRP.alpha..50A.hIgG4 antibody marginally enhances rituximab-mediated phagocytosis, whereas the chimeric hSIRP.alpha..50A.hIgG2 antibody enhances rituximab-mediated phagocytosis activity similar to the murine hSIRP.alpha..50A.mIgG1 (SEQ ID NO: 120) antibody. FIG. 23B demonstrates that the chimeric hSIRP.alpha..50A.hIgG2 antibody potently enhances tumor cell phagocytosis induced by rituximab in a concentration-dependent manner as compared to the human IgG2 isotype control. Similarly, hSIRP.alpha..50A.hIgG2 enhanced daratumumab-mediated phagocytosis (anti-hCD38, used at 0.05 .mu.g/mL) (FIG. 23C).

[0954] In addition, hSIRP.alpha..50A.hIgG2 also enhanced rituximab-mediated phagocytosis in human granulocytes. As shown in FIG. 23D, the chimeric hSIRP.alpha..50A.hIgG2 antibody enhances phagocytosis activity induced by rituximab to a similar extend as the murine hSIRP.alpha..50A.mIgG1 antibody. Likewise, as shown in FIG. 24A, the chimeric hSIRP.alpha..50A.hIgG1.N297Q, hSIRP.alpha..50A.hIgG4.N297Q (SEQ ID NO: 127) or hSIRP.alpha..50A.hIgG2 antibodies enhance rituximab-mediated phagocytosis activity by human MDMs to a similar extent as the murine hSIRP.alpha..50A.mIgG1 antibody (rituximab used at 1 .mu.g/mL). Similar observations were made in FIG. 24B when phagocytosis was induced by daratumumab (0.05 .mu.g/mL). As shown in FIG. 25, the chimeric hSIRP.alpha..50A.hIgG1.N297Q and hSIRP.alpha..50A hIgG1.L234A.L235A.P329G antibodies also enhance rituximab-mediated phagocytosis activity by human MDMs to a similar extent as the or hSIRP.alpha..50A.hIgG2 antibody (rituximab used at 1 .mu.g/mL). Chimeric variants of hSIRP.alpha..50A mAb containing a wild-type hIgG1 or hIgG4 Fc region did not enhance tumor cell phagocytosis.

Example 24: Comparison of KWAR23, Clone 18D5, hSIRP.alpha..50A, and hSIRP.alpha..40A Antibodies

[0955] A direct comparison of the specificity of monoclonal anti-hSIRP.alpha. antibodies KWAR23, clone 18D5 (SEQ ID NO: 128; SEQ ID NO: 129) from WO2017/178653, hSIRP.alpha..50A, and hSIRP.alpha..40A for binding to hSIRP.alpha.V1, hSIRP.alpha.V1(P74A), hSIRP.alpha.V2, and hSIRP.beta.1 was evaluated by CELISA. Reactivity was confirmed using CHO-K1 cells (ATCC CCL-61) expressing a cDNA encoding the full length open reading frame of hSIRP.alpha.V1, hSIRP.alpha.V1(P74A), hSIRP.alpha.V2, and hSIRP.beta.1 subcloned into the pCI-neo vector (Promega, Madison, Wis.). CHO-K1.hSIRP.alpha.V1, CHO-K1.hSIRP.alpha.V1(P74A), CHO-K1.hSIRP.alpha.V2, and CHO-K1.hSIRP.beta.1 cells were seeded in culture medium (DMEM-F12 (Gibco) supplemented with 5% New Born Calf Serum (BioWest) and Pen/Strep (Gibco)) in 96-well flat-bottom tissue culture plates and incubated at 37.degree. C., 5% CO.sub.2 and 95% humidity for 24 hours. Subsequently, culture medium was removed and cells were incubated for 1 hour at 37.degree. C., 5% CO.sub.2 and 95% humidity with purified hSIRP.alpha. antibodies (used at 10m/mL and dilutions thereof). Next, cells were washed with PBS-T and incubated for 1 hour at 37.degree. C., 5% CO.sub.2 and 95% humidity with goat-anti-mouse IgG-HRP (Southern Biotech). Subsequently, cells were washed three times with PBS-T and immunoreactivity against hSIRP.alpha.V1, hSIRP.alpha.V1(P74A), hSIRP.alpha.V2, and hSIRP.beta.1 was visualized with TMB Stabilized Chromogen (Invitrogen). Reactions were stopped with 0.5 M H.sub.2SO.sub.4 and absorbances were read at 450 and 610 nm. EC50 values, the concentration at which 50% of the total binding signal is observed, were calculated using GraphPad Prism 6 (GraphPad Software, Inc.).

[0956] Binding to hSIRP.gamma. was assessed by flow cytometry using the Jurkat E6.1 T cell leukemia cell line (ECACC 88042803). Jurkat cells were seeded in 96-well round bottomed tissue culture plates and incubated for 40 minutes with the anti-hSIRP.alpha. antibodies (20m/mL and dilutions thereof) in PBS/1% BSA at 4.degree. C. Next, cells were washed three times with PBS/1% BSA and incubated for 40 minutes at 4.degree. C. with an Alexa Fluor 647-labeled goat-anti-mouse IgG (Invitrogen) detection antibody in PBS/1% BSA. After this labeling procedure, cells were washed two times, resuspended in PBS/1% BSA, containing 0.1m/mL DAPI (BioLegend), and analysed by flow cytometry on the FACSVerse (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC). EC.sub.50 values, the concentration at which 50% of the total binding signal is observed, were calculated using GraphPad Prism 6 (GraphPad Software, Inc.).

[0957] As depicted in Table 24, KWAR23 and clone 18D5 antibodies cross-react with at least hSIRP.beta.1 and the P74A variant of hSIRP.alpha.V1. The hSIRP.alpha..50A, and hSIRP.alpha..40A antibodies of the present invention do not bind to either hSIRP.beta.1 or the P74A variant of hSIRP.alpha.V1 under the tested conditions. In this regard, the hSIRP.alpha..50A, and hSIRP.alpha..40A antibodies of the present invention similarly distinguish from antibody clone SIRP29 from WO2013/056352. FIGS. 7A and B of WO2017/178653 compares clone SIRP29 and KWAR23 binding to SIRP.beta.1 (referred to as "sirp-b", Product No. ABIN3077231 from antibodies-online.com), demonstrating that each of clone SIRP29 and KWAR23 has nanomolar affinity for SIRP.beta.1.

TABLE-US-00025 TABLE 24 hSIRP.alpha.V1 hSIRP.alpha.V1 hSIRP.alpha.V2 hSIRP.beta.1 hSIRP.gamma. binding (P74A) binding binding binding EC50 binding EC50 EC50 EC50 Antibody (nM) EC50 (nM) (nM) (nM) (nM) hSIRP.alpha..40A 0.114 nd 0.093 nd 0.369 hSIRP.alpha..50A 0.773 nd 0.645 nd -- KWAR23 0.070 0.049 0.049 0.033 0.003 18D5 0.134 0.055 nd 0.055 nd nd, not detected; -- not tested

[0958] hCD47 blockade for the KWAR23, clone 18D5, and hSIRP.alpha..40A antibodies was assessed by flow cytometry. For this purpose, THP-1 (ATCC TIB-202) and U-937 (ATCC CRL-1593.2) monocyte cell lines were used as the source of hSIRP.alpha. in the assay. THP-1 and U-937 cells were seeded in 96-well round bottomed tissue culture plates and incubated for 45 minutes with FcR Blocking Reagent (Miltenyi Biotec) and indicated anti-hSIRP.alpha. antibodies (20 .mu.g/mL and dilutions thereof) in PBS/1% BSA at 4.degree. C. Next, cells were washed three times with PBS/1% BSA and incubated with 10 .mu.g/mL DyLight 488-labeled recombinant hCD47/Fc-protein for 30 minutes at 4.degree. C. After this labeling procedure, cells were washed two times, resuspended in PBS/1% BSA containing 0.1 .mu.g/mL DAPI (BioLegend), and analysed by flow cytometry on the FACSVerse (BD Biosciences). Data were processed and analysed with FlowJo V10 software (FlowJo, LLC) and plotted using GraphPad Prism 6 (GraphPad Software, Inc.). Binding of recombinant hCD47 fused to an Fc domain of human IgG1 was monitored in the presence of increasing amounts of the anti-hSIRP.alpha. antibodies. IC50 values for the blockade of hCD47 were calculated from this data. IC50 values represent the concentration at which half of the inhibition is observed.

[0959] As depicted in Table 18 and Table 25, hSIRP.alpha..40A, hSIRP.alpha..50A, and KWAR23 antibodies block rhCD47/Fc binding to both the THP-1 and U-937 monocyte cell lines which express the hSIRP.alpha.V2 and hSIRP.alpha.V1 allele, respectively. Antibody clone 18D5 blocks rhCD47/Fc binding to the U-937 monocyte cell line but does not block rhCD47/Fc binding to the THP-1 monocyte cell line, in line with the observation that 18D5 does not bind to hSIRP.alpha.V2 (Table 24). In this regard, the hSIRP.alpha..50A, and hSIRP.alpha..40A antibodies of the present invention similarly distinguish from antibody clone 18D5.

TABLE-US-00026 TABLE 25 THP-1 U-937 Antibody IC50 (nM) IC50 (nM) hSIRP.alpha..40A 0.548 1.417 KWAR23 0.132 0.284 18D5 nd 1.522 nd, not detected

Example 25: Mapping the Interaction Interface Between hSIRP.alpha.-hSIRP.alpha..40A and hSIRP.alpha.-hSIRP.alpha..50A

[0960] The amino acids on hSIRP.alpha. that are bound by hSIRP.alpha..40A or hSIRP.alpha..50A were elucidated by a procedure that involves deuterated chemical cross-linking followed by enzymatic digestion and detection using mass spectrometry. First, antibody hSIRP.alpha..40A and antigen rhSIRP.alpha.-HIS (SinoBiological 11612-H08H-100, SEQ ID NO: 132), or antibody hSIRP.alpha..50A and antigen rhSIRP.alpha.-HIS were incubated to promote binding and integrity and aggregation level were verified by Ultraflex III MALDI TOF mass spectrometer (Bruker) equipped with a HM4 interaction module (CovalX). For these control experiments a dilution series of 10 .mu.L samples of antibody or antigen (1- to 128-fold dilution, starting at 1 mg/mL) were prepared. Of each sample 9 .mu.L was submitted to cross-linking using K200 MALDI MS analysis kit, according to the manufacturer's instructions (CovalX) and incubated for 180 minutes, while 1 .mu.L was directly used for mass spectrometry analysis (High-Mass MALDI). The mass spectrometry analysis showed the antibody and antigen had the expected molecular weight: hSIRP.alpha..40A=151.68 kDa (152.78 kDa with cross-linker), hSIRP.alpha..50A=151.80 kD (153.17 kDa with cross-linker), and rhSIRP.alpha.-HIS=46.05 kDa (48.67 kDa with cross-linker). For characterization of the antigen-antibody complex, a mixture was made with an excess of antigen (antigen:antibody ratio for rhSIRP.alpha.-HIS:hSIRP.alpha..40A 10.8 .mu.M:8.5 .mu.M, and antigen:antibody ratio for rhSIRP.alpha.-HIS:hSIRP.alpha..50A 5.4 .mu.M:2.13 .mu.M). A 9 .mu.L sample of the antigen-antibody mixture was submitted to cross-linking using K200 MALDI MS analysis kit, according to the manufacturer's instructions, while 1 .mu.L was directly used for mass spectrometry analysis. The detected mass of the antibody and antigen (hSIRP.alpha..40A: 151.18 kDa, rhSIRP.alpha.-HIS 45.93 kDa, hSIRP.alpha..50A: 151.69 kDa, rhSIRP.alpha.-HIS 46.18 kDa) corresponds to the molecular weight as detected previously. The antigen-antibody complexes, after cross-linking, were detected as two non-covalent complexes with a 1:1 (195.24 kDa) and 2:1 (240.48 kDa) stoichiometry for rhSIRP.alpha.-HIS:hSIRP.alpha..40A, and as one non-covalent complex with a 1:1 (198.24 kDa) stoichiometry for rhSIRP.alpha.-HIS:hSIRP.alpha..50A. Antibody and antigen bound non-covalent; non-covalent aggregates or non-specific multimers were not detected.

[0961] Next, peptide mass fingerprinting of rhSIRP.alpha.-HIS was performed. Samples were submitted to ASP-N, trypsin, chymotrypsin, elastase and thermolysin (Roche Diagnostic) proteolysis, following manufacturer's instructions followed by analysis by nLC-LTQ Orbitrap MS/MS using an Ultimate 3000 (Dionex) system in line with a LTQ Orbitrap XL mass spectrometer (Thermo Scientific). This proteolysis array resulted in 98% of the sequence being covered by the identified peptides.

[0962] To determine the interacting amino acids of antibody hSIRP.alpha..40A and hSIRP.alpha..50A on rhSIRP.alpha.-HIS antigen with high resolution, the antigen-antibody complex (rhSIRP.alpha.-HIS:hSIRP.alpha..40A ratio 10.8 .mu.M:8.5 .mu.M, rhSIRP.alpha.-HIS:hSIRP.alpha..50A ratio 5.4 .mu.M:2.13 .mu.M) was incubated with deuterated cross-linkers d0/d12 (K200 MALDI Kit) for 180 minutes and subjected to multi-enzymatic cleavage with the enzymes ASP-N, trypsin, chymotrypsin, elastase and thermolysin. After enrichment of the cross-linked peptides, the samples were analyzed by high-resolution mass spectrometry (nLC-Orbitrap MS) and the data generated were analyzed using XQuest (Jin Lee, Mol. Biosyst. 4:816-823 (2008)) and Stavrox (Gotze et al., J. Am. Soc. Mass Spectrom. 23:76-87 (2012)). The interacting amino acids of hSIRP.alpha..40A and hSIRP.alpha..50A to rhSIRP.alpha.-HIS were mapped onto human SIRP.alpha.V1 (SEQ ID NO: 34). Cross-linked residues of hSIRP.alpha..40A are depicted as bold, boxed, and hSIRP.alpha..50A as bold, underlined:

TABLE-US-00027 MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVLVAAGETATLRCTATSLIPVG ##STR00002## ##STR00003## DFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEVAHVTLQGDPLRGTANLSETIRVPPTL EVTQQPVRAENQVNVTCQVRKFYPQRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNV SAHRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSNERNIYIVVGVVCTLLV ALLMAALYLVRIRQKKAQGSTSSTRLHEPEKNAREITQDTNDITYADLNLPKGKKPAPQAAEPN NHTEYASIQTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK

[0963] The C-alpha distance between residue P74 and the identified cross-linked residues was measured in Discovery Studio using the crystal structure of SIRP.alpha. (PDB ID 4CMM). The cross-linked residues identified for hSIRP.alpha..50A are within 14.0 to 21.4 angstrom C-alpha atom distance from residue P74; the cross-linked residues identified for hSIRP.alpha..40A are within 16.2 to 33.5 angstrom C-alpha atom distance from residue P74. The C-alpha distances fit within the expected range for an epitope-paratope surface area of 700 .ANG..sup.2 (Rowley et al., Biotech. Ann. Rev. 10:151-188 (2004)). The identified residues and surface area are distinctly different from the binding epitope of anti-hSIRP.alpha. antibody KWAR23 (Ring et al., Proc. Natl Acad. Sci. USA 114:E10578-E10585 (2017)).

Example 26: Comparison of hSIRP.alpha. Antibodies for Binding to hSIRP.alpha.V1, hSIRP.alpha.V1(P74A), and hSIRP.beta.1

[0964] The specificity of monoclonal anti-hSIRP.alpha. antibodies (e.g., including the hSIRP.alpha. antibodies known in the art, KWAR23 (U.S. Patent CA2939293 A1), 18D5 (Patent WO2017/178653 A2), and various commercially available hSIRP.alpha. antibodies) for binding to hSIRP.alpha.V1, hSIRP.alpha.V1(P74A), and hSIRP.beta.1 was evaluated by CELISA. Reactivity was confirmed using CHO-K1 cells (ATCC CCL-61) expressing a cDNA encoding the full length open reading frame of hSIRP.alpha.V1, hSIRP.alpha.V1(P74A), and hSIRP.beta.1 subcloned into the pCI-neo vector (Promega, Madison, Wis.). CHO-K1.hSIRP.alpha.V1, CHO-K1.hSIRP.alpha.V1(P74A), and CHO-K1.hSIRP.beta.1 cells were seeded in culture medium (DMEM-F12 (Gibco) supplemented with 5% New Born Calf Serum (BioWest) and Pen/Strep (Gibco)) in 96-well flat-bottom tissue culture plates and incubated at 37.degree. C., 5% CO.sub.2 and 95% humidity for 24 hours. Subsequently, culture medium was removed and cells were incubated for 1 hour at 37.degree. C., 5% CO.sub.2 and 95% humidity with purified hSIRP.alpha. antibodies (used at 10 .mu.g/ml and dilutions thereof). Next, cells were washed with PBS-T and incubated for 1 hour at 37.degree. C., 5% CO.sub.2 and 95% humidity with either goat-anti-mouse IgG-HRP (Southern Biotech), goat-anti-human IgG-HRP (Jackson Immuno Research), or goat-anti-rabbit IgG-HRP (Southern Biotech). Subsequently, cells were washed three times with PBS-T and immunoreactivity against hSIRP.alpha.V1, hSIRP.alpha.V1(P74A), and hSIRP.beta.1 was visualized with TMB Stabilized Chromogen (Invitrogen). Reactions were stopped with 0.5 M H.sub.2SO.sub.4 and absorbances were read at 450 and 610 nm. EC.sub.50 values, the concentration at which 50% of the total binding signal is observed, were calculated using GraphPad Prism 6 (GraphPad Software, Inc.)

[0965] As depicted in Table 26, KWAR23, clone 18D5, and all commercially available monoclonal anti-hSIRP.alpha. antibodies are able to bind to the P74A variant of hSIRP.alpha.V1 whereas the hSIRP.alpha..40A and hSIRP.alpha..50A antibodies of the present invention do not bind to the P74A variant of hSIRP.alpha.V1 under the tested conditions.

TABLE-US-00028 TABLE 26 hSIRP.alpha.V1 hSIRP.alpha.V1 hSIRP.beta.1 binding (P74A) binding EC50 binding EC50 Antibody (nM) EC50 (nM) (nM) hSIRP.alpha..40A 0.053 nd nd hSIRP.alpha..50A 0.307 nd nd KWAR23 0.135 0.077 0.065 18D5 0.128 0.073 0.064 anti-hSIRP.alpha. (clone SE5A5) 0.156 0.207 0.105 anti-hSIRP.alpha. (clone 7B3) 0.122 0.141 0.115 anti-hSIRP.alpha. (clone 1C6) 0.329 0.440 >2.817 anti-hSIRP.alpha. (clone 27) nd nd nd anti-hSIRP.alpha. (clone SE7C2) >7.010 >6.139 nd anti-hSIRP.alpha. (clone P3C4) 0.179 0.197 0.160 anti-hSIRP.alpha. (clone 2A4A5) nd nd >6.456 anti-hSIRP.alpha. (clone 15-414) nd nd nd anti-hSIRP.alpha. (clone 1H1) nd nd nd anti-hSIRP.alpha. (clone C-7) nd nd nd anti-hSIRP.alpha. (clone 03) >8.247 >8.992 >6.092 anti-hSIRP.alpha. (clone 5E10) nd nd nd anti-hSIRP.alpha. (clone 602411) 0.047 0.076 0.051 anti-hSIRP.alpha. (clone EPR16264) >1.166 >1.999 nd anti-hSIRP.alpha. (clone D6I3M) >6.413 >121.509 nd anti-hSIRP.alpha. (clone 001) >0.868 >1.192 nd anti-hSIRP.alpha. (clone REA144) >3.661 >4.793 >3.075 nd, not detected

Example 27: Sequences Referred to in the Specification

TABLE-US-00029

[0966] SEQ ID Description NO: SEQUENCE 50A heavy chain 1 NYYIH CDR1 (amino acid sequence) 50A heavy chain 2 WIYPGNVNTKYNEKFKA CDR2 (amino acid sequence) 50A heavy chain 3 PTIIATDFDV CDR3 (amino acid sequence) 50A light chain CDR1 4 KASQGVGTAVG (amino acid sequence) 50A light chain CDR2 5 WASTRHT (amino acid sequence) 50A light chain CDR3 6 QQYSTYPFT (amino acid sequence) humanized 50 heavy 7 EVQLX.sub.1X.sub.2SGX.sub.3EX.sub.4VKPGASVX.sub.5X.sub.6SCKASGFTFTNYYIHWV- RQX.sub.7P chain variable region X.sub.8QGLEWX.sub.9GWIYPGNVNTKYNEKFKAX.sub.10X.sub.11X.sub.12X.sub.13TADK- STSTX.sub.14 (consensus sequence) YMX.sub.15LSSLX.sub.16SX.sub.17DX.sub.18AVYYCARPTIIATDFDVWGQGTX.sub.19VTV- S S wherein: X.sub.1 = Q, V X.sub.2 = Q, E X.sub.3 = A, S X.sub.4 = V, L X.sub.5 = K, M X.sub.6 = V, I X.sub.7 = A, R X.sub.8 = G, E X.sub.9 = I, M X.sub.10 = R, K X.sub.11 = V, A X.sub.12 = T, I X.sub.13 = I, M X.sub.14 = A, V X.sub.15 = D, E, Q X.sub.16 = R, T X.sub.17 = E, D X.sub.18 = T, M X.sub.19 = T, L humanized 50 light 8 X.sub.1X.sub.2X.sub.3X.sub.4TQSPSX.sub.5LSASVGDRVTITCKASQGVGTAVGWYQX.sub.- 6KPGK chain variable region X.sub.7PKLLIYWASTRHTGVPDRFSGSGSGTX.sub.8FTLX.sub.9IX.sub.10X.sub.11LQPEDX (consensus sequence) .sub.12AX.sub.13YYCQQYSTYPFTFGGGTKX.sub.14EIK wherein: X.sub.1 = D, E X.sub.2 = I, L X.sub.3 = V, Q X.sub.4 = L, M X.sub.5 = F, S X.sub.6 = Q, K X.sub.7 = A, S, V X.sub.8 = E, D X.sub.9 = T, A X.sub.10 = S, N X.sub.11 = S, N, G X.sub.12 = F, I, V X.sub.13 = A, D, T X.sub.14 = L, V hSIRP.alpha..50AVH1 9 GAAGTGCAGCTGCAGCAGTCTGGCGCCGAGGTCGTGAAACCTGGCG (nucleotide sequence) CCTCTGTGAAGGTGTCCTGCAAGGCCTCCGGCTTCACCTTCACCAA CTACTACATCCACTGGGTGCGACAGGCCCCAGGCCAGGGACTGGAA TGGATCGGCTGGATCTACCCCGGCAACGTGAACACCAAGTACAACG AGAAGTTCAAGGCCCGCGTGACCATCACCGCCGACAAGTCTACCTC CACCGCCTACATGGACCTGTCCTCCCTGAGATCCGAGGACACCGCC GTGTACTACTGCGCCAGACCCACCATCATTGCCACCGACTTCGACG TGTGGGGCCAGGGCACAACCGTGACCGTGTCCTCT hSIRP.alpha..50AVH1 10 EVQLQQSGAEVVKPGASVKVSCKASGFTFTNYYIHWVRQAPGQGLE (amino acid sequence) WIGWIYPGNVNTKYNEKFKARVTITADKSTSTAYMDLSSLRSEDTA VYYCARPTIIATDFDVWGQGTTVTVSS hSIRP.alpha..50AVH2 11 GAAGTGCAGCTGGTGGAATCCGGCTCCGAGCTCGTGAAGCCTGGCG (nucleotide sequence) CCTCCGTGAAGGTGTCCTGCAAGGCCTCTGGCTTCACCTTCACCAA CTACTACATCCACTGGGTGCGACAGGCCCCAGGCCAGGGACTGGAA TGGATGGGCTGGATCTACCCCGGCAACGTGAACACCAAGTACAACG AGAAGTTCAAGGCCAAGGCCACCATCACCGCCGACAAGTCCACCTC CACCGCCTACATGGAACTGTCCTCCCTGCGGAGCGAGGACACCGCC GTGTACTACTGTGCCCGGCCTACCATCATTGCCACCGACTTCGATG TGTGGGGCCAGGGCACACTCGTGACCGTGTCCTCT hSIRP.alpha..50AVH2 12 EVQLVESGSELVKPGASVKVSCKASGFTFTNYYIHWVRQAPGQGLE (amino acid sequence) WMGWIYPGNVNTKYNEKFKAKATITADKSTSTAYMELSSLRSEDTA VYYCARPTIIATDFDVWGQGTLVTVSS hSIRP.alpha..50AVH3 13 GAAGTGCAGCTGGTGCAGTCTGGCGCCGAGGTCGTGAAACCTGGCG (nucleotide sequence) CCTCCGTGATGATCTCCTGCAAGGCCTCCGGCTTCACCTTCACCAA CTACTACATCCACTGGGTGCGACAGCGGCCAGGCCAGGGACTGGAA TGGATCGGCTGGATCTACCCCGGCAACGTGAACACCAAGTACAACG AGAAGTTCAAGGCCCGCGTGATCATGACCGCCGACAAGTCCACCTC CACCGTGTACATGCAGCTGTCCTCCCTGACCTCCGAGGACACCGCC GTGTACTACTGCGCCAGACCCACCATCATTGCCACCGACTTCGACG TGTGGGGCCAGGGCACACTCGTGACCGTGTCCTCT hSIRP.alpha..50AVH3 14 EVQLVQSGAEVVKPGASVMISCKASGFTFTNYYIHWVRQRPGQGLE (amino acid sequence) WIGWIYPGNVNTKYNEKFKARVIMTADKSTSTVYMQLSSLTSEDTA VYYCARPTIIATDFDVWGQGTLVTVSS hSIRP.alpha..50AVH4 15 GAAGTGCAGCTGCAGCAGTCTGGCGCCGAGCTCGTGAAACCTGGCG (nucleotide sequence) CCTCTGTGAAGGTGTCCTGCAAGGCCTCCGGCTTCACCTTCACCAA CTACTACATCCACTGGGTGCGACAGCGGCCAGGCCAGGGACTGGAA TGGATGGGCTGGATCTACCCCGGCAACGTGAACACCAAGTACAACG AGAAGTTCAAGGCCAAGGCCACCATCACCGCCGACAAGTCCACCTC CACCGCCTACATGGAACTGTCCTCCCTGACCTCCGAGGACACCGCC GTGTACTACTGCGCCAGACCCACCATCATTGCCACCGACTTCGACG TGTGGGGCCAGGGCACAACCGTGACCGTGTCCTCT hSIRP.alpha..50AVH4 16 EVQLQQSGAELVKPGASVKVSCKASGFTFTNYYIHWVRQRPGQGLE (amino acid sequence) WMGWIYPGNVNTKYNEKFKAKATITADKSTSTAYMELSSLTSEDTA VYYCARPTIIATDFDVWGQGTTVTVSS hSIRP.alpha..50AVH5 17 GAAGTGCAGCTGGTGCAGTCTGGCGCCGAGGTCGTGAAACCTGGCG (nucleotide sequence) CCTCTGTGAAGGTGTCCTGCAAGGCCTCCGGCTTCACCTTCACCAA CTACTACATCCACTGGGTGCGACAGGCCCCCGAGCAGGGACTGGAA TGGATCGGCTGGATCTACCCCGGCAACGTGAACACCAAGTACAACG AGAAGTTCAAGGCCCGCGTGACCATGACCGCCGACAAGTCTACCTC CACCGCCTACATGGAACTGTCCTCCCTGCGGAGCGACGACATGGCC GTGTACTACTGCGCCAGACCCACCATCATTGCCACCGACTTCGACG TGTGGGGCCAGGGCACAACCGTGACCGTGTCCTCT hSIRP.alpha..50AVH5 18 EVQLVQSGAEVVKPGASVKVSCKASGFTFTNYYIHWVRQAPEQGLE (amino acid sequence) WIGWIYPGNVNTKYNEKFKARVTMTADKSTSTAYMELSSLRSDDMA VYYCARPTIIATDFDVWGQGTTVTVSS hSIRP.alpha..50AVL1 19 GACATCGTGCTGACCCAGTCCCCCAGCTTCCTGTCTGCCTCTGTGG (nucleotide sequence) GCGACAGAGTGACCATCACATGCAAGGCCTCTCAGGGCGTGGGCAC CGCTGTGGGATGGTATCAGCAGAAGCCTGGCAAGGCCCCCAAGCTG CTGATCTACTGGGCCTCTACCAGACACACCGGCGTGCCCGACAGAT TCTCCGGCTCTGGCTCTGGCACCGAGTTTACCCTGACCATCTCCAG CCTGCAGCCCGAGGATTTCGCCGCCTACTACTGCCAGCAGTACTCC ACCTACCCCTTCACCTTCGGCGGAGGCACCAAGCTGGAAATCAAG hSIRP.alpha..50AVL1 20 DIVLTQSPSFLSASVGDRVTITCKASQGVGTAVGWYQQKPGKAPKL (amino acid sequence) LIYWASTRHTGVPDRFSGSGSGTEFTLTISSLQPEDFAAYYCQQYS TYPFTFGGGTKLEIK hSIRP.alpha..50AVL2 21 GACATCGTGATGACCCAGTCCCCCTCCAGCCTGTCTGCCTCTGTGG (nucleotide sequence) GCGACAGAGTGACCATCACATGCAAGGCCTCTCAGGGCGTGGGCAC CGCTGTGGGATGGTATCAGCAGAAGCCTGGCAAGGCCCCCAAGCTG CTGATCTACTGGGCCTCTACCAGACACACCGGCGTGCCCGACAGAT TCTCCGGCTCTGGCTCTGGCACCGACTTCACCCTGACCATCTCCAA CCTGCAGCCCGAGGACTTCGCCGACTACTACTGCCAGCAGTACTCC ACCTACCCCTTCACCTTCGGCGGAGGCACCAAGGTGGAAATCAAG hSIRP.alpha..50AVL2 22 DIVMTQSPSSLSASVGDRVTITCKASQGVGTAVGWYQQKPGKAPKL (amino acid sequence) LIYWASTRHTGVPDRFSGSGSGTDFTLTISNLQPEDFADYYCQQYS TYPFTFGGGTKVEIK hSIRP.alpha..50AVL3 23 GAGCTCGTGATGACCCAGTCCCCTTCCAGCCTGTCTGCCTCCGTGG (nucleotide sequence) GCGACAGAGTGACCATCACATGCAAGGCCTCTCAGGGCGTGGGCAC CGCTGTGGGATGGTATCAGCAGAAGCCTGGCAAGGCCCCCAAGCTG CTGATCTACTGGGCCTCTACCAGACACACCGGCGTGCCCGACAGAT TCTCCGGCTCTGGCTCTGGCACCGACTTTACCCTGGCCATCTCCAG CCTGCAGCCCGAGGATATCGCCGACTACTACTGCCAGCAGTACTCC ACCTACCCCTTCACCTTCGGCGGAGGCACCAAGGTGGAAATCAAG hSIRP.alpha..50AVL3 24 ELVMTQSPSSLSASVGDRVTITCKASQGVGTAVGWYQQKPGKAPKL (amino acid sequence) LIYWASTRHTGVPDRFSGSGSGTDFTLAISSLQPEDIADYYCQQYS TYPFTFGGGTKVEIK hSIRP.alpha..50AVL4 25 GACATCCAGATGACCCAGTCCCCCTCCAGCCTGTCTGCCTCTGTGG (nucleotide sequence) GCGACAGAGTGACCATCACATGCAAGGCCTCTCAGGGCGTGGGCAC CGCTGTGGGCTGGTATCAGAAAAAGCCCGGCAAGGTGCCCAAGCTG CTGATCTACTGGGCCTCCACCAGACACACCGGCGTGCCCGATAGAT TCTCCGGCTCTGGCTCTGGCACCGACTTCACCCTGACCATCAACGG CCTGCAGCCTGAGGACGTGGCCACCTACTACTGCCAGCAGTACTCC ACCTACCCCTTCACCTTCGGCGGAGGCACCAAGCTGGAAATCAAG hSIRP.alpha..50AVL4 26 DIQMTQSPSSLSASVGDRVTITCKASQGVGTAVGWYQKKPGKVPKL (amino acid sequence) LIYWASTRHTGVPDRFSGSGSGTDFTLTINGLQPEDVATYYCQQYS TYPFTFGGGTKLEIK hSIRP.alpha..50AVL5 27 GACATCGTGCTGACCCAGTCCCCCAGCTTCCTGTCTGCCTCTGTGG (nucleotide sequence) GCGACAGAGTGACCATCACATGCAAGGCCTCTCAGGGCGTGGGCAC CGCTGTGGGATGGTATCAGCAGAAGCCCGGCAAGTCCCCCAAGCTG CTGATCTACTGGGCCTCCACCAGACACACCGGCGTGCCCGATAGAT TCTCCGGCTCTGGCTCTGGCACCGAGTTCACCCTGACCATCTCCAA CCTGCAGCCCGAGGACTTCGCCGCCTACTACTGCCAGCAGTACTCC ACCTACCCCTTCACCTTCGGCGGAGGCACCAAGCTGGAAATCAAG hSIRP.alpha..50AVL5 28 DIVLTQSPSFLSASVGDRVTITCKASQGVGTAVGWYQQKPGKSPKL (amino acid sequence) LIYWASTRHTGVPDRFSGSGSGTEFTLTISNLQPEDFAAYYCQQYS TYPFTFGGGTKLEIK hSIRP.alpha..50A mouse 29 CAGGTCCAGCTGCAGCAGTCTGGACCTGAACTGGTGAAGCCTGGGG VH (nucleotide CTTCAGTTAGGATATCCTGCAAGGCTTCTGGCTTCACCTTCACAAA sequence) CTACTATATACACTGGGTGAAGCAGAGGCCTGGACAGGGACTTGAG TGGATTGGATGGATTTATCCTGGAAATGTTAATACTAAGTACAATG AGAAGTTCAAGGCCAAGGCCACACTGACTGCAGACAAATCCTCCAC CACAGCCTACATGCAGCTCAGCAGCCTGGCCTCTGAGGACTCTGCG GTCTATTTCTGTGCAAGACCTACGATAATAGCTACGGACTTCGATG TCTGGGGCGCAGGGACCACGGTCACCGTCTCCTCA hSIRP.alpha..50A mouse 30 QVQLQQSGPELVKPGASVRISCKASGFTFTNYYIHWVKQRPGQGLE VH (amino acid WIGWIYPGNVNTKYNEKFKAKATLTADKSSTTAYMQLSSLASEDSA sequence) VYFCARPTIIATDFDVWGAGTTVTVSS hSIRP.alpha..50A mouse 31 GACATTGTCATGACCCAGTCTCACAAATTCATGTCCACATCAGTAG VL (nucleotide GAGACAGGGTCAACATCACCTGCAAGGCCAGTCAGGGTGTGGGTAC sequence) TGCTGTAGGCTGGTATCAACAGAAACCAGGGCAATCTCCTAGACTA CTGATTTACTGGGCATCCACCCGGCACACTGGAGTCCCTGATCGCT TCACAGGCAGTGGATCTGGGACAGATTTCAGTCTCGCCATTAGCAA TGTGCAGTCTGAAGACCTGGCAGATTATTTCTGTCAGCAATATAGC ACCTATCCGTTCACGTTCGGAGGGGGGACCAATCTAGAAATAAAA hSIRP.alpha..50A mouse 32 DIVMTQSHKFMSTSVGDRVNITCKASQGVGTAVGWYQQKPGQSPRL VL (amino acid LIYWASTRHTGVPDRFTGSGSGTDFSLAISNVQSEDLADYFCQQYS sequence) TYPFTFGGGTNLEIK human SIRP.alpha.V1 33 ATGGAGCCCGCCGGCCCGGCCCCCGGCCGCCTCGGGCCGCTGCTCT (nucleotide sequence) GCCTGCTGCTCGCCGCGTCCTGCGCCTGGTCAGGAGTGGCGGGTGA GGAGGAGCTGCAGGTGATTCAGCCTGACAAGTCCGTGTTGGTTGCA GCTGGAGAGACAGCCACTCTGCGCTGCACTGCGACCTCTCTGATCC CTGTGGGGCCCATCCAGTGGTTCAGAGGAGCTGGACCAGGCCGGGA ATTAATCTACAATCAAAAAGAAGGCCACTTCCCCCGGGTAACAACT GTTTCAGACCTCACAAAGAGAAACAACATGGACTTTTCCATCCGCA TCGGTAACATCACCCCAGCAGATGCCGGCACCTACTACTGTGTGAA GTTCCGGAAAGGGAGCCCCGATGACGTGGAGTTTAAGTCTGGAGCA GGCACTGAGCTGTCTGTGCGCGCCAAACCCTCTGCCCCCGTGGTAT CGGGCCCTGCGGCGAGGGCCACACCTCAGCACACAGTGAGCTTCAC CTGCGAGTCCCACGGCTTCTCACCCAGAGACATCACCCTGAAATGG TTCAAAAATGGGAATGAGCTCTCAGACTTCCAGACCAACGTGGACC CCGTAGGAGAGAGCGTGTCCTACAGCATCCACAGCACAGCCAAGGT GGTGCTGACCCGCGAGGACGTTCACTCTCAAGTCATCTGCGAGGTG GCCCACGTCACCTTGCAGGGGGACCCTCTTCGTGGGACTGCCAACT TGTCTGAGACCATCCGAGTTCCACCCACCTTGGAGGTTACTCAACA GCCCGTGAGGGCAGAGAACCAGGTGAATGTCACCTGCCAGGTGAGG AAGTTCTACCCCCAGAGACTACAGCTGACCTGGTTGGAGAATGGAA ACGTGTCCCGGACAGAAACGGCCTCAACCGTTACAGAGAACAAGGA

