Patent application title: O-Mannosyltransferase Deficient Filamentous Fungal Cells and Methods of Use Thereof
Inventors:
Jari Natunen (Vantaa, FI)
Jukka Hiltunen (Helsinki, FI)
Jukka Hiltunen (Helsinki, FI)
Anne Huuskonen (Helsinki, FI)
Markku Saloheimo (Helsinki, FI)
Markku Saloheimo (Helsinki, FI)
Christian Ostermeier (Helsinki, FI)
Benjamin Patrick Sommer (Basel, CH)
Ramon Wahl (Basel, CH)
Assignees:
GLYKOS FINLAND OY
IPC8 Class: AC12N910FI
USPC Class:
1 1
Class name:
Publication date: 2022-07-07
Patent application number: 20220213451
Abstract:
The present disclosure relates to compositions and methods useful for the
production of heterologous proteins with reduced O-mannosylation in
filamentous fungal cells, such as Trichoderma cells. More specifically,
the invention provides a PMT-deficient filamentous fungal cell comprising
a) at least a first mutation that reduces an endogenous protease activity
compared to a parental filamentous fungal cell which does not have said
first mutation, and, b) at least a second mutation in a PMT gene that
reduces endogenous O-mannosyltransferase activity compared to a parental
filamentous fungal cell which does not have said second mutation, wherein
said filamentous fungal cell is selected from the group consisting of
Trichoderma, Neurospora, Myceliophthora or Chrysosporium cell.Claims:
1. A PMT-deficient filamentous fungal cell comprising a) a first mutation
that reduces or eliminates an endogenous protease activity compared to a
parental filamentous fungal cell which does not have said first mutation,
and b) a second mutation in a PMT gene that reduces endogenous
O-mannosyltransferase activity compared to a parental filamentous fungal
cell which does not have said second mutation, wherein said filamentous
fungal cell is selected from the group consisting of Trichoderma,
Neurospora, Myceliophthora and Chrysosporium cell.
2. The PMT-deficient filamentous fungal cell of claim 1, wherein said second mutation that reduces the endogenous O-mannosyltransferase activity is a deletion or a disruption of a PMT gene encoding an endogenous protein O-mannosyltransferase activity.
3. The PMT-deficient filamentous fungal cell of claim 1 or 2, wherein said second mutation in a PMT gene is a mutation in either: a) PMT1 gene comprising the polynucleotide of SEQ ID NO:1, b) a functional homologous gene of PMT1 gene, which functional homologous gene is capable of restoring parental O-mannosylation level by functional complementation when introduced into a T. reesei strain having a disruption in said PMT1 gene, or; c) a polynucleotide encoding a polypeptide having at least 50% identity with SEQ ID NO:2, said polypeptide having O-mannosyltransferase activity.
4. The PMT-deficient filamentous fungal cell of any one of claims 1-3, wherein said cell has a third mutation that reduces or eliminates the level of expression of an ALG3 gene compared to the level of expression in a parental cell which does not have such third mutation.
5. The PMT-deficient filamentous fungal cell of claim 4, further comprising a first polynucleotide encoding a N-acetylglucosaminyltransferase I catalytic domain and a second polynucleotide encoding a N-acetylglucosaminyltransferase II catalytic domain.
6. The PMT-deficient filamentous fungal cell of any one of claims 1-5, further comprising one or more polynucleotides encoding a polypeptide selected from the group consisting of: a) .alpha.1,2 mannosidase; b) N-acetylglucosaminyltransferase I catalytic domain; c) .alpha. mannosidase II; d) N-acetylglucosaminyltransferase II catalytic domain; e) .beta.1,4 galactosyltransferase; and, f) fucosyltransferase.
7. The PMT-deficient filamentous fungal cell of any one of claims 1-6, wherein said cell is a Trichoderma cell comprising a mutation that reduces or eliminates the protein O-mannosyltransferase activity of Trichoderma pmt1.
8. The PMT-deficient filamentous fungal cell of any one of claims 1-7, wherein said cell is a Trichoderma cell, for example Trichoderma reesei, and said cell comprises mutations that reduce or eliminate the activity of a) the three endogenous proteases pep1, tsp1 and slp1; b) the three endogenous proteases gap1, slp1 and pep1; c) the three endogenous proteases selected from the group consisting of pep1, pep2, pep3, pep4, pep5, pep8, pep11, pep12, tsp1, slp1, slp2, slp3, slp7, gap1 and gap2; d) three to six proteases selected from the group consisting of pep1, pep2, pep3, pep4, pep5, tsp1, slp1, slp2, slp3, gap1 and gap2; or e) seven to ten proteases selected from the group consisting of pep1, pep2, pep3, pep4, pep5, pep7, pep8, tsp1, slp1, slp2, slp3, slp5, slp6, slp7, slp8, tpp1, gap1 and gap2.
9. A method for producing a protein having reduced O-mannosylation, comprising: a) providing a PMT-deficient filamentous fungal cell having a mutation in a PMT gene that reduces endogenous O-mannosyltransferase activity in comparison to a parental strain which does not have such mutation, and further comprising a polynucleotide encoding a protein with serine or threonine residue, b) culturing said PMT-deficient filamentous fungal cell to produce said protein having reduced O-mannosylation, wherein said filamentous fungal cell is selected from the group consisting of Trichoderma, Neurospora, Myceliophthora or Chrysosporium cell.
10. The method according to claim 9, wherein said mutation in a PMT gene is a mutation in either: a) PMT1 gene comprising the polynucleotide of SEQ ID NO:1, b) a functional homologous gene of PMT1 gene, which gene is capable of restoring parental O-mannosylation level by functional complementation when introduced into a T. reesei strain having a disruption in said PMT1 gene, or c) a polynucleotide encoding a polypeptide having at least 50% identity with SEQ ID NO:2, said polypeptide having protein O-mannosyltransferase activity.
11. The method according to claim 9 or 10, wherein said filamentous fungal cell expresses functional endogenous chaperone protein, such as Protein Disulphide Isomerase (PDI).
12. The method according to any one of claims 9-11, wherein said PMT-deficient filamentous fungal cell is selected from the cells as defined in any one of claims 1-8.
13. The method of any one of claims 9-12, wherein said produced protein is a heterologous mammalian protein selected from the group consisting of a) an immunoglubulin, such as IgG, b) a light chain or heavy chain of an immunoglobulin, c) a heavy chain or a light chain of an antibody, d) a single chain antibody, e) a camelid antibody, f) a monomeric or multimeric single domain antibody, g) a FAb-fragment, a FAb2-fragment, and, h) their antigen-binding fragments.
14. A method for producing an antibody having reduced O-mannosylation, comprising: a) providing a PMT-deficient filamentous fungal cell having i. a mutation that reduces endogenous protein O-mannosyltransferase activity as compared to parental strain which does not have such mutation, and, ii. a polynucleotide encoding a light chain antibody and a polynucleotide encoding a heavy chain antibody, b) culturing the cell to produce said antibody, consisting of heavy and light chains, having reduced O-mannosylation, wherein said filamentous fungal cell is selected from the group consisting of Trichoderma, Neurospora, Myceliophthora and Chrysosporium cell.
15. A protein or antibody composition obtainable by the method of any one of claims 9-14.
16. The protein or antibody composition according to claim 15, wherein said protein or antibody comprises, as a major glycoform, either, a) Man.alpha.3[Man.alpha.6(Man.alpha.3)Man.alpha.6]Man.beta.4GlcNA.beta.4Glc- NAc (Man5 glycoform); b) Man.alpha.6(Man.alpha.3)Man.beta.4GlcNA.beta.4GlcNAc (Man3 glycoform); c) hybrid or complex type N-glycans, such as the glycoforms selected from the subgroup consisting of GlcNAcMan3, G0, hybrid glycan GlcNAcMan5, and galactosylated derivatives, such as GalGlcNAcMan3, G1, G2; and, GalGlcNAcMan5 glycoforms.
Description:
FIELD OF THE INVENTION
[0001] The present disclosure relates to compositions and methods useful for the production of heterologous proteins in filamentous fungal cells.
BACKGROUND
[0002] Posttranslational modification of eukaryotic proteins, particularly therapeutic proteins such as immunoglobulins, is often necessary for proper protein folding and function. Because standard prokaryotic expression systems lack the proper machinery necessary for such modifications, alternative expression systems have to be used in production of these therapeutic proteins. Even where eukaryotic proteins do not have posttranslational modifications, prokaryotic expression systems often lack necessary chaperone proteins required for proper folding. Yeast and fungi are attractive options for expressing proteins as they can be easily grown at a large scale in simple media, which allows low production costs, and yeast and fungi have posttranslational machinery and chaperones that perform similar functions as found in mammalian cells. Moreover, tools are available to manipulate the relatively simple genetic makeup of yeast and fungal cells as well as more complex eukaryotic cells such as mammalian or insect cells (De Pourcq et al., Appl Microbiol Biotechnol, 87(5):1617-31).
[0003] However, posttranslational modifications occurring in yeast and fungi may still be a concern for the production of recombinant therapeutic protein. In particular, O-mannosylation is one of the biggest hurdles to overcome in the production of biopharmaceuticals for human applications in fungi. More specifically, yeasts like Pichia pastoris and Saccharomyces cerevisiae tend to hyper-mannosylate heterologously expressed biopharmaceuticals, thereby triggering adverse effects when applied to humans.
[0004] O-mannosylation to Serine and Threonine residues includes in mammals GalNAc based oligosaccharides or GlcNAc/N-acetyllactosamine comprising O-linked mannose glycans. In fungi O-mannosylation occurs as hexose monomers or oligomers. In yeasts, there are typically several protein(/polypeptide) O-mannosyltransferases, which often function as complexes. Part of the knock-outs are harmfull, at least for cell structures and stability and not all yeast knock-outs or combinations are tolerated (for a review, see Goto 2007, Biosci. Biotechnol. Biochem. 71(6), 1415-1427).
[0005] There have been reports of knock-outs of yeast O-mannosyltransferase genes, aiming to reduce the O-mannosylation levels, and even multiple knock-out mutants involving two or three pmt genes in S. cerevisiae (WO/1994/004687). Pmt1 or pmt2 knock-out of S. cerevisiae reduced the level of O-mannosylation of antifreeze glycoprotein III to about 30% of the proteins and the residual mannosylated protein contains numerous mannose residues per protein, apparently also oligosaccharides (WO/2004/057007).
[0006] WO/2010/034708 reports no significant level of O-mannosylation of recombinant hydrophobin Trichoderma protein when expressed in pmtl knock-out of S. cerevisiae host cell. Such O-mannosylation appears to be artificial yeast glycosylation of the original non-mannosylated filamentous fungal protein.
[0007] WO/2010/128143 further reports single chain antibody-albumin fusion construct in yeast S. cerevisiae pmt1 and/or pmt4 knock-out strains.
[0008] Pmt1, pmt2, and pmt3 single gene knock-outs, double, and triple knock-outs of Aspergillus species (Aspergillus nidulans, Aspergillus fumigatus, and/or Aspergillus awamori) are described in Goto et al, 2009 (Eukaryotic cell 2009, 8(10):1465); Mouyna et al, 2010 (Molecular Microbiology 2010, 76(5), 1205-1221); Zhou et al, 2007 (Eukaryotic cell 2007, 6(12):2260); Oka et al, 2004 (Microbiology 2004, 150, 1973-1982); Kriangkripipat et al, 2009; Fang et al, 2010 (Glycobiology, 2010, vol. 20 pp 542-552); and Oka et al, 2005 (Microbiology 2005, 151, 3657-3667).
[0009] Despite numerous reports on knock out of pmt homologues in filamentous fungi, there is no description of a filamentous fungal cell with reduced O-mannosylation and useful as a host cell for the production of recombinant glycoprotein.
[0010] In particular, Gorka-Niec et al (2008, Acta Biochimica Polonica, Vol. 55 No 2/2008, 251-259) reported the deletion of pmt1 gene in Trichoderma reesei. PMT1 protein showed the highest identity to Pmt4p of S. cerevisiae (51%) but functionally complement pmt2.DELTA. S. cerevisiae mutant (Gorka-Niec et al, 2007, Biochimica et Biophysica Acta 1770, 2007, 774-780). However, the authors reported that disruption of the pmt1 gene caused a decrease of protein secretion but did not alter O- and N-glycosylation of secreted protein. Zakrzewska et al (Curr Genet 2003 43: 11-16) further reported that Trichoderma reesei pmt1 gene did not functionally complement pmt4.DELTA. S. cerevisiae mutant.
[0011] In fact, deletions of the PMT genes in yeasts or filamentous fungi appears to either result in no phenotype at all or lethality or severely impaired vital functions of the cells, which would not be suitable for recombinant production of heterologous proteins, especially mammalian glycoproteins. For this reason, alternative methods such as the use of pmt inhibitors have been proposed as an alternative to pmt knock out strains (WO2009/143041).
[0012] Thus, a need remains for improved filamentous fungal cells, such as Trichoderma fungus cells, that can stably produce heterologous proteins with no or reduced O-mannosylation, such as immunoglobulins, preferably at high levels of expression.
SUMMARY
[0013] The present invention relates to improved methods for producing proteins with no or reduced O-mannosylation in filamentous fungal expression systems, and more specifically, glycoproteins, such as antibodies or related immunoglobulins or fusion proteins which may be O-mannosylated when produced in filamentous fungal expression systems.
[0014] The present invention is based in part on the surprising discovery that filamentous fungal cells, such as Trichoderma cells, can be genetically modified to reduce or suppress O-mannosylation activity, without adversely affecting viability and yield of produced glycoproteins.
[0015] Accordingly, in a first aspect, the invention relates to a PMT-deficient filamentous fungal cell comprising
[0016] a) a first mutation that reduces or eliminates an endogenous protease activity compared to a parental filamentous fungal cell which does not have said first mutation, and,
[0017] b) a second mutation in a PMT gene that reduces endogenous O-mannosyltransferase activity compared to a parental filamentous fungal cell which does not have said second mutation,
[0018] wherein said filamentous fungal cell is selected from the group consisting of Trichoderma, Neurospora, Myceliophthora and Chrysosporium cell.
[0019] In one embodiment, said PMT-deficient cell further expresses a heterologous protein containing serine and/or threonine residues. The expressed heterologous protein with serine and/or threonine residues has reduced O-mannosylation due to said mutation in said PMT gene. For example, the O-mannosylation level of the heterologous protein expressed in a PMT-deficient cell of the invention is at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80% or at least 90% lower as compared to the O-mannosylation level of the heterologous protein when expressed in the parental filamentous fungal cell which does not have said second PMT-deficient mutation.
[0020] In another embodiment, said second mutation that reduces endogenous O-mannosyltransferase activity is a deletion or a disruption of a PMT gene encoding an endogenous protein O-mannosyltransferase activity.
[0021] In another embodiment, said second PMT-deficient mutation in a PMT gene may be a mutation (such as a deletion or disruption) in either:
[0022] a) PMT1 gene comprising the polynucleotide of SEQ ID NO:1,
[0023] b) a functional homologous gene of PMT1 gene, which functional gene is capable of restoring parental O-mannosylation level by functional complementation when introduced into a T. reesei strain having a disruption in said PMT1 gene, or,
[0024] c) a polynucleotide encoding a polypeptide having at least 50%, at least 60%, at least 70%, at least 90%, or at least 95% identity with SEQ ID NO:2, said polypeptide having O-mannosyltransferase activity.
[0025] In another embodiment that may be combined with the precedent embodiments, said PMT-deficient cell has a third mutation that reduces or eliminates the level of expression of an ALG3 gene compared to the level of expression in a parental cell which does not have such third mutation. In a specific embodiment, said PMT-deficient cell further comprises a first polynucleotide encoding N-acetylglucosaminyltransferase I catalytic domain and a second polynucleotide encoding N-acetylglucosaminyltransferase II catalytic domain.
[0026] In another embodiment that may be combined with the preceding embodiments, said PMT-deficient cell further comprises one or more polynucleotides encoding a polypeptide selected from the group consisting of:
[0027] a) .alpha.1,2 mannosidase,
[0028] b) N-acetylglucosaminyltransferase I catalytic domain,
[0029] c) .alpha. mannosidase II, and
[0030] d) N-acetylglucosaminyltransferase II catalytic domain.
[0031] In another embodiment that may be combined with the preceding embodiments, said PMT-deficient cell further comprises one or more polynucleotides encoding a .beta.1,4 galactosyltransferase and/or a fucosyltransferase.
[0032] In one specific embodiment, said PMT-deficient cell is a Trichoderma cell comprising at least a mutation that reduces or eliminates the protein O-mannosyltransferase activity of Trichoderma pmt1, and, optionally, further comprising mutations in at least one or more other PMT genes that reduces or eliminates the protein O-mannosyltransferase activity selected from the group consisting of pmt2 and pmt3.
[0033] In one embodiment that may be combined with the preceding embodiments, the PMT deficient cells comprise mutations that reduce or eliminate the activity of at least two, or at least three endogenous proteases. Typically, said cell may be a Trichoderma cell and may comprise mutations that reduce or eliminate the activity of
[0034] a) the three endogenous proteases pep1, tsp1 and slp1,
[0035] b) the three endogenous proteases gap1, slp1 and pep1,
[0036] c) three endogenous proteases selected from the group consisting of pep1, pep2, pep3, pep4, pep5, pep8, pep11, pep12, tsp1, slp1, slp2, slp3, slp7, gap1 and gap2,
[0037] d) three to six proteases selected from the group consisting of pep1, pep2, pep3, pep4, pep5, tsp1, slp1, slp2, slp3, gap1 and gap2, or,
[0038] e) seven to ten proteases selected from the group consisting of pep1, pep2, pep3, pep4, pep5, pep7, pep8, tsp1, slp1, slp2, slp3, slp5, slp6, slp7, slp8, tpp1, gap1 and gap2.
[0039] In one embodiment that may be combined with the precedent embodiments, the filamentous fungal cell of the invention does not comprise a deletion or disruption of an endogenous gene encoding a chaperone protein. In particular, said filamentous fungal cell of the invention expresses functional endogenous chaperone protein Protein Disulphide Isomerase (PDI).
[0040] In another aspect, the invention relates to a method for producing a protein having reduced O-mannosylation, comprising:
[0041] a) providing a PMT-deficient filamentous fungal cell, having a mutation in a PMT gene that reduces endogenous O-mannosyltransferase activity as compared to parental strain which does not have such mutation, and further comprising a polynucleotide encoding a protein with serine or threonine residue,
[0042] b) culturing said PMT-deficient filamentous fungal cell to produce said protein with reduced O-mannosylation,
[0043] wherein said filamentous fungal cell is selected from the group consisting of Trichoderma, Neurospora, Myceliophthora and Chrysosporium cell.
[0044] According to one specific embodiment of the method, said mutation in a PMT gene is a mutation, such as a deletion or disruption, in either:
[0045] a) PMT1 gene comprising the polynucleotide of SEQ ID NO:1,
[0046] b) a functional homologous gene of PMT1 gene, which gene is capable of restoring parental O-mannosylation level by functional complementation when introduced into a T. reesei strain having a disruption in said PMT1 gene, or,
[0047] c) a polynucleotide encoding a polypeptide having at least 50%, at least 60%, at least 70%, at least 90%, or at least 95% identity with SEQ ID NO:2, said polypeptide having protein O-mannosyltransferase activity.
[0048] In another embodiment of the method, said PMT-deficient cell is a Trichoderma reesei cell and said mutation is a deletion or a disruption of T. reesei PMT1 gene.
[0049] In other embodiments of the method, said PMT-deficient cell is a PMT-deficient cell of the invention as described above.
[0050] In a specific embodiment, said polynucleotide encoding a protein is a recombinant polynucleotide encoding a heterologous protein. Typically, said heterologous protein may be a mammalian protein selected from the group consisting of
[0051] a) an immunoglubulin, such as IgG,
[0052] b) a light chain or heavy chain of an immunoglobulin,
[0053] c) a heavy chain or a light chain of an antibody,
[0054] d) a single chain antibody,
[0055] e) a camelid antibody,
[0056] f) a monomeric or multimeric single domain antibody,
[0057] g) a FAb-fragment, a FAb2-fragment, and,
[0058] h) their antigen-binding fragments.
[0059] In one embodiment of the method, that may be combined with the preceding embodiments, said polynucleotide encoding said protein further comprises a polynucleotide encoding CBH1 catalytic domain and linker as a carrier protein and/or cbh1 promoter.
[0060] In another embodiment, said polynucleotide encodes a protein with serine or threonine, which may be O-mannosylated in a PMT functional parental strain, and further comprising at least one N-glycan.
[0061] The invention also relates to a method for producing an antibody having reduced O-mannosylation, comprising:
[0062] a) providing a PMT-deficient filamentous fungal cell having
[0063] i. a mutation that reduces endogenous protein O-mannosyltransferase activity as compared to parental strain which does not have such mutation and
[0064] ii. a polynucleotide encoding a light chain antibody and a polynucleotide encoding a heavy chain antibody,
[0065] b) culturing the cell to produce said antibody, consisting of heavy and light chains, having reduced O-mannosylation,
[0066] wherein said filamentous fungal cell is selected from the group consisting of Trichoderma, Neurospora, Myceliophthora and Chrysosporium cell.
[0067] In a specific method for producing antibody, said PMT-deficient cell is a Trichoderma reesei cell and said mutation is a deletion or a disruption of T. reesei PMT1 gene.
[0068] In one embodiment of the method for producing antibody, at least 70%, 80%, 90%, 95%, or 100% of the produced antibody is not O-mannosylated.
[0069] The invention also relates to the protein composition or antibody composition obtainable or obtained by the methods of the invention as described above. In one embodiment, at least 70%, 80%, 90%, 95%, or 100% of the antibodies as obtained or obtainable the methods of the invention are not O-mannosylated.
[0070] In one specific embodiment, such protein (e.g. a glycoprotein) or antibody composition with reduced O-mannosylation comprises, as a major glycoform, either,
[0071] Man.alpha.3[Man.alpha.6(Man.alpha.3)Man.alpha.6]Man.beta.4GlcNA.beta.4Glc- NAc (Man5 glycoform);
[0072] Man.alpha.6(Man.alpha.3)Man.beta.4GlcNA.beta.4GlcNAc (Man3 glycoform);
[0073] hybrid or complex type N-glycans such as glycoforms selected from the subgroup consisting of GlcNAcMan3, G1, hybrid glycan, or GlcNAcMan5, or galactosylated derivatives, such as GalGlcNAcMan3, G1, G2; or, GalGlcNAcMan5 glycoform.
[0074] In one specific embodiment, when the core of the glycan consists of Man3, then the composition essentially lacks Man5 glycoforms.
[0075] In an embodiment that may be combined with one or more of the preceding embodiments less than 0.1%, 0.01%, 0.001% or 0% of the N-glycans and/or O-glycans of the protein composition comprises Neu5Gc and/or Gal.alpha.-structure. In an embodiment that may be combined with the preceding embodiments, less than 0.1%, 0.01%, 0.001% or 0% of the N-glycans and/or O-glycans of the antibody composition comprises Neu5Gc and/or Gal.alpha.-structure.
[0076] In an embodiment that may be combined with one or more of the preceding embodiments, less than 0.1%, 0.01%, 0.001%, or 0% of the N-glycan of the glycoprotein composition comprises core fucose structures. In an embodiment that may be combined with the preceding embodiments, less than 0.1%, 0.01%, 0.001%, or 0% of the N-glycan of the antibody composition comprises core fucose structures.
[0077] In an embodiment that may be combined with one or more of the preceding embodiments, less than 0.1%, 0.01%, 0.001%, or 0% of N-glycan of the glycoprotein composition comprises terminal galactose epitopes Gal.beta.3/4GlcNAc. In an embodiment that may be combined with the preceding embodiments, less than 0.1%, 0.01%, 0.001%, or 0% of the N-glycan of the antibody composition comprises terminal galactose epitopes Gal.beta.3/4GlcNAc.
[0078] In an embodiment that may be combined with one or more of the preceding embodiments, less than 1.0%, 0.5%, 0.1%, 0.01%, 0.001%, or 0% of the glycoprotein composition comprises glycation structures. In an embodiment that may be combined with the preceding embodiments, less than 1.0%, 0.5%, 0.1%, 0.01%, 0.001%, or 0% of the antibody composition comprises glycation structures.
[0079] In another embodiment that may be combined with one or more of the preceding embodiments, the glycoprotein composition, such as an antibody is devoid of one, two, three, four, five, or six of the structures selected from the group of Neu5Gc, terminal Gal.alpha.3Gal.beta.4GlcNAc, terminal Gal.beta.4GlcNAc, terminal Gal.beta.3GlcNAc, core linked fucose and glycation structures.
[0080] The invention also relates to a method of reducing O-mannosylation level of a recombinant glycoprotein composition produced in a filamentous fungal cell, for example, Trichoderma cell, typically, Trichoderma reesei, said method consisting of using a filamentous fungal cell having a mutation in a PMT gene wherein said PMT gene is either:
[0081] i. PMT1 gene comprising the polynucleotide of SEQ ID NO:1,
[0082] ii. a functional homologous gene of PMT1 gene, which gene is capable of restoring parental O-mannosylation level by functional complementation when introduced into a T. reesei strain having a disruption in said PMT1 gene, or,
[0083] iii. a polynucleotide encoding a polypeptide having at least 50%, at least 60%, at least 70%, at least 90%, or at least 95% identity with SEQ ID NO:2, said polypeptide having protein O-mannosyltransferase activity.
DESCRIPTION OF THE FIGURES
[0084] FIG. 1 depicts results for Southern analyses of Trichoderma reesei pmt1 deletion strains expressing antibody MAB01. A) A 5.7 kb signal is expected from parental strains M124 and M304 with pmt1 ORF probe after Spel+Xbal digestion. No signal is expected from pure pmt1 deletion strains. B) A 3.5 kb signal is expected for pmt1 5'flank probe from deletion strains after Spel+Ascl digestion. C) A 1.7 kb signal is expected for pmt1 3'flank probe from deletion strains after Ascl+Xbal digestions. Ascl does not cut intact pmt1 locus in close distance, therefore signals of over 16 kb (B) and 10 kb (C) are expected from parental strains M124 or M304. A 4.1 kb signal is expected from Pmel digested plasmid pTTv185 used as a control in hybridisations with both flank probes (B, C).
[0085] FIG. 2 depicts a spectra of light chain of flask cultured parental T. reesei strain M317 (pyr4.sup.- of M304) (A) and .DELTA.pmt1 disruptant clone 26-8A (B), day 7.
[0086] FIG. 3 depicts results for Western analyses of Trichoderma reesei pmt1 deletion strain M403 from fed-batch fermentation. Upper panel: MAB01 light chain, lower panel: MAB01 heavy chain. 0.1 .mu.l of supernatant was loaded on each lane.
[0087] FIG. 4 depicts a spectrum of light chain of fermenter cultured T. reesei strain M403 (pmt1 deletion strain of MAB01 antibody producing strain, clone 26-8A), day 7.
[0088] FIG. 5 depicts a phylogeny of PMTs of selected filamentous fungi.
[0089] FIG. 6 depicts a partial sequence alignment of the results of the PMT BLAST searches.
DETAILED DESCRIPTION
Definitions
[0090] As used herein, an "expression system" or a "host cell" refers to the cell that is genetically modified to enable the transcription, translation and proper folding of a polypeptide or a protein of interest, typically of mammalian protein.
[0091] The term "polynucleotide" or "oligonucleotide" or "nucleic acid" as used herein typically refers to a polymer of at least two nucleotides joined together by a phosphodiester bond and may consist of either ribonucleotides or deoxynucleotides or their derivatives that can be introduced into a host cell for genetic modification of such host cell. For example, a polynucleotide may encode a coding sequence of a protein, and/or comprise control or regulatory sequences of a coding sequence of a protein, such as enhancer or promoter sequences or terminator. A polynucleotide may for example comprise native coding sequence of a gene or their fragments, or variant sequences that have been optimized for optimal gene expression in a specific host cell (for example to take into account codon bias).
[0092] As used herein, the term, "optimized" with reference to a polynucleotide means that a polynucleotide has been altered to encode an amino acid sequence using codons that are preferred in the production cell or organism, for example, a filamentous fungal cell such as a Trichoderma cell. Heterologous nucleotide sequences that are transfected in a host cell are typically optimized to retain completely or as much as possible the amino acid sequence originally encoded by the original (not optimized) nucleotide sequence. The optimized sequences herein have been engineered to have codons that are preferred in the corresponding production cell or organism, for example the filamentous fungal cell.
[0093] The amino acid sequences encoded by optimized nucleotide sequences may also be referred to as optimized.
[0094] As used herein, a "peptide" or a "polypeptide" is an amino acid sequence including a plurality of consecutive polymerized amino acid residues. The peptide or polypeptide may include modified amino acid residues, naturally occurring amino acid residues not encoded by a codon, and non-naturally occurring amino acid residues. As used herein, a "protein" may refer to a peptide or a polypeptide or a combination of more than one peptide or polypeptide assembled together by covalent or non-covalent bonds. Unless specified, the term "protein" may encompass one or more amino acid sequences with their post-translation modifications, and in particular with either O-mannosylation or N-glycan modifications.
[0095] As used herein, the term "glycoprotein" refers to a protein which comprises at least one N-linked glycan attached to at least one asparagine residue of a protein, or at least one mannose attached to at least one serine or threonine resulting in O-mannosylation.
[0096] The terms "O-mannosylation" or "O-mannosyltransferase activity" are used herein to refer to the covalent linkage of at least one mannose to one specific amino acid via one oxygen (typically from serine or threonine). O-mannosyltransferase protein typically adds mannose to hydroxyl groups such as hydroxyl of serine or threonine residues.
[0097] In particular, O-mannosyltransferase activity may refer to the specificity of O-mannosyltransferase activity of fungal PMT gene encoding enzymes, and more specifically with the same specificity of T. reesei PMT1.
[0098] As used herein, "glycan" refers to an oligosaccharide chain that can be linked to a carrier such as an amino acid, peptide, polypeptide, lipid or a reducing end conjugate. In certain embodiments, the invention relates to N-linked glycans ("N-glycan") conjugated to a polypeptide N-glycosylation site such as -Asn-Xaa-Ser/Thr- by N-linkage to side-chain amide nitrogen of asparagine residue (Asn), where Xaa is any amino acid residue except Pro. The invention may further relate to glycans as part of dolichol-phospho-oligosaccharide (Dol-P-P-OS) precursor lipid structures, which are precursors of N-linked glycans in the endoplasmic reticulum of eukaryotic cells. The precursor oligosaccharides are linked from their reducing end to two phosphate residues on the dolichol lipid. For example, .alpha.3-mannosyltransferase Alg3 modifies the Dol-P-P-oligosaccharide precursor of N-glycans. Generally, the glycan structures described herein are terminal glycan structures, where the non-reducing residues are not modified by other monosaccharide residue or residues.
[0099] As used throughout the present disclosure, glycolipid and carbohydrate nomenclature is essentially according to recommendations by the IUPAC-IUB Commission on Biochemical Nomenclature (e.g. Carbohydrate Res. 1998, 312, 167; Carbohydrate Res. 1997, 297, 1; Eur. J. Biochem. 1998, 257, 29). It is assumed that Gal (galactose), Glc (glucose), GlcNAc (N-acetylglucosamine), GalNAc (N-acetylgalactosamine), Man (mannose), and Neu5Ac are of the D-configuration, Fuc of the L-configuration, and all the monosaccharide units in the pyranose form (D-Galp, D-Glcp, D-GlcpNAc, D-GalpNAc, D-Manp, L-Fucp, D-Neup5Ac). The amine group is as defined for natural galactose and glucosamines on the 2-position of GalNAc or GlcNAc. Glycosidic linkages are shown partly in shorter and partly in longer nomenclature, the linkages of the sialic acid SA/Neu5X-residues .alpha.3 and .alpha.6 mean the same as .alpha.2-3 and .alpha.2-6, respectively, and for hexose monosaccharide residues .alpha.1-3, .alpha.1-6, .beta.1-2, .beta.1-3, .beta.1-4, and .beta.1-6 can be shortened as .alpha.3, .alpha.6, .beta.2, .beta.3, .beta.4, and .beta.6, respectively. Lactosamine refers to type II N-acetyllactosamine, Gal.beta.4GlcNAc, and/or type I N-acetyllactosamine. Gal.beta.3GlcNAc and sialic acid (SA) refer to N-acetylneuraminic acid (Neu5Ac), N-glycolylneuraminic acid (Neu5Gc), or any other natural sialic acid including derivatives of Neu5X. Sialic acid is referred to as NeuNX or Neu5X, where preferably X is Ac or Gc. Occasionally Neu5Ac/Gc/X may be referred to as NeuNAc/NeuNGc/NeuNX.
[0100] The sugars typically constituting N-glycans found in mammalian glycoprotein, include, without limitation, N-acetylglucosamine (abbreviated hereafter as "GlcNAc"), mannose (abbreviated hereafter as "Man"), glucose (abbreviated hereafter as "Glc"), galactose (abbreviated hereafter as "Gal"), and sialic acid (abbreviated hereafter as "Neu5Ac"). N-glycans share a common pentasaccharide referred to as the "core" structure Man.sub.3GlcNAc.sub.2 (Man.alpha.6(Man.alpha.3)Man.beta.4GlcNA.beta.4GlcNAc, referred to as Man3). In some embodiments Man3 glycan or its derivative Man.alpha.6(GlcNAc.beta.2Man.alpha.3)Man.beta.4GlcNA.beta.4GlcNAc is the major glycoform. When a fucose is attached to the core structure, preferably .alpha.6-linked to reducing end GlcNAc, the N-glycan or the core of N-glycan, may be represented as Man.sub.3GlcNAc.sub.2(Fuc). In an embodiment the major N-glycan is Man.alpha.3[Man.alpha.6(Man.alpha.3)Man.alpha.6]Man.beta.4GlcNA.beta.4Glc- NAc (Man5).
[0101] Preferred hybrid type N-glycans comprise GlcNAc.beta.2Man.alpha.3[Man.alpha.6(Man.alpha.3)Man.alpha.6]Man.beta.4Gl- cNA.beta.4GlcNAc ("GlcNAcMan5"), or b4-galactosylated derivatives thereof Gal.beta.4GlcNAcMan3, G1, G2, or GalGlcNAcMan5 glycoform.
[0102] A "complex N-glycan" refers to a N-glycan which has at least one GlcNAc residue, optionally by GlcNAc.beta.2-residue, on terminal 1,3 mannose arm of the core structure and at least one GlcNAc residue, optionally by GlcNAc.beta.2-residue, on terminal 1,6 mannose arm of the core structure.
[0103] Such complex N-glycans include, without limitation, GlcNAc.sub.2Man.sub.3GlcNAc.sub.2 (also referred as G0 glycoform), Gal.sub.1GlcNAc.sub.2Man.sub.3GlcNAc.sub.2 (also referred as G1 glycoform), and Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2 (also referred as G2 glycoform), and their core fucosylated glycoforms FG0, FG1 and FG2, respectively GlcNAc.sub.2Man.sub.3GlcNAc.sub.2(Fuc), Gal.sub.1GlcNAc.sub.2Man.sub.3GlcNAc.sub.2(Fuc), and Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2(Fuc).
[0104] "Increased" or "Reduced activity of an endogenous enzyme": The filamentous fungal cell may have increased or reduced levels of activity of various endogenous enzymes. A reduced level of activity may be provided by inhibiting the activity of the endogenous enzyme with an inhibitor, an antibody, or the like. In certain embodiments, the filamentous fungal cell is genetically modified in ways to increase or reduce activity of various endogenous enzymes. "Genetically modified" refers to any recombinant DNA or RNA method used to create a prokaryotic or eukaryotic host cell that expresses a polypeptide at elevated levels, at lowered levels, or in a mutated form. In other words, the host cell has been transfected, transformed, or transduced with a recombinant polynucleotide molecule, and thereby been altered so as to cause the cell to alter expression of a desired protein.
[0105] "Genetic modifications" which result in a decrease or deficiency in gene expression, in the function of the gene, or in the function of the gene product (i.e., the protein encoded by the gene) can be referred to as inactivation (complete or partial), knock-out, deletion, disruption, interruption, blockage, silencing, or down-regulation, or attenuation of expression of a gene. For example, a genetic modification in a gene which results in a decrease in the function of the protein encoded by such gene, can be the result of a complete deletion of the gene (i.e., the gene does not exist, and therefore the protein does not exist), a mutation in the gene which results in incomplete (disruption) or no translation of the protein (e.g., the protein is not expressed), or a mutation in the gene which decreases or abolishes the natural function of the protein (e.g., a protein is expressed which has decreased or no enzymatic activity or action). More specifically, reference to decreasing the action of proteins discussed herein generally refers to any genetic modification in the host cell in question, which results in decreased expression and/or functionality (biological activity) of the proteins and includes decreased activity of the proteins (e.g., decreased catalysis), increased inhibition or degradation of the proteins as well as a reduction or elimination of expression of the proteins. For example, the action or activity of a protein can be decreased by blocking or reducing the production of the protein, reducing protein action, or inhibiting the action of the protein. Combinations of some of these modifications are also possible. Blocking or reducing the production of a protein can include placing the gene encoding the protein under the control of a promoter that requires the presence of an inducing compound in the growth medium. By establishing conditions such that the inducer becomes depleted from the medium, the expression of the gene encoding the protein (and therefore, of protein synthesis) could be turned off. Blocking or reducing the action of a protein could also include using an excision technology approach similar to that described in U.S. Pat. No. 4,743,546. To use this approach, the gene encoding the protein of interest is cloned between specific genetic sequences that allow specific, controlled excision of the gene from the genome. Excision could be prompted by, for example, a shift in the cultivation temperature of the culture, as in U.S. Pat. No. 4,743,546, or by some other physical or nutritional signal.
[0106] In general, according to the present invention, an increase or a decrease in a given characteristic of a mutant or modified protein (e.g., enzyme activity) is made with reference to the same characteristic of a parent (i.e., normal, not modified) protein that is derived from the same organism (from the same source or parent sequence), which is measured or established under the same or equivalent conditions. Similarly, an increase or decrease in a characteristic of a genetically modified host cell (e.g., expression and/or biological activity of a protein, or production of a product) is made with reference to the same characteristic of a wild-type host cell of the same species, and preferably the same strain, under the same or equivalent conditions. Such conditions include the assay or culture conditions (e.g., medium components, temperature, pH, etc.) under which the activity of the protein (e.g., expression or biological activity) or other characteristic of the host cell is measured, as well as the type of assay used, the host cell that is evaluated, etc. As discussed above, equivalent conditions are conditions (e.g., culture conditions) which are similar, but not necessarily identical (e.g., some conservative changes in conditions can be tolerated), and which do not substantially change the effect on cell growth or enzyme expression or biological activity as compared to a comparison made under the same conditions.
[0107] Preferably, a genetically modified host cell that has a genetic modification that increases or decreases (reduces) the activity of a given protein (e.g., an O-mannosyltransferase or protease) has an increase or decrease, respectively, in the activity or action (e.g., expression, production and/or biological activity) of the protein, as compared to the activity of the protein in a parent host cell (which does not have such genetic modification), of at least about 5%, and more preferably at least about 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55 60%, 65%, 70%, 75 80%, 85 90%, 95%, or any percentage, in whole integers between 5% and 100% (e.g., 6%, 7%, 8%, etc.).
[0108] In another aspect of the invention, a genetically modified host cell that has a genetic modification that increases or decreases (reduces) the activity of a given protein (e.g., an O-mannosyltransferase or protease) has an increase or decrease, respectively, in the activity or action (e.g., expression, production and/or biological activity) of the protein, as compared to the activity of the wild-type protein in a parent host cell, of at least about 2-fold, and more preferably at least about 5-fold, 10-fold, 20-fold, 30-fold, 40-fold, 50-fold, 75-fold, 100-fold, 125-fold, 150-fold, or any whole integer increment starting from at least about 2-fold (e.g., 3-fold, 4-fold, 5-fold, 6-fold, etc.).
[0109] As used herein, the terms "identical" or percent "identity," in the context of two or more nucleic acid or amino acid sequences, refers to two or more sequences or subsequences that are the same. Two sequences are "substantially identical" if two sequences have a specified percentage of amino acid residues or nucleotides that are the same (i.e., 29% identity, optionally 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or 100% identity over a specified region, or, when not specified, over the entire sequence), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. Optionally, the identity exists over a region that is at least about 50 nucleotides (or 10 amino acids) in length, or more preferably over a region that is 100 to 500 or 1000 or more nucleotides (or 20, 50, 200, or more amino acids) in length.
[0110] For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters. When comparing two sequences for identity, it is not necessary that the sequences be contiguous, but any gap would carry with it a penalty that would reduce the overall percent identity. For blastn, the default parameters are Gap opening penalty=5 and Gap extension penalty=2. For blastp, the default parameters are Gap opening penalty=11 and Gap extension penalty=1.
[0111] A "comparison window," as used herein, includes reference to a segment of any one of the number of contiguous positions including, but not limited to from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. Methods of alignment of sequences for comparison are well known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith and Waterman (1981), by the homology alignment algorithm of Needleman and Wunsch (1970) J Mol Biol 48(3):443-453, by the search for similarity method of Pearson and Lipman (1988) Proc Natl Acad Sci USA 85(8):2444-2448, by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by manual alignment and visual inspection [see, e.g., Brent et al., (2003) Current Protocols in Molecular Biology, John Wiley & Sons, Inc. (Ringbou Ed)].
[0112] Two examples of algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al. (1997) Nucleic Acids Res 25(17):3389-3402 and Altschul et al. (1990) J. Mol Biol 215(3)-403-410, respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information. The BLASTN program (for nucleotide sequences) uses as defaults a wordlength (W) of 11, an expectation (E) or 10, M=5, N=-4, and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a wordlength of 3, and expectation (E) of 10, and the BLOSUM62 scoring matrix [see Henikoff and Henikoff, (1992) Proc Natl Acad Sci USA 89(22):10915-10919] alignments (B) of 50, expectation (E) of 10, M=5, N=-4, and a comparison of both strands.
[0113] The BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin and Altschul, (1993) Proc Natl Acad Sci USA 90(12):5873-5877). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01, and most preferably less than about 0.001.
[0114] "Functional variant" or "functional homologous gene" as used herein refers to a coding sequence or a protein having sequence similarity with a reference sequence, typically, at least 30%, 40%, 50%, 60%, 70%, 80%, 90% or 95% identity with the reference coding sequence or protein, and retaining substantially the same function as said reference coding sequence or protein. A functional variant may retain the same function but with reduced or increased activity. Functional variants include natural variants, for example, homologs from different species or artificial variants, resulting from the introduction of a mutation in the coding sequence. Functional variant may be a variant with only conservatively modified mutations.
[0115] "Conservatively modified mutations" as used herein include individual substitutions, deletions or additions to an encoded amino acid sequence which result in the substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are well known in the art. Such conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles of the disclosure. The following eight groups contain amino acids that are conservative substitutions for one another: 1) Alanine (A), Glycine (G); 2) Aspartic acid (D), Glutamic acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K); 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); 7) Serine (S), Threonine (T); and 8) Cysteine (C), Methionine (M) (see, e.g., Creighton, Proteins (1984)).
Filamentous Fungal Cells
[0116] As used herein, "filamentous fungal cells" include cells from all filamentous forms of the subdivision Eumycota and Oomycota (as defined by Hawksworth et al., In, Ainsworth and Bisby's Dictionary of The Fungi, 8th edition, 1995, CAB International, University Press, Cambridge, UK). Filamentous fungal cells are generally characterized by a mycelial wall composed of chitin, cellulose, glucan, chitosan, mannan, and other complex polysaccharides. Vegetative growth is by hyphal elongation and carbon catabolism is obligately aerobic. In contrast, vegetative growth by yeasts such as Saccharomyces cerevisiae is by budding of a unicellular thallus and carbon catabolism may be fermentative.
[0117] Preferably, the filamentous fungal cell is not adversely affected by the transduction of the necessary nucleic acid sequences, the subsequent expression of the proteins (e.g., mammalian proteins), or the resulting intermediates. General methods to disrupt genes of and cultivate filamentous fungal cells are disclosed, for example, for Penicillium, in Kopke et al. (2010) Appl Environ Microbiol. 76(14):4664-74. doi: 10.1128/AEM.00670-10, for Aspergillus, in Maruyama and Kitamoto (2011), Methods in Molecular Biology, vol. 765, DOI10.1007/978-1-61779-197-0_27; for Neurospora, in Collopy et al. (2010) Methods Mol Biol. 2010;638:33-40. doi: 10.1007/978-1-60761-611-5-3; and for Myceliophthora or Chrysosporium PCT/NL2010/000045 and PCT/EP98/06496.
[0118] Examples of suitable filamentous fungal cells include, without limitation, cells from an Acremonium, Aspergillus, Fusarium, Humicola, Mucor, Myceliophthora, Neurospora, Penicillium, Scytalidium, Thielavia, Tolypocladium, or Trichoderma/Hypocrea strain.
[0119] In certain embodiments, the filamentous fungal cell is from a Trichoderma sp., Acremonium, Aspergillus, Aureobasidium, Cryptococcus, Chrysosporium, Chrysosporium lucknowense, Filibasidium, Fusarium, Gibberella, Magnaporthe, Mucor, Myceliophthora, Myrothecium, Neocallimastix, Neurospora, Paecilomyces, Penicillium, Piromyces, Schizophyllum, Talaromyces, Thermoascus, Thielavia, or Tolypocladium strain.
[0120] In some embodiments, the filamentous fungal cell is a Myceliophthora or Chrysosporium, Neurospora or Trichoderma strain.
[0121] Aspergillus fungal cells of the present disclosure may include, without limitation, Aspergillus aculeatus, Aspergillus awamori, Aspergillus clavatus, Aspergillus flavus, Aspergillus foetidus, Aspergillus fumigatus, Aspergillus japonicus, Aspergillus nidulans, Aspergillus niger, Aspergillus oryzae, or Aspergillus terreus.
[0122] Neurospora fungal cells of the present disclosure may include, without limitation, Neurospora crassa.
[0123] Myceliophthora fungal cells of the present disclosure may include, without limitation, Myceliophthora thermophila.
[0124] In a preferred embodiment, the filamentous fungal cell is a Trichoderma fungal cell. Trichoderma fungal cells of the present disclosure may be derived from a wild-type Trichoderma strain or a mutant thereof. Examples of suitable Trichoderma fungal cells include, without limitation, Trichoderma harzianum, Trichoderma koningii, Trichoderma longibrachiatum, Trichoderma reesei, Trichoderma atroviride, Trichoderma virens, Trichoderma viride; and alternative sexual form thereof (i.e., Hypocrea).
[0125] In a more preferred embodiment, the filamentous fungal cell is a Trichoderma reesei, and for example, strains derived from ATCC 13631 (QM 6a), ATCC 24449 (radiation mutant 207 of QM 6a), ATCC 26921 (QM 9414; mutant of ATCC 24449), VTT-D-00775 (Selinheimo et al., FEBS J., 2006, 273: 4322-4335), Rut-C30 (ATCC 56765), RL-P37 (NRRL 15709) or T. harzianum isolate T3 (Wolffhechel, H., 1989).
[0126] The invention described herein relates to a PMT deficient filamentous fungal cell, for example selected from Trichoderma, Neurospora, Myceliophthora or a Chrysosporium cells, such as Trichoderma reesei fungal cell, comprising:
[0127] a. at least a first mutation that reduces or eliminates an endogenous protease activity compared to the parental filamentous fungal cell which does not have said first mutation (i.e. a protease-deficient mutation), and,
[0128] b. at least a second mutation in a PMT gene that reduces or eliminates an endogenous O-mannosyltransferase activity compared to a parental filamentous fungal cell which does not have said second mutation (i.e. a PMT-deficient mutation).
Proteases with Reduced Activity
[0129] It has been found that reducing protease activity enables to increase substantially the production of heterologous mammalian protein. Indeed, such proteases found in filamentous fungal cells that express a heterologous protein normally catalyse significant degradation of the expressed recombinant protein. Thus, by reducing the activity of proteases in filamentous fungal cells that express a heterologous protein, the stability of the expressed protein is increased, resulting in an increased level of production of the protein, and in some circumstances, improved quality of the produced protein (e.g., full-length instead of degraded).
[0130] Proteases include, without limitation, aspartic proteases, trypsin-like serine proteases, subtilisin proteases, glutamic proteases, and sedolisin proteases. Such proteases may be identified and isolated from filamentous fungal cells and tested to determine whether reduction in their activity affects the production of a recombinant polypeptide from the filamentous fungal cell. Methods for identifying and isolating proteases are well known in the art, and include, without limitation, affinity chromatography, zymogram assays, and gel electrophoresis. An identified protease may then be tested by deleting the gene encoding the identified protease from a filamentous fungal cell that expresses a recombinant polypeptide, such a heterologous or mammalian polypeptide, and determining whether the deletion results in a decrease in total protease activity of the cell, and an increase in the level of production of the expressed recombinant polypeptide. Methods for deleting genes, measuring total protease activity, and measuring levels of produced protein are well known in the art and include the methods described herein.
Aspartic Proteases
[0131] Aspartic proteases are enzymes that use an aspartate residue for hydrolysis of the peptide bonds in polypeptides and proteins. Typically, aspartic proteases contain two highly-conserved aspartate residues in their active site which are optimally active at acidic pH. Aspartic proteases from eukaryotic organisms such as Trichoderma fungi include pepsins, cathepsins, and renins. Such aspartic proteases have a two-domain structure, which is thought to arise from ancestral gene duplication. Consistent with such a duplication event, the overall fold of each domain is similar, though the sequences of the two domains have begun to diverge. Each domain contributes one of the catalytic aspartate residues. The active site is in a cleft formed by the two domains of the aspartic proteases. Eukaryotic aspartic proteases further include conserved disulfide bridges, which can assist in identification of the polypeptides as being aspartic acid proteases.
[0132] Nine aspartic proteases have been identified in Trichoderma fungal cells: pep1 (tre74156); pep2 (tre53961); pep3 (tre121133); pep4 (tre77579), pep5 (tre81004), and pep7 (tre58669), pep8 (tre122076), pep11 (121306), and pep12 (tre119876).
[0133] Examples of suitable aspartic proteases include, without limitation, Trichoderma reesei pep1 (SEQ ID NO: 22), Trichoderma reesei pep2 (SEQ ID NO: 18), Trichoderma reesei pep3 (SEQ ID NO: 19); Trichoderma reesei pep4 (SEQ ID NO: 20), Trichoderma reesei pep5 (SEQ ID NO: 21) and Trichoderma reesei pep7 (SEQ ID NO:23), Trichoderma reesei EGR48424 pep8 (SEQ ID NO:134), Trichoderma reesei EGR49498 pep11 (SEQ ID NO:135), Trichoderma reesei EGR52517 pep12 (SEQ ID NO:35), and homologs thereof. Examples of homologs of pep1, pep2, pep3, pep4, pep5, pep7, pep8, pep11 and pep12 proteases identified in other organisms are also described in PCT/EP/2013/050186, the content of which being incorporated by reference.
Trypsin-Like Serine Proteases
[0134] Trypsin-like serine proteases are enzymes with substrate specificity similar to that of trypsin. Trypsin-like serine proteases use a serine residue for hydrolysis of the peptide bonds in polypeptides and proteins. Typically, trypsin-like serine proteases cleave peptide bonds following a positively-charged amino acid residue. Trypsin-like serine proteases from eukaryotic organisms such as Trichoderma fungi include trypsin 1, trypsin 2, and mesotrypsin. Such trypsin-like serine proteases generally contain a catalytic triad of three amino acid residues (such as histidine, aspartate, and serine) that form a charge relay that serves to make the active site serine nucleophilic. Eukaryotic trypsin-like serine proteases further include an "oxyanion hole" formed by the backbone amide hydrogen atoms of glycine and serine, which can assist in identification of the polypeptides as being trypsin-like serine proteases.
[0135] One trypsin-like serine protease has been identified in Trichoderma fungal cells: tsp1 (tre73897). As discussed in PCT/EP/2013/050186, tsp1 has been demonstrated to have a significant impact on expression of recombinant glycoproteins, such as immunoglobulins.
[0136] Examples of suitable tsp1 proteases include, without limitation, Trichoderma reesei tsp1 (SEQ ID NO: 24) and homologs thereof. Examples of homologs of tsp1 proteases identified in other organisms are described in PCT/EP/2013/050186.
Subtilisin Proteases
[0137] Subtilisin proteases are enzymes with substrate specificity similar to that of subtilisin. Subtilisin proteases use a serine residue for hydrolysis of the peptide bonds in polypeptides and proteins. Generally, subtilisin proteases are serine proteases that contain a catalytic triad of the three amino acids aspartate, histidine, and serine. The arrangement of these catalytic residues is shared with the prototypical subtilisin from Bacillus licheniformis. Subtilisin proteases from eukaryotic organisms such as Trichoderma fungi include furin, MBTPS1, and TPP2. Eukaryotic trypsin-like serine proteases further include an aspartic acid residue in the oxyanion hole.
[0138] Seven subtilisin proteases have been identified in Trichoderma fungal cells: slp1 (tre51365); slp2 (tre123244); slp3 (tre123234); slp5 (tre64719), slp6 (tre121495), slp7 (tre123865), and slp8 (tre58698). Subtilisin protease slp7 resembles also sedolisin protease tpp1.
[0139] Examples of suitable slp proteases include, without limitation, Trichoderma reesei slp1 (SEQ ID NO: 25), slp2 (SEQ ID NO: 26); slp3 (SEQ ID NO: 27); slp5 (SEQ ID NO: 28), slp6 (SEQ ID NO: 29), slp7 (SEQ ID NO: 30), and slp8 (SEQ ID NO: 31), and homologs thereof. Examples of homologs of slp proteases identified in other organisms are described in in PCT/EP/2013/050186.
Glutamic Proteases
[0140] Glutamic proteases are enzymes that hydrolyse the peptide bonds in polypeptides and proteins. Glutamic proteases are insensitive to pepstatin A, and so are sometimes referred to as pepstatin insensitive acid proteases. While glutamic proteases were previously grouped with the aspartic proteases and often jointly referred to as acid proteases, it has been recently found that glutamic proteases have very different active site residues than aspartic proteases.
[0141] Two glutamic proteases have been identified in Trichoderma fungal cells: gap1 (tre69555) and gap2 (tre106661).
[0142] Examples of suitable gap proteases include, without limitation, Trichoderma reesei gap1 (SEQ ID NO: 32), Trichoderma reesei gap2 (SEQ ID NO: 33), and homologs thereof. Examples of homologs of gap proteases identified in other organisms are described in PCT/EP/2013/050186.
Sedolisin Proteases and Homologs of Proteases
[0143] Sedolisin proteases are enzymes that use a serine residue for hydrolysis of the peptide bonds in polypeptides and proteins. Sedolisin proteases generally contain a unique catalytic triad of serine, glutamate, and aspartate. Sedolisin proteases also contain an aspartate residue in the oxyanion hole. Sedolisin proteases from eukaryotic organisms such as Trichoderma fungi include tripeptidyl peptidase.
[0144] Examples of suitable tpp1 proteases include, without limitation, Trichoderma reesei tpp1 tre82623 (SEQ ID NO: 34) and homologs thereof. Examples of homologs of tpp1 proteases identified in other organisms are described in PCT/EP/2013/050186.
[0145] As used in reference to protease, the term "homolog" refers to a protein which has protease activity and exhibit sequence similarity with a known (reference) protease sequence. Homologs may be identified by any method known in the art, preferably, by using the BLAST tool to compare a reference sequence to a single second sequence or fragment of a sequence or to a database of sequences. As described in the "Definitions" section, BLAST will compare sequences based upon percent identity and similarity.
[0146] Preferably, a homologous protease has at least 30% identity with (optionally 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or 100% identity over a specified region, or, when not specified, over the entire sequence), when compared to one of the protease sequences listed above, including T. reesei pep1, pep2, pep3, pep4, pep5, pep7, pep8, pep11, pep12, tsp1, slp1, slp2, slp3, slp5, slp6, slp7, slp8, tpp1, gap1 and gap2. Corresponding homologous proteases from N. crassa and M. thermophila are shown in SEQ ID NO: 136-169.
Reducing the Activity of Proteases in the Filamentous Fungal Cell of the Invention
[0147] The filamentous fungal cells according to the invention have reduced activity of at least one endogenous protease, typically 2, 3, 4, 5 or more, in order to improve the stability and production of the protein with reduced O-mannosylation in said filamentous fungal cell, preferably in a PMT-deficient Trichoderma cell.
[0148] The activity of proteases found in filamentous fungal cells can be reduced by any method known to those of skill in the art. In some embodiments reduced activity of proteases is achieved by reducing the expression of the protease, for example, by promoter modification or RNAi.
[0149] In further embodiments, the reduced or eliminated expression of the proteases is the result of anti-sense polynucleotides or RNAi constructs that are specific for each of the genes encoding each of the proteases. In one embodiment, an RNAi construct is specific for a gene encoding an aspartic protease such as a pep-type protease, a trypsin-like serine proteases such as a tsp1, a glutamic protease such as a gap-type protease, a subtilisin protease such as a slp-type protease, or a sedolisin protease such as a tpp1 or a slp7 protease. In one embodiment, an RNAi construct is specific for the gene encoding a slp-type protease. In one embodiment, an RNAi construct is specific for the gene encoding slp2, slp3, slp5 or slp6. In one embodiment, an RNAi construct is specific for two or more proteases. In one embodiment, two or more proteases are any one of the pep-type proteases, any one of the trypsin-like serine proteasess, any one of the slp-type proteases, any one of the gap-type proteases and/or any one of the sedolisin proteases. In one embodiment, two or more proteases are slp2, slp3, slp5 and/or slp6. In one embodiment, RNAi construct comprises any one of the following nucleic acid sequences (see also PCT/EP/2013/050186).
TABLE-US-00001 RNAi Target sequence GCACACTTTCAAGATTGGC (SEQ ID NO: 15) GTACGGTGTTGCCAAGAAG (SEQ ID NO: 16) GTTGAGTACATCGAGCGCGACAGCATTGTGCACACCATGCTTCCCCTCG AGTCCAAGGACAGCATCATCGTTGAGGACTCGTGCAACGGCGAGACGGA GAAGCAGGCTCCCTGGGGTCTTGCCCGTATCTCTCACCGAGAGACGCTC AACTTTGGCTCCTTCAACAAGTACCTCTACACCGCTGATGGTGGTGAGG GTGTTGATGCCTATGTCATTGACACCGGCACCAACATCGAGCACGTCGA CTTTGAGGGTCGTGCCAAGTGGGGCAAGACCATCCCTGCCGGCGATGAG GACGAGGACGGCAACGGCCACGGCACTCACTGCTCTGGTACCGTTGCTG GTAAGAAGTACGGTGTTGCCAAGAAGGCCCACGTCTACGCCGTCAAGGT GCTCCGATCCAACGGATCCGGCACCATGTCTGACGTCGTCAAGGGCGTC GAGTACG (SEQ ID NO: 17)
[0150] In other embodiments, reduced activity of proteases is achieved by modifying the gene encoding the protease. Examples of such modifications include, without limitation, a mutation, such as a deletion or disruption of the gene encoding said endogenous protease activity.
[0151] Accordingly, the invention relates to a filamentous fungal cell, such as a PMT-deficient Trichoderma cell, which has a first mutation that reduces or eliminates at least one endogenous protease activity compared to a parental filamentous fungal cell which does not have such protease deficient mutation, said filamentous fungal cell further comprising at least a second mutation in a PMT gene that reduces endogenous protein O-mannosyltransferase activity compared to a parental Trichoderma cell which does not have said second PMT-deficient mutation.
[0152] Deletion or disruption mutation includes without limitation knock-out mutation, a truncation mutation, a point mutation, a missense mutation, a substitution mutation, a frameshift mutation, an insertion mutation, a duplication mutation, an amplification mutation, a translocation mutation, or an inversion mutation, and that results in a reduction in the corresponding protease activity. Methods of generating at least one mutation in a protease encoding gene of interest are well known in the art and include, without limitation, random mutagenesis and screening, site-directed mutagenesis, PCR mutagenesis, insertional mutagenesis, chemical mutagenesis, and irradiation.
[0153] In certain embodiments, a portion of the protease encoding gene is modified, such as the region encoding the catalytic domain, the coding region, or a control sequence required for expression of the coding region. Such a control sequence of the gene may be a promoter sequence or a functional part thereof, i.e., a part that is sufficient for affecting expression of the gene. For example, a promoter sequence may be inactivated resulting in no expression or a weaker promoter may be substituted for the native promoter sequence to reduce expression of the coding sequence. Other control sequences for possible modification include, without limitation, a leader sequence, a propeptide sequence, a signal sequence, a transcription terminator, and a transcriptional activator.
[0154] Protease encoding genes that are present in filamentous fungal cells may also be modified by utilizing gene deletion techniques to eliminate or reduce expression of the gene. Gene deletion techniques enable the partial or complete removal of the gene thereby eliminating their expression. In such methods, deletion of the gene may be accomplished by homologous recombination using a plasmid that has been constructed to contiguously contain the 5' and 3' regions flanking the gene.
[0155] The protease encoding genes that are present in filamentous fungal cells may also be modified by introducing, substituting, and/or removing one or more nucleotides in the gene, or a control sequence thereof required for the transcription or translation of the gene. For example, nucleotides may be inserted or removed for the introduction of a stop codon, the removal of the start codon, or a frame-shift of the open reading frame. Such a modification may be accomplished by methods known in the art, including without limitation, site-directed mutagenesis and peR generated mutagenesis (see, for example, Botstein and Shortie, 1985, Science 229: 4719; Lo et al., 1985, Proceedings of the National Academy of Sciences USA 81: 2285; Higuchi et al., 1988, Nucleic Acids Research 16: 7351; Shimada, 1996, Meth. Mol. Bioi. 57: 157; Ho et al., 1989, Gene 77: 61; Horton et al., 1989, Gene 77: 61; and Sarkar and Sommer, 1990, BioTechniques 8: 404).
[0156] Additionally, protease encoding genes that are present in filamentous fungal cells may be modified by gene disruption techniques by inserting into the gene a disruptive nucleic acid construct containing a nucleic acid fragment homologous to the gene that will create a duplication of the region of homology and incorporate construct nucleic acid between the duplicated regions. Such a gene disruption can eliminate gene expression if the inserted construct separates the promoter of the gene from the coding region or interrupts the coding sequence such that a nonfunctional gene product results. A disrupting construct may be simply a selectable marker gene accompanied by 5' and 3' regions homologous to the gene. The selectable marker enables identification of transformants containing the disrupted gene.
[0157] Protease encoding genes that are present in filamentous fungal cells may also be modified by the process of gene conversion (see, for example, Iglesias and Trautner, 1983, Molecular General Genetics 189:5 73-76). For example, in the gene conversion a nucleotide sequence corresponding to the gene is mutagenized in vitro to produce a defective nucleotide sequence, which is then transformed into a Trichoderma strain to produce a defective gene. By homologous recombination, the defective nucleotide sequence replaces the endogenous gene. It may be desirable that the defective nucleotide sequence also contains a marker for selection of transformants containing the defective gene.
[0158] Protease encoding genes of the present disclosure that are present in filamentous fungal cells that express a recombinant polypeptide may also be modified by established anti-sense techniques using a nucleotide sequence complementary to the nucleotide sequence of the gene (see, for example, Parish and Stoker, 1997, FEMS Microbiology Letters 154: 151-157). In particular, expression of the gene by filamentous fungal cells may be reduced or inactivated by introducing a nucleotide sequence complementary to the nucleotide sequence of the gene, which may be transcribed in the strain and is capable of hybridizing to the mRNA produced in the cells. Under conditions allowing the complementary anti-sense nucleotide sequence to hybridize to the mRNA, the amount of protein translated is thus reduced or eliminated.
[0159] Protease encoding genes that are present in filamentous fungal cells may also be modified by random or specific mutagenesis using methods well known in the art, including without limitation, chemical mutagenesis (see, for example, Hopwood, The Isolation of Mutants in Methods in Microbiology (J. R. Norris and D. W. Ribbons, eds.) pp. 363-433, Academic Press, New York, 25 1970). Modification of the gene may be performed by subjecting filamentous fungal cells to mutagenesis and screening for mutant cells in which expression of the gene has been reduced or inactivated. The mutagenesis, which may be specific or random, may be performed, for example, by use of a suitable physical or chemical mutagenizing agent, use of a suitable oligonucleotide, subjecting the DNA sequence to peR generated mutagenesis, or any combination thereof. Examples of physical and chemical mutagenizing agents include, without limitation, ultraviolet (UV) irradiation, hydroxylamine, N-methyl-N'-nitro-N-nitrosoguanidine (MNNG), N-methyl-N'-nitrosogaunidine (NTG) O-methyl hydroxylamine, nitrous acid, ethyl methane sulphonate (EMS), sodium bisulphite, formic acid, and nucleotide analogues. When such agents are used, the mutagenesis is typically performed by incubating the filamentous fungal cells, such as Trichoderma cells, to be mutagenized in the presence of the mutagenizing agent of choice under suitable conditions, and then selecting for mutants exhibiting reduced or no expression of the gene.
[0160] In certain embodiments, the at least one mutation or modification in a protease encoding gene of the present disclosure results in a modified protease that has no detectable protease activity. In other embodiments, the at least one modification in a protease encoding gene of the present disclosure results in a modified protease that has at least 25% less, at least 50% less, at least 75% less, at least 90%, at least 95%, or a higher percentage less protease activity compared to a corresponding non-modified protease.
