Patent application number | Description | Published |
20090155856 | NUCLEIC ACID AMPLIFICATION METHOD - An object to be achieved by the present invention is to provide a nucleic acid amplification method by which a nucleic acid can be amplified using oligonucleotide primers and DNA polymerase. The present invention provides a nucleic acid amplification method which comprises performing incubation of a reaction solution containing at least one type of deoxynucleotide triphosphate, at least one type of DNA polymerase having strand displacement activity, at least two types of oligonucleotide primer, and the nucleic acid fragment as a template so as to perform a polymerase reaction that initiates from the 3′ end of the primer and thus amplifying the nucleic acid fragment, wherein a first oligonucleotide primer and a second oligonucleotide primer are designed in such a way that a region which contains two identical sequences X of serial 4 or more nucleotides within, the region of 200 or less nucleotides, or apart thereof can be amplified. | 06-18-2009 |
20090162856 | RNA DETECTION METHOD - It is an object of the present invention to provide a method for rapid, convenient, and highly sensitive detection of trace RNA wherein a risk of contamination is low. The present invention provides a method for amplification of nucleic acid which comprises the steps of: (i) allowing a reverse transcriptase to act on RNA so as to produce a nucleic acid fragment; and (ii) performing substantially isothermal incubation of a reaction solution containing at least one type of deoxynucleotide triphosphate, at least one type of DNA polymerase having strand displacement activity, a divalent cation, a surfactant accounting for at least 0.01% of the solution, at least two types of oligonucleotide primers, and the nucleic acid fragment as a template obtained in the step (i) so as to perform a polymerase reaction that is initiated from the 3′ ends of the primers and thus amplify the nucleic acid fragment. | 06-25-2009 |
20090162903 | NUCLEIC ACID AMPLIFICATION METHOD - An object to be achieved by the present invention is to provide a nucleic acid amplification method by which a nucleic acid can be amplified using oligonucleotide primers and DNA polymerase. The present invention provides a nucleic acid amplification method which comprises performing incubation of a reaction solution containing at least one type of deoxynucleotide triphosphate, at least one type of DNA polymerase, at least two types of oligonucleotide primer, and the nucleic acid fragment as a template so as to perform a polymerase reaction that initiates from the 3′ end of the primer and thus amplifying the nucleic acid fragment, wherein a tag sequence is added at the 5′ end of the first oligonucleotide primer, and the tag sequence is a nucleotide sequence on the template nucleic acid fragment which is present downstream of the sequence which is substantially complementary with the 3′ end region of the first oligonucleotide primer (a region where the first oligonucleotide is annealed to the template nucleic acid). | 06-25-2009 |
20090170096 | NUCLEIC ACID AMPLIFICATION METHOD - An object to be achieved by the present invention is to provide a nucleic acid amplification method by which a nucleic acid can be amplified substantially isothermally using oligonucleotide primers and DNA polymerase capable of strand displacement. The present invention provides a nucleic acid amplification method which comprises performing substantially isothermal incubation of a reaction solution containing at least one type of deoxynucleotide triphosphate, at least one type of DNA polymerase having strand displacement activity, a divalent cation, at least 0.01% or more surfactant, at least two types of oligonucleotide primer, and the nucleic acid fragment as a template so as to perform a polymerase reaction that initiates from the 3′ end of the primer and thus amplifying the nucleic acid fragment. | 07-02-2009 |
20100047794 | METHOD FOR DISCRIMINATING BETWEEN NUCLEOTIDE SEQUENCES OF NUCLEIC ACIDS - It is an object of the present invention to provide a method for discriminating between nucleic acid sequences with high accuracy by utilizing a method for specifically amplifying nucleic acid sequences under isothermal conditions. The present invention provides a method for discriminating between the nucleotide sequence of a first nucleic acid and the nucleotide sequence of a second nucleic acid by a nucleic acid amplification method that is performed under substantially isothermal conditions, wherein (1) at least one type of oligonucleotide (hereinafter “primer”) substantially complementary to the first nucleic acid, and (2) at least one type of oligonucleic acid (hereinafter “mask oligo”) that is designed such that it hybridizes to the nucleotide sequence portions of the first nucleic acid and the second nucleic acid to be discriminated, such that it is more complementary to the second nucleic acid than to the first nucleic acid, and such that it does not become an origin of an elongation reaction with polymerase, are used, the method being characterized in that a portion of the primer and a portion of the mask oligo hybridize to the same regions on the first nucleic acid and the second nucleic acid. | 02-25-2010 |