TGGTACCTACAACTGGATGAGCTGGCTCCTGGTGAATGTATCTGCC CACAGGGATGATGTGAAGCTCACCTGCCAGGTGGAGCATGACGGGC AGCCAGCGGTCAGCAAAAGCCATGACCTGAAGGTCTCAGCCCACCC GAAGGAGCAGGGCTCAAATACCGCCGCTGAGAACACTGGATCTAAT GAACGGAACATCTATATTGTGGTGGGTGTGGTGTGCACCTTGCTGG TGGCCCTACTGATGGCGGCCCTCTACCTCGTCCGAATCAGACAGAA GAAAGCCCAGGGCTCCACTTCTTCTACAAGGTTGCATGAGCCCGAG AAGAATGCCAGAGAAATAACACAGGACACAAATGATATCACATATG CAGACCTGAACCTGCCCAAGGGGAAGAAGCCTGCTCCCCAGGCTGC GGAGCCCAACAACCACACGGAGTATGCCAGCATTCAGACCAGCCCG CAGCCCGCGTCGGAGGACACCCTCACCTATGCTGACCTGGACATGG TCCACCTCAACCGGACCCCCAAGCAGCCGGCCCCCAAGCCTGAGCC GTCCTTCTCAGAGTACGCCAGCGTCCAGGTCCCGAGGAAG human SIRP.alpha.V1 34 MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVLVA (amino acid sequence) AGETATLRCTATSLIPVGPIQWFRGAGPGRELIYNQKEGHFPRVTT VSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPDDVEFKSGA GTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKW FKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEV AHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVR KFYPQRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSA HRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSN ERNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPE KNAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSP QPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK human SIRP.alpha.V2 35 ATGGAACCTGCCGGACCTGCCCCTGGCAGACTGGGACCTCTGCTGT (nucleotide sequence) GTCTGCTGCTGGCCGCCTCTTGTGCTTGGAGCGGAGTGGCTGGCGA AGAGGAACTGCAAGTGATCCAGCCCGACAAGAGCGTGTCCGTGGCT GCTGGCGAGTCTGCCATCCTGCACTGTACCGTGACCAGCCTGATCC CCGTGGGCCCCATCCAGTGGTTTAGAGGCGCTGGCCCTGCCAGAGA GCTGATCTACAACCAGAAAGAGGGCCACTTCCCCAGAGTGACCACC GTGTCCGAGAGCACCAAGCGCGAGAACATGGACTTCAGCATCAGCA TCTCCAACATCACCCCTGCCGACGCCGGCACCTACTACTGCGTGAA GTTCAGAAAGGGCAGCCCCGACACCGAGTTCAAGAGCGGCGCTGGA ACCGAGCTGTCTGTGCGGGCTAAGCCTTCTGCCCCTGTGGTGTCTG GACCTGCCGCCAGAGCTACACCTCAGCACACCGTGTCTTTCACATG CGAGAGCCACGGCTTCAGCCCCAGAGACATCACCCTGAAGTGGTTC AAGAACGGCAACGAGCTGAGCGACTTCCAGACCAACGTGGACCCTG TGGGCGAGTCCGTGTCCTACAGCATCCACAGCACCGCCAAGGTGGT GCTGACCCGCGAGGATGTGCACAGCCAAGTGATCTGCGAGGTGGCC CACGTGACACTGCAGGGCGATCCTCTGAGAGGCACCGCTAACCTGA GCGAGACAATCAGAGTGCCCCCCACCCTGGAAGTGACCCAGCAGCC CGTGCGGGCTGAGAACCAAGTGAACGTGACCTGCCAAGTGCGGAAG TTCTACCCTCAGAGACTGCAGCTGACCTGGCTGGAAAACGGAAACG TGTCCAGAACCGAGACAGCCAGCACCGTGACAGAGAACAAGGACGG CACATACAACTGGATGAGCTGGCTGCTCGTGAACGTGTCCGCCCAC AGAGATGACGTGAAGCTGACATGCCAGGTGGAACACGACGGCCAGC CTGCCGTGTCTAAGAGCCACGACCTGAAGGTGTCCGCTCACCCCAA AGAGCAGGGCAGCAACACCGCCGCTGAGAACACAGGCAGCAACGAG AGAAACATCTACATCGTCGTGGGCGTCGTGTGCACCCTGCTGGTGG CTCTGCTGATGGCTGCCCTGTACCTCGTGCGGATCAGACAGAAGAA GGCCCAGGGCTCCACCTCCAGCACCAGACTGCACGAGCCTGAGAAG AACGCCCGCGAGATCACCCAGGACACCAACGACATCACCTACGCCG ACCTGAACCTGCCCAAGGGCAAGAAGCCTGCCCCTCAGGCTGCCGA GCCTAACAACCACACAGAGTACGCCAGCATCCAGACCAGCCCTCAG CCTGCCAGCGAGGACACACTGACATACGCCGATCTGGACATGGTGC ACCTGAACAGAACCCCCAAGCAGCCCGCTCCCAAGCCCGAGCCTAG CTTCTCTGAGTACGCCTCCGTGCAGGTGCCCAGAAAA human SIRP.alpha.V2 36 MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVSVA (amino acid sequence) AGESAILHCTVTSLIPVGPIQWFRGAGPARELIYNQKEGHFPRVTT VSESTKRENMDFSISISNITPADAGTYYCVKFRKGSPDTEFKSGAG TELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKWF KNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEVA HVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRK FYPQRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSAH RDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSNE RNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPEK NAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSPQ PASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK human SIRP.beta.1 37 ATGCCCGTGCCAGCCTCCTGGCCCCACCTTCCTAGTCCTTTCCTGC (nucleotide sequence) TGATGACGCTACTGCTGGGGAGACTCACAGGAGTGGCAGGTGAGGA CGAGCTACAGGTGATTCAGCCTGAAAAGTCCGTATCAGTTGCAGCT GGAGAGTCGGCCACTCTGCGCTGTGCTATGACGTCCCTGATCCCTG TGGGGCCCATCATGTGGTTTAGAGGAGCTGGAGCAGGCCGGGAATT AATCTACAATCAGAAAGAAGGCCACTTCCCACGGGTAACAACTGTT TCAGAACTCACAAAGAGAAACAACCTGGACTTTTCCATCAGCATCA GTAACATCACCCCAGCAGACGCCGGCACCTACTACTGTGTGAAGTT CCGGAAAGGGAGCCCTGACGACGTGGAGTTTAAGTCTGGAGCAGGC ACTGAGCTGTCTGTGCGCGCCAAACCCTCTGCCCCCGTGGTATCGG GCCCTGCGGTGAGGGCCACACCTGAGCACACAGTGAGCTTCACCTG CGAGTCCCATGGCTTCTCTCCCAGAGACATCACCCTGAAATGGTTC AAAAATGGGAATGAGCTCTCAGACTTCCAGACCAACGTGGACCCCG CAGGAGACAGTGTGTCCTACAGCATCCACAGCACAGCCAGGGTGGT GCTGACCCGTGGGGACGTTCACTCTCAAGTCATCTGCGAGATAGCC CACATCACCTTGCAGGGGGACCCTCTTCGTGGGACTGCCAACTTGT CTGAGGCCATCCGAGTTCCACCCACCTTGGAGGTTACTCAACAGCC CATGAGGGCAGAGAACCAGGCAAACGTCACCTGCCAGGTGAGCAAT TTCTACCCCCGGGGACTACAGCTGACCTGGTTGGAGAATGGAAATG TGTCCCGGACAGAAACAGCTTCGACCCTCATAGAGAACAAGGATGG CACCTACAACTGGATGAGCTGGCTCCTGGTGAACACCTGTGCCCAC AGGGACGATGTGGTGCTCACCTGTCAGGTGGAGCATGATGGGCAGC AAGCAGTCAGCAAAAGCTATGCCCTGGAGATCTCAGCGCACCAGAA GGAGCACGGCTCAGATATCACCCATGAAGCAGCGCTGGCTCCTACT GCTCCACTCCTCGTAGCTCTCCTCCTGGGCCCCAAGCTGCTACTGG TGGTTGGTGTCTCTGCCATCTACATCTGCTGGAAACAGAAGGCC human SIRP.beta.1 (amino 38 MPVPASWPHLPSPFLLMTLLLGRLTGVAGEDELQVIQPEKSVSVAA acid sequence) GESATLRCAMTSLIPVGPIMWFRGAGAGRELIYNQKEGHFPRVTTV SELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAG TELSVRAKPSAPVVSGPAVRATPEHTVSFTCESHGFSPRDITLKWF KNGNELSDFQTNVDPAGDSVSYSIHSTARVVLTRGDVHSQVICEIA HITLQGDPLRGTANLSEAIRVPPTLEVTQQPMRAENQANVTCQVSN FYPRGLQLTWLENGNVSRTETASTLIENKDGTYNWMSWLLVNTCAH RDDVVLTCQVEHDGQQAVSKSYALEISAHQKEHGSDITHEAALAPT APLLVALLLGPKLLLVVGVSAIYICWKQKA human SIRP.gamma. 39 ATGCCTGTCCCAGCCTCCTGGCCCCATCCTCCTGGTCCTTTCCTGC (nucleotide sequence) TTCTGACTCTACTGCTGGGACTTACAGAAGTGGCAGGTGAGGAGGA GCTACAGATGATTCAGCCTGAGAAGCTCCTGTTGGTCACAGTTGGA AAGACAGCCACTCTGCACTGCACTGTGACCTCCCTGCTTCCCGTGG GACCCGTCCTGTGGTTCAGAGGAGTTGGACCAGGCCGGGAATTAAT CTACAATCAAAAAGAAGGCCACTTCCCCAGGGTAACAACAGTTTCA GACCTCACAAAGAGAAACAACATGGACTTTTCCATCCGCATCAGTA GCATCACCCCAGCAGATGTCGGCACATACTACTGTGTGAAGTTTCG AAAAGGGAGCCCTGAGAACGTGGAGTTTAAGTCTGGACCAGGCACT GAGATGGCTTTGGGTGCCAAACCCTCTGCCCCCGTGGTATTGGGCC CTGCGGCGAGGACCACACCTGAGCATACAGTGAGTTTCACCTGTGA GTCCCATGGCTTCTCTCCCAGAGACATCACCCTGAAATGGTTCAAA AATGGGAATGAGCTCTCAGACTTCCAGACCAACGTGGACCCCACAG GACAGAGTGTGGCCTACAGCATCCGCAGCACAGCCAGGGTGGTACT GGACCCCTGGGACGTTCGCTCTCAGGTCATCTGCGAGGTGGCCCAT GTCACCTTGCAGGGGGACCCTCTTCGTGGGACTGCCAACTTGTCTG AGGCCATCCGAGTTCCACCCACCTTGGAGGTTACTCAACAGCCCAT GAGGGIGGGGAACCAGGTAAACGTCACCTGCCAGGTGAGGAAGTIC TACCCCCAGAGCCTACAGCTGACCTGGTCGGAGAATGGAAACGTGT GCCAGAGAGAAACAGCCICGACCCTTACAGAGAACAAGGATGGTAC CTACAACTGGACAAGCTGGTTCCTGGTGAACATATCTGACCAAAGG GATGATGTGGTCCTCACCTGCCAGGTGAAGCATGATGGGCAGCTGG CGGTCAGCAAACGCCTTGCCCTAGAGGTCACAGTCCACCAGAAGGA CCAGAGCTCAGATGCTACCCCTGGCCCGGCATCATCCCTTACTGCG CTGCTCCTCATAGCTGTCCTCCTGGGCCCCATCTACGTCCCCTGGA AGCAGAAGACC human SIRP.gamma. (amino 40 MPVPASWPHPPGPFLLLTLLLGLTEVAGEEELQMIQPEKLLLVTVG acid sequence) KTATLHCTVTSLLPVGPVLWFRGVGPGRELIYNQKEGHFPRVTTVS DLTKRNNMDFSIRISSITPADVGTYYCVKFRKGSPENVEFKSGPGT EMALGAKPSAPVVLGPAARTTPEHTVSFTCESHGFSPRDITLKWFK NGNELSDFQTNVDPTGQSVAYSIRSTARVVLDPWDVRSQVICEVAH VTLQGDPLRGTANLSEAIRVPPTLEVTQQPMRVGNQVNVTCQVRKF YPQSLQLTWSENGNVCQRETASTLTENKDGTYNWTSWFLVNISDQR DDVVLTCQVKHDGQLAVSKRLALEVTVHQKDQSSDATPGPASSLTA LLLIAVLLGPIYVPWKQKT human CD47 41 ATGTGGCCTCTGGTGGCCGCTCTGCTGCTGGGCTCTGCTTGTTGTG (nucleotide sequence) GATCCGCCCAGCTGCTGTTCAACAAGACCAAGTCCGTGGAGTTCAC CTTCTGCAACGATACCGTCGTGATCCCCTGCTTCGTGACCAACATG GAAGCCCAGAACACCACCGAGGTGTACGTGAAGTGGAAGTTCAAGG GCCGGGACATCTACACCTTCGACGGCGCCCTGAACAAGTCCACCGT GCCCACCGATTTCTCCAGCGCCAAGATCGAGGTGTCACAGCTGCTG AAGGGCGACGCCTCCCTGAAGATGGACAAGTCCGACGCCGTGTCCC ACACCGGCAACTACACCTGTGAAGTGACCGAGCTGACCAGAGAGGG CGAGACAATCATCGAGCTGAAGTACCGGGTGGTGTCCTGGTTCAGC CCCAACGAGAACATCCTGATCGTGATCTTCCCCATCTTCGCCATCC TGCTGTTCTGGGGCCAGTTCGGCATCAAGACCCTGAAGTACAGATC CGGCGGCATGGACGAAAAGACAATCGCCCTGCTGGTGGCTGGCCTC GTGATCACCGTGATTGTGATCGTGGGCGCTATCCTGTTCGTGCCCG GCGAGTACAGCCTGAAGAATGCTACCGGCCTGGGCCTGATTGTGAC CTCCACCGGAATCCTGATCCTGCTGCACTACTACGTGTTCTCCACC GCTATCGGCCTGACCTCCTTCGTGATCGCCATTCTCGTGATCCAAG TGATCGCCTACATCCTGGCCGTCGTGGGCCTGTCCCTGTGTATCGC CGCCTGCATCCCTATGCACGGCCCCCTGCTGATCTCCGGCCTGTCT ATTCTGGCCCTGGCTCAGCTGCTGGGACTGGTGTACATGAAGTTCG TGGCCTCCAACCAGAAAACCATCCAGCCCCCTCGGAAGGCCGTGGA AGAACCCCTGAACGCCTTCAAAGAATCCAAGGGCATGATGAACGAC GAA human CD47 (amino 42 MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNM acid sequence) EAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLL KGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFS PNENILIVIFPIFAILLFWGQFGIKTLKYRSGGMDEKTIALLVAGL VITVIVIVGAILFVPGEYSLKNATGLGLIVTSTGILILLHYYVFST AIGLTSFVIAILVIQVIAYILAVVGLSLCIAACIPMHGPLLISGLS ILALAQLLGLVYMKFVASNQKTIQPPRKAVEEPLNAFKESKGMMND E human SIRP.alpha.V3 43 ATGGAACCTGCCGGCCCTGCTCCTGGTAGACTGGGACCTCTGCTGT (nucleotide sequence) GTCTGCTGCTGGCCGCCTCTTGTGCTTGGAGCGGAGTGGCTGGCGA AGAGGAACTGCAAGTGATCCAGCCCGACAAGTCCGTGTCTGTGGCC GCTGGCGAGTCTGCCATCCTGCTGTGTACCGTGACCTCCCTGATCC CCGTGGGCCCCATCCAGTGGTTTAGAGGCGCTGGCCCTGCCAGAGA GCTGATCTACAACCAGAAAGAGGGCCACTTCCCCAGAGTGACCACC GTGTCCGAGTCCACCAAGCGCGAGAACATGGACTTCTCCATCTCCA TCAGCAACATCACCCCTGCCGACGCCGGCACCTACTACTGCGTGAA GTTCCGGAAGGGCTCCCCCGACACCGAGTTCAAGTCTGGCGCTGGC ACCGAGCTGTCTGTGCGGGCTAAACCTICTGCCCCTGTGGTGTCTG GACCTGCCGCTAGAGCTACCCCTCAGCACACCGTGTCTTTTACCTG CGAGTCCCACGGCTTCAGCCCTCGGGACATCACCCTGAAGTGGTTC AAGAACGGCAACGAGCTGAGCGACTTCCAGACCAACGTGGACCCTG TGGGCGAGAGCGTGTCCTACTCCATCCACTCCACCGCCAAGGTGGT GCTGACACGCGAGGACGTGCACTCCCAAGTGATCTGCGAGGTGGCC CACGTGACACTGCAGGGCGATCCTCTGAGAGGCACCGCCAACCTGT CCGAGACAATCAGAGTGCCCCCCACCCTGGAAGTGACCCAGCAGCC AGTGCGGGCCGAGAACCAAGTGAACGTGACCTGCCAAGTGCGGAAG TTCTACCCCCAGCGGCTGCAGCTGACCTGGCTGGAAAACGGCAATG TGTCCCGGACCGAGACAGCCAGCACCGTGACCGAGAACAAGGATGG CACCTACAATTGGATGTCTTGGCTGCTCGTGAACGTGTCCGCCCAC CGGGACGATGTGAAGCTGACATGCCAGGTGGAACACGACGGCCAGC CTGCCGTGTCCAAGAGCCACGATCTGAAGGTGTCCGCTCATCCCAA AGAGCAGGGCTCCAACACCGCCGCTGAGAACACCGGCTCTAACGAG CGGAACATCTACATCGTCGTGGGCGTCGTGTGCACCCTGCTGGTGG CTCTGCTGATGGCTGCCCTGTACCTCGTGCGGATCCGGCAGAAGAA GGCCCAGGGCTCTACCTCCTCCACCAGACTGCACGAGCCCGAGAAG AACGCCAGAGAGATCACCCAGGACACCAACGACATCACCTACGCCG ACCTGAACCTGCCCAAGGGCAAGAAGCCTGCCCCTCAGGCTGCCGA GCCTAACAACCACACCGAGTACGCCTCCATCCAGACCAGCCCTCAG CCTGCCTCTGAGGACACCCTGACCTACGCTGATCTGGACATGGTGC ACCTGAACCGGACCCCCAAGCAGCCAGCTCCTAAGCCCGAGCCTAG CTTCTCTGAGTACGCCAGCGTGCAGGTGCCCCGGAAA human SIRP.alpha.V3 44 MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVSVA (amino acid sequence) AGESAILLCTVTSLIPVGPIQWFRGAGPARELIYNQKEGHFPRVTT VSESTKRENMDFSISISNITPADAGTYYCVKFRKGSPDTEFKSGAG TELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKWF KNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEVA HVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRK FYPQRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSAH RDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSNE RNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPEK NAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSPQ PASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK human SIRP.alpha.V4 45 ATGGAACCTGCCGGCCCTGCTCCTGGTAGACTGGGACCTCTGCTGT (nucleotide sequence) GTCTGCTGCTGGCCGCCTCTTGTGCTTGGAGCGGAGTGGCTGGCGA AGAGGGCCTGCAAGTGATCCAGCCCGACAAGTCCGTGTCTGTGGCC GCTGGCGAGTCTGCCATCCTGCACTGTACCGCCACCTCCCTGATCC CCGTGGGACCCATCCAGTGGTTTAGAGGCGCTGGCCCTGGCAGAGA GCTGATCTACAACCAGAAAGAGGGCCACTTCCCCAGAGTGACCACC GTGTCCGACCTGACCAAGCGGAACAACATGGACTTCTCCATCCGGA TCGGCAACATCACCCCTGCCGATGCCGGCACCTACTACTGCGTGAA GTTCCGGAAGGGCTCCCCCGACGACGTGGAGTTCAAATCCGGCGCT GGCACCGAGCTGTCTGTGCGGGCTAAACCTTCTGCCCCTGTGGTGT CTGGCCCTGCCGCTAGAGCTACCCCTCAGCACACCGTGTCTTTTAC CTGCGAGTCCCACGGCTTCAGCCCTCGGGACATCACCCTGAAGTGG TTCAAGAACGGCAACGAGCTGAGCGACTTCCAGACCAACGTGGACC CTGTGGGCGAGAGCGTGTCCTACTCCATCCACTCCACCGCCAAGGT GGTGCTGACACGCGAGGACGTGCACTCCCAAGTGATCTGCGAGGTG GCCCACGTGACACTGCAGGGCGATCCTCTGAGAGGCACCGCCAACC TGTCCGAGACAATCAGAGTGCCCCCCACCCTGGAAGTGACCCAGCA GCCAGTGCGGGCCGAGAACCAAGTGAACGTGACCTGCCAAGTGCGG AAGTTCTACCCCCAGCGGCTGCAGCTGACCTGGCTGGAAAACGGCA ATGTGTCCCGGACCGAGACAGCCTCCACCGTGACCGAGAACAAGGA TGGCACCTACAATTGGATGTCTTGGCTGCTCGTGAACGTGTCCGCC CACCGGGACGATGTGAAGCTGACATGCCAGGTGGAACACGACGGCC AGCCTGCCGTGTCCAAGTCCCACGATCTGAAGGTGTCCGCTCATCC CAAAGAGCAGGGCTCCAACACCGCCGCTGAGAACACCGGCTCTAAC GAGCGGAACATCTACATCGTCGTGGGCGTCGTGTGCACCCTGCTGG

TGGCTCTGCTGATGGCTGCCCTGTACCTCGTGCGGATCCGGCAGAA GAAGGCCCAGGGCTCTACCTCCTCCACCAGACTGCACGAGCCCGAG AAGAACGCCAGAGAGATCACCCAGGACACCAACGACATCACCTACG CCGACCTGAACCTGCCCAAGGGCAAGAAGCCTGCCCCTCAGGCTGC CGAGCCTAACAACCACACCGAGTACGCCTCCATCCAGACCAGCCCT CAGCCTGCCTCTGAGGACACCCTGACCTACGCTGATCTGGACATGG TGCACCTGAACCGGACCCCCAAGCAGCCAGCTCCTAAGCCCGAGCC TAGCTTCTCTGAGTACGCCAGCGTGCAGGTGCCCCGGAAA human SIRP.alpha.V4 46 MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEGLQVIQPDKSVSVA (amino acid sequence) AGESAILHCTATSLIPVGPIQWFRGAGPGRELIYNQKEGHFPRVTT VSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPDDVEFKSGA GTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKW FKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEV AHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVR KFYPQRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSA HRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSN ERNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPE KNAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSP QPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK human SIRP.alpha.V5 47 ATGGAACCTGCCGGCCCTGCTCCTGGTAGACTGGGACCTCTGCTGT (nucleotide sequence) GTCTGCTGCTGGCCGCCTCTTGTGCTTGGAGCGGAGTGGCTGGCGA AGAGGAACTGCAAGTGATCCAGCCCGACAAGTTCGTGCTGGTGGCC GCTGGCGAGACAGCCACCCTGAGATGTACCGCCACCTCCCTGATCC CCGTGGGCCCTATCCAGTGGTTTAGAGGCGCTGGCCCTGGCAGAGA GCTGATCTACAACCAGAAAGAGGGCCACTTCCCCAGAGTGACCACC GTGTCCGACCTGACCAAGCGGAACAACATGGACTTCTCCATCCGGA TCGGCAACATCACCCCTGCCGATGCCGGCACCTACTACTGCGTGAA GTTCCGGAAGGGCTCCCCCGACGACGTGGAGTTCAAATCCGGCGCT GGCACCGAGCTGTCTGTGCGGGCTAAACCTTCTGCCCCTGTGGTGT CTGGCCCTGCCGCTAGAGCTACCCCTCAGCACACCGTGTCTTTTAC CTGCGAGTCCCACGGCTTCAGCCCTCGGGACATCACCCTGAAGTGG TTCAAGAACGGCAACGAGCTGAGCGACTICCAGACCAACGTGGACC CTGTGGGCGAGTCCGTGTCCTACTCCATCCACTCCACCGCCAAGGT GGTGCTGACACGCGAGGACGTGCACTCCCAAGTGATCTGCGAGGTG GCCCACGTGACACTGCAGGGCGATCCTCTGAGAGGCACCGCCAACC TGTCCGAGACAATCAGAGTGCCCCCCACCCTGGAAGTGACCCAGCA GCCAGTGCGGGCCGAGAACCAAGTGAACGTGACCTGCCAAGTGCGG AAGTTCTACCCCCAGCGGCTGCAGCTGACCTGGCTGGAAAACGGCA ATGTGTCCCGGACCGAGACTGCCTCCACCGTGACCGAGAACAAGGA TGGCACCTACAATTGGATGTCTTGGCTGCTCGTGAACGTGTCCGCC CACCGGGACGATGTGAAGCTGACATGCCAGGTGGAACACGACGGCC AGCCTGCCGTGTCCAAGTCCCACGATCTGAAGGTGTCCGCTCATCC CAAAGAGCAGGGCTCCAACACCGCCGCTGAGAACACCGGCTCTAAC GAGCGGAACATCTACATCGTCGTGGGCGTCGTGTGCACCCTGCTGG TGGCTCTGCTGATGGCTGCCCTGTACCTCGTGCGGATCCGGCAGAA GAAGGCCCAGGGCTCTACCTCCTCCACCAGACTGCACGAGCCCGAG AAGAACGCCAGAGAGATCACCCAGGACACCAACGACATCACCTACG CCGACCTGAACCTGCCCAAGGGCAAGAAGCCTGCCCCTCAGGCTGC CGAGCCTAACAACCACACCGAGTACGCCTCCATCCAGACCAGCCCT CAGCCTGCCTCTGAGGACACCCTGACCTACGCTGATCTGGACATGG TGCACCTGAACCGGACCCCCAAGCAGCCAGCTCCTAAGCCCGAGCC TAGCTTCTCTGAGTACGCCAGCGTGCAGGTGCCCCGGAAA human SIRP.alpha.V5 48 MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKFVLVA (amino acid sequence) AGETATLRCTATSLIPVGPIQWFRGAGPGRELIYNQKEGHFPRVTT VSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPDDVEFKSGA GTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKW FKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEV AHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVR KFYPQRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSA HRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSN ERNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPE KNAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSP QPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK human SIRP.alpha.V6 49 ATGGAACCTGCCGGCCCTGCTCCTGGTAGACTGGGACCTCTGCTGT (nucleotide sequence) GTCTGCTGCTGGCCGCCTCTTGTGCTTGGAGCGGAGTGGCTGGCGA AGAGGAACTGCAAGTGATCCAGCCCGACAAGTCCGTGCTGGTGGCT GCTGGCGAGACTGCCACCCTGAGATGTACCGCCACCTCCCTGATCC CCGTGGGCCCTATCCAGTGGTTTAGAGGCGCTGGCCCTGGCAGAGA GCTGATCTACAACCAGAAAGAGGGCCACTTCCCCAGAGTGACCACC GTGTCCGACCTGACCAAGCGGAACAACATGGACTTCCCCATCCGGA TCGGCAACATCACCCCTGCCGATGCCGGCACCTACTACTGCGTGAA GTTCCGGAAGGGCTCCCCCGACGACGTGGAGTTCAAATCCGGCGCT GGCACCGAGCTGTCTGTGCGGGCTAAACCTTCTGCCCCTGTGGTGT CTGGCCCTGCCGCTAGAGCTACCCCTCAGCACACCGTGTCTTTTAC CTGCGAGTCCCACGGCTTCAGCCCTCGGGACATCACCCTGAAGTGG TTCAAGAACGGCAACGAGCTGAGCGACTTCCAGACCAACGTGGACC CTGTGGGCGAGTCCGTGTCCTACTCCATCCACTCCACCGCCAAGGT GGTGCTGACACGCGAGGACGTGCACTCCCAAGTGATCTGCGAGGTG GCCCACGTGACACTGCAGGGCGATCCTCTGAGAGGCACCGCCAACC TGTCCGAGACAATCAGAGTGCCCCCCACCCTGGAAGTGACCCAGCA GCCCGTGCGGGCTGAGAACCAAGTGAACGTGACCTGCCAAGTGCGG AAGTTCTACCCCCAGCGGCTGCAGCTGACCTGGCTGGAAAACGGCA ATGTGTCCCGGACCGAGACAGCCTCCACCGTGACCGAGAACAAGGA TGGCACCTACAATTGGATGTCCTGGCTGCTCGTGAACGTGTCCGCC CACCGGGACGATGTGAAGCTGACATGCCAGGTGGAACACGACGGCC AGCCTGCCGTGTCCAAGTCCCACGATCTGAAGGTGTCCGCTCATCC CAAAGAGCAGGGCTCCAACACCGCCGCTGAGAACACCGGCTCTAAC GAGCGGAACATCTACATCGTCGTGGGCGTCGTGTGCACCCTGCTGG TGGCACTGCTGATGGCCGCTCTGTACCTCGTGCGGATCCGGCAGAA GAAGGCCCAGGGCTCTACCTCCTCCACCAGACTGCACGAGCCCGAG AAGAACGCCAGAGAGATCACCCAGGACACCAACGACATCACCTACG CCGACCTGAACCTGCCCAAGGGCAAGAAGCCTGCCCCTCAGGCTGC CGAGCCTAACAACCACACCGAGTACGCCTCCATCCAGACCAGCCCT CAGCCTGCCTCTGAGGACACCCTGACCTACGCTGATCTGGACATGG TGCACCTGAACCGGACCCCCAAGCAGCCAGCTCCTAAGCCCGAGCC TAGCTTCTCTGAGTACGCCAGCGTGCAGGTGCCCCGGAAA human SIRP.alpha.V6 50 MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVLVA (amino acid sequence) AGETATLRCTATSLIPVGPIQWFRGAGPGRELIYNQKEGHFPRVTT VSDLTKRNNMDFPIRIGNITPADAGTYYCVKFRKGSPDDVEFKSGA GTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKW FKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEV AHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVR KEYPQRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSA HRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSN ERNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPE KNAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSP QPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK human SIRP.alpha.V8 51 ATGGAACCTGCCGGCCCTGCTCCTGGTAGACTGGGACCTCTGCTGT (nucleotide sequence) GTCTGCTGCTGGCCGCCTCTTGTGCTTGGAGCGGAGTGGCTGGCGA AGAGGAACTGCAAGTGATCCAGCCCGACAAGTCCGTGCTGGTGGCT GCTGGCGAGACTGCCACCCTGAGATGTACCGCCACCTCCCTGATCC CCGTGGGCCCTATCCAGTGGTTTAGAGGCGCTGGCCCTGCCAGAGA GCTGATCTACAACCAGAAAGAGGGCCACTTCCCCAGAGTGACCACC GTGTCCGAGTCCACCAAGCGCGAGAACATGGACTTCTCCATCTCCA TCAGCAACATCACCCCTGCCGACGCCGGCACCTACTACTGCGTGAA GTTCCGGAAGGGCTCCCCCGACACCGAGTTCAAGTCTGGCGCTGGC ACCGAGCTGTCTGTGCGGGCTAAACCTTCTGCCCCTGTGGTGTCTG GACCTGCCGCTAGAGCTACCCCTCAGCACACCGTGTCTTTTACCTG CGAGTCCCACGGCTTCAGCCCTCGGGACATCACCCTGAAGTGGTTC AAGAACGGCAACGAGCTGAGCGACTTCCAGACCAACGTGGACCCTG TGGGCGAGTCCGTGTCCTACTCCATCCACTCCACCGCCAAGGTGGT GCTGACACGCGAGGACGTGCACTCCCAAGTGATCTGCGAGGTGGCC CACGTGACACTGCAGGGCGATCCTCTGAGAGGCACCGCCAACCTGT CCGAGACAATCAGAGTGCCCCCCACCCTGGAAGTGACCCAGCAGCC CGTGCGGGCTGAGAACCAAGTGAACGTGACCTGCCAAGTGCGGAAG TTCTACCCCCAGCGGCTGCAGCTGACCTGGCTGGAAAACGGCAATG TGTCCCGGACCGAGACAGCCAGCACCGTGACCGAGAACAAGGATGG CACCTACAATTGGATGTCCTGGCTGCTCGTGAACGTGTCCGCCCAC CGGGACGATGTGAAGCTGACATGCCAGGTGGAACACGACGGCCAGC CTGCCGTGTCCAAGAGCCACGATCTGAAGGTGTCCGCTCATCCCAA AGAGCAGGGCTCCAACACCGCCGCTGAGAACACCGGCTCTAACGAG CGGAACATCTACATCGTCGTGGGCGTCGTGTGCACCCTGCTGGTGG CACTGCTGATGGCCGCTCTGTACCTCGTGCGGATCCGGCAGAAGAA GGCCCAGGGCTCTACCTCCTCCACCAGACTGCACGAGCCCGAGAAG AACGCCAGAGAGATCACCCAGGACACCAACGACATCACCTACGCCG ACCTGAACCTGCCCAAGGGCAAGAAGCCTGCCCCTCAGGCTGCCGA GCCTAACAACCACACCGAGTACGCCTCCATCCAGACCAGCCCTCAG CCTGCCTCTGAGGACACCCTGACCTACGCTGATCTGGACATGGTGC ACCTGAACCGGACCCCCAAGCAGCCAGCTCCTAAGCCCGAGCCTAG CTTCTCTGAGTACGCCAGCGTGCAGGTGCCCCGGAAA human SIRP.alpha.V8 52 MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVLVA (amino acid sequence) AGETATLRCTATSLIPVGPIQWFRGAGPARELIYNQKEGHFPRVTT VSESTKRENMDFSISISNITPADAGTYYCVKFRKGSPDTEFKSGAG TELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKWF KNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEVA HVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRK FYPQRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSAH RDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSNE RNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPEK NAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSPQ PASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK human SIRP.alpha.V9 53 ATGGAACCTGCCGGCCCTGCTCCTGGTAGACTGGGACCTCTGCTGT (nucleotide sequence) GTCTGCTGCTGGCCGCCTCTTGTGCTTGGAGCGGAGTGGCTGGCGA AGAGGAACTGCAAGTGATCCAGCCCGACAAGTCCGTGCTGGTGGCT GCTGGCGAGACTGCCACCCTGAGATGTACCGCCACCTCCCTGATCC CCGTGGGCCCTATCCAGTGGTTTAGAGGCGCTGGCCCTGGCAGAGA GCTGATCTACAACCAGAAAGAGGGCCACTTCCCCAGAGTGACCACC GTGTCCGACCTGACCAAGCGGAACAACATGGACTTCTCCATCCGGA TCTCCAACATCACCCCTGCCGACGCCGGCACCTACTACTGCGTGAA GTTCCGGAAGGGCTCCCCCGACGACGTGGAGTTCAAATCCGGCGCT GGCACCGAGCTGTCTGTGCGGGCTAAACCTTCTGCCCCTGTGGTGT CTGGCCCTGCCGCTAGAGCTACCCCTCAGCACACCGTGTCTTTTAC CTGCGAGTCCCACGGCTTCAGCCCTCGGGACATCACCCTGAAGTGG TTCAAGAACGGCAACGAGCTGAGCGACTTCCAGACCAACGTGGACC CTGTGGGCGAGTCCGTGTCCTACTCCATCCACTCCACCGCCAAGGT GGTGCTGACACGCGAGGACGTGCACTCCCAAGTGATCTGCGAGGTG GCCCACGTGACACTGCAGGGCGATCCTCTGAGAGGCACCGCCAACC TGTCCGAGACAATCAGAGTGCCCCCCACCCTGGAAGTGACCCAGCA GCCCGTGCGGGCTGAGAACCAAGTGAACGTGACCTGCCAAGTGCGG AAGTTCTACCCCCAGCGGCTGCAGCTGACCTGGCTGGAAAACGGCA ATGTGTCCCGGACCGAGACAGCCTCCACCGTGACCGAGAACAAGGA TGGCACCTACAATTGGATGTCCTGGCTGCTCGTGAACGTGTCCGCC CACCGGGACGATGTGAAGCTGACATGCCAGGTGGAACACGACGGCC AGCCTGCCGTGTCCAAGTCCCACGATCTGAAGGTGTCCGCTCATCC CAAAGAGCAGGGCTCCAACACCGCCGCTGAGAACACCGGCTCTAAC GAGCGGAACATCTACATCGTCGTGGGCGTCGTGTGCACCCTGCTGG TGGCACTGCTGATGGCCGCTCTGTACCTCGTGCGGATCCGGCAGAA GAAGGCCCAGGGCTCTACCTCCTCCACCAGACTGCACGAGCCCGAG AAGAACGCCAGAGAGATCACCCAGGACACCAACGACATCACCTACG CCGACCTGAACCTGCCCAAGGGCAAGAAGCCTGCCCCTCAGGCTGC CGAGCCTAACAACCACACCGAGTACGCCTCCATCCAGACCAGCCCT CAGCCTGCCTCTGAGGACACCCTGACCTACGCTGATCTGGACATGG TGCACCTGAACCGGACCCCCAAGCAGCCAGCTCCTAAGCCCGAGCC TAGCTTCTCTGAGTACGCCAGCGTGCAGGTGCCCCGGAAA human SIRP.alpha.V9 54 MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVLVA (amino acid sequence) AGETATLRCTATSLIPVGPIQWFRGAGPORELIYNQKEGHFPRVTT VSDLTKRNNMDFSIRISNITPADAGTYYCVKFRKGSPDDVEFKSGA GTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKW FKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEV AHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVR KFYPQRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSA HRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSN ERNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPE KNAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSP QPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK hSIRP.alpha.-V.beta.C1.alpha.C2.alpha. 55 ATGGAACCTGCCGGCCCTGCTCCTGGTAGACTGGGACCTCTGCTGT (nucleotide sequence) GTCTGCTGCTGGCCGCCTCTTGTGCTTGGAGCGGAGTGGCTGGCGA GGACGAGCTGCAAGTGATCCAGCCCGAGAAGTCCGTGTCTGTGGCC GCTGGCGAGTCTGCCACCCTGAGATGCGCTATGACCTCCCTGATCC CCGTGGGCCCCATCATGTGGTTTAGAGGCGCTGGCGCTGGCAGAGA GCTGATCTACAACCAGAAAGAGGGCCACTTCCCCAGAGTGACCACC GTGTCCGAGCTGACCAAGCGGAACAACCTGGACTTCTCCATCTCCA TCAGCAACATCACCCCTGCCGACGCCGGCACCTACTACTGCGTGAA GTTCCGGAAGGGCTCCCCCGACGACGTGGAGTTCAAATCCGGCGCT GGAACCGAGCTGTCCGTGCGGGCTAAACCTTCTGCCCCTGTGGTGT CTGGCCCTGCCGCTAGAGCTACCCCTCAGCACACCGTGTCTTTTAC CTGCGAGTCCCACGGCTTCAGCCCTCGGGACATCACCCTGAAGTGG TTCAAGAACGGCAACGAGCTGAGCGACTTCCAGACCAACGTGGACC CTGTGGGCGAGAGCGTGTCCTACTCCATCCACTCCACCGCCAAGGT GGTGCTGACACGCGAGGACGTGCACTCCCAAGTGATCTGCGAGGTG GCCCACGTGACACTGCAGGGCGATCCTCTGAGAGGCACCGCCAACC TGTCCGAGACAATCAGAGTGCCCCCCACCCTGGAAGTGACCCAGCA GCCTGTGCGGGCCGAGAACCAAGTGAACGTGACCTGCCAAGTGCGG AAGTTCTACCCCCAGCGGCTGCAGCTGACCTGGCTGGAAAACGGCA ATGTGTCCCGGACCGAGACAGCCAGCACCGTGACCGAGAACAAGGA TGGCACCTACAATTGGATGTCCTGGCTGCTCGTGAACGTGTCCGCC CACCGGGACGATGTGAAGCTGACATGCCAGGTGGAACACGACGGCC AGCCTGCCGTGTCCAAGTCCCACGATCTGAAGGTGTCCGCTCATCC CAAAGAGCAGGGCTCCAACACCGCCGCTGAGAACACCGGCTCTAAC GAGCGGAACATCTACATCGTCGTGGGCGTCGTGTGCACCCTGCTGG TGGCTCTGCTGATGGCTGCCCTGTACCTCGTGCGGATCCGGCAGAA GAAGGCCCAGGGCTCTACCTCCTCCACCAGACTGCACGAGCCTGAG AAGAACGCCAGAGAGATCACCCAGGACACCAACGACATCACCTACG CCGACCTGAACCTGCCCAAGGGCAAGAAGCCTGCCCCTCAGGCCGC CGAGCCTAACAACCACACCGAGTACGCCTCCATCCAGACCAGCCCT CAGCCTGCCTCTGAGGACACCCTGACCTACGCTGATCTGGACATGG TGCACCTGAACCGGACCCCCAAGCAGCCAGCTCCTAAGCCCGAGCC TAGCTTCTCTGAGTACGCCAGCGTGCAGGTGCCCCGGAAA hSIRP.alpha.-V.beta.C1.alpha.C2.alpha. 56 MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEDELQVIQPEKSVSVA (amino acid sequence) AGESATLRCAMTSLIPVGPIMWFRGAGAGRELIYNQKEGHFPRVTT VSELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGA GTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKW FKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEV AHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVR KFYPQRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSA HRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSN ERNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPE KNAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSP

QPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK hSIRP.alpha.-V.alpha.C1.beta.C2.alpha. 57 ATGGAACCTGCCGGCCCTGCTCCTGGTAGACTGGGACCTCTGCTGT (nucleotide sequence) GTCTGCTGCTGGCCGCCTCTTGTGCTTGGAGCGGAGTGGCTGGCGA AGAGGAACTGCAAGTGATCCAGCCCGACAAGTCCGTGCTGGTGGCT GCTGGCGAGACTGCCACCCTGAGATGTACCGCCACCTCCCTGATCC CCGTGGGCCCTATCCAGTGGTTTAGAGGCGCTGGCCCTGGCAGAGA GCTGATCTACAACCAGAAAGAGGGCCACTTCCCCAGAGTGACCACC GTGTCCGACCTGACCAAGCGGAACAACATGGACTTCTCCATCCGGA TCGGCAACATCACCCCTGCCGATGCCGGCACCTACTACTGCGTGAA GTTCCGGAAGGGCTCCCCCGACGACGTGGAGTTCAAATCCGGCGCT GGCACCGAGCTGTCTGTGCGGGCTAAACCTTCTGCCCCCGTGGTGT CTGGACCTGCCGTGCGAGCTACCCCTGAGCACACCGTGTCTTTTAC CTGCGAGTCCCACGGCTTCAGCCCTCGGGACATCACCCTGAAGTGG TTCAAGAACGGCAACGAGCTGAGCGACTTCCAGACCAACGTGGACC CAGCCGGCGACTCCGTGTCCTACTCCATCCACTCTACCGCCAGAGT GGTGCTGACCAGAGGCGACGTGCACTCCCAAGTGATCTGCGAGATC GCCCATATCACACTGCAGGGCGACCCCCTGAGAGGCACCGCTAACC TGTCTGAGACAATCCGGGTGCCCCCCACCCTGGAAGTGACTCAGCA GCCAGTGCGGGCCGAGAACCAAGTGAACGTGACCTGCCAAGTGCGG AAGTTCTACCCCCAGCGGCTGCAGCTGACCTGGCTGGAAAACGGCA ATGTGTCCCGGACCGAGACAGCCTCCACCGTGACCGAGAACAAGGA TGGCACCTACAATTGGATGTCTTGGCTGCTCGTGAACGTGTCCGCC CACCGGGACGATGTGAAGCTGACATGCCAGGTGGAACACGACGGCC AGCCTGCCGTGTCCAAGTCCCACGATCTGAAGGTGTCCGCTCATCC CAAAGAGCAGGGCTCCAACACCGCCGCTGAGAACACCGGCTCTAAC GAGCGGAACATCTACATCGTCGTGGGCGTCGTGTGCACCCTGCTGG TGGCACTGCTGATGGCCGCTCTGTACCTCGTGCGGATCCGGCAGAA GAAGGCCCAGGGCTCTACCTCCTCCACCAGACTGCACGAGCCCGAG AAGAACGCCAGAGAGATCACCCAGGACACCAACGACATCACCTACG CCGACCTGAACCTGCCCAAGGGCAAGAAGCCTGCCCCTCAGGCCGC CGAGCCTAACAACCACACCGAGTACGCCTCCATCCAGACCAGCCCT CAGCCTGCCTCTGAGGACACCCTGACCTACGCTGATCTGGACATGG TGCACCTGAACCGGACCCCCAAGCAGCCAGCTCCTAAGCCCGAGCC TAGCTTCTCTGAGTACGCCAGCGTGCAGGTGCCCCGGAAA hSIRP.alpha.-V.alpha.C1.beta.C2.alpha. 58 MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVLVA (amino acid sequence) AGETATLRCTATSLIPVGPIQWFRGAGPGRELIYNQKEGHFPRVTT VSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPDDVEFKSGA GTELSVRAKPSAPVVSGPAVRATPEHTVSFTCESHGFSPRDITLKW FKNGNELSDFQTNVDPAGDSVSYSIHSTARVVLTRGDVHSQVICEI AHITLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVR KFYPQRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSA HRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSN ERNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPE KNAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSP QPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK hSIRP.alpha.-V.alpha.C1.alpha.C2.beta. 59 ATGGAACCTGCCGGCCCTGCTCCTGGTAGACTGGGACCTCTGCTGT (nucleotide sequence) GTCTGCTGCTGGCCGCCTCTTGTGCTTGGAGCGGAGTGGCTGGCGA AGAGGAACTGCAAGTGATCCAGCCCGACAAGTCCGTGCTGGTGGCT GCTGGCGAGACTGCCACCCTGAGATGTACCGCCACCTCCCTGATCC CCGTGGGCCCTATCCAGTGGTTTAGAGGCGCTGGCCCTGGCAGAGA GCTGATCTACAACCAGAAAGAGGGCCACTTCCCCAGAGTGACCACC GTGTCCGACCTGACCAAGCGGAACAACATGGACTTCTCCATCCGGA TCGGCAACATCACCCCTGCCGATGCCGGCACCTACTACTGCGTGAA GTTCCGGAAGGGCTCCCCCGACGACGTGGAGTTCAAATCCGGCGCT GGCACCGAGCTGTCTGTGCGGGCTAAACCTTCTGCCCCTGTGGTGT CTGGCCCTGCCGCTAGAGCTACCCCTCAGCACACCGTGTCTTTTAC CTGCGAGTCCCACGGCTTCAGCCCTCGGGACATCACCCTGAAGTGG TTCAAGAACGGCAACGAGCTGAGCGACTTCCAGACCAACGTGGACC CTGTGGGCGAGTCCGTGTCCTACTCCATCCACTCCACCGCCAAGGT GGTGCTGACACGCGAGGACGTGCACTCCCAAGTGATCTGCGAGGTG GCCCACGTGACACTGCAGGGCGATCCTCTGAGAGGCACCGCCAACC TGTCCGAGACAATCAGAGTGCCCCCCACCCTGGAAGTGACCCAGCA GCCTATGAGAGCCGAGAACCAGGCCAACGTGACCTGCCAGGTGTCC AACTTCTACCCTCGGGGCCTGCAGCTGACCTGGCTGGAAAACGGCA ATGTGTCCCGGACCGAGACAGCCTCCACCCTGATCGAGAACAAGGA TGGCACCTACAATTGGATGTCCTGGCTGCTCGTGAACACCTGTGCC CACCGGGACGATGTGGTGCTGACCTGTCAGGTGGAACACGATGGCC AGCAGGCCGTGTCCAAGTCCTACGCTCTGGAAGTGTCCGCCCACCC CAAAGAGCAGGGCTCTAATACCGCCGCTGAGAACACCGGCTCCAAC GAGCGGAACATCTACATCGTCGTGGGCGTCGTGTGCACCCTGCTGG TGGCACTGCTGATGGCCGCTCTGTACCTCGTGCGGATCCGGCAGAA GAAGGCTCAGGGCTCCACCTCCTCCACCAGACTGCACGAGCCTGAG AAGAACGCCAGAGAGATCACCCAGGACACCAACGACATCACCTACG CCGACCTGAACCTGCCCAAGGGCAAGAAGCCTGCCCCTCAGGCTGC CGAGCCTAACAACCACACCGAGTACGCCTCCATCCAGACCAGCCCT CAGCCTGCCTCTGAGGACACCCTGACCTACGCTGATCTGGACATGG TGCACCTGAACCGGACCCCCAAGCAGCCAGCTCCTAAGCCCGAGCC TAGCTTCTCTGAGTACGCCAGCGTGCAGGTGCCCCGGAAA hSIRP.alpha.-V.alpha.C1.alpha.C2.beta. 60 MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVLVA (amino acid sequence) AGETATLRCTATSLIPVGPIQWFRGAGPGRELIYNQKEGHFPRVTT VSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPDDVEFKSGA GTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKW FKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEV AHVTLQGDPLRGTANLSETIRVPPTLEVTQQPMRAENQANVTCQVS NFYPRGLQLTWLENGNVSRTETASTLIENKDGTYNWMSWLLVNTCA HRDDVVLTCQVEHDGQQAVSKSYALEVSAHPKEQGSNTAAENTGSN ERNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPE KNAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSP QPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK human 61 ATGGAGCCCGCCGGCCCGGCCCCCGGCCGCCTCGGGCCGCTGCTCT SIRP.alpha.V1(P74A) GCCTGCTGCTCGCCGCGTCCTGCGCCTGGTCAGGAGTGGCGGGTGA (nucleotide sequence) GGAGGAGCTGCAGGTGATTCAGCCTGACAAGTCCGTGTTGGTTGCA GCTGGAGAGACAGCCACTCTGCGCTGCACTGCGACCTCTCTGATCC CTGTGGGGCCCATCCAGTGGTTCAGAGGAGCTGGAGCAGGCCGGGA ATTAATCTACAATCAAAAAGAAGGCCACTTCCCCCGGGTAACAACT GTTTCAGACCTCACAAAGAGAAACAACATGGACTTTTCCATCCGCA TCGGTAACATCACCCCAGCAGATGCCGGCACCTACTACTGTGTGAA GTTCCGGAAAGGGAGCCCCGATGACGTGGAGTTTAAGTCTGGAGCA GGCACTGAGCTGTCTGTGCGCGCCAAACCCTCTGCCCCCGTGGTAT CGGGCCCTGCGGCGAGGGCCACACCTCAGCACACAGTGAGCTTCAC CTGCGAGTCCCACGGCTTCTCACCCAGAGACATCACCCTGAAATGG TTCAAAAATGGGAATGAGCTCTCAGACTTCCAGACCAACGTGGACC CCGTAGGAGAGAGCGTGTCCTACAGCATCCACAGCACAGCCAAGGT GGTGCTGACCCGCGAGGACGTTCACTCTCAAGTCATCTGCGAGGTG GCCCACGTCACCTTGCAGGGGGACCCTCTTCGTGGGACTGCCAACT TGTCTGAGACCATCCGAGTTCCACCCACCTTGGAGGTTACTCAACA GCCCGTGAGGGCAGAGAACCAGGTGAATGTCACCTGCCAGGTGAGG AAGTTCTACCCCCAGAGACTACAGCTGACCTGGTTGGAGAATGGAA ACGTGTCCCGGACAGAAACGGCCTCAACCGTTACAGAGAACAAGGA TGGTACCTACAACTGGATGAGCTGGCTCCTGGTGAATGTATCTGCC CACAGGGATGATGTGAAGCTCACCTGCCAGGTGGAGCATGACGGGC AGCCAGCGGTCAGCAAAAGCCATGACCTGAAGGTCTCAGCCCACCC GAAGGAGCAGGGCTCAAATACCGCCGCTGAGAACACTGGATCTAAT GAACGGAACATCTATATTGTGGTGGGTGTGGTGTGCACCTTGCTGG TGGCCCTACTGATGGCGGCCCTCTACCTCGTCCGAATCAGACAGAA GAAAGCCCAGGGCTCCACTTCTTCTACAAGGTTGCATGAGCCCGAG AAGAATGCCAGAGAAATAACACAGGACACAAATGATATCACATATG CAGACCTGAACCTGCCCAAGGGGAAGAAGCCTGCTCCCCAGGCTGC GGAGCCCAACAACCACACGGAGTATGCCAGCATTCAGACCAGCCCG CAGCCCGCGTCGGAGGACACCCTCACCTATGCTGACCTGGACATGG TCCACCTCAACCGGACCCCCAAGCAGCCGGCCCCCAAGCCTGAGCC GTCCTTCTCAGAGTACGCCAGCGTCCAGGTCCCGAGGAAG human 62 MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVLVA SIRP.alpha.V1(P74A) AGETATLRCTATSLIPVGPIQWFRGAGAGRELIYNQKEGHFPRVTT (amino acid sequence) VSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPDDVEFKSGA GTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKW FKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEV AHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVR KFYPQRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSA HRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSN ERNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPE KNAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSP QPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK human kappa constant 63 CGGACCGTGGCCGCTCCCTCCGTGTTCATCTTCCCACCTTCCGACG domain (nucleotide AGCAGCTGAAGTCCGGCACCGCTTCTGTCGTGTGCCTGCTGAACAA sequence) CTTCTACCCCCGCGAGGCCAAGGTGCAGTGGAAGGTGGACAACGCC CTGCAGTCCGGCAACTCCCAGGAATCCGTGACCGAGCAGGACTCCA AGGACAGCACCTACTCCCTGTCCTCCACCCTGACCCTGTCCAAGGC CGACTACGAGAAGCACAAGGTGTACGCCTGCGAAGTGACCCACCAG GGCCTGTCTAGCCCTGTGACCAAGTCCTTCAACCGGGGCGAGTGC human kappa constant 64 RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNA domain (protein LQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQ sequence) GLSSPVTKSFNRGEC human IgG4 constant 65 GCTTCCACCAAGGGCCCCTCCGTGTTTCCTCTGGCCCCTTGCTCCA domains (including GATCCACCTCCGAGTCTACCGCCGCTCTGGGCTGCCTCGTGAAGGA S228P) CTACTTCCCCGAGCCTGTGACAGTGTCCTGGAACTCTGGCGCCCTG (nucleotide sequence) ACCTCTGGCGTGCACACCTTTCCAGCTGTGCTGCAGTCCTCCGGCC TGTACTCCCTGTCCAGCGTCGTGACAGTGCCCTCCAGCTCTCTGGG CACCAAGACCTACACCTGTAACGTGGACCACAAGCCCTCCAACACC AAGGTGGACAAGCGGGTGGAATCTAAGTACGGCCCTCCCTGCCCTC CTTGCCCAGCCCCTGAATTTCTGGGCGGACCTTCTGTGTTTCTGTT CCCCCCAAAGCCCAAGGACACCCTGATGATCTCCCGGACCCCCGAA GTGACCTGCGTGGTGGTGGATGTGTCCCAGGAAGATCCCGAGGTGC AGTTCAATTGGTACGTGGACGGCGTGGAAGTGCACAACGCCAAGAC CAAGCCTAGAGAGGAACAGTTCAACTCCACCTACCGGGTGGTGTCC GTGCTGACCGTGCTGCACCAGGATTGGCTGAACGGCAAAGAGTACA AGTGCAAGGTGTCCAACAAGGGCCTGCCCAGCTCCATCGAAAAGAC CATCTCCAAGGCCAAGGGCCAGCCCCGGGAACCCCAGGTGTACACA CTGCCTCCAAGCCAGGAAGAGATGACCAAGAACCAGGTGTCCCTGA CCTGTCTCGTGAAAGGCTTCTACCCCTCCGATATCGCCGTGGAATG GGAGTCCAACGGCCAGCCTGAGAACAACTACAAGACCACCCCCCCT GTGCTGGACTCCGACGGCTCCTTCTTTCTGTACTCTCGCCTGACCG TGGACAAGTCCCGGTGGCAGGAAGGCAACGTGTTCTCCTGCAGCGT GATGCACGAGGCCCTGCACAACCACTACACCCAGAAGTCCCTGTCC CTGTCTCTGGGAAAA human IgG4 constant 66 ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGAL domains (including TSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNT S228P) KVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPE (protein sequence) VTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVS VLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYT LPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLS LSLGK human IgG2 constant 67 GCTTCTACAAAGGGCCCCAGCGTGTTCCCTCTGGCTCCTTGTAGCA domains (nucleotide GAAGCACCAGCGAGTCTACAGCCGCTCTGGGCTGTCTGGTCAAGGA sequence) CTACTTTCCCGAGCCTGTGACCGTGTCCTGGAATAGCGGAGCACTG ACAAGCGGCGTGCACACCTTTCCAGCTGTGCTGCAAAGCTCCGGCC TGTACTCTCTGTCCAGCGTGGTCACAGTGCCCAGCAGCAATTTTGG CACCCAGACCTACACCTGTAATGTGGACCACAAGCCTAGCAACACC AAGGTGGACAAGACCGTGGAACGGAAGTGCTGCGTGGAATGCCCTC CTTGTCCTGCTCCTCCAGTGGCTGGCCCTTCCGTGTTTCTGTTCCC TCCAAAGCCTAAGGACACCCTGATGATCAGCAGAACCCCTGAAGTG ACCTGCGTGGTGGTGGATGTGTCCCACGAGGATCCTGAGGTGCAGT TCAATTGGTACGTGGACGGCGTGGAAGTGCACAACGCCAAGACCAA GCCTAGAGAGGAACAGTTCAACAGCACCTTCAGAGTGGTGTCCGTG CTGACCGTGGTGCATCAGGATTGGCTGAACGGCAAAGAGTACAAGT GCAAGGTGTCCAACAAGGGCCTGCCTGCTCCTATCGAGAAAACCAT CAGCAAGACCAAAGGCCAGCCTCGCGAGCCCCAGGTTTACACACTT CCTCCAAGCCGGGAAGAGATGACCAAGAACCAGGTGTCCCTGACCT GCCTCGTGAAGGGCTTCTACCCCAGCGACATCX.sub.1CCGTGGAATGGG AGAGCAATGGCCAGCCTGAGAACAACTACAAGACCACACCTCCTAT GCTGGACTCCGACGGCTCATTCTTCCTGTACAGCAAGCTGACAGTG GACAAGTCCAGATGGCAGCAGGGCAACGTGTTCTCCTGCAGCGTGA TGCACGAGGCCCTGCACAACCACTACACCCAGAAGTCCCTGTCTCT GAGCCCCGGCAAA wherein: X.sub.1 = G, T human IgG2 constant 68 ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGAL domains (protein TSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNT sequence) KVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEV TCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSV LTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTL PPSREEMTKNQVSLTCLVKGFYPSDIX.sub.1VEWESNGQPENNYKTTPP MLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGK wherein: X.sub.1 = A, S 40A heavy chain 69 SYWMH CDR1 (amino acid sequence) 40A heavy chain 70 AIYPVNNDTTYNQKFKG CDR2 (amino acid sequence) 40A heavy chain 71 SFYYSLDAAWFVY CDR3 (amino acid sequence) 40A light chain CDR1 72 RASQDIGSRLN (amino acid sequence) 40A light chain CDR2 73 ATSSLDS (amino acid sequence) 40A light chain CDR3 74 LQYASSPFT (amino acid sequence) humanized 40 heavy 75 EVQX.sub.1X.sub.2QSGAX.sub.3X.sub.4X.sub.5KPGASVKX.sub.6SCKASGSTFTSYWMHWV- X.sub.7QX.sub.8 chain variable region PGQGLEWX.sub.9GAIYPVNSDTTYNQKFKGX.sub.10X.sub.11TX.sub.12TVX.sub.13X.sub.- 14SX.sub.15S

(consensus sequence) TX.sub.16YMX.sub.17LSSLX.sub.18X.sub.19EDX.sub.20AVYYCX.sub.21RSFYYSLDAAW- FVYWGQG TX.sub.22X.sub.23TVSS wherein: X.sub.1 = F, L X.sub.2 = Q, R, V X.sub.3 = E, V X.sub.4 = L, V X.sub.5 = A, K, V X.sub.6 = L, M, V X.sub.7 = K, R X.sub.8 = A, R, T X.sub.9 = I, M X.sub.10 = K, R X.sub.11 = A, V X.sub.12 = L, M X.sub.13 = D, V X.sub.14 = K, T X.sub.15 = A, S, T X.sub.16 = A, V X.sub.17 = E, Q X.sub.18 = R, T X.sub.19 = F, S X.sub.20 = S, T X.sub.21 = A, T X.sub.22 = L, T X.sub.23 = L, V humanized 40 light 76 DIQMTQSPSSLSASX.sub.1GX.sub.2RVX.sub.3ITCRASQDIGSRLNWLQQX.sub.4PGKA chain variable region X.sub.5KRLIYATSSLDSGVPX.sub.6RFSGSX.sub.7SGX.sub.8X.sub.9X.sub.10X.sub.11- LTISX.sub.12LQPE (consensus sequence) DFATYYCLQYASSPFTFGX.sub.13GTKX.sub.14EIX.sub.15 wherein: X.sub.1 = L, V X.sub.2 = D, E X.sub.3 = S, T X.sub.4 = K, T X.sub.5 = I, P X.sub.6 = K, S X.sub.7 = G, R X.sub.8 = S, T X.sub.9 = D, E X.sub.10 = F, Y X.sub.11 = S, T X.sub.12 = G, S X.sub.13 = G, Q X.sub.14 = L, V X.sub.15 = H, K hSIRP.alpha..40AVH1 77 GAGGTGCAGTTCTTGCAGTCTGGTGCCGTGCTGGCTAGACCTGGAA (nucleotide sequence) CCTCCGTGAAGATCTCCTGCAAGGCCTCCGGCTCCACCTTCACCTC TTACTGGATGCACTGGGTCAAGCAGAGGCCTGGACAGGGACTCGAA TGGATCGGCGCTCTGTACCCTGTGAACTCCGACACCACCTACAACC AGAAGTTCAAGGGCAGAGCCAAGCTGACCGTGGCCACCTCTGCTTC TATCGCCTACCTGGAATTTTCCAGCCTGACCAACGAGGACTCCGCC GTGTACTACTGCGCCCGGTCCTTCTACTACTCTCTGGACGCCGCTT GGTTTGTGTACTGGGGCCAGGGAACTCTGGTGACCGTGTCCTCT hSIRP.alpha..40AVH1 78 EVQFLQSGAVLARPGTSVKISCKASGSTFTSYWMHWVKQRPGQGLE (amino acid sequence) WIGALYPVNSDTTYNQKFKGRAKLTVATSASIAYLEFSSLTNEDSA VYYCARSFYYSLDAAWFVYWGQGTLVTVSS hSIRP.alpha..40AVH2 79 GAGGTGCAGCTGGTTCAGTCTGGCGCTGAGGTTGTGAAGCCTGGCG (nucleotide sequence) CTTCCGTGAAGCTGTCCTGCAAGGCTTCTGGCTCCACCTTCACCAG CTACTGGATGCACTGGGTCAAGCAGGCCCCTGGACAAGGCCTGGAA TGGATCGGCGCTATCTACCCCGTGAACTCCGACACCACCTACAACC AGAAGTTCAAGGGCAAAGCTACCCTGACCGTGGACAAGTCTGCCTC CACCGCCTACATGGAACTGTCCAGCCTGAGATCTGAGGACACCGCC GTGTACTACTGCACCCGGTCCTTCTACTACTCCCTGGACGCCGCTT GGTTTGTGTATTGGGGCCAGGGAACACTGGTGACCGTGTCCTCT hSIRP.alpha..40AVH2 80 EVQLVQSGAEVVKPGASVKLSCKASGSTFTSYWMHWVKQAPGQGLE (amino acid sequence) WIGAIYPVNSDTTYNQKFKGKATLTVDKSASTAYMELSSLRSEDTA VYYCTRSFYYSLDAAWFVYWGQGTLVTVSS hSIRP.alpha..40AVH3 81 GAGGTGCAGCTGAGACAGTCTGGCGCTGTGCTTGTGAAGCCTGGCG (nucleotide sequence) CCTCCGTGAAGATGTCCTGCAAGGCTTCTGGCTCCACCTTCACCAG CTACTGGATGCACTGGGTCAAGCAGACCCCTGGACAGGGACTCGAG TGGATCGGCGCTATCTACCCTGTGAACTCCGACACCACCTACAACC AGAAGTTCAAGGGCAAAGCTACCCTGACCGTGGACAAGTCCTCCTC CACCGCTTACATGCAGCTGTCCAGCCTGACCTCTGAGGACTCCGCC GTGTACTACTGCGCCCGGTCCTTCTACTACTCTCTGGACGCCGCTT GGTTTGTGTACTGGGGCCAGGGCACAACCCTGACAGTGTCCTCT hSIRP.alpha..40AVH3 82 EVQLRQSGAVLVKPGASVKMSCKASGSTFTSYWMHWVKQTPGQGLE (amino acid sequence) WIGAIYPVNSDTTYNQKFKGKATLTVDKSSSTAYMQLSSLTSEDSA VYYCARSFYYSLDAAWFVYWGQGTTLTVSS hSIRP.alpha..40AVH4 83 GAGGTGCAGTTCGTTCAGTCTGGCGCCGAAGTGAAGAAACCTGGCG (nucleotide sequence) CCTCTGTGAAGGTGTCCTGCAAGGCTTCTGGCTCCACCTTCACCAG CTACTGGATGCACTGGGTCCGACAGGCTCCAGGACAAGGCTTGGAA TGGATGGGCGCTATCTACCCCGTGAACTCCGACACCACCTACAACC AGAAATTCAAGGGCAGAGTGACCATGACCGTCGTGACCTCCACCTC CACCGTGTACATGGAACTGTCCAGCCTGAGATCCGAGGACACCGCC GTGTACTACTGCGCCCGGTCCTTCTACTACTCTCTGGACGCCGCTT GGTTTGTGTACTGGGGCCAGGGAACTCTGGTGACCGTGTCCTCT hSIRP.alpha..40AVH4 84 EVQFVQSGAEVKKPGASVKVSCKASGSTFTSYWMHWVRQAPGQGLE (amino acid sequence) WMGAIYPVNSDTTYNQKFKGRVTMTVVTSTSTVYMELSSLRSEDTA VYYCARSFYYSLDAAWFVYWGQGTLVTVSS hSIRP.alpha..40AVH5 85 GAGGTCCAGCTGCAACAGTCTGGTGCCGTGTTGGCTAAGCCTGGCG (nucleotide sequence) CCTCCGTGAAGATGTCCTGCAAGGCTTCTGGCTCCACCTTCACCAG CTACTGGATGCACTGGGTCAAGCAGAGGCCTGGACAGGGACTCGAG TGGATCGGCGCTATCTACCCTGTGAACTCCGACACCACCTACAACC AGAAGTTCAAGGGCAAAGCTACCCTGACCGTGGACAAGTCCTCCTC CACCGCTTACATGCAGCTGTCCAGCCTGACCTTCGAGGACTCCGCC GTGTACTACTGCGCCCGGTCCTTCTACTACTCTCTGGACGCCGCTT GGTTTGTGTACTGGGGCCAGGGCACAACCCTGACAGTGTCCTCT hSIRP.alpha..40AVH5 86 EVQLQQSGAVLAKPGASVKMSCKASGSTFTSYWMHWVKQRPGQGLE (amino acid sequence) WIGAIYPVNSDTTYNQKFKGKATLTVDKSSSTAYMQLSSLTFEDSA VYYCARSFYYSLDAAWFVYWGQGTTLTVSS hSIRP.alpha..40AVH6 87 GAGGTGCAGCTGGTTCAGTCTGGCGCCGAAGTGAAGAAACCTGGCG (nucleotide sequence) CCTCTGTGAAGGTGTCCTGCAAGGCTTCTGGCTCCACCTTCACCAG CTACTGGATGCACTGGGTCCGACAGGCTCCAGGACAAGGCTTGGAA TGGATGGGCGCTATCTACCCCGTGAACTCCGACACCACCTACAACC AGAAATTCAAGGGCAGAGTGACCATGACCGTGGACACCTCCACCAG CACCGTGTACATGGAACTGTCCAGCCTGAGATCCGAGGACACCGCC GTGTACTACTGCGCCCGGTCCTTCTACTACTCTCTGGACGCCGCTT GGTTTGTGTACTGGGGCCAGGGAACTCTGGTGACCGTGTCCTCT hSIRP.alpha..40AVH6 88 EVQLVQSGAEVKKPGASVKVSCKASGSTFTSYWMHWVRQAPGQGLE (amino acid sequence) WMGAIYPVNSDTTYNQKFKGRVTMTVDTSTSTVYMELSSLRSEDTA VYYCARSFYYSLDAAWFVYWGQGTLVTVSS hSIRP.alpha..40AVL1 89 GACATCCAGATGACCCAGTCTCCATCCTCTCTGTCCGCCTCTGTGG (nucleotide sequence) GCGACAGAGTGACCATCACCTGTAGAGCCTCTCAGGACATCGGCTC CAGACTGAACTGGCTGCAGCAGACCCCTGGCAAGGCCATCAAGAGA CTGATCTACGCCACCTCCAGCCTGGATTCTGGCGTGCCCTCTAGAT TCTCCGGCTCTAGATCTGGCACCGACTTCTCCCTGACCATCTCTGG ACTGCAGCCTGAGGACTTCGCCACCTACTACTGTCTGCAGTACGCC AGCTCTCCATTCACCTTTGGCGGAGGCACCAAGGTGGAAATCCAC hSIRP.alpha..40AVL1 90 DIQMTQSPSSLSASVGDRVTITCRASQDIGSRLNWLQQTPGKAIKR (amino acid sequence) LIYATSSLDSGVPSRFSGSRSGTDFSLTISGLQPEDFATYYCLQYA SSPFTFGGGTKVEIH hSIRP.alpha..40AVL2 91 GACATCCAGATGACCCAGTCTCCATCCTCTCTGTCCGCCTCTGTGG (nucleotide sequence) GCGACAGAGTGACCATCACCTGTAGAGCCTCTCAGGACATCGGCTC CAGACTGAACTGGCTGCAGCAGAAGCCTGGCAAGGCCATCAAGAGA CTGATCTACGCCACCTCCAGCCTGGATTCTGGCGTGCCCTCTAGAT TCTCCGGCTCTAGATCTGGCACCGACTTTACCCTGACAATCAGCTC CCTGCAGCCTGAGGACTTCGCCACCTACTACTGTCTGCAGTACGCC TCCTCTCCATTCACCTTTGGCCAGGGCACCAAGGTGGAAATCAAG hSIRP.alpha..40AVL2 92 DIQMTQSPSSLSASVGDRVTITCRASQDIGSRLNWLQQKPGKAIKR (amino acid sequence) LIYATSSLDSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCLQYA SSPFTFGQGTKVEIK hSIRP.alpha..40AVL3 93 GACATCCAGATGACCCAGTCTCCATCCTCTCTGTCCGCCTCTGTGG (nucleotide sequence) GCGACAGAGTGACCATCACCTGTAGAGCCTCTCAGGACATCGGCTC CAGACTGAACTGGCTGCAGCAGAAGCCTGGCAAGGCCATCAAGAGA CTGATCTACGCCACCTCCAGCCTGGATTCTGGCGTGCCCTCTAGAT TCTCCGGCTCTAGATCTGGCACCGACTTTACCCTGACAATCAGCTC CCTGCAGCCTGAGGACTTCGCCACCTACTACTGTCTGCAGTACGCC AGCTCTCCATTCACCTTTGGCGGAGGCACCAAGCTGGAAATCAAG hSIRP.alpha..40AVL3 94 DIQMTQSPSSLSASVGDRVTITCRASQDIGSRLNWLQQKPGKAIKR (amino acid sequence) LIYATSSLDSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCLQYA SSPFTFGGGTKLEIK hSIRP.alpha..40AVL4 95 GACATCCAGATGACCCAGTCTCCATCCTCTCTGTCCGCCTCTGTGG (nucleotide sequence) GCGACAGAGTGACCATCACCTGTAGAGCCTCTCAGGACATCGGCTC CAGACTGAACTGGCTGCAGCAGAAGCCTGGCAAGGCCCCTAAGAGA CTGATCTACGCCACCTCCAGCCTGGATTCTGGCGTGCCCTCTAGAT TCTCCGGCTCTGGCTCTGGCACCGAGTTTACCCTGACAATCAGCTC CCTGCAGCCTGAGGACTTCGCCACCTACTACTGTCTGCAGTACGCC AGCTCTCCATTCACCTTTGGCGGAGGCACCAAGGTGGAAATCAAG hSIRP.alpha..40AVL4 96 DIQMTQSPSSLSASVGDRVTITCRASQDIGSRLNWLQQKPGKAPKR (amino acid sequence) LIYATSSLDSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQYA SSPFTFGGGTKVEIK hSIRP.alpha..40AVL5 97 GACATCCAGATGACCCAGTCTCCATCCTCTCTGTCCGCCTCTGTGG (nucleotide sequence) GCGACAGAGTGACCATCACCTGTAGAGCCTCTCAGGACATCGGCTC CAGACTGAACTGGCTGCAGCAGAAGCCTGGCAAGGCCATCAAGAGA CTGATCTACGCCACCTCCAGCCTGGATTCTGGCGTGCCCAAGAGAT TCTCCGGCTCTAGATCCGGCTCCGACTATACCCTGACAATCAGCTC CCTGCAGCCTGAGGACTTCGCCACCTACTACTGTCTGCAGTACGCC TCCTCTCCATTCACCTTTGGCCAGGGCACCAAGGTGGAAATCAAG hSIRP.alpha..40AVL5 98 DIQMTQSPSSLSASVGDRVTITCRASQDIGSRLNWLQQKPGKAIKR (amino acid sequence) LIYATSSLDSGVPKRFSGSRSGSDYTLTISSLQPEDFATYYCLQYA SSPFTFGQGTKVEIK hSIRP.alpha..40AVL6 99 GACATCCAGATGACCCAGTCTCCATCCTCTCTGTCTGCTTCCCTGG (nucleotide sequence) GCGAGAGAGTGTCCATCACCTGTAGAGCCTCTCAGGACATCGGCTC CAGACTGAACTGGCTGCAGCAGAAGCCTGGCAAGGCCATCAAGAGA CTGATCTACGCCACCTCCAGCCTGGATTCTGGCGTGCCCTCTAGAT TCTCCGGCTCTAGATCTGGCACCGACTTTACCCTGACAATCAGCTC CCTGCAGCCTGAGGACTTCGCCACCTACTACTGTCTGCAGTACGCC AGCTCTCCATTCACCTTTGGCGGAGGCACCAAGGTGGAAATCAAG hSIRP.alpha..40AVL6 100 DIQMTQSPSSLSASLGERVSITCRASQDIGSRLNWLQQKPGKAIKR (amino acid sequence) LIYATSSLDSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCLQYA SSPFTFGGGTKVEIK hSIRP.alpha..40A mouse 101 GAGGTTCAGTTCCAGCAGTCTGGGACTGTGCTGGCAAGGCCAGGGA VH (nucleotide CTTCAGTGAAGATGTCCTGCAAGGCTTCTGGCTCCACCTTTACCAG sequence) CTACTGGATGCACTGGGTAAAACAGGGGCCTGGACAGGGTCTGCAA TGGATTGGCGCTATTTATCCTGTAAATAATGATACTACCTATAATC AGAAGTTCAAGGGCAAGGCCGAACTCACTGTAGTCACTTCCACCAG CACTGCCTACATGGAGGTCAGTAGTCTGACAAATGAGGACTCTGCG GTCTATTACTGTACAAGATCGTTCTACTATAGTCTCGACGCGGCCT GGTTTGTTTACTGGGGCCAAGGGACTCTGGTCACTGTCTCTGCA hSIRP.alpha..40A mouse 102 EVQFQQSGTVLARPGTSVKMSCKASGSTFTSYWMHWVKQGPGQGLQ VH (amino acid WIGAIYPVNNDTTYNQKFKGKAELTVVTSTSTAYMEVSSLTNEDSA sequence) VYYCTRSFYYSLDAAWFVYWGQGTLVTVSA hSIRP.alpha..40A mouse 103 GACATCCAGATGACCCAGTCTCCATCCTCCTTATCTGCCTCTCTGG VL (nucleotide GAGAAAGAGTCAGTCTCACTTGTCGGGCAAGTCAGGACATTGGTAG sequence) TAGGTTAAACTGGCTTCAGCAGGAACCAGATGGAACTATTAAACGC CTGATCTACGCCACATCCAGTTTAGATTCTGGTGTCCCCAAAAGGT TCAGTGGCAGTAGGTCTGGGTCAGATTATTCTCTCACCATCAGCGG CCTTGAGTCTGAAGACTTTGTAGACTATTACTGTCTACAATATGCT AGTTCTCCGTTCACGTTCGGAGGGGGGACCAAGCTGGAAATAAAC hSIRP.alpha..40A mouse 104 DIQMTQSPSSLSASLGERVSLTCRASQDIGSRLNWLQQEPDGTIKR VL (amino acid LIYATSSLDSGVPKRFSGSRSGSDYSLTISGLESEDFVDYYCLQYA sequence) SSPFTFGGGTKLEIN hSIRP.alpha..40A mouse 105 EVQFQQSGTVLARPGTSVKMSCKASGSTFTSYWMHWVKQGPGQGLQ heavy chain (amino WIGAIYPVNNDTTYNQKFKGKAELTVVTSTSTAYMEVSSLTNEDSA acid sequence; VYYCTRSFYYSLDAAWFVYWGQGTLVTVSAAKTTPPSVYPLAPGSA constant domain AQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLY underlined, signal TLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCI peptide not shown) CTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSW FVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRV NSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMI TDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKS NWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK hSIRP.alpha..40A mouse 106 DIQMTQSPSSLSASLGERVSLTCRASQDIGSRLNWLQQEPDGTIKR light chain (amino acid LIYATSSLDSGVPKRFSGSRSGSDYSLTISGLESEDFVDYYCLQYA sequence; constant SSPFTFGGGTKLEINRADAAPTVSIFPPSSEQLTSGGASVVCFLNN domain underlined, FYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKD signal peptide not EYERHNSYTCEATHKTSTSPIVKSFNRNEC shown) rhSIRP.alpha./Fc (amino 107 (GVAG)EEELQVIQPDKSVLVAAGETATLRCTATSLIPVGPIQWFR acid sequence) GAGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRIGNITPADA GTYYCVKFRKGSPDDVEFKSGAGTELSVRAKPSAPVVSGPAARATP QHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPVGESVSYS IHSTAKVVLTREDVHSQVICEVAHVTLQGDPLRGTANLSETIRVPP

TLEVTQQPVRAENQVNVTCQVRKFYPQRLQLTWLENGNVSRTETAS TVTENKDGTYNWMSWLLVNVSAHRDDVKLTCQVEHDGQPAVSKSHD LKVSAHPKEQGSNTAAENTGSNERIEGRMDPKSCDKTHTCPPCPAP ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK rhSIRP.gamma./Fc (amino 108 VLWFRGVGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSI acid sequence) TPADVGTYYCVKFRKGSPENVEFKSGPGTEMALGAKPSAPVVLGPA ARTTPEHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPTGQ SVAYSIRSTARVVLDPWDVRSQVICEVAHVTLQGDPLRGTANLSEA IRVPPTLEVTQQPMRAGNQVNVTCQVRKFYPQSLQLTWLENGNVCQ RETASTLTENKDGTYNWTSWFLVNISDQRDDVVLTCQVKHDGQLAV SKRLALEVTVHQKDQSSDATPGPASIEGRMDPKSCDKTHTCPPCPA PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKV SNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK rhCD47/Fc (amino 109 QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRD acid sequence) IYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTG NYTCEVTELTREGETIIELKYRVVSWFSPIEGRMDPKSCDKTHTCP PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEY KCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSL TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK hSIRP-V.gamma.C1.beta.C2.beta. 110 ATGCCCGTGCCTGCCTCTTGGCCTCATCTGCCCAGCCCCTTTCTGC (nucleotide sequence) TGATGACCCTGCTGCTGGGCAGGCTGACAGGCGTGGCAGGCGAAGA GGAACTGCAGATGATCCAGCCCGAGAAGCTGCTGCTCGTGACCGTG GGCAAGACCGCCACCCTGCACTGCACCGTGACATCCCTGCTGCCTG TGGGACCCGTGCTGTGGTTTAGAGGCGTGGGCCCTGGCAGAGAGCT GATCTACAACCAGAAAGAGGGCCACTTCCCCAGAGTGACCACCGTG TCCGACCTGACCAAGCGGAACAACATGGACTTCTCCATCCGGATCT CCAGCATCACCCCTGCCGACGTGGGCACCTACTACTGCGTGAAGTT CCGGAAGGGCTCCCCCGAGAACGTGGAGTTCAAGTCTGGCCCAGGC ACCGAGATGGCCCTGGGCGCTAAACCTTCTGCCCCTGTGGTGTCTG GACCTGCCGTGCGGGCTACCCCTGAGCACACCGTGTCTTTTACCTG CGAGTCCCACGGCTTCAGCCCTCGGGACATCACCCTGAAGTGGTTC AAGAACGGCAACGAGCTGTCCGACTTCCAGACCAACGTGGACCCTG CCGGCGACTCCGTGTCCTACTCCATCCACTCTACCGCCAGAGTGGT GCTGACCAGAGGCGACGTGCACTCCCAAGTGATCTGCGAGATCGCC CATATCACACTGCAGGGCGACCCCCTGAGAGGCACCGCCAATCTGT CTGAGGCCATCAGAGTGCCCCCCACCCTGGAAGTGACCCAGCAGCC TATGAGAGCCGAGAACCAGGCCAACGTGACCTGTCAGGTGTCCAAC TTCTACCCTCGGGGCCTGCAGCTGACCTGGCTGGAAAACGGCAATG TGTCCCGGACCGAGACAGCCTCCACCCTGATCGAGAACAAGGACGG CACCTACAATTGGATGTCCTGGCTGCTCGTGAACACCTGTGCCCAC AGGGACGACGTGGTGCTGACATGCCAGGTGGAACACGATGGCCAGC AGGCCGTGTCCAAGTCCTACGCCCTGGAAATCTCCGCCCATCAGAA AGAGCACGGCTCCGATATCACCCACGAGGCCGCTCTGGCTCCTACC GCTCCTCTGCTGGTGGCTCTGCTGCTGGGACCTAAGCTGCTGCTGG TCGTGGGCGTGTCCGCCATCTACATCTGCTGGAAGCAGAAGGCCTG A hSIRP-V.gamma.C1.beta.C2.beta. 111 MPVPASWPHLPSPFLLMTLLLGRLTGVAGEEELQMIQPEKLLLVTV (amino acid sequence) GKTATLHCTVTSLLPVGPVLWFRGVGPGRELIYNQKEGHFPRVTTV SDLTKRNNMDFSIRISSITPADVGTYYCVKFRKGSPENVEFKSGPG TEMALGAKPSAPVVSGPAVRATPEHTVSFTCESHGFSPRDITLKWF KNGNELSDFQTNVDPAGDSVSYSIHSTARVVLTRGDVHSQVICEIA HITLQGDPLRGTANLSEAIRVPPTLEVTQQPMRAENQANVTCQVSN FYPRGLQLTWLENGNVSRTETASTLIENKDGTYNWMSWLLVNTCAH RDDVVLTCQVEHDGQQAVSKSYALEISAHQKEHGSDITHEAALAPT APLLVALLLGPKLLLVVGVSAIYICWKQKA hSIRP-V.beta.C1.gamma.C2.beta. 112 ATGCCCGTGCCTGCCTCTTGGCCTCATCTGCCCAGCCCCTTTCTGC (nucleotide sequence) TGATGACCCTGCTGCTGGGCAGGCTGACAGGCGTGGCAGGCGAAGA TGAGCTGCAAGTGATCCAGCCCGAGAAGTCCGTGTCTGTGGCCGCT GGCGAGTCTGCCACCCTGAGATGCGCTATGACCTCCCTGATCCCCG TGGGCCCCATCATGTGGTTTAGAGGCGCTGGCGCTGGCAGAGAGCT GATCTACAACCAGAAAGAGGGCCACTTCCCCAGAGTGACCACCGTG TCCGAGCTGACCAAGCGGAACAACCTGGACTTCTCCATCTCCATCA GCAACATCACCCCTGCCGACGCCGGCACCTACTACTGCGTGAAGTT CCGGAAGGGCTCCCCCGACGACGTGGAGTTCAAATCCGGCGCTGGA ACCGAGCTGTCCGTGCGGGCTAAACCTTCTGCCCCTGTGGTGCTGG GACCTGCCGCTAGAACCACCCCTGAGCACACCGTGTCTTTTACCTG CGAGTCCCACGGCTTCAGCCCTCGGGACATCACCCTGAAGTGGTTC AAGAACGGCAACGAGCTGAGCGACTTCCAGACCAACGTGGACCCTA CCGGCCAGTCCGTGGCCTACTCCATCAGATCCACCGCCAGAGTGGT GCTGGACCCTTGGGATGTGCGGTCCCAAGTGATCTGCGAGGTGGCC CATGTGACACTGCAGGGCGATCCTCTGAGAGGCACCGCCAATCTGT CTGAGGCCATCAGAGTGCCCCCCACCCTGGAAGTGACCCAGCAGCC TATGAGAGCCGAGAACCAGGCCAACGTGACCTGCCAGGTGTCCAAC TTCTACCCTCGGGGCCTGCAGCTGACCTGGCTGGAAAACGGCAATG TGTCCCGGACCGAGACAGCCTCCACCCTGATCGAGAACAAGGATGG CACCTACAATTGGATGTCCTGGCTGCTCGTGAACACCTGTGCCCAC CGGGATGACGTGGTGCTGACTTGTCAGGTGGAACACGACGGCCAGC AGGCCGTGTCCAAGTCCTACGCCCTGGAAATCTCCGCCCATCAGAA AGAGCACGGCTCCGATATCACCCACGAGGCCGCTCTGGCTCCTACC GCTCCTCTGCTGGTGGCTCTGCTGCTGGGACCTAAGCTGCTGCTGG TCGTGGGCGTGTCCGCCATCTACATCTGCTGGAAGCAGAAGGCCTG A hSIRP-V.beta.C1.gamma.C2.beta. 113 MPVPASWPHLPSPFLLMTLLLGRLTGVAGEDELQVIQPEKSVSVAA (amino acid sequence) GESATLRCAMTSLIPVGPIMWFRGAGAGRELIYNQKEGHFPRVTTV SELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAG TELSVRAKPSAPVVLGPAARTTPEHTVSFTCESHGFSPRDITLKWF KNGNELSDFQTNVDPTGQSVAYSIRSTARVVLDPWDVRSQVICEVA HVTLQGDPLRGTANLSEAIRVPPTLEVTQQPMRAENQANVTCQVSN FYPRGLQLTWLENGNVSRTETASTLIENKDGTYNWMSWLLVNTCAH RDDVVLTCQVEHDGQQAVSKSYALEISAHQKEHGSDITHEAALAPT APLLVALLLGPKLLLVVGVSAIYICWKQKA hSIRP-V.beta.C1.beta.C2.gamma. 114 ATGCCCGTGCCTGCCTCTTGGCCTCATCTGCCCAGCCCCTTTCTGC (nucleotide sequence) TGATGACCCTGCTGCTGGGCAGGCTGACAGGCGTGGCAGGCGAAGA TGAGCTGCAAGTGATCCAGCCCGAGAAGTCCGTGTCTGTGGCCGCT GGCGAGTCTGCCACCCTGAGATGCGCTATGACCTCCCTGATCCCCG TGGGCCCCATCATGTGGTTTAGAGGCGCTGGCGCTGGCAGAGAGCT GATCTACAACCAGAAAGAGGGCCACTTCCCCAGAGTGACCACCGTG TCCGAGCTGACCAAGCGGAACAACCTGGACTTCTCCATCTCCATCA GCAACATCACCCCTGCCGACGCCGGCACCTACTACTGCGTGAAGTT CCGGAAGGGCTCCCCCGACGACGTGGAGTTCAAATCCGGCGCTGGA ACCGAGCTGTCCGTGCGGGCTAAACCTTCTGCCCCTGTGGTGTCTG GACCTGCTGTGCGCGCTACCCCTGAGCACACCGTGTCTTTTACCTG CGAGTCCCACGGCTTCAGCCCTCGGGACATCACCCTGAAGTGGTTC AAGAACGGCAACGAGCTGAGCGACTTCCAGACCAACGTGGACCCTG CCGGCGACTCCGTGTCCTACTCCATCCACTCTACCGCCAGAGTGGT GCTGACCAGAGGCGACGTGCACTCCCAAGTGATCTGCGAGATCGCC CATATCACACTGCAGGGCGACCCCCTGAGAGGCACCGCCAATCTGT CTGAGGCCATCAGAGTGCCCCCCACCCTGGAAGTGACCCAGCAGCC TATGAGAGTGGGCAACCAAGTGAACGTGACCTGCCAAGTGCGGAAG TTCTACCCCCAGTCCCTGCAGCTGACTTGGAGCGAGAATGGCAACG TGTGCCAGAGAGAGACAGCCTCCACCCTGACCGAGAACAAGGACGG AACCTACAACTGGACCTCCTGGTTCCTCGTGAACATCTCCGACCAG CGGGACGACGTGGTGCTGACATGCCAAGTGAAGCACGATGGACAGC TGGCCGTGTCCAAGCGGCTGGCTCTGGAAGTGACAGTGCACCAGAA AGAGCACGGCTCCGACATCACCCACGAGGCCGCTCTGGCTCCTACA GCTCCTCTGCTGGTGGCTCTGCTGCTGGGACCTAAGCTGCTGCTGG TCGTGGGCGTGTCCGCCATCTACATCTGCTGGAAGCAGAAGGCCTG A hSIRP-V.beta.C1.beta.C2.gamma. 115 MPVPASWPHLPSPFLLMTLLLGRLTGVAGEDELQVIQPEKSVSVAA (amino acid sequence) GESATLRCAMTSLIPVGPIMWFRGAGAGRELIYNQKEGHFPRVTTV SELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAG TELSVRAKPSAPVVSGPAVRATPEHTVSFTCESHGFSPRDITLKWF KNGNELSDFQTNVDPAGDSVSYSIHSTARVVLTRGDVHSQVICEIA HITLQGDPLRGTANLSEAIRVPPTLEVTQQPMRVGNQVNVTCQVRK FYPQSLQLTWSENGNVCQRETASTLTENKDGTYNWTSWFLVNISDQ RDDVVLTCQVKHDGQLAVSKRLALEVTVHQKEHGSDITHEAALAPT APLLVALLLGPKLLLVVGVSAIYICWKQKA human SIRP.beta.L 116 ATGCCTGTGCCTGCCTCTTGGCCTCATCTGCCCTCTCCATTTCTGC (nucleotide sequence) TGATGACCCTGCTGCTGGGCAGACTGACAGGTGTTGCTGGCGAAGA GGAACTGCAAGTGATCCAGCCTGACAAGAGCATCTCTGTGGCCGCT GGCGAATCTGCCACACTGCACTGTACCGTGACATCTCTGATCCCTG TGGGCCCCATCCAGTGGTTTAGAGGTGCTGGACCTGGCAGAGAGCT GATCTACAACCAGAAAGAGGGACACTTCCCCAGAGTGACCACCGTG TCCGACCTGACCAAGCGGAACAACATGGACTTCAGCATCCGGATCA GCAACATCACCCCTGCCGATGCCGGCACCTACTACTGCGTGAAGTT CAGAAAGGGCAGCCCCGACCACGTCGAGTTTAAAAGCGGAGCCGGC ACAGAGCTGAGCGTGCGGGCTAAACCTTCTGCTCCTGTGGTGTCTG GACCAGCCGCTAGAGCTACACCTCAGCACACCGTGTCTTTTACCTG CGAGAGCCACGGCTTCAGCCCCAGAGATATCACCCTGAAGTGGTTC AAGAACGGCAACGAGCTGTCCGACTTCCAGACCAATGTGGACCCAG CCGGCGATAGCGTGTCCTACAGCATTCACAGCACCGCCAAGGTGGT GCTGACCCGGGAAGATGTGCACAGCCAAGTGATTTGCGAGGTGGCC CACGTTACCCTGCAAGGCGATCCTCTGAGAGGAACCGCCAACCTGA GCGAGACAATCCGGGTGCCACCTACACTGGAAGTGACCCAGCAGCC TGTGCGGGCCGAGAATCAAGTGAACGTGACCTGCCAAGTGCGGAAG TTCTACCCTCAGAGACTGCAGCTGACCTGGCTGGAAAACGGCAATG TGTCCCGGACCGAGACAGCCAGCACACTGACCGAGAACAAGGATGG CACCTACAATTGGATGAGCTGGCTGCTGGTCAATGTGTCTGCCCAC CGGGACGATGTGAAGCTGACATGCCAGGTGGAACACGATGGCCAGC CTGCCGTGTCTAAGAGCCACGACCTGAAGGTGTCCGCTCATCCCAA AGAGCAGGGCAGCAATACTGCCCCTGGACCTGCTCTTGCTTCTGCC GCTCCTCTGCTGATCGCCTTTCTGCTGGGACCTAAGGTGCTGCTGG TTGTGGGAGTGTCCGTGATCTACGTGTACTGGAAGCAGAAGGCC human SIRP.beta.L (amino 117 MPVPASWPHLPSPFLLMTLLLGRLTGVAGEEELQVIQPDKSISVAA acid sequence) GESATLHCTVTSLIPVGPIQWFRGAGPGRELIYNQKEGHFPRVTTV SDLTKRNNMDFSIRISNITPADAGTYYCVKFRKGSPDHVEFKSGAG TELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKWF KNGNELSDFQTNVDPAGDSVSYSIHSTAKVVLTREDVHSQVICEVA HVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRK FYPQRLQLTWLENGNVSRTETASTLTENKDGTYNWMSWLLVNVSAH RDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAPGPALASA APLLIAFLLGPKVLLVVGVSVIYVYWKQKA human IgG1 constant 118 GCCAGCACCAAGGGCCCATCGGTCTTCCCCCTGGCACCCTCCTCCA domains (nucleotide AGAGCACCTCTGGGGGCACAGCGGCCCTGGGCTGCCTGGTCAAGGA sequence) CTACTTCCCCGAACCGGTGACGGTGTCGTGGAACTCAGGCGCCCTG ACCAGCGGCGTGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGAC TCTACTCCCTCAGCAGCGTGGTGACCGTGCCCTCCAGCAGCTTGGG CACCCAGACCTACATCTGCAACGTGAATCACAAGCCCAGCAACACC AAGGTGGACAAGAAAGTTGAGCCCAAATCTTGTGACAAAACTCACA CATGCCCACCGTGCCCAGCACCTGAACTCCTGGGGGGACCGTCAGT CTTCCTCTTCCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGG ACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACGAAGACC CTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCATAA TGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCACGTACCGG GTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGCA AGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCAT CGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAG GTGTACACCCTGCCCCCATCCCGGGATGAGCTGACCAAGAACCAGG TCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGC CGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACC ACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCA AGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTC ATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAG AGCCTCTCCCTGTCTCCGGGTAAA human IgG1 constant 119 ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGAL domains (amino acid TSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNT sequence) KVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQ VYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQK SLSLSPGK mouse IgG1 constant 120 AKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSL domains (amino acid SSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTT sequence) VDKKLEPSGPISTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKD VLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHRED YNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKG LVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHT EENYKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLK NYYLKKTISRSPGK mouse kappa constant 121 RADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGS domain (amino acid ERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHK sequence) TSTSPIVKSFNRNEC human IgG2 constant 122 ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGAL domains, V234A- TSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNT G237A-P238S- KVDKTVERKCCVECPPCPAPPAAASSVFLFPPKPKDTLMISRTPEV H268A-V309L- TCVVVDVSAEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSV A330S-P331S (Sigma) LTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKTKGQPREPQVYTL mutant (amino acid PPSREEMTKNQVSLTCLVKGFYPSDIX.sub.1VEWESNGQPENNYKTTPP sequence) MLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGK wherein: X.sub.1 = A, S human IgG1 constant 123 ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGAL domains, L234A- TSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNT L235A mutant (amino KVDKKVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISR acid sequence) TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQ

VYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQK SLSLSPGK human IgG1 constant 124 GCTAGCACAAAGGGCCCTAGTGTGTTTCCTCTGGCTCCCTCTTCCA domains, L234A- AATCCACTTCTGGTGGCACTGCTGCTCTGGGATGCCTGGTGAAGGA L235A-P329G mutant TTACTTTCCTGAACCTGTGACTGTCTCATGGAACTCTGGTGCTCTG (nucleotide sequence) ACTTCTGGTGTCCACACTTTCCCTGCTGTGCTGCAGTCTAGTGGAC TGTACTCTCTGTCATCTGTGGTCACTGTGCCCTCTTCATCTCTGGG AACCCAGACCTACATTTGTAATGTGAACCACAAACCATCCAACACT AAAGTGGACAAAAAAGTGGAACCCAAATCCTGTGACAAAACCCACA CCTGCCCACCTTGTCCGGCGCCTGAAGCGGCGGGAGGACCTTCTGT GTTTCTGTTCCCCCCCAAACCAAAGGATACCCTGATGATCTCGCGA ACCCCTGAGGTGACATGTGTGGTGGTGGATGTGTCTCATGAGGACC CCGAAGTCAAATTTAATTGGTATGTCGACGGCGTCGAGGTGCATAA TGCCAAAACCAAGCCTAGAGAGGAACAGTACAATTCAACCTACAGA GTCGTCAGTGTGCTGACTGTGCTGCATCAGGATTGGCTGAATGGCA AGGAATACAAGTGTAAAGTCTCAAACAAGGCCCTGGGAGCTCCAAT TGAGAAAACAATCTCAAAGGCCAAAGGACAGCCTAGGGAACCCCAG GTCTACACCCTGCCACCTTCGAGAGACGAACTGACCAAAAACCAGG TGTCCCTGACATGCCTGGTCAAAGGCTTCTACCCTTCTGACATTGC TGTGGAGTGGGAGTCAAATGGACAGCCTGAGAACAACTACAAAACA ACCCCCCCTGTGCTGGATTCTGATGGCTCTTTCTTTCTGTACTCCA AACTGACTGTGGACAAGTCTAGATGGCAGCAGGGGAATGTCTTTTC TTGCTCTGTCATGCATGAGGCTCTGCATAACCACTACACTCAGAAA TCCCTGTCTCTGTCTCCCGGGAAA human IgG1 constant 125 ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGAL domains, L234A- TSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNT L235A-P329G mutant KVDKKVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISR (amino acid sequence) TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR VVSVLTVLHQDWLNGKEYKCKVSNKALGAPIEKTISKAKGQPREPQ VYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQK SLSLSPGK human IgG1 constant 126 ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGAL domains, N297Q TSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNT mutant (amino acid KVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR sequence) TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYQSTYR VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQ VYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQK SLSLSPGK human IgG4 constant 127 ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGAL domains, S228P- TSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNT N297Q mutant (amino KVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPE acid sequence) VTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFQSTYRVVS VLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYT LPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLS LSLGK 18D5 VH (amino acid 128 QVQLQQPGAELVRPGSSVKLSCKASGYTFTSYWVHWVKQRPIQGLE sequence) WIGNIDPSDSDTHYNQKFKDKASLTVDKSSSTAYMQLSSLTFEDSA VYYCVRGGTGTMAWFAYWGQGTLVTVSA 18D5 VL (amino acid 129 DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSYGNTYLYWYLQKPG sequence) QSPKLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYF CFQGTHVPYTFGSGTKLEIK KWAR23 VH (amino 130 EVQLQQSGAELVKPGASVKLSCTASGFNIKDYYIHWVQQRTEQGLE acid sequence) WIGRIDPEDGETKYAPKFQDKATITADTSSNTAYLHLSSLTSEDTA VYYCARWGAYWGQGTLVTVSS KWAR23 VL (amino 131 QIVLTQSPAIMSASPGEKVTLTCSASSSVSSSYLYWYQQKPGSSPK acid sequence) LWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAASYFCHQW SSYPRTFGAGTKLELK rhSIRP.alpha.-HIS (amino 132 MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVLVA acid sequence) AGETATLRCTATSLIPVGPIQWFRGAGPGRELIYNQKEGHFPRVTT VSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPDDVEFKSGA GTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKW FKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEV AHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVR KFYPQRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSA HRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSN ERHHHHHH

[0967] All references cited herein are incorporated by reference to the same extent as if each individual publication, database entry (e.g. Genbank sequences or GeneID entries), patent application, or patent, was specifically and individually indicated to be incorporated by reference. This statement of incorporation by reference is intended by Applicants, pursuant to 37 C.F.R. .sctn. 1.57(b)(1), to relate to each and every individual publication, database entry (e.g. Genbank sequences or GeneID entries), patent application, or patent, each of which is clearly identified in compliance with 37 C.F.R. .sctn. 1.57(b)(2), even if such citation is not immediately adjacent to a dedicated statement of incorporation by reference. The inclusion of dedicated statements of incorporation by reference, if any, within the specification does not in any way weaken this general statement of incorporation by reference. Citation of the references herein is not intended as an admission that the reference is pertinent prior art, nor does it constitute any admission as to the contents or date of these publications or documents. To the extent that the references provide a definition for a claimed term that conflicts with the definitions provided in the instant specification, the definitions provided in the instant specification shall be used to interpret the claimed invention.

[0968] The present invention is not to be limited in scope by the specific embodiments described herein. Indeed, various modifications of the invention in addition to those described herein will become apparent to those skilled in the art from the foregoing description and the accompanying figures. Such modifications are intended to fall within the scope of the appended claims.

[0969] The foregoing written specification is considered to be sufficient to enable one skilled in the art to practice the invention. Various modifications of the invention in addition to those shown and described herein will become apparent to those skilled in the art from the foregoing description and fall within the scope of the appended claims.

Sequence CWU 1

1

13715PRTArtificial SequenceSynthetic 50A heavy chain CDR1 1Asn Tyr Tyr Ile His1 5217PRTArtificial SequenceSynthetic 50A heavy chain CDR2 2Trp Ile Tyr Pro Gly Asn Val Asn Thr Lys Tyr Asn Glu Lys Phe Lys1 5 10 15Ala310PRTArtificial SequenceSynthetic 50A heavy chain CDR3 3Pro Thr Ile Ile Ala Thr Asp Phe Asp Val1 5 10411PRTArtificial SequenceSynthetic 50A light chain CDR1 4Lys Ala Ser Gln Gly Val Gly Thr Ala Val Gly1 5 1057PRTArtificial SequenceSynthetic 50A light chain CDR2 5Trp Ala Ser Thr Arg His Thr1 569PRTArtificial SequenceSynthetic 50A light chain CDR3 6Gln Gln Tyr Ser Thr Tyr Pro Phe Thr1 57119PRTArtificial SequenceSynthetic humanized 50 heavy chain variable region (consensus sequence)misc_feature(5)..(5)X = Q or Vmisc_feature(6)..(6)X = Q or Emisc_feature(9)..(9)X = A or Smisc_feature(11)..(11)X = V or Lmisc_feature(19)..(19)X = K or Mmisc_feature(20)..(20)X = V or Imisc_feature(40)..(40)X = A or Rmisc_feature(42)..(42)X = G or Emisc_feature(48)..(48)X = I or Mmisc_feature(67)..(67)X = R or Kmisc_feature(68)..(68)X = V or Amisc_feature(69)..(69)X = T or Imisc_feature(70)..(70)X = I or Mmisc_feature(79)..(79)X = A or Vmisc_feature(82)..(82)X = D or E or Qmisc_feature(87)..(87)X = R or Tmisc_feature(89)..(89)X = E or Dmisc_feature(91)..(91)X = T or Mmisc_feature(114)..(114)X = T or L 7Glu Val Gln Leu Xaa Xaa Ser Gly Xaa Glu Xaa Val Lys Pro Gly Ala1 5 10 15Ser Val Xaa Xaa Ser Cys Lys Ala Ser Gly Phe Thr Phe Thr Asn Tyr 20 25 30Tyr Ile His Trp Val Arg Gln Xaa Pro Xaa Gln Gly Leu Glu Trp Xaa 35 40 45Gly Trp Ile Tyr Pro Gly Asn Val Asn Thr Lys Tyr Asn Glu Lys Phe 50 55 60Lys Ala Xaa Xaa Xaa Xaa Thr Ala Asp Lys Ser Thr Ser Thr Xaa Tyr65 70 75 80Met Xaa Leu Ser Ser Leu Xaa Ser Xaa Asp Xaa Ala Val Tyr Tyr Cys 85 90 95Ala Arg Pro Thr Ile Ile Ala Thr Asp Phe Asp Val Trp Gly Gln Gly 100 105 110Thr Xaa Val Thr Val Ser Ser 1158107PRTArtificial SequenceSynthetic humanized 50 light chain variable region (consensus sequence)misc_feature(1)..(4)X = D or Emisc_feature(2)..(2)X = I or Lmisc_feature(3)..(3)X = V or Qmisc_feature(4)..(4)X = L or Mmisc_feature(10)..(10)X = F or Smisc_feature(38)..(38)X = Q or Kmisc_feature(43)..(43)X = A or S or Vmisc_feature(70)..(70)X = E or Dmisc_feature(74)..(74)X = T or Amisc_feature(76)..(76)X = S or Nmisc_feature(77)..(77)X = S or N or Gmisc_feature(83)..(83)X = F or I or Vmisc_feature(85)..(85)X = A or D or Tmisc_feature(104)..(104)X = L or V 8Xaa Xaa Xaa Xaa Thr Gln Ser Pro Ser Xaa Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Lys Ala Ser Gln Gly Val Gly Thr Ala 20 25 30Val Gly Trp Tyr Gln Xaa Lys Pro Gly Lys Xaa Pro Lys Leu Leu Ile 35 40 45Tyr Trp Ala Ser Thr Arg His Thr Gly Val Pro Asp Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Xaa Phe Thr Leu Xaa Ile Xaa Xaa Leu Gln Pro65 70 75 80Glu Asp Xaa Ala Xaa Tyr Tyr Cys Gln Gln Tyr Ser Thr Tyr Pro Phe 85 90 95Thr Phe Gly Gly Gly Thr Lys Xaa Glu Ile Lys 100 1059357DNAArtificial SequenceSynthetic hSIRP alpha.50AVH1 9gaagtgcagc tgcagcagtc tggcgccgag gtcgtgaaac ctggcgcctc tgtgaaggtg 60tcctgcaagg cctccggctt caccttcacc aactactaca tccactgggt gcgacaggcc 120ccaggccagg gactggaatg gatcggctgg atctaccccg gcaacgtgaa caccaagtac 180aacgagaagt tcaaggcccg cgtgaccatc accgccgaca agtctacctc caccgcctac 240atggacctgt cctccctgag atccgaggac accgccgtgt actactgcgc cagacccacc 300atcattgcca ccgacttcga cgtgtggggc cagggcacaa ccgtgaccgt gtcctct 35710119PRTArtificial SequenceSynthetic hSIRP alpha.50AVH1 10Glu Val Gln Leu Gln Gln Ser Gly Ala Glu Val Val Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Phe Thr Phe Thr Asn Tyr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Ile 35 40 45Gly Trp Ile Tyr Pro Gly Asn Val Asn Thr Lys Tyr Asn Glu Lys Phe 50 55 60Lys Ala Arg Val Thr Ile Thr Ala Asp Lys Ser Thr Ser Thr Ala Tyr65 70 75 80Met Asp Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Pro Thr Ile Ile Ala Thr Asp Phe Asp Val Trp Gly Gln Gly 100 105 110Thr Thr Val Thr Val Ser Ser 11511357DNAArtificial SequenceSynthetic hSIRP alpha.50AVH2 11gaagtgcagc tggtggaatc cggctccgag ctcgtgaagc ctggcgcctc cgtgaaggtg 60tcctgcaagg cctctggctt caccttcacc aactactaca tccactgggt gcgacaggcc 120ccaggccagg gactggaatg gatgggctgg atctaccccg gcaacgtgaa caccaagtac 180aacgagaagt tcaaggccaa ggccaccatc accgccgaca agtccacctc caccgcctac 240atggaactgt cctccctgcg gagcgaggac accgccgtgt actactgtgc ccggcctacc 300atcattgcca ccgacttcga tgtgtggggc cagggcacac tcgtgaccgt gtcctct 35712119PRTArtificial SequenceSynthetic hSIRP alpha.50AVH2 12Glu Val Gln Leu Val Glu Ser Gly Ser Glu Leu Val Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Phe Thr Phe Thr Asn Tyr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40 45Gly Trp Ile Tyr Pro Gly Asn Val Asn Thr Lys Tyr Asn Glu Lys Phe 50 55 60Lys Ala Lys Ala Thr Ile Thr Ala Asp Lys Ser Thr Ser Thr Ala Tyr65 70 75 80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Pro Thr Ile Ile Ala Thr Asp Phe Asp Val Trp Gly Gln Gly 100 105 110Thr Leu Val Thr Val Ser Ser 11513357DNAArtificial SequenceSynthetic hSIRP alpha.50AVH3 13gaagtgcagc tggtgcagtc tggcgccgag gtcgtgaaac ctggcgcctc cgtgatgatc 60tcctgcaagg cctccggctt caccttcacc aactactaca tccactgggt gcgacagcgg 120ccaggccagg gactggaatg gatcggctgg atctaccccg gcaacgtgaa caccaagtac 180aacgagaagt tcaaggcccg cgtgatcatg accgccgaca agtccacctc caccgtgtac 240atgcagctgt cctccctgac ctccgaggac accgccgtgt actactgcgc cagacccacc 300atcattgcca ccgacttcga cgtgtggggc cagggcacac tcgtgaccgt gtcctct 35714119PRTArtificial SequenceSynthetic hSIRP alpha.50AVH3 14Glu Val Gln Leu Val Gln Ser Gly Ala Glu Val Val Lys Pro Gly Ala1 5 10 15Ser Val Met Ile Ser Cys Lys Ala Ser Gly Phe Thr Phe Thr Asn Tyr 20 25 30Tyr Ile His Trp Val Arg Gln Arg Pro Gly Gln Gly Leu Glu Trp Ile 35 40 45Gly Trp Ile Tyr Pro Gly Asn Val Asn Thr Lys Tyr Asn Glu Lys Phe 50 55 60Lys Ala Arg Val Ile Met Thr Ala Asp Lys Ser Thr Ser Thr Val Tyr65 70 75 80Met Gln Leu Ser Ser Leu Thr Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Pro Thr Ile Ile Ala Thr Asp Phe Asp Val Trp Gly Gln Gly 100 105 110Thr Leu Val Thr Val Ser Ser 11515357DNAArtificial SequenceSynthetic hSIRP alpha.50AVH4 15gaagtgcagc tgcagcagtc tggcgccgag ctcgtgaaac ctggcgcctc tgtgaaggtg 60tcctgcaagg cctccggctt caccttcacc aactactaca tccactgggt gcgacagcgg 120ccaggccagg gactggaatg gatgggctgg atctaccccg gcaacgtgaa caccaagtac 180aacgagaagt tcaaggccaa ggccaccatc accgccgaca agtccacctc caccgcctac 240atggaactgt cctccctgac ctccgaggac accgccgtgt actactgcgc cagacccacc 300atcattgcca ccgacttcga cgtgtggggc cagggcacaa ccgtgaccgt gtcctct 35716119PRTArtificial SequenceSynthetic hSIRP alpha.50AVH4 16Glu Val Gln Leu Gln Gln Ser Gly Ala Glu Leu Val Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Phe Thr Phe Thr Asn Tyr 20 25 30Tyr Ile His Trp Val Arg Gln Arg Pro Gly Gln Gly Leu Glu Trp Met 35 40 45Gly Trp Ile Tyr Pro Gly Asn Val Asn Thr Lys Tyr Asn Glu Lys Phe 50 55 60Lys Ala Lys Ala Thr Ile Thr Ala Asp Lys Ser Thr Ser Thr Ala Tyr65 70 75 80Met Glu Leu Ser Ser Leu Thr Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Pro Thr Ile Ile Ala Thr Asp Phe Asp Val Trp Gly Gln Gly 100 105 110Thr Thr Val Thr Val Ser Ser 11517357DNAArtificial SequenceSynthetic hSIRP alpha.50AVH5 17gaagtgcagc tggtgcagtc tggcgccgag gtcgtgaaac ctggcgcctc tgtgaaggtg 60tcctgcaagg cctccggctt caccttcacc aactactaca tccactgggt gcgacaggcc 120cccgagcagg gactggaatg gatcggctgg atctaccccg gcaacgtgaa caccaagtac 180aacgagaagt tcaaggcccg cgtgaccatg accgccgaca agtctacctc caccgcctac 240atggaactgt cctccctgcg gagcgacgac atggccgtgt actactgcgc cagacccacc 300atcattgcca ccgacttcga cgtgtggggc cagggcacaa ccgtgaccgt gtcctct 35718119PRTArtificial SequenceSynthetic hSIRP alpha.50AVH5 18Glu Val Gln Leu Val Gln Ser Gly Ala Glu Val Val Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Phe Thr Phe Thr Asn Tyr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro Glu Gln Gly Leu Glu Trp Ile 35 40 45Gly Trp Ile Tyr Pro Gly Asn Val Asn Thr Lys Tyr Asn Glu Lys Phe 50 55 60Lys Ala Arg Val Thr Met Thr Ala Asp Lys Ser Thr Ser Thr Ala Tyr65 70 75 80Met Glu Leu Ser Ser Leu Arg Ser Asp Asp Met Ala Val Tyr Tyr Cys 85 90 95Ala Arg Pro Thr Ile Ile Ala Thr Asp Phe Asp Val Trp Gly Gln Gly 100 105 110Thr Thr Val Thr Val Ser Ser 11519321DNAArtificial SequenceSynthetic hSIRP alpha.50AVL1 19gacatcgtgc tgacccagtc ccccagcttc ctgtctgcct ctgtgggcga cagagtgacc 60atcacatgca aggcctctca gggcgtgggc accgctgtgg gatggtatca gcagaagcct 120ggcaaggccc ccaagctgct gatctactgg gcctctacca gacacaccgg cgtgcccgac 180agattctccg gctctggctc tggcaccgag tttaccctga ccatctccag cctgcagccc 240gaggatttcg ccgcctacta ctgccagcag tactccacct accccttcac cttcggcgga 300ggcaccaagc tggaaatcaa g 32120107PRTArtificial SequenceSynthetic hSIRP alpha.50AVL1 20Asp Ile Val Leu Thr Gln Ser Pro Ser Phe Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Lys Ala Ser Gln Gly Val Gly Thr Ala 20 25 30Val Gly Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45Tyr Trp Ala Ser Thr Arg His Thr Gly Val Pro Asp Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Ala Tyr Tyr Cys Gln Gln Tyr Ser Thr Tyr Pro Phe 85 90 95Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys 100 10521321DNAArtificial SequenceSynthetic hSIRP alpha.50AVL2 21gacatcgtga tgacccagtc cccctccagc ctgtctgcct ctgtgggcga cagagtgacc 60atcacatgca aggcctctca gggcgtgggc accgctgtgg gatggtatca gcagaagcct 120ggcaaggccc ccaagctgct gatctactgg gcctctacca gacacaccgg cgtgcccgac 180agattctccg gctctggctc tggcaccgac ttcaccctga ccatctccaa cctgcagccc 240gaggacttcg ccgactacta ctgccagcag tactccacct accccttcac cttcggcgga 300ggcaccaagg tggaaatcaa g 32122107PRTArtificial SequenceSynthetic hSIRP alpha.50AVL2 22Asp Ile Val Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Lys Ala Ser Gln Gly Val Gly Thr Ala 20 25 30Val Gly Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45Tyr Trp Ala Ser Thr Arg His Thr Gly Val Pro Asp Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Asn Leu Gln Pro65 70 75 80Glu Asp Phe Ala Asp Tyr Tyr Cys Gln Gln Tyr Ser Thr Tyr Pro Phe 85 90 95Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys 100 10523321DNAArtificial SequenceSynthetic hSIRP alpha.50AVL3 23gagctcgtga tgacccagtc cccttccagc ctgtctgcct ccgtgggcga cagagtgacc 60atcacatgca aggcctctca gggcgtgggc accgctgtgg gatggtatca gcagaagcct 120ggcaaggccc ccaagctgct gatctactgg gcctctacca gacacaccgg cgtgcccgac 180agattctccg gctctggctc tggcaccgac tttaccctgg ccatctccag cctgcagccc 240gaggatatcg ccgactacta ctgccagcag tactccacct accccttcac cttcggcgga 300ggcaccaagg tggaaatcaa g 32124107PRTArtificial SequenceSynthetic hSIRP alpha.50AVL3 24Glu Leu Val Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Lys Ala Ser Gln Gly Val Gly Thr Ala 20 25 30Val Gly Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45Tyr Trp Ala Ser Thr Arg His Thr Gly Val Pro Asp Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Ala Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Ile Ala Asp Tyr Tyr Cys Gln Gln Tyr Ser Thr Tyr Pro Phe 85 90 95Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys 100 10525321DNAArtificial SequenceSynthetic hSIRP alpha.50AVL4 25gacatccaga tgacccagtc cccctccagc ctgtctgcct ctgtgggcga cagagtgacc 60atcacatgca aggcctctca gggcgtgggc accgctgtgg gctggtatca gaaaaagccc 120ggcaaggtgc ccaagctgct gatctactgg gcctccacca gacacaccgg cgtgcccgat 180agattctccg gctctggctc tggcaccgac ttcaccctga ccatcaacgg cctgcagcct 240gaggacgtgg ccacctacta ctgccagcag tactccacct accccttcac cttcggcgga 300ggcaccaagc tggaaatcaa g 32126107PRTArtificial SequenceSynthetic hSIRP alpha.50AVL4 26Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Lys Ala Ser Gln Gly Val Gly Thr Ala 20 25 30Val Gly Trp Tyr Gln Lys Lys Pro Gly Lys Val Pro Lys Leu Leu Ile 35 40 45Tyr Trp Ala Ser Thr Arg His Thr Gly Val Pro Asp Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Asn Gly Leu Gln Pro65 70 75 80Glu Asp Val Ala Thr Tyr Tyr Cys Gln Gln Tyr Ser Thr Tyr Pro Phe 85 90 95Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys 100 10527321DNAArtificial SequenceSynthetic hSIRP alpha.50AVL5 27gacatcgtgc tgacccagtc ccccagcttc ctgtctgcct ctgtgggcga cagagtgacc 60atcacatgca aggcctctca gggcgtgggc accgctgtgg gatggtatca gcagaagccc 120ggcaagtccc ccaagctgct gatctactgg gcctccacca gacacaccgg cgtgcccgat 180agattctccg gctctggctc tggcaccgag ttcaccctga ccatctccaa cctgcagccc 240gaggacttcg ccgcctacta ctgccagcag tactccacct accccttcac cttcggcgga 300ggcaccaagc tggaaatcaa g 32128107PRTArtificial SequenceSynthetic hSIRP alpha.50AVL5 28Asp Ile Val Leu Thr Gln Ser Pro Ser Phe Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Lys Ala Ser Gln Gly Val Gly Thr Ala 20 25 30Val Gly Trp Tyr Gln Gln Lys Pro Gly Lys Ser Pro Lys Leu Leu Ile 35 40 45Tyr Trp Ala Ser Thr Arg His Thr Gly Val Pro Asp Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Asn Leu Gln Pro65 70 75 80Glu Asp Phe Ala Ala Tyr Tyr Cys Gln Gln Tyr Ser Thr Tyr Pro Phe 85 90 95Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys 100 10529357DNAArtificial SequenceSynthetic hSIRP alpha.50A mouse VH 29caggtccagc tgcagcagtc tggacctgaa ctggtgaagc ctggggcttc agttaggata 60tcctgcaagg cttctggctt caccttcaca aactactata tacactgggt gaagcagagg 120cctggacagg gacttgagtg gattggatgg atttatcctg gaaatgttaa tactaagtac 180aatgagaagt tcaaggccaa ggccacactg actgcagaca aatcctccac cacagcctac 240atgcagctca gcagcctggc ctctgaggac tctgcggtct atttctgtgc aagacctacg 300ataatagcta cggacttcga tgtctggggc gcagggacca cggtcaccgt ctcctca 35730119PRTArtificial

SequenceSynthetic hSIRP alpha.50A mouse VH 30Gln Val Gln Leu Gln Gln Ser Gly Pro Glu Leu Val Lys Pro Gly Ala1 5 10 15Ser Val Arg Ile Ser Cys Lys Ala Ser Gly Phe Thr Phe Thr Asn Tyr 20 25 30Tyr Ile His Trp Val Lys Gln Arg Pro Gly Gln Gly Leu Glu Trp Ile 35 40 45Gly Trp Ile Tyr Pro Gly Asn Val Asn Thr Lys Tyr Asn Glu Lys Phe 50 55 60Lys Ala Lys Ala Thr Leu Thr Ala Asp Lys Ser Ser Thr Thr Ala Tyr65 70 75 80Met Gln Leu Ser Ser Leu Ala Ser Glu Asp Ser Ala Val Tyr Phe Cys 85 90 95Ala Arg Pro Thr Ile Ile Ala Thr Asp Phe Asp Val Trp Gly Ala Gly 100 105 110Thr Thr Val Thr Val Ser Ser 11531321DNAArtificial SequenceSynthetic hSIRP alpha.50A mouse VL 31gacattgtca tgacccagtc tcacaaattc atgtccacat cagtaggaga cagggtcaac 60atcacctgca aggccagtca gggtgtgggt actgctgtag gctggtatca acagaaacca 120gggcaatctc ctagactact gatttactgg gcatccaccc ggcacactgg agtccctgat 180cgcttcacag gcagtggatc tgggacagat ttcagtctcg ccattagcaa tgtgcagtct 240gaagacctgg cagattattt ctgtcagcaa tatagcacct atccgttcac gttcggaggg 300gggaccaatc tagaaataaa a 32132107PRTArtificial SequenceSynthetic hSIRP alpha.50A mouse VL 32Asp Ile Val Met Thr Gln Ser His Lys Phe Met Ser Thr Ser Val Gly1 5 10 15Asp Arg Val Asn Ile Thr Cys Lys Ala Ser Gln Gly Val Gly Thr Ala 20 25 30Val Gly Trp Tyr Gln Gln Lys Pro Gly Gln Ser Pro Arg Leu Leu Ile 35 40 45Tyr Trp Ala Ser Thr Arg His Thr Gly Val Pro Asp Arg Phe Thr Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Ser Leu Ala Ile Ser Asn Val Gln Ser65 70 75 80Glu Asp Leu Ala Asp Tyr Phe Cys Gln Gln Tyr Ser Thr Tyr Pro Phe 85 90 95Thr Phe Gly Gly Gly Thr Asn Leu Glu Ile Lys 100 105331512DNAHomo sapiensmisc_feature(1)..(1512)human SIRP alpha V1 33atggagcccg ccggcccggc ccccggccgc ctcgggccgc tgctctgcct gctgctcgcc 60gcgtcctgcg cctggtcagg agtggcgggt gaggaggagc tgcaggtgat tcagcctgac 120aagtccgtgt tggttgcagc tggagagaca gccactctgc gctgcactgc gacctctctg 180atccctgtgg ggcccatcca gtggttcaga ggagctggac caggccggga attaatctac 240aatcaaaaag aaggccactt cccccgggta acaactgttt cagacctcac aaagagaaac 300aacatggact tttccatccg catcggtaac atcaccccag cagatgccgg cacctactac 360tgtgtgaagt tccggaaagg gagccccgat gacgtggagt ttaagtctgg agcaggcact 420gagctgtctg tgcgcgccaa accctctgcc cccgtggtat cgggccctgc ggcgagggcc 480acacctcagc acacagtgag cttcacctgc gagtcccacg gcttctcacc cagagacatc 540accctgaaat ggttcaaaaa tgggaatgag ctctcagact tccagaccaa cgtggacccc 600gtaggagaga gcgtgtccta cagcatccac agcacagcca aggtggtgct gacccgcgag 660gacgttcact ctcaagtcat ctgcgaggtg gcccacgtca ccttgcaggg ggaccctctt 720cgtgggactg ccaacttgtc tgagaccatc cgagttccac ccaccttgga ggttactcaa 780cagcccgtga gggcagagaa ccaggtgaat gtcacctgcc aggtgaggaa gttctacccc 840cagagactac agctgacctg gttggagaat ggaaacgtgt cccggacaga aacggcctca 900accgttacag agaacaagga tggtacctac aactggatga gctggctcct ggtgaatgta 960tctgcccaca gggatgatgt gaagctcacc tgccaggtgg agcatgacgg gcagccagcg 1020gtcagcaaaa gccatgacct gaaggtctca gcccacccga aggagcaggg ctcaaatacc 1080gccgctgaga acactggatc taatgaacgg aacatctata ttgtggtggg tgtggtgtgc 1140accttgctgg tggccctact gatggcggcc ctctacctcg tccgaatcag acagaagaaa 1200gcccagggct ccacttcttc tacaaggttg catgagcccg agaagaatgc cagagaaata 1260acacaggaca caaatgatat cacatatgca gacctgaacc tgcccaaggg gaagaagcct 1320gctccccagg ctgcggagcc caacaaccac acggagtatg ccagcattca gaccagcccg 1380cagcccgcgt cggaggacac cctcacctat gctgacctgg acatggtcca cctcaaccgg 1440acccccaagc agccggcccc caagcctgag ccgtccttct cagagtacgc cagcgtccag 1500gtcccgagga ag 151234504PRTHomo sapiensmisc_feature(1)..(504)human SIRP alpha V1 34Met Glu Pro Ala Gly Pro Ala Pro Gly Arg Leu Gly Pro Leu Leu Cys1 5 10 15Leu Leu Leu Ala Ala Ser Cys Ala Trp Ser Gly Val Ala Gly Glu Glu 20 25 30Glu Leu Gln Val Ile Gln Pro Asp Lys Ser Val Leu Val Ala Ala Gly 35 40 45Glu Thr Ala Thr Leu Arg Cys Thr Ala Thr Ser Leu Ile Pro Val Gly 50 55 60Pro Ile Gln Trp Phe Arg Gly Ala Gly Pro Gly Arg Glu Leu Ile Tyr65 70 75 80Asn Gln Lys Glu Gly His Phe Pro Arg Val Thr Thr Val Ser Asp Leu 85 90 95Thr Lys Arg Asn Asn Met Asp Phe Ser Ile Arg Ile Gly Asn Ile Thr 100 105 110Pro Ala Asp Ala Gly Thr Tyr Tyr Cys Val Lys Phe Arg Lys Gly Ser 115 120 125Pro Asp Asp Val Glu Phe Lys Ser Gly Ala Gly Thr Glu Leu Ser Val 130 135 140Arg Ala Lys Pro Ser Ala Pro Val Val Ser Gly Pro Ala Ala Arg Ala145 150 155 160Thr Pro Gln His Thr Val Ser Phe Thr Cys Glu Ser His Gly Phe Ser 165 170 175Pro Arg Asp Ile Thr Leu Lys Trp Phe Lys Asn Gly Asn Glu Leu Ser 180 185 190Asp Phe Gln Thr Asn Val Asp Pro Val Gly Glu Ser Val Ser Tyr Ser 195 200 205Ile His Ser Thr Ala Lys Val Val Leu Thr Arg Glu Asp Val His Ser 210 215 220Gln Val Ile Cys Glu Val Ala His Val Thr Leu Gln Gly Asp Pro Leu225 230 235 240Arg Gly Thr Ala Asn Leu Ser Glu Thr Ile Arg Val Pro Pro Thr Leu 245 250 255Glu Val Thr Gln Gln Pro Val Arg Ala Glu Asn Gln Val Asn Val Thr 260 265 270Cys Gln Val Arg Lys Phe Tyr Pro Gln Arg Leu Gln Leu Thr Trp Leu 275 280 285Glu Asn Gly Asn Val Ser Arg Thr Glu Thr Ala Ser Thr Val Thr Glu 290 295 300Asn Lys Asp Gly Thr Tyr Asn Trp Met Ser Trp Leu Leu Val Asn Val305 310 315 320Ser Ala His Arg Asp Asp Val Lys Leu Thr Cys Gln Val Glu His Asp 325 330 335Gly Gln Pro Ala Val Ser Lys Ser His Asp Leu Lys Val Ser Ala His 340 345 350Pro Lys Glu Gln Gly Ser Asn Thr Ala Ala Glu Asn Thr Gly Ser Asn 355 360 365Glu Arg Asn Ile Tyr Ile Val Val Gly Val Val Cys Thr Leu Leu Val 370 375 380Ala Leu Leu Met Ala Ala Leu Tyr Leu Val Arg Ile Arg Gln Lys Lys385 390 395 400Ala Gln Gly Ser Thr Ser Ser Thr Arg Leu His Glu Pro Glu Lys Asn 405 410 415Ala Arg Glu Ile Thr Gln Asp Thr Asn Asp Ile Thr Tyr Ala Asp Leu 420 425 430Asn Leu Pro Lys Gly Lys Lys Pro Ala Pro Gln Ala Ala Glu Pro Asn 435 440 445Asn His Thr Glu Tyr Ala Ser Ile Gln Thr Ser Pro Gln Pro Ala Ser 450 455 460Glu Asp Thr Leu Thr Tyr Ala Asp Leu Asp Met Val His Leu Asn Arg465 470 475 480Thr Pro Lys Gln Pro Ala Pro Lys Pro Glu Pro Ser Phe Ser Glu Tyr 485 490 495Ala Ser Val Gln Val Pro Arg Lys 500351509DNAHomo sapiensmisc_feature(1)..(1509)human SIRP alpha V2 35atggaacctg ccggacctgc ccctggcaga ctgggacctc tgctgtgtct gctgctggcc 60gcctcttgtg cttggagcgg agtggctggc gaagaggaac tgcaagtgat ccagcccgac 120aagagcgtgt ccgtggctgc tggcgagtct gccatcctgc actgtaccgt gaccagcctg 180atccccgtgg gccccatcca gtggtttaga ggcgctggcc ctgccagaga gctgatctac 240aaccagaaag agggccactt ccccagagtg accaccgtgt ccgagagcac caagcgcgag 300aacatggact tcagcatcag catctccaac atcacccctg ccgacgccgg cacctactac 360tgcgtgaagt tcagaaaggg cagccccgac accgagttca agagcggcgc tggaaccgag 420ctgtctgtgc gggctaagcc ttctgcccct gtggtgtctg gacctgccgc cagagctaca 480cctcagcaca ccgtgtcttt cacatgcgag agccacggct tcagccccag agacatcacc 540ctgaagtggt tcaagaacgg caacgagctg agcgacttcc agaccaacgt ggaccctgtg 600ggcgagtccg tgtcctacag catccacagc accgccaagg tggtgctgac ccgcgaggat 660gtgcacagcc aagtgatctg cgaggtggcc cacgtgacac tgcagggcga tcctctgaga 720ggcaccgcta acctgagcga gacaatcaga gtgcccccca ccctggaagt gacccagcag 780cccgtgcggg ctgagaacca agtgaacgtg acctgccaag tgcggaagtt ctaccctcag 840agactgcagc tgacctggct ggaaaacgga aacgtgtcca gaaccgagac agccagcacc 900gtgacagaga acaaggacgg cacatacaac tggatgagct ggctgctcgt gaacgtgtcc 960gcccacagag atgacgtgaa gctgacatgc caggtggaac acgacggcca gcctgccgtg 1020tctaagagcc acgacctgaa ggtgtccgct caccccaaag agcagggcag caacaccgcc 1080gctgagaaca caggcagcaa cgagagaaac atctacatcg tcgtgggcgt cgtgtgcacc 1140ctgctggtgg ctctgctgat ggctgccctg tacctcgtgc ggatcagaca gaagaaggcc 1200cagggctcca cctccagcac cagactgcac gagcctgaga agaacgcccg cgagatcacc 1260caggacacca acgacatcac ctacgccgac ctgaacctgc ccaagggcaa gaagcctgcc 1320cctcaggctg ccgagcctaa caaccacaca gagtacgcca gcatccagac cagccctcag 1380cctgccagcg aggacacact gacatacgcc gatctggaca tggtgcacct gaacagaacc 1440cccaagcagc ccgctcccaa gcccgagcct agcttctctg agtacgcctc cgtgcaggtg 1500cccagaaaa 150936503PRTHomo sapiensmisc_feature(1)..(503)human SIRP alpha V2 36Met Glu Pro Ala Gly Pro Ala Pro Gly Arg Leu Gly Pro Leu Leu Cys1 5 10 15Leu Leu Leu Ala Ala Ser Cys Ala Trp Ser Gly Val Ala Gly Glu Glu 20 25 30Glu Leu Gln Val Ile Gln Pro Asp Lys Ser Val Ser Val Ala Ala Gly 35 40 45Glu Ser Ala Ile Leu His Cys Thr Val Thr Ser Leu Ile Pro Val Gly 50 55 60Pro Ile Gln Trp Phe Arg Gly Ala Gly Pro Ala Arg Glu Leu Ile Tyr65 70 75 80Asn Gln Lys Glu Gly His Phe Pro Arg Val Thr Thr Val Ser Glu Ser 85 90 95Thr Lys Arg Glu Asn Met Asp Phe Ser Ile Ser Ile Ser Asn Ile Thr 100 105 110Pro Ala Asp Ala Gly Thr Tyr Tyr Cys Val Lys Phe Arg Lys Gly Ser 115 120 125Pro Asp Thr Glu Phe Lys Ser Gly Ala Gly Thr Glu Leu Ser Val Arg 130 135 140Ala Lys Pro Ser Ala Pro Val Val Ser Gly Pro Ala Ala Arg Ala Thr145 150 155 160Pro Gln His Thr Val Ser Phe Thr Cys Glu Ser His Gly Phe Ser Pro 165 170 175Arg Asp Ile Thr Leu Lys Trp Phe Lys Asn Gly Asn Glu Leu Ser Asp 180 185 190Phe Gln Thr Asn Val Asp Pro Val Gly Glu Ser Val Ser Tyr Ser Ile 195 200 205His Ser Thr Ala Lys Val Val Leu Thr Arg Glu Asp Val His Ser Gln 210 215 220Val Ile Cys Glu Val Ala His Val Thr Leu Gln Gly Asp Pro Leu Arg225 230 235 240Gly Thr Ala Asn Leu Ser Glu Thr Ile Arg Val Pro Pro Thr Leu Glu 245 250 255Val Thr Gln Gln Pro Val Arg Ala Glu Asn Gln Val Asn Val Thr Cys 260 265 270Gln Val Arg Lys Phe Tyr Pro Gln Arg Leu Gln Leu Thr Trp Leu Glu 275 280 285Asn Gly Asn Val Ser Arg Thr Glu Thr Ala Ser Thr Val Thr Glu Asn 290 295 300Lys Asp Gly Thr Tyr Asn Trp Met Ser Trp Leu Leu Val Asn Val Ser305 310 315 320Ala His Arg Asp Asp Val Lys Leu Thr Cys Gln Val Glu His Asp Gly 325 330 335Gln Pro Ala Val Ser Lys Ser His Asp Leu Lys Val Ser Ala His Pro 340 345 350Lys Glu Gln Gly Ser Asn Thr Ala Ala Glu Asn Thr Gly Ser Asn Glu 355 360 365Arg Asn Ile Tyr Ile Val Val Gly Val Val Cys Thr Leu Leu Val Ala 370 375 380Leu Leu Met Ala Ala Leu Tyr Leu Val Arg Ile Arg Gln Lys Lys Ala385 390 395 400Gln Gly Ser Thr Ser Ser Thr Arg Leu His Glu Pro Glu Lys Asn Ala 405 410 415Arg Glu Ile Thr Gln Asp Thr Asn Asp Ile Thr Tyr Ala Asp Leu Asn 420 425 430Leu Pro Lys Gly Lys Lys Pro Ala Pro Gln Ala Ala Glu Pro Asn Asn 435 440 445His Thr Glu Tyr Ala Ser Ile Gln Thr Ser Pro Gln Pro Ala Ser Glu 450 455 460Asp Thr Leu Thr Tyr Ala Asp Leu Asp Met Val His Leu Asn Arg Thr465 470 475 480Pro Lys Gln Pro Ala Pro Lys Pro Glu Pro Ser Phe Ser Glu Tyr Ala 485 490 495Ser Val Gln Val Pro Arg Lys 500371194DNAHomo sapiensmisc_feature(1)..(1194)human SIRP beta 1 37atgcccgtgc cagcctcctg gccccacctt cctagtcctt tcctgctgat gacgctactg 60ctggggagac tcacaggagt ggcaggtgag gacgagctac aggtgattca gcctgaaaag 120tccgtatcag ttgcagctgg agagtcggcc actctgcgct gtgctatgac gtccctgatc 180cctgtggggc ccatcatgtg gtttagagga gctggagcag gccgggaatt aatctacaat 240cagaaagaag gccacttccc acgggtaaca actgtttcag aactcacaaa gagaaacaac 300ctggactttt ccatcagcat cagtaacatc accccagcag acgccggcac ctactactgt 360gtgaagttcc ggaaagggag ccctgacgac gtggagttta agtctggagc aggcactgag 420ctgtctgtgc gcgccaaacc ctctgccccc gtggtatcgg gccctgcggt gagggccaca 480cctgagcaca cagtgagctt cacctgcgag tcccatggct tctctcccag agacatcacc 540ctgaaatggt tcaaaaatgg gaatgagctc tcagacttcc agaccaacgt ggaccccgca 600ggagacagtg tgtcctacag catccacagc acagccaggg tggtgctgac ccgtggggac 660gttcactctc aagtcatctg cgagatagcc cacatcacct tgcaggggga ccctcttcgt 720gggactgcca acttgtctga ggccatccga gttccaccca ccttggaggt tactcaacag 780cccatgaggg cagagaacca ggcaaacgtc acctgccagg tgagcaattt ctacccccgg 840ggactacagc tgacctggtt ggagaatgga aatgtgtccc ggacagaaac agcttcgacc 900ctcatagaga acaaggatgg cacctacaac tggatgagct ggctcctggt gaacacctgt 960gcccacaggg acgatgtggt gctcacctgt caggtggagc atgatgggca gcaagcagtc 1020agcaaaagct atgccctgga gatctcagcg caccagaagg agcacggctc agatatcacc 1080catgaagcag cgctggctcc tactgctcca ctcctcgtag ctctcctcct gggccccaag 1140ctgctactgg tggttggtgt ctctgccatc tacatctgct ggaaacagaa ggcc 119438398PRTHomo sapiensmisc_feature(1)..(398)human SIRP beta 1 38Met Pro Val Pro Ala Ser Trp Pro His Leu Pro Ser Pro Phe Leu Leu1 5 10 15Met Thr Leu Leu Leu Gly Arg Leu Thr Gly Val Ala Gly Glu Asp Glu 20 25 30Leu Gln Val Ile Gln Pro Glu Lys Ser Val Ser Val Ala Ala Gly Glu 35 40 45Ser Ala Thr Leu Arg Cys Ala Met Thr Ser Leu Ile Pro Val Gly Pro 50 55 60Ile Met Trp Phe Arg Gly Ala Gly Ala Gly Arg Glu Leu Ile Tyr Asn65 70 75 80Gln Lys Glu Gly His Phe Pro Arg Val Thr Thr Val Ser Glu Leu Thr 85 90 95Lys Arg Asn Asn Leu Asp Phe Ser Ile Ser Ile Ser Asn Ile Thr Pro 100 105 110Ala Asp Ala Gly Thr Tyr Tyr Cys Val Lys Phe Arg Lys Gly Ser Pro 115 120 125Asp Asp Val Glu Phe Lys Ser Gly Ala Gly Thr Glu Leu Ser Val Arg 130 135 140Ala Lys Pro Ser Ala Pro Val Val Ser Gly Pro Ala Val Arg Ala Thr145 150 155 160Pro Glu His Thr Val Ser Phe Thr Cys Glu Ser His Gly Phe Ser Pro 165 170 175Arg Asp Ile Thr Leu Lys Trp Phe Lys Asn Gly Asn Glu Leu Ser Asp 180 185 190Phe Gln Thr Asn Val Asp Pro Ala Gly Asp Ser Val Ser Tyr Ser Ile 195 200 205His Ser Thr Ala Arg Val Val Leu Thr Arg Gly Asp Val His Ser Gln 210 215 220Val Ile Cys Glu Ile Ala His Ile Thr Leu Gln Gly Asp Pro Leu Arg225 230 235 240Gly Thr Ala Asn Leu Ser Glu Ala Ile Arg Val Pro Pro Thr Leu Glu 245 250 255Val Thr Gln Gln Pro Met Arg Ala Glu Asn Gln Ala Asn Val Thr Cys 260 265 270Gln Val Ser Asn Phe Tyr Pro Arg Gly Leu Gln Leu Thr Trp Leu Glu 275 280 285Asn Gly Asn Val Ser Arg Thr Glu Thr Ala Ser Thr Leu Ile Glu Asn 290 295 300Lys Asp Gly Thr Tyr Asn Trp Met Ser Trp Leu Leu Val Asn Thr Cys305 310 315 320Ala His Arg Asp Asp Val Val Leu Thr Cys Gln Val Glu His Asp Gly 325 330 335Gln Gln Ala Val Ser Lys Ser Tyr Ala Leu Glu Ile Ser Ala His Gln 340 345 350Lys Glu His Gly Ser Asp Ile Thr His Glu Ala Ala Leu Ala Pro Thr 355 360 365Ala Pro Leu Leu Val Ala Leu Leu Leu Gly Pro Lys Leu Leu Leu Val 370 375 380Val Gly Val Ser Ala Ile Tyr Ile Cys Trp Lys Gln Lys Ala385 390