[0161] The filamentous fungal cells or Trichoderma fungal cells of the present disclosure may have reduced or no detectable protease activity of at least three, or at least four proteases selected from the group consisting of pep1, pep2, pep3, pep4, pep5, pep8, pep11, pep12, tsp1, slp1, slp2, slp3, slp5, slp6, slp7, gap1 and gap2. In preferred embodiment, a filamentous fungal cell according to the invention is a PMT-deficient filamentous fungal cell which has a deletion or disruption in at least 3 or 4 endogenous proteases, resulting in no detectable activity for such deleted or disrupted endogenous proteases and further comprising another mutation in a PMT gene that reduces endogenous protein O-mannosyltransferase activity compared to a parental Trichoderma cell which does not have said mutation.
[0162] In certain embodiments, the PMT-deficient filamentous fungal cell or Trichoderma cell, has reduced or no detectable protease activity in pep1, tsp1, and slp1. In other embodiments, the PMT-deficient filamentous fungal cell or Trichoderma cell, has reduced or no detectable protease activity in gap1, slp1, and pep1. In certain embodiments, the PMT-deficient filamentous fungal cell or Trichoderma cell, has reduced or no detectable protease activity in slp2, pep1 and gap1. In certain embodiments, the PMT-deficient filamentous fungal cell or Trichoderma cell, has reduced or no detectable protease activity in slp2, pep1, gap1 and pep4. In certain embodiments, the PMT-deficient filamentous fungal cell or Trichoderma cell, has reduced or no detectable protease activity in slp2, pep1, gap1, pep4 and slp1. In certain embodiments, the PMT-deficient filamentous fungal cell or Trichoderma cell, has reduced or no detectable protease activity in slp2, pep1, gap1, pep4, slp1, and slp3. In certain embodiments, the PMT-deficient filamentous fungal cell or Trichoderma cell, has reduced or no detectable protease activity in slp2, pep1, gap1, pep4, slp1, slp3, and pep3. In certain embodiments, the PMT-deficient filamentous fungal cell or Trichoderma cell, has reduced or no detectable protease activity in slp2, pep1, gap1, pep4, slp1, slp3, pep3 and pep2. In certain embodiments, the PMT-deficient filamentous fungal cell or Trichoderma cell, has reduced or no detectable protease activity in slp2, pep1, gap1, pep4, slp1, slp3, pep3, pep2 and pep5. In certain embodiments, the PMT-deficient filamentous fungal cell or Trichoderma cell, has reduced or no detectable protease activity in slp2, pep1, gap1, pep4, slp1, slp3, pep3, pep2, pep5 and tsp1. In certain embodiments, the PMT-deficient filamentous fungal cell or Trichoderma cell, has reduced or no detectable protease activity in slp2, pep1, gap1, pep4, slp1, slp3, pep3, pep2, pep5, tsp1 and slp7. In certain embodiments, the PMT-deficient filamentous fungal cell or Trichoderma cell, has reduced or no detectable protease activity in slp2, pep1, gap1, pep4, slp1, slp3, pep3, pep2, pep5, tsp1, slp7 and slp8. In certain embodiments, the PMT-deficient filamentous fungal cell or Trichoderma cell, has reduced or no detectable protease activity in slp2, pep1, gap1, pep4, slp1, slp3, pep3, pep2, pep5, tsp1, slp7, slp8 and gap2. In certain embodiments, the PMT-deficient filamentous fungal cell or Trichoderma cell, has reduced or no detectable protease activity in at least three endogenous proteases selected from the group consisting of pep1, pep2, pep3, pep4, pep5, pep8, pep11, pep12, tsp1, slp2, slp3, slp7, gap1 and gap2. In certain embodiments, the PMT-deficient filamentous fungal cell or Trichoderma cell, has reduced or no detectable protease activity in at least three to six endogenous proteases selected from the group consisting of pep1, pep2, pep3, pep4, pep5, tsp1, slp1, slp2, slp3, gap1 and gap2. In certain embodiments, the PMT-deficient filamentous fungal cell or Trichoderma cell, has reduced or no detectable protease activity in at least seven to ten endogenous proteases selected from the group consisting of pep1, pep2, pep3, pep4, pep5, pep7, pep8, tsp1, slp1, slp2, slp3, slp5, slp6, slp7, slp8, tpp1, gap1 and gap2.
[0163] In one embodiment that may be combined with the precedent embodiments, the filamentous fungal cell of the invention does not comprise a deletion or disruption of an endogenous gene encoding a chaperone protein. In particular, said filamentous fungal cell of the invention expresses functional endogenous chaperone protein Protein Disulphide Isomerase (PDI).
Endogenous O-Mannosyltransferase in Filamentous Fungal Cells
[0164] O-mannosyltransferases are encoded by pmt genes in yeasts and filamentous fungi, which can be divided into three subfamilies, based on sequence homologies: PMT1, PMT2 and PMT4.
[0165] For example, in yeast S. cerevisiae, 7 different PMTs have been characterized: ScPMT1, ScPMT5 and ScPMT7 belong to the PMT1 subfamily. ScPMT2, ScPMT3 and ScPMT6 belong to the PMT2 subfamily and ScPMT4 belongs to the PMT4 subfamily. Such O-mannosyltransferases and their coding sequences may be identified and isolated from filamentous fungal cells and tested to determine whether reduction in their activity enables the reduction of O-mannosylation on secreted O-mannosylated recombinant protein preferably not affecting the production of such recombinant polypeptide from the filamentous fungal cell. Methods for identifying and isolating PMTs are well known in the art. An identified O-mannosyltransferase may then be tested by deleting the gene encoding the identified O-mannosyltransferase from a filamentous fungal cell that expresses a recombinant O-mannosylated protein, such a heterologous or mammalian O-mannosylated protein, and determining whether the deletion results in a decrease in total O-mannosyltransferase activity of the cell, preferably not affecting the level of production of the expressed recombinant protein. Methods for deleting genes and measuring levels of produced protein are well known in the art and include the methods described herein.
[0166] Three O-mannosyltransferases have been identified in Trichoderma fungal cells: pmt1, pmt2 and pmt3, belonging respectively based on sequence homologies to the PMT4, PMT1 and PMT2 subfamily.
[0167] Examples of suitable O-mannosyltransferase include, without limitation, Trichoderma reesei pmt1 (SEQ ID NO: 2), Trichoderma reesei pmt2 (SEQ ID NO: 3), Trichoderma reesei pmt3 (SEQ ID NO: 4) and homologs thereof. FIG. 5 shows phylogeny of pmt homologs in selected filamentous fungi and FIG. 6 shows an alignment of pmt1 conserved domains among different species.
[0168] In a preferred embodiment, said PMT-deficient filamentous fungal cell, e.g., a Trichoderma cell, has at least one mutation in a PMT gene selected from the group consisting of:
[0169] a) PMT1 gene comprising the polynucleotide of SEQ ID NO:1,
[0170] b) a functional homologous gene of PMT1 gene, which functional homologous gene is capable of restoring parental O-mannosylation level by functional complementation when introduced into a T. reesei strain having a disruption in said PMT1 gene, and,
[0171] c) a polynucleotide encoding a polypeptide having at least 50%, at least 60%, at least 70%, at least 90%, or at least 95% identity with SEQ ID NO:2, said polypeptide having protein O-mannosyltransferase activity.
[0172] More preferably, said PMT-deficient filamentous fungal cell, e.g., a Trichoderma cell, has at least one mutation in a PMT gene which
[0173] a) has a polynucleotide encoding a polypeptide having at least 50%, at least 60%, at least 70%, at least 90%, or at least 95% identity with SEQ ID NO:2, and,
[0174] b) is capable of restoring, at least 50%, preferably about 100% of parental O-mannosylation level by functional complementation when introduced into a T. reesei strain having a disruption in a T. reesei PMT1 gene.
[0175] Methods for disrupting PMT1 gene in T. reesei are disclosed in the Examples below.
[0176] Sequences of homologs of pmt1 in filamentous fungi can be found in the databases using sequence alignment search tools, such as BLAST algorithm. It includes without limitation, A. oryzae gi391865791, EIT75070.1 (SEQ ID NO:5), A. niger gi317036343, XP_001398147.2 (SEQ ID NO:6), A. nidulans gi67522004, XP_659063.1 (SEQ ID NO:7), T. virens gi358379774, EHK17453.1 (SEQ ID NO:8), T. atroviride gi358400594, EHK49920.1 (SEQ ID NO:9), F. oxysporum gi342879728, EGU80965.1 (SEQ ID NO:10), G. zeae gi46107450, XP_380784.1 (SEQ ID NO:11), M. thermophila gi367020262, XP_003659416.1 (SEQ ID NO:12), N. crassa gi164423013, XP_963926.2 (SEQ ID NO:13), and P. chrysogenum gi255953619, XP_002567562.1 (SEQ ID NO:14).
Reducing Endogenous Protein O-Mannosyltransferase Activity in Filamentous Fungal Cell of the Invention
[0177] The PMT-deficient filamentous fungal cells according to the invention have reduced activity of at least one O-mannosyltransferase activity, in order to reduce or decrease O-mannosylation in said filamentous fungal cell, preferably Trichoderma cell.
[0178] The activity of said O-mannosyltransferases found in filamentous fungal cells can be reduced by any method known to those of skill in the art. In some embodiments reduced activity of O-mannosyltransferases is achieved by reducing the expression of the O-mannosyltransferases, for example, by promoter modification or RNAi.
[0179] In other embodiments, reduced activity of O-mannosyltransferases is achieved by modifying the gene encoding the O-mannosyltransferase. Examples of such modifications include, without limitation, a mutation, such as a deletion or disruption of the gene encoding said endogenous O-mannosyltransferase activity.
[0180] Deletion or disruption mutation can be performed as described in the above sections, in particular in relation to deletion or disruption of genes encoding proteases. These includes without limitation knock-out mutation, a truncation mutation, a point mutation, a missense mutation, a substitution mutation, a frameshift mutation, an insertion mutation, a duplication mutation, an amplification mutation, a translocation mutation, or an inversion mutation, and that results in a reduction in the corresponding O-mannosyltransferase activity.
[0181] In certain embodiments, the mutation or modification in an O-mannosyltransferase (PMT) encoding gene of the present disclosure results in a modified O-mannosyltransferase that has no detectable O-mannosyltransferase activity. In other embodiments, the at least one modification in a O-mannosyltransferase encoding gene of the present disclosure results in a modified O-mannosyltransferase that has at least 25% less, at least 50% less, at least 75% less, at least 90%, at least 95%, or a higher percentage less O-mannosyltransferase activity compared to a corresponding non-modified O-mannosyltransferase.
[0182] In preferred embodiment, a mutation that reduces endogenous protein O-mannosyltransferase activity in a PMT-deficient filamentous fungal cell, e.g. Trichoderma cell, is a PMT-deficient cell which has a deletion or disruption of a PMT gene encoding said O-mannosyltransferase activity, resulting in no detectable expression for such deleted or disrupted PMT gene.
[0183] One specific embodiment of the present invention is a PMT-deficient Trichoderma reesei cell, comprising
[0184] a. at least a first mutation that reduces an endogenous protease activity compared to a parental Trichoderma cell which does not have said first mutation, and,
[0185] b. at least a disruption or deletion of PMT1 gene of T. reesei.
[0186] c. optionally, said cell further express a heterologous protein with serine or threonine, which has reduced O-mannosylation due to said mutation in said PMT gene.
[0187] The reduction (or decrease) of O-mannosyltransferase activity may be determined by comparing the O-mannosylation level of a heterologous protein in PMT-deficient filamentous fungal cell according to the invention, with the O-mannosylation level of a heterologous protein in the parental cell which does not have said PMT-deficient mutation.
[0188] In specific embodiments, the PMT-deficient filamentous fungal cell according to the invention expresses a heterologous protein which has reduced O-mannosylation due to said mutation in said PMT gene and the O-mannosylation level on the expressed heterologous protein is at least 20%, 40%, 50%, 60%, 70%, 80%, or 90% lower than the O-mannosylation level of the heterologous protein when expressed in the parental filamentous fungal cell which does not have said second PMT-deficient mutation.
[0189] O-mannosylation level may also be determined as mole % of O-mannosylated polypeptide per total polypeptide as produced by the host cell of the invention. Analytical methods, such as MALDI TOF MS analysis may be used to determine O-mannosylation level as described in detail in the Example 1 below, section entitled "Analyses of Dpmt1 strains M403, M404, M406 and M407. In brief, a polypeptide as produced by the PMT-deficient filamentous fungal cell is purified to determine its O-mannoslyation level. Non O-mannosylated, and O-mannosylated structure of the polypeptide are separated and quantified by MALDI-TOF MS analysis. For example, the quantification of O-mannosylation level may be performed by determining area values or intensity of the different peaks of MALDI-TOF MS spectrum. An O-mannosylation level of 5% as determined by such method, using area values or intensity, reflects that about 95% (mol %) of the analysed polypeptides in the composition are not O-mannosylatedln specific embodiments, the PMT-deficient filamentous fungal cell expresses a heterologous protein which has reduced O-mannosylation due to said mutation in said PMT gene, and the O-mannosylation level on the expressed heterologous protein (for example, as defined above by determining area or intensity values of MALDI TOF MS spectrum peaks) is reduced to less than 25%, 20%, 17%, 15%, 13%, 12%,11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or 1%, or 0.5% (as mole % of mannose residues per polypeptide chain).
[0190] In an embodiment, the heterologous protein with reduced O-mannosylation is selected from the group consisting of:
[0191] a) an immunoglubulin, such as IgG,
[0192] b) a light chain or heavy chain of an immunoglobulin,
[0193] c) a heavy chain or a light chain of an antibody,
[0194] d) a single chain antibody,
[0195] e) a camelid antibody,
[0196] f) a monomeric or multimeric single domain antibody,
[0197] g) a FAb-fragment, a FAb2-fragment, and,
[0198] h) their antigen-binding fragments.
[0199] In a specific embodiment, a mutation that reduces endogenous O-mannosyltransferase activity is a deletion or a disruption of a PMT gene encoding said engogenous protein O-mannosyltransferase activity. For example in Trichoderma cell, a mutation that reduces endogenous O-mannosyltransferase activity is a deletion or a disruption of a PMT1 gene.
Filamentous Fungal Cell for Producing Glycoproteins with Reduced O-Mannosylation and Mammalian-Like N-Glycans
[0200] The filamentous fungal cells according to the present invention may be useful in particular for producing heterologous glycoproteins with reduced O-mannosylation and mammalian-like N-glycans, such as complex N-glycans.
[0201] Accordingly, in one aspect, the filamentous fungal cell is further genetically modified to produce a mammalian-like N-glycan, thereby enabling in vivo production of glycoprotein with no or reduced O-mannosylation and with mammalian-like N-glycan as major glycoforms.
[0202] In certain embodiments, this aspect includes methods of producing glycoproteins with mammalian-like N-glycans in a Trichoderma cell.
[0203] In certain embodiment, the glycoprotein comprises, as a major glycoform, the mammalian-like N-glycan having the formula [(Gal.beta.4).sub.xGlcNAc.beta.2].sub.zMan.alpha.3([(Gal.beta.4).sub.yGlc- NAc.beta.2].sub.wMan.alpha.6)Man{.beta.4GlcNAc.beta.GlcNAc, where ( ) defines a branch in the structure, where [ ] or { } define a part of the glycan structure either present or absent in a linear sequence, and where x, y, z and w are 0 or 1, independently. In an embodiment w and z are 1.
[0204] In certain embodiments, the glycoprotein comprises, as a major glycoform, mammalian-like N-glycan selected from the group consisting of:
[0205] i. Man.alpha.3[Man.alpha.6(Man.alpha.3)Man.alpha.6]Man.beta.4GlcNA.beta.4Glc- NAc (Man5 glycoform);
[0206] ii. GlcNAc.beta.2Man.alpha.3[Man.alpha.6(Man.alpha.3)Man.alpha.6]Man.beta.4Gl- cNA.beta.4GlcNAc (GlcNAcMan5 glycoform);
[0207] iii. Man.alpha.6(Man.alpha.3)Man.beta.4GlcNA.beta.4GlcNAc (Man3 glycoform);
[0208] iv. Man.alpha.6(GlcNAc.beta.2Man.alpha.3)Man.beta.4GlcNA.beta.4GlcNAc (GlcNAcMan3) or,
[0209] v. complex type N-glycans selected from the G0, G1, or G2 glycoform.
[0210] In an embodiment, the glycoprotein composition with mammalian-like N-glycans, preferably produced by an alg3 knock-out strain, include glycoforms that essentially lack or are devoid of glycans Man.alpha.3[Man.alpha.6(Man.alpha.3)Man.alpha.6]Man.beta.4GlcNA.beta.4Glc- NAc (Man5). In specific embodiments, the filamentous fungal cell produces glycoproteins with, as major glycoform, the trimannosyl N-glycan structure Man.alpha.3[Man.alpha.6]Man.beta.4GlcNAc.beta.4GlcNAc. In other embodiments, the filamentous fungal cell procudes glycoproteins with, as major glycoform, the G0 N-glycan structure GlcNAc.beta.2Man.alpha.3[GlcNAc.beta.2Man.alpha.6]Man.beta.4GlcNAc.beta.4- GlcNAc.
[0211] In certain embodiments, the PMT-deficient filamentous fungal cell of the invention produces glycoprotein composition with a mixture of different N-glycans.
[0212] In some embodiments, Man3GlcNAc2 N-glycan (i.e. Man.alpha.3[Man.alpha.6]Man.beta.4GlcNAc.beta.4GlcNAc) represents at least 10%, at least 20%, at least at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90% or more of total (mol %) neutral N-glycans of a heterologous protein with reduced O-mannosylation, as expressed in a filamentous fungal cells of the invention.
[0213] In other embodiments, GlcNAc2Man3 N-glycan (for example G0 GlcNAc.beta.2Man.alpha.3[GlcNAc.beta.2Man.alpha.6]Man.beta.4GlcNAc.beta.4- GlcNAc) represents at least 10%, at least 20%, at least at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90% or more of total (mol %) neutral N-glycans of a heterologous protein with reduced O-mannosylation, as expressed in a filamentous fungal cells of the invention.
[0214] In other embodiments, GalGlcNAc2Man3GlcNAc2 N-glycan (for example G1 N-glycan) represents at least 10%, at least 20%, at least at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90% or more of total (mol %) neutral N-glycans of a heterologous protein with reduced O-mannosylation, as expressed in a filamentous fungal cells of the invention.
[0215] In other embodiments, Gal2GlcNAc2Man3GlcNAc2 N-glycan (for example G2 N-glycan) represents at least 10%, at least 20%, at least at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90% or more of total (mol %) neutral N-glycans of a heterologous protein with reduced O-mannosylation, as expressed in a filamentous fungal cells of the invention.
[0216] In other embodiments, complex type N-glycan represents at least 10%, at least 20%, at least at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90% or more of total (mol %) neutral N-glycans of a heterologous protein with reduced O-mannosylation, as expressed in a filamentous fungal cells of the invention.
[0217] In other embodiments, hybrid type N-glycan represents at least 10%, at least 20%, at least at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90% or more of total (mol %) neutral N-glycans of a heterologous protein with reduced O-mannosylation, as expressed in a filamentous fungal cells of the invention.
[0218] In other embodiments, less than 0.5%, 0.1%, 0.05%, or less than 0.01% of the N-glycan of the glycoprotein composition produced by the host cell of the invention, comprises galactose. In certain embodiments, none of N-glycans comprise galactose.
[0219] The Neu5Gc and Gal.alpha.- (non-reducing end terminal Gal.alpha.3Gal.beta.4GlcNAc) structures are known xenoantigenic (animal derived) modifications of antibodies which are produced in animal cells such as CHO cells. The structures may be antigenic and, thus, harmful even at low concentrations. The filamentous fungi of the present invention lack biosynthetic pathways to produce the terminal Neu5Gc and Gal.alpha.-structures. In an embodiment that may be combined with the preceding embodiments less than 0.1%, 0.01%, 0.001% or 0% of the N-glycans and/or O-glycans of the glycoprotein composition comprises Neu5Gc and/or Gal.alpha.-structure. In an embodiment that may be combined with the preceding embodiments, less than 0.1%, 0.01%, 0.001% or 0% of the N-glycans and/or O-glycans of the antibody composition comprises Neu5Gc and/or Gal.alpha.-structure.
[0220] The filamentous fungal cells of the present invention lack genes to produce fucosylated heterologous proteins. In an embodiment that may be combined with the preceding embodiments, less than 0.1%, 0.01%, 0.001%, or 0% of the N-glycan of the glycoprotein composition comprises core fucose structures. In an embodiment that may be combined with the preceding embodiments, less than 0.1%, 0.01%, 0.001%, or 0% of the N-glycan of the antibody composition comprises core fucose structures.
[0221] The terminal Gal.beta.4GlcNAc structure of N-glycan of mammalian cell produced glycans affects bioactivity of antibodies and Gal.beta.3GlcNAc may be xenoantigen structure from plant cell produced proteins. In an embodiment that may be combined with one or more of the preceding embodiments, less than 0.1%, 0.01%, 0.001%, or 0% of N-glycan of the glycoprotein composition comprises terminal galactose epitopes Gal.beta.3/4GlcNAc. In an embodiment that may be combined with one or more of the preceding embodiments, less than 0.1%, 0.01%, 0.001%, or 0% of the N-glycan of the antibody composition comprises terminal galactose epitopes Gal.beta.3/4GlcNAc.
[0222] Glycation is a common post-translational modification of proteins, resulting from the chemical reaction between reducing sugars such as glucose and the primary amino groups on protein. Glycation occurs typically in neutral or slightly alkaline pH in cell cultures conditions, for example, when producing antibodies in CHO cells and analysing them (see, for example, Zhang et al. (2008) Unveiling a glycation hot spot in a recombinant humanized monoclonal antibody. Anal Chem. 80(7):2379-2390). As filamentous fungi of the present invention are typically cultured in acidic pH, occurrence of glycation is reduced. In an embodiment that may be combined with the preceding embodiments, less than 1.0%, 0.5%, 0.1%, 0.01%, 0.001%, or 0% of the glycoprotein composition comprises glycation structures. In an embodiment that may be combined with the preceding embodiments, less than 1.0%, 0.5%, 0.1%, 0.01%, 0.001%, or 0% of the antibody composition comprises glycation structures.
[0223] In one embodiment, the glycoprotein composition, such as an antibody is devoid of one, two, three, four, five, or six of the structures selected from the group of Neu5Gc, terminal Gal.alpha.3Gal.beta.4GlcNAc, terminal Gal.beta.4GlcNAc, terminal Gal.beta.3GlcNAc, core linked fucose and glycation structures.
[0224] In certain embodiments, such glycoprotein protein with mammalian-like N-glycan and reduced O-mannosylation, as produced in the filamentous fungal cell of the invention, is a therapeutic protein. Therapeutic proteins may include immunoglobulin, or a protein fusion comprising a Fc fragment or other therapeutic glycoproteins, such as antibodies, erythropoietins, interferons, growth hormones, albumins or serum albumin, enzymes, or blood-clotting factors and may be useful in the treatment of humans or animals. For example, the glycoproteins with mammalian-like N-glycan and reduced O-mannosylation as produced by the filamentous fungal cell according to the invention may be a therapeutic glycoprotein such as rituximab.
[0225] Methods for producing glycoproteins with mammalian-like N-glycans in filamentous fungal cells are also described for example in WO2012/069593.
[0226] In one aspect, the filamentous fungal cell according to the invention as described above, is further genetically modified to mimick the traditional pathway of mammalian cells, starting from Man5 N-glycans as acceptor substrate for GnTI, and followed sequentially by GnT1, mannosidase II and GnTII reaction steps (hereafter referred as the "traditional pathway" for producing G0 glycoforms). In one variant, a single recombinant enzyme comprising the catalytic domains of GnTI and GnTII, is used.
[0227] Alternatively, in a second aspect, the filamentous fungal cell according to the invention as described above is further genetically modified to have alg3 reduced expression, allowing the production of core Man.sub.3GlcNAc.sub.2 N-glycans, as acceptor substrate for GnTI and GnTII subsequent reactions and bypassing the need for mannosidase .alpha.1,2 or mannosidase II enzymes (the reduced "alg3" pathway). In one variant, a single recombinant enzyme comprising the catalytic domains of GnTI and GnTII, is used.
[0228] In such embodiments for mimicking the traditional pathway for producing glycoproteins with mammalian-like N-glycans, a Man.sub.5 expressing filamentous fungal cell, such as T. reesei strain, may be transformed with a GnTI or a GnTII/GnTI fusion enzyme using random integration or by targeted integration to a known site known not to affect Man5 glycosylation. Strains that synthesise GlcNAcMan5 N-glycan for production of proteins having hybrid type glycan(s) are selected. The selected strains are further transformed with a catalytic domain of a mannosidase II-type mannosidase capable of cleaving Man5 structures to generate GlcNAcMan3 for production of proteins having the corresponding GlcNAcMan3 glycoform or their derivative(s). In certain embodiments, mannosidase II-type enzymes belong to glycoside hydrolase family 38 (cazy.org/GH38_all.html). Characterized enzymes include enzymes listed in cazy.org/GH38_characterized.html. Especially useful enzymes are Golgi-type enzymes that cleaving glycoproteins, such as those of subfamily .alpha.-mannosidase II (Man2A1;ManA2). Examples of such enzymes include human enzyme AAC50302, D. melanogaster enzyme (Van den Elsen J. M. et al (2001) EMBO J. 20: 3008-3017), those with the 3D structure according to PDB-reference 1HTY, and others referenced with the catalytic domain in PDB. For cytoplasmic expression, the catalytic domain of the mannosidase is typically fused with an N-terminal targeting peptide (for example as disclosed in the above Section) or expressed with endogenous animal or plant Golgi targeting structures of animal or plant mannosidase II enzymes. After transformation with the catalytic domain of a mannosidase II-type mannosidase, strains are selected that produce GlcNAcMan3 (if GnTI is expressed) or strains are selected that effectively produce GlcNAc2Man3 (if a fusion of GnTI and GnTII is expressed). For strains producing GlcNAcMan3, such strains are further transformed with a polynucleotide encoding a catalytic domain of GnTII and transformant strains that are capable of producing GlcNAc2Man3GlcNAc2 are selected.
[0229] In such embodiment for mimicking the traditional pathway, the filamentous fungal cell is a PMT-deficient filamentous fungal cell as defined in previous sections, and further comprising one or more polynucleotides encoding a polypeptide selected from the group consisting of:
[0230] i) .alpha.1,2 mannosidase,
[0231] ii) N-acetylglucosaminyltransferase I catalytic domain,
[0232] iii) .alpha. mannosidase II,
[0233] iv) N-acetylglucosaminyltransferase II catalytic domain,
[0234] v) .beta.1,4 galactosyltransferase, and,
[0235] vi) fucosyltransferase.
[0236] In embodiments using the reduced alg3 pathway, the filamentous fungal cell, such as a Trichoderma cell, has a reduced level of activity of a dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase compared to the level of activity in a parent host cell. Dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase (EC 2.4.1.130) transfers an alpha-D-mannosyl residue from dolichyl-phosphate D-mannose into a membrane lipid-linked oligosaccharide. Typically, the dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase enzyme is encoded by an alg3 gene. In certain embodiments, the filamentous fungal cell for producing glycoproteins with mammalian-like N-glycans has a reduced level of expression of an alg3 gene compared to the level of expression in a parent strain.
[0237] More preferably, the filamentous fungal cell comprises a mutation of alg3. The ALG3 gene may be mutated by any means known in the art, such as point mutations or deletion of the entire alg3 gene. For example, the function of the alg3 protein is reduced or eliminated by the mutation of alg3. In certain embodiments, the alg3 gene is disrupted or deleted from the filamentous fungal cell, such as Trichoderma cell. In certain embodiments, the filamentous fungal cell is a T. reesei cell. SEQ ID NOs: 36 and 37 provide, the nucleic acid and amino acid sequences of the alg3 gene in T. reesei, respectively. In an embodiment the filamentous fungal cell is used for the production of a glycoprotein, wherein the glycan(s) comprise or consist of Man.alpha.3[Man.alpha.6]Man.beta.4GlcNAc.beta.4GlcNAc, and/or a non-reducing end elongated variant thereof.
[0238] In certain embodiments, the filamentous fungal cell has a reduced level of activity of an alpha-1,6-mannosyltransferase compared to the level of activity in a parent strain. Alpha-1,6-mannosyltransferase (EC 2.4.1.232) transfers an alpha-D-mannosyl residue from GDP-mannose into a protein-linked oligosaccharide, forming an elongation initiating alpha-(1->6)-D-mannosyl-D-mannose linkage in the Golgi apparatus. Typically, the alpha-1,6-mannosyltransferase enzyme is encoded by an och1 gene. In certain embodiments, the filamentous fungal cell has a reduced level of expression of an och1 gene compared to the level of expression in a parent filamentous fungal cell. In certain embodiments, the och1 gene is deleted from the filamentous fungal cell.
[0239] The filamentous fungal cells used in the methods of producing glycoprotein with mammalian-like N-glycans may further contain a polynucleotide encoding an N-acetylglucosaminyltransferase I catalytic domain (GnTI) that catalyzes the transfer of N-acetylglucosamine to a terminal Man.alpha.3 and a polynucleotide encoding an N-acetylglucosaminyltransferase II catalytic domain (GnTII), that catalyses N-acetylglucosamine to a terminal Man.alpha.6 residue of an acceptor glycan to produce a complex N-glycan. In one embodiment, said polynucleotides encoding GnTI and GnTII are linked so as to produce a single protein fusion comprising both catalytic domains of GnTI and GnTII.
[0240] As disclosed herein, N-acetylglucosaminyltransferase I (GlcNAc-TI; GnTI; EC 2.4.1.101) catalyzes the reaction UDP-N-acetyl-D-glucosamine+3-(alpha-D-mannosyl)-beta-D-mannosyl-R<=>- ;UDP+3-(2-(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl- -R, where R represents the remainder of the N-linked oligosaccharide in the glycan acceptor. An N-acetylglucosaminyltransferase I catalytic domain is any portion of an N-acetylglucosaminyltransferase I enzyme that is capable of catalyzing this reaction. GnTI enzymes are listed in the CAZy database in the glycosyltransferase family 13 ( cazy.org/GT13_all). Enzymatically characterized species includes A. thaliana AAR78757.1 (U.S. Pat. No. 6,653,459), C. elegans AAD03023.1 (Chen S. et al J. Biol.Chem 1999;274(1):288-97), D. melanogaster AAF57454.1 (Sarkar & Schachter Biol Chem. 2001 Feb;382(2):209-17); C. griseus AAC52872.1 (Puthalakath H. et al J. Biol.Chem 1996 271(44):27818-22); H. sapiens AAA52563.1 (Kumar R. et al Proc Natl Acad Sci U S A. 1990 Dec;87(24):9948-52); M. auratus AAD04130.1 (Opat As et al Biochem J. 1998 Dec 15;336 (Pt 3):593-8), (including an example of deactivating mutant), Rabbit, O. cuniculus AAA31493.1 (Sarkar Met al. Proc Natl Acad Sci U S A. 1991 Jan 1;88(1):234-8). Amino acid sequences for N-acetylglucosaminyltransferase I enzymes from various organisms are described for example in PCT/EP2011/070956. Additional examples of characterized active enzymes can be found at cazy.org/GT13_characterized. The 3D structure of the catalytic domain of rabbit GnTI was defined by X-ray crystallography in Unligil U M et al. EMBO J. 2000 Oct 16;19(20):5269-80. The Protein Data Bank (PDB) structures for GnTI are 1FO8, 1 FO9, 1FOA, 2AM3, 2AM4, 2AM5, and 2APC. In certain embodiments, the N-acetylglucosaminyltransferase I catalytic domain is from the human N-acetylglucosaminyltransferase I enzyme (SEQ ID NO: 38) or variants thereof. In certain embodiments, the N-acetylglucosaminyltransferase I catalytic domain contains a sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to amino acid residues 84-445 of SEQ ID NO: 38. In some embodiments, a shorter sequence can be used as a catalytic domain (e.g. amino acid residues 105-445 of the human enzyme or amino acid residues 107-447 of the rabbit enzyme; Sarkar et al. (1998) Glycoconjugate J 15:193-197). Additional sequences that can be used as the GnTI catalytic domain include amino acid residues from about amino acid 30 to 445 of the human enzyme or any C-terminal stem domain starting between amino acid residue 30 to 105 and continuing to about amino acid 445 of the human enzyme, or corresponding homologous sequence of another GnTI or a catalytically active variant or mutant thereof. The catalytic domain may include N-terminal parts of the enzyme such as all or part of the stem domain, the transmembrane domain, or the cytoplasmic domain.
[0241] As disclosed herein, N-acetylglucosaminyltransferase II (GlcNAc-TII; GnTII; EC 2.4.1.143) catalyzes the reaction UDP-N-acetyl-D-glucosamine+6-(alpha-D-mannosyl)-beta-D-mannosyl-R<=>- ;UDP+6-(2-(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl- -R, where R represents the remainder of the N-linked oligosaccharide in the glycan acceptor. An N-acetylglucosaminyltransferase II catalytic domain is any portion of an N-acetylglucosaminyltransferase II enzyme that is capable of catalyzing this reaction. Amino acid sequences for N-acetylglucosaminyltransferase II enzymes from various organisms are listed in WO2012069593. In certain embodiments, the N-acetylglucosaminyltransferase II catalytic domain is from the human N-acetylglucosaminyltransferase II enzyme (SEQ ID NO: 39) or variants thereof. Additional GnTII species are listed in the CAZy database in the glycosyltransferase family 16 (cazy.org/GT16_all). Enzymatically characterized species include GnTII of C. elegans, D. melanogaster, Homo sapiens (NP_002399.1), Rattus norvegicus, Sus scrofa (cazy.org/GT16_characterized). In certain embodiments, the N-acetylglucosaminyltransferase II catalytic domain contains a sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to amino acid residues from about 30 to about 447 of SEQ ID NO: 39. The catalytic domain may include N-terminal parts of the enzyme such as all or part of the stem domain, the transmembrane domain, or the cytoplasmic domain.
[0242] In embodiments where the filamentous fungal cell contains a fusion protein of the invention, the fusion protein may further contain a spacer in between the N-acetylglucosaminyltransferase I catalytic domain and the N-acetylglucosaminyltransferase II catalytic domain. In certain embodiments, the spacer is an EGIV spacer, a 2.times.G4S spacer, a 3.times.G4S spacer, or a CBHI spacer. In other embodiments, the spacer contains a sequence from a stem domain.
[0243] For ER/Golgi expression the N-acetylglucosaminyltransferase I and/or N-acetylglucosaminyltransferase II catalytic domain is typically fused with a targeting peptide or a part of an ER or early Golgi protein, or expressed with an endogenous ER targeting structures of an animal or plant N-acetylglucosaminyltransferase enzyme. In certain preferred embodiments, the N-acetylglucosaminyltransferase I and/or N-acetylglucosaminyltransferase II catalytic domain contains any of the targeting peptides of the invention as described in the section entitled "Targeting sequences". Preferably, the targeting peptide is linked to the N-terminal end of the catalytic domain. In some embodiments, the targeting peptide contains any of the stem domains of the invention as described in the section entitled "Targeting sequences". In certain preferred embodiments, the targeting peptide is a Kre2/Mnt1 targeting peptide. In other embodiments, the targeting peptide further contains a transmembrane domain linked to the N-terminal end of the stem domain or a cytoplasmic domain linked to the N-terminal end of the stem domain. In embodiments where the targeting peptide further contains a transmembrane domain, the targeting peptide may further contain a cytoplasmic domain linked to the N-terminal end of the transmembrane domain.
[0244] The filamentous fungal cells may also contain a polynucleotide encoding a UDP-GlcNAc transporter. The polynucleotide encoding the UDP-GlcNAc transporter may be endogenous (i.e., naturally present) in the host cell, or it may be heterologous to the filamentous fungal cell.
[0245] In certain embodiments, the filamentous fungal cell may further contain a polynucleotide encoding a .alpha.-1,2-mannosidase. The polynucleotide encoding the .alpha.-1,2-mannosidase may be endogenous in the host cell, or it may be heterologous to the host cell. Heterologous polynucleotides are especially useful for a host cell expressing high-mannose glycans transferred from the Golgi to the ER without effective exo-.alpha.-2-mannosidase cleavage. The .alpha.-1,2-mannosidase may be a mannosidase I type enzyme belonging to the glycoside hydrolase family 47 (cazy.org/GH47_all.html). In certain embodiments the .alpha.-1,2-mannosidase is an enzyme listed at cazy.org/GH47_characterized.html. In particular, the .alpha.-1,2-mannosidase may be an ER-type enzyme that cleaves glycoproteins such as enzymes in the subfamily of ER .alpha.-mannosidase I EC 3.2.1.113 enzymes. Examples of such enzymes include human .alpha.-2-mannosidase 1B (AAC26169), a combination of mammalian ER mannosidases, or a filamentous fungal enzyme such as .alpha.-1,2-mannosidase (MDS1) (T. reesei AAF34579; Maras M et al J Biotech. 77, 2000, 255, or Trire 45717). For ER expression, the catalytic domain of the mannosidase is typically fused with a targeting peptide, such as HDEL, KDEL, or part of an ER or early Golgi protein, or expressed with an endogenous ER targeting structures of an animal or plant mannosidase I enzyme.
[0246] In certain embodiments, the filamentous fungal cell may also further contain a polynucleotide encoding a galactosyltransferase. Galactosyltransferases transfer .beta.-linked galactosyl residues to terminal N-acetylglucosaminyl residue. In certain embodiments the galactosyltransferase is a .beta.-1,4-galactosyltransferase. Generally, .beta.-1,4-galactosyltransferases belong to the CAZy glycosyltransferase family 7 (cazy.org/GT7_all.html) and include .beta.-N-acetylglucosaminyl-glycopeptide .beta.-1,4-galactosyltransferase (EC 2.4.1.38), which is also known as N-acetylactosamine synthase (EC 2.4.1.90). Useful subfamilies include .beta.4-GalT1, .beta.4-GaIT-II, -III, -IV, -V, and -VI, such as mammalian or human .beta.4-GalTI or .beta.4GalT-II, -III, -IV, -V, and -VI or any combinations thereof. .beta.4-GalT1, .beta.4-GalTII, or .beta.4-GalTIII are especially useful for galactosylation of terminal GlcNAc.beta.2-structures on N-glycans such as GlcNAcMan3, GlcNAc2Man3, or GlcNAcMan5 (Guo S. et al. Glycobiology 2001, 11:813-20). The three-dimensional structure of the catalytic region is known (e.g. (2006) J.Mol.Biol. 357: 1619-1633), and the structure has been represented in the PDB database with code 2FYD. The CAZy database includes examples of certain enzymes. Characterized enzymes are also listed in the CAZy database at cazy.org/GT7_characterized.html. Examples of useful .beta.4GalT enzymes include .beta.4GalT1, e.g. bovine Bos taurus enzyme AAA30534.1 (Shaper N. L. et al Proc. Natl. Acad. Sci. U.S.A. 83 (6), 1573-1577 (1986)), human enzyme (Guo S. et al. Glycobiology 2001, 11:813-20), and Mus musculus enzyme AAA37297 (Shaper, N. L. et al. 1998 J. Biol. Chem. 263 (21), 10420-10428); .beta.4GalTII enzymes such as human .beta.4GalTII BAA75819.1, Chinese hamster Cricetulus griseus AAM77195, Mus musculus enzyme BAA34385, and Japanese Medaka fish Oryzias latipes BAH36754; and .beta.4GalTIII enzymes such as human .beta.4GalTIII BAA75820.1, Chinese hamster Cricetulus griseus AAM77196 and Mus musculus enzyme AAF22221.
[0247] The galactosyltransferase may be expressed in the plasma membrane of the host cell. A heterologous targeting peptide, such as a Kre2 peptide described in Schwientek J.Biol. Chem 1996 3398, may be used. Promoters that may be used for expression of the galactosyltransferase include constitutive promoters such as gpd, promoters of endogenous glycosylation enzymes and glycosyltransferases such as mannosyltransferases that synthesize N-glycans in the Golgi or ER, and inducible promoters of high-yield endogenous proteins such as the cbh1 promoter.
[0248] In certain embodiments of the invention where the filamentous fungal cell contains a polynucleotide encoding a galactosyltransferase, the filamentous fungal cell also contains a polynucleotide encoding a UDP-Gal 4 epimerase and/or UDP-Gal transporter. In certain embodiments of the invention where the filamentous fungal cell contains a polynucleotide encoding a galactosyltransferase, lactose may be used as the carbon source instead of glucose when culturing the host cell. The culture medium may be between pH 4.5 and 7.0 or between 5.0 and 6.5. In certain embodiments of the invention where the filamentous fungal cell contains a polynucleotide encoding a galactosyltransferase and a polynucleotide encoding a UDP-Gal 4 epimerase and/or UDP-Gal transporter, a divalent cation such as Mn2+, Ca2+ or Mg2+ may be added to the cell culture medium.
[0249] Accordingly, in certain embodiments, the filamentous fungal cell of the invention, for example, selected among Neurospora, Trichoderma, Myceliophthora or Chrysosporium cell, and more preferably Trichoderma reesei cell, may comprise the following features:
[0250] a) a mutation in at least one endogenous protease that reduces or eliminates the activity of said endogenous protease, preferably the protease activity of two or three or more endogenous proteases is reduced, for example, pep1, tsp1, gap1 and/or slp1 proteases, in order to improve production or stability of a heterologous protein to be produced,
[0251] b) a mutation in a PMT gene, for example T. reesei pmt1 gene, that reduces or eliminates endogenous O-mannosyltransferase activity compared to a parental Trichoderma cell which does not have said second mutation,
[0252] c) a polynucleotide encoding a protein having at least one serine or threonine, preferably a heterologous glycoprotein, such as an immunoglobulin, an antibody, or a protein fusion comprising Fc fragment of an immunoglobulin.
[0253] d) optionally, a deletion or disruption of the alg3 gene,
[0254] e) optionally, a polynucleotide encoding N-acetylglucosaminyltransferase I catalytic domain and a polynucleotide encoding N-acetylglucosaminyltransferase II catalytic domain,
[0255] f) optionally, a polynucleotide encoding .beta.1,4 galactosyltransferase,
[0256] g) optionally, a polynucleotide or polynucleotides encoding UDP-Gal 4 epimerase and/or transporter.
Targeting Sequences
[0257] In certain embodiments, recombinant enzymes, such as .alpha.1,2 mannosidases, GnTI, or other glycosyltransferases introduced into the filamentous fungal cells, include a targeting peptide linked to the catalytic domains. The term "linked" as used herein means that two polymers of amino acid residues in the case of a polypeptide or two polymers of nucleotides in the case of a polynucleotide are either coupled directly adjacent to each other or are within the same polypeptide or polynucleotide but are separated by intervening amino acid residues or nucleotides. A "targeting peptide", as used herein, refers to any number of consecutive amino acid residues of the recombinant protein that are capable of localizing the recombinant protein to the endoplasmic reticulum (ER) or Golgi apparatus (Golgi) within the host cell. The targeting peptide may be N-terminal or C-terminal to the catalytic domains. In certain embodiments, the targeting peptide is N-terminal to the catalytic domains. In certain embodiments, the targeting peptide provides binding to an ER or Golgi component, such as to a mannosidase II enzyme. In other embodiments, the targeting peptide provides direct binding to the ER or Golgi membrane.
[0258] Components of the targeting peptide may come from any enzyme that normally resides in the ER or Golgi apparatus. Such enzymes include mannosidases, mannosyltransferases, glycosyltransferases, Type 2 Golgi proteins, and MNN2, MNN4, MNN6, MNN9, MNN10, MNS1, KRE2, VAN1, and OCH1 enzymes. Such enzymes may come from a yeast or fungal species such as those of Acremonium, Aspergillus, Aureobasidium, Cryptococcus, Chrysosporium, Chrysosporium lucknowense, Filobasidium, Fusarium, Gibberella, Humicola, Magnaporthe, Mucor, Myceliophthora, Myrothecium, Neocallimastix, Neurospora, Paecilomyces, Penicillium, Piromyces, Schizophyllum, Talaromyces, Thermoascus, Thielavia, Tolypocladium, and Trichoderma. Sequences for such enzymes can be found in the GenBank sequence database.
[0259] In certain embodiments the targeting peptide comes from the same enzyme and organism as one of the catalytic domains of the recombinant protein. For example, if the recombinant protein includes a human GnTII catalytic domain, the targeting peptide of the recombinant protein is from the human GnTII enzyme. In other embodiments, the targeting peptide may come from a different enzyme and/or organism as the catalytic domains of the recombinant protein.
[0260] Examples of various targeting peptides for use in targeting proteins to the ER or Golgi that may be used for targeting the recombinant enzymes, include: Kre2/Mnt1 N-terminal peptide fused to galactosyltransferase (Schwientek, JBC 1996, 3398), HDEL for localization of mannosidase to ER of yeast cells to produce Man5 (Chiba, JBC 1998, 26298-304; Callewaert, FEBS Lett 2001, 173-178), OCH1 targeting peptide fused to GnTI catalytic domain (Yoshida et al, Glycobiology 1999, 53-8), yeast N-terminal peptide of Mns1 fused to .alpha.2-mannosidase (Martinet et al, Biotech Lett 1998, 1171), N-terminal portion of Kre2 linked to catalytic domain of GnTI or .beta.4GalT (Vervecken, Appl. Environ Microb 2004, 2639-46), various approaches reviewed in Wildt and Gerngross (Nature Rev Biotech 2005, 119), full-length GnTI in Aspergillus nidulans (Kalsner et al, Glycocon. J 1995, 360-370), full-length GnTI in Aspergillus oryzae (Kasajima et al, Biosci Biotech Biochem 2006, 2662-8), portion of yeast Sec12 localization structure fused to C. elegans GnTI in Aspergillus (Kainz et al 2008), N-terminal portion of yeast Mnn9 fused to human GnTI in Aspergillus (Kainz et al 2008), N-terminal portion of Aspergillus Mnn10 fused to human GnTI (Kainz et al, Appl. Environ Microb 2008, 1076-86), and full-length human GnTI in T. reesei (Maras et al, FEBS Lett 1999, 365-70).
[0261] In certain embodiments the targeting peptide is an N-terminal portion of the Mnt1/Kre2 targeting peptide having the amino acid sequence of SEQ ID NO: 40 (for example encoded by the polynucleotide of SEQ ID NO:41). In certain embodiments, the targeting peptide is selected from human GNT2, KRE2, KRE2-like, Och1, Anp1, Van1 as shown in the Table 1 below:
TABLE-US-00002 TABLE 1 Amino acid sequence of targeting peptides Protein TreID Amino acid sequence human GNT2 -- MRFRIYKRKVLILTLVVAACGFVLWSSNGRQR KNEALAPPLLDAEPARGAGGRGGDHP (SEQ ID NO: 42) KRE2 21576 MASTNARYVRYLLIAFFTILVFYFVSNSKYEGV DLNKGTFTAPDSTKTTPK (SEQ ID NO: 43) KRE2-like 69211 MAIARPVRALGGLAAILWCFFLYQLLRPSSSY NSPGDRYINFERDPNLDPTG (SEQ ID NO: 44) Och1 65646 MLNPRRALIAAAFILTVFFLISRSHNSESASTS (SEQ ID NO: 45) Anp1 82551 MMPRHHSSGFSNGYPRADTFEISPHRFQPRA TLPPHRKRKRTAIRVGIAVVVILVLVLWFGQPR SVASLISLGILSGYDDLKLE (SEQ ID NO: 46) Van1 81211 MLLPKGGLDWRSARAQIPPTRALWNAVTRTR FILLVGITGLILLLWRGVSTSASE (SEQ ID NO: 47)
[0262] Further examples of sequences that may be used for targeting peptides include the targeting sequences as described in WO2012/069593.
[0263] Uncharacterized sequences may be tested for use as targeting peptides by expressing enzymes of the glycosylation pathway in a host cell, where one of the enzymes contains the uncharacterized sequence as the sole targeting peptide, and measuring the glycans produced in view of the cytoplasmic localization of glycan biosynthesis (e.g. as in Schwientek JBC 1996 3398), or by expressing a fluorescent reporter protein fused with the targeting peptide, and analysing the localization of the protein in the Golgi by immunofluorescence or by fractionating the cytoplasmic membranes of the Golgi and measuring the location of the protein.
Methods for Producing a Protein Having Reduced O-Mannosylation
[0264] The filamentous fungal cells as described above are useful in methods for producing a protein having reduced O-mannosylation.
[0265] Accordingly, in another aspect, the invention relates to a method for producing a protein having reduced O-mannosylation, comprising:
[0266] a) providing a PMT-deficient Trichoderma cell having a mutation in a PMT gene that reduces endogenous protein O-mannosyltransferase activity as compared to parental strain which does not have such mutation, and further comprising a polynucleotide encoding a protein with serine or threonine, which may be O-mannosylated,
[0267] b) culturing said PMT-deficient Trichoderma cell to produce said protein having reduced O-mannosylation.
[0268] In such method, the produced protein has reduced O-mannosylation due to said mutation in said PMT gene as described in the previous sections. The PMT-deficient Trichoderma cell may optionally have reduced endogenous protease activity as described in the previous sections.
[0269] The filamentous fungal cells and methods of the invention are useful for the production of protein with serine or threonine which may be O-mannosylated. For example, it is particularly useful for the production of protein which are O-mannosylated when produced in a parental PMT-functional filamentous fungal host cell, for example, in at least one Trichoderma cell which is wild type for PMT1 gene, such as SEQ ID NO:1.
[0270] In methods of the invention, certain growth media include, for example, common commercially-prepared media such as Luria-Bertani (LB) broth, Sabouraud Dextrose (SD) broth or Yeast medium (YM) broth. Other defined or synthetic growth media may also be used and the appropriate medium for growth of the particular host cell will be known by someone skilled in the art of microbiology or fermentation science. Culture medium typically has the Trichoderma reesei minimal medium (Penttila et al., 1987, Gene 61, 155-164) as a basis, supplemented with substances inducing the production promoter such as lactose, cellulose, spent grain or sophorose. Temperature ranges and other conditions suitable for growth are known in the art (see, e.g., Bailey and Ollis 1986). In certain embodiments the pH of cell culture is between 3.5 and 7.5, between 4.0 and 7.0, between 4.5 and 6.5, between 5 and 5.5, or at 5.5. In certain embodiments, to produce an antibody the filamentous fungal cell or Trichoderma fungal cell is cultured at a pH range selected from 4.7 to 6.5; pH 4.8 to 6.0; pH 4.9 to 5.9; and pH 5.0 to 5.8.
[0271] In some embodiments, the protein which may be O-mannosylated is a heterologous protein, preferably a mammalian protein. In other embodiments, the heterologous protein is a non-mammalian protein.
[0272] In certain embodiments, the protein which may be O-mannosylated is a glycoprotein with N-glycan posttranslational modifications.
[0273] In certain embodiments, a mammalian protein which may be O-mannosylated is selected from an immunoglobulin, immunoglobulin or antibody heavy or light chain, a monoclonal antibody, a Fab fragment, an F(ab')2 antibody fragment, a single chain antibody, a monomeric or multimeric single domain antibody, a camelid antibody, or their antigen-binding fragments.
[0274] A fragment of a protein, as used herein, consists of at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100 consecutive amino acids of a reference protein.
[0275] As used herein, an "immunoglobulin" refers to a multimeric protein containing a heavy chain and a light chain covalently coupled together and capable of specifically combining with antigen. Immunoglobulin molecules are a large family of molecules that include several types of molecules such as IgM, IgD, IgG, IgA, and IgE.
[0276] As used herein, an "antibody" refers to intact immunoglobulin molecules, as well as fragments thereof which are capable of binding an antigen. These include hybrid (chimeric) antibody molecules (see, e.g., Winter et al. Nature 349:293-99225, 1991; and U.S. Pat No. 4,816,567 226); F(ab')2 molecules; non-covalent heterodimers; dimeric and trimeric antibody fragment constructs; humanized antibody molecules (see e.g., Riechmann et al. Nature 332, 323-27, 1988; Verhoeyan et al. Science 239, 1534-36, 1988; and GB 2,276,169); and any functional fragments obtained from such molecules, as well as antibodies obtained through non-conventional processes such as phage display or transgenic mice. Preferably, the antibodies are classical antibodies with Fc region. Methods of manufacturing antibodies are well known in the art.
[0277] In further embodiments, the yield of the mammalian glycoprotein is at least 0.5, at least 1, at least 2, at least 3, at least 4, or at least 5 grams per liter.
[0278] In certain embodiments, the mammalian glycoprotein is an antibody, optionally, IgG1, IgG2, IgG3, or IgG4. In further embodiments, the yield of the antibody is at least 0.5, at least 1, at least 2, at least 3, at least 4, or at least 5 grams per liter. In further embodiments, the mammalian glycoprotein is an antibody, and the antibody contains at least 70%, at least 80%, at least 90%, at least 95%, or at least 98% of a natural antibody C-terminus and N-terminus without additional amino acid residues. In other embodiments, the mammalian glycoprotein is an antibody, and the antibody contains at least 70%, at least 80%, at least 90%, at least 95%, or at least 98% of a natural antibody C-terminus and N-terminus that do not lack any C-terminal or N-terminal amino acid residues.
[0279] In certain embodiments where the mammalian glycoprotein is purified from cell culture, the culture containing the mammalian glycoprotein contains polypeptide fragments that make up a mass percentage that is less than 50%, less than 40%, less than 30%, less than 20%, or less than 10% of the mass of the produced polypeptides. In certain preferred embodiments, the mammalian glycoprotein is an antibody, and the polypeptide fragments are heavy chain fragments and/or light chain fragments. In other embodiments, where the mammalian glycoprotein is an antibody and the antibody purified from cell culture, the culture containing the antibody contains free heavy chains and/or free light chains that make up a mass percentage that is less than 50%, less than 40%, less than 30%, less than 20%, or less than 10% of the mass of the produced antibody. Methods of determining the mass percentage of polypeptide fragments are well known in the art and include, measuring signal intensity from an SDS-gel.
[0280] In certain embodiments, where the protein with reduced O-mannosylation, e.g. an antibody, is purified from cell culture, the culture contains at least 70%, 80%, 90%, 95% or 100% of the proteins that is not O-mannosylated (mol %, as determined for example by MALDI TOF MS analysis, and measuring area or intensity of peaks as described in the Example 1 below).
[0281] In certain embodiments where the protein with at least one serine or threonine residue which may be O-mannosylated is purified from cell culture, and where the strain is a Trichoderma cell genetically engineered to produce complex N-glycans, the culture further comprises at least 5%, 10%, 15%, 20%, 25%, 30% of secreted complex neutral N-glycans (mol %) compared to total secreted neutral N-glycans (as measured for example as described in WO2012069593).
[0282] In other embodiments, the heterologous protein with reduced O-mannosylation, for example, the antibody, comprises the trimannosyl N-glycan structure Man.alpha.3[Man.alpha.6]Man.beta.4GlcNAc.beta.4GlcNAc. In some embodiments, the Man.alpha.3[Man.alpha.6]Man.beta.4GlcNAc.beta.4GlcNAc structure represents at least 20%, 30%; 40%, 50%; 60%, 70%, 80% (mol%) or more, of the total N-glycans of the heterologous protein with reduced O-mannosylation. In other embodiments, the heterologous protein with reduced O-mannosylation comprises the G0 N-glycan structure GlcNAc.beta.2Man.alpha.3[GlcNAc.beta.2Man.alpha.6]Man.beta.4GlcNAc.beta.4- GlcNAc. In other embodiments, the non-fucosylated G0 glycoform structure represents at least 20%, 30%; 40%, 50%; 60%, 70%, 80% (mol %) or more, of the total N-glycans of the heterologous protein with reduced O-mannosylation. In other embodiments, galactosylated N-glycans represents less (mol %) than 0.5%, 0.1%, 0.05%, 0.01% of total N-glycans of the culture, and/or of the heterologous protein with reduced O-mannosylation, for example an antibody. In certain embodiments, the culture or the heterologous protein, for example an antibody, comprises no galactosylated N-glycans.
[0283] In certain embodiments, the heterologous (purified) protein is an antibody, a light chain antibody, a heavy chain antibody or a Fab, that comprises Man3, GlcNAcMan3, Man5, GlcNAcMan5, G0, core G0, G1, or G2 N-glycan structure as major glycoform and less than 35%, 20%, 17%, 15%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or 1%, or less than 0.5% of O-mannosylation level (as mole % as determined for example by MALDI TOF MS analysis, and measuring area or intensity of peaks as described in Example 1).
[0284] In a specific embodiment, the invention therefore relates to a method for producing an antibody having reduced O-mannosylation, comprising:
[0285] a. providing a PMT-deficient Trichoderma cell having
[0286] i. a mutation that reduces endogenous protein O-mannosyltransferase activity as compared to parental strain which does not have such mutation and
[0287] ii. a polynucleotide encoding a light chain antibody and a polynucleotide encoding a heavy chain antibody,
[0288] b. culturing the cell to produce said antibody, consisting of heavy and light chains, having reduced O-mannosylation.
[0289] In such specific embodiments of the methods related to the production of antibody, at least 70%, 80%, 90%, 95%, 97%, 98%, 99% or 100% of the produced antibody is not O-mannosylated (mol %, as determined for example by MALDI TOF MS analysis, and measuring area or intensity of peaks as described in Example 1.
[0290] In certain embodiments of any of the disclosed methods, the method includes the further step of providing one or more, two or more, three or more, four or more, or five or more protease inhibitors. In certain embodiments, the protease inhibitors are peptides that are co-expressed with the mammalian polypeptide. In other embodiments, the inhibitors inhibit at least two, at least three, or at least four proteases from a protease family selected from aspartic proteases, trypsin-like serine proteases, subtilisin proteases, and glutamic proteases.
[0291] In certain embodiments of any of the disclosed methods, the filamentous fungal cell or Trichoderma fungal cell also contains a carrier protein. As used herein, a "carrier protein" is portion of a protein that is endogenous to and highly secreted by a filamentous fungal cell or Trichoderma fungal cell. Suitable carrier proteins include, without limitation, those of T. reesei mannanase I (Man5A, or MANI), T. reesei cellobiohydrolase II (Cel6A, or CBHII) (see, e.g., Paloheimo et al Appl. Environ. Microbiol. 2003 December; 69(12): 7073-7082) or T. reesei cellobiohydrolase I (CBHI). In some embodiments, the carrier protein is CBH1. In other embodiments, the carrier protein is a truncated T. reesei CBH1 protein that includes the CBH1 core region and part of the CBH1 linker region. In some embodiments, a carrier such as a cellobiohydrolase or its fragment is fused to an antibody light chain and/or an antibody heavy chain. In some embodiments, a carrier-antibody fusion polypeptide comprises a Kex2 cleavage site. In certain embodiments, Kex2, or other carrier cleaving enzyme, is endogenous to a filamentous fungal cell. In certain embodiments, carrier cleaving protease is heterologous to the filamentous fungal cell, for example, another Kex2 protein derived from yeast or a TEV protease. In certain embodiments, carrier cleaving enzyme is overexpressed. In certain embodiments, the carrier consists of about 469 to 478 amino acids of N-terminal part of the T. reesei CBH1 protein GenBank accession No. EGR44817.1.
[0292] In certain embodiments, the filamentous fungal cell of the invention overexpress KEX2 protease. In an embodiment the heterologous protein is expressed as fusion construct comprising an endogenous fungal polypeptide, a protease site such as a Kex2 cleavage site, and the heterologous protein such as an antibody heavy and/or light chain. Useful 2-7 amino acids combinations preceding Kex2 cleavage site have been described, for example, in Mikosch et al. (1996) J. Biotechnol. 52:97-106; Goller et al. (1998) Appl Environ Microbiol. 64:3202-3208; Spencer et al. (1998) Eur. J. Biochem. 258:107-112; Jalving et al. (2000) Appl. Environ. Microbiol. 66:363-368; Ward et al. (2004) Appl. Environ. Microbiol. 70:2567-2576; Ahn et al. (2004) Appl. Microbiol. Biotechnol. 64:833-839; Paloheimo et al. (2007) Appl Environ Microbiol. 73:3215-3224; Paloheimo et al. (2003) Appl Environ Microbiol. 69:7073-7082; and Margolles-Clark et al. (1996) Eur J Biochem. 237:553-560.
[0293] The invention further relates to the protein composition, for example the antibody composition, obtainable or obtained by the method as disclosed above.
[0294] In specific embodiment, such antibody composition obtainable or obtained by the methods of the invention, comprises at least 70%, 80%, 90%, 95%, or 100% of the antibodies that are not O-mannosylated (mol %, as determined for example by MALDI TOF MS analysis, and measuring area or intensity of peaks as described in Example 1). In other specific embodiments, such antibody composition further comprises as 50%, 60%, 70% or 80% (mole % neutral N-glycan), of the following glycoform:
[0295] (i) Man.alpha.3[Man.alpha.6(Man.alpha.3)Man.alpha.6]Man.beta.4GlcNA.beta.- 4GlcNAc (Man5 glycoform);
[0296] (ii) GlcNAc.beta.2Man.alpha.3[Man.alpha.6(Man.alpha.3)Man.alpha.6]Man.beta.4Gl- cNA.beta.4GlcNAc, or .beta.4-galactosylated variant thereof;
[0297] (iii) Man.alpha.6(Man.alpha.3)Man.beta.4GlcNA.beta.4GlcNAc;
[0298] (iv) Man.alpha.6(GlcNAc.beta.2Man.alpha.3)Man.beta.4GlcNA.beta.4GlcNAc, or .beta.4-galactosylated variant thereof: or,
[0299] (v) complex type N-glycans selected from the G0, G1 or G2 glycoform.
[0300] In some embodiments the N-glycan glycoform according to iii-v comprises less than 15%, 10%, 7%, 5%, 3%, 1% or 0.5% or is devoid of Man5 glycan as defined in i) above.
[0301] The invention also relates to a method of reducing O-mannosylation level of a recombinant glycoprotein composition produced in a Trichoderma cell, said method consisting of using a Trichoderma cell having a mutation in a PMT gene wherein said PMT gene is either:
[0302] a. PMT1 gene comprising the polynucleotide of SEQ ID NO:1,
[0303] b. a functional homologous gene of PMT1 gene, which gene is capable of restoring parental O-mannosylation level by functional complementation when introduced into a T. reesei strain having a disruption in said PMT1 gene, or,
[0304] c. a polynucleotide encoding a polypeptide having at least 50%, at least 60%, at least 70%, at least 90%, or at least 95% identity with SEQ ID NO:2, said polypeptide having protein O-mannosyltransferase activity.
[0305] In one specific embodiment of such method, said Trichoderma cell is Trichoderma reesei.
[0306] In another specific embodiment of such method, said recombinant glycoprotein comprises at least a light chain antibody or its fragments comprising at least one serine or threonine residue and with at least one N-glycan.
EXAMPLES
[0307] As more specifically exemplified in Example 2, after deletion of pmt1, almost 95% of purified mAb and 70% of Fab molecules no longer contained any O-mannose residues. In contrast, as exemplified in Examples 3 to 4, O-mannosylation level analysis performed on pmt2 and pmt3 deletion strains did not exhibit any appreciable reduction in O-mannosylation. Together with the titer and growth analysis set forth in Example 2, these results demonstrate that filamentous fungal cells, such as Trichoderma cells, can be genetically modified to reduce or suppress O-mannosylation activity, without adversely affecting viability and yield of produced glycoproteins. As such, pmt1 is identified a valuable target to reduce O-mannosylation of secreted proteins and to improve product quality of biopharmaceuticals produced by Trichoderma reesei.
Example 1: Pmt1 Deletion in a Trichoderma reesei Strain
[0308] This example demonstrates that pmt1 is a valuable target to reduce O-mannosylation of secreted proteins and to improve product quality of biopharmaceuticals produced by Trichoderma reesei.
Generation of Pmt1 Deletion Plasmids
[0309] Three different deletion plasmids (pTTv36, pTTv124, pTTv185) were constructed for deletion of the protein O-mannosyltransferase gene pmt1 (TreID75421). All the plasmids contain the same 5' and 3' flanking regions for correct integration to the pmt1 locus. The difference between the three plasmids is the marker used in the selection; pTTv36 contains a gene encoding acetamidase of Aspergillus nidulans (amdS), pTTv124 contains a loopout version (blaster cassette) of the amdS marker and pTTv185 a loopout version (blaster cassette) of a gene encoding orotidine-5'-monophosphate (OMP) decarboxylase of T. reesei (pyr4).
[0310] The third deletion construct, pTTv185, for the protein O-mannosyltransferase gene pmt1 (TreID75421) was designed to enable removal of the selection marker from the Trichoderma reesei genome after successful integration and thereby recycling of the selection marker for subsequent transformations. In this approach, the recycling of the marker, i.e. removal of pyr4 gene from the deletion construct, resembles so called blaster cassettes developed for yeasts (Hartl, L. and Seiboth, B., 2005, Curr Genet 48:204-211; and Alani, E. et al., 1987, Genetics 116:541-545). Similar blaster cassettes have also been developed for filamentous fungi including Hypocrea jecorina (anamorph: T. reesei) (Hartl, L. and Seiboth, B., 2005, Curr Genet 48:204-211).
[0311] The TreID number refers to the identification number of a particular protease gene from the Joint Genome Institute Trichoderma reesei v2.0 genome database. Primers for construction of deletion plasmids were designed either manually or using Primer3 software (Primer3 website, Rozen and Skaletsky (2000) Bioinformatics Methods and Protocols: Methods in Molecular Biology. Humana Press, Totowa, N.J., pp 365-386).