20100184154 | METHOD FOR REPLICATING NUCLEIC ACID SEQUENCE - It is an object of the present invention to provide a method for replicating a nucleic acid sequence using oligonucleotide primers and DNA polymerase. The present invention provides a method for replicating a nucleic acid sequence, which comprises synthesizing a complementary strand with a polymerase that catalyzes a strand displacement complementary strand synthesis reaction, wherein a double-stranded template nucleic acid having a sequence A(Ac) consisting of 20 or more to 200 or less contiguous nucleotides at both ends is used as an origin. | 07-22-2010 |
20100184155 | METHOD FOR REDUCING DISPERSION IN NUCLEIC ACID AMPLIFICATION REACTION - It is an object of the present invention to provide a method for amplifying a nucleic acid, which does not require complicated temperature control and which can be carried out without using special enzyme or special primers. The present invention provides a method for amplifying a nucleic acid, which comprises the following steps (1) and (2): (1) a step of incubating a reaction solution containing at least one type of deoxynucleotide triphosphate, at least one type of DNA polymerase, at least two types of oligonucleotide primers, and a nucleic acid fragment acting as a template, at temperature (T | 07-22-2010 |
20150050737 | METHOD FOR CULTURING PLURIPOTENT STEM CELL, AND POLYPEPTIDE TO BE USED THEREFOR - A polypeptide including: (1) a first region containing at least one selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO:1) and an amino acid sequence represented by RGD; and (2) a second region containing (2-i) an amino acid sequence represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO:2), (2-ii) an amino acid sequence having an identity of not less than 50% to the amino acid sequence represented by SEQ ID NO:2 and having an adsorption ability to a cultivation container, or (2-iii) an amino acid sequence that is the amino acid sequence represented by SEQ ID NO:2 in which from 1 to 30 amino acid residues are added, substituted, or deleted, and has an adsorption ability to a cultivation container, in which the polypeptide includes from 40 to 450 amino acid residues. | 02-19-2015 |
Patent application number | Description | Published |
20080207892 | NUCLEIC ACID AMPLIFICATION METHOD USING MICROCHIP AND MICROCHIP, AND NUCLEIC ACID AMPLIFICATION SYSTEM USING THE SAME - A nucleic acid amplification method, includes: performing nucleic acid amplification using a microchip that comprises: a specimen introduction section; a reaction section; and a channel that connects the reaction section and the specimen introduction section, wherein the method further comprises preventing a reaction solution from evaporating during the amplification reaction, and a microchip, includes: a specimen introduction section; a reaction section; and a channel that connects the reaction section and the specimen introduction section, wherein the microchip executes a method for preventing a specimen containing a nucleic acid from evaporating. | 08-28-2008 |
20080233578 | METHOD FOR DETECTING MUTATION OF NUCLEIC ACID USING SINGLE-STRANDED DNA-BINDING PROTEIN - A method for judging the presence or absence of a mutation in a nucleic acid sequence, the method includes utilizing a single-stranded DNA-binding protein; the aforementioned method for judging the presence or absence of a mutation in a nucleic acid sequence, wherein the aforementioned presence or absence of a mutation in a nucleic acid sequence is judged by a product formed by a nucleic acid amplification reaction utilizing the single-stranded DNA-binding protein; and a kit for judging the presence or absence of the aforementioned mutation in a nucleic acid sequence. | 09-25-2008 |
20080268444 | Detection method of SNPs - A method for detecting a mismatch between a target nucleic acid as a measuring object and a control nucleic acid, the method comprising: (a) effecting formation of a double-stranded nucleic acid through hybridization of the control nucleic acid and the target nucleic acid; (b) allowing a mismatch binding protein to contact with the double-stranded nucleic acid and thereby to bind to a mismatched site; (c) allowing an intercalating agent which specifically recognizes the double-stranded nucleic acid and is intercalated therein, to contact with the double-stranded nucleic acid; (d) detecting the intercalating agent intercalated into the double-stranded nucleic acid; and (e) judging the presence or absence of a mismatch between the control nucleic acid and the target nucleic acid, by comparing amounts of the intercalating agent intercalated into the double-stranded nucleic acid in the absence and presence of the mismatch binding protein. | 10-30-2008 |
20120179384 | METHOD FOR ANALYZING NUCLEIC ACID MUTATION USING ARRAY COMPARATIVE GENOMIC HYBRIDIZATION TECHNIQUE - There is provided a method for analyzing nucleic acid mutation using an array comparative genomic hybridization technique, which reduces the false positive and the false negative and improves the reliability of the analysis results. A method for analyzing nucleic acid mutation using array comparative genomic hybridization technique comprising: [(a) a step of bringing a plurality of labeled sample nucleic acids one by one into contact with the plural same probe nucleic acid sets], [(b) a step of obtaining label intensities], [(c) a step of determining whether each piece of comparison values falls within a prescribed numerical value range or not], and [(d) a step of comparing whether the number of the comparison values exceeds a prescribed number or not and, in the case of exceeding the prescribed number, judging the spot positive]. | 07-12-2012 |