395391161DNAHomo sapiensmisc_feature(1)..(1161)human SIRP? 39atgcctgtcc cagcctcctg gccccatcct cctggtcctt tcctgcttct gactctactg 60ctgggactta cagaagtggc aggtgaggag gagctacaga tgattcagcc tgagaagctc 120ctgttggtca cagttggaaa gacagccact ctgcactgca ctgtgacctc cctgcttccc 180gtgggacccg tcctgtggtt cagaggagtt ggaccaggcc gggaattaat ctacaatcaa 240aaagaaggcc acttccccag ggtaacaaca gtttcagacc tcacaaagag aaacaacatg 300gacttttcca tccgcatcag tagcatcacc ccagcagatg tcggcacata ctactgtgtg 360aagtttcgaa aagggagccc tgagaacgtg gagtttaagt ctggaccagg cactgagatg 420gctttgggtg ccaaaccctc tgcccccgtg gtattgggcc ctgcggcgag gaccacacct 480gagcatacag tgagtttcac ctgtgagtcc catggcttct ctcccagaga catcaccctg 540aaatggttca aaaatgggaa tgagctctca gacttccaga ccaacgtgga ccccacagga 600cagagtgtgg cctacagcat ccgcagcaca gccagggtgg tactggaccc ctgggacgtt 660cgctctcagg tcatctgcga ggtggcccat gtcaccttgc agggggaccc tcttcgtggg 720actgccaact tgtctgaggc catccgagtt ccacccacct tggaggttac tcaacagccc 780atgagggtgg ggaaccaggt aaacgtcacc tgccaggtga ggaagttcta cccccagagc 840ctacagctga cctggtcgga gaatggaaac gtgtgccaga gagaaacagc ctcgaccctt 900acagagaaca aggatggtac ctacaactgg acaagctggt tcctggtgaa catatctgac 960caaagggatg atgtggtcct cacctgccag gtgaagcatg atgggcagct ggcggtcagc 1020aaacgccttg ccctagaggt cacagtccac cagaaggacc agagctcaga tgctacccct 1080ggcccggcat catcccttac tgcgctgctc ctcatagctg tcctcctggg ccccatctac 1140gtcccctgga agcagaagac c 116140387PRTHomo sapiensmisc_feature(1)..(387)human SIRP? 40Met Pro Val Pro Ala Ser Trp Pro His Pro Pro Gly Pro Phe Leu Leu1 5 10 15Leu Thr Leu Leu Leu Gly Leu Thr Glu Val Ala Gly Glu Glu Glu Leu 20 25 30Gln Met Ile Gln Pro Glu Lys Leu Leu Leu Val Thr Val Gly Lys Thr 35 40 45Ala Thr Leu His Cys Thr Val Thr Ser Leu Leu Pro Val Gly Pro Val 50 55 60Leu Trp Phe Arg Gly Val Gly Pro Gly Arg Glu Leu Ile Tyr Asn Gln65 70 75 80Lys Glu Gly His Phe Pro Arg Val Thr Thr Val Ser Asp Leu Thr Lys 85 90 95Arg Asn Asn Met Asp Phe Ser Ile Arg Ile Ser Ser Ile Thr Pro Ala 100 105 110Asp Val Gly Thr Tyr Tyr Cys Val Lys Phe Arg Lys Gly Ser Pro Glu 115 120 125Asn Val Glu Phe Lys Ser Gly Pro Gly Thr Glu Met Ala Leu Gly Ala 130 135 140Lys Pro Ser Ala Pro Val Val Leu Gly Pro Ala Ala Arg Thr Thr Pro145 150 155 160Glu His Thr Val Ser Phe Thr Cys Glu Ser His Gly Phe Ser Pro Arg 165 170 175Asp Ile Thr Leu Lys Trp Phe Lys Asn Gly Asn Glu Leu Ser Asp Phe 180 185 190Gln Thr Asn Val Asp Pro Thr Gly Gln Ser Val Ala Tyr Ser Ile Arg 195 200 205Ser Thr Ala Arg Val Val Leu Asp Pro Trp Asp Val Arg Ser Gln Val 210 215 220Ile Cys Glu Val Ala His Val Thr Leu Gln Gly Asp Pro Leu Arg Gly225 230 235 240Thr Ala Asn Leu Ser Glu Ala Ile Arg Val Pro Pro Thr Leu Glu Val 245 250 255Thr Gln Gln Pro Met Arg Val Gly Asn Gln Val Asn Val Thr Cys Gln 260 265 270Val Arg Lys Phe Tyr Pro Gln Ser Leu Gln Leu Thr Trp Ser Glu Asn 275 280 285Gly Asn Val Cys Gln Arg Glu Thr Ala Ser Thr Leu Thr Glu Asn Lys 290 295 300Asp Gly Thr Tyr Asn Trp Thr Ser Trp Phe Leu Val Asn Ile Ser Asp305 310 315 320Gln Arg Asp Asp Val Val Leu Thr Cys Gln Val Lys His Asp Gly Gln 325 330 335Leu Ala Val Ser Lys Arg Leu Ala Leu Glu Val Thr Val His Gln Lys 340 345 350Asp Gln Ser Ser Asp Ala Thr Pro Gly Pro Ala Ser Ser Leu Thr Ala 355 360 365Leu Leu Leu Ile Ala Val Leu Leu Gly Pro Ile Tyr Val Pro Trp Lys 370 375 380Gln Lys Thr38541969DNAHomo sapiensmisc_feature(1)..(969)human CD47 41atgtggcctc tggtggccgc tctgctgctg ggctctgctt gttgtggatc cgcccagctg 60ctgttcaaca agaccaagtc cgtggagttc accttctgca acgataccgt cgtgatcccc 120tgcttcgtga ccaacatgga agcccagaac accaccgagg tgtacgtgaa gtggaagttc 180aagggccggg acatctacac cttcgacggc gccctgaaca agtccaccgt gcccaccgat 240ttctccagcg ccaagatcga ggtgtcacag ctgctgaagg gcgacgcctc cctgaagatg 300gacaagtccg acgccgtgtc ccacaccggc aactacacct gtgaagtgac cgagctgacc 360agagagggcg agacaatcat cgagctgaag taccgggtgg tgtcctggtt cagccccaac 420gagaacatcc tgatcgtgat cttccccatc ttcgccatcc tgctgttctg gggccagttc 480ggcatcaaga ccctgaagta cagatccggc ggcatggacg aaaagacaat cgccctgctg 540gtggctggcc tcgtgatcac cgtgattgtg atcgtgggcg ctatcctgtt cgtgcccggc 600gagtacagcc tgaagaatgc taccggcctg ggcctgattg tgacctccac cggaatcctg 660atcctgctgc actactacgt gttctccacc gctatcggcc tgacctcctt cgtgatcgcc 720attctcgtga tccaagtgat cgcctacatc ctggccgtcg tgggcctgtc cctgtgtatc 780gccgcctgca tccctatgca cggccccctg ctgatctccg gcctgtctat tctggccctg 840gctcagctgc tgggactggt gtacatgaag ttcgtggcct ccaaccagaa aaccatccag 900ccccctcgga aggccgtgga agaacccctg aacgccttca aagaatccaa gggcatgatg 960aacgacgaa 96942323PRTHomo sapiensmisc_feature(1)..(323)human CD47 42Met Trp Pro Leu Val Ala Ala Leu Leu Leu Gly Ser Ala Cys Cys Gly1 5 10 15Ser Ala Gln Leu Leu Phe Asn Lys Thr Lys Ser Val Glu Phe Thr Phe 20 25 30Cys Asn Asp Thr Val Val Ile Pro Cys Phe Val Thr Asn Met Glu Ala 35 40 45Gln Asn Thr Thr Glu Val Tyr Val Lys Trp Lys Phe Lys Gly Arg Asp 50 55 60Ile Tyr Thr Phe Asp Gly Ala Leu Asn Lys Ser Thr Val Pro Thr Asp65 70 75 80Phe Ser Ser Ala Lys Ile Glu Val Ser Gln Leu Leu Lys Gly Asp Ala 85 90 95Ser Leu Lys Met Asp Lys Ser Asp Ala Val Ser His Thr Gly Asn Tyr 100 105 110Thr Cys Glu Val Thr Glu Leu Thr Arg Glu Gly Glu Thr Ile Ile Glu 115 120 125Leu Lys Tyr Arg Val Val Ser Trp Phe Ser Pro Asn Glu Asn Ile Leu 130 135 140Ile Val Ile Phe Pro Ile Phe Ala Ile Leu Leu Phe Trp Gly Gln Phe145 150 155 160Gly Ile Lys Thr Leu Lys Tyr Arg Ser Gly Gly Met Asp Glu Lys Thr 165 170 175Ile Ala Leu Leu Val Ala Gly Leu Val Ile Thr Val Ile Val Ile Val 180 185 190Gly Ala Ile Leu Phe Val Pro Gly Glu Tyr Ser Leu Lys Asn Ala Thr 195 200 205Gly Leu Gly Leu Ile Val Thr Ser Thr Gly Ile Leu Ile Leu Leu His 210 215 220Tyr Tyr Val Phe Ser Thr Ala Ile Gly Leu Thr Ser Phe Val Ile Ala225 230 235 240Ile Leu Val Ile Gln Val Ile Ala Tyr Ile Leu Ala Val Val Gly Leu 245 250 255Ser Leu Cys Ile Ala Ala Cys Ile Pro Met His Gly Pro Leu Leu Ile 260 265 270Ser Gly Leu Ser Ile Leu Ala Leu Ala Gln Leu Leu Gly Leu Val Tyr 275 280 285Met Lys Phe Val Ala Ser Asn Gln Lys Thr Ile Gln Pro Pro Arg Lys 290 295 300Ala Val Glu Glu Pro Leu Asn Ala Phe Lys Glu Ser Lys Gly Met Met305 310 315 320Asn Asp Glu431509DNAHomo sapiensmisc_feature(1)..(1509)human SIRP alpha V3 43atggaacctg ccggccctgc tcctggtaga ctgggacctc tgctgtgtct gctgctggcc 60gcctcttgtg cttggagcgg agtggctggc gaagaggaac tgcaagtgat ccagcccgac 120aagtccgtgt ctgtggccgc tggcgagtct gccatcctgc tgtgtaccgt gacctccctg 180atccccgtgg gccccatcca gtggtttaga ggcgctggcc ctgccagaga gctgatctac 240aaccagaaag agggccactt ccccagagtg accaccgtgt ccgagtccac caagcgcgag 300aacatggact tctccatctc catcagcaac atcacccctg ccgacgccgg cacctactac 360tgcgtgaagt tccggaaggg ctcccccgac accgagttca agtctggcgc tggcaccgag 420ctgtctgtgc gggctaaacc ttctgcccct gtggtgtctg gacctgccgc tagagctacc 480cctcagcaca ccgtgtcttt tacctgcgag tcccacggct tcagccctcg ggacatcacc 540ctgaagtggt tcaagaacgg caacgagctg agcgacttcc agaccaacgt ggaccctgtg 600ggcgagagcg tgtcctactc catccactcc accgccaagg tggtgctgac acgcgaggac 660gtgcactccc aagtgatctg cgaggtggcc cacgtgacac tgcagggcga tcctctgaga 720ggcaccgcca acctgtccga gacaatcaga gtgcccccca ccctggaagt gacccagcag 780ccagtgcggg ccgagaacca agtgaacgtg acctgccaag tgcggaagtt ctacccccag 840cggctgcagc tgacctggct ggaaaacggc aatgtgtccc ggaccgagac agccagcacc 900gtgaccgaga acaaggatgg cacctacaat tggatgtctt ggctgctcgt gaacgtgtcc 960gcccaccggg acgatgtgaa gctgacatgc caggtggaac acgacggcca gcctgccgtg 1020tccaagagcc acgatctgaa ggtgtccgct catcccaaag agcagggctc caacaccgcc 1080gctgagaaca ccggctctaa cgagcggaac atctacatcg tcgtgggcgt cgtgtgcacc 1140ctgctggtgg ctctgctgat ggctgccctg tacctcgtgc ggatccggca gaagaaggcc 1200cagggctcta cctcctccac cagactgcac gagcccgaga agaacgccag agagatcacc 1260caggacacca acgacatcac ctacgccgac ctgaacctgc ccaagggcaa gaagcctgcc 1320cctcaggctg ccgagcctaa caaccacacc gagtacgcct ccatccagac cagccctcag 1380cctgcctctg aggacaccct gacctacgct gatctggaca tggtgcacct gaaccggacc 1440cccaagcagc cagctcctaa gcccgagcct agcttctctg agtacgccag cgtgcaggtg 1500ccccggaaa 150944503PRTHomo sapiensmisc_feature(1)..(503)human SIRP alpha V3 44Met Glu Pro Ala Gly Pro Ala Pro Gly Arg Leu Gly Pro Leu Leu Cys1 5 10 15Leu Leu Leu Ala Ala Ser Cys Ala Trp Ser Gly Val Ala Gly Glu Glu 20 25 30Glu Leu Gln Val Ile Gln Pro Asp Lys Ser Val Ser Val Ala Ala Gly 35 40 45Glu Ser Ala Ile Leu Leu Cys Thr Val Thr Ser Leu Ile Pro Val Gly 50 55 60Pro Ile Gln Trp Phe Arg Gly Ala Gly Pro Ala Arg Glu Leu Ile Tyr65 70 75 80Asn Gln Lys Glu Gly His Phe Pro Arg Val Thr Thr Val Ser Glu Ser 85 90 95Thr Lys Arg Glu Asn Met Asp Phe Ser Ile Ser Ile Ser Asn Ile Thr 100 105 110Pro Ala Asp Ala Gly Thr Tyr Tyr Cys Val Lys Phe Arg Lys Gly Ser 115 120 125Pro Asp Thr Glu Phe Lys Ser Gly Ala Gly Thr Glu Leu Ser Val Arg 130 135 140Ala Lys Pro Ser Ala Pro Val Val Ser Gly Pro Ala Ala Arg Ala Thr145 150 155 160Pro Gln His Thr Val Ser Phe Thr Cys Glu Ser His Gly Phe Ser Pro 165 170 175Arg Asp Ile Thr Leu Lys Trp Phe Lys Asn Gly Asn Glu Leu Ser Asp 180 185 190Phe Gln Thr Asn Val Asp Pro Val Gly Glu Ser Val Ser Tyr Ser Ile 195 200 205His Ser Thr Ala Lys Val Val Leu Thr Arg Glu Asp Val His Ser Gln 210 215 220Val Ile Cys Glu Val Ala His Val Thr Leu Gln Gly Asp Pro Leu Arg225 230 235 240Gly Thr Ala Asn Leu Ser Glu Thr Ile Arg Val Pro Pro Thr Leu Glu 245 250 255Val Thr Gln Gln Pro Val Arg Ala Glu Asn Gln Val Asn Val Thr Cys 260 265 270Gln Val Arg Lys Phe Tyr Pro Gln Arg Leu Gln Leu Thr Trp Leu Glu 275 280 285Asn Gly Asn Val Ser Arg Thr Glu Thr Ala Ser Thr Val Thr Glu Asn 290 295 300Lys Asp Gly Thr Tyr Asn Trp Met Ser Trp Leu Leu Val Asn Val Ser305 310 315 320Ala His Arg Asp Asp Val Lys Leu Thr Cys Gln Val Glu His Asp Gly 325 330 335Gln Pro Ala Val Ser Lys Ser His Asp Leu Lys Val Ser Ala His Pro 340 345 350Lys Glu Gln Gly Ser Asn Thr Ala Ala Glu Asn Thr Gly Ser Asn Glu 355 360 365Arg Asn Ile Tyr Ile Val Val Gly Val Val Cys Thr Leu Leu Val Ala 370 375 380Leu Leu Met Ala Ala Leu Tyr Leu Val Arg Ile Arg Gln Lys Lys Ala385 390 395 400Gln Gly Ser Thr Ser Ser Thr Arg Leu His Glu Pro Glu Lys Asn Ala 405 410 415Arg Glu Ile Thr Gln Asp Thr Asn Asp Ile Thr Tyr Ala Asp Leu Asn 420 425 430Leu Pro Lys Gly Lys Lys Pro Ala Pro Gln Ala Ala Glu Pro Asn Asn 435 440 445His Thr Glu Tyr Ala Ser Ile Gln Thr Ser Pro Gln Pro Ala Ser Glu 450 455 460Asp Thr Leu Thr Tyr Ala Asp Leu Asp Met Val His Leu Asn Arg Thr465 470 475 480Pro Lys Gln Pro Ala Pro Lys Pro Glu Pro Ser Phe Ser Glu Tyr Ala 485 490 495Ser Val Gln Val Pro Arg Lys 500451512DNAHomo sapiensmisc_feature(1)..(1512)human SIRP alpha V4 45atggaacctg ccggccctgc tcctggtaga ctgggacctc tgctgtgtct gctgctggcc 60gcctcttgtg cttggagcgg agtggctggc gaagagggcc tgcaagtgat ccagcccgac 120aagtccgtgt ctgtggccgc tggcgagtct gccatcctgc actgtaccgc cacctccctg 180atccccgtgg gacccatcca gtggtttaga ggcgctggcc ctggcagaga gctgatctac 240aaccagaaag agggccactt ccccagagtg accaccgtgt ccgacctgac caagcggaac 300aacatggact tctccatccg gatcggcaac atcacccctg ccgatgccgg cacctactac 360tgcgtgaagt tccggaaggg ctcccccgac gacgtggagt tcaaatccgg cgctggcacc 420gagctgtctg tgcgggctaa accttctgcc cctgtggtgt ctggccctgc cgctagagct 480acccctcagc acaccgtgtc ttttacctgc gagtcccacg gcttcagccc tcgggacatc 540accctgaagt ggttcaagaa cggcaacgag ctgagcgact tccagaccaa cgtggaccct 600gtgggcgaga gcgtgtccta ctccatccac tccaccgcca aggtggtgct gacacgcgag 660gacgtgcact cccaagtgat ctgcgaggtg gcccacgtga cactgcaggg cgatcctctg 720agaggcaccg ccaacctgtc cgagacaatc agagtgcccc ccaccctgga agtgacccag 780cagccagtgc gggccgagaa ccaagtgaac gtgacctgcc aagtgcggaa gttctacccc 840cagcggctgc agctgacctg gctggaaaac ggcaatgtgt cccggaccga gacagcctcc 900accgtgaccg agaacaagga tggcacctac aattggatgt cttggctgct cgtgaacgtg 960tccgcccacc gggacgatgt gaagctgaca tgccaggtgg aacacgacgg ccagcctgcc 1020gtgtccaagt cccacgatct gaaggtgtcc gctcatccca aagagcaggg ctccaacacc 1080gccgctgaga acaccggctc taacgagcgg aacatctaca tcgtcgtggg cgtcgtgtgc 1140accctgctgg tggctctgct gatggctgcc ctgtacctcg tgcggatccg gcagaagaag 1200gcccagggct ctacctcctc caccagactg cacgagcccg agaagaacgc cagagagatc 1260acccaggaca ccaacgacat cacctacgcc gacctgaacc tgcccaaggg caagaagcct 1320gcccctcagg ctgccgagcc taacaaccac accgagtacg cctccatcca gaccagccct 1380cagcctgcct ctgaggacac cctgacctac gctgatctgg acatggtgca cctgaaccgg 1440acccccaagc agccagctcc taagcccgag cctagcttct ctgagtacgc cagcgtgcag 1500gtgccccgga aa 151246504PRTHomo sapiensmisc_feature(1)..(504)human SIRP alpha V4 46Met Glu Pro Ala Gly Pro Ala Pro Gly Arg Leu Gly Pro Leu Leu Cys1 5 10 15Leu Leu Leu Ala Ala Ser Cys Ala Trp Ser Gly Val Ala Gly Glu Glu 20 25 30Gly Leu Gln Val Ile Gln Pro Asp Lys Ser Val Ser Val Ala Ala Gly 35 40 45Glu Ser Ala Ile Leu His Cys Thr Ala Thr Ser Leu Ile Pro Val Gly 50 55 60Pro Ile Gln Trp Phe Arg Gly Ala Gly Pro Gly Arg Glu Leu Ile Tyr65 70 75 80Asn Gln Lys Glu Gly His Phe Pro Arg Val Thr Thr Val Ser Asp Leu 85 90 95Thr Lys Arg Asn Asn Met Asp Phe Ser Ile Arg Ile Gly Asn Ile Thr 100 105 110Pro Ala Asp Ala Gly Thr Tyr Tyr Cys Val Lys Phe Arg Lys Gly Ser 115 120 125Pro Asp Asp Val Glu Phe Lys Ser Gly Ala Gly Thr Glu Leu Ser Val 130 135 140Arg Ala Lys Pro Ser Ala Pro Val Val Ser Gly Pro Ala Ala Arg Ala145 150 155 160Thr Pro Gln His Thr Val Ser Phe Thr Cys Glu Ser His Gly Phe Ser 165 170 175Pro Arg Asp Ile Thr Leu Lys Trp Phe Lys Asn Gly Asn Glu Leu Ser 180 185 190Asp Phe Gln Thr Asn Val Asp Pro Val Gly Glu Ser Val Ser Tyr Ser 195 200 205Ile His Ser Thr Ala Lys Val Val Leu Thr Arg Glu Asp Val His Ser 210 215 220Gln Val Ile Cys Glu Val Ala His Val Thr Leu Gln Gly Asp Pro Leu225 230 235 240Arg Gly Thr Ala Asn Leu Ser Glu Thr Ile Arg Val Pro Pro Thr Leu 245 250 255Glu Val Thr Gln Gln Pro Val Arg Ala Glu Asn Gln Val Asn Val Thr 260 265 270Cys Gln Val Arg Lys Phe Tyr Pro Gln Arg Leu Gln Leu Thr Trp Leu 275 280 285Glu Asn Gly Asn Val Ser Arg Thr Glu Thr Ala Ser Thr Val Thr Glu 290 295 300Asn Lys Asp Gly Thr Tyr Asn Trp Met Ser Trp Leu Leu Val Asn Val305 310

315 320Ser Ala His Arg Asp Asp Val Lys Leu Thr Cys Gln Val Glu His Asp 325 330 335Gly Gln Pro Ala Val Ser Lys Ser His Asp Leu Lys Val Ser Ala His 340 345 350Pro Lys Glu Gln Gly Ser Asn Thr Ala Ala Glu Asn Thr Gly Ser Asn 355 360 365Glu Arg Asn Ile Tyr Ile Val Val Gly Val Val Cys Thr Leu Leu Val 370 375 380Ala Leu Leu Met Ala Ala Leu Tyr Leu Val Arg Ile Arg Gln Lys Lys385 390 395 400Ala Gln Gly Ser Thr Ser Ser Thr Arg Leu His Glu Pro Glu Lys Asn 405 410 415Ala Arg Glu Ile Thr Gln Asp Thr Asn Asp Ile Thr Tyr Ala Asp Leu 420 425 430Asn Leu Pro Lys Gly Lys Lys Pro Ala Pro Gln Ala Ala Glu Pro Asn 435 440 445Asn His Thr Glu Tyr Ala Ser Ile Gln Thr Ser Pro Gln Pro Ala Ser 450 455 460Glu Asp Thr Leu Thr Tyr Ala Asp Leu Asp Met Val His Leu Asn Arg465 470 475 480Thr Pro Lys Gln Pro Ala Pro Lys Pro Glu Pro Ser Phe Ser Glu Tyr 485 490 495Ala Ser Val Gln Val Pro Arg Lys 500471512DNAHomo sapiensmisc_feature(1)..(1512)human SIRP alpha V5 47atggaacctg ccggccctgc tcctggtaga ctgggacctc tgctgtgtct gctgctggcc 60gcctcttgtg cttggagcgg agtggctggc gaagaggaac tgcaagtgat ccagcccgac 120aagttcgtgc tggtggccgc tggcgagaca gccaccctga gatgtaccgc cacctccctg 180atccccgtgg gccctatcca gtggtttaga ggcgctggcc ctggcagaga gctgatctac 240aaccagaaag agggccactt ccccagagtg accaccgtgt ccgacctgac caagcggaac 300aacatggact tctccatccg gatcggcaac atcacccctg ccgatgccgg cacctactac 360tgcgtgaagt tccggaaggg ctcccccgac gacgtggagt tcaaatccgg cgctggcacc 420gagctgtctg tgcgggctaa accttctgcc cctgtggtgt ctggccctgc cgctagagct 480acccctcagc acaccgtgtc ttttacctgc gagtcccacg gcttcagccc tcgggacatc 540accctgaagt ggttcaagaa cggcaacgag ctgagcgact tccagaccaa cgtggaccct 600gtgggcgagt ccgtgtccta ctccatccac tccaccgcca aggtggtgct gacacgcgag 660gacgtgcact cccaagtgat ctgcgaggtg gcccacgtga cactgcaggg cgatcctctg 720agaggcaccg ccaacctgtc cgagacaatc agagtgcccc ccaccctgga agtgacccag 780cagccagtgc gggccgagaa ccaagtgaac gtgacctgcc aagtgcggaa gttctacccc 840cagcggctgc agctgacctg gctggaaaac ggcaatgtgt cccggaccga gactgcctcc 900accgtgaccg agaacaagga tggcacctac aattggatgt cttggctgct cgtgaacgtg 960tccgcccacc gggacgatgt gaagctgaca tgccaggtgg aacacgacgg ccagcctgcc 1020gtgtccaagt cccacgatct gaaggtgtcc gctcatccca aagagcaggg ctccaacacc 1080gccgctgaga acaccggctc taacgagcgg aacatctaca tcgtcgtggg cgtcgtgtgc 1140accctgctgg tggctctgct gatggctgcc ctgtacctcg tgcggatccg gcagaagaag 1200gcccagggct ctacctcctc caccagactg cacgagcccg agaagaacgc cagagagatc 1260acccaggaca ccaacgacat cacctacgcc gacctgaacc tgcccaaggg caagaagcct 1320gcccctcagg ctgccgagcc taacaaccac accgagtacg cctccatcca gaccagccct 1380cagcctgcct ctgaggacac cctgacctac gctgatctgg acatggtgca cctgaaccgg 1440acccccaagc agccagctcc taagcccgag cctagcttct ctgagtacgc cagcgtgcag 1500gtgccccgga aa 151248504PRTHomo sapiensmisc_feature(1)..(504)human SIRP alpha V5 48Met Glu Pro Ala Gly Pro Ala Pro Gly Arg Leu Gly Pro Leu Leu Cys1 5 10 15Leu Leu Leu Ala Ala Ser Cys Ala Trp Ser Gly Val Ala Gly Glu Glu 20 25 30Glu Leu Gln Val Ile Gln Pro Asp Lys Phe Val Leu Val Ala Ala Gly 35 40 45Glu Thr Ala Thr Leu Arg Cys Thr Ala Thr Ser Leu Ile Pro Val Gly 50 55 60Pro Ile Gln Trp Phe Arg Gly Ala Gly Pro Gly Arg Glu Leu Ile Tyr65 70 75 80Asn Gln Lys Glu Gly His Phe Pro Arg Val Thr Thr Val Ser Asp Leu 85 90 95Thr Lys Arg Asn Asn Met Asp Phe Ser Ile Arg Ile Gly Asn Ile Thr 100 105 110Pro Ala Asp Ala Gly Thr Tyr Tyr Cys Val Lys Phe Arg Lys Gly Ser 115 120 125Pro Asp Asp Val Glu Phe Lys Ser Gly Ala Gly Thr Glu Leu Ser Val 130 135 140Arg Ala Lys Pro Ser Ala Pro Val Val Ser Gly Pro Ala Ala Arg Ala145 150 155 160Thr Pro Gln His Thr Val Ser Phe Thr Cys Glu Ser His Gly Phe Ser 165 170 175Pro Arg Asp Ile Thr Leu Lys Trp Phe Lys Asn Gly Asn Glu Leu Ser 180 185 190Asp Phe Gln Thr Asn Val Asp Pro Val Gly Glu Ser Val Ser Tyr Ser 195 200 205Ile His Ser Thr Ala Lys Val Val Leu Thr Arg Glu Asp Val His Ser 210 215 220Gln Val Ile Cys Glu Val Ala His Val Thr Leu Gln Gly Asp Pro Leu225 230 235 240Arg Gly Thr Ala Asn Leu Ser Glu Thr Ile Arg Val Pro Pro Thr Leu 245 250 255Glu Val Thr Gln Gln Pro Val Arg Ala Glu Asn Gln Val Asn Val Thr 260 265 270Cys Gln Val Arg Lys Phe Tyr Pro Gln Arg Leu Gln Leu Thr Trp Leu 275 280 285Glu Asn Gly Asn Val Ser Arg Thr Glu Thr Ala Ser Thr Val Thr Glu 290 295 300Asn Lys Asp Gly Thr Tyr Asn Trp Met Ser Trp Leu Leu Val Asn Val305 310 315 320Ser Ala His Arg Asp Asp Val Lys Leu Thr Cys Gln Val Glu His Asp 325 330 335Gly Gln Pro Ala Val Ser Lys Ser His Asp Leu Lys Val Ser Ala His 340 345 350Pro Lys Glu Gln Gly Ser Asn Thr Ala Ala Glu Asn Thr Gly Ser Asn 355 360 365Glu Arg Asn Ile Tyr Ile Val Val Gly Val Val Cys Thr Leu Leu Val 370 375 380Ala Leu Leu Met Ala Ala Leu Tyr Leu Val Arg Ile Arg Gln Lys Lys385 390 395 400Ala Gln Gly Ser Thr Ser Ser Thr Arg Leu His Glu Pro Glu Lys Asn 405 410 415Ala Arg Glu Ile Thr Gln Asp Thr Asn Asp Ile Thr Tyr Ala Asp Leu 420 425 430Asn Leu Pro Lys Gly Lys Lys Pro Ala Pro Gln Ala Ala Glu Pro Asn 435 440 445Asn His Thr Glu Tyr Ala Ser Ile Gln Thr Ser Pro Gln Pro Ala Ser 450 455 460Glu Asp Thr Leu Thr Tyr Ala Asp Leu Asp Met Val His Leu Asn Arg465 470 475 480Thr Pro Lys Gln Pro Ala Pro Lys Pro Glu Pro Ser Phe Ser Glu Tyr 485 490 495Ala Ser Val Gln Val Pro Arg Lys 500491512DNAHomo sapiensmisc_feature(1)..(1512)human SIRP alpha V6 49atggaacctg ccggccctgc tcctggtaga ctgggacctc tgctgtgtct gctgctggcc 60gcctcttgtg cttggagcgg agtggctggc gaagaggaac tgcaagtgat ccagcccgac 120aagtccgtgc tggtggctgc tggcgagact gccaccctga gatgtaccgc cacctccctg 180atccccgtgg gccctatcca gtggtttaga ggcgctggcc ctggcagaga gctgatctac 240aaccagaaag agggccactt ccccagagtg accaccgtgt ccgacctgac caagcggaac 300aacatggact tccccatccg gatcggcaac atcacccctg ccgatgccgg cacctactac 360tgcgtgaagt tccggaaggg ctcccccgac gacgtggagt tcaaatccgg cgctggcacc 420gagctgtctg tgcgggctaa accttctgcc cctgtggtgt ctggccctgc cgctagagct 480acccctcagc acaccgtgtc ttttacctgc gagtcccacg gcttcagccc tcgggacatc 540accctgaagt ggttcaagaa cggcaacgag ctgagcgact tccagaccaa cgtggaccct 600gtgggcgagt ccgtgtccta ctccatccac tccaccgcca aggtggtgct gacacgcgag 660gacgtgcact cccaagtgat ctgcgaggtg gcccacgtga cactgcaggg cgatcctctg 720agaggcaccg ccaacctgtc cgagacaatc agagtgcccc ccaccctgga agtgacccag 780cagcccgtgc gggctgagaa ccaagtgaac gtgacctgcc aagtgcggaa gttctacccc 840cagcggctgc agctgacctg gctggaaaac ggcaatgtgt cccggaccga gacagcctcc 900accgtgaccg agaacaagga tggcacctac aattggatgt cctggctgct cgtgaacgtg 960tccgcccacc gggacgatgt gaagctgaca tgccaggtgg aacacgacgg ccagcctgcc 1020gtgtccaagt cccacgatct gaaggtgtcc gctcatccca aagagcaggg ctccaacacc 1080gccgctgaga acaccggctc taacgagcgg aacatctaca tcgtcgtggg cgtcgtgtgc 1140accctgctgg tggcactgct gatggccgct ctgtacctcg tgcggatccg gcagaagaag 1200gcccagggct ctacctcctc caccagactg cacgagcccg agaagaacgc cagagagatc 1260acccaggaca ccaacgacat cacctacgcc gacctgaacc tgcccaaggg caagaagcct 1320gcccctcagg ctgccgagcc taacaaccac accgagtacg cctccatcca gaccagccct 1380cagcctgcct ctgaggacac cctgacctac gctgatctgg acatggtgca cctgaaccgg 1440acccccaagc agccagctcc taagcccgag cctagcttct ctgagtacgc cagcgtgcag 1500gtgccccgga aa 151250504PRTHomo sapiensmisc_feature(1)..(504)human SIRP alpha V6 50Met Glu Pro Ala Gly Pro Ala Pro Gly Arg Leu Gly Pro Leu Leu Cys1 5 10 15Leu Leu Leu Ala Ala Ser Cys Ala Trp Ser Gly Val Ala Gly Glu Glu 20 25 30Glu Leu Gln Val Ile Gln Pro Asp Lys Ser Val Leu Val Ala Ala Gly 35 40 45Glu Thr Ala Thr Leu Arg Cys Thr Ala Thr Ser Leu Ile Pro Val Gly 50 55 60Pro Ile Gln Trp Phe Arg Gly Ala Gly Pro Gly Arg Glu Leu Ile Tyr65 70 75 80Asn Gln Lys Glu Gly His Phe Pro Arg Val Thr Thr Val Ser Asp Leu 85 90 95Thr Lys Arg Asn Asn Met Asp Phe Pro Ile Arg Ile Gly Asn Ile Thr 100 105 110Pro Ala Asp Ala Gly Thr Tyr Tyr Cys Val Lys Phe Arg Lys Gly Ser 115 120 125Pro Asp Asp Val Glu Phe Lys Ser Gly Ala Gly Thr Glu Leu Ser Val 130 135 140Arg Ala Lys Pro Ser Ala Pro Val Val Ser Gly Pro Ala Ala Arg Ala145 150 155 160Thr Pro Gln His Thr Val Ser Phe Thr Cys Glu Ser His Gly Phe Ser 165 170 175Pro Arg Asp Ile Thr Leu Lys Trp Phe Lys Asn Gly Asn Glu Leu Ser 180 185 190Asp Phe Gln Thr Asn Val Asp Pro Val Gly Glu Ser Val Ser Tyr Ser 195 200 205Ile His Ser Thr Ala Lys Val Val Leu Thr Arg Glu Asp Val His Ser 210 215 220Gln Val Ile Cys Glu Val Ala His Val Thr Leu Gln Gly Asp Pro Leu225 230 235 240Arg Gly Thr Ala Asn Leu Ser Glu Thr Ile Arg Val Pro Pro Thr Leu 245 250 255Glu Val Thr Gln Gln Pro Val Arg Ala Glu Asn Gln Val Asn Val Thr 260 265 270Cys Gln Val Arg Lys Phe Tyr Pro Gln Arg Leu Gln Leu Thr Trp Leu 275 280 285Glu Asn Gly Asn Val Ser Arg Thr Glu Thr Ala Ser Thr Val Thr Glu 290 295 300Asn Lys Asp Gly Thr Tyr Asn Trp Met Ser Trp Leu Leu Val Asn Val305 310 315 320Ser Ala His Arg Asp Asp Val Lys Leu Thr Cys Gln Val Glu His Asp 325 330 335Gly Gln Pro Ala Val Ser Lys Ser His Asp Leu Lys Val Ser Ala His 340 345 350Pro Lys Glu Gln Gly Ser Asn Thr Ala Ala Glu Asn Thr Gly Ser Asn 355 360 365Glu Arg Asn Ile Tyr Ile Val Val Gly Val Val Cys Thr Leu Leu Val 370 375 380Ala Leu Leu Met Ala Ala Leu Tyr Leu Val Arg Ile Arg Gln Lys Lys385 390 395 400Ala Gln Gly Ser Thr Ser Ser Thr Arg Leu His Glu Pro Glu Lys Asn 405 410 415Ala Arg Glu Ile Thr Gln Asp Thr Asn Asp Ile Thr Tyr Ala Asp Leu 420 425 430Asn Leu Pro Lys Gly Lys Lys Pro Ala Pro Gln Ala Ala Glu Pro Asn 435 440 445Asn His Thr Glu Tyr Ala Ser Ile Gln Thr Ser Pro Gln Pro Ala Ser 450 455 460Glu Asp Thr Leu Thr Tyr Ala Asp Leu Asp Met Val His Leu Asn Arg465 470 475 480Thr Pro Lys Gln Pro Ala Pro Lys Pro Glu Pro Ser Phe Ser Glu Tyr 485 490 495Ala Ser Val Gln Val Pro Arg Lys 500511509DNAHomo sapiensmisc_feature(1)..(1509)human SIRP alpha V8 51atggaacctg ccggccctgc tcctggtaga ctgggacctc tgctgtgtct gctgctggcc 60gcctcttgtg cttggagcgg agtggctggc gaagaggaac tgcaagtgat ccagcccgac 120aagtccgtgc tggtggctgc tggcgagact gccaccctga gatgtaccgc cacctccctg 180atccccgtgg gccctatcca gtggtttaga ggcgctggcc ctgccagaga gctgatctac 240aaccagaaag agggccactt ccccagagtg accaccgtgt ccgagtccac caagcgcgag 300aacatggact tctccatctc catcagcaac atcacccctg ccgacgccgg cacctactac 360tgcgtgaagt tccggaaggg ctcccccgac accgagttca agtctggcgc tggcaccgag 420ctgtctgtgc gggctaaacc ttctgcccct gtggtgtctg gacctgccgc tagagctacc 480cctcagcaca ccgtgtcttt tacctgcgag tcccacggct tcagccctcg ggacatcacc 540ctgaagtggt tcaagaacgg caacgagctg agcgacttcc agaccaacgt ggaccctgtg 600ggcgagtccg tgtcctactc catccactcc accgccaagg tggtgctgac acgcgaggac 660gtgcactccc aagtgatctg cgaggtggcc cacgtgacac tgcagggcga tcctctgaga 720ggcaccgcca acctgtccga gacaatcaga gtgcccccca ccctggaagt gacccagcag 780cccgtgcggg ctgagaacca agtgaacgtg acctgccaag tgcggaagtt ctacccccag 840cggctgcagc tgacctggct ggaaaacggc aatgtgtccc ggaccgagac agccagcacc 900gtgaccgaga acaaggatgg cacctacaat tggatgtcct ggctgctcgt gaacgtgtcc 960gcccaccggg acgatgtgaa gctgacatgc caggtggaac acgacggcca gcctgccgtg 1020tccaagagcc acgatctgaa ggtgtccgct catcccaaag agcagggctc caacaccgcc 1080gctgagaaca ccggctctaa cgagcggaac atctacatcg tcgtgggcgt cgtgtgcacc 1140ctgctggtgg cactgctgat ggccgctctg tacctcgtgc ggatccggca gaagaaggcc 1200cagggctcta cctcctccac cagactgcac gagcccgaga agaacgccag agagatcacc 1260caggacacca acgacatcac ctacgccgac ctgaacctgc ccaagggcaa gaagcctgcc 1320cctcaggctg ccgagcctaa caaccacacc gagtacgcct ccatccagac cagccctcag 1380cctgcctctg aggacaccct gacctacgct gatctggaca tggtgcacct gaaccggacc 1440cccaagcagc cagctcctaa gcccgagcct agcttctctg agtacgccag cgtgcaggtg 1500ccccggaaa 150952503PRTHomo sapiensmisc_feature(1)..(503)human SIRP alpha V8 52Met Glu Pro Ala Gly Pro Ala Pro Gly Arg Leu Gly Pro Leu Leu Cys1 5 10 15Leu Leu Leu Ala Ala Ser Cys Ala Trp Ser Gly Val Ala Gly Glu Glu 20 25 30Glu Leu Gln Val Ile Gln Pro Asp Lys Ser Val Leu Val Ala Ala Gly 35 40 45Glu Thr Ala Thr Leu Arg Cys Thr Ala Thr Ser Leu Ile Pro Val Gly 50 55 60Pro Ile Gln Trp Phe Arg Gly Ala Gly Pro Ala Arg Glu Leu Ile Tyr65 70 75 80Asn Gln Lys Glu Gly His Phe Pro Arg Val Thr Thr Val Ser Glu Ser 85 90 95Thr Lys Arg Glu Asn Met Asp Phe Ser Ile Ser Ile Ser Asn Ile Thr 100 105 110Pro Ala Asp Ala Gly Thr Tyr Tyr Cys Val Lys Phe Arg Lys Gly Ser 115 120 125Pro Asp Thr Glu Phe Lys Ser Gly Ala Gly Thr Glu Leu Ser Val Arg 130 135 140Ala Lys Pro Ser Ala Pro Val Val Ser Gly Pro Ala Ala Arg Ala Thr145 150 155 160Pro Gln His Thr Val Ser Phe Thr Cys Glu Ser His Gly Phe Ser Pro 165 170 175Arg Asp Ile Thr Leu Lys Trp Phe Lys Asn Gly Asn Glu Leu Ser Asp 180 185 190Phe Gln Thr Asn Val Asp Pro Val Gly Glu Ser Val Ser Tyr Ser Ile 195 200 205His Ser Thr Ala Lys Val Val Leu Thr Arg Glu Asp Val His Ser Gln 210 215 220Val Ile Cys Glu Val Ala His Val Thr Leu Gln Gly Asp Pro Leu Arg225 230 235 240Gly Thr Ala Asn Leu Ser Glu Thr Ile Arg Val Pro Pro Thr Leu Glu 245 250 255Val Thr Gln Gln Pro Val Arg Ala Glu Asn Gln Val Asn Val Thr Cys 260 265 270Gln Val Arg Lys Phe Tyr Pro Gln Arg Leu Gln Leu Thr Trp Leu Glu 275 280 285Asn Gly Asn Val Ser Arg Thr Glu Thr Ala Ser Thr Val Thr Glu Asn 290 295 300Lys Asp Gly Thr Tyr Asn Trp Met Ser Trp Leu Leu Val Asn Val Ser305 310 315 320Ala His Arg Asp Asp Val Lys Leu Thr Cys Gln Val Glu His Asp Gly 325 330 335Gln Pro Ala Val Ser Lys Ser His Asp Leu Lys Val Ser Ala His Pro 340 345 350Lys Glu Gln Gly Ser Asn Thr Ala Ala Glu Asn Thr Gly Ser Asn Glu 355 360 365Arg Asn Ile Tyr Ile Val Val Gly Val Val Cys Thr Leu Leu Val Ala 370 375 380Leu Leu Met Ala Ala Leu Tyr Leu Val Arg Ile Arg Gln Lys Lys Ala385 390 395 400Gln Gly Ser Thr Ser Ser Thr Arg Leu His Glu Pro Glu Lys Asn Ala 405 410 415Arg Glu Ile Thr Gln Asp Thr Asn Asp Ile Thr Tyr Ala Asp Leu Asn 420 425 430Leu Pro Lys Gly Lys Lys Pro Ala Pro Gln Ala Ala Glu Pro Asn Asn 435 440 445His Thr Glu Tyr Ala Ser Ile Gln Thr Ser Pro Gln