[0312] The principle of the blaster cassette using pyr4 as the marker gene is as follows: pyr4, encoding orotidine-5'-monophosphate (OMP) decarboxylase of T. reesei (Smith, J. L., et al., 1991, Current Genetics 19:27-33) is needed for uridine synthesis. Strains deficient for OMP decarboxylase activity are unable to grow on minimal medium without uridine supplementation (i.e. are uridine auxotrophs). The utilisation of 5-fluoroorotic acid (5-FOA) in generation of mutant strains lacking OMP decarboxylase activity (pyr4.sup.- strains) is based on the conversion of 5-FOA to a toxic intermediate 5-fluoro-UMP by OMP decarboxylase. Therefore, cells which have a mutated pyr4 gene are resistant to 5-FOA, but in addition are also auxotrophic for uridine. The 5-FOA resistance can in principle result also from a mutation in another gene (pyr2, orotate phosphoribosyltransferase), and therefore the spontaneous mutants obtained with this selection need to be verified for the pyr4.sup.- genotype by complementing the mutant with the pyr4 gene. Once mutated, the pyr4 gene can be used as an auxotrophic selection marker in T. reesei. In our blaster cassette pyr4 is followed by a 310 bp direct repeat of pyr4 5' untranslated region (5'UTR) and surrounded by 5' and 3' flanking regions of the gene to be deleted. Integration of the deletion cassette is selected via the pyr4 function. Removal of the pyr4 marker is then forced in the presence of 5-FOA by recombination between the two homologous regions (direct repeat of 5'UTR) resulting in looping out of the selection marker and enabling the utilisation of the same blaster cassette (pyr4 loopout) in successive rounds of gene deletions. After looping out, only the 310 bp sequence of 5'UTR remains in the locus.
[0313] Thus, the pyr4 selection marker and the 5' direct repeat (DR) fragment (310 bp of pyr4 5'UTR) were produced by PCR using plasmid containing a genomic copy of T. reesei pyr4 as a template. Both fragments contained 40 bp overlapping sequences needed to clone the plasmid with the loopout cassette using homologous recombination in yeast (see below). To enable possible additional cloning steps, an Ascl digestion site was placed between the pyr4 marker and the 5' direct repeat and Notl sites to surround the complete blaster cassette.
[0314] 1100 bp of 5' and 1000 bp of 3' flanking regions were selected as the basis of the pmt1 deletion plasmids. The flanking region fragments were produced by PCR using a T. reesei wild type strain QM6a (ATCC13631) as the template. For the yeast homologous recombination system used in cloning (see below), overlapping sequences for the vector and the selection marker were placed to the appropriate PCR-primers. To enable marker switch in the construct, Notl restriction sites were introduced between the flanking regions and the selection marker. Pmel restriction sites were placed between the vector and the flanking regions for removal of vector sequence prior to transformation into T. reesei. Vector backbone pRS426 was digested with restriction enzymes (EcoRl and Xhol).
[0315] First deletion plasmid for pmt1 (plasmid pTTv36, Table 2) used amdS, a gene encoding acetamidase of Aspergillus nidulans, as the marker. The marker cassette was digested from an existing plasmid pHHO1 with Notl. All fragments used in cloning were separated with agarose gel electrophoresis and correct fragments were isolated from the gel with a gel extraction kit (Qiagen) using standard laboratory methods.
[0316] To construct the first deletion plasmid pTTv36, the vector backbone and the appropriate marker and flanking region fragments were transformed into Saccharomyces cerevisiae (strain H3488/FY834). The yeast transformation protocol was based on the method for homologous yeast recombination described in the Neurospora knockouts workshop material of Colot and Collopy, (Dartmouth Neurospora genome protocols website), and the Gietz laboratory protocol (University of Manitoba, Gietz laboratory website). The plasmid DNA from the yeast transformants was rescued by transformation into Escherichia coli. A few clones were cultivated, plasmid DNA was isolated and digested to screen for correct recombination using standard laboratory methods. A few clones with correct insert sizes were sequenced and stored.
[0317] To clone the second pmt1 deletion plasmid (pTTv124, Table 2), the amdS marker was removed from the deletion plasmid pTTv36 with Notl digestion and replaced by another variant of the blaster cassette, amdS loopout cassette containing the amdS selection marker gene, followed by Ascl restriction site and a 300 bp direct repeat of amdS 5'UTR. The amdS blaster cassette functions in a similar manner to the pyr4 blaster cassette. The clones containing the amdS blaster cassette are able to grow on acetamide as sole nitrogen source. On medium containing 5-fluoroacetamide (5-FAA) a functional amdS gene will convert 5-FAA to a toxic fluoroacetate and therefore, in the presence of 5-FAA, removal of amdS gene is beneficial to the fungus. Removal of amdS blaster cassette is enhanced via the 300 bp DRs in the cassette like in the pyr4 blaster cassette, which enables the amdS gene to loop out via single crossover between the two DRs. Resulting clones are resistant to 5-FAA and unable to grow on acetamide as the sole nitrogen source.
[0318] The fragments needed for the amdS blaster cassette were produced by PCR using a plasmid p3SR2 (Hynes M. J. et al, 1983, Mol. Cell. Biol. 3:1430-1439) containing a genomic copy of the amdS gene as the template. For the yeast homologous recombination system used in cloning (see above), overlapping sequences were placed to the appropriate PCR-primers. To enable marker switch in the construct, Notl restriction sites were kept between the flanking regions and the blaster cassette. Additional restriction sites Fsel and AsiSl were introduced to the 5' end of amdS and an Ascl site between amdS and amdS 5'DR. The plasmid pTTv124 was constructed using the yeast recombination system described above. The plasmid DNA from the yeast transformants was rescued by transformation into Escherichia coli. A few clones were cultivated, plasmid DNA was isolated and digested to screen for correct recombination using standard laboratory methods. A few clones with correct insert sizes were sequenced and stored.
[0319] To clone the third pmt1 deletion plasmid (pTTv185, Table 2), the amdS marker was removed from the deletion plasmid pTTv36 with Notl digestion and replaced by the pyr4 blaster cassette described above. The pyr4 blaster cassette was obtained from another plasmid with Notl digestion, ligated to Notl cut pTTv36 and transformed into E. coli using standard laboratory methods. A few transformants were cultivated, plasmid DNA isolated and digested to screen for correct ligation and orientation of the pyr4 blaster cassette using standard laboratory methods. One clone with correct insert size and orientation was sequenced and stored.
[0320] These deletion plasmids for pmt1 (pTTv36, pTTv124 and pTTv185) result in 2465 bp deletion in the pmt1 locus and cover the complete coding sequence of PMT1.
TABLE-US-00003 TABLE 2 Primers for generating deletion plasmids pTTv36, pTTv124 and pTTv185 for protein O-mannosyltransferase 1 (pmt1, TreID75421) Deletion plasmid pTTv36 for pmt1 (TreID75421), vector backbone pRS426 Primer Sequence 75421_5'F CGATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCACGACGGTTT AAACGCTGCAGGGCGTACAGAACT (SEQ ID NO: 48) 75421_5'R ATCTCTCAAAGGAAGAATCCCTTCAGGGTTGCGTTTCCAGTGCGG CCGCGGCTCTAAAATGCTTCACAG (SEQ ID NO: 49) 75421_3'F CGGTTCTCATCTGGGCTTGCTCGGTCCTGGCGTAGATCTAGCGG CCGCACGATGATGATGACAGCCAG (SEQ ID NO: 50) 75421_3'R GTGGAATTGTGAGCGGATAACAATTTCACACAGGAAACAGCGTTT AAACCGTCCAGCTCCCGCAGCGCC (SEQ ID NO: 51) Deletion plasmid pTTv124 for pmt1 (TreID75421), vector backbone pTTv36 T282_75421_amds_5for ATCGCTAACTGCTTTCTCTTCTGTGAAGCATTTTAGAGCCGCGGC CGCGGCCGGCCGCGATCGCCTAGATCTACGCCAGGACCG (SEQ ID NO: 52) T283_amds_3rev_loop CGGTCCTGGCGTAGATCTAGGGCGCGCCACTGGAAACGCAACC CTGAA (SEQ ID NO: 53) T284_amds_loop_5for TTCAGGGTTGCGTTTCCAGTGGCGCGCCCTAGATCTACGCCAGG ACCG (SEQ ID NO: 54) T287_75421_loop_3rev AGCATCATGACCGCCCCCTTCTGGCTGTCATCATCATCGTGCGG CCGCGATTATTGCACAAGCAGCGA (SEQ ID NO: 55) Deletion plasmid pTTv185 for pmt1 (TreID75421), vector backbone pTTv36 Primer Sequence no new primers, pTTv36 digested with NotI and ligated with pyr4-loopout fragment obtained from another plasmid
Generation of Pmt1 Deletion Strains M403, M404, M406 and M407
[0321] To generate a pyr4 negative target strain suitable for the deletion of pmt1 using plasmid pTTv185, the MAB01 antibody producing strain M304 was subjected to selection in the presence of 5-fluoro-orotic acid in order to select for strains containing impaired pyr4 genes. The generation of the strain M304 is described in the International Patent Application No. PCT/EP2013/05012. T. reesei strain M304 comprises MAB01 light chain fused to T. reesei truncated CBH1 carrier with NVISKR Kex2 cleavage sequence, MAB01 heavy chain fused to T. reesei truncated CBH1 carrier with AXE1 [DGETVVKR] Kex2 cleavage sequence, .DELTA.pep1.DELTA.tsp1.DELTA.slp1, and overexpresses T. reesei KEX2.
[0322] Spores of M304 were spread onto minimal medium plates containing 20 g/l glucose, 2 g/l proteose peptone, 5 mM uridine and 1.5 g/l 5-FOA, pH 4.8. Some 5-FOA resistant colonies were streaked after 5-7 days onto plates described above with 1 ml/l Triton X-100 supplementation. A few clones were further purified to single cell clones via consecutive purification platings: a small piece of mycelia was picked to 0.8% NaCl-0.025% Tween 20-20% glycerol, suspended thoroughly by vortexing and filtrated through a cotton-filled pipette tip. Purified clones were sporulated on plates containing 39 g/l potato dextrose agarose. These clones were tested for uridine auxotrophy by plating spores onto minimal medium plates (20 g/l glucose, 1 ml/l Triton X-100, pH 4.8) with and without 5 mM uridine supplementation. No growth was observed on plates without uridine indicating the selected clones were putative pyr4.sup.-. Clones were stored for future use and one of them was designated with strain number M317.
[0323] Pmt1 was deleted from M317 (pyr4.sup.- of the strain M304) using the pmt1 deletion cassette from plasmid pTTv185 described above. To remove the vector sequence, plasmid pTTv185 (.DELTA.pmt1-pyr4) was digested with Pmel+Xbal and the correct fragment was purified from an agarose gel using QIAquick Gel Extraction Kit (Qiagen). Approximately 5 .mu.g of the pmt1 deletion cassette was used to transform strain M317. Preparation of protoplasts and transformation for pyr4 selection were carried out essentially according to methods in Penttila et al. (1987, Gene 61:155-164) and Gruber et al (1990, Curr. Genet. 18:71-76).
[0324] 100 colonies were picked as selective streaks. 40 transformants were screened by PCR using the primers in Table 3 for the correct integration of the deletion cassette using standard laboratory methods. 12 putative deletion clones were purified to single cell clones. Purified clones were rescreened for integration and for deletion of pmt1 ORF using primers on Table 5. Four clones (in duplicate) were pure disruptants (i.e. no signal with ORF primers).
TABLE-US-00004 TABLE 3 Primers for screening integration of deletion cassette pTTv185 and for deletion of protein O-mannosyltransferase 1 (pmt1, TreID75421) from M317. Primer Sequence T296_75421_5int TATGGCTTTAGATGGGGACA (SEQ ID NO: 56) T027_Pyr4_orf_start_rev TGCGTCGCCGTCTCGCTCCT (SEQ ID NO: 57) T061_pyr4_orf_screen_ TTAGGCGACCTCTTTTTCCA (SEQ ID NO: 58) 2F T297_75421_3int CCTGTATCGTCCTGTTCC (SEQ ID NO: 59) T359_pmt1_orf_for GCGCCTGTCGAGTCGGCATT (SEQ ID NO: 60) T360_pmt1_orf_rev CACCGGCCATGCTCTTGCCA (SEQ ID NO: 61) T756_pmt1_orf_for2 CAAGGTGCCCTATGTCGC (SEQ ID NO: 62) T757_pmt1_orf_rev2 GATCGGGTCAGGACGGAA (SEQ ID NO: 63)
[0325] Deletion of pmt1 was verified by Southern analyses. DNA for Southern analyses was extracted with Easy-DNA kit for genomic DNA isolation (Invitrogen) essentially according to the manufacturer's instructions.
[0326] Southern analyses were essentially performed according to the protocol for homologous hybridizations in Sambrook et al. (1989, Molecular Cloning: A laboratory manual. 2.sup.nd Ed., Cold Spring Harbor Laboratory Press) using radioactive labeling (.sup.32P-dCTP) and DecaLabel Plus kit (Fermentas). Southern digestion schemes were designed using Geneious Pro software (Geneious website). Fragments for probes were produced by PCR using the primers listed in Table 4 using a T. reesei wild type strain QM6a (ATCC13631) as the template. PCR products were separated with agarose gel electrophoresis and correct fragments were isolated from the gel with a gel extraction kit (Qiagen) using standard laboratory methods.
TABLE-US-00005 TABLE 4 Primers for production of probe fragments used in Southern analyses of protein O-mannosyltransferase 1 (pmt1, TreID75421) deletion strains. Primer Sequence T635_pmt1_5f_for AGCCTGTCTGAGGGACGG (SEQ ID NO: 64) T636_pmt1_5f_rev CAAGGTCGAGATTCGGCA (SEQ ID NO: 65) T637_pmt1_3f_for CAGAAGGGGGCGGTCAT (SEQ ID NO: 66) T638_pmt1_3f_rev GTCCCAGCTCCCGCTCT (SEQ ID NO: 67) T359_pmt1_orf_for GCGCCTGTCGAGTCGGCATT (SEQ ID NO: 68) T360_pmt1_orf_rev CACCGGCCATGCTCTTGCCA (SEQ ID NO: 69)
[0327] None of the clones hybridised with pmt1 ORF probe (FIG. 1A) indicating successful deletion of pmt1. Analyses using 5' and 3' flank probes revealed that four of the clones were single integrants (FIG. 1B and 1C; 26-8A and B, 26-21A and B). Four clones gave additional signals and thus indicated multiple integration of the deletion cassette. Four pure clones (with and without additional copies of the deletion cassette) have been stored for future use (M403; 26-8A, M404; 26-19A, M406; 26-16B and M407; 26-19B).
Example 2 Analyses of .DELTA.pmt1 Strains M403, M404, M406 and M407
[0328] Shake flask cultivation of T. reesei M304 and eight pmt1 deletion strains (26-8A (M403), 26-8B, 26-16A, 26-16B (M406), 26-19A (M404), 26-19B (M407), 26-21A, 26-21B) was carried out in Trichoderma minimal medium with 40 g/l lactose, 20 g/l spent grain extract, 100 mM PIPPS, 9 g/l casamino acids, pH 5.5 at +28.degree. C., 200 rpm. Samples were collected on days 3, 5, 7 and 10 by vacuum filtration. Supernatant samples were stored to -20.degree. C. (antibody and glycan analyses) or used in pH determinations. Mycelia for cell dry weight determinations were rinsed once with DDIW and dried at +100.degree. C. for 20-24 h. Mycelia for genomic DNA extraction were rinsed once with DDIW and stored to -20.degree. C.
[0329] O-mannosylation status analysis was performed to shake flask cultivations of T. reesei M304, eight pmt1 disruptants (pTTv185: 26-8A, 26-8B, 26-16A, 26-16B, 26-19A, 26-19B, 26-21A, 26-21B). All were cultivated in TrMM-40 g/l lactose-20 g/l SGE-100 mM PIPPS-9 g/l casamino acids, pH 5.5 at +28.degree. C. and samples were taken on time point days 3, 5, 7 and 10.
[0330] MAB01 antibody from each sample from day 7 was purified from supernatants using Protein G HP MultiTrap 96-well plate (GE Healthcare) according to manufacturer's instructions. The antibody was eluted with 0.1 M citrate buffer, pH 2.6 and neutralized with 2 M Tris, pH 9. The concentration was determined via UV absorbance in spectrophotometer against MAB01 standard curve. For O-mannosylation analysis, 10 .mu.g of protein was incubated in 6 M Guanidinium HCl for 30 minutes at +60.degree. C. after which 5 .mu.l of fresh 0.1 M DTT was added and incubated again as above. The samples were purified using Poros R1 96-well plate and the resulting light chains were analysed using MALDI-TOF MS. All were made as duplicates.
[0331] In flask cultures the O-mannosylation status in pmt1 disruptants was remarkably changed; all .DELTA.pmt1 disruptants looked the same--nearly complete loss of O-mannosylation in MAB01 LC (FIG. 2: Spectra of light chain of flask cultured parental T. reesei strain M317 (pyr4.sup.- of M304) (A) and .DELTA.pmt1 disruptant clone 26-8A (B), day 7).
Fermentation of .DELTA.pmt1 Strain M403
[0332] Fermentation was carried out with .DELTA.pmt1 strain M403 (clone 26-8A; pTTv185 in M317). Fermentation culture medium contained 30 g/l glucose, 60 g/l lactose, 60 g/l whole spent grain at pH 5.5. Lactose feed was started after glucose exhaustion. Growth temperature was shifted from +28.degree. C. to +22.degree. C. after glucose exhaustion. Samples were collected by vacuum filtration. Supernatant samples were stored to -20.degree. C.
[0333] In FIG. 3 is shown the Western analyses of supernatant samples. MAB01 heavy and light chains were detected from supernatant after day three. Despite the deletion of pmt1, that could also reduce O-mannosylation of the linker and thus aid KEX2 cleavage, substantial amount of light chain remains attached to the carrier in the early days of the fermentation. At later stages, the cleavage is more complete but the yield may be affected by the degradation of the heavy chain. Results on antibody titres (Table 7 below) indicate fairly steady expression between days 7 to 10. In this fermentation the pmt1 deletion strain produced approximately equal antibody levels as the parental strain. Higher titres were obtained when the same strain was fermented using a different fermenter.
[0334] M403 (clone 26-8A) was cultivated in fermenter in TrMM, 30 g/l glucose, 60 g/l lactose, 60 g/l spent grain, pH 5.5 with lactose feed. Samples were harvested on days 2, 3 and 5-11. O-mannosylation level analysis was performed as to flask cultures. The O-mannosylation status was greatly decreased also in fermenter culture (FIG. 4, Table 5).
[0335] The O-mannosylation level was calculated from average of area and intensity (Table 5). Area (Table 6) seems to give more commonly higher rate of non-O-glycosylated LC than intensity (Table 7). In all time points the O-mannosylation level was below 5%.
TABLE-US-00006 TABLE 5 O-mannosylation status of T. reesei strain M403 (pmt1 deletion strain of MAB01 antibody producing strain, clone 26-8A) from fermenter culture. Percentages calculated from area and intensity of single charged signals. In time point d 9 both samples gave 100% to LC, LC + Hex1 being practically absent. 3 d 5 d 6 d 7 d d 8 d 9 d 10 d 11 Average Average Std Average Std Average Std Average Average Average Std Average Std LC 95.8 96.8 0.30 97.5 0.29 97.4 0.36 97.3 100.0 96.6 0.2 95.5 0.11 LC + Hex 4.2 3.2 0.30 2.5 0.29 2.6 0.36 2.7 0.0 3.4 0.2 4.5 0.11
TABLE-US-00007 TABLE 6 The percentages of area values of three parallel samples from fermenter cultured M403 from day 7. Area average Std LC 98.5 0.15 LC + Hex 1.5 0.15
TABLE-US-00008 TABLE 7 The percentages of intensity values of three parallel samples from fermenter cultured M403 from day 7. Intensity average Std LC 96.3 0.57 LC + Hex 3.7 0.57
[0336] No negative effects of strain growth characteristic and secretion capacity were observed. The strain M403 grew well and produced increased amount of antibody in function of time in fermenter culture. The best titer was obtained from day 10 (Table 8). On day 11 the titer is decreased.
TABLE-US-00009 TABLE 8 Titers from fermenter cultured MAB01 producing strain M403. The antibody was purified using Protein G 96-well plate. Time point Days cultured Titer g/l 54:30 hours 2 0.04 71:50 hours 3 0.04 77:45 hours 3 0.07 126:20 hours 5 0.91 148:20 hours 6 1.23 168:20 hours 7 1.47 192:00 hours 8 1.50 217:15 hours 9 1.35 241:00 hours 10 1.52 275:20 hours 11 1.06
[0337] Deletion of pmt1 diminished dramatically MAB01 O-mannosylation; the amount of O-mannosylated LC was .about.61% in parental strain, 3% in the best .DELTA.pmt1 clone in shake flask culture and practically 0% in fermenter culture in time point day 9.
Deletion of Pmt1 in a Fab Expressing Trichoderma reesei Strain
[0338] The pmt1 disruption cassette (pmt1 amdS) was released from its backbone vector pTTv124 described above by restriction digestion and purified through gel extraction. Using protoplast transformation the deletion cassette was introduced to T. reesei strains M304 (3-fold protease deletion strain expressing MAB01) and M307 (4-fold protease deletion strain .DELTA.pep1 .DELTA.tsp1 .DELTA.slp1 .DELTA.gap1, also described in PCT/EP2013/050126 that has been transformed to express a Fab). Transformants were plated to acetamidase selective medium (minimal medium containing acetamide as the sole carbon source).
[0339] Transformants were screened by PCR for homologous integration of the acetamidase marker to the pmt1 locus using a forward primer outside the 5' flanking region fragment of the construct and the reverse primer inside the AmdS selection marker (5' integration) as well as a forward primer inside the AmdS selection marker and a reverse primer outside the 3' flanking region fragment (3' integration). Three independent transformants of each transformation (MAB01 and Fab expressing strains), which gave PCR results displaying correct integration of the construct to the pmt1 locus were selected for single spore purification to obtain uninuclear clones. Proper integration of the disruption cassette was reconfirmed by PCR using the same primer combinations as described above and the absence of the pmt1 gene was verified by using a primer combination targeted to the pmt1 open reading frame. Correct integration of the disruption cassette was additionally verified for all clones applying Southern hybridization. Digested genomic DNA of the three clones as well as the parental strain were probed against the 5' and 3' flanks of the pmt1 gene to confirm modification of the pmt1 locus as expected. Furthermore, the blotted DNA was hybridized with a probe specific to the pmt1 open reading frame in order to substantiate the absence of pmt1.
[0340] MAB01 and Fab Expression for O-Mannosylation Analysis
[0341] To evaluate the impact of pmt1 deletion on O-mannosylation levels of mAb and Fab molecules, strains were grown in batch fermentations for 7 days, in media containing 2% yeast extract, 4% cellulose, 4% cellobiose, 2% sorbose, 5g/L KH2PO4, and 5 g/L (NH4)2SO4. Culture pH was controlled at pH 5.5 (adjusted with NH4OH). The starting temperature was 30.degree. C., which was shifted to 22.degree. C. after 48 hours . mAb fermentations (strains M304, M403, M406 and M407) were carried out in 4 parallel 2 L glas reactor vessels (DASGIP) with a culture volume of 1 L and the Fab fermentation (TR090 #5) was done in a 15 L steel tank reactor (Infors) with a culture volume of 6 L. Fab strains (TR090 #5, TR090 #3, TR090 #17) were additionally cultured in shake flasks for 4 days at 28.degree. C. Main media components were 1% yeast extract, 2% cellobiose, 1% sorbose, 15 g/L KH2PO4 and 5 g/L (NH4)2SO4 and the pH was uncontrolled (pH drops from 5.5 to <3 during a time course of cultivation). Culture supernatant samples were taken during the course of the runs and stored at -20.degree. C. Samples were collected daily from the whole course of these cultivations, and production levels were analyzed by affinity liquid chromatography. Samples with maximum production levels were subject to purification and further O-mannosylation analysis.
[0342] Analysis of O-Mannosylation on Fab and mAb
[0343] O-mannosylation was analyzed on mAb and Fab molecules expressed from both, the pmt1 deletion and parental strains. The mAb and Fab was purified from culture supernatants using Lambda Select Sure and CaptureSelect Fab Lambda (BAC) affinity chromatography resin, respectively, applying conditions as described by the manufactures protocols. Both purified molecules including, the purified mAb and Fab were subjected to RP-LC-QTOF-MS either as intact and/or reduced/alkylated samples.
[0344] For intact analysis, an equivalent of 20 .mu.g protein was injected onto the column. For reduced/alkylated analyses of mAb, an equivalent of 100 .mu.g protein was deglycosylated using PNGase-F enzyme, reduced using DTT and alkylated using iodoacetamide prior to LC-MS analysis. For reduced/alkylated analyses of Fab, an equivalent of 100 .mu.g protein was reduced with DTT and alkylated with iodoacetamide prior to LC-MS analysis. 6 .mu.g of the reduced/alkylated sample were injected onto the column. Reversed-phase chromatography separation was carried out on a 2.1.times.150 mm Zorbax C3 column packed with 5 .mu.m particles, 300 .ANG. pore size the eluents were: eluent A 0.1% TFA in water and eluent B 0.1% TFA in 70% IPA, 20% ACN, 10% water. The column was heated at 75.degree. C. and the flo rate was 200 .mu.L/min. The gradient used for the sample separation is shown in Table 9.
TABLE-US-00010 TABLE 9 HPLC gradient used for intact and reduced/alkylated samples Time % B Flow (mL/min) 0 10 0.1 0.1 10 0.2 2 10 0.2 4 28 0.2 30 36.4 0.2 31 100 0.2 34 100 0.2 35 10 0.2 40 10 0.2
[0345] The HPLC was directly coupled with a Q-TOF Ultima mass spectrometer (Waters, Manchester, UK). The ESI-TOF mass spectrometer was set to run in positive ion mode. The data evaluation of intact and reduced/alkylated analyses was performed using MassLynx analysis software (Waters, Manchester, UK). The deconvolution of the averaged mass spectra from the main UV signals was carried out using the MaxEnt algorithm, a part of the MassLynx analysis software (Waters, Manchester, UK). The deconvolution parameters were the following: "max numbers of iterations" are 8; resolution is 0.1 Da/channel; Uniform Gaussian--width at half height is 1 Da for intact and 0.5 for the reduced chains and minimum intensity ratios are left 30% and right 30%. The estimated level of O-mannosylation (%) was determined using the peak signal height after deconvolution. The observed O-mannosylation levels (%) of mAbs and Fabs from independent pmt1 deletion strains are compared to the ones of the respective parental wild-type strains in Tables 10 and 11.
TABLE-US-00011 TABLE 10 O-mannosylation level [%] of Fabs from different strains Strain Parental Sample M307 TR090#5 TR090#3 TR090#17 Intact Fab 70.1 34.2 34.3 34.7 LC 58.8 10.4 10.1 10.8 HC 42.9 26.1 25.9 25.8
TABLE-US-00012 TABLE 11 O-mannosylation level [%] of MAB01 from different pmt1 deficient strains M403, M406 and M407. Parental strain is M304 Strain in yeast extract medium Sample Parental M403 M406 M407 LC 50.7 5.7 5.8 5.8 HC 4.8 Not detected Not detected Not detected
[0346] The O-mannosylation level was found to be 70% on intact Fab derived from the parental strain and reduced to .about.34% in all three pmt1 deletion strains. The transfer of mannoses was more efficiently diminished on the Fab light chains (10% of residual O-mannosylation on light chains obtained from pmt1 deletion strains vs. 59% for the parental strain), as compared to the heavy chains, for which it decreased from 43% to .about.26%.
[0347] The O-mannosylation level was found to be 50% on the light chain of mAb derived from parental strains and reduced to 5.7-5.8% in all three pmt1 deletion strains. The O-mannosylation level was found to be 4.8% on the heavy chain of mAb derived from parental strains and was completely reduced (below the limit of detection by LC-MS) in all three pmt1 deletion strains.
[0348] In conclusion, after deletion of pmt1, almost 95% of purified mAb and 70% of Fab molecules did no longer contain any O-mannose residues. Therefore, pmt1 is a valuable target to reduce O-mannosylation of secreted proteins and to improve product quality of biopharmaceuticals produced by Trichoderma reesei.
Example 3: Pmt2 Deletion in a Trichoderma reesei Strain
Generation of Pmt2 Deletion Plasmids
[0349] Three different deletion plasmids (pTTv34, pTTv122, pTTv186) were constructed for deletion of the protein O-mannosyltransferase gene pmt2 (TreID22005). All the plasmids contain the same 5' and 3' flanking regions for correct integration to the pmt2 locus. The difference between the three plasmids is the marker used in the selection; pTTv34 contains a gene encoding acetamidase of Aspergillus nidulans (amdS), pTTv122 contains a loopout version (blaster cassette) of the amdS marker and pTTv186 a loopout version (blaster cassette) of a gene encoding orotidine-5'-monophosphate (OMP) decarboxylase of T. reesei (pyr4).
[0350] 1100 bp of 5' and 1000 bp of 3' flanking regions were selected as the basis of the second protein O-mannosyltransferase gene, pmt2 (TreID22005), deletion plasmids. The construction of the first plasmid for this gene was carried out essentially as described for pmt1 in Example 1. As for pmt1, the first deletion plasmid for pmt2 (plasmid pTTv34, Table 12) used amdS, a gene encoding acetamidase of Aspergillus nidulans, as the selection marker.
[0351] Like for pmt1 in Example 1, to clone the second deletion plasmid, pTTv122 (Table 12), the amdS marker was removed from the deletion plasmid pTTv34 with Notl digestion and replaced by amdS blaster cassette for which the fragments were produced by PCR (see Example 1 above for details). The plasmid pTTv122 was constructed using the yeast recombination system described in Example 1. The plasmid DNA from the yeast transformants was rescued by transformation into Escherichia coli. A few clones were cultivated, plasmid DNA was isolated and digested to screen for correct recombination using standard laboratory methods. A few clones with correct insert sizes were sequenced and stored.
[0352] The third deletion plasmid for pmt2, pTTv186 (Table 12) was cloned like the third plasmid for pmt1; the amdS blaster cassette was removed from the deletion plasmid pTTv122 with Notl digestion and replaced by the pyr4 blaster cassette described in Example 1. The pyr4 blaster cassette was obtained from another plasmid with Notl digestion, ligated to Notl cut pTTv122 and transformed into E. coli using standard laboratory methods. A few transformants were cultivated, plasmid DNA isolated and digested to screen for correct ligation and orientation of the pyr4 blaster cassette using standard laboratory methods. One clone with correct insert size and orientation was sequenced and stored. These deletion plasmids for pmt2 (pTTv34, pTTv122 and pTTv186, Table 12) result in 3186 bp deletion in the pmt2 locus and cover the complete coding sequence of PMT2.
TABLE-US-00013 TABLE 12 Primers for generating deletion plasmids pTTv34, pTTv122 and pTTv186 for protein O-mannosyltransferase 2 (pmt2, TreID22005). Deletion plasmid pTTv34 for pmt2 (TreID22005), vector backbone pRS426 Primer Sequence 22005_5'F CGATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCACGACGGT TTAAACGTTTCAGGTACCAACACCTG (SEQ ID NO: 70) 22005_5'R ATCTCTCAAAGGAAGAATCCCTTCAGGGTTGCGTTTCCAGTGC GGCCGCGGCGAAGAGTCTGGCGGGGA (SEQ ID NO: 71) 22005_3'F CGGTTCTCATCTGGGCTTGCTCGGTCCTGGCGTAGATCTAGCG GCCGCAAGAGGATGGGGGTAAAGCT (SEQ ID NO: 72) 22005_3'R GTGGAATTGTGAGCGGATAACAATTTCACACAGGAAACAGCGT TTAAACGAGGAGGACTCGTGAGTTAT (SEQ ID NO: 73) Deletion plasmid pTTv122 for pmt2 (TreID22005), vector backbone pTTv34 T280_22005_amds_5for GCGCCCTTCCGCCTCGACAATCCCCGCCAGACTCTTCGCCGC GGCCGCGGCCGGCCGCGATCGCCTAGATCTACGCCAGGACC G (SEQ ID NO: 74) T283_amds_3rev_loop CGGTCCTGGCGTAGATCTAGGGCGCGCCACTGGAAACGCAAC CCTGAA (SEQ ID NO: 75) T284_amds_loop_5for TTCAGGGTTGCGTTTCCAGTGGCGCGCCCTAGATCTACGCCAG GACCG (SEQ ID NO: 76) T285_22005_loop_3rev GAGCTGGCCAGAAAAGACCAAGCTTTACCCCCATCCTCTTGCG GCCGCGATTATTGCACAAGCAGCGA (SEQ ID NO: 77) Deletion plasmid pTTv186 for pmt2 (TreID22005), vector backbone pTTv122 Primer Sequence no new primers, pTTv122 digested with NotI and ligated with pyr4-loopout fragment from another plasmid
Generation of pmt2 Deletion Strains M338, M339 and M340
[0353] To remove vector sequence plasmid pTTv122 (.DELTA.pmt2-amdS) was digested with Pmel+Xbal and the 5.2 kb fragment purified from agarose gel using QIAquick Gel Extraction Kit (Qiagen). Approximately 5 .mu.g of the pmt2 deletion cassette was used to transform the strain M124 (M124 strain is described in WO02012/069593). Protoplast preparation and transformation were carried out essentially according to Penttila et al., 1987, Gene 61:155-164 and Gruber et al, 1990, Current Genetics 18:71-76 for amdS selection.
[0354] 120 colonies were picked as selective streaks. 10 transformants were screened by PCR using the primers in Table 13 for the correct integration of the deletion cassette using standard laboratory methods. Five putative deletion clones were purified to single cell clones. Purified clones (two parallel from each) were rescreened for correct integration and for deletion of pmt2 ORF (primers on Table 13). Five clones were selected for Southern analyses.
TABLE-US-00014 TABLE 13 Primers for screening integration of deletion cassette pTTv122 and for deletion of protein O-mannosyltransferase 2 (pmt2, TreID22005) from M124. Primer Sequence T288_22005_5int ACGAGTTGTTTCGTGTACCG (SEQ ID NO: 78) T020_Amds_rev2 CTTTCCATTCATCAGGGATGG (SEQ ID NO: 79) T021_amds_end_fwd GGAGACTCAGTGAAGAGAGG (SEQ ID NO: 80) T289_22005_3int ATGTTGCAGTTGCGAAAG (SEQ ID NO: 81) T290_22005_5orf CCCTCGTCGCAGAAAAGATG (SEQ ID NO: 82) T291_22005_3orf AGCCTCCTTGGGAACCTCAG (SEQ ID NO: 83)
[0355] Deletion of pmt2 was verified by Southern analyses. DNA for Southern analyses was extracted with Easy-DNA kit for genomic DNA isolation (Invitrogen) essentially according to the manufacturer's instructions.
[0356] Southern analyses were essentially performed as described in Example 1. Fragments for probes were produced by PCR using the primers listed in Table 14 using a T. reesei strain M124 as the template for the ORF probe and plasmid pTTv122 for the 5' and 3' flank probes. PCR products were separated with agarose gel electrophoresis and correct fragments were isolated from the gel with a gel extraction kit (Qiagen) using standard laboratory methods.
TABLE-US-00015 TABLE 14 Primers for production of probe fragments used in Southern analyses of protein O-mannosyltransferase 2 (pmt2, TreID22005) deletion strains. Primer Sequence T639_22005 5' flank CTTAGTGCGGCTGGAGGGCG (SEQ ID NO: 84) probe F T640_22005 5' flank GGCCGGTTCGTGCAACTGGA (SEQ ID NO: 85) probe R T641_22005 3' flank GGCCGCAAGAGGATGGGGGT (SEQ ID NO: 86) probe F T642_22005 3' flank TCGGGCCAGCTGAAGCACAAC (SEQ ID NO: 87) probe R T643_22005 orf 5' probe TTGAGGAACGGCTGCCTGCG (SEQ ID NO: 88) T644_22005 orf 3' probe CGATGGCTCCGTCATCCGCC (SEQ ID NO: 89)
[0357] Three of the clones did not hybridise with pmt2 ORF probe (Data not shown) indicating successful deletion of pmt2. Analyses using 5' and 3' flank probes revealed that the same three clones were single integrants (Data not shown). The two other clones (19-35A and 19-40B) gave signals corresponding to parental strain M124. Three pure clones have been stored for future use (M338; 19-7B, M339; 19-22B and M340; 19-39B).
Analyses of .DELTA.pmt2 Strains M338, M339 and M340
[0358] Shake flask cultivation of T. reesei strain M124 and the pmt2 deletion strains (19-7B/M338, 19-22B/M339 and 19-39B/M340) was carried out in Trichoderma minimal medium with 40 g/l lactose, 20 g/l spent grain extract, 100 mM PIPPS, pH 5.5 with and without 1 M sorbitol as osmotic stabiliser at +28.degree. C., 200 rpm. Samples were collected on days 3, 5 and 7 by vacuum filtration. Supernatant samples were stored to -20.degree. C. (antibody and glycan analyses) or used in pH determinations. Mycelia for cell dry weight determinations were rinsed once with DDIW and dried at +100.degree. C. for 20-24 h. Mycelia for genomic DNA extraction were rinsed once with DDIW and stored to-20.degree. C.
Generation of Pmt2 Deletion Strains M452, M453 and M454
[0359] Generation of M317 is described in Example 1 above.
[0360] To remove vector sequence plasmid pTTv186 (.DELTA.pmt2-pyr4) was digested with Pmel+Xbal and the 4.1 kb fragment purified from agarose gel using QIAquick Gel Extraction Kit (Qiagen). Approximately 5 .mu.g of the pmt2 deletion cassette was used to transform M317.
[0361] Protoplast preparation and transformation were carried out essentially according to Penttila et al., 1987, Gene 61:155-164 and Gruber et al, 1990, Current Genetics 18:71-76 for pyr4 selection.
[0362] 100 colonies were picked as selective streaks. 20 transformants were screened by PCR using the primers in Table 15 for the correct integration of the deletion cassette using standard laboratory methods. Nine putative deletion clones were purified to single cell clones. Purified clones were rescreened for 5' integration and for deletion of pmt2 ORF (primers on Table 14). Three clones were pure deletants (i.e. no signal with ORF primers).
TABLE-US-00016 TABLE 15 Primers for screening integration of deletion cassette pTTv186 and for deletion of protein O-mannosyltransferase 2 (pmt2, TreID22005) from M317. Primer Sequence T288_22005_5int ACGAGTTGTTTCGTGTACCG (SEQ ID NO: 90) T027_Pyr4_orf_start_rev TGCGTCGCCGTCTCGCTCCT (SEQ ID NO: 91) T061_pyr4_orf_screen_ TTAGGCGACCTCTTTTTCCA (SEQ ID NO: 92) 2F T289_22005_3int ATGTTGCAGTTGCGAAAG (SEQ ID NO: 93) T290_22005_5orf CCCTCGTCGCAGAAAAGATG (SEQ ID NO: 94) T291_22005_3orf AGCCTCCTTGGGAACCTCAG (SEQ ID NO: 95)
[0363] Deletion of pmt2 was verified by Southern analyses. DNA for Southern analyses was extracted with Easy-DNA kit for genomic DNA isolation (Invitrogen) essentially according to the manufacturer's instructions.
[0364] Southern analyses were essentially performed as described in Example 1. Fragments for probes were produced by PCR using the primers listed in Table 16 using a T. reesei wild type strain QM6a (ATCC13631) as the template for pmt2 ORF probe and plasmid pTTv186 for 5' and 3' flank probes. PCR products were separated with agarose gel electrophoresis and correct fragments were isolated from the gel with a gel extraction kit (Qiagen) using standard laboratory methods.
TABLE-US-00017 TABLE 16 Primers for production of probe fragments used in Southern analyses of protein O-mannosyltransferase 2 (pmt2, TreID22005) deletion clones. Primer Sequence T639_22005 5' flank CTTAGTGCGGCTGGAGGGCG (SEQ ID NO: 96) probe F T640_22005 5' flank GGCCGGTTCGTGCAACTGGA (SEQ ID NO: 97) probe R T641_22005 3' flank GGCCGCAAGAGGATGGGGGT (SEQ ID NO: 98) probe F T642_22005 3' flank TCGGGCCAGCTGAAGCACAAC (SEQ ID NO: 99) probe R T290_22005_5orf CCCTCGTCGCAGAAAAGATG (SEQ ID NO: 100) T291_22005_3orf AGCCTCCTTGGGAACCTCAG (SEQ ID NO: 101)
[0365] None of the clones hybridised with pmt2 ORF probe (Data not shown) indicating successful deletion of pmt2. Analyses using 5' and 3' flank probes revealed that two of the clones were single integrants (Data not shown). One clone gave additional signal from the 3'flank probing (Data not shown) and thus indicated partial or multiple integration of the deletion cassette. Three pure clones (with and without additional copies of the deletion cassette) have been stored for future use (M452; 27-10A, M453; 27-17A and M454: 27-18B).
Analyses of .DELTA.pmt2 Strains M452, M453 and M454
[0366] Shake flask cultivation of T. reesei strain M304 and three pmt2 deletion strains (27-10A/M452, 27-17A/M453 and 27-18B/M454) was carried out in Trichoderma minimal medium with 40 g/l lactose, 20 g/l spent grain extract, 100 mM PIPPS, 9 g/l casamino acids, pH 5.5 at +28.degree. C., 200 rpm. Samples were collected on days 3, 5, 7 and 10 by vacuum filtration. Supernatant samples were stored to -20.degree. C. (antibody and glycan analyses) or used in pH determinations. Mycelia for cell dry weight determinations were rinsed once with DDIW and dried at +100.degree. C. for 20-24 h. Mycelia for genomic DNA extraction were rinsed once with DDIW and stored to -20.degree. C.
[0367] O-mannosylation level analysis was performed to pmt2 deletion strains as to flask cultures of pmt1 deletion strains. No difference was observed in O-mannosylation compared to parental strain M304.
Example 4: Pmt3 Deletion in a Trichoderma reesei Strain
Generation of Pmt3 Deletion Plasmids
[0368] Three different deletion plasmids (pTTv35, pTTv123, pTTv187) were constructed for deletion of the protein O-mannosyltransferase gene pmt3 (TreID22527). All the plasmids contain the same 5' and 3' flanking regions for correct integration to the pmt3 locus. The difference between the three plasmids is the marker used in the selection; pTTv35 contains a gene encoding acetamidase of Aspergillus nidulans (amdS), pTTv123 contains a loopout version (blaster cassette) of the amdS marker and pTTv187 a loopout version (blaster cassette) of a gene encoding orotidine-5'-monophosphate (OMP) decarboxylase of T. reesei (pyr4).
[0369] 1100 bp of 5' and 1000 bp of 3' flanking regions were selected as the basis of the third protein O-mannosyltransferase gene, pmt3 (TreID22527), deletion plasmids. The construction of the first plasmid for this gene was carried out essentially as described for pmt1 in Example 1. As for pmt1, the first deletion plasmid for pmt3 (plasmid pTTv35, Table 17) used amdS, a gene encoding acetamidase of Aspergillus nidulans, as the selection marker.
[0370] Like for pmt1 in Example 1, to clone the second deletion plasmid, pTTv123 (Table 16), the amdS marker was removed from the deletion plasmid pTTv35 with Notl digestion and replaced by amdS blaster cassette for which the fragments were produced by PCR (see Example 1 above for details). The plasmid pTTv123 was constructed using the yeast recombination system described in Example 1. The plasmid DNA from the yeast transformants was rescued by transformation into Escherichia coli. A few clones were cultivated, plasmid DNA was isolated and digested to screen for correct recombination using standard laboratory methods. A few clones with correct insert sizes were sequenced and stored.
[0371] The third deletion plasmid for pmt3, pTTv187 (Table 17) was cloned like the third plasmid for pmt1; the amdS blaster cassette was removed from the deletion plasmid pTTv123 with Notl digestion and replaced by the pyr4 blaster cassette described in Example 1. The pyr4 blaster cassette was obtained from another plasmid with Notl digestion, ligated to Notl cut pTTv123 and transformed into E. coli using standard laboratory methods. A few transformants were cultivated, plasmid DNA isolated and digested to screen for correct ligation and orientation of the pyr4 blaster cassette using standard laboratory methods. One clone with correct insert size and orientation was sequenced and stored. These deletion plasmids for pmt3 (pTTv35, pTTv123 and pTTv187, Table 17) result in 2495 bp deletion in the pmt3 locus and cover the complete coding sequence of PMT3.
TABLE-US-00018 TABLE 17 Primers for generating deletion plasmids pTTv35, pTTv123 and pTTv187 for protein O-mannosyltransferase 3 (pmt3, TreID22527). Deletion plasmid pTTv35 for pmt3 (TreID22527), vector backbone pRS426 Primer Sequence 22527_5'F CGATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCACGAC GGTTTAAACGTGTTTAAATTTGATGAGGC (SEQ ID NO: 102) 22527_5'R ATCTCTCAAAGGAAGAATCCCTTCAGGGTTGCGTTTCCAGT GCGGCCGCGGTCTCAGAGACAGCCTTCT (SEQ ID NO: 103) 22527_3F CGGTTCTCATCTGGGCTTGCTCGGTCCTGGCGTAGATCTA GCGGCCGCACTCGGCTTCTTTGTCCGAG (SEQ ID NO: 104) 22527_3'R GTGGAATTGTGAGCGGATAACAATTTCACACAGGAAACAG CGTTTAAACTCCTCGTCGGCAACAAGGCC (SEQ ID NO: 105) Deletion plasmid pTTv123 for pmt3 (TreID22527), vector backbone pTTv35 T281_22527_amds_ GCAGATCTGGGGGAGGAATCAGAAGGCTGTCTCTGAGACC 5for GCGGCCGCGGCCGGCCGCGATCGCCTAGATCTACGCCAG GACCG (SEQ ID NO: 106) T283_amds_3rev_loop CGGTCCTGGCGTAGATCTAGGGCGCGCCACTGGAAACGC AACCCTGAA (SEQ ID NO: 107) T284_amds_loop_5for TTCAGGGTTGCGTTTCCAGTGGCGCGCCCTAGATCTACGC CAGGACCG (SEQ ID NO: 108) T286_22527_loop_ AAAGTGGGCGAGCTGAGATACTCGGACAAAGAAGCCGAGT 3rev GCGGCCGCGATTATTGCACAAGCAGCGA (SEQ ID NO: 109) Deletion plasmid pTTv187 for pmt3 (TreID22527), vector backbone pTTv123 Primer Sequence no new primers, pTTv123 digested with NotI and ligated with pyr4-loopout fragment from another plasmid.
Generation of Pmt3 Deletion Strains M341 and M342
[0372] To remove vector sequence plasmid pTTv123 (.DELTA.pmt3-amdS) was digested with Pmel+Xbal and the 5.2 kb fragment purified from agarose gel using QIAquick Gel Extraction Kit (Qiagen). Approximately 5 .mu.g of the pmt3 deletion cassette was used to transform the strain M124. Protoplast preparation and transformation were carried out essentially according to Penttila et al., 1987, Gene 61:155-164 and Gruber et al, 1990, Current Genetics 18:71-76 for amdS selection.
[0373] 120 colonies were picked as selective streaks. 10 transformants were screened by PCR using the primers in Table 18 for the correct integration of the deletion cassette using standard laboratory methods. Three putative deletion clones were purified to single cell clones. Purified clones (three parallel from each) were rescreened for correct integration and for deletion of pmt3 ORF (primers on Table 18). Three clones were selected for Southern analyses.
TABLE-US-00019 TABLE 18 Primers for screening integration of deletion cassette pTTv123 and for deletion of protein O-mannosyltransferase 3 (pmt3, TreID22527) from M124. Primer Sequence T292_22527_5int ACGGGAGATCTCGGAAAA (SEQ ID NO: 110) T020_Amds_rev2 CTTTCCATTCATCAGGGATGG (SEQ ID NO: 111) T021_amds_end_fwd GGAGACTCAGTGAAGAGAGG (SEQ ID NO: 112) T293_22527_3int ATGAAGCTCAGCCTGTGG (SEQ ID NO: 113) T294_22527_5orf GGGGACGGCTTGAGGAAG (SEQ ID NO: 114) T295_22527_3orf CTGCTTGCTGCTTCCAGTCA (SEQ ID NO: 115)
[0374] Deletion of pmt3 was verified by Southern analyses. DNA for Southern analyses was extracted with Easy-DNA kit for genomic DNA isolation (Invitrogen) essentially according to the manufacturer's instructions.
[0375] Southern analyses were essentially performed as described in Example 1. Fragments for probes were produced by PCR using the primers listed in Table 19 using a T. reesei strain M124 as the template for the ORF probe and plasmid pTTv123 for the 5' and 3' flank probes. PCR products were separated with agarose gel electrophoresis and correct fragments were isolated from the gel with a gel extraction kit (Qiagen) using standard laboratory methods.
TABLE-US-00020 TABLE 19 Primers for production of probe fragments used in Southern analyses of protein O-mannosyltransferase 3 (pmt3, TreID22527) deletion strains. Primer Sequence T645_22527 5' flank TGGCAGATGCCGAAAGGCGG (SEQ ID NO: 116) probe F T646_22527 5' flank TGGCAACCAGCTGTGGCTCC (SEQ ID NO: 117) probe R T647_22527 3' flank CGGCCGCACTCGGCTTCTTT (SEQ ID NO: 118) probe F T648_22527 3' flank GAGTGGGCTAGGCGCAACGG (SEQ ID NO: 119) probe R T649_22527 orf 5' probe GGATCGGCCACTGCCACCAC (SEQ ID NO: 120) T650_22527 orf 3' probe GCCCACTTCTCTGCGCGTGT (SEQ ID NO: 121)
[0376] Two of the clones did not hybridise with pmt3 ORF probe (Data not shown) indicating successful deletion of pmt3. Analyses using 5' and 3' flank probes revealed that the same two clones were single integrants (Data not shown). One clone (20-32C) gave signals corresponding to parental strain M124. Two clones have been stored for future use (M341; 20-34C and M342; 20-35B).
Analyses of .DELTA.pmt3 Strains M341 and M342
[0377] Shake flask cultivation of T. reesei strain M124 and the pmt3 deletion strains (20-34C/M341 and 20-35B/M342) was carried out in Trichoderma minimal medium with 40 g/l lactose, 20 g/l spent grain extract, 100 mM PIPPS, pH 5.5 with and without 1 M sorbitol as osmotic stabiliser at +28.degree. C., 200 rpm. Samples were collected on days 3, 5 and 7 by vacuum filtration. Supernatant samples were stored to -20.degree. C. (antibody and glycan analyses) or used in pH determinations. Mycelia for cell dry weight determinations were rinsed once with DDIW and dried at +100.degree. C. for 20-24 h. Mycelia for genomic DNA extraction were rinsed once with DDIW and stored to -20.degree. C.
Generation of Pmt3 Deletion Strains M522 and M523
[0378] Generation of M317 is described in Example 1 above.
[0379] To remove vector sequence plasmid pTTv187 (.DELTA.pmt3-pyr4) was digested with Pmel+Xbal and the 4.1 kb fragment purified from agarose gel using QIAquick Gel Extraction Kit (Qiagen). Approximately 5 .mu.g of the pmt3 deletion cassette was used to transform M317. Protoplast preparation and transformation were carried out essentially according to Penttila et al., 1987, Gene 61:155-164 and Gruber et al, 1990, Current Genetics 18:71-76 for pyr4 selection.
[0380] 200 colonies were picked as selective streaks. 59 transformants were screened by PCR using the primers in Table 20 for the correct integration of the deletion cassette using standard laboratory methods. Three putative deletion clones were purified to single cell clones. Purified clones were rescreened for correct integration and for deletion of pmt3 ORF (primers on Table 19). Two clones (several parallels) were pure deletants (i.e. no signal with ORF primers).
TABLE-US-00021 TABLE 20 Primers for screening integration of deletion cassette pTTv187 and for deletion of protein O-mannosyltransferase 3 (pmt3, TreID22527) from M317. Primer Sequence T292_22527_5int ACGGGAGATCTCGGAAAA (SEQ ID NO: 122) T026_Pyr4_orf_5rev2 CCATGAGCTTGAACAGGTAA (SEQ ID NO: 123) T061_pyr4_orf_screen_ TTAGGCGACCTCTTTTTCCA (SEQ ID NO: 124) 2F T293_22527_3int ATGAAGCTCAGCCTGTGG (SEQ ID NO: 125) T649_22527_orf 5' GGATCGGCCACTGCCACCAC (SEQ ID NO: 126) probe T650_22527_orf 3' GCCCACTTCTCTGCGCGTGT (SEQ ID NO: 127) probe
[0381] Deletion of pmt3 was verified by Southern analyses. DNA for Southern analyses was extracted with Easy-DNA kit for genomic DNA isolation (Invitrogen) essentially according to the manufacturer's instructions.
[0382] Southern analyses were essentially performed as described in Example 1. Fragments for probes were produced by PCR using the primers listed in Table 21 using a T. reesei wild type strain QM6a (ATCC13631) as the template for the ORF probe and plasmid pTTv187 for the 5' and 3' flank probes. PCR products were separated with agarose gel electrophoresis and correct fragments were isolated from the gel with a gel extraction kit (Qiagen) using standard laboratory methods.
TABLE-US-00022 TABLE 21 Primers for production of probe fragments used in Southern analyses of protein O-mannosyltransferase 3 (pmt3, TreID22527) deletion strains. Primer Sequence T645_22527 5' flank TGGCAGATGCCGAAAGGCGG (SEQ ID probe F NO: 128) T646_22527 5' flank TGGCAACCAGCTGTGGCTCC (SEQ ID probe R NO: 129) T647_22527 3' flank CGGCCGCACTCGGCTTCTTT (SEQ ID probe F NO: 130) T648_22527 3' flank GAGTGGGCTAGGCGCAACGG (SEQ ID probe R NO: 131) T874_pmt3_orf_f3 CTCTGCGCGTGTTGTGG (SEQ ID NO: 132) T875_pmt3_orf_r3 TAAGGGTGCGGATTCGG (SEQ ID NO: 133)
[0383] Eight of the clones did not hybridise with pmt3 ORF probe (Data not shown) indicating successful deletion of pmt3. One clone (33-37K) hybridised with pmt3 ORF probe even though the signal size did not correspond to those from parental strains suggesting rearrangement in the pmt3 locus. Analyses using 5' and 3' flank probes revealed that the eight .DELTA.pmt3 clones were single integrants (Data not shown). One clone (33-37K) gave incorrect or additional signals suggesting rearrangements in the pmt3 locus and multiple integrations of the deletion cassette. Two pure clones have been stored for future use (M522; 33-34A and M523; 33-188A-a).
Analyses of .DELTA.pmt3 Strains M522 and M523
[0384] 24-well plate cultivation of T. reesei strain M304 and eight pmt3 deletion strains (33-34S/M522, 33-34T, 33-34U, 33-34O, 33-188A-a/M523, 33-188B-a, 33-188C-a and 33-188D-a) was carried out in Trichoderma minimal medium with 40 g/l lactose, 20 g/l spent grain extract, 100 mM PIPPS, 9 g/l casamino acids, pH 5.5 at +28.degree. C., 800 rpm with humidity control. Samples were collected on days 3, 5 and 6 by centrifugation. Supernatant samples were stored to -20.degree. C. Mycelia for cell dry weight determinations were rinsed once with DDIW and dried at +100.degree. C. for 20-24 h. Mycelia for genomic DNA extraction were rinsed twice with DDIW and stored to -20.degree. C.
[0385] O-mannosylation level analysis was performed to pmt3 deletion strains as to flask cultures of pmt1 deletion strains. No difference was observed in O-mannosylation compared to parental strain M304.
Example 5--Pmt Homologs
[0386] T. reesei pmt homologs were identified from other organisms.
[0387] BLAST searches were conducted using the National Center for Biotechnology Information (NCBI) non-redundant amino acid database using the Trichoderma reesei PMT amino acid sequences as queries. Sequence hits from the BLAST searches were aligned using the ClustalW2 alignment tool provided by EBI. Phylogenetic trees were generated using average distance with BLOSUM62 after aligning the sequences in the Clustal Omega alignment tool.
[0388] A phylogenetic tree and a partial sequence alignment of the results of the PMT BLAST searches are depicted in FIGS. 5 and 6, respectively.
Sequence CWU
1
1
19712322DNATrichoderma reesei 1atggctcgaa gtccaacgcc gcagggcagc ctgcgacagc
ggaacgttgc gtccaagcag 60gcgcctgtcg agtcggcatt cgttcccgag gtcgagctcg
acaagctctc caaggccgct 120ctgtcgtcgc gccgaaacat ccagagaggc gagctcgagc
acaagcttgc cctgacgctg 180gtgacgatcc tcggctttgt cacgcgattc tggggcatca
gccaccccga cgaggtcgtc 240tttgacgagg tgcattttgg aaagttcgcc tcctactacc
tccagcgaac ctacttcttc 300gacgtccacc cccctttcgc caagctgctc ttcgccttcg
ttggctggct ggttggctac 360gacggtcact tccacttcga caacattggc gactcctacg
tggccaacaa ggtgccctat 420gtcgccttcc gagccttgcc cgccttcctc ggcgcattga
ctgtgtcggt cacatacctc 480atcatgtggg agtctggcta tagtgtgccg gcttgccttg
tcgcgaccgg cctgatcctc 540ctggacaatg cgcacattgg ccagacccgc ctcattctgc
tcgacgccac cctggtgctc 600gccatggcct gcagtctctt gttctacatc aagttctaca
agctgcggca cgagcccttt 660agccgcaagt ggtggaagtg gctcatcctg accggctttg
cgctgtcgtg cgacatctcg 720accaagtatg tcggtctctt tgcctttgtc accattggct
ccgccgtcat cattgatctg 780tgggatcttt tggatatcaa gcgccgctat ggagccatca
gcatgccaga gtttggaaag 840cactttgcag cccgcgcctt tggcctcatc atcttgccct
tcctcttcta cctcttctgg 900ttccaggtgc acttttccgt cctgacccga tccggtcccg
gcgacgactt catgactccc 960gagttccagg agacgttgag cgacaacgtc atgctggcaa
gcgccgtcga catccagtac 1020tacgatacca tcaccatcag gcacaaggag accaaggcgt
atcttcacag ccacaccgac 1080acctaccctc tgcgatatga cgacggccgc atctccagcc
aaggccaaca ggtcaccggc 1140tacccccaca acgacaccaa caactactgg cagatcctcc
ctgccgacaa tgaccagaag 1200ctcggccgta acgttaagaa tcaagacttg gtgcgacttc
gacacattgt cacggacaag 1260atcctgctct cccatgatgt cgcctcgccc tactacccta
ccaaccagga gttcacctgt 1320gtgacccccg aggaagcatt cggcgagcgc caaaacgaca
ctctgttcga gatccggatt 1380gagggaggca agaccggcca ggacttcaag accgttgcca
gccacttcaa gctcattcac 1440ttccccagca aggtggccat gtggactcat accacgcccc
ttcccgagtg ggcctacagg 1500cagcaggaaa tcaacggcaa caagcaaatc actcccagct
ccaacgtctg gattgccgaa 1560gacattcctt cgctcccgga agacgacgct cgccgccaca
aggagcagcg caaggtcaag 1620tcgctgccgt tcctccgcaa gtggtttgag ctgcagaggt
ccatgttcta ccacaacaac 1680aagctgacca gcagccaccc ctactccagc cagccctacc
actggccatt cctcctccgc 1740ggagtgagct tctggacgca gaatgacaca cgccagcaaa
tctactttgt gggcaacccc 1800atcggctggt ggcttgccag cagtctgctg gctgtgtttg
ccggcatcat tggagctgat 1860caggtctcgc tgcgccgagg catcgatgct ctggatcacc
gcacccgctc ccgactgtac 1920aactctaccg gcttcttctt ccttgcctgg gccacccact
acttcccctt tttcctcatg 1980ggtcgtcagc tgttcttgca tcactacttg cctgcccatt
tggcgtcctg cctggtcacg 2040ggctccctcg tcgagttcat ctttaacacg gacccggcag
acgaggagcc ttcgcgatcc 2100aaaaacccca aggctactgg tcctcggaga cacatcacgg
ctcgcgagcg gtttgctggc 2160aagagcatgg ccggtgcctg gatcgcttgc tttgtgattc
tcgctgccgc cgcggctagc 2220tggtacttct tcttgccgtt gacgtatggc taccccggac
tgtctgttga ggaggttctc 2280aggagaaagt ggcttggata tgatcttcac tttgccaagt
ag 23222773PRTTrichoderma reesei 2Met Ala Arg Ser
Pro Thr Pro Gln Gly Ser Leu Arg Gln Arg Asn Val1 5
10 15Ala Ser Lys Gln Ala Pro Val Glu Ser Ala
Phe Val Pro Glu Val Glu 20 25
30Leu Asp Lys Leu Ser Lys Ala Ala Leu Ser Ser Arg Arg Asn Ile Gln
35 40 45Arg Gly Glu Leu Glu His Lys Leu
Ala Leu Thr Leu Val Thr Ile Leu 50 55
60Gly Phe Val Thr Arg Phe Trp Gly Ile Ser His Pro Asp Glu Val Val65
70 75 80Phe Asp Glu Val His
Phe Gly Lys Phe Ala Ser Tyr Tyr Leu Gln Arg 85
90 95Thr Tyr Phe Phe Asp Val His Pro Pro Phe Ala
Lys Leu Leu Phe Ala 100 105
110Phe Val Gly Trp Leu Val Gly Tyr Asp Gly His Phe His Phe Asp Asn
115 120 125Ile Gly Asp Ser Tyr Val Ala
Asn Lys Val Pro Tyr Val Ala Phe Arg 130 135
140Ala Leu Pro Ala Phe Leu Gly Ala Leu Thr Val Ser Val Thr Tyr
Leu145 150 155 160Ile Met
Trp Glu Ser Gly Tyr Ser Val Pro Ala Cys Leu Val Ala Thr
165 170 175Gly Leu Ile Leu Leu Asp Asn
Ala His Ile Gly Gln Thr Arg Leu Ile 180 185
190Leu Leu Asp Ala Thr Leu Val Leu Ala Met Ala Cys Ser Leu
Leu Phe 195 200 205Tyr Ile Lys Phe
Tyr Lys Leu Arg His Glu Pro Phe Ser Arg Lys Trp 210
215 220Trp Lys Trp Leu Ile Leu Thr Gly Phe Ala Leu Ser
Cys Asp Ile Ser225 230 235
240Thr Lys Tyr Val Gly Leu Phe Ala Phe Val Thr Ile Gly Ser Ala Val
245 250 255Ile Ile Asp Leu Trp
Asp Leu Leu Asp Ile Lys Arg Arg Tyr Gly Ala 260
265 270Ile Ser Met Pro Glu Phe Gly Lys His Phe Ala Ala
Arg Ala Phe Gly 275 280 285Leu Ile
Ile Leu Pro Phe Leu Phe Tyr Leu Phe Trp Phe Gln Val His 290
295 300Phe Ser Val Leu Thr Arg Ser Gly Pro Gly Asp
Asp Phe Met Thr Pro305 310 315
320Glu Phe Gln Glu Thr Leu Ser Asp Asn Val Met Leu Ala Ser Ala Val
325 330 335Asp Ile Gln Tyr
Tyr Asp Thr Ile Thr Ile Arg His Lys Glu Thr Lys 340
345 350Ala Tyr Leu His Ser His Thr Asp Thr Tyr Pro
Leu Arg Tyr Asp Asp 355 360 365Gly
Arg Ile Ser Ser Gln Gly Gln Gln Val Thr Gly Tyr Pro His Asn 370
375 380Asp Thr Asn Asn Tyr Trp Gln Ile Leu Pro
Ala Asp Asn Asp Gln Lys385 390 395
400Leu Gly Arg Asn Val Lys Asn Gln Asp Leu Val Arg Leu Arg His
Ile 405 410 415Val Thr Asp
Lys Ile Leu Leu Ser His Asp Val Ala Ser Pro Tyr Tyr 420
425 430Pro Thr Asn Gln Glu Phe Thr Cys Val Thr
Pro Glu Glu Ala Phe Gly 435 440
445Glu Arg Gln Asn Asp Thr Leu Phe Glu Ile Arg Ile Glu Gly Gly Lys 450
455 460Thr Gly Gln Asp Phe Lys Thr Val
Ala Ser His Phe Lys Leu Ile His465 470
475 480Phe Pro Ser Lys Val Ala Met Trp Thr His Thr Thr
Pro Leu Pro Glu 485 490
495Trp Ala Tyr Arg Gln Gln Glu Ile Asn Gly Asn Lys Gln Ile Thr Pro
500 505 510Ser Ser Asn Val Trp Ile
Ala Glu Asp Ile Pro Ser Leu Pro Glu Asp 515 520
525Asp Ala Arg Arg His Lys Glu Gln Arg Lys Val Lys Ser Leu
Pro Phe 530 535 540Leu Arg Lys Trp Phe
Glu Leu Gln Arg Ser Met Phe Tyr His Asn Asn545 550
555 560Lys Leu Thr Ser Ser His Pro Tyr Ser Ser
Gln Pro Tyr His Trp Pro 565 570
575Phe Leu Leu Arg Gly Val Ser Phe Trp Thr Gln Asn Asp Thr Arg Gln
580 585 590Gln Ile Tyr Phe Val
Gly Asn Pro Ile Gly Trp Trp Leu Ala Ser Ser 595
600 605Leu Leu Ala Val Phe Ala Gly Ile Ile Gly Ala Asp
Gln Val Ser Leu 610 615 620Arg Arg Gly
Ile Asp Ala Leu Asp His Arg Thr Arg Ser Arg Leu Tyr625
630 635 640Asn Ser Thr Gly Phe Phe Phe
Leu Ala Trp Ala Thr His Tyr Phe Pro 645
650 655Phe Phe Leu Met Gly Arg Gln Leu Phe Leu His His
Tyr Leu Pro Ala 660 665 670His
Leu Ala Ser Cys Leu Val Thr Gly Ser Leu Val Glu Phe Ile Phe 675
680 685Asn Thr Asp Pro Ala Asp Glu Glu Pro
Ser Arg Ser Lys Asn Pro Lys 690 695
700Ala Thr Gly Pro Arg Arg His Ile Thr Ala Arg Glu Arg Phe Ala Gly705
710 715 720Lys Ser Met Ala
Gly Ala Trp Ile Ala Cys Phe Val Ile Leu Ala Ala 725
730 735Ala Ala Ala Ser Trp Tyr Phe Phe Leu Pro
Leu Thr Tyr Gly Tyr Pro 740 745
750Gly Leu Ser Val Glu Glu Val Leu Arg Arg Lys Trp Leu Gly Tyr Asp
755 760 765Leu His Phe Ala Lys
7703944PRTTrichoderma reesei 3Met Ala Lys Ala Thr Ala Arg Gly Arg Ser Pro
Gln Pro Pro Leu Val1 5 10
15Ala Glu Lys Met Pro Val Ala Val Thr Ala Pro Val Ala Ser Ser Lys
20 25 30Ser Lys Ala Ala Lys Lys Asn
Ser Ser Tyr Arg Ser Asp Gly Val Ala 35 40
45Asp Asn Asp Val Phe Leu Leu Pro Gly Ala Asp Tyr Val Ala Ala
Leu 50 55 60Gly Val Thr Val Leu Ala
Thr Ile Val Arg Leu Phe Lys Ile Tyr Thr65 70
75 80Pro Thr Ser Val Val Phe Asp Glu Val His Phe
Gly Gly Phe Ala Ser 85 90
95Lys Tyr Ile Lys Gly Arg Phe Phe Met Asp Val His Pro Pro Leu Ala
100 105 110Lys Met Leu Ile Ala Leu
Thr Gly Trp Leu Ala Gly Phe Asp Gly Asn 115 120
125Phe Asp Phe Lys Asp Ile Gly Lys Asp Tyr Leu Glu Pro Gly
Val Pro 130 135 140Tyr Val Ala Met Arg
Met Phe Pro Ala Val Cys Gly Ile Leu Leu Ala145 150
155 160Pro Phe Met Phe Phe Thr Leu Lys Ala Val
Gly Cys Arg Thr Thr Thr 165 170
175Ala Ile Leu Gly Ala Ser Phe Ile Ile Phe Glu Asn Gly Leu Leu Thr
180 185 190Gln Ala Arg Leu Ile
Leu Leu Asp Ser Pro Leu Val Ala Ala Thr Ala 195
200 205Phe Thr Ala Met Ser Phe Asn Cys Phe Thr Asn Gln
His Glu Gln Gly 210 215 220Pro Asp Lys
Ala Phe Ser Leu Ser Trp Trp Phe Trp Leu Ala Met Thr225
230 235 240Gly Leu Gly Leu Gly Ile Thr
Ser Ser Ile Lys Trp Val Gly Leu Phe 245
250 255Thr Ile Ala Trp Val Gly Ser Leu Thr Leu Val Gln
Leu Trp Val Leu 260 265 270Leu
Gly Asp Ser Lys Asn Val Ser Met Arg Leu Trp Phe Lys His Phe 275
280 285Met Ala Arg Val Phe Cys Leu Ile Ile
Ile Pro Leu Thr Phe Tyr Leu 290 295
300Ser Met Phe Ala Ile His Phe Leu Cys Leu Thr Asn Pro Gly Glu Gly305
310 315 320Asp Gly Phe Met
Ser Ser Glu Phe Gln Ala Thr Leu Asn Ser Lys Gly 325
330 335Met Lys Asp Val Pro Ala Asp Val Val Phe
Gly Ser Arg Val Thr Ile 340 345
350Arg His Val Asn Thr Gln Gly Gly Tyr Leu His Ser His Pro Leu Met
355 360 365Tyr Pro Thr Gly Ser Leu Gln
Gln Gln Ile Thr Leu Tyr Pro His Lys 370 375
380Asp Glu Asn Asn Ile Trp Ile Met Glu Asn Gln Thr Gln Pro Leu
Gly385 390 395 400Val Asp
Gly Gln Pro Ile Asn Gly Thr Glu Ala Trp Asp Ala Leu Pro
405 410 415Glu Val His His Val Val Asp
Gly Ser Val Ile Arg Leu Tyr His Lys 420 425
430Pro Thr Phe Arg Arg Leu His Ser His Asp Val Arg Pro Pro
Val Thr 435 440 445Glu Ala Glu Trp
Gln Asn Glu Val Ser Ala Tyr Gly Tyr Glu Gly Phe 450
455 460Glu Gly Asp Ala Asn Asp Leu Phe Arg Val Glu Ile
Val Lys Lys Gln465 470 475
480Ser Lys Gly Pro Leu Ala Lys Glu Arg Leu Arg Thr Ile Glu Thr Lys
485 490 495Phe Arg Leu Ile His
Val Met Thr Gly Cys Ala Leu Phe Ser His Lys 500
505 510Val Lys Leu Pro Glu Trp Ala Ser Glu Gln Gln Glu
Val Thr Cys Ala 515 520 525Arg Gly
Gly Ser Leu Pro Asn Ser Ile Trp Tyr Ile Glu Tyr Asn Glu 530
535 540His Pro Leu Leu Gly Asp Asp Val Glu Lys Val
Asn Tyr Ala Asn Pro545 550 555
560Gly Phe Phe Gly Lys Phe Trp Glu Leu His Lys Val Met Trp Lys Thr
565 570 575Asn Ala Gly Leu
Thr Asp Ser His Ala Trp Asp Ser Arg Pro Pro Ser 580
585 590Trp Pro Ile Leu Arg Arg Gly Ile Asn Phe Trp
Gly Lys His His Met 595 600 605Gln
Val Tyr Leu Leu Gly Asn Pro Phe Ile Trp Trp Ser Ser Thr Ala 610
615 620Ala Val Ala Ile Trp Val Ile Phe Lys Gly
Val Ala Ile Leu Arg Trp625 630 635
640Gln Arg Gly Cys Asn Asp Tyr Ala Ser Ser Thr Phe Lys Arg Phe
Asp 645 650 655Tyr Glu Ile
Gly Thr Ser Val Leu Gly Trp Ala Leu His Tyr Phe Pro 660
665 670Phe Tyr Leu Met Glu Arg Gln Leu Phe Leu
His His Tyr Phe Pro Ala 675 680
685Leu Tyr Phe Ala Ile Leu Ala Leu Cys Gln Met Phe Asp Phe Ala Thr 690
695 700Val Arg Ile Pro Ala Ala Leu Gly
Tyr Arg Ser Thr Leu Ile Asn Arg705 710
715 720Val Gly Thr Val Ser Leu Leu Val Ile Ser Ala Ala
Val Phe Thr Leu 725 730
735Phe Ala Pro Leu Ala Tyr Gly Thr Pro Trp Thr Lys Ala Glu Cys Asn
740 745 750Arg Val Lys Leu Phe Asp
Lys Trp Asp Phe Asp Cys Asn Thr Phe Leu 755 760
765Asp Asp Tyr Lys Ser Tyr Thr Leu Thr Ser Leu Ala Pro Ser
Ser Ile 770 775 780Ala Pro Ser Pro Pro
Ala Ala Asn Val Pro Val Val Asn Gln Glu Gln785 790
795 800Lys Pro Leu Ala Lys Gln Pro Glu Pro Val
Ile Ser Gln Ala Ala Val 805 810
815Pro Gln Glu Pro Gln Ile Leu Ser Lys Glu Glu Lys Ile Glu Tyr Arg
820 825 830Asp Gln Asp Gly Asn
Leu Leu Asn Asp Glu Gln Val Lys Ala Leu Gln 835
840 845Gly Lys Val Glu Phe Lys Thr Lys Tyr Glu Thr Lys
Thr Arg Val Val 850 855 860Asp Ala Gln
Gly His Glu Ile Pro Val Pro Glu Gly Gly Trp Pro Asp865
870 875 880Asp Met Ile Ala Gly Val Ala
Pro Pro His Pro Asp Val Glu Gly Val 885
890 895Asp Lys Glu Thr Pro Lys Val Glu Ser Ala Glu Val
Pro Lys Glu Ala 900 905 910Ala
Ala Ser Arg Asp Gly Glu Val Glu Ala Glu Asn Leu Lys Ala Lys 915
920 925Pro Ala Ser Glu Gly Gln Glu Val Glu
Ala Thr Val Gln Glu Glu Leu 930 935
9404740PRTTrichoderma reesei 4Met Ala Ala Asp Lys Ala Ala Leu Ala Ser Gly
Ala Asp Leu Gly Asp1 5 10
15Gly Leu Arg Lys Arg Gln Ala Ala Ser Gln Ala Val Pro Ser Phe Ile
20 25 30Pro Ala Gln Thr Glu Asp Thr
Lys Lys Leu Ala Lys Lys Asp Lys Thr 35 40
45Phe Val Gln Val Leu Ala Asp Trp Glu Ser Val Leu Ala Pro Leu
Ile 50 55 60Phe Thr Ala Val Ala Ile
Phe Thr Arg Leu Tyr Lys Ile Gly Leu Ser65 70
75 80Asn Ile Val Thr Trp Asp Glu Ala His Phe Gly
Lys Phe Gly Ser Tyr 85 90
95Tyr Ile Lys His Glu Tyr Tyr Phe Asp Val His Pro Pro Leu Gly Lys
100 105 110Met Leu Val Gly Leu Ser
Gly Val Leu Ala Gly Tyr Asn Gly Ser Phe 115 120
125Glu Phe Lys Ser Gly Glu Gln Tyr Pro Glu Asp Val Asn Tyr
Thr Phe 130 135 140Met Arg Ala Phe Asn
Ala Ala Phe Gly Ile Ala Cys Ile Pro Met Ala145 150
155 160Tyr Phe Thr Ala Lys Glu Leu Lys Leu Thr
Arg Pro Ala Val Trp Phe 165 170
175Val Thr Leu Met Val Leu Cys Glu Asn Ser Tyr Thr Thr Ile Ser Arg
180 185 190Phe Ile Leu Leu Asp
Ser Met Leu Leu Cys Gly Thr Phe Ala Thr Thr 195
200 205Leu Cys Trp Ala Lys Phe His Asn Gln Arg His Asn
Ser Phe Glu Pro 210 215 220Glu Trp Phe
Phe Trp Leu Phe Met Thr Gly Leu Ser Ile Gly Cys Val225
230 235 240Cys Ser Val Lys Leu Val Gly
Leu Phe Val Thr Ala Leu Val Gly Leu 245
250 255Tyr Thr Ile Glu Asp Leu Trp Arg Lys Tyr Gly Asp
Arg Lys Met Pro 260 265 270Ile
Pro Val Leu Ala Ala His Phe Ser Ala Arg Val Val Gly Leu Ile 275
280 285Ile Val Pro Phe Leu Ile Tyr Met Leu
Ser Phe Ala Leu His Phe Ala 290 295
300Ile Leu Asp His Ser Gly Pro Gly Asp Ala Gln Met Ser Ser Leu Phe305
310 315 320Gln Ala Asn Leu
Lys Gly Thr Glu Val Gly Lys Asn Ser Pro Leu Glu 325
330 335Ile Ala Leu Gly Ser Arg Ala Thr Ile Lys
Asn Met Gly Tyr Gly Gly 340 345
350Gly Leu Leu His Ser His Val Gln Thr Tyr Pro Glu Gly Ser Gly Gln
355 360 365Gln Gln Val Thr Cys Tyr His
His Lys Asp Ala Asn Asn Asp Trp Phe 370 375
380Phe Tyr Pro Asn Arg His Glu Pro Asp Tyr Asp Pro Glu Gly Glu
Leu385 390 395 400Arg Phe
Ile Gly Asp Gly Ser Val Ile Arg Leu Ile His Ala Gln Thr
405 410 415Gly Arg Asn Leu His Ser His
Asp Ile Asp Ala Pro Ile Thr Lys Ser 420 425
430His Arg Glu Val Ser Ser Tyr Gly Asn Leu Thr Val Gly Asp
Glu Lys 435 440 445Asp His Trp Lys
Ile Glu Val Val Arg Asp Ala Ala Ser Arg Asp Arg 450
455 460Ser Arg Ile Arg Thr Leu Thr Thr Ala Phe Arg Leu
Lys His Thr Val465 470 475
480Leu Gly Cys Tyr Leu Arg Ala Gly Asn Val Asn Leu Pro Gln Trp Gly
485 490 495Phe Lys Gln Ile Glu
Val Thr Cys Asp Lys Gln Asn Asn Pro Arg Asp 500
505 510Thr Tyr Thr His Trp Asn Val Glu Ala His Trp Asn
Asp Arg Leu Pro 515 520 525Pro Ser
Asp Pro Gly Val Tyr Lys Ser Pro Phe Ile His Asp Phe Ile 530
535 540His Leu Asn Val Ala Met Met Thr Ser Asn Asn
Ala Leu Val Pro Asp545 550 555
560Pro Asp Lys Gln Asp Asp Leu Ala Ser Gln Trp Trp Gln Trp Pro Ile
565 570 575Leu His Val Gly
Leu Arg Met Cys Ser Trp Asp Asp Asn Ile Val Lys 580
585 590Tyr Phe Leu Leu Gly Asn Pro Phe Val Tyr Trp
Ala Ser Thr Ala Ser 595 600 605Leu
Gly Ala Val Ala Leu Val Ile Ala Trp Tyr Val Val Arg Trp Gln 610
615 620Arg Gly Phe Lys Glu Leu Ser Asn Ser Glu
Val Asp Gln Ile His Tyr625 630 635
640Ala Gly Ile Tyr Pro Val Ile Gly Trp Phe Leu His Tyr Leu Pro
Phe 645 650 655Val Ile Met
Ala Arg Val Thr Tyr Val His His Tyr Tyr Pro Ala Leu 660
665 670Tyr Phe Ala Ile Leu Ser Leu Gly Phe Leu
Val Asp Trp Val Leu Arg 675 680
685Asn Arg Ala Ala Val Val Gln Gly Val Ala Tyr Gly Ile Leu Tyr Thr 690
695 700Val Val Ile Gly Leu Tyr Ile Leu
Phe Met Pro Ile Cys Trp Gly Met705 710
715 720Thr Gly Ser Ser Lys Gln Tyr Ser Tyr Leu Lys Trp
Phe Asp Asn Trp 725 730
735Arg Ile Ser Asp 7405775PRTAspergillus oryzae 5Met Ser Gln
Ser Pro Ser Pro Ser Leu Arg Lys Arg Gly Gly Lys Lys1 5
10 15Glu Ala Ser Pro Gly Pro Ser Glu Val
Ser Ser Pro Tyr Pro Thr Asn 20 25
30Gln Gly Ala Thr Pro Lys Pro Gln Ser Glu Trp Asp Tyr Arg Leu Ala
35 40 45Ile Thr Val Leu Thr Val Leu
Ala Phe Ile Thr Arg Phe Tyr Arg Ile 50 55
60Ser Tyr Pro Asp Glu Val Val Phe Asp Glu Val His Phe Gly Lys Phe65
70 75 80Ala Ser Tyr Tyr
Leu Gln Arg Thr Tyr Phe Phe Asp Val His Pro Pro 85
90 95Phe Gly Lys Leu Leu Phe Ala Ala Val Gly
Trp Leu Ile Gly Tyr Asp 100 105
110Gly His Phe Leu Phe Glu Asn Ile Gly Asp Ser Tyr Ile Asp Asn Lys
115 120 125Val Pro Tyr Val Ala Phe Arg
Ala Leu Pro Ala Thr Leu Gly Ala Leu 130 135
140Thr Val Pro Val Val Phe Leu Ile Met Trp Glu Ser Gly Tyr Ser
Leu145 150 155 160Pro Ala
Cys Val Leu Ala Ala Gly Leu Val Leu Phe Asp Asn Ala His
165 170 175Ile Gly Glu Asp Arg Leu Ile
Leu Leu Asp Ala Thr Leu Val Ile Thr 180 185
190Met Ala Leu Ser Ile Leu Cys Tyr Val Arg Phe Tyr Lys Leu
Arg His 195 200 205Glu Pro Phe Gly
Arg Lys Trp Trp Lys Trp Leu Leu Leu Thr Gly Val 210
215 220Ser Leu Ser Cys Val Ile Ser Thr Lys Tyr Val Gly
Val Phe Thr Phe225 230 235
240Val Thr Ile Gly Ala Ala Val Met Val Asp Leu Trp Asn Leu Leu Asp
245 250 255Ile Arg Arg Pro Ala
Gly Ala Leu Ser Met Met Glu Trp Thr Lys His 260
265 270Phe Ala Ala Arg Gly Phe Ala Leu Ile Val Val Pro
Phe Phe Phe Tyr 275 280 285Leu Phe
Trp Phe Gln Val His Phe Ala Ile Leu Thr Arg Ser Gly Pro 290
295 300Gly Asp Asp Phe Met Thr Pro Glu Phe Gln Glu
Thr Leu Ser Asp Asn305 310 315
320Ala Leu Ala Ala Glu Ser Ile Gly Ile Gln Tyr Tyr Asp Ala Ile Thr
325 330 335Ile Arg His Lys
Asp Thr Lys Val Phe Leu His Ser His Trp Glu Arg 340
345 350Tyr Pro Leu Arg Tyr Asp Asp Gly Arg Ile Ser
Ser Gln Gly Gln Gln 355 360 365Val
Thr Gly Tyr Pro Phe Asn Asp Thr Asn Asn Gln Trp Gln Ile Leu 370
375 380Pro Thr Val Pro Leu Glu Asp Asn Glu Gly
Gln Gly His Ser Val Lys385 390 395
400Asn Gly Asp Leu Val Gln Leu Leu His Leu Gly Thr Asp Ser Ile
Leu 405 410 415Leu Thr His
Asp Val Ala Ser Pro Phe Tyr Pro Thr Asn Gln Glu Phe 420
425 430Thr Thr Val Thr Lys Asp Val Ala Ser Gly
Glu Arg His Asn Glu Thr 435 440
445Leu Phe Glu Ile Lys Ile Glu Asn Gly Lys Ala Gly Gln Glu Phe Arg 450
455 460Thr Leu Ser Ser His Phe Lys Leu
Ile His Tyr Pro Thr Arg Val Ala465 470
475 480Met Trp Thr His Thr Thr Pro Leu Pro Glu Trp Gly
Phe Lys Gln Ala 485 490
495Glu Ile Asn Gly Asn Lys Asn Val Leu Gln Thr Ser Asn Leu Trp Tyr
500 505 510Ala Glu Ser Ile Glu Ser
Leu Glu Glu Asp Ser Pro Arg Lys Gln Lys 515 520
525Glu Glu Arg Lys Val Lys Gln Leu Pro Phe Leu Arg Lys Tyr
Leu Glu 530 535 540Leu Gln Arg Ala Met
Phe Phe His Asn Asn Ala Leu Thr Ser Ser His545 550
555 560Pro Tyr Ala Ser Glu Pro Phe Gln Trp Pro
Phe Leu Leu Arg Gly Val 565 570
575Ser Phe Trp Thr Lys Asn Asp Thr Arg Glu Gln Ile Tyr Phe Leu Gly
580 585 590Asn Pro Ile Gly Trp
Trp Ile Ala Ser Ser Leu Leu Ala Val Phe Ala 595
600 605Gly Val Ile Gly Ala Asp Gln Leu Ser Leu Arg Arg
Gly Val Asp Ala 610 615 620Val Glu Glu
Ile Trp Gly Pro Gly Ala Arg Ser Arg Leu Tyr Asn Ser625
630 635 640Thr Gly Phe Leu Phe Leu Cys
Trp Gly Ala His Tyr Phe Pro Phe Trp 645
650 655Leu Met Gly Arg Gln Arg Phe Leu His His Tyr Leu
Pro Ala His Leu 660 665 670Ala
Ser Cys Leu Val Thr Gly Ala Leu Ile Glu Phe Ile Phe Asn Leu 675
680 685Gln Pro Val Gln Ala Val Ile Asp Ser
Glu Val Asp Pro Ser Gly Lys 690 695
700Ser Lys Ser Ile Arg Pro Arg His Phe Val Thr Ala Lys Glu Arg Met705
710 715 720Ser Arg Lys Ser
Leu Val Ala Cys Trp Ile Ala Thr Leu Ser Ile Leu 725
730 735Ala Val Thr Val Trp Gly Phe Trp Phe Tyr
Ala Pro Leu Thr Tyr Gly 740 745
750Thr Pro Gly Leu Asp Val Ala Gly Val Asn Ala Arg Arg Trp Leu Gly
755 760 765Tyr Asp Leu His Phe Ala Lys
770 7756775PRTAspergillus niger 6Met Ser Ser Ser Pro Ser
Pro Ser Leu Arg Lys Arg Gly Gly Lys Lys1 5
10 15Glu Ser Thr Pro Val Pro Ala Asp Asn Phe Ser Ser
Pro Leu Ser Lys 20 25 30Ala
Ser Ala Pro Arg Ser Glu Trp Asp Tyr Trp Leu Ala Ile Ser Ile 35
40 45Leu Thr Val Leu Ala Phe Val Thr Arg
Phe Tyr Lys Ile Ser Tyr Pro 50 55
60Asn Glu Val Val Phe Asp Glu Val His Phe Gly Lys Phe Ala Ser Tyr65
70 75 80Tyr Leu Gln Arg Thr
Tyr Phe Phe Asp Val His Pro Pro Phe Gly Lys 85
90 95Leu Leu Phe Ala Phe Met Gly Trp Leu Val Gly
Tyr Asp Gly His Phe 100 105
110Leu Phe Asp Asn Ile Gly Asp Ser Tyr Ile Glu His Gln Val Pro Tyr
115 120 125Val Ala Leu Arg Ala Met Pro
Ala Thr Leu Gly Ala Leu Thr Val Pro 130 135
140Val Val Phe Leu Ile Met Trp Glu Ser Gly Tyr Ser Leu Pro Ala
Cys145 150 155 160Val Leu
Ser Ala Gly Leu Val Leu Phe Asp Asn Ala His Ile Gly Glu
165 170 175Asp Arg Leu Ile Leu Leu Asp
Ala Ser Leu Val Leu Thr Met Ala Leu 180 185
190Ser Ile Leu Cys Tyr Ile Arg Phe Tyr Lys Leu Arg His Glu
Ala Phe 195 200 205Gly Arg Lys Trp
Trp Lys Trp Leu Leu Leu Thr Gly Val Ser Leu Ser 210
215 220Cys Val Ile Ser Thr Lys Tyr Val Gly Val Phe Thr
Phe Val Thr Ile225 230 235
240Gly Ser Ala Val Met Val Asp Leu Trp Asn Leu Leu Asp Ile Arg Arg
245 250 255Arg Gly Gly Ala Leu
Thr Met Phe Gln Trp Gly Gln His Phe Val Ala 260
265 270Arg Ala Phe Ala Leu Ile Ile Val Pro Phe Phe Phe
Tyr Leu Phe Trp 275 280 285Phe Gln
Val His Phe Ala Ile Leu Thr Arg Ser Gly Pro Gly Asp Asp 290
295 300Phe Met Thr Pro Glu Phe Gln Glu Thr Leu Ser
Asp Asn Val Leu Ser305 310 315
320Ala Gln Ser Ile Gly Ile Glu Tyr Tyr Asp Thr Ile Thr Met Lys His
325 330 335Lys Asp Thr Lys
Val Tyr Leu His Ser His Leu Glu Arg Tyr Pro Leu 340
345 350Arg Tyr Asp Asp Gly Arg Ile Ser Ser Gln Gly
Gln Gln Val Thr Gly 355 360 365Tyr
Pro Tyr Asn Asp Thr Asn Asn Gln Trp Gln Ile Ile Pro Thr Val 370
375 380Pro Leu Asp Val Thr Asp Thr Ser Gly His
Lys Val Arg Asn Gly Asp385 390 395
400Val Val Gln Leu Arg His Met Gly Thr Asp Thr Ile Leu Leu Thr
His 405 410 415Asp Val Ala
Ser Pro Tyr Tyr Pro Thr Asn Gln Glu Phe Thr Thr Val 420
425 430Ser His Glu Val Ala Asn Gly Asp Arg His
Asn Asp Thr Leu Phe Glu 435 440
445Ile Lys Ile Glu Asn Gly Lys Pro His Gln Glu Phe Arg Thr Leu Ser 450
455 460Ser His Phe Lys Leu Ile His Met
Pro Thr Arg Val Ala Met Trp Thr465 470
475 480His Thr Thr Pro Leu Pro Asp Trp Ala Phe Lys Gln
Ala Glu Ile Asn 485 490
495Gly Asn Lys Asn Ile Leu Gln Thr Ser Asn Leu Trp Phe Val Glu Ser
500 505 510Ile Glu Ser Leu Glu Glu
Asp Ser Pro Arg Leu Val Lys Glu Glu Arg 515 520
525Gln Val Lys His Leu Pro Phe Phe Arg Lys Tyr Leu Glu Leu
Gln Arg 530 535 540Ala Met Phe Phe His
Asn Asn Ala Leu Thr Ser Ser His Pro Tyr Ala545 550
555 560Ser Glu Pro Phe Gln Trp Pro Phe Leu Leu
Arg Gly Val Ser Phe Trp 565 570
575Thr Lys Asn Asp Thr Arg Glu Gln Ile Tyr Phe Leu Gly Asn Pro Val
580 585 590Gly Trp Trp Ile Ala
Ser Ser Leu Leu Ala Val Phe Ala Gly Val Ile 595
600 605Gly Ala Asp Gln Leu Ser Leu Arg Arg Gly Val Asp
Ala Val Glu Glu 610 615 620Ile Trp Gly
Gln Gly Ser Arg Ser Arg Leu Tyr Asn Ser Met Gly Phe625
630 635 640Leu Phe Leu Cys Trp Ala Ala
His Tyr Phe Pro Phe Trp Leu Met Gly 645
650 655Arg Gln Arg Phe Leu His His Tyr Leu Pro Ala His
Leu Ala Ser Ala 660 665 670Leu
Val Ala Gly Ala Leu Ile Glu Phe Ile Phe Asn Leu Glu Pro Leu 675
680 685Ser Val Ile Gln Arg Val Arg Ser Glu
Asp Asp Pro Ser Gly Lys Ala 690 695
700Lys Ala Ser Ala Ser Val Gly Arg Phe Val Thr Ala Lys Glu Arg Met705
710 715 720Gly Thr Lys Ser
Leu Leu Ala Gly Trp Ile Ala Thr Leu Val Ile Leu 725
730 735Ala Gly Thr Ile Tyr Gly Phe Val Phe Tyr
Ala Pro Leu Thr Tyr Gly 740 745
750Thr Pro Gly Leu Asp Val Pro Gly Ile Leu Ala Arg Lys Trp Leu Gly
755 760 765Tyr Asp Leu His Phe Ala Lys
770 7757773PRTAspergillus nidulans 7Met Ser Ser Ser Pro
Ser Leu Arg Lys Arg Gly Gly Lys Arg Glu Asp1 5
10 15Thr Pro Val Pro Ser Asp Arg Ser Phe Ala Pro
Ser Ala Ser Gln Leu 20 25
30Gly Ala Ala Ser Arg Ser Ser Glu Trp Asp Tyr Arg Leu Ala Ile Thr
35 40 45Ile Leu Thr Val Leu Ala Phe Ile
Thr Arg Phe Tyr Lys Ile Ser Tyr 50 55
60Pro Asp Gln Val Val Phe Asp Glu Val His Phe Gly Lys Phe Ala Ser65
70 75 80Tyr Tyr Leu Arg Arg
Thr Tyr Phe Phe Asp Val His Pro Pro Phe Ala 85
90 95Lys Leu Leu Leu Ala Phe Thr Gly Trp Leu Val
Gly Tyr Asp Gly His 100 105
110Phe Leu Phe Glu Asn Ile Gly Asp Ser Tyr Ile Asp Asn Lys Val Pro
115 120 125Tyr Val Ala Leu Arg Ala Met
Pro Ala Val Leu Gly Ala Leu Thr Ile 130 135
140Pro Val Val Phe Leu Ile Met Trp Glu Ser Gly Tyr Ser Leu Pro
Ala145 150 155 160Cys Val
Leu Ala Ser Gly Leu Val Leu Phe Asp Asn Ala His Val Gly
165 170 175Glu Asp Arg Leu Ile Leu Leu
Asp Ser Thr Leu Val Ile Thr Met Ala 180 185
190Leu Ser Ile Leu Cys Tyr Ile Arg Phe Tyr Lys Leu Arg His
Glu Pro 195 200 205Phe Gly Arg Lys
Trp Trp Lys Trp Leu Leu Leu Thr Gly Val Ser Leu 210
215 220Ser Cys Val Ile Ser Thr Lys Tyr Val Gly Val Phe
Thr Phe Val Thr225 230 235
240Ile Gly Ser Ala Val Met Val Asp Leu Trp Asn Leu Leu Asp Ile Arg
245 250 255Arg Gln Gly Gly Ala
Leu Thr Met Phe Glu Trp Thr Lys His Phe Ala 260
265 270Ala Arg Phe Phe Ser Leu Ile Val Val Pro Phe Phe
Phe Tyr Leu Phe 275 280 285Trp Phe
Gln Val His Phe Ala Ile Leu Thr His Ser Gly Pro Gly Asp 290
295 300Asp Phe Met Thr Pro Ala Phe Gln Glu Thr Leu
Ser Asp Asn Ala Met305 310 315
320Ala Ala Gln Ser Val Ser Ile Glu Tyr Phe Asp Thr Ile Thr Met Arg
325 330 335His Lys Asp Thr
Lys Val Phe Leu His Ser His Ser Asp Thr Tyr Pro 340
345 350Leu Arg Tyr Asp Asp Gly Arg Ile Ser Ser Gln
Gly Gln Gln Val Thr 355 360 365Gly
Tyr Pro Tyr Asn Asp Thr Asn Asn His Trp Gln Ile Ile Pro Thr 370
375 380Val Pro Leu Asp Glu Thr Asp Glu Lys Ser
Arg Lys Val Arg Asn Gly385 390 395
400Asp Ile Val Gln Leu Arg His Val Ala Thr Asp Thr Ile Leu Leu
Thr 405 410 415His Asp Val
Ala Ser Pro Tyr Tyr Pro Thr Asn Gln Glu Phe Thr Thr 420
425 430Val Ser His Glu Leu Ala Asp Gly Lys Arg
His Asn Asp Thr Leu Phe 435 440
445Glu Ile Arg Val Glu His Gly Lys Ser Lys Gln Glu Phe Arg Thr Leu 450
455 460Ser Ser Gln Phe Lys Leu Val His
Val Pro Thr Lys Val Ala Met Trp465 470
475 480Thr His Thr Thr Pro Leu Pro Asp Trp Ala Tyr Lys
Gln Ala Glu Ile 485 490
495Asn Gly Asn Lys Asn Val Leu Gln Ser Ser Asn Ile Trp Tyr Val Glu
500 505 510Ala Ile Glu Ser Leu Glu
Glu Asp Ser Pro Arg Leu Lys Lys Glu Glu 515 520
525Arg Lys Val Lys His Leu Pro Phe Trp Arg Lys Tyr Ile Glu
Leu Gln 530 535 540Arg Ala Met Phe Phe
His Asn Asn Ala Leu Thr Ser Ser His Pro Tyr545 550
555 560Ala Ser Glu Pro Phe Gln Trp Pro Phe Leu
Leu Arg Gly Val Ser Phe 565 570
575Trp Thr Lys Ser Asp Thr Arg Glu Gln Ile Tyr Phe Leu Gly Asn Pro
580 585 590Val Gly Trp Trp Ile
Ser Ser Ser Leu Leu Ala Val Phe Ala Gly Val 595
600 605Ile Gly Ala Asp Gln Leu Ser Leu Arg Arg Gly Val
Asp Ala Val Glu 610 615 620Glu Ile Trp
Gly Pro Gly Ser Arg Ser Arg Leu Tyr Asn Ser Thr Gly625
630 635 640Phe Leu Phe Leu Cys Trp Ala
Ala His Tyr Phe Pro Phe Trp Leu Met 645
650 655Gly Arg Gln Arg Phe Leu His His Tyr Leu Pro Ala
His Val Ala Ser 660 665 670Ala
Leu Val Thr Gly Ala Leu Ile Glu Phe Ile Phe Asn Ile Gln Pro 675
680 685Ile Ser Val Pro Ala Thr Ile Pro Val
Ala Ala Asp Asp Pro Thr Gly 690 695
700Lys Gly Lys Thr Arg Arg Phe Val Thr Ala Arg Glu Arg Met Gly Val705
710 715 720Lys Ser Ile Val
Ala Gly Trp Ile Ala Ser Leu Thr Ile Leu Ala Ala 725
730 735Thr Ile Trp Gly Phe Trp Phe Phe Ala Pro
Leu Thr Tyr Gly Thr Pro 740 745
750Gly Leu Asp Val Ala Gln Val Asn Ala Arg Lys Trp Leu Gly Tyr Asp
755 760 765Leu His Phe Ala Lys
7708774PRTTrichoderma virens 8Met Ala Arg Thr Pro Thr Pro Gln Pro Pro Ser
Leu Arg Gln Arg Asn1 5 10
15Val Ala Ser Lys Gln Pro Val Ser Glu Ala Thr Phe Ala Pro Glu Val
20 25 30Glu Leu Asp Lys Leu Ser Lys
Ala Ala Ala Ser Ser Arg Gln Asn Ile 35 40
45Gln Arg Gly Glu Thr Glu His Arg Val Ala Leu Thr Leu Val Thr
Ile 50 55 60Leu Gly Phe Val Thr Arg
Phe Trp Gly Ile Ser His Pro Asp Glu Val65 70
75 80Val Phe Asp Glu Val His Phe Gly Lys Phe Ala
Ser Tyr Tyr Leu Gln 85 90
95Arg Thr Tyr Phe Phe Asp Val His Pro Pro Phe Ala Lys Leu Leu Phe
100 105 110Ala Phe Val Gly Trp Leu
Val Gly Tyr Asp Gly His Phe His Phe Glu 115 120
125Asn Ile Gly Asp Ser Tyr Ile Ala Asn Lys Val Pro Tyr Val
Ala Phe 130 135 140Arg Ala Leu Pro Ala
Phe Leu Gly Ala Leu Thr Val Ser Val Thr Tyr145 150
155 160Leu Ile Met Trp Glu Ser Gly Tyr Ser Val
Pro Ala Cys Leu Val Ala 165 170
175Thr Gly Leu Ile Leu Leu Asp Asn Ala His Ile Gly Gln Thr Arg Leu
180 185 190Ile Leu Leu Asp Ala
Thr Leu Val Leu Ala Met Ala Cys Ser Leu Leu 195
200 205Phe Tyr Ile Lys Phe Tyr Lys Leu Arg His Glu Pro
Phe Ser Arg Lys 210 215 220Trp Trp Lys
Trp Leu Val Leu Thr Gly Phe Ala Leu Ser Cys Asp Ile225
230 235 240Ser Thr Lys Tyr Val Gly Leu
Phe Ala Phe Val Thr Ile Gly Ser Ala 245
250 255Val Ile Ile Asp Leu Trp Glu Leu Leu Asp Ile Arg
Arg Pro Gly Gly 260 265 270Ala
Ile Ser Leu Pro Leu Phe Gly Lys His Phe Ala Ala Arg Ala Val 275
280 285Gly Leu Ile Ile Leu Pro Phe Leu Phe
Tyr Leu Phe Trp Phe Gln Val 290 295
300His Phe Ala Val Leu Thr Arg Ser Gly Pro Gly Asp Asp Phe Met Ser305
310 315 320Pro Glu Phe Gln
Glu Thr Leu Ser Asp Asn Val Met Leu Ala Ser Ala 325
330 335Val Asp Ile Gln Tyr Tyr Asp Thr Ile Thr
Ile Arg His Lys Glu Thr 340 345
350Lys Ala Tyr Leu His Ser His Leu Asp Thr Tyr Pro Leu Arg Tyr Asp
355 360 365Asp Gly Arg Ile Ser Ser Gln
Gly Gln Gln Val Thr Gly Tyr Pro His 370 375
380Asn Asp Thr Asn Asn Tyr Trp Gln Ile Ile Pro Ala Ser Asn Asp
Gln385 390 395 400Lys Leu
Gly Arg Ile Val Arg Asn Gln Glu Leu Val Arg Leu Arg His
405 410 415Ile Val Thr Asp Lys Ile Leu
Leu Ser His Asp Val Ala Ser Pro Tyr 420 425
430Tyr Pro Thr Asn Gln Glu Phe Thr Ala Val Ser Ala Glu Glu
Ala Tyr 435 440 445Gly Asp Arg Leu
Asn Asp Thr Leu Phe Glu Ile Arg Ile Glu Gly Gly 450
455 460Lys Pro Asn Gln Asp Phe Lys Thr Ile Ala Ser His
Phe Lys Leu Ile465 470 475
480His Phe Pro Ser Lys Val Ala Met Trp Thr His Thr Thr Pro Leu Pro
485 490 495Glu Trp Ala Tyr Arg
Gln Gln Glu Ile Asn Gly Asn Lys Gln Ile Thr 500
505 510Pro Ser Ser Asn Val Trp Ile Ala Glu Asp Ile Pro
Ser Leu Pro Glu 515 520 525Asp His
Ser Arg Arg Gln Lys Glu Glu Arg Lys Val Lys Ser Leu Pro 530
535 540Phe Leu Arg Lys Trp Phe Glu Leu Gln Arg Ser
Met Phe Tyr His Asn545 550 555
560Asn Lys Leu Thr Ser Ser His Pro Tyr Ser Ser Gln Pro Tyr His Trp
565 570 575Pro Phe Leu Leu
Arg Gly Val Ser Phe Trp Thr Gln Asn Asp Thr Arg 580
585 590Gln Gln Ile Tyr Phe Val Gly Asn Pro Ile Gly
Trp Trp Leu Ala Ser 595 600 605Gly
Leu Leu Ala Val Phe Ala Gly Ile Ile Gly Ala Asp Gln Val Ser 610
615 620Leu Arg Arg Gly Ile Asp Ala Leu Asp His
Arg Thr Arg Ser Arg Leu625 630 635
640Tyr Asn Ser Thr Gly Phe Phe Trp Leu Ala Trp Ala Thr His Tyr
Phe 645 650 655Pro Phe Phe
Leu Met Gly Arg Gln Leu Phe Leu His His Tyr Leu Pro 660
665 670Ala His Leu Ala Ser Cys Leu Val Thr Gly
Ser Leu Val Glu Phe Ile 675 680
685Phe Asn Thr Asp Pro Ala Asp Glu Glu Pro Ser Arg Ala Thr Asn Pro 690
695 700Arg Ala Ser Gly Pro Lys Arg His
Ile Thr Ala Arg Glu Arg Phe Ala705 710
715 720Gly Lys Ser Met Ala Gly Ala Trp Ile Ala Cys Phe
Val Ile Leu Thr 725 730
735Val Ala Ala Ala Ser Trp Tyr Phe Phe Leu Pro Leu Thr Tyr Gly Tyr
740 745 750Pro Gly Leu Ser Val Asp
Glu Val Asn Arg Arg Lys Trp Leu Gly Tyr 755 760
765Asp Leu His Phe Ala Lys 7709771PRTTrichoderma
atroviride 9Met Ala Arg Ala Ser Thr Pro Gln Gly Ser Leu Arg Gln Arg Gly
Val1 5 10 15Ala Ser Lys
Gln Thr Leu Ser Glu Ser Thr Phe Ala Pro Glu Val Glu 20
25 30Leu Asp Lys Leu Ser Lys Ala Ala Ala Ser
Ser Arg Gln Asn Val Gln 35 40
45Arg Gly Glu Ile Glu His Lys Ile Ala Leu Thr Leu Val Thr Ile Leu 50
55 60Gly Phe Val Thr Arg Phe Trp Gly Ile
Ser His Pro Asp Glu Val Val65 70 75
80Phe Asp Glu Val His Phe Gly Lys Phe Ala Ser Tyr Tyr Leu
Gln Arg 85 90 95Thr Tyr
Phe Phe Asp Val His Pro Pro Phe Ala Lys Leu Leu Phe Ala 100
105 110Phe Val Gly Trp Leu Val Gly Tyr Asp
Gly His Phe His Phe Glu Asn 115 120
125Ile Gly Asp Ser Tyr Val Ala Asn Lys Val Pro Tyr Val Ala Phe Arg
130 135 140Ala Leu Pro Ala Val Leu Gly
Ala Leu Thr Val Ser Val Thr Tyr Leu145 150
155 160Ile Met Trp Glu Ser Gly Tyr Ser Leu Pro Ala Cys
Leu Val Ala Thr 165 170
175Gly Leu Ile Leu Leu Asp Asn Ala His Ile Gly Gln Thr Arg Leu Ile
180 185 190Leu Leu Asp Ala Thr Leu
Val Leu Ala Met Ala Cys Ser Leu Leu Phe 195 200
205Tyr Ile Lys Phe Tyr Lys Leu Arg His Glu Ala Phe Ser Arg
Lys Trp 210 215 220Trp Lys Trp Leu Ile
Leu Thr Gly Phe Ala Leu Ser Cys Asp Ile Ser225 230
235 240Thr Lys Tyr Val Gly Leu Phe Ala Phe Val
Thr Ile Gly Ser Ala Val 245 250
255Ile Ile Asp Leu Trp Asp Leu Leu Asp Ile Lys Arg Arg Asn Gly Ala
260 265 270Ile Ser Leu Gln Leu
Phe Gly Lys His Phe Ala Ala Arg Ala Ile Gly 275
280 285Leu Ile Val Leu Pro Phe Leu Phe Tyr Leu Phe Trp
Phe Gln Val His 290 295 300Phe Ala Val
Leu Thr Arg Ser Gly Pro Gly Asp Asp Phe Met Thr Pro305
310 315 320Glu Phe Gln Glu Thr Leu Ser
Asp Asn Val Met Leu Ala Asn Ala Val 325
330 335Asp Ile His Tyr Tyr Asp Tyr Ile Thr Ile Arg His
Lys Glu Thr Lys 340 345 350Ala
Tyr Leu His Ser His Pro Asp Thr Tyr Pro Leu Arg Tyr Asp Asp 355
360 365Gly Arg Ile Ser Ser Gln Gly Gln Gln
Ile Thr Gly Tyr Pro His Asn 370 375
380Asp Thr Asn Asn Tyr Trp Gln Val Leu Pro Ser Asp Asn Val His Asn385
390 395 400Thr Glu Arg Ile
Val Arg Asn Phe Asp Leu Val Arg Leu Arg His Ile 405
410 415Val Thr Asp Lys Ile Leu Leu Ser His Asp
Val Ala Ser Pro Tyr Phe 420 425
430Pro Thr Asn Gln Glu Phe Thr Ala Val Thr Ser Glu Glu Ala Phe Gly
435 440 445Glu Arg Gln Asn Asp Thr Leu
Phe Glu Ile Arg Val Glu Thr Ala Lys 450 455
460Val Gly Ala Glu Phe Lys Thr Val Ala Ser His Phe Lys Leu Val
His465 470 475 480Phe Pro
Ser Lys Val Ala Met Trp Thr His Thr Thr Pro Leu Pro Glu
485 490 495Trp Gly Tyr Lys Gln Gln Glu
Ile Asn Gly Asn Lys Gln Val Thr Val 500 505
510Ser Ser Asn Met Trp Ile Ala Glu Asp Ile Pro Ser Leu Pro
Gln Asp 515 520 525Asp Ala Arg Arg
Gln Lys Glu Gln Arg Gln Val Lys Ser Leu Pro Phe 530
535 540Leu Arg Lys Trp Phe Glu Leu Gln Arg Ser Met Phe
Tyr His Asn Asn545 550 555
560Lys Leu Thr Ser Ser His Pro Tyr Ser Ser Gln Pro Tyr His Trp Pro
565 570 575Phe Leu Leu Arg Gly
Val Ser Phe Trp Thr Gln Asn Asp Thr Arg Gln 580
585 590Gln Ile Tyr Phe Val Gly Asn Pro Ile Gly Trp Trp
Ile Thr Ser Ser 595 600 605Leu Leu
Ala Val Phe Ala Gly Ile Ile Ala Ala Asp Gln Ile Ser Leu 610
615 620Arg Arg Asn Ile Asp Ala Leu Asp His Arg Thr
Arg Ser Arg Leu Tyr625 630 635
640Asn Ser Thr Gly Phe Phe Trp Leu Ala Trp Ala Thr His Tyr Phe Pro
645 650 655Phe Tyr Leu Met
Gly Arg Gln Leu Phe Leu His His Tyr Leu Pro Ala 660
665 670His Leu Ala Ser Cys Leu Val Thr Gly Ala Leu
Val Glu Phe Ile Phe 675 680 685Asn
Ser Asp Ala Val Glu Glu Glu Ser Ser Lys Ser Gly Asn Arg Ser 690
695 700Ser Pro Lys Arg His Val Thr Ala Arg Glu
Arg Phe Ala Gly Lys Ser705 710 715
720Met Leu Gly Ala Trp Ile Ala Cys Gly Val Ile Leu Ser Ala Ala
Ala 725 730 735Ala Cys Trp
Tyr Phe Phe Leu Pro Leu Thr Tyr Gly Tyr Pro Gly Leu 740
745 750Ser Val Glu Glu Val Val Arg Arg Lys Trp
Leu Gly Tyr Asp Leu His 755 760
765Phe Ala Lys 77010770PRTFusarium oxysporum 10Met Ala Arg Ser Ser Thr
Pro Gln Gly Ser Leu Arg Gln Arg Gly Ala1 5
10 15Pro Ser Lys Lys Pro Phe Glu Glu Asp Ser Phe Asp
Pro Asn Ile Glu 20 25 30Leu
Asp Lys Leu Ala Lys Ala Gly Ala Gln Arg Ala Ala Ala Gln Ser 35
40 45Glu Thr Glu Tyr Lys Ile Gly Leu Phe
Leu Ile Thr Ile Leu Ser Phe 50 55
60Val Thr Arg Phe Trp Gly Ile Ser His Pro Asn Glu Val Val Phe Asp65
70 75 80Glu Val His Phe Gly
Lys Phe Ala Ser Tyr Tyr Leu Glu Arg Thr Tyr 85
90 95Phe Phe Asp Val His Pro Pro Phe Gly Lys Leu
Leu Phe Ala Phe Val 100 105
110Gly Trp Leu Val Gly Tyr Asp Gly Asn Phe His Phe Glu Asn Ile Gly
115 120 125Asp Ser Tyr Ile Ala Asn Lys
Val Pro Tyr Val Ala Tyr Arg Ala Leu 130 135
140Pro Ala Thr Leu Gly Ala Leu Thr Val Ser Val Thr Tyr Leu Ile
Met145 150 155 160Trp Glu
Ser Gly Tyr Ser Leu Pro Ala Cys Ile Leu Ala Ala Gly Leu
165 170 175Val Leu Leu Asp Asn Ala His
Ile Gly Gln Thr Arg Leu Ile Leu Leu 180 185
190Asp Ala Thr Leu Val Leu Ala Met Ala Cys Ser Leu Leu Phe
Tyr Ile 195 200 205Lys Trp Tyr Lys
Leu Arg His Glu Pro Phe Ser Arg Lys Trp Trp Lys 210
215 220Trp Leu Ile Leu Thr Gly Phe Ala Leu Ser Cys Asp
Ile Ser Val Lys225 230 235
240Tyr Val Gly Val Phe Ala Phe Val Thr Ile Gly Ser Ala Val Val Ile
245 250 255Asp Leu Trp Asp Leu
Leu Asn Ile Asn Arg Pro Gly Gly Ala Ile Ser 260
265 270Leu Gln Glu Phe Thr Lys His Phe Ala Ala Arg Ala
Phe Gly Leu Ile 275 280 285Ile Met
Pro Phe Leu Phe Tyr Leu Phe Trp Phe Gln Val His Phe Ala 290
295 300Val Leu Tyr Arg Ser Gly Pro Gly Asp Asp Phe
Met Thr Pro Glu Phe305 310 315
320Gln Glu Thr Leu Ser Asp Asn Val Met Leu Ala Asn Ser Ile Asp Ile
325 330 335Gln Tyr Tyr Asp
Gln Ile Thr Ile Arg His Lys Glu Thr Lys Thr Tyr 340
345 350Leu His Ser His Glu Asp Arg Tyr Pro Leu Arg
Tyr Asp Asp Gly Arg 355 360 365Val
Ser Ser Gln Gly Gln Gln Ile Thr Gly Tyr Pro Tyr Asn Asp Thr 370
375 380Asn Asn Tyr Trp Glu Ile Leu Pro Ala Asn
Asn Asp Lys Gln Ile Gly385 390 395
400Arg Ile Val Lys Asn His Glu Leu Val Arg Leu Arg His Val Gly
Thr 405 410 415Asp Lys Ile
Leu Leu Ser His Asp Val Ala Ser Pro Tyr Tyr Pro Thr 420
425 430Asn Gln Glu Phe Thr Ala Val Thr Pro Glu
Glu Ala Phe Gly Lys Arg 435 440
445Glu Lys Asp Thr Leu Phe Glu Val Arg Ile Glu His Gly Lys Lys Asn 450
455 460Gln Asn Phe Lys Thr Val Ala Gly
His Phe Lys Leu Ile His Asn Pro465 470
475 480Ser Lys Val Ala Met Trp Thr His Thr Lys Pro Leu
Pro Glu Trp Gly 485 490
495Tyr Lys Gln Gln Glu Ile Asn Gly Asn Lys Gln Ile Ala Pro Ser Ser
500 505 510Asn Val Trp Ile Ala Glu
Asp Ile Pro Ser Leu Pro Ala Asp His Pro 515 520
525Arg Arg Gln Lys Pro Glu Arg Lys Val Lys Ser Leu Pro Phe
Leu Gln 530 535 540Lys Trp Phe Glu Leu
Gln Arg Ala Met Phe Tyr His Asn Ser Lys Leu545 550
555 560Thr Ser Ser His Pro Tyr Ala Ser His Pro
Tyr Gln Trp Pro Phe Leu 565 570
575Leu Arg Gly Val Ser Phe Trp Thr Gln Ser Glu Thr Arg Gln Gln Ile
580 585 590Tyr Phe Leu Gly Asn
Pro Ile Gly Trp Trp Leu Ala Ser Ser Leu Leu 595
600 605Ala Val Tyr Ala Gly Ile Leu Leu Ala Asp Gln Val
Ser Leu Arg Arg 610 615 620Gly Val Asp
Ala Leu Asp Arg Arg Thr Arg Ser Arg Leu Tyr Asn Ser625
630 635 640Thr Gly Phe Phe Phe Leu Ala
Trp Ala Thr His Tyr Phe Pro Phe Phe 645
650 655Leu Met Gly Arg Gln Leu Phe Leu His His Tyr Leu
Pro Ala His Leu 660 665 670Ala
Ser Cys Leu Val Ala Gly Ala Leu Leu Glu Phe Ile Phe Asn Ser 675
680 685Glu Ala Pro Glu Glu Val Thr Ile Lys
Asp Lys Lys Gly Pro Val Ser 690 695
700Pro Arg His His Val Thr Ala Arg Glu Arg Phe Ala Gly Gln Ser Met705
710 715 720Leu Gly Ala Trp
Ile Ala Cys Gly Val Ile Leu Ser Leu Ile Ile Ala 725
730 735Gly Trp Tyr Phe Phe Leu Pro Leu Thr Tyr
Gly Tyr Pro Gly Leu Ser 740 745
750Val Asp Ala Ile Leu Arg Arg Lys Trp Leu Gly Tyr Asp Leu His Phe
755 760 765Ala Lys
77011788PRTGibberella zeae 11Met Ala Arg Ser Ser Ser Pro Ser Gln Gly Ser
Leu Arg Gln Arg Gly1 5 10
15Ala Pro Ser Lys Lys Pro Ser Glu Glu Ser Phe Asn Pro Asn Pro Glu
20 25 30Leu Asp Lys Leu Ala Lys Ala
Gly Ala Gln Arg Ala Ala Ala Gln Ser 35 40
45Glu Thr Glu His Lys Ile Gly Leu Ala Val Ile Thr Ile Leu Ser
Phe 50 55 60Val Thr Arg Phe Trp Gly
Ile Ser His Pro Asn Glu Val Val Phe Asp65 70
75 80Glu Val His Phe Gly Lys Phe Ala Ser Tyr Tyr
Leu Glu Arg Thr Tyr 85 90
95Phe Phe Asp Val His Pro Pro Phe Gly Lys Leu Leu Phe Ala Phe Val
100 105 110Gly Trp Leu Val Gly Tyr
Asp Gly His Phe His Phe Asp Asn Ile Gly 115 120
125Asp Ser Tyr Ile Ala Asn Lys Ile Pro Tyr Val Ala Phe Arg
Ala Leu 130 135 140Pro Ala Thr Leu Gly
Ala Leu Thr Val Ala Val Thr Tyr Leu Ile Met145 150
155 160Trp Glu Ser Gly Tyr Ser Leu Pro Ala Cys
Val Leu Ala Ala Gly Leu 165 170
175Leu Leu Leu Asp Asn Ala His Ile Gly Gln Thr Arg Leu Ile Leu Leu
180 185 190Asp Ala Thr Leu Val
Leu Ala Met Ala Cys Ser Leu Leu Phe Tyr Ile 195
200 205Lys Trp Tyr Lys Leu Arg His Glu Pro Phe Ser Arg
Lys Trp Trp Lys 210 215 220Trp Leu Ile
Leu Thr Gly Phe Ala Leu Ser Cys Asp Ile Ser Val Lys225
230 235 240Tyr Val Gly Val Phe Ala Phe
Val Thr Ile Gly Cys Ala Val Val Ile 245
250 255Asp Leu Trp Asp Leu Leu Asn Ile Asn Arg Pro Gly
Gly Ala Ile Ser 260 265 270Met
Gln Glu Phe Gly Lys His Phe Ala Ala Arg Ala Phe Gly Leu Ile 275
280 285Val Leu Pro Phe Leu Phe Tyr Leu Phe
Trp Phe Gln Val His Phe Ala 290 295
300Val Leu Tyr Arg Ser Gly Pro Gly Asp Asp Phe Met Thr Pro Glu Phe305
310 315 320Gln Glu Thr Leu
Ser Asp Asn Val Met Leu Ala Asn Ala Ile Asp Ile 325
330 335Gln Tyr Tyr Asp Ser Ile Thr Ile Arg His
Lys Glu Thr Lys Thr Tyr 340 345
350Leu His Ser His Glu Asp Arg Tyr Pro Leu Arg Tyr Asp Asp Gly Arg
355 360 365Val Ser Ser Gln Gly Gln Gln
Ile Thr Gly Tyr Pro Tyr Asn Asp Thr 370 375
380Asn Asn Tyr Trp Glu Ile Trp Pro Ala Asp Asn Asn Lys Thr Pro
Gly385 390 395 400Arg Ile
Val Lys Asn His Asp Leu Val Arg Leu Arg His Val Gly Thr
405 410 415Asp Lys Ile Leu Leu Ser His
Asp Val Ala Ser Pro Tyr Tyr Pro Thr 420 425
430Asn Gln Glu Phe Thr Ala Val Thr Pro Glu Glu Ala Leu Gly
Lys Arg 435 440 445Glu Lys Glu Thr
Leu Phe Glu Val Arg Leu Glu His Gly Lys Lys Asn 450
455 460Gln Asn Phe Lys Ser Val Ala Gly His Phe Lys Leu
Ile His Asn Pro465 470 475
480Ser Lys Val Ala Met Trp Thr His Thr Lys Pro Leu Pro Glu Trp Gly
485 490 495Tyr Lys Gln Gln Glu
Ile Asn Gly Asn Lys Gln Ile Ala Pro Ser Ser 500
505 510Asn Val Trp Ile Ala Glu Asp Ile Ala Ser Leu Glu
Ala Asp His Pro 515 520 525Arg Arg
Gln Lys Pro Glu Arg Lys Val Lys Ser Leu Pro Phe Leu Gln 530
535 540Lys Trp Phe Glu Leu Gln Arg Ala Met Phe Tyr
His Asn Ser Lys Leu545 550 555
560Thr Ser Ser His Pro Tyr Ala Ser His Pro Tyr Gln Trp Pro Phe Leu
565 570 575Leu Arg Gly Val
Ser Phe Trp Thr Gln Ser Glu Thr Arg Gln Gln Ile 580
585 590Tyr Phe Leu Gly Asn Pro Val Gly Trp Trp Leu
Ala Ser Ser Leu Leu 595 600 605Ala
Val Tyr Ala Gly Ile Leu Leu Ala Asp Gln Val Ser Leu Arg Arg 610
615 620Gly Ile Asp Ala Leu Asp Arg Arg Lys Leu
Met Leu Gln Ser Gln Leu625 630 635
640Met Asn Pro Thr Leu Thr Asn Ser Lys Gly Thr Arg Ser Arg Leu
Tyr 645 650 655Asn Ser Thr
Gly Phe Phe Phe Leu Ala Trp Ala Thr His Tyr Phe Pro 660
665 670Phe Phe Leu Met Gly Arg Gln Leu Phe Leu