Pro Ala Ser Glu 450 455 460Asp Thr Leu Thr Tyr Ala Asp Leu Asp Met Val His Leu Asn Arg Thr465 470 475 480Pro Lys Gln Pro Ala Pro Lys Pro Glu Pro Ser Phe Ser Glu Tyr Ala 485 490 495Ser Val Gln Val Pro Arg Lys 500531512DNAHomo sapiensmisc_feature(1)..(1512)human SIRP alpha V9 53atggaacctg ccggccctgc tcctggtaga ctgggacctc tgctgtgtct gctgctggcc 60gcctcttgtg cttggagcgg agtggctggc gaagaggaac tgcaagtgat ccagcccgac 120aagtccgtgc tggtggctgc tggcgagact gccaccctga gatgtaccgc cacctccctg 180atccccgtgg gccctatcca gtggtttaga ggcgctggcc ctggcagaga gctgatctac 240aaccagaaag agggccactt ccccagagtg accaccgtgt ccgacctgac caagcggaac 300aacatggact tctccatccg gatctccaac atcacccctg ccgacgccgg cacctactac 360tgcgtgaagt tccggaaggg ctcccccgac gacgtggagt tcaaatccgg cgctggcacc 420gagctgtctg tgcgggctaa accttctgcc cctgtggtgt ctggccctgc cgctagagct 480acccctcagc acaccgtgtc ttttacctgc gagtcccacg gcttcagccc tcgggacatc 540accctgaagt ggttcaagaa cggcaacgag ctgagcgact tccagaccaa cgtggaccct 600gtgggcgagt ccgtgtccta ctccatccac tccaccgcca aggtggtgct gacacgcgag 660gacgtgcact cccaagtgat ctgcgaggtg gcccacgtga cactgcaggg cgatcctctg 720agaggcaccg ccaacctgtc cgagacaatc agagtgcccc ccaccctgga agtgacccag 780cagcccgtgc gggctgagaa ccaagtgaac gtgacctgcc aagtgcggaa gttctacccc 840cagcggctgc agctgacctg gctggaaaac ggcaatgtgt cccggaccga gacagcctcc 900accgtgaccg agaacaagga tggcacctac aattggatgt cctggctgct cgtgaacgtg 960tccgcccacc gggacgatgt gaagctgaca tgccaggtgg aacacgacgg ccagcctgcc 1020gtgtccaagt cccacgatct gaaggtgtcc gctcatccca aagagcaggg ctccaacacc 1080gccgctgaga acaccggctc taacgagcgg aacatctaca tcgtcgtggg cgtcgtgtgc 1140accctgctgg tggcactgct gatggccgct ctgtacctcg tgcggatccg gcagaagaag 1200gcccagggct ctacctcctc caccagactg cacgagcccg agaagaacgc cagagagatc 1260acccaggaca ccaacgacat cacctacgcc gacctgaacc tgcccaaggg caagaagcct 1320gcccctcagg ctgccgagcc taacaaccac accgagtacg cctccatcca gaccagccct 1380cagcctgcct ctgaggacac cctgacctac gctgatctgg acatggtgca cctgaaccgg 1440acccccaagc agccagctcc taagcccgag cctagcttct ctgagtacgc cagcgtgcag 1500gtgccccgga aa 151254504PRTHomo sapiensmisc_feature(1)..(504)human SIRP alpha V9 54Met Glu Pro Ala Gly Pro Ala Pro Gly Arg Leu Gly Pro Leu Leu Cys1 5 10 15Leu Leu Leu Ala Ala Ser Cys Ala Trp Ser Gly Val Ala Gly Glu Glu 20 25 30Glu Leu Gln Val Ile Gln Pro Asp Lys Ser Val Leu Val Ala Ala Gly 35 40 45Glu Thr Ala Thr Leu Arg Cys Thr Ala Thr Ser Leu Ile Pro Val Gly 50 55 60Pro Ile Gln Trp Phe Arg Gly Ala Gly Pro Gly Arg Glu Leu Ile Tyr65 70 75 80Asn Gln Lys Glu Gly His Phe Pro Arg Val Thr Thr Val Ser Asp Leu 85 90 95Thr Lys Arg Asn Asn Met Asp Phe Ser Ile Arg Ile Ser Asn Ile Thr 100 105 110Pro Ala Asp Ala Gly Thr Tyr Tyr Cys Val Lys Phe Arg Lys Gly Ser 115 120 125Pro Asp Asp Val Glu Phe Lys Ser Gly Ala Gly Thr Glu Leu Ser Val 130 135 140Arg Ala Lys Pro Ser Ala Pro Val Val Ser Gly Pro Ala Ala Arg Ala145 150 155 160Thr Pro Gln His Thr Val Ser Phe Thr Cys Glu Ser His Gly Phe Ser 165 170 175Pro Arg Asp Ile Thr Leu Lys Trp Phe Lys Asn Gly Asn Glu Leu Ser 180 185 190Asp Phe Gln Thr Asn Val Asp Pro Val Gly Glu Ser Val Ser Tyr Ser 195 200 205Ile His Ser Thr Ala Lys Val Val Leu Thr Arg Glu Asp Val His Ser 210 215 220Gln Val Ile Cys Glu Val Ala His Val Thr Leu Gln Gly Asp Pro Leu225 230 235 240Arg Gly Thr Ala Asn Leu Ser Glu Thr Ile Arg Val Pro Pro Thr Leu 245 250 255Glu Val Thr Gln Gln Pro Val Arg Ala Glu Asn Gln Val Asn Val Thr 260 265 270Cys Gln Val Arg Lys Phe Tyr Pro Gln Arg Leu Gln Leu Thr Trp Leu 275 280 285Glu Asn Gly Asn Val Ser Arg Thr Glu Thr Ala Ser Thr Val Thr Glu 290 295 300Asn Lys Asp Gly Thr Tyr Asn Trp Met Ser Trp Leu Leu Val Asn Val305 310 315 320Ser Ala His Arg Asp Asp Val Lys Leu Thr Cys Gln Val Glu His Asp 325 330 335Gly Gln Pro Ala Val Ser Lys Ser His Asp Leu Lys Val Ser Ala His 340 345 350Pro Lys Glu Gln Gly Ser Asn Thr Ala Ala Glu Asn Thr Gly Ser Asn 355 360 365Glu Arg Asn Ile Tyr Ile Val Val Gly Val Val Cys Thr Leu Leu Val 370 375 380Ala Leu Leu Met Ala Ala Leu Tyr Leu Val Arg Ile Arg Gln Lys Lys385 390 395 400Ala Gln Gly Ser Thr Ser Ser Thr Arg Leu His Glu Pro Glu Lys Asn 405 410 415Ala Arg Glu Ile Thr Gln Asp Thr Asn Asp Ile Thr Tyr Ala Asp Leu 420 425 430Asn Leu Pro Lys Gly Lys Lys Pro Ala Pro Gln Ala Ala Glu Pro Asn 435 440 445Asn His Thr Glu Tyr Ala Ser Ile Gln Thr Ser Pro Gln Pro Ala Ser 450 455 460Glu Asp Thr Leu Thr Tyr Ala Asp Leu Asp Met Val His Leu Asn Arg465 470 475 480Thr Pro Lys Gln Pro Ala Pro Lys Pro Glu Pro Ser Phe Ser Glu Tyr 485 490 495Ala Ser Val Gln Val Pro Arg Lys 500551512DNAArtificial SequenceSynthetic hSIRP alpha-V beta C1 alphaC2 alpha 55atggaacctg ccggccctgc tcctggtaga ctgggacctc tgctgtgtct gctgctggcc 60gcctcttgtg cttggagcgg agtggctggc gaggacgagc tgcaagtgat ccagcccgag 120aagtccgtgt ctgtggccgc tggcgagtct gccaccctga gatgcgctat gacctccctg 180atccccgtgg gccccatcat gtggtttaga ggcgctggcg ctggcagaga gctgatctac 240aaccagaaag agggccactt ccccagagtg accaccgtgt ccgagctgac caagcggaac 300aacctggact tctccatctc catcagcaac atcacccctg ccgacgccgg cacctactac 360tgcgtgaagt tccggaaggg ctcccccgac gacgtggagt tcaaatccgg cgctggaacc 420gagctgtccg tgcgggctaa accttctgcc cctgtggtgt ctggccctgc cgctagagct 480acccctcagc acaccgtgtc ttttacctgc gagtcccacg gcttcagccc tcgggacatc 540accctgaagt ggttcaagaa cggcaacgag ctgagcgact tccagaccaa cgtggaccct 600gtgggcgaga gcgtgtccta ctccatccac tccaccgcca aggtggtgct gacacgcgag 660gacgtgcact cccaagtgat ctgcgaggtg gcccacgtga cactgcaggg cgatcctctg 720agaggcaccg ccaacctgtc cgagacaatc agagtgcccc ccaccctgga agtgacccag 780cagcctgtgc gggccgagaa ccaagtgaac gtgacctgcc aagtgcggaa gttctacccc 840cagcggctgc agctgacctg gctggaaaac ggcaatgtgt cccggaccga gacagccagc 900accgtgaccg agaacaagga tggcacctac aattggatgt cctggctgct cgtgaacgtg 960tccgcccacc gggacgatgt gaagctgaca tgccaggtgg aacacgacgg ccagcctgcc 1020gtgtccaagt cccacgatct gaaggtgtcc gctcatccca aagagcaggg ctccaacacc 1080gccgctgaga acaccggctc taacgagcgg aacatctaca tcgtcgtggg cgtcgtgtgc 1140accctgctgg tggctctgct gatggctgcc ctgtacctcg tgcggatccg gcagaagaag 1200gcccagggct ctacctcctc caccagactg cacgagcctg agaagaacgc cagagagatc 1260acccaggaca ccaacgacat cacctacgcc gacctgaacc tgcccaaggg caagaagcct 1320gcccctcagg ccgccgagcc taacaaccac accgagtacg cctccatcca gaccagccct 1380cagcctgcct ctgaggacac cctgacctac gctgatctgg acatggtgca cctgaaccgg 1440acccccaagc agccagctcc taagcccgag cctagcttct ctgagtacgc cagcgtgcag 1500gtgccccgga aa 151256504PRTArtificial SequenceSynthetic hSIRP alpha-V beta C1 alphaC2 alpha 56Met Glu Pro Ala Gly Pro Ala Pro Gly Arg Leu Gly Pro Leu Leu Cys1 5 10 15Leu Leu Leu Ala Ala Ser Cys Ala Trp Ser Gly Val Ala Gly Glu Asp 20 25 30Glu Leu Gln Val Ile Gln Pro Glu Lys Ser Val Ser Val Ala Ala Gly 35 40 45Glu Ser Ala Thr Leu Arg Cys Ala Met Thr Ser Leu Ile Pro Val Gly 50 55 60Pro Ile Met Trp Phe Arg Gly Ala Gly Ala Gly Arg Glu Leu Ile Tyr65 70 75 80Asn Gln Lys Glu Gly His Phe Pro Arg Val Thr Thr Val Ser Glu Leu 85 90 95Thr Lys Arg Asn Asn Leu Asp Phe Ser Ile Ser Ile Ser Asn Ile Thr 100 105 110Pro Ala Asp Ala Gly Thr Tyr Tyr Cys Val Lys Phe Arg Lys Gly Ser 115 120 125Pro Asp Asp Val Glu Phe Lys Ser Gly Ala Gly Thr Glu Leu Ser Val 130 135 140Arg Ala Lys Pro Ser Ala Pro Val Val Ser Gly Pro Ala Ala Arg Ala145 150 155 160Thr Pro Gln His Thr Val Ser Phe Thr Cys Glu Ser His Gly Phe Ser 165 170 175Pro Arg Asp Ile Thr Leu Lys Trp Phe Lys Asn Gly Asn Glu Leu Ser 180 185 190Asp Phe Gln Thr Asn Val Asp Pro Val Gly Glu Ser Val Ser Tyr Ser 195 200 205Ile His Ser Thr Ala Lys Val Val Leu Thr Arg Glu Asp Val His Ser 210 215 220Gln Val Ile Cys Glu Val Ala His Val Thr Leu Gln Gly Asp Pro Leu225 230 235 240Arg Gly Thr Ala Asn Leu Ser Glu Thr Ile Arg Val Pro Pro Thr Leu 245 250 255Glu Val Thr Gln Gln Pro Val Arg Ala Glu Asn Gln Val Asn Val Thr 260 265 270Cys Gln Val Arg Lys Phe Tyr Pro Gln Arg Leu Gln Leu Thr Trp Leu 275 280 285Glu Asn Gly Asn Val Ser Arg Thr Glu Thr Ala Ser Thr Val Thr Glu 290 295 300Asn Lys Asp Gly Thr Tyr Asn Trp Met Ser Trp Leu Leu Val Asn Val305 310 315 320Ser Ala His Arg Asp Asp Val Lys Leu Thr Cys Gln Val Glu His Asp 325 330 335Gly Gln Pro Ala Val Ser Lys Ser His Asp Leu Lys Val Ser Ala His 340 345 350Pro Lys Glu Gln Gly Ser Asn Thr Ala Ala Glu Asn Thr Gly Ser Asn 355 360 365Glu Arg Asn Ile Tyr Ile Val Val Gly Val Val Cys Thr Leu Leu Val 370 375 380Ala Leu Leu Met Ala Ala Leu Tyr Leu Val Arg Ile Arg Gln Lys Lys385 390 395 400Ala Gln Gly Ser Thr Ser Ser Thr Arg Leu His Glu Pro Glu Lys Asn 405 410 415Ala Arg Glu Ile Thr Gln Asp Thr Asn Asp Ile Thr Tyr Ala Asp Leu 420 425 430Asn Leu Pro Lys Gly Lys Lys Pro Ala Pro Gln Ala Ala Glu Pro Asn 435 440 445Asn His Thr Glu Tyr Ala Ser Ile Gln Thr Ser Pro Gln Pro Ala Ser 450 455 460Glu Asp Thr Leu Thr Tyr Ala Asp Leu Asp Met Val His Leu Asn Arg465 470 475 480Thr Pro Lys Gln Pro Ala Pro Lys Pro Glu Pro Ser Phe Ser Glu Tyr 485 490 495Ala Ser Val Gln Val Pro Arg Lys 500571512DNAArtificial SequenceSynthetic hSIRP alpha-V alphaC1 beta C2 alpha 57atggaacctg ccggccctgc tcctggtaga ctgggacctc tgctgtgtct gctgctggcc 60gcctcttgtg cttggagcgg agtggctggc gaagaggaac tgcaagtgat ccagcccgac 120aagtccgtgc tggtggctgc tggcgagact gccaccctga gatgtaccgc cacctccctg 180atccccgtgg gccctatcca gtggtttaga ggcgctggcc ctggcagaga gctgatctac 240aaccagaaag agggccactt ccccagagtg accaccgtgt ccgacctgac caagcggaac 300aacatggact tctccatccg gatcggcaac atcacccctg ccgatgccgg cacctactac 360tgcgtgaagt tccggaaggg ctcccccgac gacgtggagt tcaaatccgg cgctggcacc 420gagctgtctg tgcgggctaa accttctgcc cccgtggtgt ctggacctgc cgtgcgagct 480acccctgagc acaccgtgtc ttttacctgc gagtcccacg gcttcagccc tcgggacatc 540accctgaagt ggttcaagaa cggcaacgag ctgagcgact tccagaccaa cgtggaccca 600gccggcgact ccgtgtccta ctccatccac tctaccgcca gagtggtgct gaccagaggc 660gacgtgcact cccaagtgat ctgcgagatc gcccatatca cactgcaggg cgaccccctg 720agaggcaccg ctaacctgtc tgagacaatc cgggtgcccc ccaccctgga agtgactcag 780cagccagtgc gggccgagaa ccaagtgaac gtgacctgcc aagtgcggaa gttctacccc 840cagcggctgc agctgacctg gctggaaaac ggcaatgtgt cccggaccga gacagcctcc 900accgtgaccg agaacaagga tggcacctac aattggatgt cttggctgct cgtgaacgtg 960tccgcccacc gggacgatgt gaagctgaca tgccaggtgg aacacgacgg ccagcctgcc 1020gtgtccaagt cccacgatct gaaggtgtcc gctcatccca aagagcaggg ctccaacacc 1080gccgctgaga acaccggctc taacgagcgg aacatctaca tcgtcgtggg cgtcgtgtgc 1140accctgctgg tggcactgct gatggccgct ctgtacctcg tgcggatccg gcagaagaag 1200gcccagggct ctacctcctc caccagactg cacgagcccg agaagaacgc cagagagatc 1260acccaggaca ccaacgacat cacctacgcc gacctgaacc tgcccaaggg caagaagcct 1320gcccctcagg ccgccgagcc taacaaccac accgagtacg cctccatcca gaccagccct 1380cagcctgcct ctgaggacac cctgacctac gctgatctgg acatggtgca cctgaaccgg 1440acccccaagc agccagctcc taagcccgag cctagcttct ctgagtacgc cagcgtgcag 1500gtgccccgga aa 151258504PRTArtificial SequenceSynthetic hSIRP alpha-V alphaC1 beta C2 alpha 58Met Glu Pro Ala Gly Pro Ala Pro Gly Arg Leu Gly Pro Leu Leu Cys1 5 10 15Leu Leu Leu Ala Ala Ser Cys Ala Trp Ser Gly Val Ala Gly Glu Glu 20 25 30Glu Leu Gln Val Ile Gln Pro Asp Lys Ser Val Leu Val Ala Ala Gly 35 40 45Glu Thr Ala Thr Leu Arg Cys Thr Ala Thr Ser Leu Ile Pro Val Gly 50 55 60Pro Ile Gln Trp Phe Arg Gly Ala Gly Pro Gly Arg Glu Leu Ile Tyr65 70 75 80Asn Gln Lys Glu Gly His Phe Pro Arg Val Thr Thr Val Ser Asp Leu 85 90 95Thr Lys Arg Asn Asn Met Asp Phe Ser Ile Arg Ile Gly Asn Ile Thr 100 105 110Pro Ala Asp Ala Gly Thr Tyr Tyr Cys Val Lys Phe Arg Lys Gly Ser 115 120 125Pro Asp Asp Val Glu Phe Lys Ser Gly Ala Gly Thr Glu Leu Ser Val 130 135 140Arg Ala Lys Pro Ser Ala Pro Val Val Ser Gly Pro Ala Val Arg Ala145 150 155 160Thr Pro Glu His Thr Val Ser Phe Thr Cys Glu Ser His Gly Phe Ser 165 170 175Pro Arg Asp Ile Thr Leu Lys Trp Phe Lys Asn Gly Asn Glu Leu Ser 180 185 190Asp Phe Gln Thr Asn Val Asp Pro Ala Gly Asp Ser Val Ser Tyr Ser 195 200 205Ile His Ser Thr Ala Arg Val Val Leu Thr Arg Gly Asp Val His Ser 210 215 220Gln Val Ile Cys Glu Ile Ala His Ile Thr Leu Gln Gly Asp Pro Leu225 230 235 240Arg Gly Thr Ala Asn Leu Ser Glu Thr Ile Arg Val Pro Pro Thr Leu 245 250 255Glu Val Thr Gln Gln Pro Val Arg Ala Glu Asn Gln Val Asn Val Thr 260 265 270Cys Gln Val Arg Lys Phe Tyr Pro Gln Arg Leu Gln Leu Thr Trp Leu 275 280 285Glu Asn Gly Asn Val Ser Arg Thr Glu Thr Ala Ser Thr Val Thr Glu 290 295 300Asn Lys Asp Gly Thr Tyr Asn Trp Met Ser Trp Leu Leu Val Asn Val305 310 315 320Ser Ala His Arg Asp Asp Val Lys Leu Thr Cys Gln Val Glu His Asp 325 330 335Gly Gln Pro Ala Val Ser Lys Ser His Asp Leu Lys Val Ser Ala His 340 345 350Pro Lys Glu Gln Gly Ser Asn Thr Ala Ala Glu Asn Thr Gly Ser Asn 355 360 365Glu Arg Asn Ile Tyr Ile Val Val Gly Val Val Cys Thr Leu Leu Val 370 375 380Ala Leu Leu Met Ala Ala Leu Tyr Leu Val Arg Ile Arg Gln Lys Lys385 390 395 400Ala Gln Gly Ser Thr Ser Ser Thr Arg Leu His Glu Pro Glu Lys Asn 405 410 415Ala Arg Glu Ile Thr Gln Asp Thr Asn Asp Ile Thr Tyr Ala Asp Leu 420 425 430Asn Leu Pro Lys Gly Lys Lys Pro Ala Pro Gln Ala Ala Glu Pro Asn 435 440 445Asn His Thr Glu Tyr Ala Ser Ile Gln Thr Ser Pro Gln Pro Ala Ser 450 455 460Glu Asp Thr Leu Thr Tyr Ala Asp Leu Asp Met Val His Leu Asn Arg465 470 475 480Thr Pro Lys Gln Pro Ala Pro Lys Pro Glu Pro Ser Phe Ser Glu Tyr 485 490 495Ala Ser Val Gln Val Pro Arg Lys 500591512DNAArtificial SequenceSynthetic hSIRP alpha-V alphaC1 alphaC2 beta 59atggaacctg ccggccctgc tcctggtaga ctgggacctc tgctgtgtct gctgctggcc 60gcctcttgtg cttggagcgg agtggctggc gaagaggaac tgcaagtgat ccagcccgac 120aagtccgtgc tggtggctgc tggcgagact gccaccctga gatgtaccgc cacctccctg 180atccccgtgg gccctatcca gtggtttaga ggcgctggcc ctggcagaga gctgatctac 240aaccagaaag agggccactt ccccagagtg accaccgtgt ccgacctgac caagcggaac 300aacatggact tctccatccg gatcggcaac atcacccctg ccgatgccgg cacctactac 360tgcgtgaagt tccggaaggg ctcccccgac gacgtggagt tcaaatccgg cgctggcacc 420gagctgtctg tgcgggctaa accttctgcc

cctgtggtgt ctggccctgc cgctagagct 480acccctcagc acaccgtgtc ttttacctgc gagtcccacg gcttcagccc tcgggacatc 540accctgaagt ggttcaagaa cggcaacgag ctgagcgact tccagaccaa cgtggaccct 600gtgggcgagt ccgtgtccta ctccatccac tccaccgcca aggtggtgct gacacgcgag 660gacgtgcact cccaagtgat ctgcgaggtg gcccacgtga cactgcaggg cgatcctctg 720agaggcaccg ccaacctgtc cgagacaatc agagtgcccc ccaccctgga agtgacccag 780cagcctatga gagccgagaa ccaggccaac gtgacctgcc aggtgtccaa cttctaccct 840cggggcctgc agctgacctg gctggaaaac ggcaatgtgt cccggaccga gacagcctcc 900accctgatcg agaacaagga tggcacctac aattggatgt cctggctgct cgtgaacacc 960tgtgcccacc gggacgatgt ggtgctgacc tgtcaggtgg aacacgatgg ccagcaggcc 1020gtgtccaagt cctacgctct ggaagtgtcc gcccacccca aagagcaggg ctctaatacc 1080gccgctgaga acaccggctc caacgagcgg aacatctaca tcgtcgtggg cgtcgtgtgc 1140accctgctgg tggcactgct gatggccgct ctgtacctcg tgcggatccg gcagaagaag 1200gctcagggct ccacctcctc caccagactg cacgagcctg agaagaacgc cagagagatc 1260acccaggaca ccaacgacat cacctacgcc gacctgaacc tgcccaaggg caagaagcct 1320gcccctcagg ctgccgagcc taacaaccac accgagtacg cctccatcca gaccagccct 1380cagcctgcct ctgaggacac cctgacctac gctgatctgg acatggtgca cctgaaccgg 1440acccccaagc agccagctcc taagcccgag cctagcttct ctgagtacgc cagcgtgcag 1500gtgccccgga aa 151260504PRTArtificial SequenceSynthetic hSIRP alpha-V alphaC1 alphaC2 beta 60Met Glu Pro Ala Gly Pro Ala Pro Gly Arg Leu Gly Pro Leu Leu Cys1 5 10 15Leu Leu Leu Ala Ala Ser Cys Ala Trp Ser Gly Val Ala Gly Glu Glu 20 25 30Glu Leu Gln Val Ile Gln Pro Asp Lys Ser Val Leu Val Ala Ala Gly 35 40 45Glu Thr Ala Thr Leu Arg Cys Thr Ala Thr Ser Leu Ile Pro Val Gly 50 55 60Pro Ile Gln Trp Phe Arg Gly Ala Gly Pro Gly Arg Glu Leu Ile Tyr65 70 75 80Asn Gln Lys Glu Gly His Phe Pro Arg Val Thr Thr Val Ser Asp Leu 85 90 95Thr Lys Arg Asn Asn Met Asp Phe Ser Ile Arg Ile Gly Asn Ile Thr 100 105 110Pro Ala Asp Ala Gly Thr Tyr Tyr Cys Val Lys Phe Arg Lys Gly Ser 115 120 125Pro Asp Asp Val Glu Phe Lys Ser Gly Ala Gly Thr Glu Leu Ser Val 130 135 140Arg Ala Lys Pro Ser Ala Pro Val Val Ser Gly Pro Ala Ala Arg Ala145 150 155 160Thr Pro Gln His Thr Val Ser Phe Thr Cys Glu Ser His Gly Phe Ser 165 170 175Pro Arg Asp Ile Thr Leu Lys Trp Phe Lys Asn Gly Asn Glu Leu Ser 180 185 190Asp Phe Gln Thr Asn Val Asp Pro Val Gly Glu Ser Val Ser Tyr Ser 195 200 205Ile His Ser Thr Ala Lys Val Val Leu Thr Arg Glu Asp Val His Ser 210 215 220Gln Val Ile Cys Glu Val Ala His Val Thr Leu Gln Gly Asp Pro Leu225 230 235 240Arg Gly Thr Ala Asn Leu Ser Glu Thr Ile Arg Val Pro Pro Thr Leu 245 250 255Glu Val Thr Gln Gln Pro Met Arg Ala Glu Asn Gln Ala Asn Val Thr 260 265 270Cys Gln Val Ser Asn Phe Tyr Pro Arg Gly Leu Gln Leu Thr Trp Leu 275 280 285Glu Asn Gly Asn Val Ser Arg Thr Glu Thr Ala Ser Thr Leu Ile Glu 290 295 300Asn Lys Asp Gly Thr Tyr Asn Trp Met Ser Trp Leu Leu Val Asn Thr305 310 315 320Cys Ala His Arg Asp Asp Val Val Leu Thr Cys Gln Val Glu His Asp 325 330 335Gly Gln Gln Ala Val Ser Lys Ser Tyr Ala Leu Glu Val Ser Ala His 340 345 350Pro Lys Glu Gln Gly Ser Asn Thr Ala Ala Glu Asn Thr Gly Ser Asn 355 360 365Glu Arg Asn Ile Tyr Ile Val Val Gly Val Val Cys Thr Leu Leu Val 370 375 380Ala Leu Leu Met Ala Ala Leu Tyr Leu Val Arg Ile Arg Gln Lys Lys385 390 395 400Ala Gln Gly Ser Thr Ser Ser Thr Arg Leu His Glu Pro Glu Lys Asn 405 410 415Ala Arg Glu Ile Thr Gln Asp Thr Asn Asp Ile Thr Tyr Ala Asp Leu 420 425 430Asn Leu Pro Lys Gly Lys Lys Pro Ala Pro Gln Ala Ala Glu Pro Asn 435 440 445Asn His Thr Glu Tyr Ala Ser Ile Gln Thr Ser Pro Gln Pro Ala Ser 450 455 460Glu Asp Thr Leu Thr Tyr Ala Asp Leu Asp Met Val His Leu Asn Arg465 470 475 480Thr Pro Lys Gln Pro Ala Pro Lys Pro Glu Pro Ser Phe Ser Glu Tyr 485 490 495Ala Ser Val Gln Val Pro Arg Lys 500611512DNAHomo sapiensmisc_feature(1)..(1512)human SIRP alpha V1(P74A) 61atggagcccg ccggcccggc ccccggccgc ctcgggccgc tgctctgcct gctgctcgcc 60gcgtcctgcg cctggtcagg agtggcgggt gaggaggagc tgcaggtgat tcagcctgac 120aagtccgtgt tggttgcagc tggagagaca gccactctgc gctgcactgc gacctctctg 180atccctgtgg ggcccatcca gtggttcaga ggagctggag caggccggga attaatctac 240aatcaaaaag aaggccactt cccccgggta acaactgttt cagacctcac aaagagaaac 300aacatggact tttccatccg catcggtaac atcaccccag cagatgccgg cacctactac 360tgtgtgaagt tccggaaagg gagccccgat gacgtggagt ttaagtctgg agcaggcact 420gagctgtctg tgcgcgccaa accctctgcc cccgtggtat cgggccctgc ggcgagggcc 480acacctcagc acacagtgag cttcacctgc gagtcccacg gcttctcacc cagagacatc 540accctgaaat ggttcaaaaa tgggaatgag ctctcagact tccagaccaa cgtggacccc 600gtaggagaga gcgtgtccta cagcatccac agcacagcca aggtggtgct gacccgcgag 660gacgttcact ctcaagtcat ctgcgaggtg gcccacgtca ccttgcaggg ggaccctctt 720cgtgggactg ccaacttgtc tgagaccatc cgagttccac ccaccttgga ggttactcaa 780cagcccgtga gggcagagaa ccaggtgaat gtcacctgcc aggtgaggaa gttctacccc 840cagagactac agctgacctg gttggagaat ggaaacgtgt cccggacaga aacggcctca 900accgttacag agaacaagga tggtacctac aactggatga gctggctcct ggtgaatgta 960tctgcccaca gggatgatgt gaagctcacc tgccaggtgg agcatgacgg gcagccagcg 1020gtcagcaaaa gccatgacct gaaggtctca gcccacccga aggagcaggg ctcaaatacc 1080gccgctgaga acactggatc taatgaacgg aacatctata ttgtggtggg tgtggtgtgc 1140accttgctgg tggccctact gatggcggcc ctctacctcg tccgaatcag acagaagaaa 1200gcccagggct ccacttcttc tacaaggttg catgagcccg agaagaatgc cagagaaata 1260acacaggaca caaatgatat cacatatgca gacctgaacc tgcccaaggg gaagaagcct 1320gctccccagg ctgcggagcc caacaaccac acggagtatg ccagcattca gaccagcccg 1380cagcccgcgt cggaggacac cctcacctat gctgacctgg acatggtcca cctcaaccgg 1440acccccaagc agccggcccc caagcctgag ccgtccttct cagagtacgc cagcgtccag 1500gtcccgagga ag 151262504PRTHomo sapiensmisc_feature(1)..(504)human SIRP alpha V1(P74A) 62Met Glu Pro Ala Gly Pro Ala Pro Gly Arg Leu Gly Pro Leu Leu Cys1 5 10 15Leu Leu Leu Ala Ala Ser Cys Ala Trp Ser Gly Val Ala Gly Glu Glu 20 25 30Glu Leu Gln Val Ile Gln Pro Asp Lys Ser Val Leu Val Ala Ala Gly 35 40 45Glu Thr Ala Thr Leu Arg Cys Thr Ala Thr Ser Leu Ile Pro Val Gly 50 55 60Pro Ile Gln Trp Phe Arg Gly Ala Gly Ala Gly Arg Glu Leu Ile Tyr65 70 75 80Asn Gln Lys Glu Gly His Phe Pro Arg Val Thr Thr Val Ser Asp Leu 85 90 95Thr Lys Arg Asn Asn Met Asp Phe Ser Ile Arg Ile Gly Asn Ile Thr 100 105 110Pro Ala Asp Ala Gly Thr Tyr Tyr Cys Val Lys Phe Arg Lys Gly Ser 115 120 125Pro Asp Asp Val Glu Phe Lys Ser Gly Ala Gly Thr Glu Leu Ser Val 130 135 140Arg Ala Lys Pro Ser Ala Pro Val Val Ser Gly Pro Ala Ala Arg Ala145 150 155 160Thr Pro Gln His Thr Val Ser Phe Thr Cys Glu Ser His Gly Phe Ser 165 170 175Pro Arg Asp Ile Thr Leu Lys Trp Phe Lys Asn Gly Asn Glu Leu Ser 180 185 190Asp Phe Gln Thr Asn Val Asp Pro Val Gly Glu Ser Val Ser Tyr Ser 195 200 205Ile His Ser Thr Ala Lys Val Val Leu Thr Arg Glu Asp Val His Ser 210 215 220Gln Val Ile Cys Glu Val Ala His Val Thr Leu Gln Gly Asp Pro Leu225 230 235 240Arg Gly Thr Ala Asn Leu Ser Glu Thr Ile Arg Val Pro Pro Thr Leu 245 250 255Glu Val Thr Gln Gln Pro Val Arg Ala Glu Asn Gln Val Asn Val Thr 260 265 270Cys Gln Val Arg Lys Phe Tyr Pro Gln Arg Leu Gln Leu Thr Trp Leu 275 280 285Glu Asn Gly Asn Val Ser Arg Thr Glu Thr Ala Ser Thr Val Thr Glu 290 295 300Asn Lys Asp Gly Thr Tyr Asn Trp Met Ser Trp Leu Leu Val Asn Val305 310 315 320Ser Ala His Arg Asp Asp Val Lys Leu Thr Cys Gln Val Glu His Asp 325 330 335Gly Gln Pro Ala Val Ser Lys Ser His Asp Leu Lys Val Ser Ala His 340 345 350Pro Lys Glu Gln Gly Ser Asn Thr Ala Ala Glu Asn Thr Gly Ser Asn 355 360 365Glu Arg Asn Ile Tyr Ile Val Val Gly Val Val Cys Thr Leu Leu Val 370 375 380Ala Leu Leu Met Ala Ala Leu Tyr Leu Val Arg Ile Arg Gln Lys Lys385 390 395 400Ala Gln Gly Ser Thr Ser Ser Thr Arg Leu His Glu Pro Glu Lys Asn 405 410 415Ala Arg Glu Ile Thr Gln Asp Thr Asn Asp Ile Thr Tyr Ala Asp Leu 420 425 430Asn Leu Pro Lys Gly Lys Lys Pro Ala Pro Gln Ala Ala Glu Pro Asn 435 440 445Asn His Thr Glu Tyr Ala Ser Ile Gln Thr Ser Pro Gln Pro Ala Ser 450 455 460Glu Asp Thr Leu Thr Tyr Ala Asp Leu Asp Met Val His Leu Asn Arg465 470 475 480Thr Pro Lys Gln Pro Ala Pro Lys Pro Glu Pro Ser Phe Ser Glu Tyr 485 490 495Ala Ser Val Gln Val Pro Arg Lys 50063321DNAHomo sapiensmisc_feature(1)..(321)human kappa constant domain 63cggaccgtgg ccgctccctc cgtgttcatc ttcccacctt ccgacgagca gctgaagtcc 60ggcaccgctt ctgtcgtgtg cctgctgaac aacttctacc cccgcgaggc caaggtgcag 120tggaaggtgg acaacgccct gcagtccggc aactcccagg aatccgtgac cgagcaggac 180tccaaggaca gcacctactc cctgtcctcc accctgaccc tgtccaaggc cgactacgag 240aagcacaagg tgtacgcctg cgaagtgacc caccagggcc tgtctagccc tgtgaccaag 300tccttcaacc ggggcgagtg c 32164107PRTHomo sapiensmisc_feature(1)..(107)human kappa constant domain 64Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu1 5 10 15Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe 20 25 30Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln 35 40 45Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser 50 55 60Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu65 70 75 80Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser 85 90 95Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys 100 10565981DNAHomo sapiensmisc_feature(1)..(981)human IgG4 constant domains (including S228P) 65gcttccacca agggcccctc cgtgtttcct ctggcccctt gctccagatc cacctccgag 60tctaccgccg ctctgggctg cctcgtgaag gactacttcc ccgagcctgt gacagtgtcc 120tggaactctg gcgccctgac ctctggcgtg cacacctttc cagctgtgct gcagtcctcc 180ggcctgtact ccctgtccag cgtcgtgaca gtgccctcca gctctctggg caccaagacc 240tacacctgta acgtggacca caagccctcc aacaccaagg tggacaagcg ggtggaatct 300aagtacggcc ctccctgccc tccttgccca gcccctgaat ttctgggcgg accttctgtg 360tttctgttcc ccccaaagcc caaggacacc ctgatgatct cccggacccc cgaagtgacc 420tgcgtggtgg tggatgtgtc ccaggaagat cccgaggtgc agttcaattg gtacgtggac 480ggcgtggaag tgcacaacgc caagaccaag cctagagagg aacagttcaa ctccacctac 540cgggtggtgt ccgtgctgac cgtgctgcac caggattggc tgaacggcaa agagtacaag 600tgcaaggtgt ccaacaaggg cctgcccagc tccatcgaaa agaccatctc caaggccaag 660ggccagcccc gggaacccca ggtgtacaca ctgcctccaa gccaggaaga gatgaccaag 720aaccaggtgt ccctgacctg tctcgtgaaa ggcttctacc cctccgatat cgccgtggaa 780tgggagtcca acggccagcc tgagaacaac tacaagacca ccccccctgt gctggactcc 840gacggctcct tctttctgta ctctcgcctg accgtggaca agtcccggtg gcaggaaggc 900aacgtgttct cctgcagcgt gatgcacgag gccctgcaca accactacac ccagaagtcc 960ctgtccctgt ctctgggaaa a 98166327PRTHomo sapiensmisc_feature(1)..(327)human IgG4 constant domains (including S228P) 66Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Cys Ser Arg1 5 10 15Ser Thr Ser Glu Ser Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Lys Thr65 70 75 80Tyr Thr Cys Asn Val Asp His Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Arg Val Glu Ser Lys Tyr Gly Pro Pro Cys Pro Pro Cys Pro Ala Pro 100 105 110Glu Phe Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys 115 120 125Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val 130 135 140Asp Val Ser Gln Glu Asp Pro Glu Val Gln Phe Asn Trp Tyr Val Asp145 150 155 160Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Phe 165 170 175Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp 180 185 190Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Gly Leu 195 200 205Pro Ser Ser Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg 210 215 220Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Gln Glu Glu Met Thr Lys225 230 235 240Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp 245 250 255Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys 260 265 270Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser 275 280 285Arg Leu Thr Val Asp Lys Ser Arg Trp Gln Glu Gly Asn Val Phe Ser 290 295 300Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser305 310 315 320Leu Ser Leu Ser Leu Gly Lys 32567978DNAHomo sapiensmisc_feature(1)..(978)human IgG2 constant domainsmisc_feature(769)..(769)n is g or t 67gcttctacaa agggccccag cgtgttccct ctggctcctt gtagcagaag caccagcgag 60tctacagccg ctctgggctg tctggtcaag gactactttc ccgagcctgt gaccgtgtcc 120tggaatagcg gagcactgac aagcggcgtg cacacctttc cagctgtgct gcaaagctcc 180ggcctgtact ctctgtccag cgtggtcaca gtgcccagca gcaattttgg cacccagacc 240tacacctgta atgtggacca caagcctagc aacaccaagg tggacaagac cgtggaacgg 300aagtgctgcg tggaatgccc tccttgtcct gctcctccag tggctggccc ttccgtgttt 360ctgttccctc caaagcctaa ggacaccctg atgatcagca gaacccctga agtgacctgc 420gtggtggtgg atgtgtccca cgaggatcct gaggtgcagt tcaattggta cgtggacggc 480gtggaagtgc acaacgccaa gaccaagcct agagaggaac agttcaacag caccttcaga 540gtggtgtccg tgctgaccgt ggtgcatcag gattggctga acggcaaaga gtacaagtgc 600aaggtgtcca acaagggcct gcctgctcct atcgagaaaa ccatcagcaa gaccaaaggc 660cagcctcgcg agccccaggt ttacacactt cctccaagcc gggaagagat gaccaagaac 720caggtgtccc tgacctgcct cgtgaagggc ttctacccca gcgacatcnc cgtggaatgg 780gagagcaatg gccagcctga gaacaactac aagaccacac ctcctatgct ggactccgac 840ggctcattct tcctgtacag caagctgaca gtggacaagt ccagatggca gcagggcaac 900gtgttctcct gcagcgtgat gcacgaggcc ctgcacaacc actacaccca gaagtccctg 960tctctgagcc ccggcaaa 97868326PRTHomo sapiensmisc_feature(1)..(326)human IgG2 constant domainsmisc_feature(257)..(257)X is A or S 68Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Cys Ser Arg1 5 10 15Ser Thr Ser Glu Ser Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val Val Thr Val Pro Ser Ser Asn Phe Gly Thr Gln Thr65 70 75 80Tyr Thr Cys Asn Val Asp

His Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Thr Val Glu Arg Lys Cys Cys Val Glu Cys Pro Pro Cys Pro Ala Pro 100 105 110Pro Val Ala Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp 115 120 125Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp 130 135 140Val Ser His Glu Asp Pro Glu Val Gln Phe Asn Trp Tyr Val Asp Gly145 150 155 160Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Phe Asn 165 170 175Ser Thr Phe Arg Val Val Ser Val Leu Thr Val Val His Gln Asp Trp 180 185 190Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Gly Leu Pro 195 200 205Ala Pro Ile Glu Lys Thr Ile Ser Lys Thr Lys Gly Gln Pro Arg Glu 210 215 220Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn225 230 235 240Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile 245 250 255Xaa Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr 260 265 270Thr Pro Pro Met Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys 275 280 285Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys 290 295 300Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu305 310 315 320Ser Leu Ser Pro Gly Lys 325695PRTArtificial SequenceSynthetic 40A heavy chain CDR1 69Ser Tyr Trp Met His1 57017PRTArtificial SequenceSynthetic 40A heavy chain CDR2 70Ala Ile Tyr Pro Val Asn Asn Asp Thr Thr Tyr Asn Gln Lys Phe Lys1 5 10 15Gly7113PRTArtificial SequenceSynthetic 40A heavy chain CDR3 71Ser Phe Tyr Tyr Ser Leu Asp Ala Ala Trp Phe Val Tyr1 5 107211PRTArtificial SequenceSynthetic 40A light chain CDR1 72Arg Ala Ser Gln Asp Ile Gly Ser Arg Leu Asn1 5 10737PRTArtificial SequenceSynthetic 40A light chain CDR2 73Ala Thr Ser Ser Leu Asp Ser1 5749PRTArtificial SequenceSynthetic 40A light chain CDR3 74Leu Gln Tyr Ala Ser Ser Pro Phe Thr1 575122PRTArtificial SequenceSynthetic humanized 40 heavy chain variable region (consensus sequence)misc_feature(4)..(4)X = F or Lmisc_feature(5)..(5)X = Q or R or Vmisc_feature(10)..(10)X = E or Vmisc_feature(11)..(11)X = L or Vmisc_feature(12)..(12)X = A or K or Vmisc_feature(20)..(20)X = L or M or Vmisc_feature(38)..(38)X = K or Rmisc_feature(40)..(40)X = A or R or Tmisc_feature(48)..(48)X = I or Mmisc_feature(67)..(67)X = K or Rmisc_feature(68)..(68)X = A or Vmisc_feature(70)..(70)X = L or Mmisc_feature(73)..(73)X = D or Vmisc_feature(74)..(74)X = K or Tmisc_feature(76)..(76)X = A or S or Tmisc_feature(79)..(79)X = A or Vmisc_feature(82)..(82)X = E or Qmisc_feature(87)..(87)X = R or Tmisc_feature(88)..(88)X = F or Smisc_feature(91)..(91)X = S or Tmisc_feature(97)..(97)X = A or Tmisc_feature(117)..(117)X = L or Tmisc_feature(118)..(118)X = L or V 75Glu Val Gln Xaa Xaa Gln Ser Gly Ala Xaa Xaa Xaa Lys Pro Gly Ala1 5 10 15Ser Val Lys Xaa Ser Cys Lys Ala Ser Gly Ser Thr Phe Thr Ser Tyr 20 25 30Trp Met His Trp Val Xaa Gln Xaa Pro Gly Gln Gly Leu Glu Trp Xaa 35 40 45Gly Ala Ile Tyr Pro Val Asn Ser Asp Thr Thr Tyr Asn Gln Lys Phe 50 55 60Lys Gly Xaa Xaa Thr Xaa Thr Val Xaa Xaa Ser Xaa Ser Thr Xaa Tyr65 70 75 80Met Xaa Leu Ser Ser Leu Xaa Xaa Glu Asp Xaa Ala Val Tyr Tyr Cys 85 90 95Xaa Arg Ser Phe Tyr Tyr Ser Leu Asp Ala Ala Trp Phe Val Tyr Trp 100 105 110Gly Gln Gly Thr Xaa Xaa Thr Val Ser Ser 115 12076107PRTArtificial SequenceSynthetic humanized 40 light chain variable region (consensus sequence)misc_feature(15)..(15)X = L or Vmisc_feature(17)..(17)X = D or Emisc_feature(20)..(20)X = S or Tmisc_feature(39)..(39)X = K or Tmisc_feature(44)..(44)X = I or Pmisc_feature(60)..(60)X = K or Smisc_feature(66)..(66)X = G or Rmisc_feature(69)..(69)X = S or Tmisc_feature(70)..(70)X = D or Emisc_feature(71)..(71)X = F or Ymisc_feature(72)..(72)X = S or Tmisc_feature(77)..(77)X = G or Smisc_feature(100)..(100)X = G or Qmisc_feature(104)..(104)X = L or Vmisc_feature(107)..(107)X = H or K 76Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Xaa Gly1 5 10 15Xaa Arg Val Xaa Ile Thr Cys Arg Ala Ser Gln Asp Ile Gly Ser Arg 20 25 30Leu Asn Trp Leu Gln Gln Xaa Pro Gly Lys Ala Xaa Lys Arg Leu Ile 35 40 45Tyr Ala Thr Ser Ser Leu Asp Ser Gly Val Pro Xaa Arg Phe Ser Gly 50 55 60Ser Xaa Ser Gly Xaa Xaa Xaa Xaa Leu Thr Ile Ser Xaa Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Leu Gln Tyr Ala Ser Ser Pro Phe 85 90 95Thr Phe Gly Xaa Gly Thr Lys Xaa Glu Ile Xaa 100 10577366DNAArtificial SequenceSynthetic hSIRP alpha.40AVH1 77gaggtgcagt tcttgcagtc tggtgccgtg ctggctagac ctggaacctc cgtgaagatc 60tcctgcaagg cctccggctc caccttcacc tcttactgga tgcactgggt caagcagagg 120cctggacagg gactcgaatg gatcggcgct ctgtaccctg tgaactccga caccacctac 180aaccagaagt tcaagggcag agccaagctg accgtggcca cctctgcttc tatcgcctac 240ctggaatttt ccagcctgac caacgaggac tccgccgtgt actactgcgc ccggtccttc 300tactactctc tggacgccgc ttggtttgtg tactggggcc agggaactct ggtgaccgtg 360tcctct 36678122PRTArtificial SequenceSynthetic hSIRP alpha.40AVH1 78Glu Val Gln Phe Leu Gln Ser Gly Ala Val Leu Ala Arg Pro Gly Thr1 5 10 15Ser Val Lys Ile Ser Cys Lys Ala Ser Gly Ser Thr Phe Thr Ser Tyr 20 25 30Trp Met His Trp Val Lys Gln Arg Pro Gly Gln Gly Leu Glu Trp Ile 35 40 45Gly Ala Leu Tyr Pro Val Asn Ser Asp Thr Thr Tyr Asn Gln Lys Phe 50 55 60Lys Gly Arg Ala Lys Leu Thr Val Ala Thr Ser Ala Ser Ile Ala Tyr65 70 75 80Leu Glu Phe Ser Ser Leu Thr Asn Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Phe Tyr Tyr Ser Leu Asp Ala Ala Trp Phe Val Tyr Trp 100 105 110Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 12079366DNAArtificial SequenceSynthetic hSIRP alpha.40AVH2 79gaggtgcagc tggttcagtc tggcgctgag gttgtgaagc ctggcgcttc cgtgaagctg 60tcctgcaagg cttctggctc caccttcacc agctactgga tgcactgggt caagcaggcc 120cctggacaag gcctggaatg gatcggcgct atctaccccg tgaactccga caccacctac 180aaccagaagt tcaagggcaa agctaccctg accgtggaca agtctgcctc caccgcctac 240atggaactgt ccagcctgag atctgaggac accgccgtgt actactgcac ccggtccttc 300tactactccc tggacgccgc ttggtttgtg tattggggcc agggaacact ggtgaccgtg 360tcctct 36680122PRTArtificial SequenceSynthetic hSIRP alpha.40AVH2 80Glu Val Gln Leu Val Gln Ser Gly Ala Glu Val Val Lys Pro Gly Ala1 5 10 15Ser Val Lys Leu Ser Cys Lys Ala Ser Gly Ser Thr Phe Thr Ser Tyr 20 25 30Trp Met His Trp Val Lys Gln Ala Pro Gly Gln Gly Leu Glu Trp Ile 35 40 45Gly Ala Ile Tyr Pro Val Asn Ser Asp Thr Thr Tyr Asn Gln Lys Phe 50 55 60Lys Gly Lys Ala Thr Leu Thr Val Asp Lys Ser Ala Ser Thr Ala Tyr65 70 75 80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Thr Arg Ser Phe Tyr Tyr Ser Leu Asp Ala Ala Trp Phe Val Tyr Trp 100 105 110Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 12081366DNAArtificial SequenceSynthetic hSIRP alpha.40AVH3 81gaggtgcagc tgagacagtc tggcgctgtg cttgtgaagc ctggcgcctc cgtgaagatg 60tcctgcaagg cttctggctc caccttcacc agctactgga tgcactgggt caagcagacc 120cctggacagg gactcgagtg gatcggcgct atctaccctg tgaactccga caccacctac 180aaccagaagt tcaagggcaa agctaccctg accgtggaca agtcctcctc caccgcttac 240atgcagctgt ccagcctgac ctctgaggac tccgccgtgt actactgcgc ccggtccttc 300tactactctc tggacgccgc ttggtttgtg tactggggcc agggcacaac cctgacagtg 360tcctct 36682122PRTArtificial SequenceSynthetic hSIRP alpha.40AVH3 82Glu Val Gln Leu Arg Gln Ser Gly Ala Val Leu Val Lys Pro Gly Ala1 5 10 15Ser Val Lys Met Ser Cys Lys Ala Ser Gly Ser Thr Phe Thr Ser Tyr 20 25 30Trp Met His Trp Val Lys Gln Thr Pro Gly Gln Gly Leu Glu Trp Ile 35 40 45Gly Ala Ile Tyr Pro Val Asn Ser Asp Thr Thr Tyr Asn Gln Lys Phe 50 55 60Lys Gly Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser Thr Ala Tyr65 70 75 80Met Gln Leu Ser Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Phe Tyr Tyr Ser Leu Asp Ala Ala Trp Phe Val Tyr Trp 100 105 110Gly Gln Gly Thr Thr Leu Thr Val Ser Ser 115 12083366DNAArtificial SequenceSynthetic hSIRP alpha.40AVH4 83gaggtgcagt tcgttcagtc tggcgccgaa gtgaagaaac ctggcgcctc tgtgaaggtg 60tcctgcaagg cttctggctc caccttcacc agctactgga tgcactgggt ccgacaggct 120ccaggacaag gcttggaatg gatgggcgct atctaccccg tgaactccga caccacctac 180aaccagaaat tcaagggcag agtgaccatg accgtcgtga cctccacctc caccgtgtac 240atggaactgt ccagcctgag atccgaggac accgccgtgt actactgcgc ccggtccttc 300tactactctc tggacgccgc ttggtttgtg tactggggcc agggaactct ggtgaccgtg 360tcctct 36684122PRTArtificial SequenceSynthetic hSIRP alpha.40AVH4 84Glu Val Gln Phe Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Ser Thr Phe Thr Ser Tyr 20 25 30Trp Met His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40 45Gly Ala Ile Tyr Pro Val Asn Ser Asp Thr Thr Tyr Asn Gln Lys Phe 50 55 60Lys Gly Arg Val Thr Met Thr Val Val Thr Ser Thr Ser Thr Val Tyr65 70 75 80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Phe Tyr Tyr Ser Leu Asp Ala Ala Trp Phe Val Tyr Trp 100 105 110Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 12085366DNAArtificial SequenceSynthetic hSIRP alpha.40AVH5 85gaggtccagc tgcaacagtc tggtgccgtg ttggctaagc ctggcgcctc cgtgaagatg 60tcctgcaagg cttctggctc caccttcacc agctactgga tgcactgggt caagcagagg 120cctggacagg gactcgagtg gatcggcgct atctaccctg tgaactccga caccacctac 180aaccagaagt tcaagggcaa agctaccctg accgtggaca agtcctcctc caccgcttac 240atgcagctgt ccagcctgac cttcgaggac tccgccgtgt actactgcgc ccggtccttc 300tactactctc tggacgccgc ttggtttgtg tactggggcc agggcacaac cctgacagtg 360tcctct 36686122PRTArtificial SequenceSynthetic hSIRP alpha.40AVH5 86Glu Val Gln Leu Gln Gln Ser Gly Ala Val Leu Ala Lys Pro Gly Ala1 5 10 15Ser Val Lys Met Ser Cys Lys Ala Ser Gly Ser Thr Phe Thr Ser Tyr 20 25 30Trp Met His Trp Val Lys Gln Arg Pro Gly Gln Gly Leu Glu Trp Ile 35 40 45Gly Ala Ile Tyr Pro Val Asn Ser Asp Thr Thr Tyr Asn Gln Lys Phe 50 55 60Lys Gly Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser Thr Ala Tyr65 70 75 80Met Gln Leu Ser Ser Leu Thr Phe Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Phe Tyr Tyr Ser Leu Asp Ala Ala Trp Phe Val Tyr Trp 100 105 110Gly Gln Gly Thr Thr Leu Thr Val Ser Ser 115 12087366DNAArtificial SequenceSynthetic hSIRP alpha.40AVH6 87gaggtgcagc tggttcagtc tggcgccgaa gtgaagaaac ctggcgcctc tgtgaaggtg 60tcctgcaagg cttctggctc caccttcacc agctactgga tgcactgggt ccgacaggct 120ccaggacaag gcttggaatg gatgggcgct atctaccccg tgaactccga caccacctac 180aaccagaaat tcaagggcag agtgaccatg accgtggaca cctccaccag caccgtgtac 240atggaactgt ccagcctgag atccgaggac accgccgtgt actactgcgc ccggtccttc 300tactactctc tggacgccgc ttggtttgtg tactggggcc agggaactct ggtgaccgtg 360tcctct 36688122PRTArtificial SequenceSynthetic hSIRP alpha.40AVH6 88Glu Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Ser Thr Phe Thr Ser Tyr 20 25 30Trp Met His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40 45Gly Ala Ile Tyr Pro Val Asn Ser Asp Thr Thr Tyr Asn Gln Lys Phe 50 55 60Lys Gly Arg Val Thr Met Thr Val Asp Thr Ser Thr Ser Thr Val Tyr65 70 75 80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ser Phe Tyr Tyr Ser Leu Asp Ala Ala Trp Phe Val Tyr Trp 100 105 110Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 12089321DNAArtificial SequenceSynthetic hSIRP alpha.40AVL1 89gacatccaga tgacccagtc tccatcctct ctgtccgcct ctgtgggcga cagagtgacc 60atcacctgta gagcctctca ggacatcggc tccagactga actggctgca gcagacccct 120ggcaaggcca tcaagagact gatctacgcc acctccagcc tggattctgg cgtgccctct 180agattctccg gctctagatc tggcaccgac ttctccctga ccatctctgg actgcagcct 240gaggacttcg ccacctacta ctgtctgcag tacgccagct ctccattcac ctttggcgga 300ggcaccaagg tggaaatcca c 32190107PRTArtificial SequenceSynthetic hSIRP alpha.40AVL1 90Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Asp Ile Gly Ser Arg 20 25 30Leu Asn Trp Leu Gln Gln Thr Pro Gly Lys Ala Ile Lys Arg Leu Ile 35 40 45Tyr Ala Thr Ser Ser Leu Asp Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Arg Ser Gly Thr Asp Phe Ser Leu Thr Ile Ser Gly Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Leu Gln Tyr Ala Ser Ser Pro Phe 85 90 95Thr Phe Gly Gly Gly Thr Lys Val Glu Ile His 100 10591321DNAArtificial SequenceSynthetic hSIRP alpha.40AVL2 91gacatccaga tgacccagtc tccatcctct ctgtccgcct ctgtgggcga cagagtgacc 60atcacctgta gagcctctca ggacatcggc tccagactga actggctgca gcagaagcct 120ggcaaggcca tcaagagact gatctacgcc acctccagcc tggattctgg cgtgccctct 180agattctccg gctctagatc tggcaccgac tttaccctga caatcagctc cctgcagcct 240gaggacttcg ccacctacta ctgtctgcag tacgcctcct ctccattcac ctttggccag 300ggcaccaagg tggaaatcaa g 32192107PRTArtificial SequenceSynthetic hSIRP alpha.40AVL2 92Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Asp Ile Gly Ser Arg 20 25 30Leu Asn Trp Leu Gln Gln Lys Pro Gly Lys Ala Ile Lys Arg Leu Ile 35 40 45Tyr Ala Thr Ser Ser Leu Asp Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Arg Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Leu Gln Tyr Ala Ser Ser Pro Phe 85 90 95Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys 100 10593321DNAArtificial SequenceSynthetic hSIRP alpha.40AVL3 93gacatccaga tgacccagtc tccatcctct ctgtccgcct ctgtgggcga cagagtgacc 60atcacctgta gagcctctca ggacatcggc tccagactga actggctgca gcagaagcct 120ggcaaggcca tcaagagact gatctacgcc acctccagcc tggattctgg cgtgccctct 180agattctccg gctctagatc tggcaccgac tttaccctga caatcagctc cctgcagcct 240gaggacttcg ccacctacta ctgtctgcag tacgccagct ctccattcac ctttggcgga 300ggcaccaagc tggaaatcaa g 32194107PRTArtificial SequenceSynthetic

hSIRP alpha.40AVL3 94Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Asp Ile Gly Ser Arg 20 25 30Leu Asn Trp Leu Gln Gln Lys Pro Gly Lys Ala Ile Lys Arg Leu Ile 35 40 45Tyr Ala Thr Ser Ser Leu Asp Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Arg Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Leu Gln Tyr Ala Ser Ser Pro Phe 85 90 95Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys 100 10595321DNAArtificial SequenceSynthetic hSIRP alpha.40AVL4 95gacatccaga tgacccagtc tccatcctct ctgtccgcct ctgtgggcga cagagtgacc 60atcacctgta gagcctctca ggacatcggc tccagactga actggctgca gcagaagcct 120ggcaaggccc ctaagagact gatctacgcc acctccagcc tggattctgg cgtgccctct 180agattctccg gctctggctc tggcaccgag tttaccctga caatcagctc cctgcagcct 240gaggacttcg ccacctacta ctgtctgcag tacgccagct ctccattcac ctttggcgga 300ggcaccaagg tggaaatcaa g 32196107PRTArtificial SequenceSynthetic hSIRP alpha.40AVL4 96Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Asp Ile Gly Ser Arg 20 25 30Leu Asn Trp Leu Gln Gln Lys Pro Gly Lys Ala Pro Lys Arg Leu Ile 35 40 45Tyr Ala Thr Ser Ser Leu Asp Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Leu Gln Tyr Ala Ser Ser Pro Phe 85 90 95Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys 100 10597321DNAArtificial SequenceSynthetic hSIRP alpha.40AVL5 97gacatccaga tgacccagtc tccatcctct ctgtccgcct ctgtgggcga cagagtgacc 60atcacctgta gagcctctca ggacatcggc tccagactga actggctgca gcagaagcct 120ggcaaggcca tcaagagact gatctacgcc acctccagcc tggattctgg cgtgcccaag 180agattctccg gctctagatc cggctccgac tataccctga caatcagctc cctgcagcct 240gaggacttcg ccacctacta ctgtctgcag tacgcctcct ctccattcac ctttggccag 300ggcaccaagg tggaaatcaa g 32198107PRTArtificial SequenceSynthetic hSIRP alpha.40AVL5 98Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Asp Ile Gly Ser Arg 20 25 30Leu Asn Trp Leu Gln Gln Lys Pro Gly Lys Ala Ile Lys Arg Leu Ile 35 40 45Tyr Ala Thr Ser Ser Leu Asp Ser Gly Val Pro Lys Arg Phe Ser Gly 50 55 60Ser Arg Ser Gly Ser Asp Tyr Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Leu Gln Tyr Ala Ser Ser Pro Phe 85 90 95Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys 100 10599321DNAArtificial SequenceSynthetic hSIRP alpha.40AVL6 99gacatccaga tgacccagtc tccatcctct ctgtctgctt ccctgggcga gagagtgtcc 60atcacctgta gagcctctca ggacatcggc tccagactga actggctgca gcagaagcct 120ggcaaggcca tcaagagact gatctacgcc acctccagcc tggattctgg cgtgccctct 180agattctccg gctctagatc tggcaccgac tttaccctga caatcagctc cctgcagcct 240gaggacttcg ccacctacta ctgtctgcag tacgccagct ctccattcac ctttggcgga 300ggcaccaagg tggaaatcaa g 321100107PRTArtificial SequenceSynthetic hSIRP alpha.40AVL6 100Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Leu Gly1 5 10 15Glu Arg Val Ser Ile Thr Cys Arg Ala Ser Gln Asp Ile Gly Ser Arg 20 25 30Leu Asn Trp Leu Gln Gln Lys Pro Gly Lys Ala Ile Lys Arg Leu Ile 35 40 45Tyr Ala Thr Ser Ser Leu Asp Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Arg Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Leu Gln Tyr Ala Ser Ser Pro Phe 85 90 95Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys 100 105101366DNAArtificial SequenceSynthetic hSIRP alpha.40A mouse VH 101gaggttcagt tccagcagtc tgggactgtg ctggcaaggc cagggacttc agtgaagatg 60tcctgcaagg cttctggctc cacctttacc agctactgga tgcactgggt aaaacagggg 120cctggacagg gtctgcaatg gattggcgct atttatcctg taaataatga tactacctat 180aatcagaagt tcaagggcaa ggccgaactc actgtagtca cttccaccag cactgcctac 240atggaggtca gtagtctgac aaatgaggac tctgcggtct attactgtac aagatcgttc 300tactatagtc tcgacgcggc ctggtttgtt tactggggcc aagggactct ggtcactgtc 360tctgca 366102122PRTArtificial SequenceSynthetic hSIRP alpha.40A mouse VH 102Glu Val Gln Phe Gln Gln Ser Gly Thr Val Leu Ala Arg Pro Gly Thr1 5 10 15Ser Val Lys Met Ser Cys Lys Ala Ser Gly Ser Thr Phe Thr Ser Tyr 20 25 30Trp Met His Trp Val Lys Gln Gly Pro Gly Gln Gly Leu Gln Trp Ile 35 40 45Gly Ala Ile Tyr Pro Val Asn Asn Asp Thr Thr Tyr Asn Gln Lys Phe 50 55 60Lys Gly Lys Ala Glu Leu Thr Val Val Thr Ser Thr Ser Thr Ala Tyr65 70 75 80Met Glu Val Ser Ser Leu Thr Asn Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95Thr Arg Ser Phe Tyr Tyr Ser Leu Asp Ala Ala Trp Phe Val Tyr Trp 100 105 110Gly Gln Gly Thr Leu Val Thr Val Ser Ala 115 120103321DNAArtificial SequenceSynthetic hSIRP alpha.40A mouse VL 103gacatccaga tgacccagtc tccatcctcc ttatctgcct ctctgggaga aagagtcagt 60ctcacttgtc gggcaagtca ggacattggt agtaggttaa actggcttca gcaggaacca 120gatggaacta ttaaacgcct gatctacgcc acatccagtt tagattctgg tgtccccaaa 180aggttcagtg gcagtaggtc tgggtcagat tattctctca ccatcagcgg ccttgagtct 240gaagactttg tagactatta ctgtctacaa tatgctagtt ctccgttcac gttcggaggg 300gggaccaagc tggaaataaa c 321104107PRTArtificial SequenceSynthetic hSIRP alpha.40A mouse VL 104Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Leu Gly1 5 10 15Glu Arg Val Ser Leu Thr Cys Arg Ala Ser Gln Asp Ile Gly Ser Arg 20 25 30Leu Asn Trp Leu Gln Gln Glu Pro Asp Gly Thr Ile Lys Arg Leu Ile 35 40 45Tyr Ala Thr Ser Ser Leu Asp Ser Gly Val Pro Lys Arg Phe Ser Gly 50 55 60Ser Arg Ser Gly Ser Asp Tyr Ser Leu Thr Ile Ser Gly Leu Glu Ser65 70 75 80Glu Asp Phe Val Asp Tyr Tyr Cys Leu Gln Tyr Ala Ser Ser Pro Phe 85 90 95Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Asn 100 105105446PRTArtificial SequenceSynthetic hSIRP alpha.40A mouse heavy chain 105Glu Val Gln Phe Gln Gln Ser Gly Thr Val Leu Ala Arg Pro Gly Thr1 5 10 15Ser Val Lys Met Ser Cys Lys Ala Ser Gly Ser Thr Phe Thr Ser Tyr 20 25 30Trp Met His Trp Val Lys Gln Gly Pro Gly Gln Gly Leu Gln Trp Ile 35 40 45Gly Ala Ile Tyr Pro Val Asn Asn Asp Thr Thr Tyr Asn Gln Lys Phe 50 55 60Lys Gly Lys Ala Glu Leu Thr Val Val Thr Ser Thr Ser Thr Ala Tyr65 70 75 80Met Glu Val Ser Ser Leu Thr Asn Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95Thr Arg Ser Phe Tyr Tyr Ser Leu Asp Ala Ala Trp Phe Val Tyr Trp 100 105 110Gly Gln Gly Thr Leu Val Thr Val Ser Ala Ala Lys Thr Thr Pro Pro 115 120 125Ser Val Tyr Pro Leu Ala Pro Gly Ser Ala Ala Gln Thr Asn Ser Met 130 135 140Val Thr Leu Gly Cys Leu Val Lys Gly Tyr Phe Pro Glu Pro Val Thr145 150 155 160Val Thr Trp Asn Ser Gly Ser Leu Ser Ser Gly Val His Thr Phe Pro 165 170 175Ala Val Leu Gln Ser Asp Leu Tyr Thr Leu Ser Ser Ser Val Thr Val 180 185 190Pro Ser Ser Thr Trp Pro Ser Glu Thr Val Thr Cys Asn Val Ala His 195 200 205Pro Ala Ser Ser Thr Lys Val Asp Lys Lys Ile Val Pro Arg Asp Cys 210 215 220Gly Cys Lys Pro Cys Ile Cys Thr Val Pro Glu Val Ser Ser Val Phe225 230 235 240Ile Phe Pro Pro Lys Pro Lys Asp Val Leu Thr Ile Thr Leu Thr Pro 245 250 255Lys Val Thr Cys Val Val Val Asp Ile Ser Lys Asp Asp Pro Glu Val 260 265 270Gln Phe Ser Trp Phe Val Asp Asp Val Glu Val His Thr Ala Gln Thr 275 280 285Gln Pro Arg Glu Glu Gln Phe Asn Ser Thr Phe Arg Ser Val Ser Glu 290 295 300Leu Pro Ile Met His Gln Asp Trp Leu Asn Gly Lys Glu Phe Lys Cys305 310 315 320Arg Val Asn Ser Ala Ala Phe Pro Ala Pro Ile Glu Lys Thr Ile Ser 325 330 335Lys Thr Lys Gly Arg Pro Lys Ala Pro Gln Val Tyr Thr Ile Pro Pro 340 345 350Pro Lys Glu Gln Met Ala Lys Asp Lys Val Ser Leu Thr Cys Met Ile 355 360 365Thr Asp Phe Phe Pro Glu Asp Ile Thr Val Glu Trp Gln Trp Asn Gly 370 375 380Gln Pro Ala Glu Asn Tyr Lys Asn Thr Gln Pro Ile Met Asp Thr Asp385 390 395 400Gly Ser Tyr Phe Val Tyr Ser Lys Leu Asn Val Gln Lys Ser Asn Trp 405 410 415Glu Ala Gly Asn Thr Phe Thr Cys Ser Val Leu His Glu Gly Leu His 420 425 430Asn His His Thr Glu Lys Ser Leu Ser His Ser Pro Gly Lys 435 440 445106214PRTArtificial SequenceSynthetic hSIRP alpha.40A mouse light chain 106Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Leu Gly1 5 10 15Glu Arg Val Ser Leu Thr Cys Arg Ala Ser Gln Asp Ile Gly Ser Arg 20 25 30Leu Asn Trp Leu Gln Gln Glu Pro Asp Gly Thr Ile Lys Arg Leu Ile 35 40 45Tyr Ala Thr Ser Ser Leu Asp Ser Gly Val Pro Lys Arg Phe Ser Gly 50 55 60Ser Arg Ser Gly Ser Asp Tyr Ser Leu Thr Ile Ser Gly Leu Glu Ser65 70 75 80Glu Asp Phe Val Asp Tyr Tyr Cys Leu Gln Tyr Ala Ser Ser Pro Phe 85 90 95Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Asn Arg Ala Asp Ala Ala 100 105 110Pro Thr Val Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly 115 120 125Gly Ala Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile 130 135 140Asn Val Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu145 150 155 160Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser 165 170 175Ser Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr 180 185 190Thr Cys Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser 195 200 205Phe Asn Arg Asn Glu Cys 210107581PRTArtificial SequenceSynthetic rhSIRP alpha/Fc 107Gly Val Ala Gly Glu Glu Glu Leu Gln Val Ile Gln Pro Asp Lys Ser1 5 10 15Val Leu Val Ala Ala Gly Glu Thr Ala Thr Leu Arg Cys Thr Ala Thr 20 25 30Ser Leu Ile Pro Val Gly Pro Ile Gln Trp Phe Arg Gly Ala Gly Pro 35 40 45Gly Arg Glu Leu Ile Tyr Asn Gln Lys Glu Gly His Phe Pro Arg Val 50 55 60Thr Thr Val Ser Asp Leu Thr Lys Arg Asn Asn Met Asp Phe Ser Ile65 70 75 80Arg Ile Gly Asn Ile Thr Pro Ala Asp Ala Gly Thr Tyr Tyr Cys Val 85 90 95Lys Phe Arg Lys Gly Ser Pro Asp Asp Val Glu Phe Lys Ser Gly Ala 100 105 110Gly Thr Glu Leu Ser Val Arg Ala Lys Pro Ser Ala Pro Val Val Ser 115 120 125Gly Pro Ala Ala Arg Ala Thr Pro Gln His Thr Val Ser Phe Thr Cys 130 135 140Glu Ser His Gly Phe Ser Pro Arg Asp Ile Thr Leu Lys Trp Phe Lys145 150 155 160Asn Gly Asn Glu Leu Ser Asp Phe Gln Thr Asn Val Asp Pro Val Gly 165 170 175Glu Ser Val Ser Tyr Ser Ile His Ser Thr Ala Lys Val Val Leu Thr 180 185 190Arg Glu Asp Val His Ser Gln Val Ile Cys Glu Val Ala His Val Thr 195 200 205Leu Gln Gly Asp Pro Leu Arg Gly Thr Ala Asn Leu Ser Glu Thr Ile 210 215 220Arg Val Pro Pro Thr Leu Glu Val Thr Gln Gln Pro Val Arg Ala Glu225 230 235 240Asn Gln Val Asn Val Thr Cys Gln Val Arg Lys Phe Tyr Pro Gln Arg 245 250 255Leu Gln Leu Thr Trp Leu Glu Asn Gly Asn Val Ser Arg Thr Glu Thr 260 265 270Ala Ser Thr Val Thr Glu Asn Lys Asp Gly Thr Tyr Asn Trp Met Ser 275 280 285Trp Leu Leu Val Asn Val Ser Ala His Arg Asp Asp Val Lys Leu Thr 290 295 300Cys Gln Val Glu His Asp Gly Gln Pro Ala Val Ser Lys Ser His Asp305 310 315 320Leu Lys Val Ser Ala His Pro Lys Glu Gln Gly Ser Asn Thr Ala Ala 325 330 335Glu Asn Thr Gly Ser Asn Glu Arg Ile Glu Gly Arg Met Asp Pro Lys 340 345 350Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 355 360 365Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr 370 375 380Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val385 390 395 400Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 405 410 415Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser 420 425 430Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 435 440 445Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 450 455 460Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro465 470 475 480Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln 485 490 495Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala 500 505 510Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 515 520 525Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 530 535 540Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser545 550 555 560Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 565 570 575Leu Ser Pro Gly Lys 580108538PRTArtificial SequenceSynthetic rhSIRPg/Fc 108Val Leu Trp Phe Arg Gly Val Gly Pro Gly Arg Glu Leu Ile Tyr Asn1 5 10 15Gln Lys Glu Gly His Phe Pro Arg Val Thr Thr Val Ser Asp Leu Thr 20 25 30Lys Arg Asn Asn Met Asp Phe Ser Ile Arg Ile Ser Ser Ile Thr Pro 35 40 45Ala Asp Val Gly Thr Tyr Tyr Cys Val Lys Phe Arg Lys Gly Ser Pro 50 55 60Glu Asn Val Glu Phe Lys Ser Gly Pro Gly Thr Glu Met Ala Leu Gly65 70 75 80Ala Lys Pro Ser Ala Pro Val Val Leu Gly Pro Ala Ala Arg Thr Thr 85 90 95Pro Glu His Thr Val Ser Phe Thr Cys Glu Ser His Gly Phe Ser Pro 100 105 110Arg Asp Ile Thr Leu Lys Trp Phe Lys Asn Gly Asn Glu Leu Ser Asp 115 120 125Phe Gln Thr Asn Val Asp Pro Thr Gly Gln Ser Val Ala Tyr Ser Ile 130 135 140Arg Ser Thr Ala Arg Val Val Leu Asp Pro Trp