His His Tyr Leu Pro Ala 675 680
685His Leu Ala Ser Cys Leu Val Ala Gly Ala Leu Leu Glu Phe Ile Phe 690
695 700Asn Ser Glu Pro Ala Glu Glu Ile
Thr Ile Lys Asp Lys Lys Gly Pro705 710
715 720Val Ser Pro Arg His His Val Thr Ala Arg Glu Arg
Phe Ser Gly Gln 725 730
735Ser Met Ala Ser Ala Trp Ile Ala Cys Gly Val Val Leu Ala Leu Val
740 745 750Val Ala Gly Trp Tyr Phe
Phe Leu Pro Leu Thr Tyr Gly Tyr Pro Gly 755 760
765Leu Ser Val Glu Ala Ile Leu Arg Arg Lys Trp Leu Gly Tyr
Asp Leu 770 775 780His Phe Ala
Lys78512775PRTMyceliophthora thermophila 12Met Ala Ser Thr Ser Thr Pro
Gln Gly Thr Leu Arg Gln Arg Asn Val1 5 10
15Gly Val Ser Thr Lys Lys Pro Lys Asp Gly Ala Ser Ser
Asp Val Glu 20 25 30Leu Asp
Lys Leu Val Lys Ala Ala Ala Glu Lys Ser Ser Lys Asn Ser 35
40 45Glu Arg Asp Phe Lys Val Val Phe Val Val
Met Thr Ala Leu Ala Phe 50 55 60Leu
Thr Arg Phe Trp Gly Ile Ser His Pro Asn Glu Val Val Phe Asp65
70 75 80Glu Val His Phe Gly Lys
Phe Ala Ser Tyr Tyr Leu Glu Arg Thr Tyr 85
90 95Phe Phe Asp Val His Pro Pro Leu Gly Lys Leu Leu
Phe Ala Phe Met 100 105 110Gly
Trp Leu Val Gly Tyr Asp Gly His Phe His Phe Glu Asn Ile Gly 115
120 125Asp Ser Tyr Ile Val Asn Lys Val Pro
Tyr Val Ala Phe Arg Ser Leu 130 135
140Pro Ala Ile Leu Gly Ala Leu Thr Val Ser Val Thr Tyr Leu Ile Met145
150 155 160Trp Glu Ser Gly
Tyr Ser Leu Pro Ala Cys Ile Ile Ala Ala Gly Leu 165
170 175Ile Leu Leu Asp Asn Ala His Ile Gly Gln
Thr Arg Leu Ile Leu Leu 180 185
190Asp Ala Thr Leu Val Phe Ala Met Ala Cys Ser Leu Leu Cys Tyr Ile
195 200 205Lys Phe Tyr Lys Leu Arg His
Glu Pro Phe Ser Arg Lys Trp Trp Lys 210 215
220Trp Leu Ile Leu Thr Gly Phe Ala Leu Ser Cys Asp Ile Ser Thr
Lys225 230 235 240Tyr Val
Gly Leu Phe Ala Phe Ile Thr Ile Gly Ser Ala Val Val Ile
245 250 255Asp Leu Trp Asp Leu Leu Asp
Ile Lys Arg Pro Gly Gly Ala Leu Thr 260 265
270Leu Ala Glu Phe Gly Lys His Phe Ala Ala Arg Ala Phe Gly
Leu Ile 275 280 285Ile Met Pro Phe
Leu Phe Tyr Leu Phe Trp Phe Gln Val His Phe Ser 290
295 300Ile Leu Thr Arg Ser Gly Pro Gly Asp Asp Phe Met
Thr Pro Glu Phe305 310 315
320Gln Glu Thr Leu Ser Asp Asn Ile Met Leu Ala Asn Ala Val Thr Ile
325 330 335Asp Tyr Tyr Asp Thr
Ile Leu Ile Lys His Lys Glu Thr Lys Val Tyr 340
345 350Leu His Ser His Pro Asp Arg Tyr Pro Leu Arg Tyr
Asp Asp Gly Arg 355 360 365Val Ser
Ser Gln Gly Gln Gln Val Thr Gly Tyr Pro Phe Asn Asp Thr 370
375 380Asn Asn Tyr Trp Gln Ile Leu Pro Gly Gly Ala
Asp Asp Gln Lys Leu385 390 395
400Gly Arg His Val Arg Asn His Asp Leu Val Arg Leu Arg His Leu Gly
405 410 415Thr Asp Thr Ile
Leu Leu Ser His Asp Val Ala Ser Pro Tyr Tyr Pro 420
425 430Thr Asn Gln Glu Phe Thr Thr Val Ser Ile Ala
Asp Ala Tyr Gly Glu 435 440 445Arg
Ala Ala Asp Thr Leu Phe Glu Ile Arg Ile Glu His Gly Lys Asp 450
455 460Gly Gln Glu Phe Lys Ser Val Ser Ser His
Phe Lys Leu Ile His Asn465 470 475
480Pro Ser Lys Val Ala Met Trp Thr His Pro Lys Pro Leu Pro Asp
Trp 485 490 495Gly Tyr Lys
Gln Gln Glu Ile Asn Gly Asn Lys Gln Ile Ala Pro Ser 500
505 510Ser Asn Val Trp Leu Val Glu Asp Ile Val
Ser Leu Pro Pro Asp His 515 520
525Lys Arg Arg Glu Lys Pro Glu Arg Lys Val Lys Thr Leu Pro Phe Leu 530
535 540Arg Lys Trp Phe Glu Leu Gln Arg
Ser Met Phe Trp His Asn Asn Gln545 550
555 560Leu Thr Ala Ser His Pro Tyr Ala Ser Leu Pro Tyr
Gln Trp Pro Phe 565 570
575Leu Leu Arg Gly Val Ser Phe Trp Thr Gln Asn Glu Thr Arg Gln Gln
580 585 590Ile Tyr Phe Leu Gly Asn
Pro Val Gly Trp Trp Ile Ala Ser Ser Val 595 600
605Leu Ala Ile Tyr Ala Gly Ile Val Leu Ala Asp Gln Phe Ser
Leu Arg 610 615 620Arg Gly Ile Asp Ala
Leu Asp His Arg Ser Arg Ser Arg Leu Tyr Asn625 630
635 640Ser Thr Gly Phe Phe Phe Leu Ala Trp Ala
Thr His Tyr Phe Pro Phe 645 650
655Tyr Val Met Gly Arg Gln Leu Phe Leu His His Tyr Leu Pro Ala His
660 665 670Leu Ala Ser Ala Leu
Val Thr Gly Ala Ile Val Glu Phe Ile Phe Ala 675
680 685Gln Asp Ser Leu Glu His Glu Val Ala Tyr Gln Ala
Ala Lys Ala Gly 690 695 700Lys Lys Thr
Gly Val Gln Lys Arg His Leu Ser Ala Arg Glu Arg Phe705
710 715 720Ala Gly Gln Ser Met Val Ala
Ser Trp Ile Ala Thr Val Val Ile Leu 725
730 735Ile Ala Val Ala Ala Ser Trp Tyr Phe Phe Leu Pro
Leu Thr Tyr Gly 740 745 750Tyr
Pro Gly Leu Ser Val Asp Gln Val Leu Arg Arg Lys Trp Leu Gly 755
760 765Tyr Asp Leu His Phe Ala Lys 770
77513774PRTNeurospora crassa 13Met Ala Ser Thr Thr Ala Thr
Pro Glu Ala Thr Leu Arg Gln Arg Asn1 5 10
15Val Pro Ala Ser Ser Lys Lys Ala Lys Asn Gly Val Ser
Ser Asp Val 20 25 30Glu Thr
Asp Lys Val Pro Asp Ala Val Ala Pro Ala Lys Ser Gly Ser 35
40 45Glu Leu Glu Tyr Lys Leu Ala Leu Ile Leu
Ile Thr Gly Leu Ala Phe 50 55 60Leu
Thr Arg Phe Trp Gly Ile Ser His Pro Asp Glu Val Val Phe Asp65
70 75 80Glu Val His Phe Gly Lys
Phe Ala Ser Tyr Tyr Leu Glu Arg Thr Tyr 85
90 95Phe Phe Asp Val His Pro Pro Phe Gly Lys Leu Leu
Phe Ala Phe Met 100 105 110Gly
Trp Leu Val Gly Tyr Asp Gly His Phe His Phe Glu Asn Ile Gly 115
120 125Asp Ser Tyr Ile Arg Asn Lys Val Pro
Tyr Val Ala Phe Arg Ser Leu 130 135
140Pro Ala Ile Leu Gly Ala Leu Thr Val Ser Val Val Tyr Met Ile Met145
150 155 160Trp Glu Ser Gly
Tyr Ser Leu Pro Ala Cys Leu Ile Ala Ala Gly Leu 165
170 175Val Leu Leu Asp Asn Ala His Ile Gly Gln
Thr Arg Leu Ile Leu Leu 180 185
190Asp Ala Thr Leu Val Phe Ala Met Ala Cys Ser Leu Leu Cys Tyr Ile
195 200 205Lys Phe His Lys Leu Arg His
Glu Pro Phe Ser Arg Lys Trp Trp Lys 210 215
220Trp Leu Ile Leu Thr Gly Phe Ala Leu Ser Cys Asp Ile Ser Thr
Lys225 230 235 240Tyr Val
Gly Leu Phe Ala Phe Ile Thr Ile Gly Ser Ala Val Cys Ile
245 250 255Asp Leu Trp Asp Leu Leu Asp
Ile Lys Arg Pro Gly Gly Ala Leu Thr 260 265
270Leu Pro Gln Phe Gly Lys His Phe Ala Ala Arg Ala Phe Gly
Leu Ile 275 280 285Ile Met Pro Phe
Ile Phe Tyr Leu Phe Trp Phe Gln Val His Phe Ser 290
295 300Ile Leu Thr Arg Ser Gly Pro Gly Asp Asp Phe Met
Thr Pro Glu Phe305 310 315
320Gln Glu Thr Leu Ser Asp Asn Ile Met Leu Ala Asn Ala Val Thr Ile
325 330 335Asp Tyr Tyr Asp Thr
Ile Ser Ile Arg His Lys Glu Thr Lys Ala Tyr 340
345 350Leu His Ser His Pro Asp Lys Tyr Pro Leu Arg Tyr
Asp Asp Gly Arg 355 360 365Val Ser
Ser Gln Gly Gln Gln Val Thr Gly Tyr Pro Phe Asn Asp Thr 370
375 380Asn Asn Tyr Trp Gln Ile Leu Pro Pro Gly Pro
Asp Asp Gln Lys Leu385 390 395
400Gly His Pro Ile Lys Asn His Asp Leu Val Arg Leu Arg His Ile Val
405 410 415Thr Asp Thr Ile
Leu Leu Ser His Asp Val Ala Ser Pro Tyr Tyr Pro 420
425 430Thr Asn Gln Glu Phe Thr Thr Val Ser Ile Gly
Asp Ala Tyr Gly Asp 435 440 445Arg
Ala Ala Asp Thr Leu Phe Glu Ile Arg Ile Glu His Gly Lys Ala 450
455 460Asn Gln Glu Phe Lys Ser Ile Ser Ser His
Phe Lys Leu Ile His Asn465 470 475
480Pro Ser Lys Val Ala Met Trp Thr His Ser Lys Pro Leu Pro Glu
Trp 485 490 495Gly His Lys
Gln Gln Glu Ile Asn Gly Asn Lys Gln Leu Ala Gln Ser 500
505 510Ser Asn Val Trp Leu Val Glu Asp Ile Val
Ser Leu Pro Ala Asp His 515 520
525Ala Arg Arg Glu Lys Pro Glu Lys Lys Val Lys Thr Leu Pro Phe Leu 530
535 540Arg Lys Trp Phe Glu Leu Gln Arg
Ser Met Phe Trp His Asn Asn Gln545 550
555 560Leu Thr Ser Ser His Pro Tyr Ala Ser Leu Pro Tyr
Gln Trp Pro Phe 565 570
575Leu Leu Arg Gly Val Ser Phe Trp Thr Gln Asn Asp Thr Arg Gln Gln
580 585 590Ile Tyr Phe Leu Gly Asn
Pro Ile Gly Trp Trp Leu Ala Ser Ser Val 595 600
605Leu Ala Ile Tyr Ala Gly Ile Ile Leu Ala Asp Gln Phe Ser
Leu Arg 610 615 620Arg Gly Leu Asp Ala
Met Asp Arg Arg Thr Arg Ser Arg Leu Tyr Asn625 630
635 640Ser Thr Gly Phe Phe Phe Leu Ala Trp Ala
Thr His Tyr Phe Pro Phe 645 650
655Phe Val Met Gly Arg Gln Leu Phe Leu His His Tyr Leu Pro Ala His
660 665 670Leu Ala Ser Ala Leu
Val Thr Gly Ser Val Val Glu Phe Leu Phe Ser 675
680 685Thr Asp Ser Ala Glu Pro Glu Tyr Gln Pro Ser Lys
Ser Gly Lys Lys 690 695 700Val Ala Pro
Thr Thr Lys Arg Arg Leu Ser Ala Arg Glu Arg Leu Ala705
710 715 720Gly Gln Ser Met Ala Gly Ala
Trp Ile Ala Thr Ala Val Ile Met Val 725
730 735Leu Val Ala Phe Gly Trp Tyr Phe Phe Leu Pro Leu
Thr Tyr Gly Tyr 740 745 750Pro
Gly Leu Thr Ala Pro Glu Val Asn Arg Arg Lys Trp Leu Gly Tyr 755
760 765Asp Leu His Phe Ala Lys
77014776PRTPenicillium chrysogenum 14Met Ser Ser Pro Ser Pro Ser Leu Arg
Lys Arg Gly Gly Lys Lys Asp1 5 10
15Val Tyr Thr Ala Leu Pro Ser Asp Asp Thr Ser Thr Pro Val Ser
Val 20 25 30Pro Val Lys Gln
Lys Ser Glu Trp Asp Tyr Trp Leu Ala Ile Val Ile 35
40 45Leu Thr Leu Leu Ala Phe Ala Thr Arg Phe Tyr Arg
Leu Asp Tyr Pro 50 55 60Asn Glu Val
Val Phe Asp Glu Val His Phe Gly Lys Phe Ala Ser Tyr65 70
75 80Tyr Leu Gln Arg Thr Tyr Phe Phe
Asp Val His Pro Pro Phe Gly Lys 85 90
95Leu Leu Phe Ala Leu Met Gly Trp Leu Val Gly Phe Asp Gly
Ser Phe 100 105 110Leu Phe Glu
Asn Ile Gly Asp Ser Tyr Ile Glu Asn Asn Val Pro Tyr 115
120 125Leu Ser Leu Arg Ala Met Pro Ala Thr Leu Gly
Ala Leu Thr Ile Pro 130 135 140Val Val
Phe Leu Ile Met Trp Glu Ser Gly Tyr Ser Leu Pro Ala Cys145
150 155 160Val Leu Ser Ala Gly Leu Met
Val Phe Asp Asn Ala His Val Gly Glu 165
170 175Asp Arg Leu Ile Leu Leu Asp Ala Thr Leu Val Leu
Ser Met Ala Leu 180 185 190Ser
Ile Leu Cys Tyr Val Arg Phe Tyr Lys Leu Arg His Gln Pro Phe 195
200 205Gly Arg Lys Trp Trp Lys Trp Leu Leu
Leu Thr Gly Phe Cys Met Ser 210 215
220Cys Val Ile Ser Thr Lys Tyr Val Gly Phe Phe Thr Phe Val Thr Ile225
230 235 240Gly Ala Ala Val
Leu Ile Asp Leu Trp Asn Leu Leu Asp Ile Asn Arg 245
250 255Glu Gln Gly Ala Leu Ser Met Ile Ser Trp
Gly Lys His Phe Ile Ala 260 265
270Arg Ala Val Gly Leu Val Ile Ile Pro Phe Met Phe Tyr Leu Phe Trp
275 280 285Phe Gln Val His Phe Ala Ile
Leu Asn Arg Ser Gly Pro Gly Asp Asp 290 295
300Phe Met Thr Pro Glu Phe Gln Glu Thr Leu Ser Asp Asn Gln Met
Thr305 310 315 320Ala Gln
Ser Val Gly Ile Gln Tyr Phe Asp Thr Ile Thr Met Arg His
325 330 335Lys Asp Thr Lys Val Phe Leu
His Ser His Trp Asp Lys Tyr Pro Leu 340 345
350Arg Tyr Asp Asp Gly Arg Ile Ser Ser Gln Gly Gln Gln Val
Thr Gly 355 360 365Tyr Pro His Asn
Asp Thr Asn Asn Gln Trp Gln Ile Leu Pro Ala Glu 370
375 380Pro Leu Ala Asp Ser Ser Glu Pro Lys Ser Val Arg
Asn Gly Asp Ile385 390 395
400Ile Gln Leu Arg His Ile Gly Thr Glu Ser Tyr Leu Leu Thr His Asp
405 410 415Val Ala Ser Pro Phe
Phe Pro Thr Asn Gln Glu Phe Thr Thr Val Ser 420
425 430Gln Glu Leu Ala Asp Gly Glu Arg His Asn Asp Thr
Leu Phe Glu Leu 435 440 445Lys Ile
Glu Ser Gly Lys Thr Ala Gln Glu Phe Arg Thr Leu Ala Ser 450
455 460Leu Phe Lys Leu Val His Val Pro Thr Arg Val
Ala Leu Trp Thr His465 470 475
480Thr Thr Pro Leu Pro Glu Trp Gly Tyr Lys Gln Ala Glu Ile Asn Gly
485 490 495Asn Lys Asn Ile
Leu Gln Ser Ser Asn Met Trp Tyr Val Glu Asn Ile 500
505 510Glu Asn Leu Ala Glu Asp Ser Pro Arg Leu Val
Lys Glu Glu Arg Lys 515 520 525Val
Lys Thr Leu Pro Phe Leu Arg Lys Tyr Phe Glu Leu Gln Gly Ala 530
535 540Met Phe His His Asn Asn Ala Leu Thr Ser
Ser His Pro Tyr Ala Thr545 550 555
560Glu Pro Phe Gln Trp Pro Phe Leu Leu Arg Gly Val Ser Phe Trp
Thr 565 570 575Lys Asn Asp
Thr Arg Glu Gln Ile Tyr Phe Leu Gly Asn Pro Ile Gly 580
585 590Trp Trp Ile Ala Ser Ser Ile Leu Ala Val
Phe Ala Gly Val Val Gly 595 600
605Ala Asp Gln Leu Ser Leu Arg Arg Gly Val Asp Ala Leu Glu Glu Ile 610
615 620Trp Gly Pro Gly Thr Arg Ser Arg
Leu Tyr Asn Ser Thr Gly Phe Leu625 630
635 640Phe Leu Cys Trp Ala Ala His Tyr Phe Pro Phe Trp
Leu Met Gly Arg 645 650
655Gln Arg Phe Leu His His Tyr Leu Pro Ser His Leu Ala Ser Thr Met
660 665 670Val Cys Gly Ala Leu Ile
Glu Phe Ile Phe Asn Leu Gln Pro Leu Asp 675 680
685Pro Arg Thr Ala Leu Pro Pro Val Asp Asp Pro Ser Gly Lys
Ser Lys 690 695 700Ala Arg Ser Leu Ser
Ser Leu Arg Arg Phe Ile Thr Ala Lys Glu Arg705 710
715 720Met Gly Cys Arg Ser Leu Ile Ala Gly Trp
Ile Ala Thr Leu Ile Ile 725 730
735Leu Ala Ala Thr Ile Trp Gly Phe Ile Phe Tyr Ala Pro Leu Thr Tyr
740 745 750Gly Thr Pro Gly Leu
Asp Val Ala Gly Val Asn Ala Arg Lys Trp Leu 755
760 765Asn Tyr Asp Leu His Phe Ala Lys 770
7751519DNATrichoderma reesei 15gcacactttc aagattggc
191619DNATrichoderma reesei 16gtacggtgtt
gccaagaag
1917448DNATrichoderma reesei 17gttgagtaca tcgagcgcga cagcattgtg
cacaccatgc ttcccctcga gtccaaggac 60agcatcatcg ttgaggactc gtgcaacggc
gagacggaga agcaggctcc ctggggtctt 120gcccgtatct ctcaccgaga gacgctcaac
tttggctcct tcaacaagta cctctacacc 180gctgatggtg gtgagggtgt tgatgcctat
gtcattgaca ccggcaccaa catcgagcac 240gtcgactttg agggtcgtgc caagtggggc
aagaccatcc ctgccggcga tgaggacgag 300gacggcaacg gccacggcac tcactgctct
ggtaccgttg ctggtaagaa gtacggtgtt 360gccaagaagg cccacgtcta cgccgtcaag
gtgctccgat ccaacggatc cggcaccatg 420tctgacgtcg tcaagggcgt cgagtacg
44818399PRTTrichoderma reesei 18Met Gln
Pro Ser Phe Gly Ser Phe Leu Val Thr Val Leu Ser Ala Ser1 5
10 15Met Ala Ala Gly Ser Val Ile Pro
Ser Thr Asn Ala Asn Pro Gly Ser 20 25
30Phe Glu Ile Lys Arg Ser Ala Asn Lys Ala Phe Thr Gly Arg Asn
Gly 35 40 45Pro Leu Ala Leu Ala
Arg Thr Tyr Ala Lys Tyr Gly Val Glu Val Pro 50 55
60Lys Thr Leu Val Asp Ala Ile Gln Leu Val Lys Ser Ile Gln
Leu Ala65 70 75 80Lys
Arg Asp Ser Ala Thr Val Thr Ala Thr Pro Asp His Asp Asp Ile
85 90 95Glu Tyr Leu Val Pro Val Lys
Ile Gly Thr Pro Pro Gln Thr Leu Asn 100 105
110Leu Asp Phe Asp Thr Gly Ser Ser Asp Leu Trp Val Phe Ser
Ser Asp 115 120 125Val Asp Pro Thr
Ser Ser Gln Gly His Asp Ile Tyr Thr Pro Ser Lys 130
135 140Ser Thr Ser Ser Lys Lys Leu Glu Gly Ala Ser Trp
Asn Ile Thr Tyr145 150 155
160Gly Asp Arg Ser Ser Ser Ser Gly Asp Val Tyr His Asp Ile Val Ser
165 170 175Val Gly Asn Leu Thr
Val Lys Ser Gln Ala Val Glu Ser Ala Arg Asn 180
185 190Val Ser Ala Gln Phe Thr Gln Gly Asn Asn Asp Gly
Leu Val Gly Leu 195 200 205Ala Phe
Ser Ser Ile Asn Thr Val Lys Pro Thr Pro Gln Lys Thr Trp 210
215 220Tyr Asp Asn Ile Val Gly Ser Leu Asp Ser Pro
Val Phe Val Ala Asp225 230 235
240Leu Arg His Asp Thr Pro Gly Ser Tyr His Phe Gly Ser Ile Pro Ser
245 250 255Glu Ala Ser Lys
Ala Phe Tyr Ala Pro Ile Asp Asn Ser Lys Gly Phe 260
265 270Trp Gln Phe Ser Thr Ser Ser Asn Ile Ser Gly
Gln Phe Asn Ala Val 275 280 285Ala
Asp Thr Gly Thr Thr Leu Leu Leu Ala Ser Asp Asp Leu Val Lys 290
295 300Ala Tyr Tyr Ala Lys Val Gln Gly Ala Arg
Val Asn Val Phe Leu Gly305 310 315
320Gly Tyr Val Phe Asn Cys Thr Thr Gln Leu Pro Asp Phe Thr Phe
Thr 325 330 335Val Gly Glu
Gly Asn Ile Thr Val Pro Gly Thr Leu Ile Asn Tyr Ser 340
345 350Glu Ala Gly Asn Gly Gln Cys Phe Gly Gly
Ile Gln Pro Ser Gly Gly 355 360
365Leu Pro Phe Ala Ile Phe Gly Asp Ile Ala Leu Lys Ala Ala Tyr Val 370
375 380Ile Phe Asp Ser Gly Asn Lys Gln
Val Gly Trp Ala Gln Lys Lys385 390
39519452PRTTrichoderma reesei 19Met Glu Ala Ile Leu Gln Ala Gln Ala Lys
Phe Arg Leu Asp Arg Gly1 5 10
15Leu Gln Lys Ile Thr Ala Val Arg Asn Lys Asn Tyr Lys Arg His Gly
20 25 30Pro Lys Ser Tyr Val Tyr
Leu Leu Asn Arg Phe Gly Phe Glu Pro Thr 35 40
45Lys Pro Gly Pro Tyr Phe Gln Gln His Arg Ile His Gln Arg
Gly Leu 50 55 60Ala His Pro Asp Phe
Lys Ala Ala Val Gly Gly Arg Val Thr Arg Gln65 70
75 80Lys Val Leu Ala Lys Lys Val Lys Glu Asp
Gly Thr Val Asp Ala Gly 85 90
95Gly Ser Lys Thr Gly Glu Val Asp Ala Glu Asp Gln Gln Asn Asp Ser
100 105 110Glu Tyr Leu Cys Glu
Val Thr Ile Gly Thr Pro Gly Gln Lys Leu Met 115
120 125Leu Asp Phe Asp Thr Gly Ser Ser Asp Leu Trp Val
Phe Ser Thr Glu 130 135 140Leu Ser Lys
His Leu Gln Glu Asn His Ala Ile Phe Asp Pro Lys Lys145
150 155 160Ser Ser Thr Phe Lys Pro Leu
Lys Asp Gln Thr Trp Gln Ile Ser Tyr 165
170 175Gly Asp Gly Ser Ser Ala Ser Gly Thr Cys Gly Ser
Asp Thr Val Thr 180 185 190Leu
Gly Gly Leu Ser Ile Lys Asn Gln Thr Ile Glu Leu Ala Ser Lys 195
200 205Leu Ala Pro Gln Phe Ala Gln Gly Thr
Gly Asp Gly Leu Leu Gly Leu 210 215
220Ala Trp Pro Gln Ile Asn Thr Val Gln Thr Asp Gly Arg Pro Thr Pro225
230 235 240Ala Asn Thr Pro
Val Ala Asn Met Ile Gln Gln Asp Asp Ile Pro Ser 245
250 255Asp Ala Gln Leu Phe Thr Ala Ala Phe Tyr
Ser Glu Arg Asp Glu Asn 260 265
270Ala Glu Ser Phe Tyr Thr Phe Gly Tyr Ile Asp Gln Asp Leu Val Ser
275 280 285Ala Ser Gly Gln Glu Ile Ala
Trp Thr Asp Val Asp Asn Ser Gln Gly 290 295
300Phe Trp Met Phe Pro Ser Thr Lys Thr Thr Ile Asn Gly Lys Asp
Ile305 310 315 320Ser Gln
Glu Gly Asn Thr Ala Ile Ala Asp Thr Gly Thr Thr Leu Ala
325 330 335Leu Val Ser Asp Glu Val Cys
Glu Ala Leu Tyr Lys Ala Ile Pro Gly 340 345
350Ala Lys Tyr Asp Asp Asn Gln Gln Gly Tyr Val Phe Pro Ile
Asn Thr 355 360 365Asp Ala Ser Ser
Leu Pro Glu Leu Lys Val Ser Val Gly Asn Thr Gln 370
375 380Phe Val Ile Gln Pro Glu Asp Leu Ala Phe Ala Pro
Ala Asp Asp Ser385 390 395
400Asn Trp Tyr Gly Gly Val Gln Ser Arg Gly Ser Asn Pro Phe Asp Ile
405 410 415Leu Gly Asp Val Phe
Leu Lys Ser Val Tyr Ala Ile Phe Asp Gln Gly 420
425 430Asn Gln Arg Phe Gly Ala Val Pro Lys Ile Gln Ala
Lys Gln Asn Leu 435 440 445Gln Pro
Pro Gln 45020395PRTTrichoderma reesei 20Met Lys Ser Ala Leu Leu Ala
Ala Ala Ala Leu Val Gly Ser Ala Gln1 5 10
15Ala Gly Ile His Lys Met Lys Leu Gln Lys Val Ser Leu
Glu Gln Gln 20 25 30Leu Glu
Gly Ser Ser Ile Glu Ala His Val Gln Gln Leu Gly Gln Lys 35
40 45Tyr Met Gly Val Arg Pro Thr Ser Arg Ala
Glu Val Met Phe Asn Asp 50 55 60Lys
Pro Pro Lys Val Gln Gly Gly His Pro Val Pro Val Thr Asn Phe65
70 75 80Met Asn Ala Gln Tyr Phe
Ser Glu Ile Thr Ile Gly Thr Pro Pro Gln 85
90 95Ser Phe Lys Val Val Leu Asp Thr Gly Ser Ser Asn
Leu Trp Val Pro 100 105 110Ser
Gln Ser Cys Asn Ser Ile Ala Cys Phe Leu His Ser Thr Tyr Asp 115
120 125Ser Ser Ser Ser Ser Thr Tyr Lys Pro
Asn Gly Ser Asp Phe Glu Ile 130 135
140His Tyr Gly Ser Gly Ser Leu Thr Gly Phe Ile Ser Asn Asp Val Val145
150 155 160Thr Ile Gly Asp
Leu Lys Ile Lys Gly Gln Asp Phe Ala Glu Ala Thr 165
170 175Ser Glu Pro Gly Leu Ala Phe Ala Phe Gly
Arg Phe Asp Gly Ile Leu 180 185
190Gly Leu Gly Tyr Asp Thr Ile Ser Val Asn Gly Ile Val Pro Pro Phe
195 200 205Tyr Gln Met Val Asn Gln Lys
Leu Ile Asp Glu Pro Val Phe Ala Phe 210 215
220Tyr Leu Gly Ser Ser Asp Glu Gly Ser Glu Ala Val Phe Gly Gly
Val225 230 235 240Asp Asp
Ala His Tyr Glu Gly Lys Ile Glu Tyr Ile Pro Leu Arg Arg
245 250 255Lys Ala Tyr Trp Glu Val Asp
Leu Asp Ser Ile Ala Phe Gly Asp Glu 260 265
270Val Ala Glu Leu Glu Asn Thr Gly Ala Ile Leu Asp Thr Gly
Thr Ser 275 280 285Leu Asn Val Leu
Pro Ser Gly Leu Ala Glu Leu Leu Asn Ala Glu Ile 290
295 300Gly Ala Lys Lys Gly Phe Gly Gly Gln Tyr Thr Val
Asp Cys Ser Lys305 310 315
320Arg Asp Ser Leu Pro Asp Ile Thr Phe Ser Leu Ala Gly Ser Lys Tyr
325 330 335Ser Leu Pro Ala Ser
Asp Tyr Ile Ile Glu Met Ser Gly Asn Cys Ile 340
345 350Ser Ser Phe Gln Gly Met Asp Phe Pro Glu Pro Val
Gly Pro Leu Val 355 360 365Ile Leu
Gly Asp Ala Phe Leu Arg Arg Tyr Tyr Ser Val Tyr Asp Leu 370
375 380Gly Arg Asp Ala Val Gly Leu Ala Lys Ala
Lys385 390 39521426PRTTrichoderma reesei
21Met Lys Phe His Ala Ala Ala Leu Thr Leu Ala Cys Leu Ala Ser Ser1
5 10 15Ala Ser Ala Gly Val Ala
Gln Pro Arg Ala Asp Glu Val Glu Ser Ala 20 25
30Glu Gln Gly Lys Thr Phe Ser Leu Glu Gln Ile Pro Asn
Glu Arg Tyr 35 40 45Lys Gly Asn
Ile Pro Ala Ala Tyr Ile Ser Ala Leu Ala Lys Tyr Ser 50
55 60Pro Thr Ile Pro Asp Lys Ile Lys His Ala Ile Glu
Ile Asn Pro Asp65 70 75
80Leu His Arg Lys Phe Ser Lys Leu Ile Asn Ala Gly Asn Met Thr Gly
85 90 95Thr Ala Val Ala Ser Pro
Pro Pro Gly Ala Asp Ala Glu Tyr Val Leu 100
105 110Pro Val Lys Ile Gly Thr Pro Pro Gln Thr Leu Pro
Leu Asn Leu Asp 115 120 125Thr Gly
Ser Ser Asp Leu Trp Val Ile Ser Thr Asp Thr Tyr Pro Pro 130
135 140Gln Val Gln Gly Gln Thr Arg Tyr Asn Val Ser
Ala Ser Thr Thr Ala145 150 155
160Gln Arg Leu Ile Gly Glu Ser Trp Val Ile Arg Tyr Gly Asp Gly Ser
165 170 175Ser Ala Asn Gly
Ile Val Tyr Lys Asp Arg Val Gln Ile Gly Asn Thr 180
185 190Phe Phe Asn Gln Gln Ala Val Glu Ser Ala Val
Asn Ile Ser Asn Glu 195 200 205Ile
Ser Asp Asp Ser Phe Ser Ser Gly Leu Leu Gly Ala Ala Ser Ser 210
215 220Ala Ala Asn Thr Val Arg Pro Asp Arg Gln
Thr Thr Tyr Leu Glu Asn225 230 235
240Ile Lys Ser Gln Leu Ala Arg Pro Val Phe Thr Ala Asn Leu Lys
Lys 245 250 255Gly Lys Pro
Gly Asn Tyr Asn Phe Gly Tyr Ile Asn Gly Ser Glu Tyr 260
265 270Ile Gly Pro Ile Gln Tyr Ala Ala Ile Asn
Pro Ser Ser Pro Leu Trp 275 280
285Glu Val Ser Val Ser Gly Tyr Arg Val Gly Ser Asn Asp Thr Lys Tyr 290
295 300Val Pro Arg Val Trp Asn Ala Ile
Ala Asp Thr Gly Thr Thr Leu Leu305 310
315 320Leu Val Pro Asn Asp Ile Val Ser Ala Tyr Tyr Ala
Gln Val Lys Gly 325 330
335Ser Thr Phe Ser Asn Asp Val Gly Met Met Leu Val Pro Cys Ala Ala
340 345 350Thr Leu Pro Asp Phe Ala
Phe Gly Leu Gly Asn Tyr Arg Gly Val Ile 355 360
365Pro Gly Ser Tyr Ile Asn Tyr Gly Arg Met Asn Lys Thr Tyr
Cys Tyr 370 375 380Gly Gly Ile Gln Ser
Ser Glu Asp Ala Pro Phe Ala Val Leu Gly Asp385 390
395 400Ile Ala Leu Lys Ala Gln Phe Val Val Phe
Asp Met Gly Asn Lys Val 405 410
415Val Gly Phe Ala Asn Lys Asn Thr Asn Val 420
42522407PRTTrichoderma reesei 22Met Gln Thr Phe Gly Ala Phe Leu Val
Ser Phe Leu Ala Ala Ser Gly1 5 10
15Leu Ala Ala Ala Leu Pro Thr Glu Gly Gln Lys Thr Ala Ser Val
Glu 20 25 30Val Gln Tyr Asn
Lys Asn Tyr Val Pro His Gly Pro Thr Ala Leu Phe 35
40 45Lys Ala Lys Arg Lys Tyr Gly Ala Pro Ile Ser Asp
Asn Leu Lys Ser 50 55 60Leu Val Ala
Ala Arg Gln Ala Lys Gln Ala Leu Ala Lys Arg Gln Thr65 70
75 80Gly Ser Ala Pro Asn His Pro Ser
Asp Ser Ala Asp Ser Glu Tyr Ile 85 90
95Thr Ser Val Ser Ile Gly Thr Pro Ala Gln Val Leu Pro Leu
Asp Phe 100 105 110Asp Thr Gly
Ser Ser Asp Leu Trp Val Phe Ser Ser Glu Thr Pro Lys 115
120 125Ser Ser Ala Thr Gly His Ala Ile Tyr Thr Pro
Ser Lys Ser Ser Thr 130 135 140Ser Lys
Lys Val Ser Gly Ala Ser Trp Ser Ile Ser Tyr Gly Asp Gly145
150 155 160Ser Ser Ser Ser Gly Asp Val
Tyr Thr Asp Lys Val Thr Ile Gly Gly 165
170 175Phe Ser Val Asn Thr Gln Gly Val Glu Ser Ala Thr
Arg Val Ser Thr 180 185 190Glu
Phe Val Gln Asp Thr Val Ile Ser Gly Leu Val Gly Leu Ala Phe 195
200 205Asp Ser Gly Asn Gln Val Arg Pro His
Pro Gln Lys Thr Trp Phe Ser 210 215
220Asn Ala Ala Ser Ser Leu Ala Glu Pro Leu Phe Thr Ala Asp Leu Arg225
230 235 240His Gly Gln Asn
Gly Ser Tyr Asn Phe Gly Tyr Ile Asp Thr Ser Val 245
250 255Ala Lys Gly Pro Val Ala Tyr Thr Pro Val
Asp Asn Ser Gln Gly Phe 260 265
270Trp Glu Phe Thr Ala Ser Gly Tyr Ser Val Gly Gly Gly Lys Leu Asn
275 280 285Arg Asn Ser Ile Asp Gly Ile
Ala Asp Thr Gly Thr Thr Leu Leu Leu 290 295
300Leu Asp Asp Asn Val Val Asp Ala Tyr Tyr Ala Asn Val Gln Ser
Ala305 310 315 320Gln Tyr
Asp Asn Gln Gln Glu Gly Val Val Phe Asp Cys Asp Glu Asp
325 330 335Leu Pro Ser Phe Ser Phe Gly
Val Gly Ser Ser Thr Ile Thr Ile Pro 340 345
350Gly Asp Leu Leu Asn Leu Thr Pro Leu Glu Glu Gly Ser Ser
Thr Cys 355 360 365Phe Gly Gly Leu
Gln Ser Ser Ser Gly Ile Gly Ile Asn Ile Phe Gly 370
375 380Asp Val Ala Leu Lys Ala Ala Leu Val Val Phe Asp
Leu Gly Asn Glu385 390 395
400Arg Leu Gly Trp Ala Gln Lys 40523446PRTTrichoderma
reesei 23Met Thr Leu Pro Val Pro Leu Arg Glu His Asp Leu Pro Phe Leu Lys1
5 10 15Glu Lys Arg Lys
Leu Pro Ala Asp Asp Ile Pro Ser Gly Thr Tyr Thr 20
25 30Leu Pro Ile Ile His Ala Arg Arg Pro Lys Leu
Ala Ser Arg Ala Ile 35 40 45Glu
Val Gln Val Glu Asn Arg Ser Asp Val Ser Tyr Tyr Ala Gln Leu 50
55 60Asn Ile Gly Thr Pro Pro Gln Thr Val Tyr
Ala Gln Ile Asp Thr Gly65 70 75
80Ser Phe Glu Leu Trp Val Asn Pro Asn Cys Ser Asn Val Gln Ser
Ala 85 90 95Asp Gln Arg
Phe Cys Arg Ala Ile Gly Phe Tyr Asp Pro Ser Ser Ser 100
105 110Ser Thr Ala Asp Val Thr Ser Gln Ser Ala
Arg Leu Arg Tyr Gly Ile 115 120
125Gly Ser Ala Asp Val Thr Tyr Val His Asp Thr Ile Ser Leu Pro Gly 130
135 140Ser Gly Ser Gly Ser Lys Ala Met
Lys Ala Val Gln Phe Gly Val Ala145 150
155 160Asp Thr Ser Val Asp Glu Phe Ser Gly Ile Leu Gly
Leu Gly Ala Gly 165 170
175Asn Gly Ile Asn Thr Glu Tyr Pro Asn Phe Val Asp Glu Leu Ala Ala
180 185 190Gln Gly Val Thr Ala Thr
Lys Ala Phe Ser Leu Ala Leu Gly Ser Lys 195 200
205Ala Glu Glu Glu Gly Val Ile Ile Phe Gly Gly Val Asp Thr
Ala Lys 210 215 220Phe His Gly Glu Leu
Ala His Leu Pro Ile Val Pro Ala Asp Asp Ser225 230
235 240Pro Asp Gly Val Ala Arg Tyr Trp Val Lys
Met Lys Ser Ile Ser Leu 245 250
255Thr Pro Pro Pro Pro Ser Ser Ser Gly Ser Thr Asp Asp Asn Asn Asn
260 265 270Lys Pro Val Ala Phe
Pro Gln Thr Ser Met Thr Val Phe Leu Asp Ser 275
280 285Gly Ser Thr Leu Thr Leu Leu Pro Pro Ala Leu Val
Arg Gln Ile Ala 290 295 300Ser Ala Leu
Gly Ser Thr Gln Thr Asp Glu Ser Gly Phe Phe Val Val305
310 315 320Asp Cys Ala Leu Ala Ser Gln
Asp Gly Thr Ile Asp Phe Glu Phe Asp 325
330 335Gly Val Thr Ile Arg Val Pro Tyr Ala Glu Met Ile
Arg Gln Val Ser 340 345 350Thr
Leu Pro Pro His Cys Tyr Leu Gly Met Met Gly Ser Thr Gln Phe 355
360 365Ala Leu Leu Gly Asp Thr Phe Leu Arg
Ser Ala Tyr Ala Val Phe Asp 370 375
380Leu Thr Ser Asn Val Val His Leu Ala Pro Tyr Ala Asn Cys Gly Thr385
390 395 400Asn Val Lys Ser
Ile Thr Ser Thr Ser Ser Leu Ser Asn Leu Val Gly 405
410 415Thr Cys Asn Asp Pro Ser Lys Pro Ser Ser
Ser Pro Ser Pro Ser Gln 420 425
430Thr Pro Ser Ala Ser Pro Ser Ser Thr Ala Thr Gln Lys Ala 435
440 44524259PRTTrichoderma reesei 24Met Ala
Pro Ala Ser Gln Val Val Ser Ala Leu Met Leu Pro Ala Leu1 5
10 15Ala Leu Gly Ala Ala Ile Gln Pro
Arg Gly Ala Asp Ile Val Gly Gly 20 25
30Thr Ala Ala Ser Leu Gly Glu Phe Pro Tyr Ile Val Ser Leu Gln
Asn 35 40 45Pro Asn Gln Gly Gly
His Phe Cys Gly Gly Val Leu Val Asn Ala Asn 50 55
60Thr Val Val Thr Ala Ala His Cys Ser Val Val Tyr Pro Ala
Ser Gln65 70 75 80Ile
Arg Val Arg Ala Gly Thr Leu Thr Trp Asn Ser Gly Gly Thr Leu
85 90 95Val Gly Val Ser Gln Ile Ile
Val Asn Pro Ser Tyr Asn Asp Arg Thr 100 105
110Thr Asp Phe Asp Val Ala Val Trp His Leu Ser Ser Pro Ile
Arg Glu 115 120 125Ser Ser Thr Ile
Gly Tyr Ala Thr Leu Pro Ala Gln Gly Ser Asp Pro 130
135 140Val Ala Gly Ser Thr Val Thr Thr Ala Gly Trp Gly
Thr Thr Ser Glu145 150 155
160Asn Ser Asn Ser Ile Pro Ser Arg Leu Asn Lys Val Ser Val Pro Val
165 170 175Val Ala Arg Ser Thr
Cys Gln Ala Asp Tyr Arg Ser Gln Gly Leu Ser 180
185 190Val Thr Asn Asn Met Phe Cys Ala Gly Leu Thr Gln
Gly Gly Lys Asp 195 200 205Ser Cys
Ser Gly Asp Ser Gly Gly Pro Ile Val Asp Ala Asn Gly Val 210
215 220Leu Gln Gly Val Val Ser Trp Gly Ile Gly Cys
Ala Glu Ala Gly Phe225 230 235
240Pro Gly Val Tyr Thr Arg Ile Gly Asn Phe Val Asn Tyr Ile Asn Gln
245 250 255Asn Leu
Ala25882PRTTrichoderma reesei 25Met Val Arg Ser Ala Leu Phe Val Ser Leu
Leu Ala Thr Phe Ser Gly1 5 10
15Val Ile Ala Arg Val Ser Gly His Gly Ser Lys Ile Val Pro Gly Ala
20 25 30Tyr Ile Phe Glu Phe Glu
Asp Ser Gln Asp Thr Ala Asp Phe Tyr Lys 35 40
45Lys Leu Asn Gly Glu Gly Ser Thr Arg Leu Lys Phe Asp Tyr
Lys Leu 50 55 60Phe Lys Gly Val Ser
Val Gln Leu Lys Asp Leu Asp Asn His Glu Ala65 70
75 80Lys Ala Gln Gln Met Ala Gln Leu Pro Ala
Val Lys Asn Val Trp Pro 85 90
95Val Thr Leu Ile Asp Ala Pro Asn Pro Lys Val Glu Trp Val Ala Gly
100 105 110Ser Thr Ala Pro Thr
Leu Glu Ser Arg Ala Ile Lys Lys Pro Pro Ile 115
120 125Pro Asn Asp Ser Ser Asp Phe Pro Thr His Gln Met
Thr Gln Ile Asp 130 135 140Lys Leu Arg
Ala Lys Gly Tyr Thr Gly Lys Gly Val Arg Val Ala Val145
150 155 160Ile Asp Thr Gly Ile Asp Tyr
Thr His Pro Ala Leu Gly Gly Cys Phe 165
170 175Gly Arg Gly Cys Leu Val Ser Phe Gly Thr Asp Leu
Val Gly Asp Asp 180 185 190Tyr
Thr Gly Phe Asn Thr Pro Val Pro Asp Asp Asp Pro Val Asp Cys 195
200 205Ala Gly His Gly Ser His Val Ala Gly
Ile Ile Ala Ala Gln Glu Asn 210 215
220Pro Tyr Gly Phe Thr Gly Gly Ala Pro Asp Val Thr Leu Gly Ala Tyr225
230 235 240Arg Val Phe Gly
Cys Asp Gly Gln Ala Gly Asn Asp Val Leu Ile Ser 245
250 255Ala Tyr Asn Gln Ala Phe Glu Asp Gly Ala
Gln Ile Ile Thr Ala Ser 260 265
270Ile Gly Gly Pro Ser Gly Trp Ala Glu Glu Pro Trp Ala Val Ala Val
275 280 285Thr Arg Ile Val Glu Ala Gly
Val Pro Cys Thr Val Ser Ala Gly Asn 290 295
300Glu Gly Asp Ser Gly Leu Phe Phe Ala Ser Thr Ala Ala Asn Gly
Lys305 310 315 320Lys Val
Ile Ala Val Ala Ser Val Asp Asn Glu Asn Ile Pro Ser Val
325 330 335Leu Ser Val Ala Ser Tyr Lys
Ile Asp Ser Gly Ala Ala Gln Asp Phe 340 345
350Gly Tyr Val Ser Ser Ser Lys Ala Trp Asp Gly Val Ser Lys
Pro Leu 355 360 365Tyr Ala Val Ser
Phe Asp Thr Thr Ile Pro Asp Asp Gly Cys Ser Pro 370
375 380Leu Pro Asp Ser Thr Pro Asp Leu Ser Asp Tyr Ile
Val Leu Val Arg385 390 395
400Arg Gly Thr Cys Thr Phe Val Gln Lys Ala Gln Asn Val Ala Ala Lys
405 410 415Gly Ala Lys Tyr Leu
Leu Tyr Tyr Asn Asn Ile Pro Gly Ala Leu Ala 420
425 430Val Asp Val Ser Ala Val Pro Glu Ile Glu Ala Val
Gly Met Val Asp 435 440 445Asp Lys
Thr Gly Ala Thr Trp Ile Ala Ala Leu Lys Asp Gly Lys Thr 450
455 460Val Thr Leu Thr Leu Thr Asp Pro Ile Glu Ser
Glu Lys Gln Ile Gln465 470 475
480Phe Ser Asp Asn Pro Thr Thr Gly Gly Ala Leu Ser Gly Tyr Thr Thr
485 490 495Trp Gly Pro Thr
Trp Glu Leu Asp Val Lys Pro Gln Ile Ser Ser Pro 500
505 510Gly Gly Asn Ile Leu Ser Thr Tyr Pro Val Ala
Leu Gly Gly Tyr Ala 515 520 525Thr
Leu Ser Gly Thr Ser Met Ala Cys Pro Leu Thr Ala Ala Ala Val 530
535 540Ala Leu Ile Gly Gln Ala Arg Gly Thr Phe
Asp Pro Ala Leu Ile Asp545 550 555
560Asn Leu Leu Ala Thr Thr Ala Asn Pro Gln Leu Phe Asn Asp Gly
Glu 565 570 575Lys Phe Tyr
Asp Phe Leu Ala Pro Val Pro Gln Gln Gly Gly Gly Leu 580
585 590Ile Gln Ala Tyr Asp Ala Ala Phe Ala Thr
Thr Leu Leu Ser Pro Ser 595 600
605Ser Leu Ser Phe Asn Asp Thr Asp His Phe Ile Lys Lys Lys Gln Ile 610
615 620Thr Leu Lys Asn Thr Ser Lys Gln
Arg Val Thr Tyr Lys Leu Asn His625 630
635 640Val Pro Thr Asn Thr Phe Tyr Thr Leu Ala Pro Gly
Asn Gly Tyr Pro 645 650
655Ala Pro Phe Pro Asn Asp Ala Val Ala Ala His Ala Asn Leu Lys Phe
660 665 670Asn Leu Gln Gln Val Thr
Leu Pro Ala Gly Arg Ser Ile Thr Val Asp 675 680
685Val Phe Pro Thr Pro Pro Arg Asp Val Asp Ala Lys Arg Leu
Ala Leu 690 695 700Trp Ser Gly Tyr Ile
Thr Val Asn Gly Thr Asp Gly Thr Ser Leu Ser705 710
715 720Val Pro Tyr Gln Gly Leu Thr Gly Ser Leu
His Lys Gln Lys Val Leu 725 730
735Tyr Pro Glu Asp Ser Trp Ile Ala Asp Ser Thr Asp Glu Ser Leu Ala
740 745 750Pro Val Glu Asn Gly
Thr Val Phe Thr Ile Pro Ala Pro Gly Asn Ala 755
760 765Gly Pro Asp Asp Lys Leu Pro Ser Leu Val Val Ser
Pro Ala Leu Gly 770 775 780Ser Arg Tyr
Val Arg Val Asp Leu Val Leu Leu Ser Ala Pro Pro His785
790 795 800Gly Thr Lys Leu Lys Thr Val
Lys Phe Leu Asp Thr Thr Ser Ile Gly 805
810 815Gln Pro Ala Gly Ser Pro Leu Leu Trp Ile Ser Arg
Gly Ala Asn Pro 820 825 830Ile
Ala Trp Thr Gly Glu Leu Ser Asp Asn Lys Phe Ala Pro Pro Gly 835
840 845Thr Tyr Lys Ala Val Phe His Ala Leu
Arg Ile Phe Gly Asn Glu Lys 850 855
860Lys Lys Glu Asp Trp Asp Val Ser Glu Ser Pro Ala Phe Thr Ile Lys865
870 875 880Tyr
Ala26541PRTTrichoderma reesei 26Met Arg Ser Val Val Ala Leu Ser Met Ala
Ala Val Ala Gln Ala Ser1 5 10
15Thr Phe Gln Ile Gly Thr Ile His Glu Lys Ser Ala Pro Val Leu Ser
20 25 30Asn Val Glu Ala Asn Ala
Ile Pro Asp Ala Tyr Ile Ile Lys Phe Lys 35 40
45Asp His Val Gly Glu Asp Asp Ala Ser Lys His His Asp Trp
Ile Gln 50 55 60Ser Ile His Thr Asn
Val Glu Gln Glu Arg Leu Glu Leu Arg Lys Arg65 70
75 80Ser Asn Val Phe Gly Ala Asp Asp Val Phe
Asp Gly Leu Lys His Thr 85 90
95Phe Lys Ile Gly Asp Gly Phe Lys Gly Tyr Ala Gly His Phe His Glu
100 105 110Ser Val Ile Glu Gln
Val Arg Asn His Pro Asp Val Glu Tyr Ile Glu 115
120 125Arg Asp Ser Ile Val His Thr Met Leu Pro Leu Glu
Ser Lys Asp Ser 130 135 140Ile Ile Val
Glu Asp Ser Cys Asn Gly Glu Thr Glu Lys Gln Ala Pro145
150 155 160Trp Gly Leu Ala Arg Ile Ser
His Arg Glu Thr Leu Asn Phe Gly Ser 165
170 175Phe Asn Lys Tyr Leu Tyr Thr Ala Asp Gly Gly Glu
Gly Val Asp Ala 180 185 190Tyr
Val Ile Asp Thr Gly Thr Asn Ile Glu His Val Asp Phe Glu Gly 195
200 205Arg Ala Lys Trp Gly Lys Thr Ile Pro
Ala Gly Asp Glu Asp Glu Asp 210 215
220Gly Asn Gly His Gly Thr His Cys Ser Gly Thr Val Ala Gly Lys Lys225
230 235 240Tyr Gly Val Ala
Lys Lys Ala His Val Tyr Ala Val Lys Val Leu Arg 245
250 255Ser Asn Gly Ser Gly Thr Met Ser Asp Val
Val Lys Gly Val Glu Tyr 260 265
270Ala Ala Leu Ser His Ile Glu Gln Val Lys Lys Ala Lys Lys Gly Lys
275 280 285Arg Lys Gly Phe Lys Gly Ser
Val Ala Asn Met Ser Leu Gly Gly Gly 290 295
300Lys Thr Gln Ala Leu Asp Ala Ala Val Asn Ala Ala Val Arg Ala
Gly305 310 315 320Val His
Phe Ala Val Ala Ala Gly Asn Asp Asn Ala Asp Ala Cys Asn
325 330 335Tyr Ser Pro Ala Ala Ala Thr
Glu Pro Leu Thr Val Gly Ala Ser Ala 340 345
350Leu Asp Asp Ser Arg Ala Tyr Phe Ser Asn Tyr Gly Lys Cys
Thr Asp 355 360 365Ile Phe Ala Pro
Gly Leu Ser Ile Gln Ser Thr Trp Ile Gly Ser Lys 370
375 380Tyr Ala Val Asn Thr Ile Ser Gly Thr Ser Met Ala
Ser Pro His Ile385 390 395
400Cys Gly Leu Leu Ala Tyr Tyr Leu Ser Leu Gln Pro Ala Gly Asp Ser
405 410 415Glu Phe Ala Val Ala
Pro Ile Thr Pro Lys Lys Leu Lys Glu Ser Val 420
425 430Ile Ser Val Ala Thr Lys Asn Ala Leu Ser Asp Leu
Pro Asp Ser Asp 435 440 445Thr Pro
Asn Leu Leu Ala Trp Asn Gly Gly Gly Cys Ser Asn Phe Ser 450
455 460Gln Ile Val Glu Ala Gly Ser Tyr Thr Val Lys
Pro Lys Gln Asn Lys465 470 475
480Gln Ala Lys Leu Pro Ser Thr Ile Glu Glu Leu Glu Glu Ala Ile Glu
485 490 495Gly Asp Phe Glu
Val Val Ser Gly Glu Ile Val Lys Gly Ala Lys Ser 500
505 510Phe Gly Ser Lys Ala Glu Lys Phe Ala Lys Lys
Ile His Asp Leu Val 515 520 525Glu
Glu Glu Ile Glu Glu Phe Ile Ser Glu Leu Ser Glu 530
535 54027391PRTTrichoderma reesei 27Met Arg Leu Ser Val
Leu Leu Ser Val Leu Pro Leu Val Leu Ala Ala1 5
10 15Pro Ala Ile Glu Lys Arg Ala Glu Pro Ala Pro
Leu Leu Val Pro Thr 20 25
30Thr Lys His Gly Leu Val Ala Asp Lys Tyr Ile Val Lys Phe Lys Asp
35 40 45Gly Ser Ser Leu Gln Ala Val Asp
Glu Ala Ile Ser Gly Leu Val Ser 50 55
60Asn Ala Asp His Val Tyr Gln His Val Phe Arg Gly Phe Ala Ala Thr65
70 75 80Leu Asp Lys Glu Thr
Leu Glu Ala Leu Arg Asn His Pro Glu Val Asp 85
90 95Tyr Ile Glu Gln Asp Ala Val Val Lys Ile Asn
Ala Tyr Val Ser Gln 100 105
110Thr Gly Ala Pro Trp Gly Leu Gly Arg Ile Ser His Lys Ala Arg Gly
115 120 125Ser Thr Thr Tyr Val Tyr Asp
Asp Ser Ala Gly Ala Gly Thr Cys Ser 130 135
140Tyr Val Ile Asp Thr Gly Val Asp Ala Thr His Pro Asp Phe Glu
Gly145 150 155 160Arg Ala
Thr Leu Leu Arg Ser Phe Val Ser Gly Gln Asn Thr Asp Gly
165 170 175Asn Gly His Gly Thr His Val
Ser Gly Thr Ile Gly Ser Arg Thr Tyr 180 185
190Gly Val Ala Lys Lys Thr Gln Ile Tyr Gly Val Lys Val Leu
Asp Asn 195 200 205Ser Gly Ser Gly
Ser Phe Ser Thr Val Ile Ala Gly Met Asp Tyr Val 210
215 220Ala Ser Asp Ser Gln Thr Arg Asn Cys Pro Asn Gly
Ser Val Ala Asn225 230 235
240Met Ser Leu Gly Gly Gly Tyr Thr Ala Ser Val Asn Gln Ala Ala Ala
245 250 255Arg Leu Ile Gln Ala
Gly Val Phe Leu Ala Val Ala Ala Gly Asn Asp 260
265 270Gly Val Asp Ala Arg Asn Thr Ser Pro Ala Ser Glu
Pro Thr Val Cys 275 280 285Thr Val
Gly Ala Ser Thr Ser Ser Asp Ala Arg Ala Ser Phe Ser Asn 290
295 300Tyr Gly Ser Val Val Asp Ile Phe Ala Pro Gly
Gln Asp Ile Leu Ser305 310 315
320Thr Trp Pro Asn Arg Gln Thr Asn Thr Ile Ser Gly Thr Ser Met Ala
325 330 335Thr Pro His Ile
Val Gly Leu Gly Ala Tyr Leu Ala Gly Leu Glu Gly 340
345 350Phe Ser Asp Pro Gln Ala Leu Cys Ala Arg Ile
Gln Ser Leu Ala Asn 355 360 365Arg
Asn Leu Leu Ser Gly Ile Pro Ser Gly Thr Ile Asn Ala Ile Ala 370
375 380Phe Asn Gly Asn Pro Ser Gly385
39028387PRTTricochoderma reesei 28Met Gly Leu Val Thr Asn Pro Phe
Ala Lys Asn Ile Ile Pro Asn Arg1 5 10
15Tyr Ile Val Val Tyr Asn Asn Ser Phe Gly Glu Glu Ala Ile
Ser Ala 20 25 30Lys Gln Ala
Gln Phe Ala Ala Lys Ile Ala Lys Arg Asn Leu Gly Lys 35
40 45Arg Gly Leu Phe Gly Asn Glu Leu Ser Thr Ala
Ile His Ser Phe Ser 50 55 60Met His
Thr Trp Arg Ala Met Ala Leu Asp Ala Asp Asp Ile Met Ile65
70 75 80Lys Asp Ile Phe Asp Ala Glu
Glu Val Ala Tyr Ile Glu Ala Asp Thr 85 90
95Lys Val Gln His Ala Ala Leu Val Ala Gln Thr Asn Ala
Ala Pro Gly 100 105 110Leu Ile
Arg Leu Ser Asn Lys Ala Val Gly Gly Gln Asn Tyr Ile Phe 115
120 125Asp Asn Ser Ala Gly Ser Asn Ile Thr Ala
Tyr Val Val Asp Thr Gly 130 135 140Ile
Arg Ile Thr His Ser Glu Phe Glu Gly Arg Ala Thr Phe Gly Ala145
150 155 160Asn Phe Val Asn Asp Asp
Thr Asp Glu Asn Gly His Gly Ser His Val 165
170 175Ala Gly Thr Ile Gly Gly Ala Thr Phe Gly Val Ala
Lys Asn Val Glu 180 185 190Leu
Val Ala Val Lys Val Leu Asp Ala Asp Gly Ser Gly Ser Asn Ser 195
200 205Gly Val Leu Asn Gly Met Gln Phe Val
Val Asn Asp Val Gln Ala Lys 210 215
220Lys Arg Ser Gly Lys Ala Val Met Asn Met Ser Leu Gly Gly Ser Phe225
230 235 240Ser Thr Ala Val
Asn Asn Ala Ile Thr Ala Leu Thr Asn Ala Gly Ile 245
250 255Val Pro Val Val Ala Ala Gly Asn Glu Asn
Gln Asp Thr Ala Asn Thr 260 265
270Ser Pro Gly Ser Ala Pro Gln Ala Ile Thr Val Gly Ala Ile Asp Ala
275 280 285Thr Thr Asp Ile Arg Ala Gly
Phe Ser Asn Phe Gly Thr Gly Val Asp 290 295
300Ile Tyr Ala Pro Gly Val Asp Val Leu Ser Val Gly Ile Lys Ser
Asp305 310 315 320Ile Asp
Thr Ala Val Leu Ser Gly Thr Ser Met Ala Ser Pro His Val
325 330 335Ala Gly Leu Ala Ala Tyr Leu
Met Ala Leu Glu Gly Val Ser Asn Val 340 345
350Asp Asp Val Ser Asn Leu Ile Lys Asn Leu Ala Ala Lys Thr
Gly Ala 355 360 365Ala Val Lys Gln
Asn Ile Ala Gly Thr Thr Ser Leu Ile Ala Asn Asn 370
375 380Gly Asn Phe38529409PRTTrichoderma reesei 29Met Ala
Ser Leu Arg Arg Leu Ala Leu Tyr Leu Gly Ala Leu Leu Pro1 5
10 15Ala Val Leu Ala Ala Pro Ala Val
Asn Tyr Lys Leu Pro Glu Ala Val 20 25
30Pro Asn Lys Phe Ile Val Thr Leu Lys Asp Gly Ala Ser Val Asp
Thr 35 40 45Asp Ser His Leu Thr
Trp Val Lys Asp Leu His Arg Arg Ser Leu Gly 50 55
60Lys Arg Ser Thr Ala Gly Val Glu Lys Thr Tyr Asn Ile Asp
Ser Trp65 70 75 80Asn
Ala Tyr Ala Gly Glu Phe Asp Glu Glu Thr Val Lys Gln Ile Lys
85 90 95Ala Asn Pro Asp Val Ala Ser
Val Glu Pro Asp Tyr Ile Met Trp Leu 100 105
110Ser Asp Ile Val Glu Asp Lys Arg Ala Leu Thr Thr Gln Thr
Gly Ala 115 120 125Pro Trp Gly Leu
Gly Thr Val Ser His Arg Thr Pro Gly Ser Thr Ser 130
135 140Tyr Ile Tyr Asp Thr Ser Ala Gly Ser Gly Thr Phe
Ala Tyr Val Val145 150 155
160Asp Ser Gly Ile Asn Ile Ala His Gln Gln Phe Gly Gly Arg Ala Ser
165 170 175Leu Gly Tyr Asn Ala
Ala Gly Gly Asp His Val Asp Thr Leu Gly His 180
185 190Gly Thr His Val Ser Gly Thr Ile Gly Gly Ser Thr
Tyr Gly Val Ala 195 200 205Lys Gln
Ala Ser Leu Ile Ser Val Lys Val Phe Gln Gly Asn Ser Ala 210
215 220Ser Thr Ser Val Ile Leu Asp Gly Tyr Asn Trp
Ala Val Asn Asp Ile225 230 235
240Val Ser Arg Asn Arg Ala Ser Lys Ser Ala Ile Asn Met Ser Leu Gly
245 250 255Gly Pro Ala Ser
Ser Thr Trp Ala Thr Ala Ile Asn Ala Ala Phe Asn 260
265 270Lys Gly Val Leu Thr Ile Val Ala Ala Gly Asn
Gly Asp Ala Leu Gly 275 280 285Asn
Pro Gln Pro Val Ser Ser Thr Ser Pro Ala Asn Val Pro Asn Ala 290
295 300Ile Thr Val Ala Ala Leu Asp Ile Asn Trp
Arg Thr Ala Ser Phe Thr305 310 315
320Asn Tyr Gly Ala Gly Val Asp Val Phe Ala Pro Gly Val Asn Ile
Leu 325 330 335Ser Ser Trp
Ile Gly Ser Asn Thr Ala Thr Asn Thr Ile Ser Gly Thr 340
345 350Ser Met Ala Thr Pro His Val Val Gly Leu
Ala Leu Tyr Leu Gln Ala 355 360
365Leu Glu Gly Leu Ser Thr Pro Thr Ala Val Thr Asn Arg Ile Lys Ala 370
375 380Leu Ala Thr Thr Gly Arg Val Thr
Gly Ser Leu Asn Gly Ser Pro Asn385 390
395 400Thr Leu Ile Phe Asn Gly Asn Ser Ala
40530555PRTTrichoderma reesei 30Met Arg Ala Cys Leu Leu Phe Leu Gly Ile
Thr Ala Leu Ala Thr Ala1 5 10
15Ile Pro Ala Leu Lys Pro Pro His Gly Ser Pro Asp Arg Ala His Thr
20 25 30Thr Gln Leu Ala Lys Val
Ser Ile Ala Leu Gln Pro Glu Cys Arg Glu 35 40
45Leu Leu Glu Gln Ala Leu His His Leu Ser Asp Pro Ser Ser
Pro Arg 50 55 60Tyr Gly Arg Tyr Leu
Gly Arg Glu Glu Ala Lys Ala Leu Leu Arg Pro65 70
75 80Arg Arg Glu Ala Thr Ala Ala Val Lys Arg
Trp Leu Ala Arg Ala Gly 85 90
95Val Pro Ala His Asp Val Leu Thr Asp Gly Gln Phe Ile His Val Arg
100 105 110Thr Leu Ala Glu Lys
Ala Gln Ala Leu Leu Gly Phe Glu Tyr Asn Ser 115
120 125Thr Leu Gly Ser Gln Thr Ile Ala Ile Ser Thr Leu
Pro Gly Lys Ile 130 135 140Arg Lys His
Val Met Thr Val Gln Tyr Val Pro Leu Trp Thr Glu Ala145
150 155 160Asp Trp Glu Glu Cys Lys Thr
Ile Ile Thr Pro Ser Cys Leu Lys Arg 165
170 175Leu Tyr His Val Asp Ser Tyr Arg Ala Lys Tyr Glu
Ser Ser Ser Leu 180 185 190Phe
Gly Ile Val Gly Phe Ser Gly Gln Ala Ala Gln His Asp Glu Leu 195
200 205Asp Lys Phe Leu His Asp Phe Ala Pro
Tyr Ser Thr Asn Ala Asn Phe 210 215
220Ser Ile Glu Ser Val Asn Gly Gly Gln Ser Pro Gln Gly Met Asn Glu225
230 235 240Pro Ala Ser Glu
Ala Asn Gly Asp Val Gln Tyr Ala Val Ala Met Gly 245
250 255Tyr His Val Pro Val Arg Tyr Tyr Ala Val
Gly Gly Glu Asn His Asp 260 265
270Ile Ile Pro Asp Leu Asp Leu Val Asp Thr Thr Glu Glu Tyr Leu Glu
275 280 285Pro Phe Leu Glu Phe Ala Ser
His Leu Leu Asp Leu Asp Asp Asp Glu 290 295
300Leu Pro Arg Val Val Ser Ile Ser Tyr Gly Ala Asn Glu Gln Leu
Phe305 310 315 320Pro Arg
Ser Tyr Ala His Gln Val Cys Asp Met Phe Gly Gln Leu Gly
325 330 335Ala Arg Gly Val Ser Ile Val
Val Ala Ala Gly Asp Leu Gly Pro Gly 340 345
350Val Ser Cys Gln Ser Asn Asp Gly Ser Ala Arg Pro Lys Phe
Ile Pro 355 360 365Ser Phe Pro Ala
Thr Cys Pro Tyr Val Thr Ser Val Gly Ser Thr Arg 370
375 380Gly Ile Met Pro Glu Val Ala Ala Ser Phe Ser Ser
Gly Gly Phe Ser385 390 395
400Asp Tyr Phe Ala Arg Pro Ala Trp Gln Asp Arg Ala Val Gly Ala Tyr
405 410 415Leu Gly Ala His Gly
Glu Glu Trp Glu Gly Phe Tyr Asn Pro Ala Gly 420
425 430Arg Gly Phe Pro Asp Val Ala Ala Gln Gly Val Asn
Phe Arg Phe Arg 435 440 445Ala His
Gly Asn Glu Ser Leu Ser Ser Gly Thr Ser Leu Ser Ser Pro 450
455 460Val Phe Ala Ala Leu Ile Ala Leu Leu Asn Asp
His Arg Ser Lys Ser465 470 475
480Gly Met Pro Pro Met Gly Phe Leu Asn Pro Trp Ile Tyr Thr Val Gly
485 490 495Ser His Ala Phe
Thr Asp Ile Ile Glu Ala Arg Ser Glu Gly Cys Pro 500
505 510Gly Gln Ser Val Glu Tyr Leu Ala Ser Pro Tyr
Ile Pro Asn Ala Gly 515 520 525Trp
Ser Ala Val Pro Gly Trp Asp Pro Val Thr Gly Trp Gly Thr Pro 530
535 540Leu Phe Asp Arg Met Leu Asn Leu Ser Leu
Val545 550 55531388PRTTrichoderma reesei
31Met Ala Trp Leu Lys Lys Leu Ala Leu Val Leu Leu Ala Ile Val Pro1
5 10 15Tyr Ala Thr Ala Ser Pro
Ala Leu Ser Pro Arg Ser Arg Glu Ile Leu 20 25
30Ser Leu Glu Asp Leu Glu Ser Glu Asp Lys Tyr Val Ile
Gly Leu Lys 35 40 45Gln Gly Leu
Ser Pro Thr Asp Leu Lys Lys His Leu Leu Arg Val Ser 50
55 60Ala Val Gln Tyr Arg Asn Lys Asn Ser Thr Phe Glu
Gly Gly Thr Gly65 70 75
80Val Lys Arg Thr Tyr Ala Ile Gly Asp Tyr Arg Ala Tyr Thr Ala Val
85 90 95Leu Asp Arg Asp Thr Val
Arg Glu Ile Trp Asn Asp Thr Leu Glu Lys 100
105 110Pro Pro Trp Gly Leu Ala Thr Leu Ser Asn Lys Lys
Pro His Gly Phe 115 120 125Leu Tyr
Arg Tyr Asp Lys Ser Ala Gly Glu Gly Thr Phe Ala Tyr Val 130
135 140Leu Asp Thr Gly Ile Asn Ser Lys His Val Asp
Phe Glu Gly Arg Ala145 150 155
160Tyr Met Gly Phe Ser Pro Pro Lys Thr Glu Pro Thr Asp Ile Asn Gly
165 170 175His Gly Thr His
Val Ala Gly Ile Ile Gly Gly Lys Thr Phe Gly Val 180
185 190Ala Lys Lys Thr Gln Leu Ile Gly Val Lys Val
Phe Leu Asp Asp Glu 195 200 205Ala
Thr Thr Ser Thr Leu Met Glu Gly Leu Glu Trp Ala Val Asn Asp 210
215 220Ile Thr Thr Lys Gly Arg Gln Gly Arg Ser
Val Ile Asn Met Ser Leu225 230 235
240Gly Gly Pro Tyr Ser Gln Ala Leu Asn Asp Ala Ile Asp His Ile
Ala 245 250 255Asp Met Gly
Ile Leu Pro Val Ala Ala Ala Gly Asn Lys Gly Ile Pro 260
265 270Ala Thr Phe Ile Ser Pro Ala Ser Ala Asp
Lys Ala Met Thr Val Gly 275 280
285Ala Ile Asn Ser Asp Trp Gln Glu Thr Asn Phe Ser Asn Phe Gly Pro 290
295 300Gln Val Asn Ile Leu Ala Pro Gly
Glu Asp Val Leu Ser Ala Tyr Val305 310
315 320Ser Thr Asn Thr Ala Thr Arg Val Leu Ser Gly Thr
Ser Met Ala Ala 325 330
335Pro His Val Ala Gly Leu Ala Leu Tyr Leu Met Ala Leu Glu Glu Phe
340 345 350Asp Ser Thr Gln Lys Leu
Thr Asp Arg Ile Leu Gln Leu Gly Met Lys 355 360
365Asn Lys Val Val Asn Leu Met Thr Asp Ser Pro Asn Leu Ile
Ile His 370 375 380Asn Asn Val
Lys38532256PRTTrichoderma reesei 32Met Phe Ile Ala Gly Val Ala Leu Ser
Ala Leu Leu Cys Ala Asp Thr1 5 10
15Val Leu Ala Gly Val Ala Gln Asp Arg Gly Leu Ala Ala Arg Leu
Ala 20 25 30Arg Arg Ala Gly
Arg Arg Ser Ala Pro Phe Arg Asn Asp Thr Ser His 35
40 45Ala Thr Val Gln Ser Asn Trp Gly Gly Ala Ile Leu
Glu Gly Ser Gly 50 55 60Phe Thr Ala
Ala Ser Ala Thr Val Asn Val Pro Arg Gly Gly Gly Gly65 70
75 80Ser Asn Ala Ala Gly Ser Ala Trp
Val Gly Ile Asp Gly Ala Ser Cys 85 90
95Gln Thr Ala Ile Leu Gln Thr Gly Phe Asp Trp Tyr Gly Asp
Gly Thr 100 105 110Tyr Asp Ala
Trp Tyr Glu Trp Tyr Pro Glu Phe Ala Ala Asp Phe Ser 115
120 125Gly Ile Asp Ile Arg Gln Gly Asp Gln Ile Ala
Met Ser Val Val Ala 130 135 140Thr Ser
Leu Thr Gly Gly Ser Ala Thr Leu Glu Asn Leu Ser Thr Gly145
150 155 160Gln Lys Val Thr Gln Asn Phe
Asn Arg Val Thr Ala Gly Ser Leu Cys 165
170 175Glu Thr Ser Ala Glu Phe Ile Ile Glu Asp Phe Glu
Glu Cys Asn Ser 180 185 190Asn
Gly Ser Asn Cys Gln Pro Val Pro Phe Ala Ser Phe Ser Pro Ala 195
200 205Ile Thr Phe Ser Ser Ala Thr Ala Thr
Arg Ser Gly Arg Ser Val Ser 210 215
220Leu Ser Gly Ala Glu Ile Thr Glu Val Ile Val Asn Asn Gln Asp Leu225
230 235 240Thr Arg Cys Ser
Val Ser Gly Ser Ser Thr Leu Thr Cys Ser Tyr Val 245
250 25533236PRTTrichoderma reesei 33Met Asp Ala
Ile Arg Ala Arg Ser Ala Ala Arg Arg Ser Asn Arg Phe1 5
10 15Gln Ala Gly Ser Ser Lys Asn Val Asn
Gly Thr Ala Asp Val Glu Ser 20 25
30Thr Asn Trp Ala Gly Ala Ala Ile Thr Thr Ser Gly Val Thr Glu Val
35 40 45Ser Gly Thr Phe Thr Val Pro
Arg Pro Ser Val Pro Ala Gly Gly Ser 50 55
60Ser Arg Glu Glu Tyr Cys Gly Ala Ala Trp Val Gly Ile Asp Gly Tyr65
70 75 80Ser Asp Ala Asp
Leu Ile Gln Thr Gly Val Leu Trp Cys Val Glu Asp 85
90 95Gly Glu Tyr Leu Tyr Glu Ala Trp Tyr Glu
Tyr Leu Pro Ala Ala Leu 100 105
110Val Glu Tyr Ser Gly Ile Ser Val Thr Ala Gly Ser Val Val Thr Val
115 120 125Thr Ala Thr Lys Thr Gly Thr
Asn Ser Gly Val Thr Thr Leu Thr Ser 130 135
140Gly Gly Lys Thr Val Ser His Thr Phe Ser Arg Gln Asn Ser Pro
Leu145 150 155 160Pro Gly
Thr Ser Ala Glu Trp Ile Val Glu Asp Phe Thr Ser Gly Ser
165 170 175Ser Leu Val Pro Phe Ala Asp
Phe Gly Ser Val Thr Phe Thr Gly Ala 180 185
190Thr Ala Val Val Asn Gly Ala Thr Val Thr Ala Gly Gly Asp
Ser Pro 195 200 205Val Ile Ile Asp
Leu Glu Asp Ser Arg Gly Asp Ile Leu Thr Ser Thr 210
215 220Thr Val Ser Gly Ser Thr Val Thr Val Glu Tyr Glu225
230 23534612PRTTrichoderma reesei 34Met
Ala Lys Leu Ser Thr Leu Arg Leu Ala Ser Leu Leu Ser Leu Val1
5 10 15Ser Val Gln Val Ser Ala Ser
Val His Leu Leu Glu Ser Leu Glu Lys 20 25
30Leu Pro His Gly Trp Lys Ala Ala Glu Thr Pro Ser Pro Ser
Ser Gln 35 40 45Ile Val Leu Gln
Val Ala Leu Thr Gln Gln Asn Ile Asp Gln Leu Glu 50 55
60Ser Arg Leu Ala Ala Val Ser Thr Pro Thr Ser Ser Thr
Tyr Gly Lys65 70 75
80Tyr Leu Asp Val Asp Glu Ile Asn Ser Ile Phe Ala Pro Ser Asp Ala
85 90 95Ser Ser Ser Ala Val Glu
Ser Trp Leu Gln Ser His Gly Val Thr Ser 100
105 110Tyr Thr Lys Gln Gly Ser Ser Ile Trp Phe Gln Thr
Asn Ile Ser Thr 115 120 125Ala Asn
Ala Met Leu Ser Thr Asn Phe His Thr Tyr Ser Asp Leu Thr 130
135 140Gly Ala Lys Lys Val Arg Thr Leu Lys Tyr Ser
Ile Pro Glu Ser Leu145 150 155
160Ile Gly His Val Asp Leu Ile Ser Pro Thr Thr Tyr Phe Gly Thr Thr
165 170 175Lys Ala Met Arg
Lys Leu Lys Ser Ser Gly Val Ser Pro Ala Ala Asp 180
185 190Ala Leu Ala Ala Arg Gln Glu Pro Ser Ser Cys
Lys Gly Thr Leu Val 195 200 205Phe
Glu Gly Glu Thr Phe Asn Val Phe Gln Pro Asp Cys Leu Arg Thr 210
215 220Glu Tyr Ser Val Asp Gly Tyr Thr Pro Ser
Val Lys Ser Gly Ser Arg225 230 235
240Ile Gly Phe Gly Ser Phe Leu Asn Glu Ser Ala Ser Phe Ala Asp
Gln 245 250 255Ala Leu Phe
Glu Lys His Phe Asn Ile Pro Ser Gln Asn Phe Ser Val 260
265 270Val Leu Ile Asn Gly Gly Thr Asp Leu Pro
Gln Pro Pro Ser Asp Ala 275 280
285Asn Asp Gly Glu Ala Asn Leu Asp Ala Gln Thr Ile Leu Thr Ile Ala 290
295 300His Pro Leu Pro Ile Thr Glu Phe
Ile Thr Ala Gly Ser Pro Pro Tyr305 310
315 320Phe Pro Asp Pro Val Glu Pro Ala Gly Thr Pro Asn
Glu Asn Glu Pro 325 330
335Tyr Leu Gln Tyr Tyr Glu Phe Leu Leu Ser Lys Ser Asn Ala Glu Ile
340 345 350Pro Gln Val Ile Thr Asn
Ser Tyr Gly Asp Glu Glu Gln Thr Val Pro 355 360
365Arg Ser Tyr Ala Val Arg Val Cys Asn Leu Ile Gly Leu Leu
Gly Leu 370 375 380Arg Gly Ile Ser Val
Leu His Ser Ser Gly Asp Glu Gly Val Gly Ala385 390
395 400Ser Cys Val Ala Thr Asn Ser Thr Thr Pro
Gln Phe Asn Pro Ile Phe 405 410
415Pro Ala Thr Cys Pro Tyr Val Thr Ser Val Gly Gly Thr Val Ser Phe
420 425 430Asn Pro Glu Val Ala
Trp Ala Gly Ser Ser Gly Gly Phe Ser Tyr Tyr 435
440 445Phe Ser Arg Pro Trp Tyr Gln Gln Glu Ala Val Gly
Thr Tyr Leu Glu 450 455 460Lys Tyr Val
Ser Ala Glu Thr Lys Lys Tyr Tyr Gly Pro Tyr Val Asp465
470 475 480Phe Ser Gly Arg Gly Phe Pro
Asp Val Ala Ala His Ser Val Ser Pro 485
490 495Asp Tyr Pro Val Phe Gln Gly Gly Glu Leu Thr Pro
Ser Gly Gly Thr 500 505 510Ser
Ala Ala Ser Pro Val Val Ala Ala Ile Val Ala Leu Leu Asn Asp 515
520 525Ala Arg Leu Arg Glu Gly Lys Pro Thr
Leu Gly Phe Leu Asn Pro Leu 530 535
540Ile Tyr Leu His Ala Ser Lys Gly Phe Thr Asp Ile Thr Ser Gly Gln545
550 555 560Ser Glu Gly Cys
Asn Gly Asn Asn Thr Gln Thr Gly Ser Pro Leu Pro 565
570 575Gly Ala Gly Phe Ile Ala Gly Ala His Trp
Asn Ala Thr Lys Gly Trp 580 585
590Asp Pro Thr Thr Gly Phe Gly Val Pro Asn Leu Lys Lys Leu Leu Ala
595 600 605Leu Val Arg Phe
61035477PRTTrichoderma reesei 35Met Arg Phe Val Gln Tyr Val Ser Leu Ala
Gly Leu Phe Ala Ala Ala1 5 10
15Thr Val Ser Ala Gly Val Val Thr Val Pro Phe Glu Lys Arg Asn Leu
20 25 30Asn Pro Asp Phe Ala Pro
Ser Leu Leu Arg Arg Asp Gly Ser Val Ser 35 40
45Leu Asp Ala Ile Asn Asn Leu Thr Gly Gly Gly Tyr Tyr Ala
Gln Phe 50 55 60Ser Val Gly Thr Pro
Pro Gln Lys Leu Ser Phe Leu Leu Asp Thr Gly65 70
75 80Ser Ser Asp Thr Trp Val Asn Ser Val Thr
Ala Asp Leu Cys Thr Asp 85 90
95Glu Phe Thr Gln Gln Thr Val Gly Glu Tyr Cys Phe Arg Gln Phe Asn
100 105 110Pro Arg Arg Ser Ser
Ser Tyr Lys Ala Ser Thr Glu Val Phe Asp Ile 115
120 125Thr Tyr Leu Asp Gly Arg Arg Ile Arg Gly Asn Tyr
Phe Thr Asp Thr 130 135 140Val Thr Ile
Asn Gln Ala Asn Ile Thr Gly Gln Lys Ile Gly Leu Ala145
150 155 160Leu Gln Ser Val Arg Gly Thr
Gly Ile Leu Gly Leu Gly Phe Arg Glu 165
170 175Asn Glu Ala Ala Asp Thr Lys Tyr Pro Thr Val Ile
Asp Asn Leu Val 180 185 190Ser
Gln Lys Val Ile Pro Val Pro Ala Phe Ser Leu Tyr Leu Asn Asp 195
200 205Leu Gln Thr Ser Gln Gly Ile Leu Leu
Phe Gly Gly Val Asp Thr Asp 210 215
220Lys Phe His Gly Gly Leu Ala Thr Leu Pro Leu Gln Ser Leu Pro Pro225
230 235 240Ser Ile Ala Glu
Thr Gln Asp Ile Val Met Tyr Ser Val Asn Leu Asp 245
250 255Gly Phe Ser Ala Ser Asp Val Asp Thr Pro
Asp Val Ser Ala Lys Ala 260 265
270Val Leu Asp Ser Gly Ser Thr Ile Thr Leu Leu Pro Asp Ala Val Val
275 280 285Gln Glu Leu Phe Asp Glu Tyr
Asp Val Leu Asn Ile Gln Gly Leu Pro 290 295
300Val Pro Phe Ile Asp Cys Ala Lys Ala Asn Ile Lys Asp Ala Thr
Phe305 310 315 320Asn Phe
Lys Phe Asp Gly Lys Thr Ile Lys Val Pro Ile Asp Glu Met
325 330 335Val Leu Asn Asn Leu Ala Ala
Ala Ser Asp Glu Ile Met Ser Asp Pro 340 345
350Ser Leu Ser Lys Phe Phe Lys Gly Trp Ser Gly Val Cys Thr
Phe Gly 355 360 365Met Gly Ser Thr
Lys Thr Phe Gly Ile Gln Ser Asp Glu Phe Val Leu 370
375 380Leu Gly Asp Thr Phe Leu Arg Ser Ala Tyr Val Val
Tyr Asp Leu Gln385 390 395
400Asn Lys Gln Ile Gly Ile Ala Gln Ala Thr Leu Asn Ser Thr Ser Ser
405 410 415Thr Ile Val Glu Phe
Lys Ala Gly Ser Lys Thr Ile Pro Gly Pro Ala 420
425 430Ser Thr Gly Asp Asp Ser Asp Asp Ser Ser Asp Asp
Ser Asp Glu Asp 435 440 445Ser Ala
Gly Ala Ala Leu His Pro Thr Phe Ser Ile Ala Leu Ala Gly 450
455 460Thr Leu Phe Thr Ala Val Ser Met Met Met Ser
Val Leu465 470 475361263DNATrichoderma
reesei 36atggcgtcac tcatcaaaac tgccgtggac attgccaacg gccgccatgc
gctgtccaga 60tatgtcatct ttgggctctg gcttgcggat gcggtgctgt gcgggctgat
tatctggaaa 120gtgccttata cggaaatcga ctgggtcgcc tacatggagc aagtcaccca
gttcgtccac 180ggagagcgag actaccccaa gatggagggc ggcacagggc ccctggtgta
tcccgcggcc 240catgtgtaca tctacacagg gctctactac ctgacgaaca agggcaccga
catcctgctg 300gcgcagcagc tctttgccgt gctctacatg gctactctgg cggtcgtcat
gacatgctac 360tccaaggcca aggtcccgcc gtacatcttc ccgcttctca tcctctccaa
aagacttcac 420agcgtcttcg tcctgagatg cttcaacgac tgcttcgccg ccttcttcct
ctggctctgc 480atcttcttct tccagaggcg agagtggacc atcggagctc tcgcatacag
catcggcctg 540ggcgtcaaaa tgtcgctgct actggttctc cccgccgtgg tcatcgtcct
ctacctcggc 600cgcggcttca agggcgccct gcggctgctc tggctcatgg tgcaggtcca
gctcctcctc 660gccataccct tcatcacgac aaattggcgc ggctacctcg gccgtgcatt
cgagctctcg 720aggcagttca agtttgaatg gacagtcaat tggcgcatgc tgggcgagga
tctgttcctc 780agccggggct tctctatcac gctactggca tttcacgcca tcttcctcct
cgcctttatc 840ctcggccggt ggctgaagat tagggaacgg accgtactcg ggatgatccc
ctatgtcatc 900cgattcagat cgccctttac cgagcaggaa gagcgcgcca tctccaaccg
cgtcgtcacg 960cccggctatg tcatgtccac catcttgtcg gccaacgtgg tgggactgct
gtttgcccgg 1020tctctgcact accagttcta tgcatatctg gcgtgggcga ccccctatct
cctgtggacg 1080gcctgcccca atcttttggt ggtggccccc ctctgggcgg cgcaagaatg
ggcctggaac 1140gtcttcccca gcacgcctct tagctcgagc gtcgtggtga gcgtgctggc
cgtgacggtg 1200gccatggcgt ttgcaggttc aaatccgcag ccacgtgaaa catcgaagcc
gaagcagcac 1260taa
126337420PRTTrichoderma reesei 37Met Ala Ser Leu Ile Lys Thr
Ala Val Asp Ile Ala Asn Gly Arg His1 5 10
15Ala Leu Ser Arg Tyr Val Ile Phe Gly Leu Trp Leu Ala
Asp Ala Val 20 25 30Leu Cys
Gly Leu Ile Ile Trp Lys Val Pro Tyr Thr Glu Ile Asp Trp 35
40 45Val Ala Tyr Met Glu Gln Val Thr Gln Phe
Val His Gly Glu Arg Asp 50 55 60Tyr
Pro Lys Met Glu Gly Gly Thr Gly Pro Leu Val Tyr Pro Ala Ala65
70 75 80His Val Tyr Ile Tyr Thr
Gly Leu Tyr Tyr Leu Thr Asn Lys Gly Thr 85
90 95Asp Ile Leu Leu Ala Gln Gln Leu Phe Ala Val Leu
Tyr Met Ala Thr 100 105 110Leu
Ala Val Val Met Thr Cys Tyr Ser Lys Ala Lys Val Pro Pro Tyr 115
120 125Ile Phe Pro Leu Leu Ile Leu Ser Lys
Arg Leu His Ser Val Phe Val 130 135
140Leu Arg Cys Phe Asn Asp Cys Phe Ala Ala Phe Phe Leu Trp Leu Cys145
150 155 160Ile Phe Phe Phe
Gln Arg Arg Glu Trp Thr Ile Gly Ala Leu Ala Tyr 165
170 175Ser Ile Gly Leu Gly Val Lys Met Ser Leu
Leu Leu Val Leu Pro Ala 180 185
190Val Val Ile Val Leu Tyr Leu Gly Arg Gly Phe Lys Gly Ala Leu Arg
195 200 205Leu Leu Trp Leu Met Val Gln
Val Gln Leu Leu Leu Ala Ile Pro Phe 210 215
220Ile Thr Thr Asn Trp Arg Gly Tyr Leu Gly Arg Ala Phe Glu Leu
Ser225 230 235 240Arg Gln
Phe Lys Phe Glu Trp Thr Val Asn Trp Arg Met Leu Gly Glu
245 250 255Asp Leu Phe Leu Ser Arg Gly
Phe Ser Ile Thr Leu Leu Ala Phe His 260 265
270Ala Ile Phe Leu Leu Ala Phe Ile Leu Gly Arg Trp Leu Lys
Ile Arg 275 280 285Glu Arg Thr Val
Leu Gly Met Ile Pro Tyr Val Ile Arg Phe Arg Ser 290
295 300Pro Phe Thr Glu Gln Glu Glu Arg Ala Ile Ser Asn
Arg Val Val Thr305 310 315
320Pro Gly Tyr Val Met Ser Thr Ile Leu Ser Ala Asn Val Val Gly Leu
325 330 335Leu Phe Ala Arg Ser
Leu His Tyr Gln Phe Tyr Ala Tyr Leu Ala Trp 340
345 350Ala Thr Pro Tyr Leu Leu Trp Thr Ala Cys Pro Asn
Leu Leu Val Val 355 360 365Ala Pro
Leu Trp Ala Ala Gln Glu Trp Ala Trp Asn Val Phe Pro Ser 370
375 380Thr Pro Leu Ser Ser Ser Val Val Val Ser Val
Leu Ala Val Thr Val385 390 395
400Ala Met Ala Phe Ala Gly Ser Asn Pro Gln Pro Arg Glu Thr Ser Lys
405 410 415Pro Lys Gln His
42038445PRTHomo sapiens 38Met Leu Lys Lys Gln Ser Ala Gly Leu
Val Leu Trp Gly Ala Ile Leu1 5 10
15Phe Val Ala Trp Asn Ala Leu Leu Leu Leu Phe Phe Trp Thr Arg
Pro 20 25 30Ala Pro Gly Arg
Pro Pro Ser Val Ser Ala Leu Asp Gly Asp Pro Ala 35
40 45Ser Leu Thr Arg Glu Val Ile Arg Leu Ala Gln Asp
Ala Glu Val Glu 50 55 60Leu Glu Arg
Gln Arg Gly Leu Leu Gln Gln Ile Gly Asp Ala Leu Ser65 70
75 80Ser Gln Arg Gly Arg Val Pro Thr
Ala Ala Pro Pro Ala Gln Pro Arg 85 90
95Val Pro Val Thr Pro Ala Pro Ala Val Ile Pro Ile Leu Val
Ile Ala 100 105 110Cys Asp Arg
Ser Thr Val Arg Arg Cys Leu Asp Lys Leu Leu His Tyr 115
120 125Arg Pro Ser Ala Glu Leu Phe Pro Ile Ile Val
Ser Gln Asp Cys Gly 130 135 140His Glu
Glu Thr Ala Gln Ala Ile Ala Ser Tyr Gly Ser Ala Val Thr145
150 155 160His Ile Arg Gln Pro Asp Leu
Ser Ser Ile Ala Val Pro Pro Asp His 165
170 175Arg Lys Phe Gln Gly Tyr Tyr Lys Ile Ala Arg His
Tyr Arg Trp Ala 180 185 190Leu
Gly Gln Val Phe Arg Gln Phe Arg Phe Pro Ala Ala Val Val Val 195
200 205Glu Asp Asp Leu Glu Val Ala Pro Asp
Phe Phe Glu Tyr Phe Arg Ala 210 215
220Thr Tyr Pro Leu Leu Lys Ala Asp Pro Ser Leu Trp Cys Val Ser Ala225
230 235 240Trp Asn Asp Asn
Gly Lys Glu Gln Met Val Asp Ala Ser Arg Pro Glu 245
250 255Leu Leu Tyr Arg Thr Asp Phe Phe Pro Gly
Leu Gly Trp Leu Leu Leu 260 265
270Ala Glu Leu Trp Ala Glu Leu Glu Pro Lys Trp Pro Lys Ala Phe Trp
275 280 285Asp Asp Trp Met Arg Arg Pro
Glu Gln Arg Gln Gly Arg Ala Cys Ile 290 295
300Arg Pro Glu Ile Ser Arg Thr Met Thr Phe Gly Arg Lys Gly Val
Ser305 310 315 320His Gly
Gln Phe Phe Asp Gln His Leu Lys Phe Ile Lys Leu Asn Gln
325 330 335Gln Phe Val His Phe Thr Gln
Leu Asp Leu Ser Tyr Leu Gln Arg Glu 340 345
350Ala Tyr Asp Arg Asp Phe Leu Ala Arg Val Tyr Gly Ala Pro
Gln Leu 355 360 365Gln Val Glu Lys
Val Arg Thr Asn Asp Arg Lys Glu Leu Gly Glu Val 370
375 380Arg Val Gln Tyr Thr Gly Arg Asp Ser Phe Lys Ala
Phe Ala Lys Ala385 390 395
400Leu Gly Val Met Asp Asp Leu Lys Ser Gly Val Pro Arg Ala Gly Tyr
405 410 415Arg Gly Ile Val Thr
Phe Gln Phe Arg Gly Arg Arg Val His Leu Ala 420
425 430Pro Pro Leu Thr Trp Glu Gly Tyr Asp Pro Ser Trp
Asn 435 440 44539447PRTHomo
sapiens 39Met Arg Phe Arg Ile Tyr Lys Arg Lys Val Leu Ile Leu Thr Leu
Val1 5 10 15Val Ala Ala
Cys Gly Phe Val Leu Trp Ser Ser Asn Gly Arg Gln Arg 20
25 30Lys Asn Glu Ala Leu Ala Pro Pro Leu Leu
Asp Ala Glu Pro Ala Arg 35 40
45Gly Ala Gly Gly Arg Gly Gly Asp His Pro Ser Val Ala Val Gly Ile 50
55 60Arg Arg Val Ser Asn Val Ser Ala Ala
Ser Leu Val Pro Ala Val Pro65 70 75
80Gln Pro Glu Ala Asp Asn Leu Thr Leu Arg Tyr Arg Ser Leu
Val Tyr 85 90 95Gln Leu
Asn Phe Asp Gln Thr Leu Arg Asn Val Asp Lys Ala Gly Thr 100
105 110Trp Ala Pro Arg Glu Leu Val Leu Val
Val Gln Val His Asn Arg Pro 115 120
125Glu Tyr Leu Arg Leu Leu Leu Asp Ser Leu Arg Lys Ala Gln Gly Ile
130 135 140Asp Asn Val Leu Val Ile Phe
Ser His Asp Phe Trp Ser Thr Glu Ile145 150
155 160Asn Gln Leu Ile Ala Gly Val Asn Phe Cys Pro Val
Leu Gln Val Phe 165 170
175Phe Pro Phe Ser Ile Gln Leu Tyr Pro Asn Glu Phe Pro Gly Ser Asp
180 185 190Pro Arg Asp Cys Pro Arg
Asp Leu Pro Lys Asn Ala Ala Leu Lys Leu 195 200
205Gly Cys Ile Asn Ala Glu Tyr Pro Asp Ser Phe Gly His Tyr
Arg Glu 210 215 220Ala Lys Phe Ser Gln
Thr Lys His His Trp Trp Trp Lys Leu His Phe225 230
235 240Val Trp Glu Arg Val Lys Ile Leu Arg Asp
Tyr Ala Gly Leu Ile Leu 245 250
255Phe Leu Glu Glu Asp His Tyr Leu Ala Pro Asp Phe Tyr His Val Phe
260 265 270Lys Lys Met Trp Lys
Leu Lys Gln Gln Glu Cys Pro Glu Cys Asp Val 275
280 285Leu Ser Leu Gly Thr Tyr Ser Ala Ser Arg Ser Phe
Tyr Gly Met Ala 290 295 300Asp Lys Val
Asp Val Lys Thr Trp Lys Ser Thr Glu His Asn Met Gly305
310 315 320Leu Ala Leu Thr Arg Asn Ala
Tyr Gln Lys Leu Ile Glu Cys Thr Asp 325
330 335Thr Phe Cys Thr Tyr Asp Asp Tyr Asn Trp Asp Trp
Thr Leu Gln Tyr 340 345 350Leu
Thr Val Ser Cys Leu Pro Lys Phe Trp Lys Val Leu Val Pro Gln 355
360 365Ile Pro Arg Ile Phe His Ala Gly Asp
Cys Gly Met His His Lys Lys 370 375
380Thr Cys Arg Pro Ser Thr Gln Ser Ala Gln Ile Glu Ser Leu Leu Asn385
390 395 400Asn Asn Lys Gln
Tyr Met Phe Pro Glu Thr Leu Thr Ile Ser Glu Lys 405
410 415Phe Thr Val Val Ala Ile Ser Pro Pro Arg
Lys Asn Gly Gly Trp Gly 420 425
430Asp Ile Arg Asp His Glu Leu Cys Lys Ser Tyr Arg Arg Leu Gln
435 440 4454085PRTTrichoderma reesei
40Met Ala Ser Thr Asn Ala Arg Tyr Val Arg Tyr Leu Leu Ile Ala Phe1
5 10 15Phe Thr Ile Leu Val Phe
Tyr Phe Val Ser Asn Ser Lys Tyr Glu Gly 20 25
30Val Asp Leu Asn Lys Gly Thr Phe Thr Ala Pro Asp Ser
Thr Lys Thr 35 40 45Thr Pro Lys
Pro Pro Ala Thr Gly Asp Ala Lys Asp Phe Pro Leu Ala 50
55 60Leu Thr Pro Asn Asp Pro Gly Phe Asn Asp Leu Val
Gly Ile Ala Pro65 70 75
80Gly Pro Arg Met Asn 8541255DNATrichoderma reesei
41atggcgtcaa caaatgcgcg ctatgtgcgc tatctactaa tcgccttctt cacaatcctc
60gtcttctact ttgtctccaa ttcaaagtat gagggcgtcg atctcaacaa gggcaccttc
120acagctccgg attcgaccaa gacgacacca aagccgccag ccactggcga tgccaaagac
180tttcctctgg ccctgacgcc gaacgatcca ggcttcaacg acctcgtcgg catcgctccc
240ggccctcgaa tgaac
2554258PRTHomo sapiens 42Met Arg Phe Arg Ile Tyr Lys Arg Lys Val Leu Ile
Leu Thr Leu Val1 5 10
15Val Ala Ala Cys Gly Phe Val Leu Trp Ser Ser Asn Gly Arg Gln Arg
20 25 30Lys Asn Glu Ala Leu Ala Pro
Pro Leu Leu Asp Ala Glu Pro Ala Arg 35 40
45Gly Ala Gly Gly Arg Gly Gly Asp His Pro 50
554351PRTTrichoderma reesei 43Met Ala Ser Thr Asn Ala Arg Tyr Val Arg Tyr
Leu Leu Ile Ala Phe1 5 10
15Phe Thr Ile Leu Val Phe Tyr Phe Val Ser Asn Ser Lys Tyr Glu Gly
20 25 30Val Asp Leu Asn Lys Gly Thr
Phe Thr Ala Pro Asp Ser Thr Lys Thr 35 40
45Thr Pro Lys 504452PRTTrichoderma reesei 44Met Ala Ile Ala
Arg Pro Val Arg Ala Leu Gly Gly Leu Ala Ala Ile1 5
10 15Leu Trp Cys Phe Phe Leu Tyr Gln Leu Leu
Arg Pro Ser Ser Ser Tyr 20 25
30Asn Ser Pro Gly Asp Arg Tyr Ile Asn Phe Glu Arg Asp Pro Asn Leu
35 40 45Asp Pro Thr Gly
504533PRTTrichoderma reesei 45Met Leu Asn Pro Arg Arg Ala Leu Ile Ala Ala
Ala Phe Ile Leu Thr1 5 10
15Val Phe Phe Leu Ile Ser Arg Ser His Asn Ser Glu Ser Ala Ser Thr
20 25 30Ser4684PRTTrichoderma
reesei 46Met Met Pro Arg His His Ser Ser Gly Phe Ser Asn Gly Tyr Pro Arg1
5 10 15Ala Asp Thr Phe
Glu Ile Ser Pro His Arg Phe Gln Pro Arg Ala Thr 20
25 30Leu Pro Pro His Arg Lys Arg Lys Arg Thr Ala
Ile Arg Val Gly Ile 35 40 45Ala
Val Val Val Ile Leu Val Leu Val Leu Trp Phe Gly Gln Pro Arg 50
55 60Ser Val Ala Ser Leu Ile Ser Leu Gly Ile
Leu Ser Gly Tyr Asp Asp65 70 75
80Leu Lys Leu Glu4755PRTTrichoderma reesei 47Met Leu Leu Pro Lys
Gly Gly Leu Asp Trp Arg Ser Ala Arg Ala Gln1 5
10 15Ile Pro Pro Thr Arg Ala Leu Trp Asn Ala Val
Thr Arg Thr Arg Phe 20 25
30Ile Leu Leu Val Gly Ile Thr Gly Leu Ile Leu Leu Leu Trp Arg Gly
35 40 45Val Ser Thr Ser Ala Ser Glu
50 554869DNAArtificial SequencePrimer 48cgattaagtt
gggtaacgcc agggttttcc cagtcacgac ggtttaaacg ctgcagggcg 60tacagaact
694969DNAArtificial SequencePrimer 49atctctcaaa ggaagaatcc cttcagggtt
gcgtttccag tgcggccgcg gctctaaaat 60gcttcacag
695068DNAArtificial SequencePrimer
50cggttctcat ctgggcttgc tcggtcctgg cgtagatcta gcggccgcac gatgatgatg
60acagccag
685169DNAArtificial SequencePrimer 51gtggaattgt gagcggataa caatttcaca
caggaaacag cgtttaaacc gtccagctcc 60cgcagcgcc
695284DNAArtificial SequencePrimer
52atcgctaact gctttctctt ctgtgaagca ttttagagcc gcggccgcgg ccggccgcga
60tcgcctagat ctacgccagg accg
845348DNAArtificial SequencePrimer 53cggtcctggc gtagatctag ggcgcgccac
tggaaacgca accctgaa 485448DNAArtificial SequencePrimer
54ttcagggttg cgtttccagt ggcgcgccct agatctacgc caggaccg
485568DNAArtificial SequencePrimer 55agcatcatga ccgccccctt ctggctgtca
tcatcatcgt gcggccgcga ttattgcaca 60agcagcga
685620DNAArtificial SequencePrimer
56tatggcttta gatggggaca
205720DNAArtificial SequencePrimer 57tgcgtcgccg tctcgctcct
205820DNAArtificial SequencePrimer
58ttaggcgacc tctttttcca
205918DNAArtificial SequencePrimer 59cctgtatcgt cctgttcc
186020DNAArtificial SequencePrimer
60gcgcctgtcg agtcggcatt
206120DNAArtificial SequencePrimer 61caccggccat gctcttgcca
206218DNAArtificial SequencePrimer
62caaggtgccc tatgtcgc
186318DNAArtificial SequencePrimer 63gatcgggtca ggacggaa
186418DNAArtificial SequencePrimer
64agcctgtctg agggacgg
186518DNAArtificial SequencePrimer 65caaggtcgag attcggca
186617DNAArtificial SequencePrimer
66cagaaggggg cggtcat
176717DNAArtificial SequencePrimer 67gtcccagctc ccgctct
176820DNAArtificial SequencePrimer
68gcgcctgtcg agtcggcatt
206920DNAArtificial SequencePrimer 69caccggccat gctcttgcca
207069DNAArtificial SequencePrimer
70cgattaagtt gggtaacgcc agggttttcc cagtcacgac ggtttaaacg tttcaggtac
60caacacctg
697169DNAArtificial SequencePrimer 71atctctcaaa ggaagaatcc cttcagggtt
gcgtttccag tgcggccgcg gcgaagagtc 60tggcgggga
697268DNAArtificial SequencePrimer
72cggttctcat ctgggcttgc tcggtcctgg cgtagatcta gcggccgcaa gaggatgggg
60gtaaagct
687369DNAArtificial SequencePrimer 73gtggaattgt gagcggataa caatttcaca
caggaaacag cgtttaaacg aggaggactc 60gtgagttat
697484DNAArtificial SequencePrimer
74gcgcccttcc gcctcgacaa tccccgccag actcttcgcc gcggccgcgg ccggccgcga
60tcgcctagat ctacgccagg accg
847548DNAArtificial SequencePrimer 75cggtcctggc gtagatctag ggcgcgccac
tggaaacgca accctgaa 487648DNAArtificial SequencePrimer
76ttcagggttg cgtttccagt ggcgcgccct agatctacgc caggaccg
487768DNAArtificial SequencePrimer 77gagctggcca gaaaagacca agctttaccc
ccatcctctt gcggccgcga ttattgcaca 60agcagcga
687820DNAArtificial SequencePrimer
78acgagttgtt tcgtgtaccg
207921DNAArtificial SequencePrimer 79ctttccattc atcagggatg g
218020DNAArtificial SequencePrimer
80ggagactcag tgaagagagg
208118DNAArtificial SequencePrimer 81atgttgcagt tgcgaaag
188220DNAArtificial SequencePrimer
82ccctcgtcgc agaaaagatg
208320DNAArtificial SequencePrimer 83agcctccttg ggaacctcag
208420DNAArtificial SequencePrimer
84cttagtgcgg ctggagggcg
208520DNAArtificial SequencePrimer 85ggccggttcg tgcaactgga
208620DNAArtificial SequencePrimer
86ggccgcaaga ggatgggggt
208721DNAArtificial SequencePrimer 87tcgggccagc tgaagcacaa c
218820DNAArtificial SequencePrimer
88ttgaggaacg gctgcctgcg
208920DNAArtificial SequencePrimer 89cgatggctcc gtcatccgcc
209020DNAArtificial SequencePrimer
90acgagttgtt tcgtgtaccg
209120DNAArtificial SequencePrimer 91tgcgtcgccg tctcgctcct
209220DNAArtificial SequencePrimer
92ttaggcgacc tctttttcca
209318DNAArtificial SequencePrimer 93atgttgcagt tgcgaaag
189420DNAArtificial SequencePrimer
94ccctcgtcgc agaaaagatg
209520DNAArtificial SequencePrimer 95agcctccttg ggaacctcag
209620DNAArtificial SequencePrimer
96cttagtgcgg ctggagggcg
209720DNAArtificial SequencePrimer 97ggccggttcg tgcaactgga
209820DNAArtificial SequencePrimer
98ggccgcaaga ggatgggggt
209921DNAArtificial SequencePrimer 99tcgggccagc tgaagcacaa c
2110020DNAArtificial SequencePrimer
100ccctcgtcgc agaaaagatg
2010120DNAArtificial SequencePrimer 101agcctccttg ggaacctcag
2010269DNAArtificial SequencePrimer
102cgattaagtt gggtaacgcc agggttttcc cagtcacgac ggtttaaacg tgtttaaatt
60tgatgaggc
6910369DNAArtificial SequencePrimer 103atctctcaaa ggaagaatcc cttcagggtt
gcgtttccag tgcggccgcg gtctcagaga 60cagccttct
6910468DNAArtificial SequencePrimer
104cggttctcat ctgggcttgc tcggtcctgg cgtagatcta gcggccgcac tcggcttctt
60tgtccgag
6810569DNAArtificial SequencePrimer 105gtggaattgt gagcggataa caatttcaca
caggaaacag cgtttaaact cctcgtcggc 60aacaaggcc
6910684DNAArtificial SequencePrimer
106gcagatctgg gggaggaatc agaaggctgt ctctgagacc gcggccgcgg ccggccgcga
60tcgcctagat ctacgccagg accg
8410748DNAArtificial SequencePrimer 107cggtcctggc gtagatctag ggcgcgccac
tggaaacgca accctgaa 4810848DNAArtificial SequencePrimer
108ttcagggttg cgtttccagt ggcgcgccct agatctacgc caggaccg
4810968DNAArtificial SequencePrimer 109aaagtgggcg agctgagata ctcggacaaa
gaagccgagt gcggccgcga ttattgcaca 60agcagcga
6811018DNAArtificial SequencePrimer
110acgggagatc tcggaaaa
1811121DNAArtificial SequencePrimer 111ctttccattc atcagggatg g
2111220DNAArtificial SequencePrimer
112ggagactcag tgaagagagg
2011318DNAArtificial SequencePrimer 113atgaagctca gcctgtgg
1811418DNAArtificial SequencePrimer
114ggggacggct tgaggaag
1811520DNAArtificial SequencePrimer 115ctgcttgctg cttccagtca
2011620DNAArtificial SequencePrimer
116tggcagatgc cgaaaggcgg
2011720DNAArtificial SequencePrimer 117tggcaaccag ctgtggctcc
2011820DNAArtificial SequencePrimer
118cggccgcact cggcttcttt
2011920DNAArtificial SequencePrimer 119gagtgggcta ggcgcaacgg
2012020DNAArtificial SequencePrimer
120ggatcggcca ctgccaccac
2012120DNAArtificial SequencePrimer 121gcccacttct ctgcgcgtgt
2012218DNAArtificial SequencePrimer
122acgggagatc tcggaaaa
1812320DNAArtificial SequencePrimer 123ccatgagctt gaacaggtaa
2012420DNAArtificial SequencePrimer
124ttaggcgacc tctttttcca
2012518DNAArtificial SequencePrimer 125atgaagctca gcctgtgg
1812620DNAArtificial SequencePrimer
126ggatcggcca ctgccaccac
2012720DNAArtificial SequencePrimer 127gcccacttct ctgcgcgtgt
2012820DNAArtificial SequencePrimer
128tggcagatgc cgaaaggcgg
2012920DNAArtificial SequencePrimer 129tggcaaccag ctgtggctcc
2013020DNAArtificial SequencePrimer
130cggccgcact cggcttcttt
2013120DNAArtificial SequencePrimer 131gagtgggcta ggcgcaacgg
2013217DNAArtificial SequencePrimer
132ctctgcgcgt gttgtgg
1713317DNAArtificial SequencePrimer 133taagggtgcg gattcgg
17134488PRTTrichoderma reesei 134Met
Arg Ala Ser Pro Leu Ala Val Ala Gly Val Ala Leu Ala Ser Ala1
5 10 15Ala Gln Ala Gln Val Val Gln
Phe Asp Ile Glu Lys Arg His Ala Pro 20 25
30Arg Leu Ser Arg Arg Asp Gly Thr Ile Asp Gly Thr Leu Ser
Asn Gln 35 40 45Arg Val Gln Gly
Gly Tyr Phe Ile Asn Val Gln Val Gly Ser Pro Gly 50 55
60Gln Asn Ile Thr Leu Gln Leu Asp Thr Gly Ser Ser Asp
Val Trp Val65 70 75
80Pro Ser Ser Thr Ala Ala Ile Cys Thr Gln Val Ser Glu Arg Asn Pro
85 90 95Gly Cys Gln Phe Gly Ser
Phe Asn Pro Asp Asp Ser Asp Thr Phe Asp 100
105 110Glu Val Gly Gln Gly Leu Phe Asp Ile Thr Tyr Val
Asp Gly Ser Ser 115 120 125Ser Lys
Gly Asp Tyr Phe Gln Asp Asn Phe Gln Ile Asn Gly Val Thr 130
135 140Val Lys Asn Leu Thr Met Gly Leu Gly Leu Ser
Ser Ser Ile Pro Asn145 150 155
160Gly Leu Ile Gly Val Gly Tyr Met Asn Asp Glu Ala Ser Val Ser Thr
165 170 175Thr Arg Ser Thr
Tyr Pro Asn Leu Pro Ile Val Leu Gln Gln Gln Lys 180
185 190Leu Ile Asn Ser Val Ala Phe Ser Leu Trp Leu
Asn Asp Leu Asp Ala 195 200 205Ser
Thr Gly Ser Ile Leu Phe Gly Gly Ile Asp Thr Glu Lys Tyr His 210
215 220Gly Asp Leu Thr Ser Ile Asp Ile Ile Ser
Pro Asn Gly Gly Lys Thr225 230 235
240Phe Thr Glu Phe Ala Val Asn Leu Tyr Ser Val Gln Ala Thr Ser
Pro 245 250 255Ser Gly Thr
Asp Thr Leu Ser Thr Ser Glu Asp Thr Leu Ile Ala Val 260
265 270Leu Asp Ser Gly Thr Thr Leu Thr Tyr Leu
Pro Gln Asp Met Ala Glu 275 280
285Glu Ala Trp Asn Glu Val Gly Ala Glu Tyr Ser Asn Glu Leu Gly Leu 290
295 300Ala Val Val Pro Cys Ser Val Gly
Asn Thr Asn Gly Phe Phe Ser Phe305 310
315 320Thr Phe Ala Gly Thr Asp Gly Pro Thr Ile Asn Val
Thr Leu Ser Glu 325 330
335Leu Val Leu Asp Leu Phe Ser Gly Gly Pro Ala Pro Arg Phe Ser Ser
340 345 350Gly Pro Asn Lys Gly Gln
Ser Ile Cys Glu Phe Gly Ile Gln Asn Gly 355 360
365Thr Gly Ser Pro Phe Leu Leu Gly Asp Thr Phe Leu Arg Ser
Ala Phe 370 375 380Val Val Tyr Asp Leu
Val Asn Asn Gln Ile Ala Ile Ala Pro Thr Asn385 390
395 400Phe Asn Ser Thr Arg Thr Asn Val Val Ala
Phe Ala Ser Ser Gly Ala 405 410
415Pro Ile Pro Ser Ala Thr Ala Ala Pro Asn Gln Ser Arg Thr Gly His
420 425 430Ser Ser Ser Thr His
Ser Gly Leu Ser Ala Ala Ser Gly Phe His Asp 435
440 445Gly Asp Asp Glu Asn Ala Gly Ser Leu Thr Ser Val
Phe Ser Gly Pro 450 455 460Gly Met Ala
Val Val Gly Met Thr Ile Cys Tyr Thr Leu Leu Gly Ser465
470 475 480Ala Ile Phe Gly Ile Gly Trp
Leu 485135761PRTTrichoderma reesei 135Met Arg Ser Thr Leu
Tyr Gly Leu Ala Ala Leu Pro Leu Ala Ala Gln1 5
10 15Ala Leu Glu Phe Ile Asp Asp Thr Val Ala Gln
Gln Asn Gly Ile Met 20 25
30Arg Tyr Thr Leu Thr Thr Thr Lys Gly Ala Thr Ser Lys His Leu His
35 40 45Arg Arg Gln Asp Ser Ala Asp Leu
Met Ser Gln Gln Thr Gly Tyr Phe 50 55
60Tyr Ser Ile Gln Leu Glu Ile Gly Thr Pro Pro Gln Ala Val Ser Val65
70 75 80Asn Phe Asp Thr Gly
Ser Ser Glu Leu Trp Val Asn Pro Val Cys Ser 85
90 95Lys Ala Thr Asp Pro Ala Phe Cys Lys Thr Phe
Gly Gln Tyr Asn His 100 105
110Ser Thr Thr Phe Val Asp Ala Lys Ala Pro Gly Gly Ile Lys Tyr Gly
115 120 125Thr Gly Phe Val Asp Phe Asn
Tyr Gly Tyr Asp Tyr Val Gln Leu Gly 130 135
140Ser Leu Arg Ile Asn Gln Gln Val Phe Gly Val Ala Thr Asp Ser
Glu145 150 155 160Phe Ala
Ser Val Gly Ile Leu Gly Ala Gly Pro Asp Leu Ser Gly Trp
165 170 175Thr Ser Pro Tyr Pro Phe Val
Ile Asp Asn Leu Val Lys Gln Gly Phe 180 185
190Ile Lys Ser Arg Ala Phe Ser Leu Asp Ile Arg Gly Leu Asp
Ser Asp 195 200 205Arg Gly Ser Val
Thr Tyr Gly Gly Ile Asp Ile Lys Lys Phe Ser Gly 210
215 220Pro Leu Ala Lys Lys Pro Ile Ile Pro Ala Ala Gln
Ser Pro Asp Gly225 230 235
240Tyr Thr Arg Tyr Trp Val His Met Asp Gly Met Ser Ile Thr Lys Glu
245 250 255Asp Gly Ser Lys Phe
Glu Ile Phe Asp Lys Pro Asn Gly Gln Pro Val 260
265 270Leu Leu Asp Ser Gly Tyr Thr Val Ser Thr Leu Pro
Gly Pro Leu Met 275 280 285Asp Lys
Ile Leu Glu Ala Phe Pro Ser Ala Arg Leu Glu Ser Thr Ser 290
295 300Gly Asp Tyr Ile Val Asp Cys Asp Ile Ile Asp
Thr Pro Gly Arg Val305 310 315
320Asn Phe Lys Phe Gly Asn Val Val Val Asp Val Glu Tyr Lys Asp Phe
325 330 335Ile Trp Gln Gln
Pro Asp Leu Gly Ile Cys Lys Leu Gly Val Ser Gln 340
345 350Asp Asp Asn Phe Pro Val Leu Gly Asp Thr Phe
Leu Arg Ala Ala Tyr 355 360 365Val
Val Phe Asp Trp Asp Asn Gln Glu Val His Ile Ala Ala Asn Glu 370
375 380Asp Cys Gly Asp Glu Leu Ile Pro Ile Gly
Ser Gly Pro Asp Ala Ile385 390 395
400Pro Ala Ser Ala Ile Gly Lys Cys Ser Pro Ser Val Lys Thr Asp
Thr 405 410 415Thr Thr Ser
Val Ala Glu Thr Thr Ala Thr Ser Ala Ala Ala Ser Thr 420
425 430Ser Glu Leu Ala Ala Thr Thr Ser Glu Ala
Ala Thr Thr Ser Ser Glu 435 440
445Ala Ala Thr Thr Ser Ala Ala Ala Glu Thr Thr Ser Val Pro Leu Asn 450
455 460Thr Ala Pro Ala Thr Thr Gly Leu
Leu Pro Thr Thr Ser His Arg Phe465 470
475 480Ser Asn Gly Thr Ala Pro Tyr Pro Ile Pro Ser Leu
Ser Ser Val Ala 485 490
495Ala Ala Ala Gly Ser Ser Thr Val Pro Ser Glu Ser Ser Thr Gly Ala
500 505 510Ala Ala Ala Gly Thr Thr
Ser Ala Ala Thr Gly Ser Gly Ser Gly Ser 515 520
525Gly Ser Gly Asp Ala Thr Thr Ala Ser Ala Thr Tyr Thr Ser
Thr Phe 530 535 540Thr Thr Thr Asn Val
Tyr Thr Val Thr Ser Cys Pro Pro Ser Val Thr545 550
555 560Asn Cys Pro Val Gly His Val Thr Thr Glu
Val Val Val Ala Tyr Thr 565 570
575Thr Trp Cys Pro Val Glu Asn Gly Pro His Pro Thr Ala Pro Pro Lys
580 585 590Pro Ala Ala Pro Glu
Ile Thr Ala Thr Phe Thr Leu Pro Asn Thr Tyr 595
600 605Thr Cys Ser Gln Gly Lys Asn Thr Cys Ser Asn Pro
Lys Thr Ala Pro 610 615 620Asn Val Ile
Val Val Thr Pro Ile Val Thr Gln Thr Ala Pro Val Val625
630 635 640Ile Pro Gly Ile Ala Ala Pro
Thr Pro Thr Pro Ser Val Ala Ala Ser 645
650 655Ser Pro Ala Ser Pro Ser Val Val Pro Ser Pro Thr
Ala Pro Val Ala 660 665 670Thr
Ser Pro Ala Gln Ser Ala Tyr Tyr Pro Pro Pro Pro Pro Pro Glu 675
680 685His Ala Val Ser Thr Pro Val Ala Asn
Pro Pro Ala Val Thr Pro Ala 690 695
700Pro Ala Pro Phe Pro Ser Gly Gly Leu Thr Thr Val Ile Ala Pro Gly705
710 715 720Ser Thr Gly Val
Pro Ser Gln Pro Ala Gln Ser Gly Leu Pro Pro Val 725
730 735Pro Ala Gly Ala Ala Gly Phe Arg Ala Pro
Ala Ala Val Ala Leu Leu 740 745
750Ala Gly Ala Val Ala Ala Ala Leu Leu 755
760136439PRTNeurospora crassa 136Met Val Ala Leu Thr Asn Leu Leu Leu Thr
Thr Leu Leu Ala Ser Ala1 5 10
15Gly Leu Gly Ala Ala Leu Pro Pro Arg Ile Gly Ser Thr Val Ile Glu
20 25 30Ala Arg Glu Pro Glu Leu
Pro Val Ser Gly Arg Lys Ile Thr Leu Pro 35 40
45Gln Gln Lys Asn Pro Arg Phe His Lys Phe Asn Gly Ala Leu
Ser Val 50 55 60Tyr Lys Thr Tyr Leu
Lys Tyr Gly Ala Pro Val Pro Asp His Leu Val65 70
75 80Gln Ala Val Ala Asn His Leu Gly Ile Ser
Val Glu Glu Val His Asn 85 90
95Tyr Ala Asn Thr Thr Ala Asn Ala Arg Arg Asp Gln Gly Ser Ala Thr
100 105 110Ala Ala Pro Ile Asp
Gln Ser Asp Ser Ala Tyr Ile Thr Pro Val Ser 115
120 125Ile Gly Thr Pro Ala Gln Thr Leu Asn Leu Asp Phe
Asp Thr Gly Ser 130 135 140Ser Asp Leu
Trp Val Phe Ser Asn Ser Leu Pro Ser Ser Gln Arg Ala145
150 155 160Gly His Thr Ile Tyr Asn Pro
Ser Lys Ser Ser Thr Ala Lys Arg Val 165
170 175Asn Gly Ala Ser Trp Asp Ile Ser Tyr Gly Asp Gly
Ser Ser Ser Lys 180 185 190Gly
Gln Val Tyr Leu Asp Lys Val Thr Ile Gly Gly Leu Val Val Ser 195
200 205Asn Gln Ala Val Glu Thr Ala Gln Gln
Val Ser Gln Ser Phe Thr Ala 210 215
220Glu Thr Ser Ile Asp Gly Leu Val Gly Leu Ala Phe Gly Ser Leu Asn225
230 235 240Thr Val Arg Pro
Arg Gln Gln Lys Thr Trp Phe Glu Asn Ala Ile Gly 245
250 255Gln Leu Asp Gln Pro Leu Phe Ala Ala Asp
Leu Lys Tyr Glu Ala Ser 260 265
270Gly Thr Tyr Asp Phe Gly Phe Ile Asp Pro Ala Lys His Thr Gly Asp
275 280 285Ile Thr Tyr Val Pro Val Asn
Thr Asn Pro Gly Tyr Trp Thr Trp Thr 290 295
300Ser Thr Gly Tyr Gln Val Gly Ser Ser Pro Phe Val Ser Gln Ser
Ile305 310 315 320Thr Asn
Ile Ala Asp Thr Gly Thr Thr Leu Met Tyr Val Pro Asp Ser
325 330 335Ile Leu Arg Ala Tyr Tyr Gly
Gln Ile Arg Gly Ala Thr Asn Ser Gln 340 345
350Ser Tyr Gly Gly Tyr Val Phe Pro Cys Ser Thr Glu Ala Pro
Asp Phe 355 360 365Thr Phe Gly Val
Thr Asp Glu Ala Thr Ile Thr Ile Pro Gly Arg Phe 370
375 380Ile Asn Tyr Gly Pro Val Thr Asp Asp Gly Glu Thr
Cys Phe Gly Gly385 390 395
400Leu Gln Thr Ser Ser Asp Val Gly Ile Asn Ile Phe Gly Asp Val Ala
405 410 415Leu Lys Ala Ala Tyr
Val Val Phe Lys Gly Gly Asp Ser Pro Ser Leu 420
425 430Gly Trp Ala Ser Lys Gln Leu
435137417PRTMyceliophthora thermophila 137Met His Leu Thr Pro Ala Leu Val
Ala Ala Thr Cys Ala Val Glu Val1 5 10
15Cys Ala Gly Val Leu Pro Arg Ser Ser Ser Thr Pro Thr Thr
Phe Gly 20 25 30Ser Gly Thr
Leu Ser Leu Lys Gln Val Arg Asn Pro Asn Phe Val Arg 35
40 45Asn Gly Pro Val Gln Leu Ala Arg Ile Tyr His
Lys Tyr Gly Val Pro 50 55 60Leu Pro
His Asp Leu Arg Glu Ala Val Ala Arg Phe Arg Ala Glu Ile65
70 75 80Arg Lys Arg Ser Asn Gly Ser
Thr Glu Thr Asn Pro Glu Thr Asn Asp 85 90
95Val Glu Tyr Leu Thr Pro Val Ser Ile Gly Thr Pro Pro
Gln Val Leu 100 105 110Asn Leu
Asp Phe Asp Thr Gly Ser Ser Asp Leu Trp Val Phe Ser Ser 115
120 125Glu Thr Arg Ser Ser Asp Val Gln Gly Gln
Thr Ile Tyr Asp Pro Asn 130 135 140Glu
Ser Ser Thr Ala Gln Lys Leu Gln Gly Tyr Ser Trp Gln Ile Ser145
150 155 160Tyr Gly Asp Gly Ser Ser
Ser Ser Gly Asp Val Tyr Thr Asp Ala Val 165
170 175Thr Val Gly Gly Leu Thr Val Pro Ser Gln Ala Val
Glu Val Ala Arg 180 185 190Arg
Val Ser Asp Glu Phe Thr Ser Asp Pro Asn Asn Asp Gly Leu Leu 195
200 205Gly Leu Gly Phe Ser Ser Ile Asn Thr
Val Gln Pro Val Pro Gln Lys 210 215
220Thr Phe Phe Asp Asn Ala Lys Ala Asp Leu Asp Ala Pro Ile Phe Thr225
230 235 240Ala Asp Leu Lys
Ala Ser Ala Pro Gly Phe Phe Asn Phe Gly Tyr Ile 245
250 255Asp His Gly Ala Tyr Thr Gly Glu Ile Thr
Tyr Met Pro Val Asp Ser 260 265
270Ser Asp Gly Phe Trp Ala Trp Thr Ser Pro Gly Tyr Ala Val Gly Ser
275 280 285Gly Ser Phe Lys Arg Thr Thr
Ile Gln Gly Ile Ala Asp Thr Gly Thr 290 295
300Ser Leu Phe Leu Leu Pro Ser Ser Val Val Ser Ala Tyr Tyr Gly
Gln305 310 315 320Ile Ser
Gly Ala Lys Tyr Asp Ser Ile Gln Gly Gly Tyr Thr Leu Pro
325 330 335Cys Ser Gly Ser Val Pro Asp
Phe Ala Phe Gly Ile Gly Asp Ser Asn 340 345
350Thr Thr Ile Ser Val Pro Gly Asp Tyr Val Arg Tyr Ala Ala
Thr Asp 355 360 365Ser Ser Gly Ile
Ile Cys Phe Gly Gly Ile Gln Ala Asn Thr Gly Ile 370
375 380Gly Phe Ser Ile Phe Gly Asp Val Ala Leu Lys Ala
Ala Phe Val Val385 390 395
400Phe Asp Gly Ala Lys Gln Gln Leu Gly Trp Ala Ser Lys Pro Leu Pro
405 410
415Ser138434PRTNeurospora crassa 138Met Leu Leu Phe Pro Thr Ile Leu Thr
Ala Ala Leu Ala Ala Thr Gly1 5 10
15Met Ala Ala Ala Ile Pro Ser Arg Asp Asp Thr Thr Ala Asn Lys
Gly 20 25 30Thr Ala Ser Leu
Leu Gln Val Arg Asn Pro Ser Phe Glu Phe Arg His 35
40 45Gly Pro Leu Ala Leu Ala Lys Ala Tyr Gln Lys Phe
Gly Ala Pro Met 50 55 60Pro Glu Asp
Leu Arg Ala Ala Ile Ala Arg Phe Arg Gln Asn Gln Lys65 70
75 80Arg Thr Thr Gly Thr Ile Ala Thr
Asp Pro Glu Lys His Asp Val Glu 85 90
95Tyr Leu Thr Pro Ile Ser Val Gly Thr Pro Ser Gln Asp Leu
Val Val 100 105 110Asp Phe Asp
Thr Gly Ser Ser Asp Leu Trp Val Phe Ser Thr Glu Met 115
120 125Ser Thr Ser Asp Ile Lys Gly Gln Thr Val Tyr
Asp Pro Asn Asn Ser 130 135 140Ser Thr
Ser Glu Lys Val Gln Gly Ser Thr Trp Lys Ile Thr Tyr Gly145
150 155 160Asp Gly Ser Ser Ser Ser Gly
Asp Val Tyr Leu Asp Thr Val Thr Ile 165
170 175Gly Asn Leu Thr Val Pro Ser Gln Ala Val Glu Ala
Ala Lys Lys Val 180 185 190Ser
Ser Glu Phe Thr Asp Asp Ser His Asn Asp Gly Leu Leu Gly Leu 195
200 205Gly Phe Ser Ala Ile Asn Ala Val Glu
Pro Thr Pro Gln Asn Thr Phe 210 215
220Phe Asp Asn Ile Lys Gly Ser Leu Asp Ala Pro Leu Phe Thr Val Asp225
230 235 240Leu Lys His Gly
Thr Pro Gly Ser Phe Asn Phe Gly Tyr Ile Asp Pro 245
250 255Ala Ala Tyr Ile Gly Asn Ile Ser Trp Thr
Pro Val Asp Ser Ser Gln 260 265
270Gly Tyr Trp Gly Phe Thr Ser Pro Gly Tyr Ala Val Gly Thr Gly Ala
275 280 285Phe Arg Asn His Ser Ile Ser
Gly Ile Ala Asp Thr Gly Thr Thr Leu 290 295
300Leu Leu Leu Pro Lys Ser Val Val Ser Ala Tyr Tyr Lys Glu Ile
Gln305 310 315 320Gly Ala
Gln Tyr Asp Ser Asp Gln Gly Gly Tyr Ile Phe Pro Cys Ser
325 330 335Pro Thr Pro Pro Asp Phe Val
Phe Gly Val Asn Lys Gly Ile Val Thr 340 345
350Val Pro Gly Asp Met Val Ser Tyr Ala Pro Ala Asp Ser Ala
Asn Gln 355 360 365Asn Cys Phe Gly
Gly Ile Gln Thr Asp Thr Gly Ile Gly Phe Ser Ile 370
375 380Phe Gly Asp Val Ala Leu Lys Thr Ser Phe Val His
Leu His Gly Ser385 390 395
400Ile Val Pro Gly Tyr Tyr Ala Asp Cys Ala Met Arg Phe Asn Arg Met
405 410 415Leu Arg Ser Tyr Ser
Asn Asp Gln Leu Val Asp Phe Ser Ser Ser Gly 420
425 430Pro Leu139466PRTMyceliophthora thermophila 139Met
Asp Ala Leu Phe Glu Thr His Ala Lys Leu Arg Lys Arg Met Ala1
5 10 15Leu Tyr Arg Val Arg Ala Val
Pro Asn Gln Asn Tyr Gln Arg Asp Gly 20 25
30Thr Lys Ser Tyr Val Ser Val Leu Asn Arg Phe Gly Phe Gln
Pro Thr 35 40 45Lys Pro Gly Pro
Tyr Phe Gln Ile Phe Glu Glu Ser Glu Glu Ala Pro 50 55
60Ser Met Ser Ala Ala Pro Gly Val Lys Pro Gly His Val
Trp Gln Gly65 70 75
80Leu Phe Lys Lys Leu Lys Asp Gln Glu Glu Pro Gly Glu Val Thr Ala
85 90 95Glu Asp Gln Gln Asn Asp
Ser Glu Tyr Leu Cys Glu Val Met Ile Gly 100
105 110Thr Ala Trp Thr Ala Glu Arg Gln Ile Val Lys Met
Asp Phe Asp Thr 115 120 125Gly Leu
Ala Asp Phe Trp Val Ser Gln Lys Ser Phe Asp Pro Lys Lys 130
135 140Ser Val Thr Trp Gln Leu Ala Lys Asp Lys Ser
Trp Lys Val Gln Tyr145 150 155
160Gly Asp Gly Ser Ser Ala Ser Gly Ile Val Gly His Asp Ile Leu Ile
165 170 175Ile Gly Gly Ile