Asp Val Arg Ser Gln145 150 155 160Val Ile Cys Glu Val Ala His Val Thr Leu Gln Gly Asp Pro Leu Arg 165 170 175Gly Thr Ala Asn Leu Ser Glu Ala Ile Arg Val Pro Pro Thr Leu Glu 180 185 190Val Thr Gln Gln Pro Met Arg Ala Gly Asn Gln Val Asn Val Thr Cys 195 200 205Gln Val Arg Lys Phe Tyr Pro Gln Ser Leu Gln Leu Thr Trp Leu Glu 210 215 220Asn Gly Asn Val Cys Gln Arg Glu Thr Ala Ser Thr Leu Thr Glu Asn225 230 235 240Lys Asp Gly Thr Tyr Asn Trp Thr Ser Trp Phe Leu Val Asn Ile Ser 245 250 255Asp Gln Arg Asp Asp Val Val Leu Thr Cys Gln Val Lys His Asp Gly 260 265 270Gln Leu Ala Val Ser Lys Arg Leu Ala Leu Glu Val Thr Val His Gln 275 280 285Lys Asp Gln Ser Ser Asp Ala Thr Pro Gly Pro Ala Ser Ile Glu Gly 290 295 300Arg Met Asp Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys305 310 315 320Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro 325 330 335Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys 340 345 350Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp 355 360 365Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu 370 375 380Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu385 390 395 400His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn 405 410 415Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly 420 425 430Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu 435 440 445Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr 450 455 460Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn465 470 475 480Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe 485 490 495Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn 500 505 510Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr 515 520 525Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 530 535109358PRTArtificial SequenceSynthetic rhCD47/Fc 109Gln Leu Leu Phe Asn Lys Thr Lys Ser Val Glu Phe Thr Phe Cys Asn1 5 10 15Asp Thr Val Val Ile Pro Cys Phe Val Thr Asn Met Glu Ala Gln Asn 20 25 30Thr Thr Glu Val Tyr Val Lys Trp Lys Phe Lys Gly Arg Asp Ile Tyr 35 40 45Thr Phe Asp Gly Ala Leu Asn Lys Ser Thr Val Pro Thr Asp Phe Ser 50 55 60Ser Ala Lys Ile Glu Val Ser Gln Leu Leu Lys Gly Asp Ala Ser Leu65 70 75 80Lys Met Asp Lys Ser Asp Ala Val Ser His Thr Gly Asn Tyr Thr Cys 85 90 95Glu Val Thr Glu Leu Thr Arg Glu Gly Glu Thr Ile Ile Glu Leu Lys 100 105 110Tyr Arg Val Val Ser Trp Phe Ser Pro Ile Glu Gly Arg Met Asp Pro 115 120 125Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu 130 135 140Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp145 150 155 160Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp 165 170 175Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly 180 185 190Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn 195 200 205Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp 210 215 220Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro225 230 235 240Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu 245 250 255Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn 260 265 270Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile 275 280 285Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr 290 295 300Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys305 310 315 320Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys 325 330 335Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu 340 345 350Ser Leu Ser Pro Gly Lys 3551101197DNAArtificial SequenceSynthetic hSIRP-V?C1 beta C2 beta 110atgcccgtgc ctgcctcttg gcctcatctg cccagcccct ttctgctgat gaccctgctg 60ctgggcaggc tgacaggcgt ggcaggcgaa gaggaactgc agatgatcca gcccgagaag 120ctgctgctcg tgaccgtggg caagaccgcc accctgcact gcaccgtgac atccctgctg 180cctgtgggac ccgtgctgtg gtttagaggc gtgggccctg gcagagagct gatctacaac 240cagaaagagg gccacttccc cagagtgacc accgtgtccg acctgaccaa gcggaacaac 300atggacttct ccatccggat ctccagcatc acccctgccg acgtgggcac ctactactgc 360gtgaagttcc ggaagggctc ccccgagaac gtggagttca agtctggccc aggcaccgag 420atggccctgg gcgctaaacc ttctgcccct gtggtgtctg gacctgccgt gcgggctacc 480cctgagcaca ccgtgtcttt tacctgcgag tcccacggct tcagccctcg ggacatcacc 540ctgaagtggt tcaagaacgg caacgagctg tccgacttcc agaccaacgt ggaccctgcc 600ggcgactccg tgtcctactc catccactct accgccagag tggtgctgac cagaggcgac 660gtgcactccc aagtgatctg cgagatcgcc catatcacac tgcagggcga ccccctgaga 720ggcaccgcca atctgtctga ggccatcaga gtgcccccca ccctggaagt gacccagcag 780cctatgagag ccgagaacca ggccaacgtg acctgtcagg tgtccaactt ctaccctcgg 840ggcctgcagc tgacctggct ggaaaacggc aatgtgtccc ggaccgagac agcctccacc 900ctgatcgaga acaaggacgg cacctacaat tggatgtcct ggctgctcgt gaacacctgt 960gcccacaggg acgacgtggt gctgacatgc caggtggaac acgatggcca gcaggccgtg 1020tccaagtcct acgccctgga aatctccgcc catcagaaag agcacggctc cgatatcacc 1080cacgaggccg ctctggctcc taccgctcct ctgctggtgg ctctgctgct gggacctaag 1140ctgctgctgg tcgtgggcgt gtccgccatc tacatctgct ggaagcagaa ggcctga 1197111398PRTArtificial SequenceSynthetic hSIRP-V?C1 beta C2 beta 111Met Pro Val Pro Ala Ser Trp Pro His Leu Pro Ser Pro Phe Leu Leu1 5 10 15Met Thr Leu Leu Leu Gly Arg Leu Thr Gly Val Ala Gly Glu Glu Glu 20 25 30Leu Gln Met Ile Gln Pro Glu Lys Leu Leu Leu Val Thr Val Gly Lys 35 40 45Thr Ala Thr Leu His Cys Thr Val Thr Ser Leu Leu Pro Val Gly Pro 50 55 60Val Leu Trp Phe Arg Gly Val Gly Pro Gly Arg Glu Leu Ile Tyr Asn65 70 75 80Gln Lys Glu Gly His Phe Pro Arg Val Thr Thr Val Ser Asp Leu Thr 85 90 95Lys Arg Asn Asn Met Asp Phe Ser Ile Arg Ile Ser Ser Ile Thr Pro 100 105 110Ala Asp Val Gly Thr Tyr Tyr Cys Val Lys Phe Arg Lys Gly Ser Pro 115 120 125Glu Asn Val Glu Phe Lys Ser Gly Pro Gly Thr Glu Met Ala Leu Gly 130 135 140Ala Lys Pro Ser Ala Pro Val Val Ser Gly Pro Ala Val Arg Ala Thr145 150 155 160Pro Glu His Thr Val Ser Phe Thr Cys Glu Ser His Gly Phe Ser Pro 165 170 175Arg Asp Ile Thr Leu Lys Trp Phe Lys Asn Gly Asn Glu Leu Ser Asp 180 185 190Phe Gln Thr Asn Val Asp Pro Ala Gly Asp Ser Val Ser Tyr Ser Ile 195 200 205His Ser Thr Ala Arg Val Val Leu Thr Arg Gly Asp Val His Ser Gln 210 215 220Val Ile Cys Glu Ile Ala His Ile Thr Leu Gln Gly Asp Pro Leu Arg225 230 235 240Gly Thr Ala Asn Leu Ser Glu Ala Ile Arg Val Pro Pro Thr Leu Glu 245 250 255Val Thr Gln Gln Pro Met Arg Ala Glu Asn Gln Ala Asn Val Thr Cys 260 265 270Gln Val Ser Asn Phe Tyr Pro Arg Gly Leu Gln Leu Thr Trp Leu Glu 275 280 285Asn Gly Asn Val Ser Arg Thr Glu Thr Ala Ser Thr Leu Ile Glu Asn 290 295 300Lys Asp Gly Thr Tyr Asn Trp Met Ser Trp Leu Leu Val Asn Thr Cys305 310 315 320Ala His Arg Asp Asp Val Val Leu Thr Cys Gln Val Glu His Asp Gly 325 330 335Gln Gln Ala Val Ser Lys Ser Tyr Ala Leu Glu Ile Ser Ala His Gln 340 345 350Lys Glu His Gly Ser Asp Ile Thr His Glu Ala Ala Leu Ala Pro Thr 355 360 365Ala Pro Leu Leu Val Ala Leu Leu Leu Gly Pro Lys Leu Leu Leu Val 370 375 380Val Gly Val Ser Ala Ile Tyr Ile Cys Trp Lys Gln Lys Ala385 390 3951121197DNAArtificial SequenceSynthetic hSIRP-V beta C1?C2 beta 112atgcccgtgc ctgcctcttg gcctcatctg cccagcccct ttctgctgat gaccctgctg 60ctgggcaggc tgacaggcgt ggcaggcgaa gatgagctgc aagtgatcca gcccgagaag 120tccgtgtctg tggccgctgg cgagtctgcc accctgagat gcgctatgac ctccctgatc 180cccgtgggcc ccatcatgtg gtttagaggc gctggcgctg gcagagagct gatctacaac 240cagaaagagg gccacttccc cagagtgacc accgtgtccg agctgaccaa gcggaacaac 300ctggacttct ccatctccat cagcaacatc acccctgccg acgccggcac ctactactgc 360gtgaagttcc ggaagggctc ccccgacgac gtggagttca aatccggcgc tggaaccgag 420ctgtccgtgc gggctaaacc ttctgcccct gtggtgctgg gacctgccgc tagaaccacc 480cctgagcaca ccgtgtcttt tacctgcgag tcccacggct tcagccctcg ggacatcacc 540ctgaagtggt tcaagaacgg caacgagctg agcgacttcc agaccaacgt ggaccctacc 600ggccagtccg tggcctactc catcagatcc accgccagag tggtgctgga cccttgggat 660gtgcggtccc aagtgatctg cgaggtggcc catgtgacac tgcagggcga tcctctgaga 720ggcaccgcca atctgtctga ggccatcaga gtgcccccca ccctggaagt gacccagcag 780cctatgagag ccgagaacca ggccaacgtg acctgccagg tgtccaactt ctaccctcgg 840ggcctgcagc tgacctggct ggaaaacggc aatgtgtccc ggaccgagac agcctccacc 900ctgatcgaga acaaggatgg cacctacaat tggatgtcct ggctgctcgt gaacacctgt 960gcccaccggg atgacgtggt gctgacttgt caggtggaac acgacggcca gcaggccgtg 1020tccaagtcct acgccctgga aatctccgcc catcagaaag agcacggctc cgatatcacc 1080cacgaggccg ctctggctcc taccgctcct ctgctggtgg ctctgctgct gggacctaag 1140ctgctgctgg tcgtgggcgt gtccgccatc tacatctgct ggaagcagaa ggcctga 1197113398PRTArtificial SequenceSynthetic hSIRP-V beta C1?C2 beta 113Met Pro Val Pro Ala Ser Trp Pro His Leu Pro Ser Pro Phe Leu Leu1 5 10 15Met Thr Leu Leu Leu Gly Arg Leu Thr Gly Val Ala Gly Glu Asp Glu 20 25 30Leu Gln Val Ile Gln Pro Glu Lys Ser Val Ser Val Ala Ala Gly Glu 35 40 45Ser Ala Thr Leu Arg Cys Ala Met Thr Ser Leu Ile Pro Val Gly Pro 50 55 60Ile Met Trp Phe Arg Gly Ala Gly Ala Gly Arg Glu Leu Ile Tyr Asn65 70 75 80Gln Lys Glu Gly His Phe Pro Arg Val Thr Thr Val Ser Glu Leu Thr 85 90 95Lys Arg Asn Asn Leu Asp Phe Ser Ile Ser Ile Ser Asn Ile Thr Pro 100 105 110Ala Asp Ala Gly Thr Tyr Tyr Cys Val Lys Phe Arg Lys Gly Ser Pro 115 120 125Asp Asp Val Glu Phe Lys Ser Gly Ala Gly Thr Glu Leu Ser Val Arg 130 135 140Ala Lys Pro Ser Ala Pro Val Val Leu Gly Pro Ala Ala Arg Thr Thr145 150 155 160Pro Glu His Thr Val Ser Phe Thr Cys Glu Ser His Gly Phe Ser Pro 165 170 175Arg Asp Ile Thr Leu Lys Trp Phe Lys Asn Gly Asn Glu Leu Ser Asp 180 185 190Phe Gln Thr Asn Val Asp Pro Thr Gly Gln Ser Val Ala Tyr Ser Ile 195 200 205Arg Ser Thr Ala Arg Val Val Leu Asp Pro Trp Asp Val Arg Ser Gln 210 215 220Val Ile Cys Glu Val Ala His Val Thr Leu Gln Gly Asp Pro Leu Arg225 230 235 240Gly Thr Ala Asn Leu Ser Glu Ala Ile Arg Val Pro Pro Thr Leu Glu 245 250 255Val Thr Gln Gln Pro Met Arg Ala Glu Asn Gln Ala Asn Val Thr Cys 260 265 270Gln Val Ser Asn Phe Tyr Pro Arg Gly Leu Gln Leu Thr Trp Leu Glu 275 280 285Asn Gly Asn Val Ser Arg Thr Glu Thr Ala Ser Thr Leu Ile Glu Asn 290 295 300Lys Asp Gly Thr Tyr Asn Trp Met Ser Trp Leu Leu Val Asn Thr Cys305 310 315 320Ala His Arg Asp Asp Val Val Leu Thr Cys Gln Val Glu His Asp Gly 325 330 335Gln Gln Ala Val Ser Lys Ser Tyr Ala Leu Glu Ile Ser Ala His Gln 340 345 350Lys Glu His Gly Ser Asp Ile Thr His Glu Ala Ala Leu Ala Pro Thr 355 360 365Ala Pro Leu Leu Val Ala Leu Leu Leu Gly Pro Lys Leu Leu Leu Val 370 375 380Val Gly Val Ser Ala Ile Tyr Ile Cys Trp Lys Gln Lys Ala385 390 3951141197DNAArtificial SequenceSynthetic hSIRP-V beta C1 beta C2? 114atgcccgtgc ctgcctcttg gcctcatctg cccagcccct ttctgctgat gaccctgctg 60ctgggcaggc tgacaggcgt ggcaggcgaa gatgagctgc aagtgatcca gcccgagaag 120tccgtgtctg tggccgctgg cgagtctgcc accctgagat gcgctatgac ctccctgatc 180cccgtgggcc ccatcatgtg gtttagaggc gctggcgctg gcagagagct gatctacaac 240cagaaagagg gccacttccc cagagtgacc accgtgtccg agctgaccaa gcggaacaac 300ctggacttct ccatctccat cagcaacatc acccctgccg acgccggcac ctactactgc 360gtgaagttcc ggaagggctc ccccgacgac gtggagttca aatccggcgc tggaaccgag 420ctgtccgtgc gggctaaacc ttctgcccct gtggtgtctg gacctgctgt gcgcgctacc 480cctgagcaca ccgtgtcttt tacctgcgag tcccacggct tcagccctcg ggacatcacc 540ctgaagtggt tcaagaacgg caacgagctg agcgacttcc agaccaacgt ggaccctgcc 600ggcgactccg tgtcctactc catccactct accgccagag tggtgctgac cagaggcgac 660gtgcactccc aagtgatctg cgagatcgcc catatcacac tgcagggcga ccccctgaga 720ggcaccgcca atctgtctga ggccatcaga gtgcccccca ccctggaagt gacccagcag 780cctatgagag tgggcaacca agtgaacgtg acctgccaag tgcggaagtt ctacccccag 840tccctgcagc tgacttggag cgagaatggc aacgtgtgcc agagagagac agcctccacc 900ctgaccgaga acaaggacgg aacctacaac tggacctcct ggttcctcgt gaacatctcc 960gaccagcggg acgacgtggt gctgacatgc caagtgaagc acgatggaca gctggccgtg 1020tccaagcggc tggctctgga agtgacagtg caccagaaag agcacggctc cgacatcacc 1080cacgaggccg ctctggctcc tacagctcct ctgctggtgg ctctgctgct gggacctaag 1140ctgctgctgg tcgtgggcgt gtccgccatc tacatctgct ggaagcagaa ggcctga 1197115398PRTArtificial SequenceSynthetic hSIRP-V beta C1 beta C2? 115Met Pro Val Pro Ala Ser Trp Pro His Leu Pro Ser Pro Phe Leu Leu1 5 10 15Met Thr Leu Leu Leu Gly Arg Leu Thr Gly Val Ala Gly Glu Asp Glu 20 25 30Leu Gln Val Ile Gln Pro Glu Lys Ser Val Ser Val Ala Ala Gly Glu 35 40 45Ser Ala Thr Leu Arg Cys Ala Met Thr Ser Leu Ile Pro Val Gly Pro 50 55 60Ile Met Trp Phe Arg Gly Ala Gly Ala Gly Arg Glu Leu Ile Tyr Asn65 70 75 80Gln Lys Glu Gly His Phe Pro Arg Val Thr Thr Val Ser Glu Leu Thr 85 90 95Lys Arg Asn Asn Leu Asp Phe Ser Ile Ser Ile Ser Asn Ile Thr Pro 100 105 110Ala Asp Ala Gly Thr Tyr Tyr Cys Val Lys Phe Arg Lys Gly Ser Pro 115 120 125Asp Asp Val Glu Phe Lys Ser Gly Ala Gly Thr Glu Leu Ser Val Arg 130 135 140Ala Lys Pro Ser Ala Pro Val Val Ser Gly Pro Ala Val Arg Ala Thr145 150 155 160Pro Glu His Thr Val Ser Phe Thr Cys Glu Ser His Gly Phe Ser Pro 165 170 175Arg Asp Ile Thr Leu Lys Trp Phe Lys Asn Gly Asn Glu Leu Ser Asp 180 185 190Phe Gln Thr Asn Val Asp Pro Ala Gly Asp Ser Val Ser Tyr Ser Ile 195 200 205His Ser Thr Ala Arg Val Val Leu Thr Arg Gly Asp Val His Ser Gln 210 215 220Val Ile Cys Glu Ile Ala His Ile Thr Leu Gln Gly Asp Pro Leu Arg225 230 235 240Gly Thr Ala Asn Leu Ser Glu Ala Ile Arg Val Pro Pro Thr Leu Glu 245 250 255Val Thr Gln Gln Pro Met Arg Val Gly Asn Gln Val Asn Val Thr Cys 260 265 270Gln Val Arg Lys Phe Tyr Pro Gln Ser Leu Gln Leu Thr Trp Ser Glu 275

280 285Asn Gly Asn Val Cys Gln Arg Glu Thr Ala Ser Thr Leu Thr Glu Asn 290 295 300Lys Asp Gly Thr Tyr Asn Trp Thr Ser Trp Phe Leu Val Asn Ile Ser305 310 315 320Asp Gln Arg Asp Asp Val Val Leu Thr Cys Gln Val Lys His Asp Gly 325 330 335Gln Leu Ala Val Ser Lys Arg Leu Ala Leu Glu Val Thr Val His Gln 340 345 350Lys Glu His Gly Ser Asp Ile Thr His Glu Ala Ala Leu Ala Pro Thr 355 360 365Ala Pro Leu Leu Val Ala Leu Leu Leu Gly Pro Lys Leu Leu Leu Val 370 375 380Val Gly Val Ser Ala Ile Tyr Ile Cys Trp Lys Gln Lys Ala385 390 3951161194DNAHomo sapiensmisc_feature(1)..(1194)human SIRP beta L 116atgcctgtgc ctgcctcttg gcctcatctg ccctctccat ttctgctgat gaccctgctg 60ctgggcagac tgacaggtgt tgctggcgaa gaggaactgc aagtgatcca gcctgacaag 120agcatctctg tggccgctgg cgaatctgcc acactgcact gtaccgtgac atctctgatc 180cctgtgggcc ccatccagtg gtttagaggt gctggacctg gcagagagct gatctacaac 240cagaaagagg gacacttccc cagagtgacc accgtgtccg acctgaccaa gcggaacaac 300atggacttca gcatccggat cagcaacatc acccctgccg atgccggcac ctactactgc 360gtgaagttca gaaagggcag ccccgaccac gtcgagttta aaagcggagc cggcacagag 420ctgagcgtgc gggctaaacc ttctgctcct gtggtgtctg gaccagccgc tagagctaca 480cctcagcaca ccgtgtcttt tacctgcgag agccacggct tcagccccag agatatcacc 540ctgaagtggt tcaagaacgg caacgagctg tccgacttcc agaccaatgt ggacccagcc 600ggcgatagcg tgtcctacag cattcacagc accgccaagg tggtgctgac ccgggaagat 660gtgcacagcc aagtgatttg cgaggtggcc cacgttaccc tgcaaggcga tcctctgaga 720ggaaccgcca acctgagcga gacaatccgg gtgccaccta cactggaagt gacccagcag 780cctgtgcggg ccgagaatca agtgaacgtg acctgccaag tgcggaagtt ctaccctcag 840agactgcagc tgacctggct ggaaaacggc aatgtgtccc ggaccgagac agccagcaca 900ctgaccgaga acaaggatgg cacctacaat tggatgagct ggctgctggt caatgtgtct 960gcccaccggg acgatgtgaa gctgacatgc caggtggaac acgatggcca gcctgccgtg 1020tctaagagcc acgacctgaa ggtgtccgct catcccaaag agcagggcag caatactgcc 1080cctggacctg ctcttgcttc tgccgctcct ctgctgatcg cctttctgct gggacctaag 1140gtgctgctgg ttgtgggagt gtccgtgatc tacgtgtact ggaagcagaa ggcc 1194117398PRTHomo sapiensmisc_feature(1)..(398)human SIRP beta L 117Met Pro Val Pro Ala Ser Trp Pro His Leu Pro Ser Pro Phe Leu Leu1 5 10 15Met Thr Leu Leu Leu Gly Arg Leu Thr Gly Val Ala Gly Glu Glu Glu 20 25 30Leu Gln Val Ile Gln Pro Asp Lys Ser Ile Ser Val Ala Ala Gly Glu 35 40 45Ser Ala Thr Leu His Cys Thr Val Thr Ser Leu Ile Pro Val Gly Pro 50 55 60Ile Gln Trp Phe Arg Gly Ala Gly Pro Gly Arg Glu Leu Ile Tyr Asn65 70 75 80Gln Lys Glu Gly His Phe Pro Arg Val Thr Thr Val Ser Asp Leu Thr 85 90 95Lys Arg Asn Asn Met Asp Phe Ser Ile Arg Ile Ser Asn Ile Thr Pro 100 105 110Ala Asp Ala Gly Thr Tyr Tyr Cys Val Lys Phe Arg Lys Gly Ser Pro 115 120 125Asp His Val Glu Phe Lys Ser Gly Ala Gly Thr Glu Leu Ser Val Arg 130 135 140Ala Lys Pro Ser Ala Pro Val Val Ser Gly Pro Ala Ala Arg Ala Thr145 150 155 160Pro Gln His Thr Val Ser Phe Thr Cys Glu Ser His Gly Phe Ser Pro 165 170 175Arg Asp Ile Thr Leu Lys Trp Phe Lys Asn Gly Asn Glu Leu Ser Asp 180 185 190Phe Gln Thr Asn Val Asp Pro Ala Gly Asp Ser Val Ser Tyr Ser Ile 195 200 205His Ser Thr Ala Lys Val Val Leu Thr Arg Glu Asp Val His Ser Gln 210 215 220Val Ile Cys Glu Val Ala His Val Thr Leu Gln Gly Asp Pro Leu Arg225 230 235 240Gly Thr Ala Asn Leu Ser Glu Thr Ile Arg Val Pro Pro Thr Leu Glu 245 250 255Val Thr Gln Gln Pro Val Arg Ala Glu Asn Gln Val Asn Val Thr Cys 260 265 270Gln Val Arg Lys Phe Tyr Pro Gln Arg Leu Gln Leu Thr Trp Leu Glu 275 280 285Asn Gly Asn Val Ser Arg Thr Glu Thr Ala Ser Thr Leu Thr Glu Asn 290 295 300Lys Asp Gly Thr Tyr Asn Trp Met Ser Trp Leu Leu Val Asn Val Ser305 310 315 320Ala His Arg Asp Asp Val Lys Leu Thr Cys Gln Val Glu His Asp Gly 325 330 335Gln Pro Ala Val Ser Lys Ser His Asp Leu Lys Val Ser Ala His Pro 340 345 350Lys Glu Gln Gly Ser Asn Thr Ala Pro Gly Pro Ala Leu Ala Ser Ala 355 360 365Ala Pro Leu Leu Ile Ala Phe Leu Leu Gly Pro Lys Val Leu Leu Val 370 375 380Val Gly Val Ser Val Ile Tyr Val Tyr Trp Lys Gln Lys Ala385 390 395118990DNAHomo sapiensmisc_feature(1)..(990)human IgG1 constant domains 118gccagcacca agggcccatc ggtcttcccc ctggcaccct cctccaagag cacctctggg 60ggcacagcgg ccctgggctg cctggtcaag gactacttcc ccgaaccggt gacggtgtcg 120tggaactcag gcgccctgac cagcggcgtg cacaccttcc cggctgtcct acagtcctca 180ggactctact ccctcagcag cgtggtgacc gtgccctcca gcagcttggg cacccagacc 240tacatctgca acgtgaatca caagcccagc aacaccaagg tggacaagaa agttgagccc 300aaatcttgtg acaaaactca cacatgccca ccgtgcccag cacctgaact cctgggggga 360ccgtcagtct tcctcttccc cccaaaaccc aaggacaccc tcatgatctc ccggacccct 420gaggtcacat gcgtggtggt ggacgtgagc cacgaagacc ctgaggtcaa gttcaactgg 480tacgtggacg gcgtggaggt gcataatgcc aagacaaagc cgcgggagga gcagtacaac 540agcacgtacc gggtggtcag cgtcctcacc gtcctgcacc aggactggct gaatggcaag 600gagtacaagt gcaaggtctc caacaaagcc ctcccagccc ccatcgagaa aaccatctcc 660aaagccaaag ggcagccccg agaaccacag gtgtacaccc tgcccccatc ccgggatgag 720ctgaccaaga accaggtcag cctgacctgc ctggtcaaag gcttctatcc cagcgacatc 780gccgtggagt gggagagcaa tgggcagccg gagaacaact acaagaccac gcctcccgtg 840ctggactccg acggctcctt cttcctctac agcaagctca ccgtggacaa gagcaggtgg 900cagcagggga acgtcttctc atgctccgtg atgcatgagg ctctgcacaa ccactacacg 960cagaagagcc tctccctgtc tccgggtaaa 990119330PRTHomo sapiensmisc_feature(1)..(330)human IgG1 constant domains 119Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys1 5 10 15Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr65 70 75 80Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys 100 105 110Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro 115 120 125Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys 130 135 140Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp145 150 155 160Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu 165 170 175Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu 180 185 190His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn 195 200 205Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly 210 215 220Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu225 230 235 240Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr 245 250 255Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn 260 265 270Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe 275 280 285Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn 290 295 300Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr305 310 315 320Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 325 330120336PRTMus musculusmisc_feature(1)..(336)mouse IgG1 constant domains 120Ala Lys Thr Thr Pro Pro Ser Val Tyr Pro Leu Ala Pro Gly Cys Gly1 5 10 15Asp Thr Thr Gly Ser Ser Val Thr Leu Gly Cys Leu Val Lys Gly Tyr 20 25 30Phe Pro Glu Ser Val Thr Val Thr Trp Asn Ser Gly Ser Leu Ser Ser 35 40 45Ser Val His Thr Phe Pro Ala Leu Leu Gln Ser Gly Leu Tyr Thr Met 50 55 60Ser Ser Ser Val Thr Val Pro Ser Ser Thr Trp Pro Ser Gln Thr Val65 70 75 80Thr Cys Ser Val Ala His Pro Ala Ser Ser Thr Thr Val Asp Lys Lys 85 90 95Leu Glu Pro Ser Gly Pro Ile Ser Thr Ile Asn Pro Cys Pro Pro Cys 100 105 110Lys Glu Cys His Lys Cys Pro Ala Pro Asn Leu Glu Gly Gly Pro Ser 115 120 125Val Phe Ile Phe Pro Pro Asn Ile Lys Asp Val Leu Met Ile Ser Leu 130 135 140Thr Pro Lys Val Thr Cys Val Val Val Asp Val Ser Glu Asp Asp Pro145 150 155 160Asp Val Gln Ile Ser Trp Phe Val Asn Asn Val Glu Val His Thr Ala 165 170 175Gln Thr Gln Thr His Arg Glu Asp Tyr Asn Ser Thr Ile Arg Val Val 180 185 190Ser Thr Leu Pro Ile Gln His Gln Asp Trp Met Ser Gly Lys Glu Phe 195 200 205Lys Cys Lys Val Asn Asn Lys Asp Leu Pro Ser Pro Ile Glu Arg Thr 210 215 220Ile Ser Lys Ile Lys Gly Leu Val Arg Ala Pro Gln Val Tyr Ile Leu225 230 235 240Pro Pro Pro Ala Glu Gln Leu Ser Arg Lys Asp Val Ser Leu Thr Cys 245 250 255Leu Val Val Gly Phe Asn Pro Gly Asp Ile Ser Val Glu Trp Thr Ser 260 265 270Asn Gly His Thr Glu Glu Asn Tyr Lys Asp Thr Ala Pro Val Leu Asp 275 280 285Ser Asp Gly Ser Tyr Phe Ile Tyr Ser Lys Leu Asn Met Lys Thr Ser 290 295 300Lys Trp Glu Lys Thr Asp Ser Phe Ser Cys Asn Val Arg His Glu Gly305 310 315 320Leu Lys Asn Tyr Tyr Leu Lys Lys Thr Ile Ser Arg Ser Pro Gly Lys 325 330 335121107PRTMus musculusmisc_feature(1)..(107)mouse kappa constant domain 121Arg Ala Asp Ala Ala Pro Thr Val Ser Ile Phe Pro Pro Ser Ser Glu1 5 10 15Gln Leu Thr Ser Gly Gly Ala Ser Val Val Cys Phe Leu Asn Asn Phe 20 25 30Tyr Pro Lys Asp Ile Asn Val Lys Trp Lys Ile Asp Gly Ser Glu Arg 35 40 45Gln Asn Gly Val Leu Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp Ser 50 55 60Thr Tyr Ser Met Ser Ser Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu65 70 75 80Arg His Asn Ser Tyr Thr Cys Glu Ala Thr His Lys Thr Ser Thr Ser 85 90 95Pro Ile Val Lys Ser Phe Asn Arg Asn Glu Cys 100 105122326PRTHomo sapiensmisc_feature(1)..(326)human IgG2 constant domains, V234A-G237A-P238S-H268A-V309L-A330S-P331S (Sigma) mutantmisc_feature(257)..(257)X is A or S 122Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Cys Ser Arg1 5 10 15Ser Thr Ser Glu Ser Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val Val Thr Val Pro Ser Ser Asn Phe Gly Thr Gln Thr65 70 75 80Tyr Thr Cys Asn Val Asp His Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Thr Val Glu Arg Lys Cys Cys Val Glu Cys Pro Pro Cys Pro Ala Pro 100 105 110Pro Ala Ala Ala Ser Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp 115 120 125Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp 130 135 140Val Ser Ala Glu Asp Pro Glu Val Gln Phe Asn Trp Tyr Val Asp Gly145 150 155 160Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Phe Asn 165 170 175Ser Thr Phe Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp 180 185 190Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Gly Leu Pro 195 200 205Ser Ser Ile Glu Lys Thr Ile Ser Lys Thr Lys Gly Gln Pro Arg Glu 210 215 220Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn225 230 235 240Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile 245 250 255Xaa Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr 260 265 270Thr Pro Pro Met Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys 275 280 285Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys 290 295 300Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu305 310 315 320Ser Leu Ser Pro Gly Lys 325123330PRTHomo sapiensmisc_feature(1)..(330)human IgG1 constant domains, L234A-L235A mutant 123Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys1 5 10 15Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr65 70 75 80Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys 100 105 110Pro Ala Pro Glu Ala Ala Gly Gly Pro Ser Val Phe Leu Phe Pro Pro 115 120 125Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys 130 135 140Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp145 150 155 160Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu 165 170 175Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu 180 185 190His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn 195 200 205Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly 210 215 220Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu225 230 235 240Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr 245 250 255Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn 260 265 270Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe 275 280 285Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn 290 295 300Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr305 310 315 320Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 325 330124990DNAHomo sapiensmisc_feature(1)..(990)human IgG1 constant domains, L234A-L235A-P329G mutant 124gctagcacaa agggccctag tgtgtttcct ctggctccct cttccaaatc cacttctggt 60ggcactgctg ctctgggatg cctggtgaag gattactttc ctgaacctgt gactgtctca 120tggaactctg gtgctctgac ttctggtgtc cacactttcc ctgctgtgct gcagtctagt 180ggactgtact ctctgtcatc tgtggtcact gtgccctctt catctctggg aacccagacc 240tacatttgta atgtgaacca caaaccatcc

aacactaaag tggacaaaaa agtggaaccc 300aaatcctgtg acaaaaccca cacctgccca ccttgtccgg cgcctgaagc ggcgggagga 360ccttctgtgt ttctgttccc ccccaaacca aaggataccc tgatgatctc gcgaacccct 420gaggtgacat gtgtggtggt ggatgtgtct catgaggacc ccgaagtcaa atttaattgg 480tatgtcgacg gcgtcgaggt gcataatgcc aaaaccaagc ctagagagga acagtacaat 540tcaacctaca gagtcgtcag tgtgctgact gtgctgcatc aggattggct gaatggcaag 600gaatacaagt gtaaagtctc aaacaaggcc ctgggagctc caattgagaa aacaatctca 660aaggccaaag gacagcctag ggaaccccag gtctacaccc tgccaccttc gagagacgaa 720ctgaccaaaa accaggtgtc cctgacatgc ctggtcaaag gcttctaccc ttctgacatt 780gctgtggagt gggagtcaaa tggacagcct gagaacaact acaaaacaac cccccctgtg 840ctggattctg atggctcttt ctttctgtac tccaaactga ctgtggacaa gtctagatgg 900cagcagggga atgtcttttc ttgctctgtc atgcatgagg ctctgcataa ccactacact 960cagaaatccc tgtctctgtc tcccgggaaa 990125330PRTHomo sapiensmisc_feature(1)..(330)human IgG1 constant domains, L234A-L235A-P329G mutant 125Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys1 5 10 15Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr65 70 75 80Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys 100 105 110Pro Ala Pro Glu Ala Ala Gly Gly Pro Ser Val Phe Leu Phe Pro Pro 115 120 125Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys 130 135 140Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp145 150 155 160Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu 165 170 175Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu 180 185 190His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn 195 200 205Lys Ala Leu Gly Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly 210 215 220Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu225 230 235 240Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr 245 250 255Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn 260 265 270Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe 275 280 285Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn 290 295 300Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr305 310 315 320Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 325 330126330PRTHomo sapiensmisc_feature(1)..(330)human IgG1 constant domains, N297Q mutant 126Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys1 5 10 15Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr65 70 75 80Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys 100 105 110Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro 115 120 125Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys 130 135 140Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp145 150 155 160Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu 165 170 175Glu Gln Tyr Gln Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu 180 185 190His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn 195 200 205Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly 210 215 220Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu225 230 235 240Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr 245 250 255Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn 260 265 270Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe 275 280 285Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn 290 295 300Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr305 310 315 320Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 325 330127327PRTHomo sapiensmisc_feature(1)..(327)human IgG4 constant domains, S228P-N297Q mutant 127Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Cys Ser Arg1 5 10 15Ser Thr Ser Glu Ser Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Lys Thr65 70 75 80Tyr Thr Cys Asn Val Asp His Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Arg Val Glu Ser Lys Tyr Gly Pro Pro Cys Pro Pro Cys Pro Ala Pro 100 105 110Glu Phe Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys 115 120 125Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val 130 135 140Asp Val Ser Gln Glu Asp Pro Glu Val Gln Phe Asn Trp Tyr Val Asp145 150 155 160Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Phe 165 170 175Gln Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp 180 185 190Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Gly Leu 195 200 205Pro Ser Ser Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg 210 215 220Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Gln Glu Glu Met Thr Lys225 230 235 240Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp 245 250 255Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys 260 265 270Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser 275 280 285Arg Leu Thr Val Asp Lys Ser Arg Trp Gln Glu Gly Asn Val Phe Ser 290 295 300Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser305 310 315 320Leu Ser Leu Ser Leu Gly Lys 325128120PRTArtificial SequenceSynthetic 18D5 VH 128Gln Val Gln Leu Gln Gln Pro Gly Ala Glu Leu Val Arg Pro Gly Ser1 5 10 15Ser Val Lys Leu Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr 20 25 30Trp Val His Trp Val Lys Gln Arg Pro Ile Gln Gly Leu Glu Trp Ile 35 40 45Gly Asn Ile Asp Pro Ser Asp Ser Asp Thr His Tyr Asn Gln Lys Phe 50 55 60Lys Asp Lys Ala Ser Leu Thr Val Asp Lys Ser Ser Ser Thr Ala Tyr65 70 75 80Met Gln Leu Ser Ser Leu Thr Phe Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95Val Arg Gly Gly Thr Gly Thr Met Ala Trp Phe Ala Tyr Trp Gly Gln 100 105 110Gly Thr Leu Val Thr Val Ser Ala 115 120129112PRTArtificial SequenceSynthetic 18D5 VL 129Asp Val Val Met Thr Gln Thr Pro Leu Ser Leu Pro Val Ser Leu Gly1 5 10 15Asp Gln Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Leu Val His Ser 20 25 30Tyr Gly Asn Thr Tyr Leu Tyr Trp Tyr Leu Gln Lys Pro Gly Gln Ser 35 40 45Pro Lys Leu Leu Ile Tyr Arg Val Ser Asn Arg Phe Ser Gly Val Pro 50 55 60Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile65 70 75 80Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Phe Cys Phe Gln Gly 85 90 95Thr His Val Pro Tyr Thr Phe Gly Ser Gly Thr Lys Leu Glu Ile Lys 100 105 110130113PRTArtificial SequenceSynthetic KWAR23 VH 130Glu Val Gln Leu Gln Gln Ser Gly Ala Glu Leu Val Lys Pro Gly Ala1 5 10 15Ser Val Lys Leu Ser Cys Thr Ala Ser Gly Phe Asn Ile Lys Asp Tyr 20 25 30Tyr Ile His Trp Val Gln Gln Arg Thr Glu Gln Gly Leu Glu Trp Ile 35 40 45Gly Arg Ile Asp Pro Glu Asp Gly Glu Thr Lys Tyr Ala Pro Lys Phe 50 55 60Gln Asp Lys Ala Thr Ile Thr Ala Asp Thr Ser Ser Asn Thr Ala Tyr65 70 75 80Leu His Leu Ser Ser Leu Thr Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Trp Gly Ala Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser 100 105 110Ser131108PRTArtificial SequenceSynthetic KWAR23 VL 131Gln Ile Val Leu Thr Gln Ser Pro Ala Ile Met Ser Ala Ser Pro Gly1 5 10 15Glu Lys Val Thr Leu Thr Cys Ser Ala Ser Ser Ser Val Ser Ser Ser 20 25 30Tyr Leu Tyr Trp Tyr Gln Gln Lys Pro Gly Ser Ser Pro Lys Leu Trp 35 40 45Ile Tyr Ser Thr Ser Asn Leu Ala Ser Gly Val Pro Ala Arg Phe Ser 50 55 60Gly Ser Gly Ser Gly Thr Ser Tyr Ser Leu Thr Ile Ser Ser Met Glu65 70 75 80Ala Glu Asp Ala Ala Ser Tyr Phe Cys His Gln Trp Ser Ser Tyr Pro 85 90 95Arg Thr Phe Gly Ala Gly Thr Lys Leu Glu Leu Lys 100 105132376PRTArtificial SequenceSynthetic rhSIRP alpha-HIS 132Met Glu Pro Ala Gly Pro Ala Pro Gly Arg Leu Gly Pro Leu Leu Cys1 5 10 15Leu Leu Leu Ala Ala Ser Cys Ala Trp Ser Gly Val Ala Gly Glu Glu 20 25 30Glu Leu Gln Val Ile Gln Pro Asp Lys Ser Val Leu Val Ala Ala Gly 35 40 45Glu Thr Ala Thr Leu Arg Cys Thr Ala Thr Ser Leu Ile Pro Val Gly 50 55 60Pro Ile Gln Trp Phe Arg Gly Ala Gly Pro Gly Arg Glu Leu Ile Tyr65 70 75 80Asn Gln Lys Glu Gly His Phe Pro Arg Val Thr Thr Val Ser Asp Leu 85 90 95Thr Lys Arg Asn Asn Met Asp Phe Ser Ile Arg Ile Gly Asn Ile Thr 100 105 110Pro Ala Asp Ala Gly Thr Tyr Tyr Cys Val Lys Phe Arg Lys Gly Ser 115 120 125Pro Asp Asp Val Glu Phe Lys Ser Gly Ala Gly Thr Glu Leu Ser Val 130 135 140Arg Ala Lys Pro Ser Ala Pro Val Val Ser Gly Pro Ala Ala Arg Ala145 150 155 160Thr Pro Gln His Thr Val Ser Phe Thr Cys Glu Ser His Gly Phe Ser 165 170 175Pro Arg Asp Ile Thr Leu Lys Trp Phe Lys Asn Gly Asn Glu Leu Ser 180 185 190Asp Phe Gln Thr Asn Val Asp Pro Val Gly Glu Ser Val Ser Tyr Ser 195 200 205Ile His Ser Thr Ala Lys Val Val Leu Thr Arg Glu Asp Val His Ser 210 215 220Gln Val Ile Cys Glu Val Ala His Val Thr Leu Gln Gly Asp Pro Leu225 230 235 240Arg Gly Thr Ala Asn Leu Ser Glu Thr Ile Arg Val Pro Pro Thr Leu 245 250 255Glu Val Thr Gln Gln Pro Val Arg Ala Glu Asn Gln Val Asn Val Thr 260 265 270Cys Gln Val Arg Lys Phe Tyr Pro Gln Arg Leu Gln Leu Thr Trp Leu 275 280 285Glu Asn Gly Asn Val Ser Arg Thr Glu Thr Ala Ser Thr Val Thr Glu 290 295 300Asn Lys Asp Gly Thr Tyr Asn Trp Met Ser Trp Leu Leu Val Asn Val305 310 315 320Ser Ala His Arg Asp Asp Val Lys Leu Thr Cys Gln Val Glu His Asp 325 330 335Gly Gln Pro Ala Val Ser Lys Ser His Asp Leu Lys Val Ser Ala His 340 345 350Pro Lys Glu Gln Gly Ser Asn Thr Ala Ala Glu Asn Thr Gly Ser Asn 355 360 365Glu Arg His His His His His His 370 375133107PRTArtificial SequenceSynthetic hSIRP alphaV1 133Glu Glu Glu Leu Gln Val Ile Gln Pro Asp Lys Ser Val Leu Val Ala1 5 10 15Ala Gly Glu Thr Ala Thr Leu Arg Cys Thr Ala Thr Ser Leu Ile Pro 20 25 30Val Gly Pro Ile Gln Trp Phe Arg Gly Ala Gly Pro Gly Arg Glu Leu 35 40 45Ile Tyr Asn Gln Lys Glu Gly His Phe Pro Arg Val Thr Thr Val Ser 50 55 60Asp Leu Thr Lys Arg Asn Asn Met Asp Phe Ser Ile Arg Ile Gly Asn65 70 75 80Ile Thr Pro Ala Asp Ala Gly Thr Tyr Tyr Cys Val Lys Phe Arg Lys 85 90 95Gly Ser Pro Asp Asp Val Glu Phe Lys Ser Gly 100 105134106PRTArtificial SequenceSynthetic hSIRP alphaV2 134Glu Glu Glu Leu Gln Val Ile Gln Pro Asp Lys Ser Val Ser Val Ala1 5 10 15Ala Gly Glu Ser Ala Ile Leu His Cys Thr Val Thr Ser Leu Ile Pro 20 25 30Val Gly Pro Ile Gln Trp Phe Arg Gly Ala Gly Pro Ala Arg Glu Leu 35 40 45Ile Tyr Asn Gln Lys Glu Gly His Phe Pro Arg Val Thr Thr Val Ser 50 55 60Glu Ser Thr Lys Arg Glu Asn Met Asp Phe Ser Ile Ser Ile Ser Asn65 70 75 80Ile Thr Pro Ala Asp Ala Gly Thr Tyr Tyr Cys Val Lys Phe Arg Lys 85 90 95Gly Ser Pro Asp Thr Glu Phe Lys Ser Gly 100 105135107PRTArtificial SequenceSynthetic hSIRP beta 1 135Glu Asp Glu Leu Gln Val Ile Gln Pro Glu Lys Ser Val Ser Val Ala1 5 10 15Ala Gly Glu Ser Ala Thr Leu Arg Cys Ala Met Thr Ser Leu Ile Pro 20 25 30Val Gly Pro Ile Met Trp Phe Arg Gly Ala Gly Ala Gly Arg Glu Leu 35 40 45Ile Tyr Asn Gln Lys Glu Gly His Phe Pro Arg Val Thr Thr Val Ser 50 55 60Glu Leu Thr Lys Arg Asn Asn Leu Asp Phe Ser Ile Ser Ile Ser Asn65 70 75 80Ile Thr Pro Ala Asp Ala Gly Thr Tyr Tyr Cys Val Lys Phe Arg Lys 85 90 95Gly Ser Pro Asp Asp Val Glu Phe Lys Ser Gly 100 10513617PRTArtificial SequenceSynthetic subsequence from SEQ ID NO 78 136Ala Ile Tyr Pro Val Asn Ser Asp Thr Thr Tyr Asn Gln Lys Phe Lys1 5 10 15Gly13717PRTArtificial SequenceSynthetic subsequence from SEQ ID NO 80 137Ala Leu Tyr Pro Val Asn Ser Asp Thr Thr Tyr Asn Gln Lys Phe Lys1 5 10 15Gly



User Contributions:

Comment about this patent or add new information about this topic:

CAPTCHA
New patent applications in this class:
DateTitle
2022-05-05Antibodies to oxidation-specific epitopes
2022-05-05Chimeric antigen receptor comprising interleukin-15 intracellular domain and uses thereof
2022-05-05Cd38 antibody
2022-05-05Antibodies binding to human cd3 at acidic ph
2022-05-05Anti-rabbit cd19 antibodies and methods of use
Top Inventors for class "Drug, bio-affecting and body treating compositions"
RankInventor's name
1David M. Goldenberg
2Hy Si Bui
3Lowell L. Wood, Jr.
4Roderick A. Hyde
5Yat Sun Or
Website © 2023 Advameg, Inc.