Gln Ile Lys Arg Gln Ala Ile Glu Ile Ala Thr Glu 180
185 190Met Ser Ala Gln Phe Ser Glu Gly Thr Met Asp
Gly Ile Leu Gly Leu 195 200 205Ala
Phe Ser Lys Leu Asn Thr Val Gln Thr Asp Gly Lys Pro Asp Pro 210
215 220Gln Arg Thr Val Val Asp Asn Met Met Ala
Gln Asp Asp Ile Pro Pro225 230 235
240Glu Ala Glu Leu Phe Ser Thr Ala Leu Tyr Ser Asn Arg Glu Asp
Asp 245 250 255Gln Arg Ser
Phe Tyr Thr Phe Gly Trp Ile Asp Glu Asp Leu Val Lys 260
265 270Ala Ser Gly Glu Glu Ile Val Trp Thr Asp
Val Asp Asn Ser Glu Gly 275 280
285Phe Trp Met Phe Ser Ser Glu His Val Thr Ile Asp Gly Gln Gln Val 290
295 300Arg Ile Glu Gly Asn Lys Ala Ile
Ala Asp Thr Gly Thr Ser Leu Val305 310
315 320Leu Val Ser Asp Gln Val Cys Asp Ala Leu Tyr Ala
His Ile Pro Ser 325 330
335Ala Glu Tyr Ser Glu Glu Tyr Gln Gly Trp Thr Phe Pro Gln Glu Thr
340 345 350Glu Val Asp Lys Leu Pro
Glu Phe Ser Ile Ala Ile Gly Asp Lys Glu 355 360
365Phe Val Leu Gln Lys Glu Asp Leu Ile Phe Ala Pro Ala Asp
Glu Arg 370 375 380Val Phe Tyr Gly Ser
Val Gln Ser Arg Gly Glu Asn Pro Phe Asp Ile385 390
395 400Leu Gly Ile Ala Phe Leu Lys Ser Ile Tyr
Ala Ile Trp Asp Gln Gly 405 410
415His Lys Arg Phe Gly Ala Val Pro Lys Met Glu Ala Phe Val Pro Pro
420 425 430Thr Lys Tyr Asp Arg
Pro Arg Leu Thr Asp Gln Asp Arg Lys Asp Leu 435
440 445Gly Val Thr Ile Gly Tyr Gly Asp Ile Ser Ser Thr
Phe Phe Glu Lys 450 455 460Arg
Ala465140481PRTNeurospora crassa 140Met Gly Ser Met Tyr Gln Val Gln Ser
Lys Leu Arg Gln Asp Leu Gly1 5 10
15Leu His Lys Val Gln Ala Val Arg Lys Pro Gly Arg Glu Leu Asn
Gly 20 25 30Thr Lys Ala Tyr
Val Ser Ala Met Ala Arg Tyr Gly Phe Asn Pro Thr 35
40 45Glu Glu Ser Arg Phe Phe His Leu Lys Lys Thr Asp
Leu Thr Lys Glu 50 55 60Phe Gln Arg
Arg Gly Tyr Ile Arg His Trp Glu Gln Leu Val Arg Thr65 70
75 80Pro Gln Glu Arg Pro Asp Asp Pro
His Thr Asp Asn Glu Pro Val Pro 85 90
95Ala Glu Asp Gln Gln Tyr Asp Thr Gln Tyr Leu Cys Glu Ile
Gly Ile 100 105 110Gly Thr Pro
Gln Gln Lys Val Lys Leu Asp Phe Asp Thr Gly Ser Ala 115
120 125Asp Leu Trp Val Arg Cys Thr Asp Ser Ser Leu
Leu His His Ala Asp 130 135 140Lys Lys
Phe Asp Pro Lys Lys Ser Asp Thr Phe Gln Glu Ser Lys Thr145
150 155 160Asp Gln Thr Trp Lys Ile Gln
Tyr Gly Asp Gly Ser Thr Ala Ser Gly 165
170 175Thr Val Gly Thr Asp Val Ile Thr Val Gly Gly Leu
Gln Ile Lys Asn 180 185 190Gln
Ala Ile Glu Leu Ala Lys Lys Val Ser Ser Ala Phe Ser Ser Gly 195
200 205Glu Ala Asp Gly Leu Leu Gly Leu Ala
Phe Ser Thr Ile Asn Thr Ile 210 215
220Glu Ser Asp Gly Lys Pro Asp Pro Gln Pro Thr Pro Val Glu Asn Met225
230 235 240Ile Ser Gln Glu
Asp Ile Pro Lys Glu Ala Glu Leu Phe Thr Ser Ala 245
250 255Phe Tyr Ser Ala Arg Asp Asp Lys Ser Glu
Glu Lys Ser Phe Tyr Thr 260 265
270Phe Gly Trp Val Asp Glu Asp Leu Val Lys Ala Ser Gly Lys Asp Ile
275 280 285Thr Trp Thr Pro Ile Asp Asn
Ser Glu Gly Phe Trp Lys Phe Pro Ser 290 295
300Glu Ser Ala Thr Val Asp Gly Asp Asn Val Ser Val Ser Gly Asn
Thr305 310 315 320Ala Ile
Ala Asp Thr Gly Thr Thr Leu Ala Leu Val Ser Asp Thr Val
325 330 335Cys Lys Ala Leu Tyr Ala Lys
Ile Pro Gly Ser Lys Tyr Ser Tyr Arg 340 345
350Tyr Gln Gly Tyr Leu Ile Pro Ser Thr Ile Thr Ala Asp Gln
Leu Pro 355 360 365Gln Leu Ser Val
Ala Val Gly Gly Glu Gln Phe Val Ile Gln Asn Glu 370
375 380Asp Leu Leu Leu Ala Pro Ala Asp Asp Asp His Trp
Tyr Gly Gly Val385 390 395
400Gln Ser Arg Gly Thr Met Pro Phe Asp Ile Leu Gly Asp Thr Phe Leu
405 410 415Lys Ser Ile Tyr Ala
Ile Trp Asp Gln Gly Asn Asn Arg Phe Gly Ala 420
425 430Val Pro Lys Ile Glu Val Asn Gln His Thr Val Phe
Pro Asp Thr Glu 435 440 445Pro Ser
Pro Glu Ala Ser Ser Pro Glu Pro Ala Asp Lys Val Gly Asp 450
455 460Val Ser Pro Val Glu Gln Val Lys Gly Ala Val
Lys Ser Leu Lys Val465 470 475
480Leu141397PRTMyceliophthora thermophila 141Met Lys Asp Ala Phe Leu
Leu Thr Ala Ala Val Leu Leu Gly Ser Ala1 5
10 15Gln Gly Ala Val His Lys Met Lys Leu Gln Lys Ile
Pro Leu Ser Glu 20 25 30Gln
Leu Glu Ala Val Pro Ile Asn Thr Gln Leu Glu His Leu Gly Gln 35
40 45Lys Tyr Met Gly Leu Arg Pro Arg Glu
Ser Gln Ala Asp Ala Ile Phe 50 55
60Lys Gly Met Val Ala Asp Val Lys Gly Asn His Pro Ile Pro Ile Ser65
70 75 80Asn Phe Met Asn Ala
Gln Tyr Phe Ser Glu Ile Thr Ile Gly Thr Pro 85
90 95Pro Gln Ser Phe Lys Val Val Leu Asp Thr Gly
Ser Ser Asn Leu Trp 100 105
110Val Pro Ser Val Glu Cys Gly Ser Ile Ala Cys Tyr Leu His Ser Lys
115 120 125Tyr Asp Ser Ser Ala Ser Ser
Thr Tyr Lys Lys Asn Gly Thr Ser Phe 130 135
140Glu Ile Arg Tyr Gly Ser Gly Ser Leu Ser Gly Phe Val Ser Gln
Asp145 150 155 160Thr Val
Ser Ile Gly Asp Ile Thr Ile Gln Gly Gln Asp Phe Ala Glu
165 170 175Ala Thr Ser Glu Pro Gly Leu
Ala Phe Ala Phe Gly Arg Phe Asp Gly 180 185
190Ile Leu Gly Leu Gly Tyr Asp Arg Ile Ser Val Asn Gly Ile
Val Pro 195 200 205Pro Phe Tyr Lys
Met Val Glu Gln Lys Leu Ile Asp Glu Pro Val Phe 210
215 220Ala Phe Tyr Leu Ala Asp Thr Asn Gly Gln Ser Glu
Val Val Phe Gly225 230 235
240Gly Val Asp His Asp Lys Tyr Lys Gly Lys Ile Thr Thr Ile Pro Leu
245 250 255Arg Arg Lys Ala Tyr
Trp Glu Val Asp Phe Asp Ala Ile Ser Tyr Gly 260
265 270Asp Asp Thr Ala Glu Leu Glu Asn Thr Gly Ile Ile
Leu Asp Thr Gly 275 280 285Thr Ser
Leu Ile Ala Leu Pro Ser Gln Leu Ala Glu Met Leu Asn Ala 290
295 300Gln Ile Gly Ala Lys Lys Ser Tyr Thr Gly Gln
Tyr Thr Ile Asp Cys305 310 315
320Asn Lys Arg Asp Ser Leu Lys Asp Val Thr Phe Asn Leu Ala Gly Tyr
325 330 335Asn Phe Thr Leu
Gly Pro Tyr Asp Tyr Val Leu Glu Val Gln Gly Ser 340
345 350Cys Ile Ser Thr Phe Met Gly Met Asp Phe Pro
Ala Pro Thr Gly Pro 355 360 365Leu
Ala Ile Leu Gly Asp Ala Phe Leu Arg Arg Tyr Tyr Ser Ile Tyr 370
375 380Asp Leu Gly Ala Asp Thr Val Gly Leu Ala
Glu Ala Lys385 390 395142396PRTNeurospora
crassa 142Met Lys Gly Ala Leu Leu Thr Ala Ala Met Leu Leu Gly Ser Ala
Gln1 5 10 15Ala Gly Val
His Thr Met Lys Leu Lys Lys Val Pro Leu Ala Glu Gln 20
25 30Leu Glu Ser Val Pro Ile Asp Val Gln Val
Gln His Leu Gly Gln Lys 35 40
45Tyr Thr Gly Leu Arg Thr Glu Ser His Thr Gln Ala Met Phe Lys Ala 50
55 60Thr Asp Ala Gln Val Ser Gly Asn His
Pro Val Pro Ile Thr Asn Phe65 70 75
80Met Asn Ala Gln Tyr Phe Ser Glu Ile Thr Ile Gly Thr Pro
Pro Gln 85 90 95Thr Phe
Lys Val Val Leu Asp Thr Gly Ser Ser Asn Leu Trp Val Pro 100
105 110Ser Ser Gln Cys Gly Ser Ile Ala Cys
Tyr Leu His Asn Lys Tyr Glu 115 120
125Ser Ser Glu Ser Ser Thr Tyr Lys Lys Asn Gly Thr Ser Phe Lys Ile
130 135 140Glu Tyr Gly Ser Gly Ser Leu
Ser Gly Phe Val Ser Gln Asp Arg Met145 150
155 160Thr Ile Gly Asp Ile Thr Ile Asn Asp Gln Leu Phe
Ala Glu Ala Thr 165 170
175Ser Glu Pro Gly Leu Ala Phe Ala Phe Gly Arg Phe Asp Gly Ile Leu
180 185 190Gly Leu Gly Tyr Asp Arg
Ile Ala Val Asn Gly Ile Thr Pro Pro Phe 195 200
205Tyr Lys Met Val Glu Gln Lys Leu Val Asp Glu Pro Val Phe
Ser Phe 210 215 220Tyr Leu Ala Asp Gln
Asp Gly Glu Ser Glu Val Val Phe Gly Gly Val225 230
235 240Asn Lys Asp Arg Tyr Thr Gly Lys Ile Thr
Thr Ile Pro Leu Arg Arg 245 250
255Lys Ala Tyr Trp Glu Val Asp Phe Asp Ala Ile Gly Tyr Gly Lys Asp
260 265 270Phe Ala Glu Leu Glu
Gly His Gly Val Ile Leu Asp Thr Gly Thr Ser 275
280 285Leu Ile Ala Leu Pro Ser Gln Leu Ala Glu Met Leu
Asn Ala Gln Ile 290 295 300Gly Ala Lys
Lys Ser Trp Asn Gly Gln Phe Thr Ile Asp Cys Gly Lys305
310 315 320Lys Ser Ser Leu Glu Asp Val
Thr Phe Thr Leu Ala Gly Tyr Asn Phe 325
330 335Thr Leu Gly Pro Glu Asp Tyr Ile Leu Glu Ala Ser
Gly Ser Cys Leu 340 345 350Ser
Thr Phe Met Gly Met Asp Met Pro Ala Pro Val Gly Pro Leu Ala 355
360 365Ile Leu Gly Asp Ala Phe Leu Arg Lys
Tyr Tyr Ser Ile Tyr Asp Leu 370 375
380Gly Ala Asp Thr Val Gly Ile Ala Thr Ala Lys Arg385 390
395143454PRTMyceliophthora thermophila 143Met Lys Phe Ala
Ala Leu Ala Leu Ala Ala Ser Leu Val Ala Ala Ala1 5
10 15Pro Arg Val Val Lys Val Asp Pro Ser Asp
Ile Lys Pro Arg Arg Leu 20 25
30Gly Gly Thr Lys Phe Lys Leu Gly Gln Ile His Asn Asp Leu Phe Arg
35 40 45Gln His Gly Arg Gly Pro Arg Ala
Leu Ala Lys Ala Tyr Glu Lys Tyr 50 55
60Asn Ile Glu Leu Pro Pro Asn Leu Leu Glu Val Val Gln Arg Ile Leu65
70 75 80Lys Asp Leu Gly Ile
Glu Pro His Ser Lys Lys Ile Pro Gly Ser Lys 85
90 95Ser Ser Tyr Gly Asn Gly Ala Pro Tyr Thr Asn
Glu Thr Asp Asp Ser 100 105
110Gly Glu Val Ser Ala Ile Pro Gln Leu Phe Asp Val Glu Tyr Leu Ala
115 120 125Pro Val Gln Ile Gly Thr Pro
Pro Gln Thr Leu Met Leu Asn Phe Asp 130 135
140Thr Gly Ser Ser Asp Leu Trp Val Phe Ser Ser Glu Thr Pro Ser
Arg145 150 155 160Gln Gln
Asn Gly Gln Lys Ile Tyr Lys Ile Glu Glu Ser Ser Thr Ala
165 170 175Arg Arg Leu Ser Asn His Thr
Trp Ser Ile Gln Tyr Gly Asp Gly Ser 180 185
190Arg Ser Ala Gly Asn Val Tyr Leu Asp Thr Val Ser Val Gly
Gly Val 195 200 205Asn Val Phe Asn
Gln Ala Val Glu Ser Ala Thr Phe Val Ser Ser Ser 210
215 220Phe Val Thr Asp Ala Ala Ser Ser Gly Leu Leu Gly
Leu Gly Phe Asp225 230 235
240Ser Ile Asn Thr Val Lys Pro Thr Lys Gln Lys Thr Phe Ile Ser Asn
245 250 255Ala Leu Glu Ser Leu
Glu Met Gly Leu Phe Thr Ala Asn Leu Lys Lys 260
265 270Ala Glu Pro Gly Asn Tyr Asn Phe Gly Phe Ile Asp
Glu Thr Glu Phe 275 280 285Val Gly
Pro Leu Ser Phe Ile Asp Val Asp Ser Thr Asp Gly Phe Trp 290
295 300Gln Phe Asp Ala Thr Gly Tyr Ser Ile Gln Leu
Pro Glu Pro Ser Gly305 310 315
320Asn Ile Thr Gly Thr Pro Phe Arg Ala Val Ala His Thr Ala Ile Ala
325 330 335Asp Thr Gly Thr
Thr Leu Leu Leu Leu Pro Pro Gly Ile Ala Gln Ala 340
345 350Tyr Tyr Trp Gln Val Gln Gly Ala Arg Gln Ala
Pro Glu Val Gly Gly 355 360 365Trp
Val Met Pro Cys Asn Ala Ser Met Pro Asp Leu Thr Leu His Ile 370
375 380Gly Thr Tyr Lys Ala Val Ile Pro Gly Glu
Leu Ile Pro Tyr Ala Pro385 390 395
400Val Asp Thr Asp Asp Met Asp Thr Ala Thr Val Cys Tyr Gly Gly
Ile 405 410 415Gln Ser Ala
Ser Gly Met Pro Phe Ala Ile Tyr Gly Asp Ile Phe Phe 420
425 430Lys Ala Gln Phe Thr Val Phe Asp Val Glu
Asn Leu Lys Leu Gly Phe 435 440
445Ala Pro Lys Pro Glu Leu 450144489PRTMyceliophthora thermophila
144Met Ala Ile Pro Val Leu Phe Ser Ala Leu Val Leu Leu Val Ala Leu1
5 10 15Leu Cys Cys His Ala Thr
Ala Ala Leu Gln Gln Leu Ala His Asp Val 20 25
30Gly Cys Val His Leu Pro Val Val His Ser Thr Lys Val
Asp Arg Phe 35 40 45Ser Asp Lys
Arg Gly Ile Gln Leu Gln Leu Ala Asn Arg Ser Asp Val 50
55 60Ala Tyr Tyr Ala Gln Leu Ser Ile Gly Thr Pro Pro
Gln Pro Val Phe65 70 75
80Val Gln Leu Asp Thr Gly Ser Phe Glu Leu Trp Val Asn Pro Asp Cys
85 90 95Thr Thr Val Ser Gly Ser
Asp Ala Val Phe Cys Glu Arg Ala Gly Arg 100
105 110Tyr Asp Val Thr Lys Ser Ser Thr Ala Thr Ser Leu
Gly Thr Asn Arg 115 120 125Thr Leu
Arg Tyr Gly Ile Gly Ala Ala Asn Ile Ser Tyr Phe Thr Asp 130
135 140Thr Ile Ser Leu Ala Gly Ser Pro Met Met Leu
Gln Asp Val Gln Phe145 150 155
160Gly Val Ala Thr Ala Ser Glu Asp Ala Phe Ser Gly Ile Leu Gly Ile
165 170 175Gly Tyr Gly Lys
Gly Ile Gly Thr Gly Tyr Pro Asn Phe Val Asp Gln 180
185 190Leu Trp Glu Gln Asn Val Thr Arg Val Lys Ala
Tyr Thr Leu Ala Leu 195 200 205Gly
Ser Lys Asp Ser Gln Glu Gly Val Ile Val Phe Gly Gly Val Asp 210
215 220Thr Ser Lys Phe Ala Gly Lys Leu Ala Arg
Leu Pro Val Ile Pro Pro225 230 235
240Ala Gln Ser Pro Asp Gly Val Pro Arg Phe Trp Val Glu Met Lys
Ser 245 250 255Leu Ser Ile
Thr Arg Pro Ser Gly Leu Asn Thr Val Tyr Asp Gly Gly 260
265 270Ala Met Pro Val Phe Leu Asp Ser Gly Ser
Thr Met Thr Leu Leu Pro 275 280
285Ala Asn Leu Thr Met Ala Val Ala Arg Asp Phe Gly Ala Gln Ala Pro 290
295 300Asp Ala Asn Gly Phe Tyr Lys Ile
Asp Cys Ala Leu Thr Ala Leu Asn305 310
315 320Gly Thr Leu Asp Phe Ala Phe Asp Gly Val Thr Val
Arg Val Pro Tyr 325 330
335Lys Glu Leu Thr Arg Glu Val Ala Ser Asn Pro Pro Ser Cys Phe Leu
340 345 350Gly Ile Val Ala Ser Asp
Arg Phe Thr Leu Leu Gly Asp Thr Phe Leu 355 360
365Arg Ser Ala Tyr Thr Val Phe Asp Leu Glu Thr Asp Ser Ile
Trp Met 370 375 380Ala Pro Ala Val Asn
Cys Gly Ser Ser Pro Ala Ala Leu Ser Asn Val385 390
395 400Gln Asp Leu Ser Ala Val Thr Gly Glu Cys
Gly Val Arg Glu Ile Ala 405 410
415Glu Ser Thr Ser Ser Thr Gln Val Pro Ser Thr Gly Val Asp Asp Thr
420 425 430Glu Ala Gly Ala Val
Pro Thr Ser Thr Thr Thr Val Val Ser Gln Pro 435
440 445Ser Gly Thr Thr Thr Gln Met Gly Ala Arg Pro Thr
Leu Asp Asn Ala 450 455 460Ser Asn Pro
Leu Gly Ala His Arg Leu Thr Trp Val Leu Val Ile Thr465
470 475 480Ala Ala Leu His Leu Phe Thr
Gly Ile 485145518PRTNeurospora crassa 145Met Ala Ala Phe
Pro Phe Leu Ser Ala Ser Phe Val Leu Leu Gln Leu1 5
10 15Ala Leu Thr Cys Leu Ala Gln His Leu Asn
Leu Thr Thr Gly Pro Leu 20 25
30His Leu Thr Gly His Thr Pro Gly Asp Gly Cys Val His Leu Pro Ile
35 40 45Ile His Ser Thr Asn Thr Asp His
Phe Ala Arg Arg Gly Ile Gln Leu 50 55
60Ala Leu Asn Asn Arg Ser Asp Val Ala Tyr Tyr Ala Gln Leu Glu Ile65
70 75 80Gly Thr Pro Pro Gln
Thr Val Tyr Thr Gln Leu Asp Thr Gly Ser Phe 85
90 95Glu Leu Trp Val Asn Pro Asp Cys Thr Thr Val
Ser Pro Ser Asp Ser 100 105
110Ser Phe Cys Asp His Ile Gly Phe Tyr Asn Ala Ser Leu Ser Ser Thr
115 120 125Ser Lys Ser Leu Gly Thr Ser
Lys Thr Leu Arg Tyr Gly Ile Gly Ala 130 135
140Ala Asn Ile Ser Tyr Val Thr Asp Thr Ile Ser Leu Ser Gly Ser
Ser145 150 155 160Thr Ser
Leu Lys Asp Ile Gln Phe Gly Val Ala Thr Ser Ser Lys Asp
165 170 175Ala Phe Ser Gly Ile Leu Gly
Ile Gly Tyr Gly Gln Gly Leu Ala Thr 180 185
190Lys Tyr Pro Asn Phe Ile Asp Gln Leu Tyr Ala Gln Lys Ile
Thr Lys 195 200 205Val Lys Ala Tyr
Thr Leu Ala Leu Gly Ser Lys Thr Ala Gln Gln Gly 210
215 220Ser Ile Val Phe Gly Gly Val Asp Thr Ser Lys Phe
Ala Gly Pro Leu225 230 235
240Gly Arg Leu Pro Ile Ile Pro Ala Glu Asp Ser Pro Asp Gly Val Pro
245 250 255Arg Phe Trp Val Gln
Met Asn Gly Ile Ser Leu Thr Pro Pro Ser Gly 260
265 270Gln Ser Met Gly Val Tyr Glu Gly Ser Lys Ile Pro
Ala Phe Leu Asp 275 280 285Ser Gly
Ser Thr Met Thr Ile Leu Pro Pro Ala Leu Ala Asn Lys Ile 290
295 300Ala Glu Asp Phe Gly Ser Pro Glu Met Asp Ala
Asn Gly Phe Tyr Arg305 310 315
320Val Gly Cys Gly Tyr Val Glu Met Asn Gly Thr Met Asp Phe Glu Phe
325 330 335Val Gly Ala Gly
Gln Lys Val Thr Val Arg Val Pro Tyr Lys Glu Met 340
345 350Ile Arg Glu Val Gly Gln Gly Glu Ser Lys Met
Cys Phe Leu Gly Ile 355 360 365Met
Gly Ser Glu Ser Phe Thr Leu Leu Gly Asp Thr Phe Leu Arg Ser 370
375 380Ala Tyr Ala Thr Ser Cys Gly Asn Thr Pro
Ala Ala Leu Arg Asp Val385 390 395
400Thr Asp Leu Ser Arg Val Val Gly Asn Cys Gln Ile Gln Leu Gly
Glu 405 410 415Lys Glu Ala
Val Val Asp Val Val Ser Glu Thr Ser Ile Ala Pro Pro 420
425 430Thr Gly Ser Thr Gly Asp Thr Asp Gly Val
Thr Gly Thr Gly Gly Asn 435 440
445Gly Ser Gly Asn Gly Gly Thr Arg Thr Ala Trp Gly Phe Val Thr Thr 450
455 460Thr Leu Ala Val Pro Met Ala Thr
Gly Leu Ala Gly Val Gly Gly Ser465 470
475 480Gly Ser Gly Ser Met Ser Ala Thr Ala Leu Asp Ser
Ser Gly Arg Ser 485 490
495Met Ala Gly Asp Val Val Leu Ser Ala Ala Val Ala Val Gly Ala Ala
500 505 510Val Leu Gly Ser Leu Leu
515146501PRTMyceliophthora thermophila 146Met Arg Gly Tyr Ala Ala Val
Ala Phe Gly Ala Ile Leu Ala Gly Ala1 5 10
15Val His Ala Ser Ala Gly Asn Gly Val Val Gln Trp Asp
Ile Arg Arg 20 25 30Thr Gln
Arg Gln Glu Glu Leu Gln Arg Leu Asn Arg Arg Leu Arg Lys 35
40 45Arg Ala Asn Pro Val Leu Glu Val Ile Thr
Asn Glu Lys Ile Arg Gly 50 55 60Gly
Tyr Phe Ala Thr Cys Lys Ile Gly Thr Pro Gly Gln Asp Leu Thr65
70 75 80Leu Gln Leu Asp Thr Gly
Ser Ser Asp Ile Trp Val Pro Asp Ser Ala 85
90 95Ala Gln Val Cys Arg Glu Ile Gly Thr Glu Gly Cys
Ala Leu Gly Thr 100 105 110Phe
Asn Pro Asn Arg Ser Ser Ser Phe Glu Val Ile Gly Glu Gly Gln 115
120 125Phe Asp Ile Glu Tyr Val Asp Gly Ser
Ser Ser Lys Gly Asp Tyr Phe 130 135
140Thr Asp Val Phe Gln Ile Gly Asp Ile Ser Val Gln Asn Met Thr Met145
150 155 160Gly Leu Gly Leu
His Thr Asp Ile Ala Tyr Gly Leu Val Gly Val Gly 165
170 175Tyr Ala Ile Asn Glu Ala Ile Val Ala Thr
Thr Gln Ser Arg Asp Ser 180 185
190Val Tyr Pro Asn Leu Pro Val Gln Met Val Asp Gln Gly Leu Ile Asn
195 200 205Thr Val Ala Tyr Ser Leu Trp
Leu Asn Asp Leu Asp Ala Ser Ser Gly 210 215
220Ser Ile Leu Phe Gly Gly Ile Asp Thr Glu Lys Tyr Gln Gly Glu
Leu225 230 235 240Thr Arg
Ile Asp Ile Tyr Pro Thr Ser Gln Gly Asp Phe Ser Ser Phe
245 250 255Val Val Ala Leu Thr Ser Leu
Glu Ala Arg Ser Pro Ser Gly Gln Asp 260 265
270Thr Leu Thr Ser Gln Glu Phe Pro Ile Pro Val Val Leu Asp
Ser Gly 275 280 285Thr Thr Leu Ser
Tyr Leu Pro Thr Asp Leu Ala Thr Gln Ala Trp Lys 290
295 300Glu Val Gly Ala Phe Tyr Leu Pro Glu Val Gly Ala
Ala Val Leu Pro305 310 315
320Cys Asp Met Glu Asn Ser Lys Gly Ser Phe Ser Phe Gly Phe Ala Gly
325 330 335Pro Asp Gly Pro Arg
Ile Thr Val Gly Met Asp Glu Leu Val Leu Asp 340
345 350Met Thr Asp Gly Gln Ala Pro Gln Phe Leu Ser Gly
Pro Tyr Lys Gly 355 360 365Arg Asp
Val Cys Gln Phe Gly Ile Gln Asn Phe Thr Ser Ala Pro Phe 370
375 380Leu Leu Gly Asp Thr Phe Leu Arg Ser Ala Tyr
Val Val Tyr Asp Leu385 390 395
400Val Asn Asn Gln Ile Gly Ile Ala Ala Thr Asp Phe Asn Ser Thr Asp
405 410 415Ser Asn Ile Val
Pro Phe Pro Ser Met Gly Ala Pro Ile Pro Ser Ala 420
425 430Thr Val Ala Ala Asn Gln Arg Glu Val Thr Arg
Val Pro Thr Val Thr 435 440 445Glu
Pro Ala Tyr Ser Ala Ser Gln Gly Phe Met Glu Ser Ala Ser Gly 450
455 460Glu Glu Ser Leu Ala Pro Gly Met Pro Ala
Ala Trp Gly Met Gly Gln465 470 475
480Leu Leu Val Val Gly Val Thr Met Ala Leu Thr Ala Leu Gly Ser
Gly 485 490 495Leu Phe Phe
Val Leu 500147492PRTNeurospora crassa 147Met Lys Gly Tyr Thr
Ser Ser Ala Leu Leu Leu Gly Pro Ala Leu Leu1 5
10 15Ser Gln Leu Ala Leu Ala Gln Gln Ala Pro Asn
Gly Val Val His Trp 20 25
30Gly Ile Gln Lys Arg His Ala Pro Asn Ala Pro Asn Arg Leu Leu Arg
35 40 45Arg Ala Gly Pro Thr His Gln Ala
Ile Leu Gln Asn Glu Gln Ala Arg 50 55
60Gly Gly Tyr Phe Ala Thr Cys Ala Met Gly Thr Pro Gly Gln Lys Val65
70 75 80Thr Leu Gln Leu Asp
Thr Gly Ser Ser Asp Val Trp Val Pro Asp Ser 85
90 95Thr Ala Ser Ile Cys Asn Lys Gly Ala Cys Asp
Leu Gly Ser Trp Gln 100 105
110Gly Glu Phe Asp Ile Ser Tyr Val Asp Gly Ser Ser Ser Lys Gly Asp
115 120 125Tyr Phe Thr Asp Val Phe Asn
Ile Gly Gly Thr Thr Val Thr Asn Leu 130 135
140Thr Met Gly Leu Gly Ala Gln Thr Asp Ile Ala Tyr Gly Leu Val
Gly145 150 155 160Ile Gly
Tyr Ala Ile Asn Glu Ala Ile Val Gly Asn Ser His Ser Leu
165 170 175Ser Ser Gln Tyr Pro Asn Leu
Pro Val Ala Met Val Asp Asp Gly Leu 180 185
190Ile Asn Thr Ile Ala Tyr Ser Leu Trp Leu Asn Asp Leu Asp
Ala Gly 195 200 205Glu Gly Ser Ile
Leu Phe Gly Gly Ile Asp Thr Lys Lys Tyr Lys Gly 210
215 220Asp Leu Thr Arg Ile Arg Ile Tyr Pro Ser Ser Asn
Gly Tyr Tyr Phe225 230 235
240Ser Phe Ile Val Ala Leu Thr Ser Leu Gln Ala Ile Ser Pro Ser Gly
245 250 255Asn Asp Thr Leu Thr
Ser Gln Glu Phe Pro Ile Pro Val Val Leu Asp 260
265 270Ser Gly Thr Thr Leu Ser Tyr Leu Pro Gln Asp Ile
Val Asp Gln Ile 275 280 285Trp Gln
Glu Val Gly Ala Glu Tyr Ser Asp Arg Leu Glu Leu Ala Val 290
295 300Ile Pro Cys Ser Lys Lys Ser Ser Asn Gly Tyr
Phe Ser Phe Gly Phe305 310 315
320Ala Gly Pro Asp Gly Pro Arg Ile Thr Val Arg Met Asp Glu Leu Val
325 330 335Leu Asp Leu Thr
Ser Gly Asp Pro Pro Lys Tyr Thr Ser Gly Pro Asn 340
345 350Lys Gly Gln Asp Val Cys Glu Phe Gly Ile Gln
Asn Ser Thr Ser Ala 355 360 365Pro
Tyr Leu Leu Gly Asp Thr Phe Leu Arg Ser Ala Tyr Val Val Tyr 370
375 380Asp Leu Val Asn Asn Glu Ile Gly Leu Ala
Glu Thr Asp Phe Asn Ser385 390 395
400Thr Glu Ser Asn Ile Val Ala Phe Ala Ser Met Ser Ala Thr Ile
Pro 405 410 415Ser Ala Thr
Gln Ala Pro Asn Gln Ala Ala Val Thr Asn Arg Pro Val 420
425 430Ala Thr Met Pro Ser Phe Ala Ala Ser Ser
Gly Phe Ser Asp Thr Gly 435 440
445Gly Ser Gly Asn Asp Gly Lys Asp Glu Asn Ala Ser Ala Gly Met Pro 450
455 460Ser Ala Phe Gly Val Ala Gln Met
Ser Val Met Gly Ile Ala Met Val465 470
475 480Phe Ala Met Val Gly Ser Gly Val Phe Val Leu Leu
485 490148668PRTMyceliophthora thermophila
148Met Ser Phe Ala Leu Tyr Ala Ala Ala Leu Leu Pro Val Ala Val Leu1
5 10 15Gly Ala Gly Leu Ser Val
Pro Glu Asp Asn Arg Met Val Gln Gln Asp 20 25
30Gly Leu Leu Arg Tyr Pro Leu Met Pro Arg Leu Gly Asn
Leu Leu Phe 35 40 45Gly Lys His
Ala Asn Ile Thr Arg Arg Gln Ile Asp Thr Gly Ile Phe 50
55 60Asp Pro Leu Ser Gly Thr Leu Tyr Thr Ile Glu Leu
Thr Leu Gly Thr65 70 75
80Pro Gly Gln Thr Val Pro Val Gln Phe Asp Thr Gly Ser Asp Met Leu
85 90 95Trp Val Asn Pro Val Cys
Ser Lys Ala Ala Glu Pro Glu Phe Cys Ala 100
105 110Ala Gln Pro Arg Phe Thr Asp Ser Ser Thr Leu Val
Asp Phe Gly Glu 115 120 125Gln Gly
Asn Ile Thr Tyr Gly Thr Gly Tyr Ala Tyr Tyr Glu Tyr Val 130
135 140Ala Asp Tyr Val Ala Ile Gly Ser Ala Arg Ile
Thr Gln Gln Val Phe145 150 155
160Gly Val Ala Leu Asp Ser Ala His Ala Asp Val Gly Ile Phe Gly Ala
165 170 175Gly Pro Asn Leu
Asp Gly Trp Asp Ser Ala Tyr Pro Leu Val Val Asp 180
185 190Ser Leu Ala Gln Gln Gly Tyr Thr Ser Ser Arg
Ala Phe Ser Met Asp 195 200 205Leu
Lys Gly Phe Glu Ser Ala Arg Gly Ser Val Ile Phe Gly Gly Ile 210
215 220Asp Thr Lys Lys Tyr Arg Gly Ser Leu Ile
Lys Arg Leu Ile Ile Pro225 230 235
240Ala Ala Glu Ser Pro Asp Gly Tyr Thr Arg Phe Trp Ile Tyr Leu
Asp 245 250 255Gly Ile Ser
Val Asn Gln Pro Asp Gly Asp Val Val Thr Val Phe Ser 260
265 270Thr Pro Asp Gly Gly Lys Gly Gln Pro Val
Leu Leu Asp Ser Gly Tyr 275 280
285Thr Leu Ser Ala Leu Pro Arg Pro Ile Phe Gln Lys Leu Val Ala Ala 290
295 300Phe Pro Ser Ala Gln Tyr Val Ser
Ser Ala Asp Val Tyr Val Val Asp305 310
315 320Cys Val Asp His Gly Glu Gly Gly Ser Leu Asp Phe
Ile Phe Gly Gly 325 330
335Lys Thr Ile Asn Val Pro Tyr His Glu Phe Val Trp Ala Gln Pro Glu
340 345 350Ser Asn Thr Cys Val Leu
Gly Ala Phe Glu Asp Asp Phe Pro Val Leu 355 360
365Gly Asp Thr Phe Leu Arg Ser Ala Tyr Val Val Tyr Asp Trp
Asp Asn 370 375 380Arg Asn Ile Tyr Leu
Ala Gln Ser Asp Asp Cys Gly Ser Asn Leu Val385 390
395 400Ala Ile Gly Ser Gly Pro Asp Ala Val Pro
Ser Ile Val Gly Glu Cys 405 410
415Gly Lys Pro Lys Pro Thr Ser Thr Ser Thr Phe Ser Lys Thr Ser Ser
420 425 430Lys Thr Ser Thr Ala
Ser Lys Thr Ser Ser Thr Ser Asp Ser Thr Ser 435
440 445Ser Ser Ser Ser His Val Thr Thr Ser Ser Ser Ser
Thr Thr Ala Thr 450 455 460Thr Leu Ser
Thr His Lys Pro Pro Phe Pro Thr Ala Ser Gly Asn Phe465
470 475 480Thr Thr Thr Arg Ser Pro Thr
Thr Thr Thr Ala Ser Ser Thr Ile Ser 485
490 495Lys Ser Thr Leu Thr Ile Thr Ser Ala Thr Thr Tyr
Thr Ile Thr Ser 500 505 510Cys
Pro Pro Thr Val Thr Arg Cys Pro Ala His Glu Val Thr Thr Glu 515
520 525Ile Ile Thr Lys Thr Thr Ala Val Cys
Pro Glu Thr Thr Ala Thr Tyr 530 535
540Thr Ile Pro Arg Thr Ile Thr Cys Pro Gly Ser Gly Gly Gly Asp Asp545
550 555 560Cys Pro Pro Gly
Ala Thr Arg Thr Thr Thr Leu Thr Val Thr Leu Ser 565
570 575Pro Val Gly Pro Thr Asp Arg Thr Thr His
Val Val Pro Gly Val Thr 580 585
590Thr Thr Thr Pro Thr Thr Ile Thr Ala Pro Pro Thr Gly Gln Thr Thr
595 600 605Thr Thr Leu Val Pro Ala Leu
Pro Pro Thr Thr Thr Thr Met Ser Gly 610 615
620His Arg Gly Ile Asn Gly Thr Val Thr Ala Thr Ser Lys Pro Pro
Ala625 630 635 640Val Thr
Ala Gly Ser Ala Lys Val Gly Leu Val Ser Gly Ala Thr Ala
645 650 655Ile Val Ala Gly Val Met Ala
Val Leu Met Ala Leu 660 665149551PRTNeurospora
crassa 149Met Leu Pro Val Pro Leu Thr Thr Leu Ser Leu Tyr Val Val Ala
Leu1 5 10 15Leu Ser Pro
Pro Ala Ala Ala Gly Val Leu Ala Ser Ala Thr Thr Lys 20
25 30Leu Pro Ile Lys Leu Pro Ile Ser Pro Ala
Gln Gly His Arg Ser Ser 35 40
45Thr Ala Ala Ser Pro Ser Leu Thr Ser Arg Ser Ser Ser Ser Gly Asn 50
55 60Gly Phe Ile Arg Ala Ser Val His Ala
Ala His Gly Ala Pro Pro Lys65 70 75
80Leu Arg Arg Arg Gln Glu Asp Glu Gly Leu Lys Asn Gln Asn
Leu Gly 85 90 95Thr Thr
Tyr Thr Ile Asp Ile Asp Ile Gly Thr Pro Pro Gln Thr Val 100
105 110Thr Leu Ile Leu Asp Thr Gly Ser Pro
Asp Leu Trp Val Asn Pro Gln 115 120
125Cys Glu Thr Ser Gly Gln Glu Lys Tyr Cys Asn Ser Phe Arg Gln Phe
130 135 140Asp Tyr Thr Lys Ser Lys Thr
Ile Gln Asp Thr Gly Ala Ala Asp Ile145 150
155 160Leu Lys Tyr Gly Lys Gly Asn Val Thr Ile Glu Tyr
Val Thr Asp Asp 165 170
175Val Ile Ile Gly Ser Ala Lys Ile Lys Ser Gln Ile Leu Gly Ile Gly
180 185 190Phe Glu Ser Ile Asp Ile
Pro Leu Gly Ile Leu Gly Leu Ser Pro Ser 195 200
205Val Ser Pro Asp Gly Thr Ser Pro Tyr Pro Tyr Leu Leu Asp
Ser Met 210 215 220Ala Ser Gln Gly Ile
Ile Ser Ser Arg Ala Phe Ser Leu Asp Leu Arg225 230
235 240Ser Ile Asp Asn Pro Ser Gly Ala Ile Ile
Phe Gly Gly Val Asp Leu 245 250
255Gly Lys Phe Ser Gly Ser Leu Ala Lys Leu Pro Met Leu Asp Pro Ser
260 265 270Gln Thr Pro Ala Gly
Val Asp Arg Tyr Trp Ile Val Leu Ser Gly Val 275
280 285Gly Met Thr Tyr Pro Asp Gly Glu Glu Val Glu Ser
Glu Glu Ile Gly 290 295 300Val Pro Val
Phe Leu Asp Ser Gly Gly Thr Leu Ser Arg Leu Pro Glu305
310 315 320Thr Ile Phe Gln Ala Ile Gly
Asp Ser Phe Pro Gly Ser Gln Tyr Asp 325
330 335Pro Glu Ser Gly Phe Tyr Ile Val Asp Cys Ala Val
Ala Glu Gln Ala 340 345 350Gly
Ser Val Asp Phe Ile Phe Gly Ser Ser Gly Ser Arg Ser Ser Lys 355
360 365Lys Ile Arg Val Pro Tyr Gly Asp Phe
Val Trp Glu Val Gln Thr Gly 370 375
380Val Cys Val Val Gly Val Leu Pro Thr Asp Asp Glu Pro Val Phe Gly385
390 395 400Asp Ser Phe Leu
Arg Ala Ala Tyr Val Val Phe Asp Gln Asp Asn Arg 405
410 415Asn Leu His Leu Ala Gln Ala Ala Asn Cys
Gly Glu Gln Ile Val Glu 420 425
430Ile Gly Ser Gly Gln Asp Ala Val Pro Ser Ser Thr Gly Lys Cys Lys
435 440 445Asp Gly Ser Ala Gly Ser Thr
Lys Thr Ala Gly Gly Gly Gly Leu Asp 450 455
460Val Thr Ala Thr Arg Ala Pro Thr Arg Thr Ala Gly Gly Ser Gly
Pro465 470 475 480Ala Val
Thr Asn Ser Asp Phe Gly Pro Gly Pro Ala Gly Thr Arg Val
485 490 495Ser Thr Gly Gly Ile Gly Leu
Pro Thr Gly Thr Gly Gly Gly Gly Gly 500 505
510Ser Gly Asp Gly Asn Gly Asn Asn Asp Asp Asp Asp Ser Ala
Ala Ser 515 520 525Gly Leu Asp Val
Gly Val Thr Ala Ala Ala Val Leu Ala Gly Leu Asn 530
535 540Met Leu Ile Val Trp Leu Leu545
550150529PRTNeurospora crassa 150Met Lys Ser Thr Leu Ala Thr Leu Leu Ala
Leu Ala Ser Val Ala Val1 5 10
15Ala Glu Asn Gly Val Val Asn Phe Pro Leu Asn Arg Gly Val Pro His
20 25 30Phe Arg Val Gly Asn Val
Arg Gln Asn Val Lys Arg Asp Thr Tyr Ser 35 40
45Gln Ala Leu Ile Asn Asn Ile Thr Gly Gly Ala Tyr Tyr Ala
Glu Val 50 55 60Thr Val Gly Thr Pro
Gly Gln Lys Val Ser Val Val Leu Asp Thr Gly65 70
75 80Ser Ser Asp Leu Trp Val Val Ser Tyr Lys
Ala Asp Leu Cys Thr Asp 85 90
95Pro Ser Ile Gln Arg Gln Trp Gly Asp Ser Cys Asp Lys Thr Tyr Asn
100 105 110Pro Thr Lys Ser Ser
Ser Tyr Lys Val Leu Glu Glu Asp Ser Phe Glu 115
120 125Ile Arg Tyr Leu Asp Asn Ser Thr Ala Ala Gly Asp
Tyr Ile Thr Asp 130 135 140Asp Leu Asn
Ile Gly Gly Ala Thr Ile Lys Ser Leu Gln Met Gly Tyr145
150 155 160Ala Thr Lys Thr Val Arg Gly
Ala Gly Ile Leu Gly Val Gly Tyr Ser 165
170 175Ser Asn Val Ala Ser Gln Gln Arg Tyr Pro Asn Leu
Ile Asp Gln Phe 180 185 190Val
Ala Gln Lys Leu Ile Thr Thr Lys Ala Tyr Ser Leu Tyr Leu Asn 195
200 205Asp Arg Arg Ser Asp Thr Gly Ser Ile
Leu Phe Gly Gly Ile Asp Lys 210 215
220Asp Lys Phe Ile Gly Asp Leu Ser Ile Leu Pro Ile Tyr Leu Ala Lys225
230 235 240Gly Gln Ala Glu
Pro Ile His Phe Glu Val Glu Met Gln Ser Val Ser 245
250 255Leu Ala Leu Thr Lys Asn Gly Lys Thr Thr
Lys Ile Ile Ser Thr Asp 260 265
270Pro Ser Leu Ser Gln Thr Ser Thr Ile Ala Ile Leu Asp Ser Gly Thr
275 280 285Thr Leu Ser Tyr Leu Pro Ser
Lys Ile Thr Asp Gln Ile His Thr Lys 290 295
300Leu Ser Val Tyr Val Asp Glu Ile Trp Thr Gly Leu Thr Phe Ile
Asp305 310 315 320Cys Gln
Tyr Leu Thr Ser Asn Pro Asp Leu Arg Leu Ser Phe Thr Phe
325 330 335Gly Ala Asn Ala Thr Ile Ser
Val Pro Val Trp Glu Leu Val Leu Asp 340 345
350Leu Leu Gly Glu Ser Gln Ser Glu Leu Pro Phe Lys Met Pro
Phe Lys 355 360 365Asn Ala Cys Ile
Phe Gly Ile Gln Ser Thr Ala Gly Phe Gln Glu Asp 370
375 380Asn Phe Asp Glu Asp Trp Ala Leu Leu Gly Glu Thr
Phe Leu Arg Ser385 390 395
400Ala Tyr Val Val Tyr Asp Leu Thr His His Gln Ile Gly Ile Ala Gln
405 410 415Ala Asn Leu Asn Ser
Thr Thr Thr Asp Ile Val Glu Leu Ser Gly Ala 420
425 430Asp Gly Gly Leu Pro Thr Gly Leu Thr Gly Val Lys
Glu Gln Gln Thr 435 440 445Ser Asn
Asp Pro Ser Gly Asn Ala Gly Ser Gly Ser Gly Ser Ser Thr 450
455 460Asp Lys Asp Gly Ala Lys Glu Thr Glu Thr Val
Thr Ala Gly Ser Thr465 470 475
480Ala Ala Thr Gly Thr Ala Ala Ser Gly Ala Lys Glu Thr Asp Ser Ala
485 490 495Ala Ala Gly Leu
Ser Ala Arg Gly Gly Ala Val Gly Ala Leu Ala Val 500
505 510Ala Ser Leu Thr Gly Phe Leu Ala Leu Val Gly
Gly Ala Val Val Ala 515 520
525Leu151566PRTMyceliophthora thermophila 151Met Lys Pro Ser Ser Ala Ile
Leu Leu Ala Leu Ala Pro Gly Ser Ser1 5 10
15Ser Lys Asn Val Val Glu Phe Ser Val Ser Arg Gly Leu
Pro Gly Asn 20 25 30Arg Thr
Pro Leu Ser Phe Pro Pro Leu Thr Arg Arg Glu Thr Tyr Ser 35
40 45Glu Arg Leu Ile Asn Asn Ile Ala Gly Gly
Gly Tyr Tyr Val Gln Val 50 55 60Gln
Val Gly Thr Pro Pro Gln Asn Leu Thr Met Leu Leu Asp Thr Gly65
70 75 80Ser Ser Asp Ala Trp Val
Leu Ser His Glu Ala Asp Leu Cys Ile Ser 85
90 95Pro Ala Leu Gln Asp Phe Tyr Gly Met Pro Cys Thr
Asp Thr Tyr Asp 100 105 110Pro
Ser Lys Ser Ser Ser Lys Lys Met Val Glu Glu Gly Gly Phe Lys 115
120 125Ile Thr Tyr Leu Asp Gly Gly Thr Ala
Ser Gly Asp Tyr Ile Thr Asp 130 135
140His Phe Thr Ile Gly Gly Val Thr Val Gln Ser Leu Gln Met Ala Cys145
150 155 160Val Thr Lys Ala
Val Arg Gly Thr Gly Ile Leu Gly Leu Gly Phe Ser 165
170 175Ile Ser Glu Arg Ala Ser Thr Lys Tyr Pro
Asn Ile Ile Asp Glu Met 180 185
190Tyr Ser Gln Gly Leu Ile Lys Ser Lys Ala Phe Ser Leu Tyr Leu Asn
195 200 205Asp Arg Arg Ala Asp Ser Gly
Thr Leu Leu Phe Gly Gly Ile Asp Thr 210 215
220Asp Lys Phe Ile Gly Pro Leu Gly Val Leu Pro Leu His Lys Pro
Pro225 230 235 240Gly Asp
Arg Asp Tyr Ser Ser Phe Glu Val Asn Phe Thr Ser Val Ser
245 250 255Leu Thr Tyr Thr Asn Gly Ser
Arg His Thr Ile Pro Thr Ala Ile Leu 260 265
270Asn His Pro Ala Pro Ala Val Leu Asp Ser Gly Thr Thr Leu
Ser Tyr 275 280 285Leu Pro Asp Glu
Leu Ala Asp Pro Ile Asn Thr Ala Leu Asp Thr Phe 290
295 300Tyr Asp Asp Arg Leu Gln Met Thr Leu Ile Asp Cys
Ser His Pro Leu305 310 315
320Leu Arg Thr Asp Pro Asp Phe His Leu Ala Phe Thr Phe Thr Pro Thr
325 330 335Thr Ser Ile Thr Val
Pro Leu Gly Asp Leu Val Leu Asp Ile Leu Pro 340
345 350Pro Thr Tyr Pro Gln Ser Asn Ser Asn Asn Asn Asn
Glu Val Glu Asp 355 360 365Asp Asp
Asp Asp Asp Asp Asp Asp Asp Asp Asp Asp Lys Val Pro Pro 370
375 380Ala Thr Glu Arg Arg Trp Cys Val Phe Gly Ile
Gln Ser Thr Thr Arg385 390 395
400Phe Ala Ala Ser Ser Gly Gln Ser Glu Ala Asn Phe Thr Leu Leu Gly
405 410 415Asp Thr Phe Leu
Arg Ser Ala Tyr Val Val Tyr Asp Leu Ser His Tyr 420
425 430Gln Ile Gly Leu Ala Gln Ala Asn Leu Asn Ser
Ser Ser Ser Ser Thr 435 440 445Asn
Thr Asn Thr Ile Val Glu Leu Thr Ala Asp Asn His Asp Asp Gly 450
455 460Ala Ser Glu Arg Gly Glu Gly Ala Gly Ala
Gly Ala Asp Ala Gly Thr465 470 475
480Arg Thr Val Ile Ala Gly Gly Leu Pro Ser Gly Leu Met Gly Val
Glu 485 490 495Ala Gln Gln
Thr Thr Phe Thr Pro Thr Ala Thr Ala Asn Gly His Pro 500
505 510Gly Tyr Gly Gly Gly Pro Gly Gly Ser Thr
Arg Pro Gly Ser Glu Arg 515 520
525Asn Ala Ala Ala Gly Gly Phe Thr Ala Val Arg Thr Gly Leu Leu Gly 530
535 540Glu Leu Val Gly Val Ala Ala Val
Thr Ala Leu Phe Ile Leu Leu Gly545 550
555 560Gly Ala Leu Ile Ala Val
565152897PRTMyceliophthora thermophila 152Met Val Arg Leu Asp Trp Ala Ala
Val Leu Leu Ala Ala Thr Ala Val1 5 10
15Ala Lys Ala Val Thr Pro His Thr Pro Ser Phe Val Pro Gly
Ala Tyr 20 25 30Ile Val Glu
Tyr Glu Glu Asp Gln Asp Ser His Ala Phe Val Asn Lys 35
40 45Leu Gly Gly Lys Ala Ser Leu Arg Lys Asp Leu
Arg Phe Lys Leu Phe 50 55 60Lys Gly
Ala Ser Ile Gln Phe Lys Asp Thr Glu Thr Ala Asp Gln Met65
70 75 80Val Ala Lys Val Ala Glu Met
Pro Lys Val Lys Ala Val Tyr Pro Val 85 90
95Arg Arg Tyr Pro Val Pro Asn His Val Val His Ser Thr
Gly Asn Val 100 105 110Ala Asp
Glu Val Leu Val Lys Arg Gln Ala Ala Gly Asn Asp Thr Phe 115
120 125Ser Thr His Leu Met Thr Gln Val Asn Lys
Phe Arg Asp Ala Gly Ile 130 135 140Thr
Gly Lys Gly Ile Lys Ile Ala Val Ile Asp Thr Gly Ile Asp Tyr145
150 155 160Leu His Glu Ala Leu Gly
Gly Cys Phe Gly Pro Asp Cys Leu Val Ser 165
170 175Tyr Gly Thr Asp Leu Val Gly Asp Asp Phe Asn Gly
Ser Asn Thr Pro 180 185 190Lys
Pro Asp Pro Asp Pro Ile Asp Asn Cys Gln Gly His Gly Thr His 195
200 205Val Ala Gly Ile Ile Ala Ala Gln Thr
Asn Asn Pro Phe Gly Ile Ile 210 215
220Gly Ala Ala Thr Asp Val Thr Leu Gly Ala Tyr Arg Val Phe Gly Cys225
230 235 240Asn Gly Asp Thr
Pro Asn Asp Val Leu Ile Ala Ala Tyr Asn Met Ala 245
250 255Tyr Glu Ala Gly Ser Asp Ile Ile Thr Ala
Ser Ile Gly Gly Pro Ser 260 265
270Gly Trp Ser Glu Asp Pro Trp Ala Ala Val Val Thr Arg Ile Val Glu
275 280 285Asn Gly Val Pro Cys Val Val
Ser Ala Gly Asn Asp Gly Asp Ala Gly 290 295
300Ile Phe Tyr Ala Ser Thr Ala Ala Asn Gly Lys Lys Val Thr Ala
Ile305 310 315 320Ala Ser
Val Asp Asn Ile Val Thr Pro Ala Leu Leu Ser Asn Ala Ser
325 330 335Tyr Thr Leu Asn Gly Thr Asp
Asp Phe Phe Gly Phe Thr Ala Gly Asp 340 345
350Pro Gly Ser Trp Asp Asp Val Asn Leu Pro Leu Trp Ala Val
Ser Phe 355 360 365Asp Thr Thr Asp
Pro Ala Asn Gly Cys Asn Pro Tyr Pro Asp Ser Thr 370
375 380Pro Asp Leu Ser Gly Tyr Ile Val Leu Ile Arg Arg
Gly Thr Cys Thr385 390 395
400Phe Val Glu Lys Ala Ser Tyr Ala Ala Ala Lys Gly Ala Lys Tyr Val
405 410 415Met Phe Tyr Asn Asn
Val Gln Gln Gly Thr Val Thr Val Ser Ala Ala 420
425 430Glu Ala Lys Gly Ile Glu Gly Val Ala Met Val Thr
Ala Gln Gln Gly 435 440 445Glu Ala
Trp Val Arg Ala Leu Glu Ala Gly Ser Glu Val Val Leu His 450
455 460Met Lys Asp Pro Leu Lys Ala Gly Lys Phe Leu
Thr Thr Thr Pro Asn465 470 475
480Thr Ala Thr Gly Gly Phe Met Ser Asp Tyr Thr Ser Trp Gly Pro Thr
485 490 495Trp Glu Val Glu
Val Lys Pro Gln Phe Gly Thr Pro Gly Gly Ser Ile 500
505 510Leu Ser Thr Tyr Pro Arg Ala Leu Gly Ser Tyr
Ala Val Leu Ser Gly 515 520 525Thr
Ser Met Ala Cys Pro Leu Ala Ala Ala Ile Tyr Ala Leu Leu Ile 530
535 540Asn Thr Arg Gly Thr Lys Asp Pro Lys Thr
Leu Glu Asn Leu Ile Ser545 550 555
560Ser Thr Ala Arg Pro Asn Leu Phe Arg Leu Asn Gly Glu Ser Leu
Pro 565 570 575Leu Leu Ala
Pro Val Pro Gln Gln Gly Gly Gly Ile Val Gln Ala Trp 580
585 590Asp Ala Ala Gln Ala Thr Thr Leu Leu Ser
Val Ser Ser Leu Ser Phe 595 600
605Asn Asp Thr Asp His Phe Lys Pro Val Gln Thr Phe Thr Ile Thr Asn 610
615 620Thr Gly Lys Lys Ala Val Thr Tyr
Ser Leu Ser Asn Val Gly Ala Ala625 630
635 640Thr Ala Tyr Thr Phe Ala Asp Ala Lys Ser Ile Glu
Pro Ala Pro Phe 645 650
655Pro Asn Glu Leu Thr Ala Asp Phe Ala Ser Leu Thr Phe Val Pro Lys
660 665 670Arg Leu Thr Ile Pro Ala
Gly Lys Arg Gln Thr Val Thr Val Ile Ala 675 680
685Lys Pro Ser Glu Gly Val Asp Ala Lys Arg Leu Pro Val Tyr
Ser Gly 690 695 700Tyr Ile Ala Ile Asn
Gly Ser Asp Ser Ser Ala Leu Ser Leu Pro Tyr705 710
715 720Leu Gly Val Val Gly Ser Leu His Ser Ala
Val Val Leu Asp Ser Asn 725 730
735Gly Ala Arg Ile Ser Leu Ala Ser Asp Asp Thr Asn Lys Pro Leu Pro
740 745 750Ala Asn Thr Ser Phe
Val Leu Pro Pro Ala Gly Phe Pro Asn Asp Thr 755
760 765Ser Tyr Ala Asn Ser Thr Asp Leu Pro Lys Leu Val
Val Asp Leu Ala 770 775 780Met Gly Ser
Ala Leu Leu Arg Ala Asp Val Val Pro Leu Ser Gly Gly785
790 795 800Ala Ala Thr Ala Thr Ala Arg
Leu Thr Arg Thr Val Phe Gly Thr Arg 805
810 815Thr Ile Gly Gln Pro Tyr Gly Leu Pro Ala Arg Tyr
Asn Pro Arg Gly 820 825 830Thr
Phe Glu Tyr Ala Trp Asp Gly Arg Leu Asp Asp Gly Ser Tyr Ala 835
840 845Pro Ala Gly Arg Tyr Arg Phe Ala Val
Lys Ala Leu Arg Ile Phe Gly 850 855
860Asp Ala Lys Arg Ala Arg Glu Tyr Asp Ala Ala Glu Thr Val Glu Phe865
870 875 880Asn Ile Glu Tyr
Leu Pro Gly Pro Ser Ala Lys Phe Arg Arg Arg Leu 885
890 895Phe153876PRTNeurospora crassa 153Met Val
Arg Leu Gly Leu Ala Thr Thr Leu Leu Ala Ala Ala Ser Phe1 5
10 15Ala Gln Ala Ala His Gln Lys Ala
Pro Ala Val Val Pro Gly Ala Tyr 20 25
30Ile Val Glu Tyr Glu Asp Ser His Asp Pro Thr Ser Ile Leu Ala
Ser 35 40 45Ile Lys Gly Asp Ala
Thr Ile Arg Lys Asp Ile Arg His Glu Leu Phe 50 55
60Lys Gly Ala Ser Phe Gln Phe Lys Asp Leu Asn Lys Ala Asp
Asp Leu65 70 75 80Ala
Ser Lys Val Ala Ala Met Ser Gly Val Lys Ala Leu Tyr Pro Val
85 90 95Arg Arg Tyr Ser Ile Pro Glu
His Thr Val His Ser Thr Gly Ser Ala 100 105
110Val Gln Glu Val Val Ala Lys Arg Asp Thr Gly Asn Asp Thr
Phe Ser 115 120 125Pro His Leu Met
Thr Gln Val Asn Lys Phe Arg Asp Ser Gly Ile Thr 130
135 140Gly Lys Gly Ile Lys Ile Ala Val Ile Asp Thr Gly
Val Asp Tyr Leu145 150 155
160His Pro Ala Leu Gly Gly Cys Phe Gly Pro Gly Cys Leu Val Ser Tyr
165 170 175Gly Thr Asp Leu Val
Gly Asp Asp Phe Asn Gly Ser Asn Thr Pro Val 180
185 190Pro Asp Ser Asp Pro Met Asp Thr Cys Asn Gly His
Gly Ser His Val 195 200 205Leu Gly
Leu Leu Ser Ala Asn Thr Asn Asn Pro Tyr Gly Ile Ile Gly 210
215 220Ala Ala Pro Asp Val Thr Leu Gly Ala Tyr Arg
Val Phe Gly Cys Ser225 230 235
240Gly Asp Val Gly Asn Asp Ile Leu Ile Glu Ala Tyr Leu Lys Ala Tyr
245 250 255Asp Asp Gly Ser
Asp Ile Ile Thr Ala Ser Ile Gly Gly Ala Ser Gly 260
265 270Trp Pro Glu Asp Ser Trp Ala Ala Val Val Ser
Arg Ile Val Glu Lys 275 280 285Gly
Val Pro Cys Leu Val Ser Ala Gly Asn Asp Gly Ala Thr Gly Ile 290
295 300Phe Tyr Ala Ser Thr Ala Ala Asn Gly Lys
Arg Val Thr Ala Val Ala305 310 315
320Ser Val Asp Asn Ile Leu Ala Pro Ala Leu Leu Ser Glu Ala Ser
Tyr 325 330 335Ser Val Ala
Asn Gly Ser Leu Ser Thr Phe Gly Phe Thr Ala Gly Ser 340
345 350Pro Ser Ala Trp Ala Asn Val Ser Leu Pro
Val Trp Ser Val Asn Phe 355 360
365Asn Thr Ala Asp Ala Ala Asn Gly Cys Glu Ala Phe Pro Asp Asp Thr 370
375 380Pro Asp Leu Ser Lys Tyr Ile Val
Leu Ile Arg Arg Gly Thr Cys Thr385 390
395 400Phe Val Gln Lys Ala Gln Asn Ala Ala Ala Lys Gly
Ala Lys Tyr Ile 405 410
415Ile Tyr Tyr Asn Asn Ala Ser Gly Ser Thr Lys Val Asp Val Ser Ala
420 425 430Val Ala Asp Val Lys Ala
Ala Ala Met Val Thr Ser Glu Thr Gly Ala 435 440
445Ala Trp Ile Lys Ala Leu Gln Ala Gly Thr Gln Val Thr Val
Asn Met 450 455 460Ala Asp Pro Glu Thr
Ala Pro Lys Asn Leu Asn Asn Phe Pro Asn Thr465 470
475 480Ala Thr Pro Gly Phe Leu Ser Thr Tyr Thr
Ser Trp Gly Pro Thr Tyr 485 490
495Glu Val Asp Val Lys Pro Gln Ile Ser Ser Pro Gly Gly Met Ile Leu
500 505 510Ser Thr Tyr Pro Arg
Ala Leu Gly Ser Tyr Ala Val Leu Ser Gly Thr 515
520 525Ser Met Ala Cys Pro Leu Ala Ala Ala Thr Trp Ala
Leu Val Met Gln 530 535 540Lys Arg Gly
Thr Lys Asp Pro Lys Val Leu Glu Asn Leu Phe Ser Ala545
550 555 560Thr Ala His Pro Asn Leu Phe
Asn Asp Gly Thr Lys Thr Tyr Pro Met 565
570 575Leu Ala Pro Val Ala Gln Gln Gly Ala Gly Leu Ile
Gln Ala Trp Asp 580 585 590Ala
Ala Asn Ala Asn Ala Leu Leu Ser Val Ser Ser Ile Ser Phe Asn 595
600 605Asp Thr Glu His Phe Lys Pro Leu Gln
Ser Phe Glu Val Thr Asn Thr 610 615
620Gly Lys Lys Ala Val Thr Tyr Gln Leu Gly His Thr Ser Ala Ala Thr625
630 635 640Ala Tyr Thr Phe
Ala Asn Asp Thr Ser Ile Gly Pro Ala Ala Phe Pro 645
650 655Asn Glu Leu Val Asp Ala Lys Ala Thr Leu
Val Leu Thr Pro Ala Lys 660 665
670Leu Thr Leu Asn Pro Gly Gln Lys Lys Thr Val Thr Val Leu Ala Ile
675 680 685Pro Pro Leu Gly Leu Asp Ala
Lys Arg Leu Pro Val Tyr Ser Gly Tyr 690 695
700Ile Thr Leu Asn Gly Thr Asp Ser Thr Gly Tyr Ser Leu Pro Tyr
Gln705 710 715 720Gly Val
Val Gly Ser Met Arg Ser Val Thr Val Leu Asp Lys Gln Asn
725 730 735Ser Tyr Leu Ser Gln Ser Ser
Asp Ala Thr Tyr Ala Pro Val Ala Ala 740 745
750Gly Thr Thr Phe Thr Leu Pro Pro Ala Gly Lys Ala Asn Asp
Thr Leu 755 760 765Tyr Ala Thr Thr
Val Tyr Pro Thr Ile Val Leu Thr Leu Ser Met Gly 770
775 780Ser Ala Glu Val His Ala Asp Val Val Asn Ser Lys
Gly Lys Thr Ile785 790 795
800Gly Gln Val Leu Thr Phe Pro Ala Arg Trp Asn Pro Arg Gly Thr Phe
805 810 815Glu Trp Asn Trp Asp
Gly Ala Leu Ser Asp Gly Thr Tyr Ala Pro Ala 820
825 830Asp Thr Tyr Lys Ile Thr Leu Lys Ala Leu Lys Ile
Tyr Gly Asn Ser 835 840 845Lys Trp
Pro Leu Asp Trp Glu Thr Gln Thr Thr Glu Pro Phe Thr Ile 850
855 860Lys Tyr Ala Ala Lys Ser Lys Arg Ala Phe Thr
Ala865 870 875154534PRTMyceliophthora
thermophila 154Met Arg Gly Leu Val Ala Phe Ser Leu Ala Ala Cys Val Ser
Ala Ala1 5 10 15Pro Ser
Phe Lys Thr Glu Thr Ile Asn Gly Glu His Ala Pro Ile Leu 20
25 30Ser Ser Ser Asn Ala Glu Val Val Pro
Asn Ser Tyr Ile Ile Lys Phe 35 40
45Lys Lys His Val Asp Glu Ser Ser Ala Ser Ala His His Ala Trp Ile 50
55 60Gln Asp Ile His Thr Ser Arg Glu Lys
Val Arg Gln Asp Leu Lys Lys65 70 75
80Arg Gly Gln Val Pro Leu Leu Asp Asp Val Phe His Gly Leu
Lys His 85 90 95Thr Tyr
Lys Ile Gly Gln Glu Phe Leu Gly Tyr Ser Gly His Phe Asp 100
105 110Asp Glu Thr Ile Glu Gln Val Arg Arg
His Pro Asp Val Glu Tyr Ile 115 120
125Glu Arg Asp Ser Ile Val His Thr Met Arg Val Thr Glu Glu Thr Cys
130 135 140Asp Gly Glu Leu Glu Lys Ala
Ala Pro Trp Gly Leu Ala Arg Ile Ser145 150
155 160His Arg Asp Thr Leu Gly Phe Ser Thr Phe Asn Lys
Tyr Leu Tyr Ala 165 170
175Ala Glu Gly Gly Glu Gly Val Asp Ala Tyr Val Ile Asp Thr Gly Thr
180 185 190Asn Ile Glu His Val Asp
Phe Glu Gly Arg Ala Lys Trp Gly Lys Thr 195 200
205Ile Pro Ala Gly Asp Ala Asp Val Asp Gly Asn Gly His Gly
Thr His 210 215 220Cys Ser Gly Thr Ile
Ala Gly Lys Lys Tyr Gly Val Ala Lys Lys Ala225 230
235 240Asn Val Tyr Ala Val Lys Val Leu Arg Ser
Asn Gly Ser Gly Thr Met 245 250
255Ala Asp Val Val Ala Gly Val Glu Trp Ala Ala Lys Ser His Leu Glu
260 265 270Gln Val Gln Ala Ala
Lys Asp Gly Lys Arg Lys Gly Phe Lys Gly Ser 275
280 285Val Ala Asn Met Ser Leu Gly Gly Gly Lys Thr Arg
Ala Leu Asp Asp 290 295 300Thr Val Asn
Ala Ala Val Ser Val Gly Ile His Phe Ala Val Ala Ala305
310 315 320Gly Asn Asp Asn Ala Asp Ala
Cys Asn Tyr Ser Pro Ala Ala Ala Glu 325
330 335Lys Ala Val Thr Val Gly Ala Ser Ala Ile Asp Asp
Ser Arg Ala Tyr 340 345 350Phe
Ser Asn Tyr Gly Lys Cys Thr Asp Ile Phe Ala Pro Gly Leu Ser 355
360 365Ile Leu Ser Thr Trp Ile Gly Ser Lys
Tyr Ala Thr Asn Thr Ile Ser 370 375
380Gly Thr Ser Met Ala Ser Pro His Ile Ala Gly Leu Leu Ala Tyr Tyr385
390 395 400Leu Ser Leu Gln
Pro Ala Thr Asp Ser Glu Tyr Ser Val Ala Pro Ile 405
410 415Thr Pro Glu Lys Met Lys Ser Asn Leu Leu
Lys Ile Ala Thr Gln Asp 420 425
430Ala Leu Thr Asp Ile Pro Asp Glu Thr Pro Asn Leu Leu Ala Trp Asn
435 440 445Gly Gly Gly Cys Asn Asn Tyr
Thr Ala Ile Val Glu Ala Gly Gly Tyr 450 455
460Lys Ala Lys Lys Lys Thr Thr Thr Asp Lys Val Asp Ile Gly Ala
Ser465 470 475 480Val Ser
Glu Leu Glu Lys Leu Ile Glu His Asp Phe Glu Val Ile Ser
485 490 495Gly Lys Val Val Lys Gly Val
Ser Ser Phe Ala Asp Lys Ala Glu Lys 500 505
510Phe Ser Glu Lys Ile His Glu Leu Val Asp Glu Glu Leu Lys
Glu Phe 515 520 525Leu Glu Asp Ile
Ala Ala 530155396PRTNeurospora crassa 155Met Lys Leu Ser Ala Val Leu
Ala Leu Leu Pro Leu Ala Met Ala Ala1 5 10
15Pro Ser Ala Pro Ile Asp Lys Arg Ala Pro Ile Leu Glu
Ala Arg Ala 20 25 30Gly Thr
Gln Ala Val Pro Gly Lys Tyr Ile Val Lys Leu Arg Glu Thr 35
40 45Ala Ser Asp Asp Asp Leu Asp Lys Ala Val
Lys Lys Leu Gly Asn Ser 50 55 60Lys
Ala Asp His Val Tyr Lys His Ala Phe Arg Gly Phe Ala Gly Arg65
70 75 80Ile Asp Asp Lys Thr Leu
Asp Asp Ile Arg Ser Leu Pro Glu Val Glu 85
90 95Tyr Val Glu Gln Glu Ala Val Phe Thr Ile Asn Thr
Tyr Thr Ser Gln 100 105 110Ser
Ser Val Pro Ser Trp Gly Leu Ala Arg Leu Ser Ser Lys Thr Thr 115
120 125Gly Lys Thr Thr Tyr Val Tyr Asp Ser
Ser Ala Gly Ala Gly Thr Cys 130 135
140Ala Tyr Ile Ile Asp Thr Gly Ile Asn Thr Ala His Ser Asp Phe Gly145
150 155 160Gly Arg Ala Thr
Trp Leu Ala Asn Tyr Ala Gly Asp Gly Ile Asn Ser 165
170 175Asp Gly Asn Gly His Gly Thr His Val Ala
Gly Thr Val Gly Gly Thr 180 185
190Thr Tyr Gly Val Ala Lys Lys Thr Gln Leu Tyr Ala Val Lys Val Leu
195 200 205Asp Ser Asn Gly Ser Gly Ser
Asn Ser Gly Val Ile Ala Gly Met Asn 210 215
220Phe Val Ala Gln Asp Ala Gln Ser Arg Asn Cys Pro Asn Gly Thr
Val225 230 235 240Ala Asn
Met Ser Leu Gly Gly Gly Tyr Ser Ala Ser Thr Asn Ser Ala
245 250 255Ala Ala Ala Met Val Arg Ala
Gly Val Phe Leu Ala Val Ala Ala Gly 260 265
270Asn Asp Gly Ala Asn Ala Ala Asn Tyr Ser Pro Ala Ser Glu
Pro Thr 275 280 285Val Cys Thr Val
Gly Ala Thr Thr Ser Ala Asp Ala Ile Ala Tyr Tyr 290
295 300Ser Asn Tyr Gly Thr Ile Val Asp Ile Phe Ala Pro
Gly Thr Ser Ile305 310 315
320Thr Ser Ala Trp Ile Gly Ser Thr Thr Ala Lys Asn Thr Ile Ser Gly
325 330 335Thr Ser Met Ala Thr
Pro His Ile Thr Gly Leu Gly Ala Tyr Leu Leu 340
345 350Thr Leu Leu Gly Lys Lys Ser Pro Ala Ala Leu Cys
Ser Tyr Ile Ala 355 360 365Ser Thr
Ala Asn Ser Gly Val Ile Ser Gly Ile Pro Arg Gly Thr Val 370
375 380Asn Lys Leu Ala Phe Asn Gly Asn Pro Ser Ala
Tyr385 390 395156392PRTMyceliophthora
thermophila 156Met His Phe Ser Thr Ala Leu Leu Ala Phe Leu Pro Ala Ala
Leu Ala1 5 10 15Ala Pro
Thr Ala Glu Thr Leu Asp Lys Arg Ala Pro Ile Leu Thr Ala 20
25 30Arg Ala Gly Gln Val Val Pro Gly Lys
Tyr Ile Ile Lys Leu Arg Asp 35 40
45Gly Ala Ser Asp Asp Val Leu Glu Ala Ala Ile Gly Lys Leu Arg Ser 50
55 60Lys Ala Asp His Val Tyr Arg Gly Lys
Phe Arg Gly Phe Ala Gly Lys65 70 75
80Leu Glu Asp Asp Val Leu Asp Ala Ile Arg Leu Leu Pro Glu
Val Glu 85 90 95Tyr Val
Glu Glu Glu Ala Ile Phe Thr Ile Asn Ala Tyr Thr Ser Gln 100
105 110Ser Asn Ala Pro Trp Gly Leu Ala Arg
Leu Ser Ser Lys Thr Ala Gly 115 120
125Ser Thr Thr Tyr Thr Tyr Asp Thr Ser Ala Gly Glu Gly Thr Cys Ala
130 135 140Tyr Val Ile Asp Thr Gly Ile
Tyr Thr Ser His Ser Asp Phe Gly Gly145 150
155 160Arg Ala Thr Phe Ala Ala Asn Phe Val Asp Ser Ser
Asn Thr Asp Gly 165 170
175Asn Gly His Gly Thr His Val Ala Gly Thr Ile Gly Gly Thr Thr Tyr
180 185 190Gly Val Ala Lys Lys Thr
Lys Leu Tyr Ala Val Lys Val Leu Gly Ser 195 200
205Asp Gly Ser Gly Thr Thr Ser Gly Val Ile Ala Gly Ile Asn
Phe Val 210 215 220Ala Asp Asp Ala Pro
Lys Arg Ser Cys Pro Lys Gly Val Val Ala Asn225 230
235 240Met Ser Leu Gly Gly Ser Tyr Ser Ala Ser
Ile Asn Asn Ala Ala Ala 245 250
255Ala Leu Val Arg Ser Gly Val Phe Leu Ala Val Ala Ala Gly Asn Glu
260 265 270Asn Gln Asn Ala Ala
Asn Ser Ser Pro Ala Ser Glu Ala Ser Ala Cys 275
280 285Thr Val Gly Ala Thr Asp Arg Asn Asp Ala Lys Ala
Ser Tyr Ser Asn 290 295 300Tyr Gly Ser
Val Val Asp Ile Gln Ala Pro Gly Ser Asn Ile Leu Ser305
310 315 320Thr Trp Ile Gly Ser Thr Ser
Ala Thr Asn Thr Ile Ser Gly Thr Ser 325
330 335Met Ala Ser Pro His Ile Ala Gly Leu Gly Ala Tyr
Leu Leu Ala Leu 340 345 350Glu
Gly Ser Lys Thr Pro Ala Glu Leu Cys Asn Tyr Ile Lys Ser Thr 355
360 365Gly Asn Ala Ala Ile Thr Gly Val Pro
Ser Gly Thr Thr Asn Arg Ile 370 375
380Ala Phe Asn Gly Asn Pro Ser Ala385
390157433PRTNeurospora crassa 157Met Val Arg Phe Ser Val Ala Ala Ala Phe
Leu Leu Ser Ala Leu Gly1 5 10
15Val Thr Ala Ala Pro Ser Gly Gly Arg His Asn His Gln Asn Thr Gln
20 25 30Asn Thr Gly Ala Thr Ala
Gly Asn Ala Ala Gly Val Pro Val Ala Asn 35 40
45Ser Asp Ile Ser Asn Ile Ile Pro Gly Arg Tyr Ile Val Val
Tyr Asn 50 55 60Asn Thr Phe Gly Glu
Glu Ala Ile Asn Ala His Gln Ile Lys Val Thr65 70
75 80Ser Leu Val Ala Lys Arg Asn Leu Gly Lys
Arg Asp Ala Lys Thr Gly 85 90
95Arg Ile Met Ser Pro Ser Val Lys Ala Phe Lys Met Gly Thr Trp Arg
100 105 110Ala Met Ala Leu Asp
Ala Asp Asp Asp Met Ile Asn Asp Ile Asn Ser 115
120 125Ala Gln Glu Val Glu Tyr Ile Glu Ala Asp Gln Tyr
Val Lys Leu Asn 130 135 140Ala Leu Thr
Ser Gln Asn Ser Thr Thr Thr Gly Leu Ala Arg Leu Ser145
150 155 160His Ala Gly Pro Ser Lys Lys
Ala Ala Pro Tyr Ile Phe Asp Ser Ser 165
170 175Ala Gly Glu Gly Ile Thr Ala Phe Val Val Asp Thr
Gly Ile Arg Val 180 185 190Thr
His Ser Glu Tyr Glu Gly Arg Ala Thr Phe Ala Ala Asn Phe Val 195
200 205Asn Asn Val Asp Thr Asp Glu Asn Gly
His Gly Ser His Val Ala Gly 210 215
220Thr Ile Ala Gly Ala Thr Phe Gly Val Ala Lys Lys Ala Lys Leu Val225
230 235 240Ala Val Lys Val
Leu Asp Gly Ser Gly Ser Gly Ser Asn Ser Gly Val 245
250 255Leu Gln Gly Met Gln Phe Val Ala Asp Thr
Ala Thr Ser Gln Lys Leu 260 265
270Gly Gly Lys Ala Val Leu Asn Met Ser Leu Gly Gly Gly Lys Ser Arg
275 280 285Ala Ile Asn Ser Ala Ile Asn
Gln Ile Ala Ala Ala Gly Val Val Pro 290 295
300Val Val Ala Ala Gly Asn Glu Asn Gln Asp Thr Ala Asn Thr Ser
Pro305 310 315 320Gly Ser
Ala Pro Ala Ala Ile Thr Val Gly Ala Ile Asp Gln Arg Thr
325 330 335Asp Ala Arg Ala Ser Phe Ser
Asn Phe Gly Ala Gly Val Asp Ile Phe 340 345
350Ala Pro Gly Val Asn Val Leu Ser Val Gly Ile Lys Ser Asp
Thr Asp 355 360 365Thr Asp Thr Leu
Ser Gly Thr Ser Met Ala Ser Pro His Val Ala Gly 370
375 380Leu Ala Ala Tyr Leu Met Ala Leu Glu Gly Leu Thr
Asp Val Thr Ala385 390 395
400Val Gly Asn Arg Ile Lys Glu Leu Ala Gln Lys Thr Gly Ala Lys Val
405 410 415Thr Asn Asn Val Arg
Gly Thr Thr Ser Leu Ile Ala Asn Asn Gly Asn 420
425 430Leu158420PRTMyceliophthora thermophila 158Met Ala
Gly Arg Leu Leu Leu Cys Leu Thr Ala Ala Leu Ser Ala Leu1 5
10 15Gly Val Ser Ala Ala Pro Ala Pro
Asp Ala Ser Gly Arg Pro Phe Ile 20 25
30Gly Val Pro Val Ser Asn Pro Gly Ile Ala Asn Ala Ile Pro Asn
Arg 35 40 45Tyr Ile Val Val Tyr
Asn Asn Thr Phe Asn Asp Glu Asp Ile Asp Leu 50 55
60His Gln Ser Asn Val Ile Lys Thr Ile Ala Lys Arg Asn Ile
Ala Lys65 70 75 80Arg
Ser Leu Thr Gly Lys Leu Leu Ser Thr Thr Val Asn Thr Tyr Lys
85 90 95Ile Asn Asn Trp Arg Ala Met
Ala Leu Glu Ala Asp Asp Ala Thr Ile 100 105
110Asn Glu Ile Phe Ala Ala Lys Glu Val Ser Tyr Ile Glu Gln
Asp Ala 115 120 125Val Ile Ser Leu
Asn Val Arg Gln Met Gln Ser Gln Ala Thr Thr Gly 130
135 140Leu Ala Arg Ile Ser His Ala Gln Pro Gly Ala Arg
Thr Tyr Ile Phe145 150 155
160Asp Ser Ser Ala Gly Glu Gly Ile Thr Ala Tyr Val Val Asp Thr Gly
165 170 175Ile Arg Val Thr His
Glu Glu Phe Glu Gly Arg Ala Thr Phe Ala Ala 180
185 190Asn Phe Ile Asp Asp Val Asp Thr Asp Glu Gln Gly
His Gly Ser His 195 200 205Val Ala
Gly Thr Ile Gly Gly Lys Thr Phe Gly Val Ala Lys Lys Val 210
215 220Asn Leu Val Ala Val Lys Val Leu Gly Ala Asp
Gly Ser Gly Ser Asn225 230 235
240Ser Gly Val Ile Ala Gly Met Gln Phe Val Ala Ser Asn Ala Thr Ala
245 250 255Met Gly Leu Lys
Gly Arg Ala Val Met Asn Met Ser Leu Gly Gly Pro 260
265 270Ala Ser Arg Ala Val Asn Ser Ala Ile Asn Gln
Val Glu Ala Ala Gly 275 280 285Val
Val Pro Val Val Ala Ala Gly Asn Glu Ser Gln Asp Thr Ala Asn 290
295 300Thr Ser Pro Gly Ser Ala Glu Ala Ala Ile
Thr Val Gly Ala Ile Asp305 310 315
320Gln Thr Asn Asp Arg Met Ala Ser Phe Ser Asn Phe Gly Glu Leu
Val 325 330 335Asp Ile Phe
Ala Pro Gly Val Asn Val Gln Ser Val Gly Ile Arg Ser 340
345 350Asp Thr Ser Thr Asn Thr Leu Ser Gly Thr
Ser Met Ala Ser Pro His 355 360
365Val Ala Gly Leu Ala Ala Tyr Ile Met Ser Leu Glu Asn Ile Thr Gly 370
375 380Val Gln Ala Val Ser Asp Arg Leu
Lys Glu Leu Ala Gln Ala Thr Gly385 390
395 400Ala Arg Ala Arg Gly Val Pro Arg Gly Thr Thr Thr
Leu Ile Ala Asn 405 410
415Asn Gly Phe Ala 420159421PRTNeurospora crassa 159Met Val
Gly Leu Lys Asn Val Ala Leu Phe Ala Ala Ser Ile Ile Leu1 5
10 15Pro Ala Ser Ile Thr Trp Ala Ala
Pro Ile Ile Glu Val Glu Thr Lys 20 25
30Pro Ile Pro Glu Lys Tyr Ile Val Leu Leu Lys Pro His Ala Asp
Leu 35 40 45Glu Gly His Leu Ser
Trp Ala Lys Asp Val His Ala Arg Ser Leu Ser 50 55
60Arg Arg Asp Thr Ala Gly Val His Lys Ala Trp Ser Val Gly
Ser Lys65 70 75 80Phe
Lys Ala Tyr Ala Gly Glu Phe Asp Glu Glu Thr Leu Lys Ile Ile
85 90 95Gln Arg Asp Glu Arg Asn Val
His Ser Ile Glu Pro Asp Lys Ser Trp 100 105
110Arg Leu Tyr Lys Ser Asn Lys Lys Asp Asn Asp Asp Ser Asn
Ser Asp 115 120 125Asn Thr Thr Ile
Ile Thr Gln Lys Gln Ala Pro Trp Gly Leu Gly Tyr 130
135 140Leu Ser His Lys Gly Lys Thr Ser Ser Asp Tyr Val
Tyr Asn Ser Thr145 150 155
160Ala Gly Thr Gly Thr Tyr Ala Tyr Val Val Asp Thr Gly Cys Trp Lys
165 170 175Asp His Val Glu Phe
Glu Gly Arg Val Gln Leu Gly Tyr Asn Ala Tyr 180
185 190Pro Asp Ser Pro Phe Ile Asp Met Asp Gly His Gly
Thr His Val Thr 195 200 205Gly Thr
Leu Ile Ser Lys Thr Tyr Gly Val Ala Lys Asn Ala Thr Val 210
215 220Ile Cys Val Lys Val Phe His Gly Gly Gly Ser
Ala Asn Thr Ile Val225 230 235
240Met Asp Gly Phe Glu Trp Ala Val Lys Asp Ile Ile Ala Lys Lys Arg
245 250 255Gln Arg Asn Ser
Val Ile Asn Met Ser Leu Gly Cys Asp Arg Ser Glu 260
265 270Ala Phe Asn Ala Ile Val Asp Ala Ala Tyr Asp
Gln Gly Ile Leu Thr 275 280 285Val
Val Ala Ala Gly Asn Glu Asn Gln Pro Ala Ala Leu Val Ser Pro 290
295 300Ala Ser Ser Ala Arg Ala Phe Ser Val Gly
Ala Ile Asp Asn Lys Asn305 310 315
320Thr Arg Ala Tyr Phe Ser Asn Tyr Gly Ala Ile Val Asp Ile Phe
Ala 325 330 335Pro Gly Val
Asn Ile Val Ser Thr Tyr Ile Gly Lys Lys Asp Gly Asp 340
345 350Asn Asn Arg Thr Met Thr Met Ser Gly Thr
Ser Met Ala Ser Pro His 355 360
365Val Ala Gly Leu Ala Leu Tyr Leu Lys Ser Leu Asp Pro Glu Lys Tyr 370
375 380Gly Asn Ser Ser Asp Ala His Ser
Gly Leu Arg Ala Leu Gly Val Pro385 390
395 400Asp Lys Val Trp Asp Ala Gly Glu Met Ser Pro Asn
Leu Val Ala Tyr 405 410
415Asn Gly Val Gln Gly 420160243PRTMyceliophthora thermophila
160Met Lys Leu Ala Val Leu Ile Ala Thr Thr Ala Gly Leu Ala Ala Ala1
5 10 15Leu Pro Gln Gly Val Ala
Arg Arg Gly Val Gly Arg Pro Leu His His 20 25
30Ser Gly Pro Asn Ile Arg Asn Thr Thr Tyr Pro Gln Tyr
Ser Ser Asn 35 40 45Trp Ala Gly
Ala Val Gln Ile Gly Thr Gly Phe Thr Ser Val Tyr Gly 50
55 60Thr Ile Thr Val Pro Ser Val His Asp Arg Asn Pro
Asn Ala Ala Ala65 70 75
80Ser Ala Trp Val Gly Ile Asp Gly Asp Thr Cys Gln Gln Ala Ile Leu
85 90 95Gln Thr Gly Val Ser Phe
Tyr Gly Asp Gly Ser Phe Asp Ala Trp Tyr 100
105 110Glu Trp Ile Pro Asp Tyr Ala Tyr Ser Phe Ser Asn
Phe Arg Leu Ser 115 120 125Ala Gly
Asp Gln Ile Arg Met Ser Val Glu Ala Ser Ser Lys Arg Ala 130
135 140Gly Val Ala Thr Leu Glu Asn Leu Ser Thr Gly
Gln Lys Val Ser His145 150 155
160Thr Phe Thr Ser Thr Pro Ser Thr Leu Cys Glu Thr Asn Ala Glu Trp
165 170 175Ile Val Glu Asp
Phe Gln Glu Gly Ser Ser Leu Val Pro Phe Ala Asp 180
185 190Phe Gly Thr Val Thr Phe Thr Asp Ala Tyr Ala
Thr Gly Ser Ser Gly 195 200 205Thr
Val Thr Pro Ser Gly Ala Thr Ile Ile Asp Ile Lys Gln Gly Asn 210
215 220Glu Val Leu Thr Asn Cys Ala Thr Ser Gly
Ser Asp Leu Thr Cys Ser225 230 235
240Tyr Thr Gly161288PRTNeurospora crassa 161Met Lys Leu Leu Ser
Pro Ala Ile Ser Leu Leu Gly Val Ile Ser Gln1 5
10 15Pro Ile Leu Ala Gln Phe Thr Phe Thr Ser Thr
Val Glu His Asn Gly 20 25
30Val Pro Val Pro Gln Ala Glu Thr Asp Leu Lys Pro Phe Lys Pro Gly
35 40 45Thr Leu Gly Arg Ile Arg Ser Arg
Thr Asp Asp Asp Ser Gly Pro Glu 50 55
60Ile Gly Thr Thr Thr Leu Arg Arg Val Lys Arg Thr Asn Pro Thr Ala65
70 75 80Asn Ser Asn Asn Trp
Cys Gly Ser Val Gln Ser Thr Thr Ser Ser Asn 85
90 95Gln Ile Lys Leu Val His Gly Thr Phe Gln His
Pro Thr Cys Thr Gln 100 105
110Arg Pro Gly Val Thr Gln Tyr Pro Gln Ala Ala Ala Ala Trp Ile Gly
115 120 125Ile Asp Gly Asp Ser Trp Thr
Ser Ala Leu Leu Gln Ala Gly Thr Val 130 135
140Cys Lys Ile Asn Asn Ser Thr Gly Ile Val Glu Asn Glu Val Trp
Trp145 150 155 160Gln Trp
Val Pro Asn Gly Ala Tyr Thr Ile Thr Asn Ile Pro Val Phe
165 170 175Ala Gly Asp Trp Phe Asp Ile
Thr Ile Asn Thr Thr Ser Ser Thr Ala 180 185
190Ala Thr Ile Lys Ile Met Ser Asn Arg Gly Tyr Thr Tyr Ser
Val Asn 195 200 205Ala Trp Gln Gly
Ala Thr Leu Ala Arg Val Asp Ala Asp Trp Val Val 210
215 220Glu Arg Pro Tyr Tyr Gly Ser Thr Leu Ala Gly Phe
Ala Gln Phe Thr225 230 235
240Gln Val Trp Phe Gln Asn Ala Tyr Ala Thr Leu Thr Ser Gly Thr Ser
245 250 255Ser Leu Gly Ile Thr
Gly Ala Lys Gln Tyr Gln Ile Pro Gly Gly Cys 260
265 270Ala Ser Ala Glu Tyr Asp Asn Ser Lys Leu Tyr Ala
Ala Val Ala Ala 275 280
285162285PRTMyceliophthora thermophila 162Met Trp Ser Ile Val Arg Ser Leu
Ser Leu Ala Ser Leu Ile Ser Ser1 5 10
15Ala Cys Thr Val Thr Ala Gln Leu Ser Phe Val Ala Ser Val
Lys Gln 20 25 30His Gly Lys
Asp Val Asp Ala Ser Gly Leu Ser Phe Val Arg Ile Pro 35
40 45Pro Leu Glu His Arg Trp His Ala Ser Arg Pro
Arg Arg Gly Gln Asn 50 55 60Asn Arg
Thr Val Glu Arg Asp Ala Val Ser Tyr Ser Ala Asn Trp Cys65
70 75 80Gly Ala Ser Gln His Ala Ser
Asp Ser Asp Gly Ile Lys Ser Val Leu 85 90
95Gly Tyr Phe Thr Ala Pro Asp Leu Thr Leu Arg Pro Gly
Thr Pro Ala 100 105 110Pro Gln
Phe Ala Ala Ala Trp Val Gly Ile Asp Gly Ala Ala Cys Asn 115
120 125Thr Thr Leu Leu Gln Ala Gly Val Thr Thr
Ile Val Asn Ser Asp Gly 130 135 140Gly
Gln Ser Ala Ser Ala Trp Trp Glu Trp Tyr Pro Glu Ala Ser Tyr145
150 155 160Thr Ile Ser Gly Leu Lys
Val Lys Ala Gly Glu Trp Met Ser Val Asn 165
170 175Ile Thr Thr Lys Asp Ala Ser Ser Ala Ile Leu Val
Ile Glu Asn Ala 180 185 190Asp
Thr Gly Thr Ser Val Thr Leu Glu Leu Asn Asn Gly Pro Gln Leu 195
200 205Cys Arg Arg Asp Ala Glu Trp Ile Leu
Glu Asp Phe Tyr Glu Ser Gly 210 215
220Lys Gln Val Ala Leu Ala Asn Phe Ala Asp Leu Trp Phe Val Asp Ser225
230 235 240Gly Ala Thr Thr
Val Gly Gly Lys Asn Val Gly Phe Asp Gly Ala Thr 245
250 255Met Val His Leu Arg Asp Glu Asn Gly Asn
Val Leu Cys Ser Pro Glu 260 265
270Pro Tyr Asp Asn Ser Asn Phe Val Val Val Ser Lys Pro 275
280 285163307PRTMyceliophthora thermophila
163Met Lys Pro Thr Val Leu Phe Thr Leu Leu Ala Ser Gly Ala Tyr Ala1
5 10 15Ala Ala Thr Pro Ala Ile
Pro Gly Tyr Ser Pro Arg Thr Arg Gly Met 20 25
30Asn Pro His His His Ala Pro Leu Arg Leu Leu His Thr
Phe Thr Pro 35 40 45Ile Ser Thr
Ser Gly Lys Ser Phe Arg Leu Leu Ala Ser Ser Thr Glu 50
55 60Ser Thr Lys Gly Gly Ala Ile Leu Gly Leu Pro Asp
Asn Asp Leu Ser65 70 75
80Thr Val Arg Thr Thr Ile Arg Ile Pro Ala Ala Lys Met Pro Thr Ala
85 90 95Gly Pro Thr Ala Asn Asn
Thr Val Gly Glu Tyr Ala Ala Ser Phe Trp 100
105 110Val Gly Ile Asp Ser Ala Thr Asp Ala Cys Gly Ala
Gly Gly Ser Leu 115 120 125Arg Ala
Gly Val Asp Ile Phe Trp Asp Gly Thr Leu Gly Gly Gln Gln 130
135 140Thr Pro Phe Ala Trp Tyr Gln Gly Pro Gly Gln
Ala Asp Val Val Gly145 150 155
160Phe Gly Gly Gly Phe Pro Val Gly Glu Gly Asp Leu Val Arg Leu Thr
165 170 175Leu Glu Ala Gly
Pro Ala Gly Gly Glu Glu Ile Ala Val Val Ala Glu 180
185 190Asn Phe Gly Arg Asn Val Thr Arg Ala Asp Glu
Gly Ala Val Pro Val 195 200 205Arg
Lys Val Arg Lys Val Leu Pro Ala Glu Ala Gly Gly Gln Lys Leu 210
215 220Cys Arg Gly Glu Ala Ala Trp Met Val Glu
Asp Phe Pro Leu Gln Gly225 230 235
240Arg Pro Glu Phe Pro Thr Ala Leu Ala Asn Phe Thr Ser Val Thr
Phe 245 250 255Asn Thr Gly
Ile Thr Leu Asp Asp Gly Thr Glu Lys Asp Leu Thr Gly 260
265 270Ala Glu Val Leu Asp Ile Gln Leu Glu Ala
Gln Gly Gly Arg Leu Thr 275 280
285Ser Cys Glu Val Val Asp Asp Arg Asn Val Lys Cys Ala Arg Val Val 290
295 300Gly Asp
Asn305164197PRTMyceliophthora thermophila 164Met Arg Trp Pro Leu Ala Ala
Leu Leu Gly Ser Ala Leu Val Ala Arg1 5 10
15Gln Ala Leu Ala Glu Leu Thr Phe Thr Val Glu Ala Thr
Arg Asn Gly 20 25 30Val Pro
Ile Pro Ala Ser Glu Ile Arg Leu Glu Pro Phe Glu Pro Gly 35
40 45Arg Thr Arg Met Gly Ala Val Ala Glu Ala
Pro Arg Ala Gln Arg Lys 50 55 60Thr
Arg Arg Ser Asn Ala Gln Ala Asp Ser Ala Asn Trp Cys Gly Ser65
70 75 80Val Asn Met Ala Pro Thr
Gly Thr Asn Ile Gln Leu Ala His Gly Ser 85
90 95Phe Gln His Pro Ser Cys Ser Ile Arg Pro Gly Tyr
Thr Phe Pro Gln 100 105 110Ala
Ala Ala Ser Trp Val Gly Ile Asp Gly Asp Ser Tyr Arg Asp Ala 115
120 125Leu Leu Gln Ala Gly Thr Val Cys Lys
Ile Asp Asn Ser Thr Gly Val 130 135
140Val Arg His Glu Ala Trp Trp Gln Trp Val Pro Ser Ala Ala Phe Thr145
150 155 160Ile Thr Ser Met
Pro Gly Gln Ser Asn Thr Thr Gly Phe Cys Ile Pro 165
170 175Tyr Ser Ala Pro Phe Val Ser Leu Cys Phe
Phe Gly Arg Thr Arg Thr 180 185
190Cys Leu Phe Leu His 195165621PRTMyceliophthora thermophila
165Met Leu Arg Asn Ile Phe Leu Thr Ala Ala Leu Ala Ala Phe Gly Gln1
5 10 15Cys Gly Ser Thr Val Phe
Glu Ser Val Pro Ala Lys Pro Arg Gly Trp 20 25
30Thr Arg Leu Gly Asp Ala Ser Ala Asp Gln Pro Leu Arg
Leu Arg Ile 35 40 45Ala Leu Gln
Gln Pro Asn Glu Asp Leu Phe Glu Arg Thr Leu Tyr Glu 50
55 60Val Ser Asp Pro Ser His Ala Arg Tyr Gly Gln His
Leu Ser Arg Asp65 70 75
80Glu Leu Ser Ala Leu Leu Ala Pro Arg Ala Glu Ser Thr Ala Ala Val
85 90 95Leu Asn Trp Leu Arg Asp
Ala Gly Ile Pro Ser Asp Lys Ile Glu Glu 100
105 110Asp Gly Glu Trp Ile Asn Leu Arg Val Thr Val Arg
Glu Ala Ser Glu 115 120 125Leu Leu
Asp Ala Asp Phe Gly Val Trp Ala Tyr Glu Gly Thr Asn Val 130
135 140Lys Arg Val Arg Ala Leu Gln Tyr Ser Val Pro
Glu Glu Ile Ala Pro145 150 155
160His Ile Arg Met Val Ala Pro Val Val Arg Phe Gly Gln Ile Arg Pro
165 170 175Glu Arg Ser Gln
Val Phe Glu Val Val Glu Thr Ala Pro Ser Gln Val 180
185 190Lys Val Ala Ala Ala Ile Pro Pro Gln Asp Leu
Asp Val Lys Ala Cys 195 200 205Asn
Thr Ser Ile Thr Pro Glu Cys Leu Arg Ala Leu Tyr Lys Val Gly 210
215 220Ser Tyr Gln Ala Glu Pro Ser Lys Lys Ser
Leu Phe Gly Val Ala Gly225 230 235
240Tyr Leu Glu Gln Trp Ala Lys Tyr Asp Gln Leu Glu Leu Phe Ala
Ser 245 250 255Thr Tyr Ala
Pro Tyr Ala Ala Asp Ala Asn Phe Thr Ser Val Gly Val 260
265 270Asn Gly Gly Glu Asn Asn Gln Gly Pro Ser
Asp Gln Gly Asp Ile Glu 275 280
285Ala Asn Leu Asp Ile Gln Tyr Ala Val Ala Leu Ser Tyr Lys Thr Pro 290
295 300Ile Thr Tyr Tyr Ile Thr Gly Gly
Arg Gly Pro Leu Val Pro Asp Leu305 310
315 320Asp Gln Pro Asp Pro Asn Asp Val Ser Asn Glu Pro
Tyr Leu Glu Phe 325 330
335Phe Ser Tyr Leu Leu Lys Leu Pro Asp Ser Glu Leu Pro Gln Thr Leu
340 345 350Thr Thr Ser Tyr Gly Glu
Asp Glu Gln Ser Val Pro Arg Pro Tyr Ala 355 360
365Glu Lys Val Cys Gln Met Ile Gly Gln Leu Gly Ala Arg Gly
Val Ser 370 375 380Val Ile Phe Ser Ser
Gly Asp Thr Gly Val Gly Ser Ala Cys Gln Thr385 390
395 400Asn Asp Gly Lys Asn Thr Thr Arg Phe Leu
Pro Ile Phe Pro Gly Ala 405 410
415Cys Pro Tyr Val Thr Ser Ile Gly Ala Thr Arg Tyr Val Glu Pro Glu
420 425 430Gln Ala Ala Ala Phe
Ser Ser Gly Gly Phe Ser Asp Ile Phe Lys Arg 435
440 445Pro Ala Tyr Gln Glu Ala Ala Val Ser Thr Tyr Leu
His Lys His Leu 450 455 460Gly Ser Arg
Trp Lys Gly Leu Tyr Asn Pro Gln Gly Arg Gly Phe Pro465
470 475 480Asp Val Ser Ala Gln Gly Val
Ala Tyr His Val Phe Ser Gln Asp Lys 485
490 495Asp Ile Lys Val Ser Gly Thr Ser Ala Ser Ala Pro
Leu Phe Ala Ala 500 505 510Leu
Val Ser Leu Leu Asn Asn Ala Arg Leu Ala Gln Gly Arg Pro Pro 515
520 525Leu Gly Phe Leu Asn Pro Trp Leu Tyr
Ser Glu Lys Val Gln Lys Ala 530 535
540Gly Ala Leu Thr Asp Ile Val His Gly Gly Ser Ser Gly Cys Thr Gly545
550 555 560Lys Asp Met Tyr
Ser Gly Leu Pro Thr Pro Tyr Val Pro Tyr Ala Ser 565
570 575Trp Asn Ala Thr Pro Gly Trp Asp Pro Val
Thr Gly Leu Gly Thr Pro 580 585
590Val Phe Asp Lys Leu Leu Glu Leu Ser Ser Pro Gly Lys Lys Leu Pro
595 600 605His Ile Gly Gly Gly His Gly
His Gly Ala Gly Gly His 610 615
620166587PRTNeurospora crassa 166Met Leu Trp Ser Val Leu Leu Leu Ala Ala
Gly Ala Ser Ala His Val1 5 10
15Lys Ser Ser Leu Pro Ser Val Pro Ser Gly Trp Lys Lys Val Arg Ala
20 25 30Ala Ser Ala Asp Glu Ser
Val Ser Leu Lys Ile Ala Leu Pro Ala His 35 40
45Gln Pro Asp Ala Leu Glu Thr Ala Ile Leu Arg Val Ser Asp
Pro Asn 50 55 60His His Glu Tyr Gly
Met His Leu Ser Ser Glu Glu Val Arg Ser Leu65 70
75 80Val Ala Pro Ala Asp Glu Thr Thr Asp Ala
Val Thr Ser Trp Leu Asn 85 90
95Arg Asn Gly Ile Lys Gly Lys Val Asp Asn Asp Trp Val Ser Phe Thr
100 105 110Thr Ser Val Ala Lys
Ala Asn Asn Leu Leu Asn Thr Thr Phe Asp Trp 115
120 125Tyr Gln Gln Asp Gly Asp Lys Thr Gly Pro Lys Leu
Arg Thr Leu Gln 130 135 140Tyr Ser Val
Pro Asp Glu Leu Asp Ala His Val Asp Met Ile Gln Pro145
150 155 160Thr Thr Arg Phe Gly Lys Leu
Ala Ala Lys Ala Ser Thr Ile Phe Glu 165
170 175Ile Phe Asp Glu Pro Glu Pro Lys Asn Ile Ala Asn
Val Lys Val Gly 180 185 190Gly
Asp His Pro Thr Cys Thr Gly Cys Ile Tyr Pro Asp Glu Ile Arg 195
200 205Ser Leu Tyr Asn Ile Lys Tyr Lys Pro
Ser Ala Ser Asp Lys Asn Thr 210 215
220Ile Ala Phe Ala Ser Tyr Leu Glu Gln Tyr Ser Asn Tyr Asp Asp Phe225
230 235 240Thr Ser Phe Ala
Lys Ala Phe Ile Pro Asp Ala Ala Asp Arg Asn Tyr 245
250 255Thr Val Lys Leu Val Lys Gly Gly Leu His
Asp Gln Ser Pro Asp Lys 260 265
270Ile Gly Val Glu Ala Asn Leu Asp Leu Gln Tyr Ile Leu Ala Ile Ser
275 280 285Asn Pro Ile Pro Ile Arg Glu
Tyr Ser Ile Gly Gly Arg Gly Pro Leu 290 295
300Val Pro Thr Ala Asn Gln Pro Gly Pro Glu Ile Ser Asn Glu Pro
Tyr305 310 315 320Leu Asp
Phe Phe Gln Tyr Leu Leu Ser Leu Lys Asn Ser Glu Leu Pro
325 330 335Ala Thr Leu Ser Thr Ser Tyr
Gly Glu Glu Glu Gln Ser Val Pro Arg 340 345
350Glu Tyr Ala Leu Lys Val Cys Ser Met Ile Gly Gln Leu Gly
Ala Arg 355 360 365Gly Val Ser Val
Ile Phe Ser Ser Gly Asp Ser Gly Pro Gly Asp Ala 370
375 380Cys Ile Arg Asn Asp Gly Thr Asn Ser Thr Tyr Phe
Glu Pro Thr Phe385 390 395
400Pro Gly Ala Cys Pro Trp Val Thr Ser Val Gly Gly Thr Tyr Gln Thr
405 410 415Gly Pro Glu Lys Ala
Val Asp Phe Ser Ser Gly Gly Phe Ser Met Tyr 420
425 430His Lys Arg Pro Val Tyr Gln Glu Arg Val Val Lys
Lys Tyr Leu Asp 435 440 445Lys Ile
Gly Asp Thr Tyr Ser Asp Phe Phe Asp Glu Gln Gly Arg Gly 450
455 460Phe Pro Asp Val Ser Ala Gln Ala Ser Arg Tyr
Ala Val Tyr Val Asp465 470 475
480Gly Arg Leu Val Gly Val Ser Gly Thr Ser Ala Ser Ala Pro Met Phe
485 490 495Ala Gly Leu Val
Ala Leu Leu Asn Ala Ala Arg Lys Ser His Gly Leu 500
505 510Pro Ser Leu Gly Phe Ile Asn Pro Leu Leu Tyr
Ala Ser Lys Asp Ala 515 520 525Phe
Thr Asp Ile Val Asn Gly Ala Gly Thr Gly Cys Arg Gly Arg Pro 530
535 540Glu Phe Ala Gly Asp Val Gly Gly Thr Ala
Lys Trp Asn Ala Thr Glu545 550 555
560Gly Trp Asp Pro Val Thr Gly Leu Gly Thr Pro Lys Phe Asp Lys
Leu 565 570 575Leu Ala Leu
Ala Ala Pro Gly Val Lys Asn Ala 580
585167720PRTMyceliophthora thermophila 167Met Arg Ile Arg His Ala Leu Val
Gly Ile Ala Ser Leu Cys Cys Leu1 5 10
15Leu Gly Thr Ala Ser Gly Ala Arg Ile Ser Ser Arg Asp Met
Leu Ser 20 25 30Arg Arg Val
Val Pro Pro Ser His Thr Leu His Glu Arg His Glu Ala 35
40 45Gly Asn Val Glu Gly Trp Val Lys Arg Gly Leu
Ala Asp Ala Glu Ser 50 55 60Thr Val
Pro Val Arg Ile Gly Leu Lys Gln Ser Asn Val Asp Ala Ala65
70 75 80His Asp Leu Leu Met Asp Ile
Ser Asp Pro Arg Ser Pro Asn Tyr Gly 85 90
95Lys His Leu Ser Arg Ser Glu Val Glu Asp Leu Phe Ala
Pro Arg Glu 100 105 110His Ser
Val Ala Lys Val Lys Arg Trp Leu Ala Ser Ala Gly Val Asp 115
120 125Glu Gly Arg Ile Ser Gln Ser Ala Asn Lys
Gln Trp Ile Gln Phe Asp 130 135 140Ala
Pro Val Tyr Glu Leu Glu Lys Leu Leu Leu Thr Arg Tyr His Ile145
150 155 160Phe Glu Asn Leu Glu Thr
Gly Val Gln Asn Ile Ala Cys Ser Glu Tyr 165
170 175His Val Pro Arg Asp Val Ser His His Ile Asp Tyr
Ile Thr Pro Gly 180 185 190Ile
Lys Leu Met Ala Gly Gly Arg Glu Glu Arg Met Val Arg Trp Arg 195
200 205Lys Ala Asp Arg Arg Ser Leu Val Ala
Gly Leu Ala Ser Gln Gly Arg 210 215
220Lys Gly Ala His Gly Met Gly His Gly Gly Gly Gly Gly Ser Arg Ser225
230 235 240Pro Asp Asp Pro
Val Val Asp Asp Ser Pro Phe Arg Val Thr Gly Pro 245
250 255Cys Ser Ala Glu Ile Thr Pro Asn Cys Ile
Arg Ala Gln Tyr Gln Leu 260 265
270Pro Asn Gly Thr Arg Ala Ala Ser Gly Asn Glu Leu Gly Ile Phe Gln
275 280 285Gly Leu Gly Gln His Tyr Ser
Gln Glu Asp Leu Asp Asn Tyr Trp Lys 290 295
300Tyr Val Ala Pro Trp Val Pro Arg Gly Thr His Pro Glu Leu Arg
Ser305 310 315 320Ile Asn
Gly Ala Leu Gly Pro Ala Asn Asp Thr Leu Arg Ala Gly Glu
325 330 335Glu Ala Asp Leu Asp Phe Gln
Ile Ala Ile Pro Leu Ile Trp Pro Gln 340 345
350Arg Thr Val Leu Phe Gln Thr Asp Asp Glu Trp Tyr Gln Gln
Asp Gln 355 360 365Gln Arg Ala Asp
Thr Lys Tyr Pro Gly Phe Phe Asn Thr Phe Phe Asp 370
375 380Ala Ile Asp Gly Ser Tyr Cys His Met Thr Ala Phe
Asn Met Thr Gly385 390 395
400Asn Cys Val Thr Pro Glu Cys Arg Asp Pro Glu Tyr Pro Asn Pro Asn
405 410 415Ala Thr Pro Glu Gln
Gly Gly Tyr Ala Gly Ala Leu Met Cys Gly Arg 420
425 430His Arg Pro Thr Ser Val Val Ser Val Ser Tyr Ser
Gly Thr Glu Asp 435 440 445Ser Trp
Pro Ala Ser Tyr Met Arg Arg Gln Cys Leu Glu Val Leu Lys 450
455 460Leu Ala Leu Gln Gly Val Thr Val Val Glu Ser
Ser Gly Asp Phe Gly465 470 475
480Val Gly Gly Arg Pro Phe Asp Pro Arg Ala Gly Cys Leu Gly Pro Asp
485 490 495Arg Ala Val Phe
Ser Pro Arg Val Met Ala Asn Cys Pro Tyr Val Leu 500
505 510Ser Val Gly Ala Thr Ala Leu Val Asp Pro Glu
Gln Glu Gln Gln Gln 515 520 525Gln
His Ala Asp Arg Gly Gly Ser Gly Lys Glu Pro Arg Leu Val Glu 530
535 540Val Ala Ala Arg Thr Phe Ala Ser Gly Gly
Gly Phe Ser Asn Ile Phe545 550 555
560Gly Arg Pro Lys Trp Gln Asp Arg His Val Arg Glu Tyr Leu Arg
Lys 565 570 575Thr Asn Leu
Ser Glu Leu Gly Tyr Asp Asn Ala Ala Gly Met Ser Phe 580
585 590Asp Ser Leu Arg Pro Pro Pro Ala Gly Gly
Lys Leu Phe Asn Arg Leu 595 600
605Gly Arg Gly Tyr Pro Asp Val Ala Ala Val Gly Gln Asn Phe Arg Val 610
615 620Val Leu Arg Gly Tyr Pro Asn Arg
Met His Gly Thr Ser Ala Ala Ala625 630
635 640Pro Val Trp Ala Ser Ile Leu Thr Leu Ile Asn Glu
Glu Arg Arg Ala 645 650
655Val Gly Lys Gly Pro Val Gly Phe Val His Gln Val Leu Tyr Gln His
660 665 670Pro Glu Val Phe Thr Asp
Ile Thr Val Gly Ser Asn Pro Gly Cys Gly 675 680
685Thr Asp Gly Phe Pro Val Glu Glu Gly Trp Asp Pro Val Thr
Gly Leu 690 695 700Gly Ser Pro Ile Tyr
Pro Lys Leu Leu Lys Leu Phe Met Ser Leu Pro705 710
715 720168719PRTNeurospora crassa 168Met Phe Arg
Phe His Leu Trp Thr Leu Leu Arg Leu Phe Ala Leu Leu1 5
10 15Ser Ser Leu Val Thr Ala Ser Arg Ile
Val Leu Glu Glu Ala Gly His 20 25
30Leu Pro Ala Gly Trp Lys Val Glu Arg His Ala Thr Ala Ser Asp Arg
35 40 45Ile Gln Leu Ser Ile Ala Leu
Lys Glu Pro Gly Ile Glu Glu Leu Lys 50 55
60Arg Arg Leu Leu Gln Gln Ser Thr Ser Asp Asp His Pro Asn Ser Arg65
70 75 80Gln Phe Thr Lys
Glu Glu Val Glu Lys His Arg Gln Pro Asp Gln Arg 85
90 95Ser Val Thr Ala Val Gly Arg Trp Leu Gln
Ser His Gly Ile Lys Ser 100 105
110Tyr Asn Ala Asp Asn Ser Trp Ile Thr Phe Lys Ala Thr Ala Ala Thr
115 120 125Val Gln Met Leu Phe Glu Ala
Asp Leu Ala Tyr Tyr Ser Tyr Asn Gly 130 135
140Asp Pro Ser Thr Gln Ile Leu Arg Ser Arg Ser Tyr Thr Ile Pro
Arg145 150 155 160Trp Leu
Ser Asp Asp Ile Asp Phe Val His Pro Leu Thr Asn Phe Met
165 170 175Pro Pro Arg Asn Arg Asn Asp
Gly Thr Leu Gly Ile Gly Arg Arg Gln 180 185
190Pro Ile Gln Pro Lys Leu Ser Ala Arg Glu Asp Phe Phe Ala
Pro Pro 195 200 205Cys Trp Thr Gly
Thr Phe Pro Gly Cys Ile Arg Lys Leu Tyr Asn Leu 210
215 220Thr Tyr Thr Pro Ser Pro Asp Phe Arg Ser Pro Ser
Pro Val Arg Phe225 230 235
240Gly Ile Ala Ser Phe Leu Glu Gln Tyr Ile Thr His Arg Asp Val Thr
245 250 255Ser Phe Leu Ala Thr
Tyr Ala Arg Glu Leu Leu Pro Leu Arg Pro Thr 260
265 270Pro Ser Arg Gly Gly Ser Gly Gly Ser Leu Thr Leu
Pro Pro Val Thr 275 280 285Asn Thr
Thr Ser Glu Pro Pro Tyr Asn Ile Thr Ile Thr Leu Leu Asn 290
295 300Asn Ala Thr Arg Trp Asp Pro His Ser Thr Asp
Pro Ala Leu Ser Gly305 310 315
320Leu Glu Ala Asn Leu Asp Val Gln Tyr Ala Leu Ser Leu Gly His Pro
325 330 335Thr Arg Val Ile
Tyr Tyr Ala Thr Gly Gly Arg Gly Thr Lys Leu Asp 340
345 350Ser Ser Gly Arg Pro Leu Pro Thr Asn Asp Pro
Arg Ala Asn Asn Glu 355 360 365Pro
Phe Leu Glu Phe Leu Gln Ala Leu Leu Ala Leu Pro Asp Asn Gln 370
375 380Ile Pro His Val Leu Ser Ile Ser Tyr Ala
Asp Asp Glu Gln Ser Val385 390 395
400Pro Arg Lys Tyr Ala His Arg Val Cys Asp Leu Phe Ala Ala Val
Ala 405 410 415Ala Arg Gly
Thr Ser Val Leu Val Ala Thr Gly Asp Gly Gly Ala Ala 420
425 430Gly Ile Gly Phe Ser Ala Gly Gly Gly Asp
Thr Cys Ile Lys Asn Asp 435 440
445Gly Ser Gly Arg Arg Ala Phe Val Pro Thr Phe Pro Ala Ser Cys Pro 450
455 460Trp Val Thr Ser Val Gly Ala Thr
Asp Asn Thr Ala Leu Asn Leu Thr465 470
475 480Gly Ala Ala Phe Ser Ser Gly Gly Phe Ser Glu Tyr
Phe Asp Arg Pro 485 490
495Leu Trp Gln Arg Ala Ala Val Asp Pro Tyr Val Ser Ser Leu Leu Arg
500 505 510Ser Arg Ser Ser Lys Pro
Gly Gln Pro Ser Gln Pro Arg Asp Leu Lys 515 520
525Gly Val Tyr Phe Ser His Asn Gly Arg Gly Met Pro Asp Met
Ala Ala 530 535 540Ile Gly Ser Gly Phe
Gln Ile Ile His Arg Gly Glu Met Val Glu Val545 550
555 560Arg Gly Thr Ser Ala Ser Thr Pro Val Val
Ala Ala Met Val Ala Leu 565 570
575Val Asn Asp Gln Arg Leu Arg Gln Gly Lys Arg Ser Leu Gly Trp Leu
580 585 590Asn Gly His Leu Tyr
Leu Asp Pro Arg Val Arg Arg Val Leu Thr Asp 595
600 605Val Lys Trp Gly Arg Ser Glu Gly Cys Val Phe Pro
Gly Glu Ala Leu 610 615 620Glu Glu Gly
Arg Gly Lys Gly Lys Glu Lys Tyr Trp Arg His Ser Val625
630 635 640Val Glu Lys Arg Gln Gly Asn
Ser Glu Glu Asp Gly Gly Thr His Gly 645
650 655Gly Asp Gly Glu Gly Lys Ala Asp Glu Glu Asp Trp
Gly Gly Glu Gly 660 665 670Glu
Val Gly Glu Gly Glu Gly Asp Gln Ser Glu Asn Val Ile Leu Gly 675
680 685Gly Trp Asp Ala Arg Lys Gly Trp Asp
Pro Val Thr Gly Leu Gly Val 690 695
700Pro Gly Asp Phe Gln Glu Met Leu Lys Val Leu Gly Ser Val Trp705
710 715169454PRTNeurospora crassa 169Met Arg Ala
Thr Leu Val Val Val Leu Cys His Leu Ser Leu Ala Phe1 5
10 15Ala Leu Ala Ile Ser Pro Ala Ala Ser
His Trp Lys Arg Ser Ala Arg 20 25
30Leu Ala Ser Asp Gln Thr Ala Ser Glu Arg Tyr Ser Leu Pro Ser Arg
35 40 45Val Ala Arg Tyr Ile Asp Tyr
Val Leu Pro Ala Pro Asp Pro Asp Pro 50 55
60Val Ser Ser Ala Pro Lys Ser Val Ala Val Gln Asp Pro Pro Thr Leu65
70 75 80Lys Gly Val Ile
Gly Ala Arg Gln Thr Arg Asp Val Asp Cys Leu Gln 85
90 95Tyr Ile Ala Pro Gln Cys Leu Arg Gln Leu
Ala Trp Leu Ala Glu Asp 100 105
110Leu Asp Met Phe Phe Gly Asp Phe Ala Pro Asp Leu Leu Thr Asn Phe
115 120 125Asn Leu Glu Pro Asn Leu Asp
Tyr Lys Tyr Thr Met Ala Met Ala Lys 130 135
140Pro Ile Pro Val Thr Asn Ile Gln Val Gly Asp Phe Val Val Gln
Gly145 150 155 160Asn Met
Asn Ile Met Leu Ala Ala Phe Asn Ala His Tyr Cys Arg Thr
165 170 175Gly Leu Asp Pro Gln Phe Asp
Pro Val Tyr Pro Asn Pro Ala Pro Gly 180 185
190Gly Tyr Asn Ala Ser Asp Cys Gly Thr His Val Pro Pro Arg
Val Ile 195 200 205Ala Ile Met Tyr
Ala Trp Asn Lys Ala Trp Tyr Ser Asp Ala Asp Phe 210
215 220Ala Ser Ile Phe Pro Ala Ser Asp Pro Trp Val Thr
Ser Val Gly Gly225 230 235
240Thr Gln Phe Leu Pro Val Val Ser Asn Gly Ser Ser Ser Thr Thr Ala
245 250 255Ser Ser Gly Met Pro
Ser Ser Ser Ser Ser Ser Ser Ser Ser Ser Ser 260
265 270Ser Ser Ser Ser Ser Ser Ser Ser Ser Leu Phe Pro
Gly Glu Thr Ala 275 280 285Leu Asp
Asp Asn Asn Thr Gly Ser Ser Gly Gly Ser Phe Ser Arg Leu 290
295 300Phe Pro Gly Pro Trp Tyr Gln Gly Asn Leu Thr
Arg Glu Tyr Leu Ala305 310 315
320Ser Ala Pro Gly Ala Ala Glu Leu Ala Arg Gln Gly Tyr Phe Asn Gly
325 330 335Ser Gly Arg Gly
Tyr Pro Asp Ile Ser Ala Met Ala Arg Ser Phe Leu 340
345 350Val Ala Leu His Gly Gly Tyr His Ala Val Ser
Gly Thr Ser Ala Ser 355 360 365Thr
Pro Val Val Ala Ala Met Val Ala Lys Ile Asn Asp Ala Arg Leu 370
375 380His Ala Gly Lys Ser Thr Val Gly Phe Leu
Asn Pro Val Leu Tyr Ser385 390 395
400Ala Ala Ala Gly Lys Ala Gly Val Leu Arg Asp Val Pro Leu Gly
Lys 405 410 415Asn His Asp
Cys Gly Val Gly Glu Ala Phe Pro Ala Arg Arg Ala Trp 420
425 430Asp Ala Val Thr Gly Leu Gly Thr Pro Asp
Phe Glu Lys Leu Lys Glu 435 440
445Leu Tyr Leu Gly Leu Pro 45017050PRTAspergillus niger 170Ile Val Thr
Trp Asp Glu Ala His Phe Gly Lys Phe Gly Ser His Tyr1 5
10 15Leu Lys Arg Glu Phe Tyr Phe Asp Val
His Pro Pro Leu Gly Lys Met 20 25
30Leu Val Gly Leu Ser Gly Phe Leu Ala Gly Tyr Asn Gly Ser Phe Glu
35 40 45Phe Lys
5017150PRTAspergillus oryzae 171Ile Val Thr Trp Asp Glu Ala His Phe Gly
Lys Phe Gly Ser His Tyr1 5 10
15Leu Lys Arg Glu Phe Tyr Phe Asp Val His Pro Pro Leu Gly Lys Met
20 25 30Leu Val Gly Leu Ser Gly
Tyr Leu Ala Gly Tyr Asn Gly Ser Phe Glu 35 40
45Phe Lys 5017250PRTAspergillus nidulans 172Ile Val Thr
Trp Asp Glu Ala His Phe Gly Lys Phe Gly Ser His Tyr1 5
10 15Leu Lys Arg Glu Phe Tyr Phe Asp Val
His Pro Pro Leu Gly Lys Met 20 25
30Leu Val Gly Leu Ser Gly Leu Leu Ala Gly Tyr Asn Gly Ser Phe Glu
35 40 45Phe Lys
5017350PRTMyceliophthora thermophila 173Ile Val Thr Trp Asp Glu Ala His
Phe Gly Lys Phe Gly Ser His Tyr1 5 10
15Leu Lys Arg Glu Phe Tyr Phe Asp Val His Pro Pro Ala Gly
Lys Leu 20 25 30Leu Val Gly
Leu Ser Gly Tyr Leu Ala Gly Tyr Asn Gly Ser Phe Glu 35
40 45Phe Lys 5017450PRTNeurospora crassa 174Ile
Val Thr Trp Asp Glu Ala His Phe Gly Lys Phe Gly Ser His Tyr1
5 10 15Leu Lys Arg Glu Phe Tyr Phe
Asp Val His Pro Pro Ala Gly Lys Leu 20 25
30Leu Val Gly Leu Ser Gly Leu Leu Ala Gly Tyr Asn Gly Ser
Phe Glu 35 40 45Phe Lys
5017550PRTTrichoderma virens 175Ile Val Thr Trp Asp Glu Ala His Phe Gly
Lys Phe Gly Ser Tyr Tyr1 5 10
15Ile Lys His Glu Tyr Tyr Phe Asp Val His Pro Pro Leu Gly Lys Met
20 25 30Leu Val Gly Leu Ser Gly
Val Leu Ala Gly Tyr Asn Gly Ser Phe Glu 35 40
45Phe Lys 5017650PRTTrichoderma reesei 176Ile Val Thr Trp
Asp Glu Ala His Phe Gly Lys Phe Gly Ser Tyr Tyr1 5
10 15Ile Lys His Glu Tyr Tyr Phe Asp Val His
Pro Pro Leu Gly Lys Met 20 25
30Leu Val Gly Leu Ser Gly Val Leu Ala Gly Tyr Asn Gly Ser Phe Glu
35 40 45Phe Lys 5017750PRTFusarium
oxysporum 177Ile Val Thr Trp Asp Glu Ala His Phe Gly Lys Phe Gly Ser Tyr
Tyr1 5 10 15Ile Lys His
Glu Tyr Tyr Phe Asp Val His Pro Pro Leu Gly Lys Met 20
25 30Leu Val Gly Leu Ser Gly Val Leu Ala Gly
Tyr Asn Gly Thr Phe Glu 35 40
45Phe Lys 5017850PRTNeurospora crassa 178Ser Val Val Phe Asp Glu Val
His Phe Gly Gly Phe Ala Ser Lys Tyr1 5 10
15Ile Lys Gly Lys Phe Phe Met Asp Val His Pro Pro Leu
Ala Lys Leu 20 25 30Met Ile
Thr Leu Phe Gly Trp Leu Ala Gly Phe Asp Gly Ser Phe Asp 35
40 45Phe Lys 5017950PRTMyceliophthora
thermophila 179Ser Val Val Phe Asp Glu Val His Phe Gly Gly Phe Ala Thr
Lys Tyr1 5 10 15Ile Lys
Gly Lys Phe Phe Met Asp Val His Pro Pro Leu Ala Lys Leu 20
25 30Met Ile Thr Leu Phe Gly Trp Leu Ala
Gly Phe Lys Gly Asn Phe Asp 35 40
45Phe Lys 5018050PRTTrichoderma virens 180Ser Val Val Phe Asp Glu Val
His Phe Gly Gly Phe Ala Ser Lys Tyr1 5 10
15Ile Lys Gly Lys Phe Phe Met Asp Val His Pro Pro Leu
Ala Lys Met 20 25 30Leu Ile
Ala Leu Thr Gly Trp Leu Ala Gly Phe Asp Gly Asn Phe Asp 35
40 45Phe Lys 5018150PRTTrichoderma
atroviride 181Ser Val Val Phe Asp Glu Val His Phe Gly Gly Phe Ala Ser Lys
Tyr1 5 10 15Ile Lys Gly
Arg Phe Phe Met Asp Val His Pro Pro Leu Ala Lys Met 20
25 30Leu Ile Ala Leu Thr Gly Trp Leu Ala Gly
Phe Asp Gly Asp Phe Asp 35 40
45Phe Lys 5018250PRTTrichoderma reesei 182Ser Val Val Phe Asp Glu Val
His Phe Gly Gly Phe Ala Ser Lys Tyr1 5 10
15Ile Lys Gly Arg Phe Phe Met Asp Val His Pro Pro Leu
Ala Lys Met 20 25 30Leu Ile
Ala Leu Thr Gly Trp Leu Ala Gly Phe Asp Gly Asn Phe Asp 35
40 45Phe Lys 5018350PRTFusarium oxysporum
183Ser Val Val Phe Asp Glu Val His Phe Gly Gly Phe Ala Thr Lys Tyr1
5 10 15Ile Lys Gly Lys Phe Phe
Met Asp Val His Pro Pro Leu Ala Lys Met 20 25
30Leu Ile Ala Leu Thr Gly Trp Leu Ala Gly Phe Asp Gly
Ser Phe Asp 35 40 45Phe Lys
5018450PRTAspergillus nidulans 184Ser Val Val Phe Asp Glu Val His Phe Gly
Gly Phe Ala Thr Lys Tyr1 5 10
15Ile Lys Gly Arg Phe Phe Met Asp Val His Pro Pro Leu Ala Lys Leu
20 25 30Leu Ile Thr Leu Ala Gly
Trp Leu Ala Gly Phe Lys Gly Asp Phe Asp 35 40
45Phe Lys 5018550PRTAspergillus oryzae 185Ser Val Val Phe
Asp Glu Val His Phe Gly Gly Phe Ala Ser Lys Tyr1 5
10 15Ile Lys Gly Arg Phe Phe Met Asp Val His
Pro Pro Leu Ala Lys Leu 20 25
30Leu Ile Thr Leu Ala Gly Trp Leu Ala Gly Phe Asn Gly Asp Phe Asp
35 40 45Phe Lys
5018650PRTAspergillus niger 186Ser Val Val Phe Asp Glu Val His Phe Gly
Gly Phe Ala Thr Lys Tyr1 5 10
15Ile Lys Gly Arg Phe Phe Met Asp Val His Pro Pro Leu Ala Lys Leu
20 25 30Leu Ile Thr Leu Ala Gly
Trp Leu Ala Gly Phe Asp Gly Glu Phe Asp 35 40
45Phe Lys 5018750PRTPenicillium chrysogenum 187Ser Val
Val Phe Asp Glu Val His Phe Gly Gly Phe Ala Ser Lys Tyr1 5
10 15Ile Lys Gly Lys Phe Phe Met Asp
Val His Pro Pro Leu Ala Lys Leu 20 25
30Leu Leu Thr Leu Ala Gly Trp Leu Ala Gly Phe Asp Gly Asn Phe
Asp 35 40 45Phe Lys
5018850PRTTrichoderma reesei 188Glu Val Val Phe Asp Glu Val His Phe Gly
Lys Phe Ala Ser Tyr Tyr1 5 10
15Leu Gln Arg Thr Tyr Phe Phe Asp Val His Pro Pro Phe Ala Lys Leu
20 25 30Leu Phe Ala Phe Val Gly
Trp Leu Val Gly Tyr Asp Gly His Phe His 35 40
45Phe Asp 5018950PRTTrichoderma virens 189Glu Val Val Phe
Asp Glu Val His Phe Gly Lys Phe Ala Ser Tyr Tyr1 5
10 15Leu Gln Arg Thr Tyr Phe Phe Asp Val His
Pro Pro Phe Ala Lys Leu 20 25
30Leu Phe Ala Phe Val Gly Trp Leu Val Gly Tyr Asp Gly His Phe His
35 40 45Phe Glu 5019050PRTFusarium
oxysporum 190Glu Val Val Phe Asp Glu Val His Phe Gly Lys Phe Ala Ser Tyr
Tyr1 5 10 15Leu Glu Arg
Thr Tyr Phe Phe Asp Val His Pro Pro Phe Gly Lys Leu 20
25 30Leu Phe Ala Phe Val Gly Trp Leu Val Gly
Tyr Asp Gly Asn Phe His 35 40
45Phe Glu 5019150PRTGibberella zeae 191Glu Val Val Phe Asp Glu Val His
Phe Gly Lys Phe Ala Ser Tyr Tyr1 5 10
15Leu Glu Arg Thr Tyr Phe Phe Asp Val His Pro Pro Phe Gly
Lys Leu 20 25 30Leu Phe Ala
Phe Val Gly Trp Leu Val Gly Tyr Asp Gly His Phe His 35
40 45Phe Asp 5019250PRTMyceliophthora
thermophila 192Glu Val Val Phe Asp Glu Val His Phe Gly Lys Phe Ala Ser
Tyr Tyr1 5 10 15Leu Glu
Arg Thr Tyr Phe Phe Asp Val His Pro Pro Leu Gly Lys Leu 20
25 30Leu Phe Ala Phe Met Gly Trp Leu Val
Gly Tyr Asp Gly His Phe His 35 40
45Phe Glu 5019350PRTNeurospora crassa 193Glu Val Val Phe Asp Glu Val
His Phe Gly Lys Phe Ala Ser Tyr Tyr1 5 10
15Leu Glu Arg Thr Tyr Phe Phe Asp Val His Pro Pro Phe
Gly Lys Leu 20 25 30Leu Phe
Ala Phe Met Gly Trp Leu Val Gly Tyr Asp Gly His Phe His 35
40 45Phe Glu 5019450PRTAspergillus nidulans
194Gln Val Val Phe Asp Glu Val His Phe Gly Lys Phe Ala Ser Tyr Tyr1
5 10 15Leu Arg Arg Thr Tyr Phe
Phe Asp Val His Pro Pro Phe Ala Lys Leu 20 25
30Leu Leu Ala Phe Thr Gly Trp Leu Val Gly Tyr Asp Gly
His Phe Leu 35 40 45Phe Glu
5019550PRTAspergillus niger 195Glu Val Val Phe Asp Glu Val His Phe Gly
Lys Phe Ala Ser Tyr Tyr1 5 10
15Leu Gln Arg Thr Tyr Phe Phe Asp Val His Pro Pro Phe Gly Lys Leu
20 25 30Leu Phe Ala Phe Met Gly
Trp Leu Val Gly Tyr Asp Gly His Phe Leu 35 40
45Phe Asp 5019650PRTAspergillus oryzae 196Glu Val Val Phe
Asp Glu Val His Phe Gly Lys Phe Ala Ser Tyr Tyr1 5
10 15Leu Gln Arg Thr Tyr Phe Phe Asp Val His
Pro Pro Phe Gly Lys Leu 20 25
30Leu Phe Ala Ala Val Gly Trp Leu Ile Gly Tyr Asp Gly His Phe Leu
35 40 45Phe Glu
5019750PRTPenicillium chrysogenum 197Glu Val Val Phe Asp Glu Val His Phe
Gly Lys Phe Ala Ser Tyr Tyr1 5 10
15Leu Gln Arg Thr Tyr Phe Phe Asp Val His Pro Pro Phe Gly Lys
Leu 20 25 30Leu Phe Ala Leu
Met Gly Trp Leu Val Gly Phe Asp Gly Ser Phe Leu 35
40 45Phe Glu 50
User Contributions:
Comment about this patent or add new information about this topic: