Patent application title: RECOMBINANT VIRUS AND PREPARATIONS THEREOF
Inventors:
Feng Zhang (Cambridge, MA, US)
Feng Zhang (Cambridge, MA, US)
Mark D. Brigham (Somerville, MA, US)
Le Cong (Cambridge, MA, US)
Le Cong (Cambridge, MA, US)
Silvana Konermann (Zurich, CH)
IPC8 Class: AC12N700FI
USPC Class:
506 7
Class name: Combinatorial chemistry technology: method, library, apparatus method of screening a library
Publication date: 2016-03-10
Patent application number: 20160068822
Abstract:
The present invention generally relates to methods and compositions used
delivery of gene editing compositions including transcriptional effectors
with parvovirus and preferred methods for making same.Claims:
1. A method for obtaining and optionally storing a sample containing a
set amount of rAAV comprising or consisting essentially of: (a) creating
infected or transfected cells by a process comprising or consisting
essentially of one or more methods selected from: (i) transfecting
plasmid(s) containing or consisting essentially of exogenous DNA
including DNA for expression into AAV-infected cells along with another
helper plasmid that provides AAV rep and/or cap genes which are
obligatory for replication and packaging of the rAAV; or (ii) infecting
susceptible cells with a rAAV containing or consisting essentially of
exogenous DNA including DNA for expression, and helper virus wherein the
rAAV lacks functioning cap and/or rep and the helper virus provides the
cap and/or rev function that the rAAV lacks; or (iii) infecting
susceptible cells with a rAAV containing or consisting essentially of
exogenous DNA including DNA for expression, wherein the recombinant
construct lacks functioning cap and/or rep, and transfecting said cells
with a plasmid supplying cap and/or rep function that the rAAV lacks; or
(iv) infecting susceptible cells with a rAAV containing or consisting
essentially of exogenous DNA including DNA for expression, wherein the
recombinant construct lacks functioning cap and/or rep, wherein said
cells supply cap and/or rep function that the recombinant construct
lacks; or (v) transfecting the susceptible cells with an AAV lacking
functioning cap and/or rep and plasmids for inserting exogenous DNA into
the recombinant construct so that the exogenous DNA is expressed by the
recombinant construct and for supplying rep and/or cap functions whereby
transfection results in an rAAV containing or consisting essentially of
the exogenous DNA including DNA for expression that lacks functioning cap
and/or rep; and (b) incubating the infected or transfected cells, whereby
there results infected or transfected cells and supernatant containing
the rAAV lacking functioning cap and/or rep; (c) after incubating,
extracting an aliquot from the supernatant; (d) filtering the aliquot,
whereby the filtered aliquot contains and the method obtains a sample
containing set amount of the rAAV relative to the type and amount of
susceptible cells infected or transfected; and (e) optionally freezing
the filtered aliquot, whereby the method optionally includes storing a
sample containing set amount of the rAAV relative to the type and amount
of susceptible cells infected or transfected.
2. A method for screening rAAV comprising or consisting essentially of, preparing the filtered aliquot or the stored filtered aliquot of claim 1, if necessary, thawing the stored filtered aliquot, contacting the filtered aliquot with cells, and determining whether the exogenous DNA is expressed in an amount and/or duration sufficient for an intended use.
3. The method of claim 2 wherein the contacting of the filtered aliquot with cells comprises or consists essentially of transducing said cells.
4. The method of claim 3 wherein the contacting is for 5-6 days.
5. The method of claim 2 wherein the rAAV expresses a TALE and the contacting includes or consists essentially of detecting nuclease, activator or repressor activity.
6. The method of claim 2 wherein the rAAV expresses a LITE, and the contacting includes or consists essentially of inducing gene expression or subjecting the contacted cells to a suitable stimulus, and detecting whether a transcriptional effector has been induced.
7. The method of claim 6 wherein detecting whether a transcriptional effector has been induced includes or consists essentially of detecting a color change.
8. The method of claim 2 wherein the rAAV expresses a CRISPR system, and the contacting includes or consists essentially of detecting gene knockdown or other effects of the CRISPR system.
9. The method of claim 1 wherein the AAV is AAV1, AAV2, AAV5 or an AAV having a hybrid or mosaic AAV1, AAV2 and/or AAV5 capsid.
10. The method of claim 1 wherein the susceptible cells are 293FT cells.
11. The method of claim 10 wherein 2.times.10.sup.5 cells are transfected or infected.
12. The method of claim 11 wherein a 250 μL filtered aliquot contains the recombinant AAV at a concentration of about 5.6+/-0.24.times.10.sup.5.
13. The method of claim 1 including freezing the filtered aliquot.
14. The method of claim 13 wherein the filtered aliquot is frozen at about -80 C.
15. The method of claim 1 including adding a secretion enhancer to the cells before, during or after and within the incubating.
16. The method of claim 15 wherein the secretion enhancer is polyethylenimine (PEI).
17. A method of high-throughput screening of a sample comprising or consisting essentially of contacting the supernatant containing the rAAV lacking functioning cap and/or rep of claim 1 with the sample and determining whether the exogenous DNA of claim 1 is present in the sample.
18. The method of claim 17, wherein the supernatant is thawed from the filtered aliquot.
Description:
RELATED APPLICATIONS AND INCORPORATION BY REFERENCE
[0001] This application is a continuation-in-part of international patent application Serial No. PCT/US2014/030394, filed Mar. 17, 2014, and published as PCT Publication No. WO2014/145599 on Sep. 18, 2014 and which claims priority to U.S. patent application Ser. No. 14/213,991 filed on Mar. 14, 2014 which claims priority to U.S. Provisional Application 61/799,800 filed on Mar. 15, 2013. Reference is made to US applications having Broad reference BI-2011/008 to US Provisional Application Nos. 61/736,527 filed Dec. 12, 2012; 61/748,427 filed Jan. 2, 2013; 61/757,972 filed Jan. 29, 2013, 61/768,959, filed Feb. 25, 2013 and 61/791,409 filed Mar. 15, 2013, titled SYSTEMS METHODS AND COMPOSITIONS FOR SEQUENCE MANIPULATION; Broad reference BI-2011/020 to US Provisional Application Nos. 61/675,778 filed Jul. 25, 2012; 61/721,283 filed Nov. 1, 2012: 61/726,465 filed Dec. 12, 2012 and 61/794,458 filed Mar. 15, 2013, tided. INDUCIBLE DNA BINDING PROTEINS AND GENOME PERTURBATION TOOLS AND APPLICATIONS THEREOF; Broad reference BI-2011/021 to U.S. Provisional Application No. 61/565,171 filed Nov. 30, 2011 and U.S. application Ser. No. 13/554,922 filed Jul. 30, 2012 and Ser. No. 13/604,945 filed Sep. 6, 2012, titled NUCLEOTIDE-SPECIFIC RECOGNITION SEQUENCES FOR DESIGNER TAL EFFECTORS and Broad references BI-2013/003 and BI-2013/004 to U.S. Provisional Application No. 61/836,123 filed on Jun. 17, 2013 and U.S. Provisional Application Nos. 61/758,468; 61/769,046; 61/802,174; 61/806,375; 61/814,263; 61/819,803 and 61/828,130 each entitled ENGINEERING AND OPTIMIZATION OF SYSTEMS, METHODS AND COMPOSITIONS FOR SEQUENCE MANIPULATION, filed on Jan. 30, 2013; Feb. 25, 2013; Mar. 15, 2013; Mar. 28, 2013; Apr. 20, 2013; May 6, 2013 and May 28, 2013 respectively.
[0002] The foregoing applications, and all documents cited therein or during their prosecution ("appln cited documents") and all documents cited or referenced in the appln cited documents, and all documents cited or referenced herein ("herein cited documents"), and all documents cited or referenced in herein cited documents, together with any manufacturer's instructions, descriptions, product specifications, and product sheets for any products mentioned herein or in any document incorporated by reference herein, are hereby incorporated herein by reference, and may be employed in the practice of the invention. More specifically, all referenced documents are incorporated by reference to the same extent as if each individual document was specifically and individually indicated to be incorporated by reference.
FIELD OF THE INVENTION
[0004] The present invention generally relates to methods for preparation of viral vector and methods and compositions for advantageous delivery of nucleic acid molecule(s) for expression of Transcription Activation Like Effector (TALE) and nucleic acid molecule(s) for expression of a CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) system, or nucleic acid molecule(s) for expression of a light-inducible transcriptional effector (LITE), or a cassette or plurality of cassette comprising or consisting essentially of a promoter and exogenous nucleic acid molecule encoding same particularly for gene editing in a eukaryote cell. TALEs, LITEs and CRISPRs expressed via a recombinant construct, e.g., an AAV, can advantageously provide activator, repressor or nuclease activity in vivo, in vitro or ex vivo.
[0005] The method of the invention can provide a readily accessible, reproducible aliquot of recombinant construct that can be used for testing, e.g., testing whether construction of the recombinant construct was successful, or whether the recombinant construct expresses the exogenous DNA in an amount that may be sufficient for an intended use and/or for a duration that may be sufficient for an intended use, i.e., for screening, such as high throughput screening. And hence the invention relates to a method that may advantageously be for screening or high throughput screening, wherein the method additionally comprises or consists essentially of contacting the aliquot with cells and determining whether the exogenous DNA is expressed in an amount and/or duration sufficient for an intended use.
BACKGROUND OF THE INVENTION
[0006] Normal gene expression is a dynamic process with carefully orchestrated temporal and spatial components, the precision of which are necessary for normal development, homeostasis, and advancement of the organism. In turn, the dysregulation of required gene expression patterns, either by increased, decreased, or altered function of a gene or set of genes, has been linked to a wide array of pathologies. Technologies capable of modulating gene expression in a spatiotemporally precise fashion will enable the elucidation of the genetic cues responsible for normal biological processes and disease mechanisms. To address this technological need, Applicants developed molecular tools that may regulate gene expression.
[0007] There is an evident need for methods and compositions that allow for efficient and precise spatial and temporal control of a genomic locus of interest. These methods and compositions may provide for the regulation and modulation of genomic expression both in vivo and in vitro as well as provide for novel treatment methods for a number of disease pathologies.
[0008] Adeno-associated virus (AAV) is a single-stranded DNA parvovirus which is endogenous to the human population. Although capable of productive infection in cells from a variety of species, AAV is a dependovirus, requiring helper functions from either adenovirus, herpesvirus or a poxvirus such as vaccinia virus for its own replication. In the absence of helper functions from any of these helper viruses, AAV will infect cells, uncoat in the nucleus, and integrate its genome into the host chromosome, but will not replicate or produce new viral particles. There are at least 12 recognized AAV serotypes, There are recombinant AAVs. A recombinant AAV can accommodate approximately 4300 bases of exogenous DNA, and AAVs having a hybrid or mosaic capsid have been produced.
[0009] The genome of AAV has been cloned into bacterial plasmids and is well characterized. The viral genome consists of 4682 bases which include two terminal repeats of 145 bases each. These terminal repeats serve as origins of DNA replication for the virus. Some investigators have also proposed that they have enhancer functions. The rest of the genome is divided into two functional domains. The left portion of the genome codes for the rep functions which regulate viral DNA replication and vital gene expression. The right side of the vital genome contains the cap genes that encode the structural capsid proteins VP1, VP2 and VP3. The proteins encoded by both the rep and cap genes function in trans during productive AAV replication.
[0010] Citation or identification of any document in this application is not an admission that such document is available as prior art to the present invention.
SUMMARY OF THE INVENTION
[0011] The present invention particularly relates to methods for preparation of viral vector and methods and compositions for advantageous delivery of Transcription Activation Like Effector (TALE) and nucleic acid molecule(s) for expression or a CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) system, or a cassette or plurality of cassette comprising or consisting essentially of a promoter and exogenous nucleic acid molecule encoding same particularly for gene editing in a eukaryote cell.
[0012] The present invention encompasses nucleic acid encoding the polypeptides of the present invention. The nucleic acid may comprise a promoter, advantageously human Synapsin I promoter (hSyn). In one embodiment, the nucleic acid is packaged into a viral vector. In some embodiments, the nucleic acid is packaged into a parvovirus-based vector. In some embodiments, the nucleic acid is packaged into an adeno associated viral vector (AAV).
[0013] The invention further relates to methods of treatment or therapy that encompass the methods and compositions described herein.
[0014] As discussed herein, the present invention generally relates to recombinant parvovirus (Group II viruses according to the Baltimore classification; e.g., Parvovirus B19, e.g. Dependovirus (e.g. Adeno-Associated Virus or AAV), Erythrovirus (e.g. Parvovirus B19) or Bocavirus), advantageously AAV. AAV is a prototypical Dependovirus, The invention will be discussed with regard to advantageous AAV embodiments with it understood that the invention comprehends any of "parvovirus", "Parvovirus B19". "Dependovirus", "Erythrovirus" or "Bocavirus" or species or serotypes of any of the foregoing in place of "AAV" in discussion herein. It is also understood that "AAV", unless specified as being a particular serotype or specified as having a particular capsid can be any of the herein identified AAVs.
[0015] There is a need for TALEs and LITEs to be expressed via a recombinant construct, e.g., an AAV, e.g., to provide activator, repressor or nuclease activity in vivo, in vitro or ex vivo.
[0016] There is a need for expression of a CRISPR system via a recombinant construct, e.g., an AAV, e.g., to provide knockdown in vivo, in vitro or ex vivo by the CRISPR introducing a spacer, which inhibits a target gene.
[0017] As traditional AAV or rAAV production requires a laborious production and purification process from cells, e.g., HEK-293FT cells, and this can make testing many constructs in parallel impractical. There is a need for a simple yet highly effective method of preparing AAV or rAAV, including testing or screening thereof, e.g., high throughput screening, and methods of using the resulting AAV or rAAV to integrate into the genome of cells otherwise difficult to infect, such as non-dividing cells, although AAV is able to infect both dividing and quiescent cells. In one aspect neuronal cells are targetted e.g., via neuronal transduction. Means for neuronal transduction also can be ascertained via Mason et al, "Comparison of AAV Serotypes for Gene Delivery to Dorsal Root Ganglion Neurons," Mol Ther. 2010 April; 18(4): 715-724 (2010 Feb. 23). All types of AAV and other Dependovirus are known to infect multiple diverse tissue types, and various AAV serotypes are known to have natural tropism to different tissues depending on their capsid proteins. Target tissues include, but are not limited to, e.g., brain, neurons, liver, eye, cardiac, muscle, and even cancer. See, e.g., Alam et al., Mol Cancer. 2011 Aug. 9; 10:97; Bartel et al. Gene Ther. 2012 June; 19(6):694-700.
[0018] There is also a need for a readily accessible, reproducible aliquot of recombinant construct that can be used for testing whether construction of the recombinant construct was successful, or whether the recombinant construct expresses the exogenous DNA in an amount that may be sufficient for an intended use and/or for a duration that may be sufficient for an intended use, i.e., for screening, such as high throughput screening, for therapeutic uses such as gene therapy, and targeting a broad range of tissues, whether of dividing or quiescent cells. Thus, there is a need for methods of the invention including those that may advantageously be for screening or high throughput screening, wherein the method includes or consists essentially of contacting the aliquot with cells and determining whether the exogenous DNA is expressed in an amount and/or duration sufficient for an intended use, e.g., gene therapy, genetic engineering or screening.
[0019] AAV is considered an ideal candidate for use as a transducing vector. Such AAV transducing vectors can comprise sufficient cis-acting functions to replicate in the presence of adenovirus or herpesvirus or poxvirus (e.g., vaccinia virus) helper functions provided in trans. Recombinant AAV (rAAV) can be used to carry exogenous genes into cells of a variety of lineages. In these vectors, the AAV cap and/or rep genes are deleted from the viral genome and replaced with a DNA segment of choice. Current AAV vectors may accommodate up to 4300 bases of inserted DNA.
[0020] There are a number of ways to produce rAAV, and the invention provides rAAV compositions and methods for preparing rAAV. For example, plasmid(s) containing or consisting essentially of the desired viral construct are transfected into AAV-infected cells. In addition, a second or additional helper plasmid is cotransfected into these cells to provide the AAV rep and/or cap genes which are obligatory for replication and packaging of the recombinant viral construct. Under these conditions, the rep and/or cap proteins of AAV act in trans to stimulate replication and packaging of the rAAV construct. Two to three days after transfection, rAAV is harvested. Traditionally rAAV is harvested from the cells along with adenovirus. The contaminating adenovirus is then inactivated by heat treatment. In the instant invention, rAAV is advantageously harvested not from the cells themselves, but from cell supernatant. Accordingly, in an initial aspect the invention provides for preparing rAAV, and in addition to the foregoing, rAAV can be prepared by one or more methods that comprise or consist essentially of,
[0021] infecting susceptible cells with a rAAV containing exogenous DNA including DNA for expression, and helper virus (e.g., adenovirus, herpesvirus, poxvirus such as vaccinia virus) wherein the rAAV lacks functioning cap and/or rep (and the helper virus (e.g., adenovirus, herpesvirus, poxvirus such as vaccinia virus) provides the cap and/or rev function that the rAAV lacks); or
[0022] infecting susceptible cells with a rAAV containing exogenous DNA including DNA for expression, wherein the recombinant construct lacks functioning cap and/or rep, and transfecting said cells with a plasmid supplying cap and/or rep function that the rAAV lacks; or
[0023] infecting susceptible cells with a rAAV containing exogenous DNA including DNA for expression, wherein the recombinant construct lacks functioning cap and/or rep, wherein said cells supply cap and/or rep function that the recombinant construct lacks; or
[0024] transfecting the susceptible cells with an AAV lacking functioning cap and/or rep and plasmids for inserting exogenous DNA into the recombinant construct so that the exogenous DNA is expressed by the recombinant construct and for supplying rep and/or cap functions whereby transfection results in an rAAV containing the exogenous DNA including DNA for expression that lacks functioning cap and/or rep.
[0025] In addition to methods for preparing rAAV, the invention provides methods for using such recombinant constructs, and compositions or preparations of such recombinant constructs, including without limitation compositions or preparations resulting from a method for obtaining and optionally storing a sample containing a set amount of rAAV; and, this method can further optionally include testing the rAAV.
[0026] The method advantageously may comprise or consist essentially of, and hence the invention pertains to a method for obtaining and optionally storing a sample containing a set amount of rAAV comprising or consisting essentially of:
[0027] preparing the rAAV as herein described, e.g.,
[0028] plasmid(s) containing or consisting essentially of the desired viral construct are transfected into AAV-infected cells along with another helper plasmid that provide the AAV rep and/or cap genes which are obligatory for replication and packaging of the recombinant viral construct; or
[0029] infecting susceptible cells with a rAAV containing exogenous DNA including DNA for expression, and helper virus (e.g., adenovirus, herpesvirus, poxvirus such as vaccinia virus) wherein the rAAV lacks functioning cap and/or rep (and the helper virus (e.g., adenovirus, herpesvirus, poxvirus such as vaccinia virus) provides the cap and/or rev function that the rAAV lacks); or
[0030] infecting susceptible cells with a rAAV containing exogenous DNA including DNA for expression, wherein the recombinant construct lacks functioning cap and/or rep, and transfecting said cells with a plasmid supplying cap and/or rep function that the rAAV lacks; or
[0031] infecting susceptible cells with a rAAV containing exogenous DNA including DNA for expression, wherein the recombinant construct lacks functioning cap and/or rep, wherein said cells supply cap and/or rep function that the recombinant lacks; or
[0032] transfecting the susceptible cells with an AAV lacking functioning cap and/or rep and plasmids for inserting exogenous DNA into the recombinant construct so that the exogenous DNA is expressed by the recombinant construct and for supplying rep and/or cap functions whereby transfection results in an rAAV containing the exogenous DNA including DNA for expression that lacks functioning cap and/or rep; and
[0033] incubating the infected or transfected cells, whereby there results infected or transfected cells and supernatant containing the rAAV lacking functioning cap and/or rep;
[0034] after incubating, extracting an aliquot from the supernatant;
[0035] filtering the aliquot, whereby the filtered aliquot contains and the method obtains a sample containing set amount of the rAAV relative to the type and amount of susceptible cells infected or transfected; and
[0036] optionally freezing the filtered aliquot, whereby the method optionally includes storing a sample containing set amount of the rAAV relative to the type and amount of susceptible cells infected or transfected.
[0037] The rAAV can be from an AAV as herein described, and advantageously can be an rAAV1, rAAV2, AAV5 or rAAV having a hybrid capsid which may comprise AAV1, AAV2, AAV5 or any combination thereof. One can select the AAV of the rAAV with regard to the cells to be targeted by the rAAV; e.g., one can select AAV serotypes 1, 2, 5 or a hybrid or capsid AAV1, AAV2, AAV5 or any combination thereof for targeting brain or neuronal cells; and one can select AAV4 for targeting cardiac tissue.
[0038] The susceptible cells are advantageously 293FT cells. The method advantageously includes or consists essentially of freezing (e.g., about -80° C.) the filtered aliquot. A secretion enhancer (e.g., polyethylenimine (PEI)) may be added to the cells before, during or after and within the incubating. The incubating can be typically up to 48 or 72 hours. 2×105 cells are advantageously transfected or infected, especially when the cells are 293FT cells. The filtered aliquot advantageously has a volume of 250 μL.
[0039] When the cells are 293FT cells and 2×105 cells are advantageously transfected or infected, the rAAV concentration in the filtered 250 μL, aliquot is approximately 5.6+/-0.24×105. When cells other than 293FT are used, there should be a linear relationship with regard to the amount of rAAV in the supernatant, aliquot and filtered aliquot. Thus, from 2×105 293 FT cells obtaining the rAAV concentration in the filtered 250 μL aliquot of approximately 5.6+/-0.24×105, the skilled person can transfect the same number of other cells and measure the viral output (e.g., via qPCR) and ascertain the linear relationship amongst cells. Other cells that can be used in the practice of the invention and the relative infectivity of certain AAV serotypes in vitro as to these cells (see Grimm, D. et al, J. Virol. 82: 5887-5911 (2008)) are as follows:
TABLE-US-00001 Cell Line AAV-1 AAV-2 AAV-3 AAV-4 AAV-5 AAV-6 AAV-8 AAV-9 Huh-7 13 100 2.5 0.0 0.1 10 0.7 0.0 HEK293 25 100 2.5 0.1 0.1 5 0.7 0.1 HeLa 3 100 2.0 0.1 6.7 1 0.2 0.1 HepG2 3 100 16.7 0.3 1.7 5 0.3 ND Hep1A 20 100 0.2 1.0 0.1 1 0.2 0.0 911 17 100 11 0.2 0.1 17 0.1 ND CHO 100 100 14 1.4 333 50 10 1.0 COS 33 100 33 3.3 5.0 14 2.0 0.5 MeWo 10 100 20 0.3 6.7 10 1.0 0.2 NIH3T3 10 100 2.9 2.9 0.3 10 0.3 ND A549 14 100 20 ND 0.5 10 0.5 0.1 HT1180 20 100 10 0.1 0.3 33 0.5 0.1 Monocytes 1111 100 ND ND 125 1429 ND ND Immature DC 2500 100 ND ND 222 2857 ND ND Mature DC 2222 100 ND ND 333 3333 ND ND
[0040] The invention provides rAAV that contains or consists essentially of an exogenous nucleic acid molecule encoding a transcriptional effector such as a Transcription Activation Like Effector (TALE) and nucleic acid molecule(s) for expression or a cassette comprising or consisting essentially of a promoter and a nucleic acid molecule encoding a transcriptional effector such as a TALE.
[0041] The invention provides rAAV that contains or consists essentially of an exogenous nucleic acid molecule encoding an inducible transcriptional effector such as a light-inducible transcriptional effector (LITE) and nucleic acid molecule(s) for expression or a cassette comprising or consisting essentially of a promoter and a nucleic acid molecule encoding an inducible transcriptional effector such as a LITE.
[0042] The invention provides rAAV that contains or consists essentially of an exogenous nucleic acid molecule encoding a CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) system, e.g., a plurality of cassettes comprising or consisting a first cassette comprising or consisting essentially of a promoter, a nucleic acid molecule encoding a CRISPR-associated (Cas) protein (putative nuclease or helicase proteins), e.g., Cas9 and a terminator, and a two, or more, advantageously up to the packaging size limit of the vector, e.g., in total (including the first cassette) five, cassettes comprising or consisting essentially of a promoter, nucleic acid molecule encoding guide RNA (gRNA) and a terminator (e.g., each cassette schematically represented as Promoter-gRNA1-terminator, Promoter-gRNA2-terminator . . . Promoter-gRNA(N)-terminator (where N is a number that can be inserted that is at an upper limit of the packaging size limit of the vector), or two or more individual rAAVs, each containing one or more than one cassette of a CRISPR system, e.g., a first rAAV containing the first cassette comprising or consisting essentially of a promoter, a nucleic acid molecule encoding Cas, e.g., Cas9 and a terminator, and a second rAAV containing a plurality, four, cassettes comprising or consisting essentially of a promoter, nucleic acid molecule encoding guide RNA (gRNA) and a terminator (e.g., each cassette schematically represented as Promoter-gRNA1-terminator, Promoter-gRNA2-terminator . . . Promoter-gRNA(N)-terminator (where N is a number that can be inserted that is at an upper limit of the packaging size limit of the vector).
[0043] As rAAV is a DNA virus, the nucleic acid molecules in the herein discussion are advantageously DNA.
[0044] The invention also provides a readily accessible, reproducible aliquot of rAAV that can be used for testing, e.g., testing whether construction of the rAAV was successful, or whether the rAAV expresses the exogenous DNA in an amount that may be sufficient for an intended use and/or for a duration that may be sufficient for an intended use, i.e., for screening, such as high throughput screening.
[0045] Hence, the invention provides a method for screening or high throughput screening, wherein the method comprises or consists essentially of preparing the filtered aliquot or the stored filtered aliquot as herein described, if necessary, thawing the stored filtered aliquot, contacting the filtered aliquot with cells and determining whether the exogenous DNA is expressed in an amount and/or duration sufficient for an intended use. The contacting with cells can be transducing said cells (e.g., contacting can take 5-6 days with observation whereby suitable levels of rAAV expression are reached). For instance, the rAAV can express a TALE and the contacting can include detecting nuclease, activator or repressor activity. The rAAV can express an inducible transcriptional effector such as a LITE, and the contacting can include inducing gene expression or subjecting the contacted cells to a suitable stimulus, and if detecting whether transcriptional effector has been induced, e.g., via detecting a color change. The rAAV can express a CRISPR system, and the contacting can include detecting gene knockdown or other effects of the CRISPR system.
[0046] The invention further provides advantageous methods of AAV or rAAV production. In one aspect, as further described in the Examples herein, the invention encompasses AAV supernatant production. The methods of the invention described herein comprehend varying the DNA ratios of the vectors used, e.g. the ratios of vector of interest plasmid: AAV serotype plasmid: pHelper plasmid may be varied. In a preferred embodiment of the invention, this value may be 1:1.7:2 for AAV supernatant production down to 24-well scale. In another preferred embodiment of the invention, this value may be 1:2:1 for a 96-well format.
[0047] The invention also comprehends the scaling up of the AAV supernatant production to higher throughput formats. Aspects of the invention may be carried out in a 15 cm dish. In a further embodiment, aspects of the invention comprehend scaling up from a 15 cm dish to 96-well plates for production. In another aspect, the invention also encompasses scaling up which includes but is not limited to 384-well plates or 1536-well plates. In a further embodiment, the invention also comprehends a microfluidic device capable of maintaining cell cultures in individual chambers. In a preferred embodiment, the AAV supernatant produced in the methods of the invention may be produced at the same scale as it may be applied.
[0048] The invention provides for methods of filtration or purification of the supernatant containing AAV generated in the methods described herein. Methods of filtration or purification may include but are not limited to the use of filters or centrifugation. In one aspect of the invention, filtration with specific pore size filters may be employed to remove any potential 293FT cells and large cell debris. In a preferred embodiment, a 22 micron or 45 micron pore size low protein binding filter may be used. When filtration is utilized the flow-through is harvested and subsequently used. In another aspect of the invention, centrifugation may be employed to pellet cells and cell debris. In a preferred embodiment, centrifugation at speeds in the range of 200 g for 20 min to 6000 g for 1-10 min may be utilized. When centrifugation is utilized the supernatant is collected and subsequently used. In a further embodiment of the invention, these steps may be followed by subsequent purification steps when more stringent purification is desired. In a preferred embodiment a sequence of molecular weight cutoff filters (e.g. amicon filters, Millipore) may be used.
[0049] The invention also provides for methods of AAV supernatant production which do not use fetal bovine serum (FBS). In a preferred embodiment, the culture medium used to support AAV producing 293FT cells may be replaced with a chemically-defined serum-free medium. e.g. Pro293a.
[0050] The invention also provides for AAV supernatant production methods being used to generate functional pooled AAV supernatant. Furthermore, the invention also provides for multiple supernatant AAV batches being harvested from a single AAV producing 293FT culture.
[0051] Accordingly, it is an object of the invention not to encompass within the invention any previously known product, process of making the product, or method of using the product such that Applicants reserve the right and hereby disclose a disclaimer of any previously known product, process, or method. It is further noted that the invention does not intend to encompass within the scope of the invention any product, process, or making of the product or method of using the product, which does not meet the written description and enablement requirements of the USPTO (35 U.S.C. §112, first paragraph) or the EPO (Article 83 of the EPC), such that Applicants reserve the right and hereby disclose a disclaimer of any previously described product, process of making the product, or method of using the product.
[0052] It is noted that in this disclosure and particularly in the claims and/or paragraphs, terms such as "comprises", "comprised", "comprising" and the like can have the meaning attributed to it in U.S. Patent law; e.g., they can mean "includes", "included", "including", and the like; and that terms such as "consisting essentially of" and "consists essentially of" have the meaning ascribed to them in U.S. Patent law, e.g., they allow for elements not explicitly recited, but exclude elements that are found in the prior art or that affect a basic or novel characteristic of the invention.
[0053] The invention further also provides other recombinant constructs, compositions, preparations, and methods described herein.
[0054] These and other embodiments are disclosed or are obvious from and encompassed by, the following Detailed Description.
BRIEF DESCRIPTION OF THE DRAWINGS
[0055] The following detailed description, given by way of example, but not intended to limit the invention solely to the specific embodiments described, may best be understood in conjunction with the accompanying drawings.
[0056] FIG. 1 shows a schematic indicating the need for spatial and temporal precision.
[0057] FIG. 2 shows transcription activator like effectors (TALEs). TALEs consist of 34 aa repeats (SEQ ID NO:1) at the core of their sequence. Each repeat corresponds to a base in the target DNA that is bound by the TALE, with one example shown as SEQ ID NO:2. Repeats differ only by 2 variable amino acids at positions 12 and 13. The code of this correspondence has been elucidated (Boch, J et al., Science, 2009 and Moscou, M et al., Science, 2009) and is shown in this figure. Applicants have developed a method for the synthesis of designer TALEs incorporating this code and capable of binding a sequence of choice within the genome (Zhang, F et al., Nature Biotechnology, 2011).
[0058] FIG. 3 shows a design of a LITE: TALE/Cryptochrome transcriptional activation. Each LITE is a two-component system which may comprise a TALE fused to CRY2 and the cryptochrome binding partner CIB1 fused to VP64, a transcription activator. In the inactive state, the TALE localizes its fused CRY2 domain to the promoter region of the gene of interest. At this point, CIB1 is unable to bind CRY2, leaving the CIB1-VP64 unbound in the nuclear space. Upon stimulation with 488 nm (blue) light, CRY2 undergoes a conformational change, revealing its CIB1 binding site (Liu, H et al., Science, 2008). Rapid binding of CIB1 results in recruitment of the fused VP64 domain, which induces transcription of the target gene.
[0059] FIG. 4 shows effects of cryptochrome dimer truncations on LITE activity. Truncations known to alter the activity of CRY2 and CIB1 (Kennedy M et al., Nature Methods 2010) were compared against the full length proteins. A LITE targeted to the promoter of Neurog2 was tested in Neuro-2a cells for each combination of domains. Following stimulation with 488 nm light, transcript levels of Neurog2 were quantified using qPCR for stimulated and unstimulated samples.
[0060] FIG. 5 shows a light-intensity dependent response of KLF4 LITE.
[0061] FIG. 6 shows activation kinetics of Neurog2 LITE and inactivation kinetics of Neurog2 LITE.
[0062] FIG. 7A shows the base-preference of various RVDs as determined using the Applicants' RVD screening system.
[0063] FIG. 7B shows the base-preference of additional RVDs as determined using the Applicants' RVD screening system.
[0064] FIGS. 8A-D show in (a) Natural structure of TALEs derived from Xanthomonas sp. Each DNA-binding module consists of 34 amino acids (SEQ ID NO:1), where the RVDs in the 12th and 13th amino acid positions of each repeat specify the DNA base being targeted (e.g., SEQ ID NO:2) according to the cipher NG=T, HD=C, NI=A, and NN=G or A. The DNA-binding modules are flanked by nonrepetitive N and C termini, which carry the translocation, nuclear localization (NLS) and transcription activation (AD) domains. A cryptic signal within the N terminus specifies a thymine as the first base of the target site. (b) The TALE toolbox allows rapid and inexpensive construction of custom TALE-TFs and TALENs. The kit consists of 12 plasmids in total: four monomer plasmids to be used as templates for PCR amplification, four TALE-TF and four TALEN cloning backbones corresponding to four different bases targeted by the 0.5 repeat. CMV, cytomegalovirus promoter; N term, nonrepetitive N terminus from the Hax3 TALE; C term, nonrepetitive C terminus from the Hax3 TALE; BsaI, type IIs restriction sites used for the insertion of custom TALE DNA-binding domains; ccdB+CmR, negative selection cassette containing the ccdB negative selection gene and chloramphenicol resistance gene; NLS, nuclear localization signal; VP64, synthetic transcriptional activator derived from VP16 protein of herpes simplex virus; 2A, 2A self-cleavage linker; EGFP, enhanced green fluorescent protein; polyA signal, polyadenylation signal; FokI, catalytic domain from the FokI endonuclease. (c) TALEs may be used to generate custom TALE-TFs and modulate the transcription of endogenous genes from the genome. The TALE DNA-binding domain is fused to the synthetic VP64 transcriptional activator, which recruits RNA polymerase and other factors needed to initiate transcription. (d) TALENs may be used to generate site-specific double-strand breaks to facilitate genome editing through nonhomologous repair or homology directed repair. Two TALENs target a pair of binding sites flanking a 16-bp spacer. The left and right TALENs recognize the top and bottom strands of the target sites, respectively. Each TALE DNA-binding domain is fused to the catalytic domain of FokI endonuclease; when FokI dimerizes, it cuts the DNA in the region between the left and right TALEN-binding sites.
[0065] FIG. 9A-F shows a table listing monomer sequences (excluding the RVDs at positions 12 and 13) (SEQ ID NOS:3-74) and the frequency with which monomers having a particular sequence occur.
[0066] FIG. 10 shows the comparison of the effect of non-RVD amino acid on TALE activity (SEQ ID NO:1 and variants thereof).
[0067] FIG. 11 shows an activator screen comparing levels of activation between VP64, p65 and VP16.
[0068] FIGS. 12A-D show the development of a TALE transcriptional repressor architecture. (a) Design of SOX2 TALE for TALE repressor screening. A TALE targeting a 14 bp sequence within the SOX2 locus of the human genome (SEQ ID NO:75) was synthesized. (b) List of all repressors screened and their host origin (left). Eight different candidate repressor domains were fused to the C-term of the SOX2 TALE. (c) The fold decrease of endogenous SOX2 mRNA is measured using qRTPCR by dividing the SOX2 mRNA levels in mock transfected cells by SOX2 mRNA levels in cells transfected with each candidate TALE repressor. (d) Transcriptional repression of endogenous CACNA1C. TALEs using NN, NK, and NH as the G-targeting RVD were constructed to target a 18 bp target site (SEQ ID NO:76) within the human CACNA1C locus. Each TALE is fused to the SID repression domain. NLS, nuclear localization signal; KRAB, Kruppel-associated box; SID, mSin interaction domain. All results are collected from three independent experiments in HEK 293FT cells. Error bars indicate s.e.m.; n=3. *p<0.05, Student's t test.
[0069] FIGS. 13A-C shows the optimization of TALE transcriptional repressor architecture using SID and SID4X. (a) Design of p11 TALE for testing of TALE repressor architecture. A TALE targeting a 20 bp sequence (p11 TALE binding site, SEQ ID NO:77) within the p11 (s100a10) locus of the mouse (Mus musculus) genome was synthesized. (b) Transcriptional repression of endogenous mouse p11 mRNA. TALEs targeting the mouse p11 locus harboring two different truncations of the wild type TALE architecture were fused to different repressor domains as indicated on the x-axis. The value in the bracket indicate the number of amino acids at the N- and C-termini of the TALE DNA binding domain flanking the DNA binding repeats, followed by the repressor domain used in the construct. The endogenous p11 mRNA levels were measured using qRT-PCR and normalized to the level in the negative control cells transfected with a GFP-encoding construct. (c) Fold of transcriptional repression of endogenous mouse p11. The fold decrease of endogenous p11 mRNA is measured using qRT-PCR through dividing the p11 mRNA levels in cells transfected with a negative control GFP construct by p11 mRNA levels in cells transfected with each candidate TALE repressors. The labeling of the constructs along the x-axis is the same as previous panel. NLS, nuclear localization signal; SID, mSin interaction domain; SID4X, an optimized four-time tandem repeats of SID domain linked by short peptide linkers. All results are collected from three independent experiments in Neuro2A cells. Error bars indicate s.e.m.; n=3. ***p<0.001, Student's t test.
[0070] FIG. 14A-D shows a comparison of two different types of TALE architecture.
[0071] FIGS. 15A-C show a chemically inducible TALE ABA inducible system. ABI (ABA insensitive 1) and PYL (PYL protein: pyrabactin resistance (PYR)/PYR1-like (PYL)) are domains from two proteins listed below that will dimerize upon binding of plant hormone Abscisic Acid (ABA). This plant hormone is a small molecule chemical that Applicants used in Applicants' inducible TALE system. In this system, the TALE DNA-binding polypeptide is fused to the ABI domain, whereas the VP64 activation domain or SID repressor domain or any effector domains are linked to the PYL domain. Thus, upon the induction by the presence of ABA molecule, the two interacting domains, ABI and PYL, will dimerize and allow the TALE to be linked to the effector domains to perform its activity in regulating target gene expression.
[0072] FIGS. 16A-B show a chemically inducible TALE 4OHT inducible system.
[0073] FIG. 17 depicts an effect of cryptochrome2 heterodimer orientation on LITE functionality.
[0074] FIG. 18 depicts mGlur2 LITE activity in mouse cortical neuron culture.
[0075] FIG. 19 depicts transduction of primary mouse neurons with LITE AAV vectors.
[0076] FIG. 20 depicts expression of LITE component in vivo.
[0077] FIG. 21 depicts an improved design of the construct where the specific NES peptide sequence used is LDLASLIL.
[0078] FIG. 22 depicts Sox2 mRNA levels in the absence and presence of 40H tamoxifen.
[0079] FIGS. 23A-E depict a Type II CRISPR locus from Streptococcus pyogenes SF370 can be reconstituted in mammalian cells to facilitate targeted DSBs of DNA. (A) Engineering of SpCas9 and SpRNase III with NLSs enables import into the mammalian nucleus. (B) Mammalian expression of SpCas9 and SpRNase III are driven by the EF1a promoter, whereas tracrRNA and pre-crRNA array (DR-Spacer-DR) are driven by the U6 promoter. A protospacer (blue highlight) from the human EMX1 locus (SEQ ID NO:78) with PAM is used as template for the spacer in the pre-crRNA array. (C) Schematic representation of base pairing between target locus (SEQ ID NOS:79-80) and EMX1-targeting crRNA (SEQ ID NO:81). Red arrow indicates putative cleavage site. (D) SURVEYOR assay for SpCas9-mediated indels. (E) An example chromatogram showing a micro-deletion, as well as representative sequences of mutated alleles (SEQ ID NOS:82-89) identified from 187 clonal amplicons. Red dashes, deleted bases; red bases, insertions or mutations. Scale bar=10 μm.
[0080] FIGS. 24A-C depict a SpCas9 can be reprogrammed to target multiple genomic loci in mammalian cells. (A) Schematic of the human EMX1 locus (SEQ ID NOS:90-91) showing the location of five protospacers, indicated by blue lines with corresponding PAM in magenta. (B) Schematic of the pre-crRNA:tracrRNA complex (SEQ ID NOS:92-93) (top) showing hybridization between the direct repeat (gray) region of the pre-crRNA and tracrRNA. Schematic of a chimeric RNA design (SEQ ID NO:94) (M. Jinek et al., A programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity. Science 337, 816 (Aug. 17, 2012)) (bottom). tracrRNA sequence is shown in red and the 20 bp spacer sequence in blue. (C) SURVEYOR assay comparing the efficacy of Cas9-mediated cleavage at five protospacers in the human EMX1 locus. Each protospacer is targeted using either processed pre-crRNA:tracrRNA complex (crRNA) or chimeric RNA (chiRNA).
[0081] FIGS. 25A-D depict an evaluation of the SpCas9 specificity and comparison of efficiency with TALENs. (A) EMX1-targeting chimeric crRNAs with single point mutations were generated to evaluate the effects of spacer-protospacer mismatches (SEQ ID NOS:95-96, 97-108). (B) SURVEYOR assay comparing the cleavage efficiency of different mutant chimeric RNAs. (C) Schematic showing the design of TALENs targeting EMX1 (SEQ ID NOS:95-96). (D) SURVEYOR gel comparing the efficiency of TALEN and SpCas9 (N=3).
[0082] FIGS. 26A-G depict applications of Cas9 for homologous recombination and multiplex genome engineering. (A) Mutation of the RuvC I domain converts Cas9 into a nicking enzyme (SpCas9n) (B) Co-expression of EMX1-targeting chimeric RNA with SpCas9 leads to indels, whereas SpCas9n does not (N=3). (C) Schematic representation of the recombination strategy. A repair template is designed to insert restriction sites into EMX1 locus. Primers used to amplify the modified region are shown as red arrows. (D) Restriction fragments length polymorphism gel analysis. Arrows indicate fragments generated by HindIII digestion. (E) Example chromatogram showing successful recombination (SEQ ID NO:109). (F) SpCas9 can facilitate multiplex genome modification using a crRNA array containing two spacers (SEQ ID NOS:110, 111) targeting EMX1 and PVALB. Schematic showing the design of the crRNA array (top). Both spacers mediate efficient protospacer cleavage (bottom). (G) SpCas9 can be used to achieve precise genomic deletion. Two spacers (SEQ ID NOS:112, 113) targeting EMX1 (top) mediated a 118 bp genomic deletion (SEQ ID NOS:114-118) (bottom).
[0083] FIG. 27 depicts a schematic of the type II CRISPR-mediated DNA double-strand break. The type II CRISPR locus from Streptococcus pyogenes SF370 contains a cluster of four genes, Cas9, Cas1, Cas2, and Csn1, as well as two non-coding RNA elements, tracrRNA and a characteristic array of repetitive sequences (direct repeats) interspaced by short stretches of nonrepetitive sequences (spacers, 30 bp each) (15-18, 30, 31). Each spacer is typically derived from foreign genetic material (protospacer), and directs the specificity of CRISPR-mediated nucleic acid cleavage. In the target nucleic acid, each protospacer is associated with a protospacer adjacent motif (PAM) whose recognition is specific to individual CRISPR systems (22, 23). The Type II CRISPR system carries out targeted DNA double-strand break (DSB) in sequential steps (M. Jinek et al., Science 337, 816 (Aug. 17, 2012); Gasiunas, R. et al. Proc Natl Acad Sci USA 109, E2579 (Sep. 25, 2012); J. E. Garneau et al., Nature 468, 67 (Nov. 4, 2010); R. Sapranauskas et al., Nucleic Acids Res 39, 9275 (November, 2011); A. H. Magadan et al. PLoS One 7, e40913 (2012)). First, the pre-crRNA array and tracrRNA are transcribed from the CRISPR locus. Second, tracrRNA hybridizes to the direct repeats of pre-crRNA and associates with Cas9 as a duplex, which mediates the processing of the pre-crRNA into mature crRNAs containing individual, truncated spacer sequences. Third, the mature crRNA:tracrRNA duplex directs Cas9 to the DNA target consisting of the protospacer and the requisite PAM via heteroduplex formation between the spacer region of the crRNA and the protospacer DNA. Finally, Cas9 mediates cleavage of target DNA upstream of PAM to create a DSB within the protospacer.
[0084] FIGS. 28A-C depict a comparison of different tracrRNA transcripts for Cas9-mediated gene targeting. (A) Schematic showing the design and sequences of two tracrRNA transcripts (SEQ ID NOS:119-120) tested (short and long). Each transcript is driven by a U6 promoter. Transcription start site is marked as +1 and transcription terminator is as indicated. Blue line indicates the region whose reverse-complement sequence is used to generate northern blot probes for tracrRNA detection. (B) SURVEYOR assay comparing the efficiency of hSpCas9-mediated cleavage of the EMX1 locus. Two biological replicas are shown for each tracrRNA transcript. (C) Northern blot analysis of total RNA extracted from 293FT cells transfected with U6 expression constructs carrying long or short tracrRNA, as well as SpCas9 and DR-EMX1(1)-DR. Left and right panels are from 293FT cells transfected without or with SpRNase III respectively. U6 indicate loading control blotted with a probe targeting human U6 snRNA. Transfection of the short tracrRNA expression construct led to abundant levels of the processed form of tracrRNA (˜75 bp) (E. Deltcheva et al., Nature 471, 602 (Mar. 31, 2011)). Very low amounts of long tracrRNA are detected on the Northern blot. As a result of these experiments, Applicants chose to use short tracrRNA for application in mammalian cells.
[0085] FIG. 29 depicts a SURVEYOR assay for detection of double strand break-induced micro insertions and deletions (D. Y. Guschin et al. Methods Mol Biol 649, 247 (2010)). Schematic of the SURVEYOR assay used to determine Cas9-mediated cleavage efficiency. First, genomic PCR (gPCR) is used to amplify the Cas9 target region from a heterogeneous population of modified and unmodified cells, and the gPCR products are reannealed slowly to generate heteroduplexes. The reannealed heteroduplexes are cleaved by SURVEYOR nuclease, whereas homoduplexes are left intact. Cas9-mediated cleavage efficiency (% indel) is calculated based on the fraction of cleaved DNA.
[0086] FIG. 30A-B depict a Northern blot analysis of crRNA processing in mammalian cells. (A) Schematic showing the expression vector for a single spacer flanked by two direct repeats (DR-EMX1(1)-DR) (SEQ ID NO: 121). The 30 bp spacer targeting the human EMX1 locus protospacer 1 (Table 1) is shown in blue and direct repeats are in shown in gray. Orange line indicates the region whose reverse complement sequence is used to generate northern blot probes for EMX1(1) crRNA detection. (B) Northern blot analysis of total RNA extracted from 293FT cells transfected with U6 expression constructs carrying DR-EMX1(1)-DR. Left and right panels are from 293FT cells transfected without or with SpRNase III respectively. DR-EMX1(1)-DR was processed into mature crRNAs only in the presence of SpCas9 and short tracrRNA, and was not dependent on the presence of SpRNase III. The mature crRNA detected from transfected 293FT total RNA is ˜33 bp and is shorter than the 39-42 bp mature crRNA from S. pyogenes (E. Deltcheva et al., Nature 471, 602 (Mar. 31, 2011)), suggesting that the processed mature crRNA in human 293FT cells is likely different from the bacterial mature crRNA in S. pyogenes.
[0087] FIG. 31A-B depict bicistronic expression vectors for pre-crRNA array or chimeric crRNA with Cas9 (SEQ ID NOS:122-129). (A) Schematic showing the design of an expression vector for the pre-crRNA array. Spacers can be inserted between two BbsI sites using annealed oligonucleotides. Sequence design for the oligonucleotides are shown below with the appropriate ligation adapters indicated. (B) Schematic of the expression vector for chimeric crRNA. The guide sequence can be inserted between two BbsI sites using annealed oligonucleotides. The vector already contains the partial direct repeat (gray) and partial tracrRNA (red) sequences. WPRE, Woodchuck hepatitis virus posttranscriptional regulatory element.
[0088] FIGS. 32A-B depict a selection of protospacers in the human PVALB (SEQ ID NOS: 130-131) and mouse (SEQ ID NOS: 132-133) Th loci. Schematic of the human PVALB (A) and mouse Th (B) loci and the location of the three protospacers within the last exon of the PVALB and Th genes, respectively. The 30 bp protospacers are indicated by black lines and the adjacent PAM sequences are indicated by the magenta bar. Protospacers on the sense and anti-sense strands are indicated above and below the DNA sequences respectively.
[0089] FIGS. 33A-C depict occurrences of PAM sequences in the human genome. Histograms of distances between adjacent Streptococcus pyogenes SF370 locus 1 PAM (NGG) (A) and Streptococcus thermophilus LMD9 locus 1 PAM (NNAGAAW) (B) in the human genome. (C) Distances for each PAM by chromosome. Chr, chromosome. Putative targets were identified using both the plus and minus strands of human chromosomal sequences. Given that there may be chromatin, DNA methylation-, RNA structure, and other factors that may limit the cleavage activity at some protospacer targets, it is important to note that the actual targeting ability might be less than the result of this computational analysis.
[0090] FIGS. 34A-D depict type II CRISPR from Streptococcus thermophilus LMD-9 can also function in eukaryotic cells. (A) Schematic of CRISPR locus 2 from Streptococcus thermophilus LMD-9. (B) Design of the expression system for the S. thermophilus CRISPR system. Human codon-optimized hStCas9 is expressed using a constitutive EF1a promoter. Mature versions of tracrRNA and crRNA are expressed using the U6 promoter to ensure precise transcription initiation. Sequences for the mature crRNA and tracrRNA are shown (SEQ ID NOS: 134-135). A single based indicated by the lower case "a" in the crRNA sequence was used to remove the polyU sequence, which serves as a RNA Pol III transcriptional terminator. (C) Schematic showing protospacer and corresponding PAM sequences targets in the human EMX1 locus (SEQ ID NOS: 136-137). Two protospacer sequences are highlighted and their corresponding PAM sequences satisfying the NNAGAAW motif (SEQ ID NO:138) are indicated by magenta lines. Both protospacers are targeting the anti-sense strand. (D) SURVEYOR assay showing StCas9-mediated cleavage in the target locus. RNA guide spacers 1 and 2 induced 14% and 6.4% respectively. Statistical analysis of cleavage activity across biological replica at these two protospacer sites can be found in Table 1.
[0091] FIGS. 35A-E depict design and optimization of the LITE system. (A) A TALE DNA-binding domain (SEQ ID NO: 139) is fused to CRY2 and a transcriptional effector domain is fused to CIB1. In the inactive state, TALE-CRY2 binds the promoter region of the target gene while CIB1-effector remains unbound in the nucleus. The VP64 transcriptional activator is shown above. Upon illumination with blue light, TALE-CRY2 and CIB1-effector rapidly dimerize, recruiting CIB1-effector to the target promoter. The effector in turn modulates transcription of the target gene. (B) Light-dependent upregulation of the endogenous target Ngn2 mRNA with LITEs containing functional truncations of its light-sensitive binding partners. LITE-transfected Neuro-2a cells were stimulated for 24 h with 466 nm light at an intensity of 5 mW/cm2 and a duty cycle of 7% (1 s pulses at 0.066 Hz). (C) Ngn2 upregulation with and without light by LITEs using different transcriptional activation domains VP16, VP64, and p65. Stimulation parameters are the same as (b). (D) The transcriptional activity of CRY2PHR-CIB1 LITE was found to vary according to the intensity of 466 nm blue light. Neuro 2a cells were stimulated for 24 h hours at a 7% duty cycle (1 s pulses at 0.066 Hz) (E) Light-induced toxicity measured as the percentage of cells positive for red-fluorescent ethidium homodimer-1 versus calcein-positive cells. All Ngn2 mRNA levels were measured relative to cells expressing YFP only (mean±s.e.m.; n=3-4)
[0092] FIGS. 36A-B depict kinetics of light-induced transcriptional activation. (A) Time course of light-dependent Ngn2 upregulation by TALE-CRY2PHR and CIB1-VP64 LITEs. LITE-transfected Neuro-2a cells were stimulated with 466 nm light at an intensity of 5 mW/cm2 and a duty cycle of 7% (1 s pulses at 0.066 Hz). (B) Decrease of Ngn2 mRNA levels after 6 h of light stimulation. All Ngn2 mRNA levels were measured relative to expressing YFP control cells (mean±s.e.m.; n=3-4) (*=p<0.05 and ***=p<0.001).
[0093] FIGS. 37A-F depict virus-mediated TALE delivery enabling bimodal control of endogenous gene expression in neurons (A) General schematic of constitutive TALE transcriptional activator and repressor packaged into AAV. Effector domains VP64 and SID4X are highlighted. (B) Representative images showing transduction with AAV-TALE-VP64 constructs from (a) in primary cortical neurons. Cells were stained for virally delivered GFP and neuronal marker NeuN. Scale bars=25 μm. (C) 6 TALEs were designed, with two TALEs targeting each of the endogenous mouse loci Grm5, Grin2a, and Grm2 (SEQ ID NOS:140-145). TALEs were fused to the transcriptional activator domain VP64 or the repressor domain SID4X and virally transduced into primary neurons. Both the target gene upregulation via VP64 and downregulation via SID4X are shown for each TALE relative to levels in neurons expressing GFP only. (D) Efficient delivery of TALE-VP64 by AAV into the ILC of mice. Scale bar=100 um. (Cg1=cingulate cortex, PLC=prelimbic cortex, ILC=infralimbic cortex). (E) Higher magnification image of efficient transduction of neurons in ILC. (F) Grm2 mRNA upregulation by TALE-VP64 in vivo in ILC (mean±s.e.m.; n=3).
[0094] FIGS. 38A-J depict light-mediated manipulation of Grm2 expression in primary neurons and in vivo (A) AAV LITE activator construct with switched CRY2PHR and CIB1 architecture. (B) Representative images showing co-transduction of AAV-delivered LITE constructs in primary neurons. Cells were stained for GFP, HA-tag, and DAPI. (Scale bars=25 μm). (C) Light-induced activation of Grm2 expression in primary neurons after 24 h of stimulation with 0.8% duty cycle pulsed 466 nm light (250 ms pulses at 0.033 Hz or 500 ms pulses at 0.016 Hz; 5 mW/cm2). (D) Upregulation of Grm2 mRNA in primary cortical neurons with and without light stimulation at 4 h and 24 h time points. Expression levels are shown relative to neurons transduced with GFP only. (E) Quantification of mGluR2 protein levels in GFP only control transductions, unstimulated neurons with LITEs, and light-stimulated neurons with LITEs. A representative western blot is shown with β-tubulin-III as a loading control. (F) LITE repressor construct highlighting SID4X repressor domain. (G) Light-induced repression of endogenous Grm2 expression in primary cortical neurons using Grm2 T1-LITE and Grm2 T2-LITE. Fold downregulation is shown relative to neurons transduced with GFP only (mean±s.e.m.; n=3-4 for all subpanels). (H) Schematic showing transduction of ILC with the LITE system, the optical fiber implant, and the 0.35 mm diameter brain punch used for tissue isolation. (I) Representative images of ILC co-transduced with both LITE components. Stains are shown for HA-tag (red), GFP (green), and DAPI (blue). (Scale bar=25 μm). (J) Light-induced activation of endogenous Grm2 expression using LITEs transduced into ILC.
[0095] FIG. 39 depicts an activation Ratio of CRY2 and CIB1 truncations. Fold activation of Ngn2 expression by LITEs was calculated as the ratio of mRNA levels in stimulated cells versus unstimulated cells (light/no light; experiment and data corresponding to FIG. 35B), for each CRY2 and CIB1 truncation pair.
[0096] FIG. 40 depicts an impact of illumination duty cycle on LITE-mediated gene expression. Varying duty cycles (illumination as percentage of total time) were used to stimulate HEK293FT cells expressing LITEs targeting the KLF4 gene, in order to investigate the effect of duty cycle on LITE activity. KLF4 expression levels were compared to cells expressing GFP only. Stimulation parameters were: 466 nm, 5 mW/cm2 for 24 h. Pulses were performed at 0.067 Hz with the following durations: 1.7%=0.25 s pulse, 7%=1 s pulse, 27%=4 s pulse, 100%=constant illumination.
[0097] FIG. 41 depicts an illustration of the absorption spectrum of CRY2 in vitro. Cryptochrome 2 was optimally activated by 350-475 nm light'. A sharp drop in absorption and activation was seen for wavelengths greater than 480 nm. Spectrum was adapted from Banerjee, R. et al. The Signaling State of Arabidopsis Cryptochrome 2 Contains Flavin Semiquinone. Journal of Biological Chemistry 282, 14916-14922, doi:10.1074/jbc.M700616200 (2007).
[0098] FIGS. 42A-C depict AAV supernatant production. (A) Lentiviral and AAV vectors carrying GFP were used to test transduction efficiency. (B) Primary embryonic cortical neurons were transduced with 250 μL supernatant derived from the same number of AAV or lentivirus-transfected 293FT cells. Representative images of GFP expression were collected at 7 d.p.i. Scale bars=50 μm. (C) The depicted process was developed for the production of AAV supernatant and subsequent transduction of primary neurons. 293FT cells were transfected with an AAV vector carrying the gene of interest, the AAV1 serotype packaging vector (pAAV1), and helper plasmid (pDF6) using PEI. 48 h later, the supernatant was harvested and filtered through a 0.45 μm PVDF membrane. Primary neurons were then transduced with supernatant and remaining aliquots were stored at -80° C. Stable levels of AAV construct expression were reached after 5-6 days.
[0099] FIG. 43 depicts a selection of TALE target sites guided by DNaseI-sensitive chromatin regions. High DNaseI sensitivity based on mouse cortical tissue data from ENCODE (at the website of genome.ucsc.edu) was used to identify open chromatin regions. The peak with the highest amplitude within the region 2 kb upstream of the transcriptional start site was selected for targeting. TALE binding targets were then picked within a 200 bp region at the center of the peak.
[0100] FIG. 44 depicts a TALE SID4X repressor characterization. A synthetic repressor was constructed by concatenating 4 SID domains (SID4X). To identify the optimal TALE-repressor architecture, SID or SID4X was fused to a TALE designed to target the mouse p11 gene (SEQ ID NO:146). Fold decrease in p11 mRNA was assayed using qRT-PCR.
[0101] FIGS. 45A-B depict exchanging CRY2PHR and CIB1 components. (A) TALE-CIB1::CRY2PHR-VP64 was able to activate Ngn2 at higher levels than TALE-CRY2PHR::CIB1-VP64. (B) Fold activation ratios (light versus no light) ratios of Ngn2 LITEs show similar efficiency for both designs. Stimulation parameters were the same as those used in FIG. 35B.
[0102] FIG. 46 depicts an impact of light duty cycle on primary neuron health. The effect of light stimulation on primary cortical neuron health was compared for duty cycles of 7%, 0.8%, and no light conditions. Calcein was used to evaluate neuron viability. Bright-field images were captured to show morphology and cell integrity. Primary cortical neurons were stimulated with the indicated duty cycle for 24 h with 5 mW/cm2 of 466 nm light. Representative images, scale bar=50 μm. Pulses were performed in the following manner: 7% duty cycle=1 s pulse at 0.067 Hz, 0.8% duty cycle=0.5 s pulse at 0.0167 Hz.
[0103] FIGS. 47A-B depict a contribution of individual LITE components to baseline transcription modulation. (A) Grm2 mRNA levels were determined in primary neurons transfected with individual LITE components. Primary neurons expressing T6-CIB1 alone led to a similar increase in Grm2 mRNA levels as unstimulated cells expressing the complete LITE system. (B) Transcription repression by individual LITE repressor components targeting the Grm2 gene was compared.
[0104] FIG. 48 depicts a co-transduction efficiency of LITE components by AAV1/2 in mouse infralimbic cortex. Cells transduced by T6-CIB1 alone, CRY2PHR-VP64 alone, or co-transduced were calculated as a percentage of all transduced cells.
[0105] FIG. 49 shows a schematic of an AAV-promotor-TALE-effector construct. In the construct: hSyn=human synapsin 1 promoter; N+136=TALE N-term, AA+136 truncation; C63=TALE C-term, AA+63 truncation; vp=VP64 effector domain; GFP=green fluorescent protein; WPRE=Woodchuck Hepatitis Virus Posttranscriptional Regulatory Element; bGH=bovine growth hormone polyA; ITR=AAV inverted terminal repeat; AmpR=ampicillin resistance gene.
DETAILED DESCRIPTION OF THE INVENTION
[0106] The term "nucleic acid" or "nucleic acid sequence" refers to a deoxyribonucleic or ribonucleic oligonucleotide in either single- or double-stranded form. The term encompasses nucleic acids, i.e., oligonucleotides, containing known analogues of natural nucleotides. The term also encompasses nucleic-acid-like structures with synthetic backbones, see, e.g., Eckstein, 1991; Baserga et al., 1992; Milligan, 1993; WO 97/03211; WO 96/39154; Mata, 1997; Strauss-Soukup, 1997; and Samstag, 1996.
[0107] As used herein, "recombinant" refers to a non-naturally occurring composition comprising materials from more than one origin and, in some embodiments, materials derived from more than one organism. A "recombinant construct" may be a polynucleotide synthesized or otherwise manipulated in vitro (e.g., "recombinant polynucleotide"), and the invention includes methods of using recombinant polynucleotides to produce gene products in cells or other biological systems, or to a polypeptide ("recombinant protein") encoded by a recombinant polynucleotide. "Recombinant means" encompasses methods of recombining compositions, e.g., ligation of nucleic acids having various coding regions or domains or promoter sequences from different sources into an expression cassette or vector for expression of, e.g., inducible or constitutive expression of polypeptide coding sequences in the vectors of invention.
[0108] The term "heterologous" when used with reference to a nucleic acid, indicates that the nucleic acid is in a cell or a virus where it is not normally found in nature; or, comprises two or more subsequences that are not found in the same relationship to each other as normally found in nature, or is recombinantly engineered so that its level of expression, or physical relationship to other nucleic acids or other molecules in a cell, or structure, is not normally found in nature. A similar term used in this context is "exogenous". For instance, a heterologous nucleic acid is typically recombinantly produced, having two or more sequences from unrelated genes arranged in a manner not found in nature; e.g., a human gene operably linked to a promoter sequence inserted into an adenovirus-based vector of the invention. As an example, a heterologous nucleic acid of interest may encode an immunogenic gene product, wherein the adenovirus is administered therapeutically or prophylactically as a carrier or drug-vaccine composition. Heterologous sequences may comprise various combinations of promoters and sequences, examples of which are described in detail herein.
[0109] A "therapeutic ligand" may be a substance which may bind to a receptor of a target cell with therapeutic effects.
[0110] A "therapeutic effect" may be a consequence of a medical treatment of any kind, the results of which are judged by one of skill in the field to be desirable and beneficial. The "therapeutic effect" may be a behavioral or physiologic change which occurs as a response to the medical treatment. The result may be expected, unexpected, or even an unintended consequence of the medical treatment. A "therapeutic effect" may include, for example, a reduction of symptoms in a subject suffering from infection by a pathogen.
[0111] A "target cell" may be a cell in which an alteration in its activity may induce a desired result or response.
[0112] A "ligand" may be any substance that binds to and forms a complex with a biomolecule to serve a biological purpose. As used herein, "ligand" may also refer to an "antigen" or "immunogen". As used herein "antigen" and "immunogen" are used interchangeably.
[0113] "Expression" of a gene or nucleic acid encompasses not only cellular gene expression, but also the transcription and translation of nucleic acid(s) in cloning systems and in any other context.
[0114] As used herein, a "vector" is a tool that allows or facilitates the transfer of an entity from one environment to another. By way of example, some vectors used in recombinant DNA techniques allow entities, such as a segment of DNA (such as a heterologous DNA segment, such as a heterologous cDNA segment), to be transferred into a target cell. The present invention comprehends recombinant vectors that may include viral vectors, bacterial vectors, protozoan vectors, DNA vectors, or recombinant constructs thereof.
[0115] With respect to exogenous DNA for expression in a vector (e.g., encoding an epitope of interest and/or an antigen and/or a therapeutic) and documents providing such exogenous DNA, as well as with respect to the expression of transcription and/or translation factors for enhancing expression of nucleic acid molecules, and as to terms such as "epitope of interest", "therapeutic", "immune response", "immunological response", "protective immune response", "immunological composition", "immunogenic composition", and "vaccine composition", inter alia, reference is made to U.S. Pat. No. 5,990,091 issued Nov. 23, 1999, and WO 98/00166 and WO 99/60164, and the documents cited therein and the documents of record in the prosecution of that patent and those PCT applications; all of which are incorporated herein by reference. Thus, U.S. Pat. No. 5,990,091 and WO 98/00166 and WO 99/60164 and documents cited therein and documents of record in the prosecution of that patent and those PCT applications, and other documents cited herein or otherwise incorporated herein by reference, may be consulted in the practice of this invention; and, all exogenous nucleic acid molecules, promoters, and vectors cited therein may be used in the practice of this invention. In this regard, mention is also made of U.S. Pat. Nos. 6,706,693; 6,716,823; 6,348,450; U.S. patent application Ser. Nos. 10/424,409; 10/052,323; 10/116,963; 10/346,021; and WO 99/08713, published Feb. 25, 1999, from PCT/US98/16739.
[0116] As used herein, the terms "drug composition" and "drug", "vaccinal composition", "vaccine", "vaccine composition", "therapeutic composition" and "therapeutic-immunologic composition" cover any composition that induces protection against an antigen or pathogen. In some embodiments, the protection may be due to an inhibition or prevention of infection by a pathogen. In other embodiments, the protection may be induced by an immune response against the antigen(s) of interest, or which efficaciously protects against the antigen; for instance, after administration or injection into the subject, elicits a protective immune response against the targeted antigen or immunogen or provides efficacious protection against the antigen or immunogen expressed from the inventive adenovirus vectors of the invention. The term "pharmaceutical composition" means any composition that is delivered to a subject. In some embodiments, the composition may be delivered to inhibit or prevent infection by a pathogen.
[0117] A "therapeutically effective amount" is an amount or concentration of the recombinant vector encoding the gene of interest, that, when administered to a subject, produces a therapeutic response or an immune response to the gene product of interest.
[0118] The term "viral vector" as used herein includes but is not limited to retroviruses, adenoviruses, adeno-associated viruses, alphaviruses, and herpes simplex virus.
[0119] The present invention enables spatiotemporal control of endogenous gene expression using a form of energy. The form of energy by include but is not limited to electromagnetic radiation, sound energy, chemical energy and thermal energy. In a preferred embodiment of the invention, the form of energy is electromagnetic radiation, preferably, light energy. Previous approaches to control expression of endogenous genes, such as transcription activators linked to DNA binding zinc finger proteins provided no mechanism for temporal or spatial control. The capacity for photoactivation of the system described herein allows the induction of gene expression modulation to begin at a precise time within a localized population of cells.
[0120] Two key molecular tools were leveraged in the design of the photoresponsive transcription activator-like (TAL) effector system. First, the DNA binding specificity of engineered TAL effectors is utilized to localize the complex to a particular region in the genome. Second, light-induced protein dimerization is used to attract an activating or repressing domain to the region specified by the TAL effector, resulting in modulation of the downstream gene.
[0121] Inducible effectors are contemplated for in vitro or in vivo application in which temporally or spatially specific gene expression control is desired. In vitro examples: temporally precise induction/suppression of developmental genes to elucidate the timing of developmental cues, spatially controlled induction of cell fate reprogramming factors for the generation of cell-type patterned tissues. In vivo examples: combined temporal and spatial control of gene expression within specific brain regions.
[0122] In a preferred embodiment of the invention, the inducible effector is a Light Inducible Transcriptional Effector (LITE). The modularity of the LITE system allows for any number of effector domains to be employed for transcriptional modulation. In a particularly advantageous embodiment, transcription activator like effector (TALE) and the activation domain VP64 are utilized in the present invention.
[0123] LITEs are designed to modulate or alter expression of individual endogenous genes in a temporally and spatially precise manner. Each LITE may comprise a two component system consisting of a customized DNA-binding transcription activator like effector (TALE) protein, a light-responsive cryptochrome heterodimer from Arabadopsis thaliana, and a transcriptional activation/repression domain. The TALE is designed to bind to the promoter sequence of the gene of interest. The TALE protein is fused to one half of the cryptochrome heterodimer (cryptochrome-2 or CIB1), while the remaining cryptochrome partner is fused to a transcriptional effector domain. Effector domains may be either activators, such as VP16, VP64, or p65, or repressors, such as KRAB, EnR, or SID. In a LITE's unstimulated state, the TALE-cryptochrome2 protein localizes to the promoter of the gene of interest, but is not bound to the CIB1-effector protein. Upon stimulation of a LITE with blue spectrum light, cryptochrome-2 becomes activated, undergoes a conformational change, and reveals its binding domain. CIB1, in turn, binds to cryptochrome-2 resulting in localization of the effector domain to the promoter region of the gene of interest and initiating gene overexpression or silencing.
[0124] Activator and repressor domains may selected on the basis of species, strength, mechanism, duration, size, or any number of other parameters. Preferred effector domains include, but are not limited to, a transposase domain, integrase domain, recombinase domain, resolvase domain, invertase domain, protease domain, DNA methyltransferase domain, DNA demethylase domain, histone acetylase domain, histone deacetylases domain, nuclease domain, repressor domain, activator domain, nuclear-localization signal domains, transcription-protein recruiting domain, cellular uptake activity associated domain, nucleic acid binding domain or antibody presentation domain.
[0125] Gene targeting in a LITE or in any other inducible effector may be achieved via the specificity of customized TALE DNA binding proteins. A target sequence in the promoter region of the gene of interest is selected and a TALE customized to this sequence is designed. The central portion of the TALE consists of tandem repeats 34 amino acids in length. Although the sequences of these repeats are nearly identical, the 12th and 13th amino acids (termed repeat variable diresidues) of each repeat vary, determining the nucleotide-binding specificity of each repeat. Thus, by synthesizing a construct with the appropriate ordering of TALE monomer repeats, a DNA binding protein specific to the target promoter sequence is created.
[0126] In advantageous embodiments of the invention, the methods provided herein use isolated, non-naturally occurring, recombinant or engineered DNA binding proteins that comprise TALE monomers or TALE monomers or half monomers as a part of their organizational structure that enable the targeting of nucleic acid sequences with improved efficiency and expanded specificity.
[0127] Naturally occurring TALEs or "wild type TALEs" are nucleic acid binding proteins secreted by numerous species of proteobacteria. TALE polypeptides contain a nucleic acid binding domain composed of tandem repeats of highly conserved monomer polypeptides that are predominantly 33, 34 or 35 amino acids in length and that differ from each other mainly in amino acid positions 12 and 13. In advantageous embodiments the nucleic acid is DNA. As used herein, the term "polypeptide monomers", "TALE monomers" or "monomers" will be used to refer to the highly conserved repetitive polypeptide sequences within the TALE nucleic acid binding domain and the term "repeat variable di-residues" or "RVD" will be used to refer to the highly variable amino acids at positions 12 and 13 of the polypeptide monomers. As provided throughout the disclosure, the amino acid residues of the RVD are depicted using the IUPAC single letter code for amino acids. A general representation of a TALE monomer which is comprised within the DNA binding domain is X1-11-(X12X13)-X14-33 or 34 or 35, where the subscript indicates the amino acid position and X represents any amino acid. X12X13 indicate the RVDs. In some polypeptide monomers, the variable amino acid at position 13 is missing or absent and in such monomers, the RVD consists of a single amino acid. In such cases the RVD may be alternatively represented as X*, where X represents X12 and (*) indicates that X13 is absent. The DNA binding domain comprises several repeats of TALE monomers and this may be represented as (X1-11-(X12X13)-X14-33 or 34 or 35)z, where in an advantageous embodiment, z is at least 5 to 40. In a further advantageous embodiment, z is at least 10 to 26.
[0128] The TALE monomers have a nucleotide binding affinity that is determined by the identity of the amino acids in its RVD. For example, polypeptide monomers with an RVD of NI preferentially bind to adenine (A), monomers with an RVD of NG preferentially bind to thymine (T), monomers with an RVD of HD preferentially bind to cytosine (C) and monomers with an RVD of NN preferentially bind to both adenine (A) and guanine (G). In yet another embodiment of the invention, monomers with an RVD of IG preferentially bind to T. Thus, the number and order of the polypeptide monomer repeats in the nucleic acid binding domain of a TALE determines its nucleic acid target specificity. In still further embodiments of the invention, monomers with an RVD of NS recognize all four base pairs and may bind to A, T, G or C. The structure and function of TALEs is further described in, for example, Moscou et al., Science 326:1501 (2009); Boch et al., Science 326:1509-1512 (2009); and Zhang et al., Nature Biotechnology 29:149-153 (2011), each of which is incorporated by reference in its entirety.
[0129] The polypeptides used in methods of the invention are isolated, non-naturally occurring, recombinant or engineered nucleic acid-binding proteins that have nucleic acid or DNA binding regions containing polypeptide monomer repeats that are designed to target specific nucleic acid sequences.
[0130] As described herein, polypeptide monomers having an RVD of HN or NH preferentially bind to guanine and thereby allow the generation of TALE polypeptides with high binding specificity for guanine containing target nucleic acid sequences. In a preferred embodiment of the invention, polypeptide monomers having RVDs RN, NN, NK, SN, NH, KN, HN, NQ, HH, RG, KH, RH and SS preferentially bind to guanine. In a much more advantageous embodiment of the invention, polypeptide monomers having RVDs RN, NK, NQ, HH, KH, RH, SS and SN preferentially bind to guanine and thereby allow the generation of TALE polypeptides with high binding specificity for guanine containing target nucleic acid sequences. In an even more advantageous embodiment of the invention, polypeptide monomers having RVDs HH, KH, NH, NK, NQ, RH, RN and SS preferentially bind to guanine and thereby allow the generation of TALE polypeptides with high binding specificity for guanine containing target nucleic acid sequences. In a further advantageous embodiment, the RVDs that have high binding specificity for guanine are RN, NH RH and KH. Furthermore, polypeptide monomers having an RVD of NV preferentially bind to adenine and guanine. In more preferred embodiments of the invention, monomers having RVDs of H*, HA, KA, N*, NA, NC, NS, RA, and S* bind to adenine, guanine, cytosine and thymine with comparable affinity.
[0131] The predetermined N-terminal to C-terminal order of the one or more polypeptide monomers of the nucleic acid or DNA binding domain determines the corresponding predetermined target nucleic acid sequence to which the polypeptides of the invention will bind. As used herein the monomers and at least one or more half monomers are "specifically ordered to target" the genomic locus or gene of interest. In plant genomes, the natural TALE-binding sites always begin with a thymine (T), which may be specified by a cryptic signal within the nonrepetitive N-terminus of the TALE polypeptide; in some cases this region may be referred to as repeat 0. In animal genomes, TALE binding sites do not necessarily have to begin with a thymine (T) and polypeptides of the invention may target DNA sequences that begin with T, A, G or C. The tandem repeat of TALE monomers always ends with a half-length repeat or a stretch of sequence that may share identity with only the first 20 amino acids of a repetitive full length TALE monomer and this half repeat may be referred to as a half-monomer (FIG. 8). Therefore, it follows that the length of the nucleic acid or DNA being targeted is equal to the number of full monomers plus two.
[0132] As described in Zhang et al., Nature Biotechnology 29:149-153 (2011), TALE polypeptide binding efficiency may be increased by including amino acid sequences from the "capping regions" that are directly N-terminal or C-terminal of the DNA binding region of naturally occurring TALEs into the engineered TALEs at positions N-terminal or C-terminal of the engineered TALE DNA binding region. Thus, in certain embodiments, the TALE polypeptides described herein further comprise an N-terminal capping region and/or a C-terminal capping region.
[0133] An exemplary amino acid sequence of a N-terminal capping region is:
TABLE-US-00002 (SEQ ID NO: 147) M D P I R S R T P S P A R E L L S G P Q P D G V Q P T A D R G V S P P A G G P L D G L P A R R T M S R T R L P S P P A P S P A F S A D S F S D L L R Q F D P S L F N T S L F D S L P P F G A H H T E A A T G E W D E V Q S G L R A A D A P P P T M R V A V T A A R P P R A K P A P R R R A A Q P S D A S P A A Q V D L R T L G Y S Q Q Q Q E K I K P K V R S T V A Q H H E A L V G H G F T H A H I V A L S Q H P A A L G T V A V K Y Q D M I A A L P E A T H E A I V G V G K Q W S G A R A L E A L L T V A G E L R G P P L Q L D T G Q L L K I A K R G G V T A V E A V H A W R N A L T G A P L N
[0134] An exemplary amino acid sequence of a C-terminal capping region is:
TABLE-US-00003 (SEQ ID NO: 148) R P A L E S I V A Q L S R P D P A L A A L T N D H L V A L A C L G G R P A L D A V K K G L P H A P A L I K R T N R R I P E R T S H R V A D H A Q V V R V L G F F Q C H S H P A Q A F D D A M T Q F G M S R H G L L Q L F R R V G V T E L E A R S G T L P P A S Q R W D R I L Q A S G M K R A K P S P T S T Q T P D Q A S L H A F A D S L E R D L D A P S P M H E G D Q T R A S
[0135] As used herein the predetermined "N-terminus" to "C terminus" orientation of the N-terminal capping region, the DNA binding domain comprising the repeat TALE monomers and the C-terminal capping region provide structural basis for the organization of different domains in the d-TALEs or polypeptides of the invention.
[0136] The entire N-terminal and/or C-terminal capping regions are not necessary to enhance the binding activity of the DNA binding region. Therefore, in certain embodiments, fragments of the N-terminal and/or C-terminal capping regions are included in the TALE polypeptides described herein.
[0137] In certain embodiments, the TALE polypeptides described herein contain a N-terminal capping region fragment that included at least 10, 20, 30, 40, 50, 54, 60, 70, 80, 87, 90, 94, 100, 102, 110, 117, 120, 130, 140, 147, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260 or 270 amino acids of an N-terminal capping region. In certain embodiments, the N-terminal capping region fragment amino acids are of the C-terminus (the DNA-binding region proximal end) of an N-terminal capping region. As described in Zhang et al., Nature Biotechnology 29:149-153 (2011), N-terminal capping region fragments that include the C-terminal 240 amino acids enhance binding activity equal to the full length capping region, while fragments that include the C-terminal 147 amino acids retain greater than 80% of the efficacy of the full length capping region, and fragments that include the C-terminal 117 amino acids retain greater than 50% of the activity of the full-length capping region.
[0138] In some embodiments, the TALE polypeptides described herein contain a C-terminal capping region fragment that included at least 6, 10, 20, 30, 37, 40, 50, 60, 68, 70, 80, 90, 100, 110, 120, 127, 130, 140, 150, 155, 160, 170, 180 amino acids of a C-terminal capping region. In certain embodiments, the C-terminal capping region fragment amino acids are of the N-terminus (the DNA-binding region proximal end) of a C-terminal capping region. As described in Zhang et al., Nature Biotechnology 29:149-153 (2011), C-terminal capping region fragments that include the C-terminal 68 amino acids enhance binding activity equal to the full length capping region, while fragments that include the C-terminal 20 amino acids retain greater than 50% of the efficacy of the full length capping region.
[0139] In certain embodiments, the capping regions of the TALE polypeptides described herein do not need to have identical sequences to the capping region sequences provided herein. Thus, in some embodiments, the capping region of the TALE polypeptides described herein have sequences that are at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical or share identity to the capping region amino acid sequences provided herein. Sequence identity is related to sequence homology. Homology comparisons may be conducted by eye, or more usually, with the aid of readily available sequence comparison programs. These commercially available computer programs may calculate percent (%) homology between two or more sequences and may also calculate the sequence identity shared by two or more amino acid or nucleic acid sequences. In some preferred embodiments, the capping region of the TALE polypeptides described herein have sequences that are at least 95% identical or share identity to the capping region amino acid sequences provided herein.
[0140] Sequence homologies may be generated by any of a number of computer programs known in the art, which include but are not limited to BLAST or FASTA. Suitable computer program for carrying out alignments like the GCG Wisconsin Bestfit package may also be used. Once the software has produced an optimal alignment, it is possible to calculate % homology, preferably % sequence identity. The software typically does this as part of the sequence comparison and generates a numerical result.
[0141] In advantageous embodiments described herein, the TALE polypeptides of the invention include a nucleic acid binding domain linked to the one or more effector domains. The terms "effector domain" or "regulatory and functional domain" refer to a polypeptide sequence that has an activity other than binding to the nucleic acid sequence recognized by the nucleic acid binding domain. By combining a nucleic acid binding domain with one or more effector domains, the polypeptides of the invention may be used to target the one or more functions or activities mediated by the effector domain to a particular target DNA sequence to which the nucleic acid binding domain specifically binds.
[0142] In some embodiments of the TALE polypeptides described herein, the activity mediated by the effector domain is a biological activity. For example, in some embodiments the effector domain is a transcriptional inhibitor (i.e., a repressor domain), such as an mSin interaction domain (SID). SID4X domain or a Kruppel-associated box (KRAB) or fragments of the KRAB domain. In some embodiments the effector domain is an enhancer of transcription (i.e. an activation domain), such as the VP16, VP64 or p65 activation domain. In some embodiments, the nucleic acid binding is linked, for example, with an effector domain that includes but is not limited to a transposase, integrase, recombinase, resolvase, invertase, protease, DNA methyltransferase, DNA demethylase, histone acetylase, histone deacetylase, nuclease, transcriptional repressor, transcriptional activator, transcription factor recruiting, protein nuclear-localization signal or cellular uptake signal.
[0143] In some embodiments, the effector domain is a protein domain which exhibits activities which include but are not limited to transposase activity, integrase activity, recombinase activity, resolvase activity, invertase activity, protease activity, DNA methyltransferase activity, DNA demethylase activity, histone acetylase activity, histone deacetylase activity, nuclease activity, nuclear-localization signaling activity, transcriptional repressor activity, transcriptional activator activity, transcription factor recruiting activity, or cellular uptake signaling activity. Other preferred embodiments of the invention may include any combination the activities described herein.
[0144] As described in Zhang et al., Nature Biotechnology 29:149-153 (2011), a TALE polypeptide having a nucleic acid binding domain and an effector domain may be used to target the effector domain's activity to a genomic position having a predetermined nucleic acid sequence recognized by the nucleic acid binding domain. In some embodiments of the invention described herein, TALE polypeptides are designed and used for targeting gene regulatory activity, such as transcriptional or translational modifier activity, to a regulatory, coding, and/or intergenic region, such as enhancer and/or repressor activity, that may affect transcription upstream and downstream of coding regions, and may be used to enhance or repress gene expression. For example, TALEs polypeptide may comprise effector domains having DNA-binding domains from transcription factors, effector domains from transcription factors (activators, repressors, co-activators, co-repressors), silencers, nuclear hormone receptors, and/or chromatin associated proteins and their modifiers (e.g., methylases, kinases, phosphatases, acetylases and deacetylases). In a preferred embodiment, the TALE polypeptide may comprise a nuclease domain. In a more preferred embodiment the nuclease domain is a non-specific FokI endonucleases catalytic domain.
[0145] In a further embodiment, useful domains for regulating gene expression may also be obtained from the gene products of oncogenes. In yet further advantageous embodiments of the invention, effector domains having integrase or transposase activity may be used to promote integration of exogenous nucleic acid sequence into specific nucleic acid sequence regions, eliminate (knock-out) specific endogenous nucleic acid sequence, and/or modify epigenetic signals and consequent gene regulation, such as by promoting DNA methyltransferase, DNA demethylase, histone acetylase and histone deacetylase activity. In other embodiments, effector domains having nuclease activity may be used to alter genome structure by nicking or digesting target sequences to which the polypeptides of the invention specifically bind, and may allow introduction of exogenous genes at those sites. In still further embodiments, effector domains having invertase activity may be used to alter genome structure by swapping the orientation of a DNA fragment.
[0146] In particularly advantageous embodiments, the polypeptides used in the methods of the invention may be used to target transcriptional activity. As used herein, the term "transcription factor" refers to a protein or polypeptide that binds specific DNA sequences associated with a genomic locus or gene of interest to control transcription. Transcription factors may promote (as an activator) or block (as a repressor) the recruitment of RNA polymerase to a gene of interest. Transcription factors may perform their function alone or as a part of a larger protein complex. Mechanisms of gene regulation used by transcription factors include but are not limited to a) stabilization or destabilization of RNA polymerase binding, b) acetylation or deacetylation of histone proteins and c) recruitment of co-activator or co-repressor proteins. Furthermore, transcription factors play roles in biological activities that include but are not limited to basal transcription, enhancement of transcription, development, response to intercellular signaling, response to environmental cues, cell-cycle control and pathogenesis. With regards to information on transcriptional factors, mention is made of Latchman and DS (1997) Int. J. Biochem. Cell Biol. 29 (12): 1305-12; Lee T I, Young R A (2000) Annu Rev. Genet. 34: 77-137 and Mitchell P J, Tjian R (1989) Science 245 (4916): 371-8, herein incorporated by reference in their entirety.
[0147] Light responsiveness of a LITE is achieved via the activation and binding of cryptochrome-2 and CIB1. As mentioned above, blue light stimulation induces an activating conformational change in cryptochrome-2, resulting in recruitment of its binding partner CIB1. This binding is fast and reversible, achieving saturation in <15 sec following pulsed stimulation and returning to baseline <15 min after the end of stimulation. These rapid binding kinetics result in a LITE system temporally bound only by the speed of transcription/translation and transcript/protein degradation, rather than uptake and clearance of inducing agents. Cryptochrome-2 activation is also highly sensitive, allowing for the use of low light intensity stimulation and mitigating the risks of phototoxicity. Further, in a context such as the intact mammalian brain, variable light intensity may be used to control the size of a LITE stimulated region, allowing for greater precision than vector delivery alone may offer.
[0148] The modularity of the LITE system allows for any number of effector domains to be employed for transcriptional modulation. Thus, activator and repressor domains may be selected on the basis of species, strength, mechanism, duration, size, or any number of other parameters.
[0149] Applicants next present two prototypical manifestations of the LITE system. The first example is a LITE designed to activate transcription of the mouse gene NEUROG2. The sequence TGAATGATGATAATACGA (SEQ ID NO:149), located in the upstream promoter region of mouse NEUROG2, was selected as the target and a TALE was designed and synthesized to match this sequence. The TALE sequence was linked to the sequence for cryptochrome-2 via a nuclear localization signal (amino acids: SPKKKRKVEAS; SEQ ID NO: 150) to facilitate transport of the protein from the cytosol to the nuclear space. A second vector was synthesized comprising the CIB1 domain linked to the transcriptional activator domain VP64 using the same nuclear localization signal. This second vector, also a GFP sequence, is separated from the CIB1-VP64 fusion sequence by a 2A translational skip signal. Expression of each construct was driven by a ubiquitous, constitutive promoter (CMV or EF1-α). Mouse neuroblastoma cells from the Neuro 2A cell line were co-transfected with the two vectors. After incubation to allow for vector expression, samples were stimulated by periodic pulsed blue light from an array of 488 nm LEDs. Unstimulated co-transfected samples and samples transfected only with the fluorescent reporter YFP were used as controls. At the end of each experiment, mRNA was purified from the samples analyzed via qPCR.
[0150] Truncated versions of cryptochrome-2 and CIB1 were cloned and tested in combination with the full-length versions of cryptochrome-2 and CIB1 in order to determine the effectiveness of each heterodimer pair. The combination of the CRY2PHR domain, consisting of the conserved photoresponsive region of the cryptochrome-2 protein, and the full-length version of CIB1 resulted in the highest upregulation of Neurog2 mRNA levels (˜22 fold over YFP samples and ˜7 fold over unstimulated co-transfected samples). The combination of full-length cryptochrome-2 (CRY2) with full-length CIB1 resulted in a lower absolute activation level (˜4.6 fold over YFP), but also a lower baseline activation (˜1.6 fold over YFP for unstimulated co-transfected samples). These cryptochrome protein pairings may be selected for particular uses depending on absolute level of induction required and the necessity to minimize baseline "leakiness" of the LITE system.
[0151] Speed of activation and reversibility are critical design parameters for the LITE system. The invention contemplates energy sources such as electromagnetic radiation, sound energy or thermal energy.
[0152] The cells of the present invention are preferably a eukaryotic cell, advantageously an animal cell, more advantageously a mammalian cell.
[0153] The present invention also contemplates a multiplex genome engineering using CRISPR/Cas systems. Functional elucidation of causal genetic variants and elements requires precise genome editing technologies. The type II prokaryotic CRISPR (clustered regularly interspaced short palindromic repeats) adaptive immune system has been shown to facilitate RNA-guided site-specific DNA cleavage. Applicants engineered two different type II CRISPR systems and demonstrate that Cas9 nucleases can be directed by short RNAs to induce precise cleavage at endogenous genomic loci in human and mouse cells. Cas9 can also be converted into a nicking enzyme to facilitate homology-directed repair with minimal mutagenic activity. Finally, multiple guide sequences can be encoded into a single CRISPR array to enable simultaneous editing of several sites within the mammalian genome, demonstrating easy programmability and wide applicability of the CRISPR technology.
[0154] In general, "CRISPR system" refers collectively to transcripts and other elements involved in the expression of or directing the activity of CRISPR-associated ("Cas") genes, including sequences encoding a Cas gene, a tracr (trans-activating CRISPR) sequence (e.g. tracrRNA or an active partial tracrRNA), a tracr-mate sequence (encompassing a "direct repeat" and a tracrRNA-processed partial direct repeat in the context of an endogenous CRISPR system), a guide sequence (also referred to as a "spacer" in the context of an endogenous CRISPR system), or other sequences and transcripts from a CRISPR locus. In some embodiments, one or more elements of a CRISPR system is derived from a type I, type II, or type III CRISPR system. In some embodiments, one or more elements of a CRISPR system is derived from a particular organism comprising an endogenous CRISPR system, such as Streptococcus pyogenes. In general, a CRISPR system is characterized by elements that promote the formation of a CRISPR complex at the site of a target sequence (also referred to as a protospacer in the context of an endogenous CRISPR system). In the context of formation of a CRISPR complex, "target sequence" refers to a sequence to which a guide sequence is designed to have complementarity, where hybridization between a target sequence and a guide sequence promotes the formation of a CRISPR complex. A target sequence may comprise any polynucleotide, such as DNA or RNA polynucleotides. In some embodiments, a target sequence is located in the nucleus or cytoplasm of a cell.
[0155] Typically, in the context of an endogenous CRISPR system, formation of a CRISPR complex (comprising a guide sequence hybridized to a target sequence and complexed with one or more Cas proteins) results in cleavage of one or both strands in or near (e.g. within 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 50, or more base pairs from) the target sequence. Without wishing to be bound by theory, all or a portion of the tracr sequence may also form part of a CRISPR complex, such as by hybridization to all or a portion of a tracr mate sequence that is operably linked to the guide sequence. In some embodiments, one or more vectors driving expression of one or more elements of a CRISPR system are introduced into a host cell such that expression of the elements of the CRISPR system direct formation of a CRISPR complex at one or more target sites. For example, a Cas enzyme, a guide sequence linked to a tracr-mate sequence, and a tracr sequence could each be operably linked to separate regulatory elements on separate vectors. Alternatively, two or more of the elements expressed from the same or different regulatory elements, may be combined in a single vector, with one or more additional vectors providing any components of the CRISPR system not included in the first vector. CRISPR system elements that are combined in a single vector may be arranged in any suitable orientation, such as one element located 5' with respect to ("upstream" of) or 3' with respect to ("downstream" of) a second element. The coding sequence of one element may be located on the same or opposite strand of the coding sequence of a second element, and oriented in the same or opposite direction. In some embodiments, a single promoter drives expression of a transcript encoding a CRISPR enzyme and one or more of the guide sequence, tracr mate sequence (optionally operably linked to the guide sequence), and a tracr sequence embedded within one or more intron sequences (e.g. each in a different intron, two or more in at least one intron, or all in a single intron). In some embodiments, the CRISPR enzyme, guide sequence, tracr mate sequence, and tracr sequence are operably linked to and expressed from the same promoter.
[0156] In some embodiments, a vector comprises one or more insertion sites, such as a restriction endonuclease recognition sequence (also referred to as a "cloning site"). In some embodiments, one or more insertion sites (e.g. about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more insertion sites) are located upstream and/or downstream of one or more sequence elements of one or more vectors. In some embodiments, a vector comprises an insertion site upstream of a tracr mate sequence, and optionally downstream of a regulatory element operably linked to the tracr mate sequence, such that following insertion of a guide sequence into the insertion site and upon expression the guide sequence directs sequence-specific binding of a CRISPR complex to a target sequence in a eukaryotic cell. In some embodiments, a vector comprises two or more insertion sites, each insertion site being located between two tracr mate sequences so as to allow insertion of a guide sequence at each site. In such an arrangement, the two or more guide sequences may comprise two or more copies of a single guide sequence, two or more different guide sequences, or combinations of these. When multiple different guide sequences are used, a single expression construct may be used to target CRISPR activity to multiple different, corresponding target sequences within a cell. For example, a single vector may comprise about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or more guide sequences. In some embodiments, about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more such guide-sequence-containing vectors may be provided, and optionally delivered to a cell.
[0157] In some embodiments, a vector comprises a regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme, such as a Cas protein. Non-limiting examples of Cas proteins include Cas1, Cas1B, Cas2, Cas3, Cas4, Cas5, Cas6, Cas7, Cas8, Cas9 (also known as Csn1 and Csx12), Cas10, Csy1, Csy2, Csy3, Cse1, Cse2, Csc1, Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmr1, Cmr3, Cmr4, Cmr5, Cmr6, Csb1, Csb2, Csb3, Csx17, Csx14, Csx10, Csx16, CsaX, Csx3, Csx1, Csx15, Csf1, Csf2, Csf3, Csf4, homologues thereof, or modified versions thereof. In some embodiments, the unmodified CRISPR enzyme has DNA cleavage activity, such as Cas9. In some embodiments, the CRISPR enzyme directs cleavage of one or both strands at the location of a target sequence, such as within the target sequence and/or within the complement of the target sequence. In some embodiments, the CRISPR enzyme directs cleavage of one or both strands within about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 50, 100, 200, 500, or more base pairs from the first or last nucleotide of a target sequence. In some embodiments, a vector encodes a CRISPR enzyme that is mutated to with respect to a corresponding wild-type enzyme such that the mutated CRISPR enzyme lacks the ability to cleave one or both strands of a target polynucleotide containing a target sequence. For example, an aspartate-to-alanine substitution (D10A) in the RuvC I catalytic domain of Cas9 from S. pyogenes converts Cas9 from a nuclease that cleaves both strands to a nickase (cleaves a single strand). Other examples of mutations that render Cas9 a nickase include, without limitation, H840A, N854A, and N863A. As a further example, two or more catalytic domains of Cas9 (RuvC I, RuvC II, and RuvC III) may be mutated to produce a mutated Cas9 substantially lacking all DNA cleavage activity. In some embodiments, a D10A mutation is combined with one or more of H840A, N854A, or N863A mutations to produce a Cas9 enzyme substantially lacking all DNA cleavage activity. In some embodiments, a CRISPR enzyme is considered to substantially lack all DNA cleavage activity when the DNA cleavage activity of the mutated enzyme is less than about 25%, 10%, 5%, 1%, 0.1%, 0.01%, or lower with respect to its non-mutated form.
[0158] In some embodiments, an enzyme coding sequence encoding a CRISPR enzyme is codon optimized for expression in particular cells, such as eukaryotic cells. The eukaryotic cells may be those of or derived from a particular organism, such as a mammal, including but not limited to human, mouse, rat, rabbit, dog, or non-human primate. In general, codon optimization refers to a process of modifying a nucleic acid sequence for enhanced expression in the host cells of interest by replacing at least one codon (e.g. about or more than about 1, 2, 3, 4, 5, 10, 15, 20, 25, 50, or more codons) of the native sequence with codons that are more frequently or most frequently used in the genes of that host cell while maintaining the native amino acid sequence. Various species exhibit particular bias for certain codons of a particular amino acid. Codon bias (differences in codon usage between organisms) often correlates with the efficiency of translation of messenger RNA (mRNA), which is in turn believed to be dependent on, among other things, the properties of the codons being translated and the availability of particular transfer RNA (tRNA) molecules. The predominance of selected tRNAs in a cell is generally a reflection of the codons used most frequently in peptide synthesis. Accordingly, genes can be tailored for optimal gene expression in a given organism based on codon optimization. Codon usage tables are readily available, for example, at the "Codon Usage Database" available at www.kazusa.orjp/codon/ (visited Jul. 9, 2002), and these tables can be adapted in a number of ways. See Nakamura, Y., et al. "Codon usage tabulated from the international DNA sequence databases: status for the year 2000''Nucl. Acids Res. 28:292 (2000). Computer algorithms for codon optimizing a particular sequence for expression in a particular host cell are also available, such as Gene Forge (Aptagen; Jacobus, PA), are also available. In some embodiments, one or more codons (e.g. 1, 2, 3, 4, 5, 10, 15, 20, 25, 50, or more, or all codons) in a sequence encoding a CRISPR enzyme correspond to the most frequently used codon for a particular amino acid.
[0159] In some embodiments, a vector encodes a CRISPR enzyme comprising one or more nuclear localization sequences (NLSs), such as about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs. In some embodiments, the CRISPR enzyme comprises about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs at or near the amino-terminus, about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs at or near the carboxy-terminus, or a combination of these (e.g. one or more NLS at the amino-terminus and one or more NLS at the carboxy terminus). When more than one NLS is present, each may be selected independently of the others, such that a single NLS may be present in more than one copy and/or in combination with one or more other NLSs present in one or more copies. In some embodiments, an NLS is considered near the N- or C-terminus when the nearest amino acid of the NLS is within about 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 40, 50, or more amino acids along the polypeptide chain from the N- or C-terminus. Non-limiting examples of NLSs include an NLS sequence derived from: the NLS of the SV40 virus large T-antigen, having the amino acid sequence PKKKRKV (SEQ ID NO: 151); the NLS from nucleoplasmin (e.g. the nucleoplasmin bipartite NLS with the sequence KRPAATKKAGQAKKKK; SEQ ID NO: 152); the c-myc NLS having the amino acid sequence PAAKRVKLD (SEQ ID NO: 153) or RQRRNELKRSP (SEQ ID NO: 154); the hRNPA1 M9 NLS having the sequence NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY (SEQ ID NO: 155); the sequence RMRIZFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNV (SEQ ID NO: 156) of the IBB domain from importin-alpha; the sequences VSRKRPRP (SEQ ID NO: 157) and PPKKARED (SEQ ID NO: 158) of the myoma T protein; the sequence PQPKKKPL (SEQ ID NO: 159) of human p53; the sequence SALIKKKKKMAP (SEQ ID NO: 160) of mouse c-abl IV; the sequences DRLRR (SEQ ID NO: 161) and PKQKKRK (SEQ ID NO: 162) of the influenza virus NS1; the sequence RKLKKKIKKL (SEQ ID NO: 163) of the Hepatitis virus delta antigen; the sequence REKKKFLKRR (SEQ ID NO: 164) of the mouse Mx1 protein; the sequence KRKGDEVDGVDEVAKKKSKK (SEQ ID NO: 165) of the human poly(ADP-ribose) polymerase; and the sequence RKCLQAGMNLEARKTKK (SEQ ID NO: 166) of the steroid hormone receptors (human) glucocorticoid.
[0160] In general, the one or more NLSs are of sufficient strength to drive accumulation of the CRISPR enzyme in a detectable amount in the nucleus of a eukaryotic cell. In general, strength of nuclear localization activity may derive from the number of NLSs in the CRISPR enzyme, the particular NLS(s) used, or a combination of these factors. Detection of accumulation in the nucleus may be performed by any suitable technique. For example, a detectable marker may be fused to the CRISPR enzyme, such that location within a cell may be visualized, such as in combination with a means for detecting the location of the nucleus (e.g. a stain specific for the nucleus such as DAPI). Cell nuclei may also be isolated from cells, the contents of which may then be analyzed by any suitable process for detecting protein, such as immunohistochemistry, Western blot, or enzyme activity assay. Accumulation in the nucleus may also be determined indirectly, such as by an assay for the effect of CRISPR complex formation (e.g. assay for DNA cleavage or mutation at the target sequence, or assay for altered gene expression activity affected by CRISPR complex formation and/or CRISPR enzyme activity), as compared to a control no exposed to the CRISPR enzyme or complex, or exposed to a CRISPR enzyme lacking the one or more NLSs.
[0161] The present invention also encompasses nucleic acid encoding the polypeptides of the present invention. The nucleic acid may comprise a promoter, advantageously human Synapsin I promoter (hSyn). In a particularly advantageous embodiment, the nucleic acid may be packaged into an adeno associated viral vector (AAV).
[0162] Also contemplated by the present invention are recombinant vectors and recombinant adenoviruses that may comprise subviral particles from more than one adenovirus serotype. For example, it is known that adenovirus vectors may display an altered tropism for specific tissues or cell types (Havenga, M. J. E. et al., 2002), and therefore, mixing and matching of different adenoviral capsids, i.e., fiber, or penton proteins from various adenoviral serotypes may be advantageous. Modification of the adenoviral capsids, including fiber and penton may result in an adenoviral vector with a tropism that is different from the unmodified adenovirus. Adenovirus vectors that are modified and optimized in their ability to infect target cells may allow for a significant reduction in the therapeutic or prophylactic dose, resulting in reduced local and disseminated toxicity.
[0163] Viral vector gene delivery systems are commonly used in gene transfer and gene therapy applications. Different viral vector systems have their own unique advantages and disadvantages. Viral vectors that may be used to express the pathogen-derived ligand of the present invention include but are not limited to adenoviral vectors, adeno-associated viral vectors, alphavirus vectors, herpes simplex viral vectors, and retroviral vectors, described in more detail below.
[0164] Additional general features of adenoviruses are such that the biology of the adenovirus is characterized in detail; the adenovirus is not associated with severe human pathology; the adenovirus is extremely efficient in introducing its DNA into the host cell; the adenovirus may infect a wide variety of cells and has a broad host range; the adenovirus may be produced in large quantities with relative ease; and the adenovirus may be rendered replication defective and/or non-replicating by deletions in the early region 1 ("E1") of the viral genome.
[0165] Adenovirus is a non-enveloped DNA virus. The genome of adenovirus is a linear double-stranded DNA molecule of approximately 36,000 base pairs ("bp") with a 55-kDa terminal protein covalently bound to the 5'-terminus of each strand. The adenovirus DNA contains identical inverted terminal repeats ("ITRs") of about 100 bp, with the exact length depending on the serotype. The viral origins of replication are located within the ITRs exactly at the genome ends. DNA synthesis occurs in two stages. First, replication proceeds by strand displacement, generating a daughter duplex molecule and a parental displaced strand. The displaced strand is single stranded and may form a "panhandle" intermediate, which allows replication initiation and generation of a daughter duplex molecule. Alternatively, replication may proceed from both ends of the genome simultaneously, obviating the requirement to form the panhandle structure.
[0166] During the productive infection cycle, the viral genes are expressed in two phases: the early phase, which is the period up to viral DNA replication, and the late phase, which coincides with the initiation of viral DNA replication. During the early phase, only the early gene products, encoded by regions E1, E2, E3 and E4, are expressed, which carry out a number of functions that prepare the cell for synthesis of viral structural proteins (Berk, A. J., 1986). During the late phase, the late viral gene products are expressed in addition to the early gene products and host cell DNA and protein synthesis are shut off. Consequently, the cell becomes dedicated to the production of viral DNA and of viral structural proteins (Tooze, J., 1981).
[0167] The E1 region of adenovirus is the first region of adenovirus expressed after infection of the target cell. This region consists of two transcriptional units, the E1A and E1B genes, both of which are required for oncogenic transformation of primary (embryonal) rodent cultures. The main functions of the E1A gene products are to induce quiescent cells to enter the cell cycle and resume cellular DNA synthesis, and to transcriptionally activate the E1B gene and the other early regions (E2, E3 and E4) of the viral genome. Transfection of primary cells with the E1A gene alone may induce unlimited proliferation (immortalization), but does not result in complete transformation. However, expression of E1A, in most cases, results in induction of programmed cell death (apoptosis), and only occasionally is immortalization obtained (Jochemsen et al., 1987). Co-expression of the E1B gene is required to prevent induction of apoptosis and for complete morphological transformation to occur. In established immortal cell lines, high-level expression of E1A may cause complete transformation in the absence of E1B (Roberts, B. E. et al., 1985).
[0168] The E1B encoded proteins assist E1A in redirecting the cellular functions to allow viral replication. The E1B 55 kD and E4 33 kD proteins, which form a complex that is essentially localized in the nucleus, function in inhibiting the synthesis of host proteins and in facilitating the expression of viral genes. Their main influence is to establish selective transport of viral mRNAs from the nucleus to the cytoplasm, concomitantly with the onset of the late phase of infection. The E1B 21 kD protein is important for correct temporal control of the productive infection cycle, thereby preventing premature death of the host cell before the virus life cycle has been completed. Mutant viruses incapable of expressing the E1B 21 kD gene product exhibit a shortened infection cycle that is accompanied by excessive degradation of host cell chromosomal DNA (deg-phenotype) and in an enhanced cytopathic effect (cyt-phenotype; Telling et al., 1994). The deg and cyt phenotypes are suppressed when in addition the E1A gene is mutated, indicating that these phenotypes are a function of E1A (White, E. et al., 1988). Furthermore, the E1B 21 kDa protein slows down the rate by which E1A switches on the other viral genes. It is not yet known by which mechanisms E1B 21 kD quenches these E1A dependent functions.
[0169] In contrast to, for example, retroviruses, adenoviruses do not efficiently integrate into the host cell's genome, are able to infect non-dividing cells, and are able to efficiently transfer recombinant genes in vivo (Brody et al., 1994). These features make adenoviruses attractive candidates for in vivo gene transfer of, for example, an antigen or immunogen of interest into cells, tissues or subjects in need thereof.
[0170] Adenovirus vectors containing multiple deletions are preferred to both increase the carrying capacity of the vector and reduce the likelihood of recombination to generate replication competent adenovirus (RCA). Where the adenovirus contains multiple deletions, it is not necessary that each of the deletions, if present alone, would result in a replication defective and/or non-replicating adenovirus. As long as one of the deletions renders the adenovirus replication defective or non-replicating, the additional deletions may be included for other purposes, e.g., to increase the carrying capacity of the adenovirus genome for heterologous nucleotide sequences. Preferably, more than one of the deletions prevents the expression of a functional protein and renders the adenovirus replication defective and/or non-replicating and/or attenuated. More preferably, all of the deletions are deletions that would render the adenovirus replication-defective and/or non-replicating and/or attenuated. However, the invention also encompasses adenovirus and adenovirus vectors that are replication competent and/or wild-type, i.e. comprises all of the adenoviral genes necessary for infection and replication in a subject.
[0171] Embodiments of the invention employing adenovirus recombinants may include E1-defective or deleted, or E3-defective or deleted, or E4-defective or deleted or adenovirus vectors comprising deletions of E1 and E3, or E1 and E4, or E3 and E4, or E1, E3, and E4 deleted, or the "gutless" adenovirus vector in which all viral genes are deleted. The adenovirus vectors may comprise mutations in E1, E3, or E4 genes, or deletions in these or all adenoviral genes. The E1 mutation raises the safety margin of the vector because E1-defective adenovirus mutants are said to be replication-defective and/or non-replicating in non-permissive cells, and are, at the very least, highly attenuated. The E3 mutation enhances the immunogenicity of the antigen by disrupting the mechanism whereby adenovirus down-regulates MHC class I molecules. The E4 mutation reduces the immunogenicity of the adenovirus vector by suppressing the late gene expression, thus may allow repeated re-vaccination utilizing the same vector. The present invention comprehends adenovirus vectors of any serotype or serogroup that are deleted or mutated in E1, or E3, or E4, or E1 and E3, or E1 and E4. Deletion or mutation of these adenoviral genes result in impaired or substantially complete loss of activity of these proteins.
[0172] The "gutless" adenovirus vector is another type of vector in the adenovirus vector family. Its replication requires a helper virus and a special human 293 cell line expressing both E1a and Cre, a condition that does not exist in a natural environment; the vector is deprived of all viral genes, thus the vector as a vaccine carrier is non-immunogenic and may be inoculated multiple times for re-vaccination. The "gutless" adenovirus vector also contains 36 kb space for accommodating antigen or immunogen(s) of interest, thus allowing co-delivery of a large number of antigen or immunogens into cells.
[0173] Adeno-associated virus (AAV) is a single-stranded DNA parvovirus which is endogenous to the human population. Although capable of productive infection in cells from a variety of species, AAV is a dependovirus, requiring helper functions from either adenovirus or herpes virus for its own replication. In the absence of helper functions from either of these helper viruses, AAV will infect cells, uncoat in the nucleus, and integrate its genome into the host chromosome, but will not replicate or produce new viral particles.
[0174] The genome of AAV has been cloned into bacterial plasmids and is well characterized. The viral genome consists of 4682 bases which include two terminal repeats of 145 bases each. These terminal repeats serve as origins of DNA replication for the virus. Some investigators have also proposed that they have enhancer functions. The rest of the genome is divided into two functional domains. The left portion of the genome codes for the rep functions which regulate viral DNA replication and vital gene expression. The right side of the vital genome contains the cap genes that encode the structural capsid proteins VP1, VP2 and VP3. The proteins encoded by both the rep and cap genes function in trans during productive AAV replication.
[0175] AAV is considered an ideal candidate for use as a transducing vector, and it has been used in this manner. Such AAV transducing vectors comprise sufficient cis-acting functions to replicate in the presence of adenovirus or herpes virus helper functions provided in trans. Recombinant AAV (rAAV) have been constructed in a number of laboratories and have been used to carry exogenous genes into cells of a variety of lineages. In these vectors, the AAV cap and/or rep genes are deleted from the viral genome and replaced with a DNA segment of choice. Current vectors may accommodate up to 4300 bases of inserted DNA.
[0176] To produce rAAV, plasmids containing the desired vital construct are transfected into adenovirus-infected cells. In addition, a second helper plasmid is cotransfected into these cells to provide the AAV rep and cap genes which are obligatory for replication and packaging of the recombinant viral construct. Under these conditions, the rep and cap proteins of AAV act in trans to stimulate replication and packaging of the rAAV construct. Three days after transfection, rAAV is harvested from the cells along with adenovirus. The contaminating adenovirus is then inactivated by heat treatment.
[0177] Herpes Simplex Virus 1 (HSV-1) is an enveloped, double-stranded DNA virus with a genome of 153 kb encoding more than 80 genes. Its wide host range is due to the binding of viral envelope glycoproteins to the extracellular heparin sulphate molecules found in cell membranes (WuDunn & Spear, 1989). Internalization of the virus then requires envelope glycoprotein gD and fibroblast growth factor receptor (Kaner, 1990). HSV is able to infect cells lytically or may establish latency. HSV vectors have been used to infect a wide variety of cell types (Lowenstein, 1994; Huard, 1995; Miyanohara, 1992; Liu, 1996; Goya, 1998).
[0178] There are two types of HSV vectors, called the recombinant HSV vectors and the amplicon vectors. Recombinant HSV vectors are generated by the insertion of transcription units directly into the HSV genome, through homologous recombination events. The amplicon vectors are based on plasmids bearing the transcription unit of choice, an origin of replication, and a packaging signal.
[0179] HSV vectors have the obvious advantages of a large capacity for insertion of foreign genes, the capacity to establish latency in neurons, a wide host range, and the ability to confer transgene expression to the CNS for up to 18 months (Carpenter & Stevens, 1996).
[0180] Retroviruses are enveloped single-stranded RNA viruses, which have been widely used in gene transfer protocols. Retroviruses have a diploid genome of about 7-10 kb, composed of four gene regions termed gag, pro, pol and env. These gene regions encode for structural capsid proteins, viral protease, integrase and viral reverse transcriptase, and envelope glycoproteins, respectively. The genome also has a packaging signal and cis-acting sequences, termed long-terminal repeats (LTRs), at each end, which have a role in transcriptional control and integration.
[0181] The viral vectors of the present invention are useful for the delivery of nucleic acids expressing antigens or immunogens to cells both in vitro and in vivo. In particular, the inventive vectors may be advantageously employed to deliver or transfer nucleic acids to cells, more preferably mammalian cells. Nucleic acids of interest include nucleic acids encoding peptides and proteins, preferably therapeutic (e.g., for medical or veterinary uses) or immunogenic (e.g., for vaccines) peptides or proteins.
[0182] Preferably, the codons encoding the antigen or immunogen of interest are "optimized" codons, i.e., the codons are those that appear frequently in, e.g., highly expressed genes in the subject's species, instead of those codons that are frequently used by, for example, an influenza virus. Such codon usage provides for efficient expression of the antigen or immunogen in animal cells. In other embodiments, for example, when the antigen or immunogen of interest is expressed in bacteria, yeast or another expression system, the codon usage pattern is altered to represent the codon bias for highly expressed genes in the organism in which the antigen or immunogen is being expressed. Codon usage patterns are known in the literature for highly expressed genes of many species (e.g., Nakamura et al., 1996; Wang et al., 1998; McEwan et al. 1998).
[0183] As a further alternative, the viral vectors may be used to infect a cell in culture to express a desired gene product, e.g., to produce a protein or peptide of interest. Preferably, the protein or peptide is secreted into the medium and may be purified therefrom using routine techniques known in the art. Signal peptide sequences that direct extracellular secretion of proteins are known in the art and nucleotide sequences encoding the same may be operably linked to the nucleotide sequence encoding the peptide or protein of interest by routine techniques known in the art. Alternatively, the cells may be lysed and the expressed recombinant protein may be purified from the cell lysate. Preferably, the cell is an animal cell, more preferably a mammalian cell. Also preferred are cells that are competent for transduction by particular viral vectors of interest. Such cells include PER.C6 cells, 911 cells, and HEK293 cells.
[0184] A culture medium for culturing host cells includes a medium commonly used for tissue culture, such as M199-earle base, Eagle MEM (E-MEM), Dulbecco MEM (DMEM), SC-UCM102, UP-SFM (GIBCO BRL), EX-CELL302 (Nichirei), EX-CELL293-S(Nichirei), TFBM-01 (Nichirei), ASF104, among others. Suitable culture media for specific cell types may be found at the American Type Culture Collection (ATCC) or the European Collection of Cell Cultures (ECACC). Culture media may be supplemented with amino acids such as L-glutamine, salts, anti-fungal or anti-bacterial agents such as Fungizone®, penicillin-streptomycin, animal serum, and the like. The cell culture medium may optionally be serum-free.
[0185] The present invention also relates to cell lines or transgenic animals which are capable of expressing or overexpressing LITEs or at least one agent useful in the present invention. Preferably the cell line or animal expresses or overexpresses one or more LITEs.
[0186] The transgenic animal is typically a vertebrate, more preferably a rodent, such as a rat or a mouse, but also includes other mammals such as human, goat, pig or cow etc.
[0187] Such transgenic animals are useful as animal models of disease and in screening assays for new useful compounds. By specifically expressing one or more polypeptides, as defined above, the effect of such polypeptides on the development of disease may be studied. Furthermore, therapies including gene therapy and various drugs may be tested on transgenic animals. Methods for the production of transgenic animals are known in the art. For example, there are several possible routes for the introduction of genes into embryos. These include (i) direct transfection or retroviral infection of embryonic stem cells followed by introduction of these cells into an embryo at the blastocyst stage of development; (ii) retroviral infection of early embryos; and (iii) direct microinjection of DNA into zygotes or early embryo cells. The gene and/or transgene may also include genetic regulatory elements and/or structural elements known in the art. A type of target cell for transgene introduction is the embryonic stem cell (ES). ES cells may be obtained from pre-implantation embryos cultured in vitro and fused with embryos (Evans et al., 1981, Nature 292:154-156; Bradley et al., 1984, Nature 309:255-258; Gossler et al., 1986, Proc. Natl. Acad. Sci. USA 83:9065-9069; and Robertson et al., 1986 Nature 322:445-448). Transgenes may be efficiently introduced into the ES cells by a variety of standard techniques such as DNA transfection, microinjection, or by retrovirus-mediated transduction. The resultant transformed ES cells may thereafter be combined with blastocysts from a non-human animal. The introduced ES cells thereafter colonize the embryo and contribute to the germ line of the resulting chimeric animal (Jaenisch, 1988, Science 240: 1468-1474).
[0188] LITEs may also offer valuable temporal precision in vivo. LITEs may be used to alter gene expression during a particular stage of development, for example, by repressing a particular apoptosis gene only during a particular stage of C elegans growth. LITEs may be used to time a genetic cue to a particular experimental window. For example, genes implicated in learning may be overexpressed or repressed only during the learning stimulus in a precise region of the intact rodent or primate brain. Further, LITEs may be used to induce gene expression changes only during particular stages of disease development. For example, an oncogene may be overexpressed only once a tumor reaches a particular size or metastatic stage. Conversely, proteins suspected in the development of Alzheimer's may be knocked down only at defined time points in the animal's life and within a particular brain region. Although these examples do not exhaustively list the potential applications of the LITE system, they highlight some of the areas in which LITEs may be a powerful technology.
[0189] Therapeutic or diagnostic compositions of the invention are administered to an individual in amounts sufficient to treat or diagnose disorders. The effective amount may vary according to a variety of factors such as the individual's condition, weight, sex and age. Other factors include the mode of administration.
[0190] The pharmaceutical compositions may be provided to the individual by a variety of routes such as subcutaneous, topical, oral and intramuscular.
[0191] Compounds identified according to the methods disclosed herein may be used alone at appropriate dosages. Alternatively, co-administration or sequential administration of other agents may be desirable.
[0192] The present invention also has the objective of providing suitable topical, oral, systemic and parenteral pharmaceutical formulations for use in the novel methods of treatment of the present invention. The compositions containing compounds identified according to this invention as the active ingredient may be administered in a wide variety of therapeutic dosage forms in conventional vehicles for administration. For example, the compounds may be administered in such oral dosage forms as tablets, capsules (each including timed release and sustained release formulations), pills, powders, granules, elixirs, tinctures, solutions, suspensions, syrups and emulsions, or by injection. Likewise, they may also be administered in intravenous (both bolus and infusion), intraperitoneal, subcutaneous, topical with or without occlusion, or intramuscular form, all using forms well known to those of ordinary skill in the pharmaceutical arts.
[0193] Advantageously, compounds of the present invention may be administered in a single daily dose, or the total daily dosage may be administered in divided doses of two, three or four times daily. Furthermore, compounds for the present invention may be administered in intranasal form via topical use of suitable intranasal vehicles, or via transdermal routes, using those forms of transdermal skin patches well known to those of ordinary skill in that art. To be administered in the form of a transdermal delivery system, the dosage administration will, of course, be continuous rather than intermittent throughout the dosage regimen.
[0194] For combination treatment with more than one active agent, where the active agents are in separate dosage formulations, the active agents may be administered concurrently, or they each may be administered at separately staggered times.
[0195] The dosage regimen utilizing the compounds of the present invention is selected in accordance with a variety of factors including type, species, age, weight, sex and medical condition of the patient; the severity of the condition to be treated; the route of administration; the renal, hepatic and cardiovascular function of the one patient; and the particular compound thereof employed. A physician of ordinary skill may readily determine and prescribe the effective amount of the drug required to prevent, counter or arrest the progress of the condition. Optimal precision in achieving concentrations of drug within the range that yields efficacy without toxicity requires a regimen based on the kinetics of the drug's availability to target sites. This involves a consideration of the distribution, equilibrium, and elimination of a drug.
[0196] Although the present invention and its advantages have been described in detail, it should be understood that various changes, substitutions and alterations may be made herein without departing from the spirit and scope of the invention as defined in the appended claims.
[0197] The present invention will be further illustrated in the following Examples which are given for illustration purposes only and are not intended to limit the invention in any way.
EXAMPLES
Example 1
[0198] The ability to directly modulate gene expression from the endogenous mammalian genome is critical for elucidating normal gene function and disease mechanism. Advances that further refine the spatial and temporal control of gene expression within cell populations have the potential to expand the utility of gene modulation. Applicants previously developed transcription activator-like effectors (TALEs) from Xanthamonas oryze to enable the rapid design and construction of site-specific DNA binding proteins. Applicants developed a set of molecular tools for enabling light-regulated gene expression in the endogenous mammalian genome. The system consists of engineered artificial transcription factors linked to light-sensitive dimerizing protein domains from Arabidopsis thaliana. The system responds to light in the range of 450 nm-500 nm and is capable of inducing a significant increase in the expression of pluripotency factors after stimulation with light at an intensity of 6.2 mW/cm2 in mammalian cells. Applicants are developing tools for the targeting of a wide range of genes. Applicants believe that a toolbox for the light-mediated control of gene expression would complement the existing optogenetic methods and may in the future help elucidate the timing-, cell type- and concentration dependent role of specific genes in the brain.
[0199] The ability to directly modulate gene expression from the endogenous mammalian genome is critical for elucidating normal gene function and disease mechanisms. Applicants present the development of a set of molecular tools for enabling light-regulated gene expression in the endogenous mammalian genome. This system consists of a transcription activator like effector (TALE) and the activation domain VP64 linked to the light-sensitive dimerizing protein domains cryptochrome 2 (CRY2) and CIB1 from Arabidopsis thaliana. Applicants show that blue-light stimulation of HEK293FT and Neuro-2a cells transfected with these LITE constructs designed to target the promoter region of KLF4 and Neurog2 results in a significant increase in target expression, demonstrating the functionality of TALE-based optical gene expression modulation technology.
[0200] FIG. 2 shows transcription activator like effectors (TALEs). TALEs consist of 34 aa repeats (SEQ ID NO:1) at the core of their sequence. Each repeat corresponds to a base in the target DNA that is bound by the TALE. Repeats differ only by 2 variable amino acids at positions 12 and 13. The code of this correspondence has been elucidated (Boch, J et al., Science, 2009 and Moscou, M et al., Science, 2009) and is shown in this figure. One example of a binding site is shown as SEQ ID NO: 2. Applicants developed a method for the synthesis of designer TALEs incorporating this code and capable of binding a sequence of choice within the genome (Zhang, F et al., Nature Biotechnology, 2011).
[0201] FIG. 3 depicts a design of a LITE: TALE/Cryptochrome transcriptional activation. Each LITE is a two-component system which may comprise a TALE fused to CRY2 and the cryptochrome binding partner CIB1 fused to VP64, a transcription activator. In the inactive state, the TALE localizes its fused CRY2 domain to the promoter region of the gene of interest. At this point, CIB1 is unable to bind CRY2, leaving the CIB1-VP64 unbound in the nuclear space. Upon stimulation with 488 nm (blue) light, CRY2 undergoes a conformational change, revealing its CIB1 binding site (Liu, H et al., Science, 2008). Rapid binding of CIB1 results in recruitment of the fused VP64 domain, which induces transcription of the target gene.
Example 2
[0202] Normal gene expression is a dynamic process with carefully orchestrated temporal and spatial components, the precision of which are necessary for normal development, homeostasis, and advancement of the organism. In turn, the dysregulation of required gene expression patterns, either by increased, decreased, or altered function of a gene or set of genes, has been linked to a wide array of pathologies. Technologies capable of modulating gene expression in a spatiotemporally precise fashion will enable the elucidation of the genetic cues responsible for normal biological processes and disease mechanisms. To address this technological need, Applicants developed light-inducible transcriptional effectors (LITEs), which provide light-mediated control of endogenous gene expression.
[0203] Inducible gene expression systems have typically been designed to allow for chemically inducible activation of an inserted open reading frame or shRNA sequence, resulting in gene overexpression or repression, respectively. Disadvantages of using open reading frames for overexpression include loss of splice variation and limitation of gene size. Gene repression via RNA interference, despite its transformative power in human biology, may be hindered by complicated off-target effects. Certain inducible systems including estrogen, ecdysone, and FKBP12/FRAP based systems are known to activate off-target endogenous genes. The potentially deleterious effects of long-term antibiotic treatment may complicate the use of tetracycline transactivator (TET) based systems. In vivo, the temporal precision of these chemically inducible systems is dependent upon the kinetics of inducing agent uptake and elimination. Further, because inducing agents are generally delivered systemically, the spatial precision of such systems is bounded by the precision of exogenous vector delivery.
[0204] In response to these limitations, LITEs are designed to modulate expression of individual endogenous genes in a temporally and spatially precise manner. Each LITE is a two component system consisting of a customized DNA-binding transcription activator like effector (TALE) protein, a light-responsive cryptochrome heterodimer from Arabadopsis thaliana, and a transcriptional activation/repression domain. The TALE is designed to bind to the promoter sequence of the gene of interest. The TALE protein is fused to one half of the cryptochrome heterodimer (cryptochrome-2 or CIB1), while the remaining cryptochrome partner is fused to a transcriptional effector domain. Effector domains may be either activators, such as VP16, VP64, or p65, or repressors, such as KRAB, EnR, or SID. In a LITE's unstimulated state, the TALE-cryptochrome2 protein localizes to the promoter of the gene of interest, but is not bound to the CIB1-effector protein. Upon stimulation of a LITE with blue spectrum light, cryptochrome-2 becomes activated, undergoes a conformational change, and reveals its binding domain. CIB1, in turn, binds to cryptochrome-2 resulting in localization of the effector domain to the promoter region of the gene of interest and initiating gene overexpression or silencing.
[0205] Gene targeting in a LITE is achieved via the specificity of customized TALE DNA binding proteins. A target sequence in the promoter region of the gene of interest is selected and a TALE customized to this sequence is designed. The central portion of the TALE consists of tandem repeats 34 amino acids in length. Although the sequences of these repeats are nearly identical, the 12th and 13th amino acids (termed repeat variable diresidues) of each repeat vary, determining the nucleotide-binding specificity of each repeat. Thus, by synthesizing a construct with the appropriate ordering of TALE monomer repeats, a DNA binding protein specific to the target promoter sequence is created.
[0206] Light responsiveness of a LITE is achieved via the activation and binding of cryptochrome-2 and CIB1. As mentioned above, blue light stimulation induces an activating conformational change in cryptochrome-2, resulting in recruitment of its binding partner CIB1. This binding is fast and reversible, achieving saturation in <15 sec following pulsed stimulation and returning to baseline <15 min after the end of stimulation. These rapid binding kinetics result in a LITE system temporally bound only by the speed of transcription/translation and transcript/protein degradation, rather than uptake and clearance of inducing agents. Cryptochrome-2 activation is also highly sensitive, allowing for the use of low light intensity stimulation and mitigating the risks of phototoxicity. Further, in a context such as the intact mammalian brain, variable light intensity may be used to control the size of a LITE stimulated region, allowing for greater precision than vector delivery alone may offer.
[0207] The modularity of the LITE system allows for any number of effector domains to be employed for transcriptional modulation. Thus, activator and repressor domains may be selected on the basis of species, strength, mechanism, duration, size, or any number of other parameters.
[0208] Applicants next present two prototypical manifestations of the LITE system. The first example is a LITE designed to activate transcription of the mouse gene NEUROG2. The sequence TGAATGATGATAATACGA (SEQ ID NO:149), located in the upstream promoter region of mouse NEUROG2, was selected as the target and a TALE was designed and synthesized to match this sequence. The TALE sequence was linked to the sequence for cryptochrome-2 via a nuclear localization signal (amino acids: SPKKKRKVEAS; SEQ ID NO: 150) to facilitate transport of the protein from the cytosol to the nuclear space. A second vector was synthesized comprising the CIB1 domain linked to the transcriptional activator domain VP64 using the same nuclear localization signal. This second vector, also a GFP sequence, is separated from the CIB1-VP64 fusion sequence by a 2A translational skip signal. Expression of each construct was driven by a ubiquitous, constitutive promoter (CMV or EF1-α). Mouse neuroblastoma cells from the Neuro 2A cell line were co-transfected with the two vectors. After incubation to allow for vector expression, samples were stimulated by periodic pulsed blue light from an array of 488 nm LEDs. Unstimulated co-transfected samples and samples transfected only with the fluorescent reporter YFP were used as controls. At the end of each experiment, mRNA was purified from the samples analyzed via qPCR.
[0209] Truncated versions of cryptochrome-2 and CIB1 were cloned and tested in combination with the full-length versions of cryptochrome-2 and CIB1 in order to determine the effectiveness of each heterodimer pair. The combination of the CRY2PHR domain, consisting of the conserved photoresponsive region of the cryptochrome-2 protein, and the full-length version of CIB1 resulted in the highest upregulation of Neurog2 mRNA levels (˜22 fold over YFP samples and ˜7 fold over unstimulated co-transfected samples). The combination of full-length cryptochrome-2 (CRY2) with full-length CIB1 resulted in a lower absolute activation level (˜4.6 fold over YFP), but also a lower baseline activation (˜1.6 fold over YFP for unstimulated co-transfected samples). These cryptochrome protein pairings may be selected for particular uses depending on absolute level of induction required and the necessity to minimize baseline "leakiness" of the LITE system.
[0210] Speed of activation and reversibility are critical design parameters for the LITE system. To characterize the kinetics of the LITE system, constructs consisting of the Neurog2 TALE-CRY2PHR and CIB1-VP64 version of the system were tested to determine its activation and inactivation speed. Samples were stimulated for as little as 0.5 h to as long as 24 h before extraction. Upregulation of Neurog2 expression was observed at the shortest, 0.5 h, time point (˜5 fold vs YFP samples). Neurog2 expression peaked at 12 h of stimulation (˜19 fold vs YFP samples). Inactivation kinetics were analyzed by stimulating co-transfected samples for 6 h, at which time stimulation was stopped, and samples were kept in culture for 0 to 12 h to allow for mRNA degradation. Neurog2 mRNA levels peaked at 0.5 h after the end of stimulation (˜16 fold vs. YFP samples), after which the levels degraded with an ˜3 h half-life before returning to near baseline levels by 12 h.
[0211] The second prototypical example is a LITE designed to activate transcription of the human gene KLF4. The sequence TTCTTACTTATAAC (SEQ ID NO: 167), located in the upstream promoter region of human KLF4, was selected as the target and a TALE was designed and synthesized to match this sequence. The TALE sequence was linked to the sequence for CRY2PHR via a nuclear localization signal (amino acids: SPKKKRKVEAS; SEQ ID NO: 150). The identical CIB1-VP64 activator protein described above was also used in this manifestation of the LITE system. Human embryonal kidney cells from the HEK293FT cell line were co-transfected with the two vectors. After incubation to allow for vector expression, samples were stimulated by periodic pulsed blue light from an array of 488 nm LEDs. Unstimulated co-transfected samples and samples transfected only with the fluorescent reporter YFP were used as controls. At the end of each experiment, mRNA was purified from the samples analyzed via qPCR.
[0212] The light-intensity response of the LITE system was tested by stimulating samples with increased light power (0-9 mW/cm2). Upregulation of KLF4 mRNA levels was observed for stimulation as low as 0.2 mW/cm2. KLF4 upregulation became saturated at 5 mW/cm2 (2.3 fold vs. YFP samples). Cell viability tests were also performed for powers up to 9 mW/cm2 and showed >98% cell viability. Similarly, the KLF4 LITE response to varying duty cycles of stimulation was tested (1.6-100%). No difference in KLF4 activation was observed between different duty cycles indicating that a stimulation paradigm of as low as 0.25 sec every 15 sec should result in maximal activation.
[0213] There are potential applications for which LITEs represent an advantageous choice for gene expression control. There exist a number of in vitro applications for which LITEs are particularly attractive. In all these cases, LITEs have the advantage of inducing endogenous gene expression with the potential for correct splice variant expression.
[0214] Because LITE activation is photoinducible, spatially defined light patterns, created via masking or rasterized laser scanning, may be used to alter expression levels in a confined subset of cells. For example, by overexpressing or silencing an intercellular signaling molecule only in a spatially constrained set of cells, the response of nearby cells relative to their distance from the stimulation site may help elucidate the spatial characteristics of cell non-autonomous processes. Additionally, recent advances in cell reprogramming biology have shown that overexpression of sets of transcription factors may be utilized to transform one cell type, such as fibroblasts, into another cell type, such as neurons or cardiomyocytes. Further, the correct spatial distribution of cell types within tissues is critical for proper organotypic function. Overexpression of reprogramming factors using LITEs may be employed to reprogram multiple cell lineages in a spatially precise manner for tissue engineering applications.
[0215] The rapid transcriptional response and endogenous targeting of LITEs make for an ideal system for the study of transcriptional dynamics. For example, LITEs may be used to study the dynamics of mRNA splice variant production upon induced expression of a target gene. On the other end of the transcription cycle, mRNA degradation studies are often performed in response to a strong extracellular stimulus, causing expression level changes in a plethora of genes. LITEs may be utilized to reversibly induce transcription of an endogenous target, after which point stimulation may be stopped and the degradation kinetics of the unique target may be tracked.
[0216] The temporal precision of LITEs may provide the power to time genetic regulation in concert with experimental interventions. For example, targets with suspected involvement in long-term potentiation (LTP) may be modulated in organotypic or dissociated neuronal cultures, but only during stimulus to induce LTP, so as to avoid interfering with the normal development of the cells. Similarly, in cellular models exhibiting disease phenotypes, targets suspected to be involved in the effectiveness of a particular therapy may be modulated only during treatment. Conversely, genetic targets may be modulated only during a pathological stimulus. Any number of experiments in which timing of genetic cues to external experimental stimuli is of relevance may potentially benefit from the utility of LITE modulation.
[0217] The in vivo context offers equally rich opportunities for the use of LITEs to control gene expression. As mentioned above, photoinducibility provides the potential for previously unachievable spatial precision. Taking advantage of the development of optrode technology, a stimulating fiber optic lead may be placed in a precise brain region. Stimulation region size may then be tuned by light intensity. This may be done in conjunction with the delivery of LITEs via viral vectors, or, if transgenic LITE animals were to be made available, may eliminate the use of viruses while still allowing for the modulation of gene expression in precise brain regions. LITEs may be used in a transparent organism, such as an immobilized zebrafish, to allow for extremely precise laser induced local gene expression changes.
[0218] LITEs may also offer valuable temporal precision in vivo. LITEs may be used to alter gene expression during a particular stage of development, for example, by repressing a particular apoptosis gene only during a particular stage of C elegans growth. LITEs may be used to time a genetic cue to a particular experimental window. For example, genes implicated in learning may be overexpressed or repressed only during the learning stimulus in a precise region of the intact rodent or primate brain. Further, LITEs may be used to induce gene expression changes only during particular stages of disease development. For example, an oncogene may be overexpressed only once a tumor reaches a particular size or metastatic stage. Conversely, proteins suspected in the development of Alzheimer's may be knocked down only at defined time points in the animal's life and within a particular brain region. Although these examples do not exhaustively list the potential applications of the LITE system, they highlight some of the areas in which LITEs may be a powerful technology.
Example 3
Development of Mammalian TALE ToolBox
[0219] Customized TALEs may be used for a wide variety of genome engineering applications, including transcriptional modulation and genome editing. Here, Applicants describe a toolbox for rapid construction of custom TALE transcription factors (TALE-TFs) and nucleases (TALENs) using a hierarchical ligation procedure. This toolbox facilitates affordable and rapid construction of custom TALE-TFs and TALENs within 1 week and may be easily scaled up to construct TALEs for multiple targets in parallel. Applicants also provide details for testing the activity in mammalian cells of custom TALE-TFs and TALENs using quantitative reverse-transcription PCR and Surveyor nuclease, respectively. The TALE toolbox will enable a broad range of biological applications.
[0220] TALEs are natural bacterial effector proteins used by Xanthomonas sp. to modulate gene transcription in host plants to facilitate bacterial colonization (7, 8). The central region of the protein contains tandem repeats of 34-aa sequences (termed monomers; e.g., SEQ ID NO: 1) that are required for DNA recognition and binding (9, 10, 11, 12) (FIG. 8). Naturally occurring TALEs have been found to have a variable number of monomers, ranging from 1.5 to 33.5 (7). Although the sequence of each monomer is highly conserved, they differ primarily in two positions termed the repeat variable diresidues (RVDs, 12th and 13th positions). Recent reports have found that the identity of these two residues determines the nucleotide-binding specificity of each TALE repeat and that a simple cipher specifies the target base of each RVD (NI=A, HD=C, NG=T, NN=G or A) (1, 2). Thus, each monomer targets one nucleotide and the linear sequence of monomers in a TALE specifies the target DNA sequence in the 5' to 3' orientation. The natural TALE-binding sites within plant genomes always begin with a thymine (1, 2), which is presumably specified by a cryptic signal within the nonrepetitive N terminus of TALEs. The tandem repeat DNA-binding domain always ends with a half-length repeat (0.5 repeat, FIG. 8). Therefore, the length of the DNA sequence being targeted is equal to the number of full repeat monomers plus two.
[0221] Applicants have further improved the TALE assembly system with a few optimizations, including maximizing the dissimilarity of ligation adaptors to minimize misligations and combining separate digest and ligation steps into single Golden Gate (13, 14, 15) reactions. Briefly, each nucleotide-specific monomer sequence is amplified with ligation adaptors that uniquely specify the monomer position within the TALE tandem repeats. Once this monomer library is produced, it may conveniently be reused for the assembly of many TALEs. For each TALE desired, the appropriate monomers are first ligated into hexamers, which are then amplified via PCR. Then, a second Golden Gate digestion-ligation with the appropriate TALE cloning backbone (FIG. 8) yields a fully assembled, sequence-specific TALE. The backbone contains a ccdB negative selection cassette flanked by the TALE N and C termini, which is replaced by the tandem repeat DNA-binding domain when the TALE has been successfully constructed. ccdB selects against cells transformed with an empty backbone, thereby yielding clones with tandem repeats inserted (5).
[0222] Assemblies of monomeric DNA-binding domains may be inserted into the appropriate TALE-TF or TALEN cloning backbones to construct customized TALE-TFs and TALENs. TALE-TFs are constructed by replacing the natural activation domain within the TALE C terminus with the synthetic transcription activation domain VP64 (3; FIG. 8).
REFERENCES
[0223] 1. Boch, J. et al. Breaking the code of DNA binding specificity of TAL-type III effectors. Science 326, 1509-1512 (2009).
[0224] 2. Moscou, M. J. & Bogdanove, A. J. A simple cipher governs DNA recognition by TAL effectors. Science 326, 1501 (2009).
[0225] 3. Zhang, F. et al. Efficient construction of sequence-specific TAL effectors for modulating mammalian transcription. Nat. Biotechnol. 29, 149-153 (2011).
[0226] 4. Miller, J. C. et al. A TALE nuclease architecture for efficient genome editing. Nat. Biotechnol. 29, 143-148 (2011).
[0227] 5. Cermak, T. et al. Efficient design and assembly of custom TALEN and other TAL effector-based constructs for DNA targeting. Nucleic Acids Res. 39, e82 (2011).
[0228] 6. Hockemeyer, D. et al. Genetic engineering of human pluripotent cells using TALE nucleases. Nat. Biotechnol. 29, 731-734 (2011).
[0229] 7. Boch, J. & Bonas, U. Xanthomonas AvrBs3 family-type III effectors: discovery and function. Annu. Rev. Phytopathol. 48, 419-436 (2010).
[0230] 8. Bogdanove, A. J., Schornack, S. & Lahaye, T. TAL effectors: finding plant genes for disease and defense. Curr. Opin. Plant Biol. 13, 394-401 (2010).
[0231] 9. Romer, P. et al. Plant pathogen recognition mediated by promoter activation of the pepper Bs3 resistance gene. Science 318, 645-648 (2007).
[0232] 10. Kay, S., Hahn, S., Marois, E., Hause, G. & Bonas, U. A bacterial effector acts as a plant transcription factor and induces a cell size regulator. Science 318, 648-651 (2007).
[0233] 11. Kay, S., Hahn, S., Marois, E., Wieduwild, R. & Bonas, U. Detailed analysis of the DNA recognition motifs of the Xanthomonas type III effectors AvrBs3 and AvrBs3Deltarep16. Plant J. 59, 859-871 (2009).
[0234] 12. Romer, P. et al. Recognition of AvrBs3-like proteins is mediated by specific binding to promoters of matching pepper Bs3 alleles. Plant Physiol. 150, 1697-1712 (2009).
[0235] 13. Engler, C., Kandzia, R. & Marillonnet, S. A one pot, one step, precision cloning method with high throughput capability. PLoS ONE 3, e3647 (2008).
[0236] 14. Engler, C., Gruetzner, R., Kandzia, R. & Marillonnet, S. Golden gate shuffling: a one-pot DNA shuffling method based on type IIs restriction enzymes. PLoS ONE 4, e5553 (2009).
[0237] 15. Weber, E., Engler, C., Gruetzner, R., Werner, S. & Marillonnet, S. A modular cloning system for standardized assembly of multigene constructs. PLoS ONE 6, e16765 (2011).
[0238] 16. Huertas, P. DNA resection in eukaryotes: deciding how to fix the break. Nat. Struct. Mol. Biol. 17, 11-16 (2010).
Example 4
[0239] FIG. 17 depicts an effect of cryptochrome2 heterodimer orientation on LITE functionality. Two versions of the Neurogenin 2 (Neurog2) LITE were synthesized to investigate the effects of cryptochrome 2 photolyase homology region (CRY2PHR)/calcium and integrin-binding protein 1 (CIB1) dimer orientation. In one version, the CIB1 domain was fused to the C-terminus of the TALE (Neurog2) domain, while the CRY2PHR domain was fused to the N-terminus of the VP64 domain. In the converse version, the CRY2PHR domain was fused to the C-terminus of the TALE (Neurog2) domain, while the CIB1 domain was fused to the N-terminus of the VP64 domain. Each set of plasmids were transfected in Neuro2a cells and stimulated (466 nm, 5 mW/cm2, 1 sec pulse per 15 sec, 12 h) before harvesting for qPCR analysis. Stimulated LITE and unstimulated LITE Neurog2 expression levels were normalized to Neurog2 levels from stimulated GFP control samples. The TALE-CRY2PHR/CIB1-VP64 LITE exhibited elevated basal activity and higher light induced Neurog2 expression, and suggested its suitability for situations in which higher absolute activation is required. Although the relative light inducible activity of the TALE-CIB1/CRY2PHR-VP64 LITE was lower that its counterpart, the lower basal activity suggested its utility in applications requiring minimal baseline activation. Further, the TALE-CIB1 construct was smaller in size, compared to the TALE-CRY2PHR construct, a potential advantage for applications such as viral packaging.
[0240] FIG. 18 depicts metabotropic glutamate receptor 2 (mGlur2) LITE activity in mouse cortical neuron culture. A mGluR2 targeting LITE was constructed via the plasmids pAAV-human Synapsin I promoter (hSyn)-HA-TALE(mGluR2)-CIB1 and pAAV-hSyn-CRY2PHR-VP64-2A-GFP. These fusion constructs were then packaged into adeno associated viral vectors (AAV). Additionally, AAV carrying hSyn-TALE-VP64-2A-GFP and GFP only were produced. Embryonic mouse (E16) cortical cultures were plated on Poly-L-lysine coated 24 well plates. After 5 days in vitro neural cultures were co-transduced with a mixture of TALE(mGluR2)-CIB1 and CRY2PHR-VP64 AAV stocks. Control samples were transduced with either TALE(mGluR2)-VP64 AAV or GFP AAV. 6 days after AAV transduction, experimental samples were stimulated using either of two light pulsing paradigms: 0.5 s per min and 0.25 sec per 30 sec. Neurons were stimulated for 24 h and harvested for qPCR analysis. All mGluR2 expression levels were normalized to the respective stimulated GFP control. The data suggested that the LITE system could be used to induce the light-dependent activation of a target gene in primary neuron cultures in vitro.
[0241] FIG. 19 depicts transduction of primary mouse neurons with LITE AAV vectors. Primary mouse cortical neuron cultures were co-transduced at 5 days in vitro with AAV vectors encoding hSyn-CRY2PHR-VP64-2A-GFP and hSyn-HA-TALE-CIB1, the two components of the LITE system. Left panel: at 6 days after transduction, neural cultures exhibited high expression of GFP from the hSyn-CRY2PHR-VP64-2A-GFP vector. Right panel: Co-transduced neuron cultures were fixed and stained with an antibody specific to the HA epitope on the N-terminus of the TALE domain in hSyn-HA-TALE-CIB1. Red signal indicated HA expression, with particularly strong nuclear signal (DNA stained by DAPI in blue channel). Together these images suggested that the expression of each LITE component could be achieved in primary mouse neuron cultures. (scale bars=50 um).
[0242] FIG. 20 depicts expression of a LITE component in vivo. An AAV vector of serotype 1/2 carrying hSyn-CRY2PHR-VP64 was produced via transfection of HEK293FT cells and purified via heparin column binding. The vector was concentrated for injection into the intact mouse brain. 1 uL of purified AAV stock was injected into the hippocampus and infralimbic cortex of an 8 week old male C57BL/6 mouse by steroeotaxic surgery and injection. 7 days after in vivo transduction, the mouse was euthanized and the brain tissue was fixed by paraformaldehyde perfusion. Slices of the brain were prepared on a vibratome and mounted for imaging. Strong and widespread GFP signals in the hippocampus and infralimbic cortex suggested efficient transduction and high expression of the LITE component CRY2PHR-VP64.
Example 5
Multiplex Genome Engineering Using CRISPR/Cas Systems
[0243] Functional elucidation of causal genetic variants and elements requires precise genome editing technologies. The type II prokaryotic CRISPR (clustered regularly interspaced short palindromic repeats) adaptive immune system has been shown to facilitate RNA-guided site-specific DNA cleavage. Applicants engineered two different type II CRISPR systems and demonstrate that Cas9 nucleases can be directed by short RNAs to induce precise cleavage at endogenous genomic loci in human and mouse cells. Cas9 can also be converted into a nicking enzyme to facilitate homology-directed repair with minimal mutagenic activity. Finally, multiple guide sequences can be encoded into a single CRISPR array to enable simultaneous editing of several sites within the mammalian genome, demonstrating easy programmability and wide applicability of the CRISPR technology.
[0244] Prokaryotic CRISPR adaptive immune systems can be reconstituted and engineered to mediate multiplex genome editing in eukaryote cells, advantageously mammalian cells.
[0245] Precise and efficient genome targeting technologies are needed to enable systematic reverse engineering of causal genetic variations by allowing selective perturbation of individual genetic elements. Although genome-editing technologies such as designer zinc fingers (ZFs) (1-4), transcription activator-like effectors (TALEs) (4-10), and homing meganucleases (11) have begun to enable targeted genome modifications, there remains a need for new technologies that are scalable, affordable, and easy to engineer. Here, Applicants report the development of a new class of precision genome engineering tools based on the RNA-guided Cas9 nuclease (12-14) from the type II prokaryotic CRISPR adaptive immune system (15-18).
[0246] The Streptococcus pyogenes SF370 type II CRISPR locus consists of four genes, including the Cas9 nuclease, as well as two non-coding RNAs: tracrRNA and a pre-crRNA array containing nuclease guide sequences (spacers) interspaced by identical direct repeats (DRs) (FIG. 27) (19). Applicants sought to harness this prokaryotic RNA-programmable nuclease system to introduce targeted double stranded breaks (DSBs) in mammalian chromosomes through heterologous expression of the key components. It has been previously shown that expression of tracrRNA, pre-crRNA, host factor RNase III, and Cas9 nuclease are necessary and sufficient for cleavage of DNA in vitro (12, 13) and in prokaryotic cells (20, 21). Applicants codon optimized the S. pyogenes Cas9 (SpCas9) and RNase III (SpRNase III) and attached nuclear localization signals (NLS) to ensure nuclear compartmentalization in mammalian cells. Expression of these constructs in human 293FT cells revealed that two NLSs are required for targeting SpCas9 to the nucleus (FIG. 23A). To reconstitute the non-coding RNA components of CRISPR, Applicants expressed an 89-nucleotide (nt) tracrRNA (FIG. 28) under the RNA polymerase III U6 promoter (FIG. 23B). Similarly, Applicants used the U6 promoter to drive the expression of a pre-crRNA array comprising a single guide spacer flanked by DRs (FIG. 23B). Applicants designed an initial spacer to target a 30-basepair (bp) site (protospacer) in the human EMX1 locus that precedes an NGG, the requisite protospacer adjacent motif (PAM) (FIG. 23C and FIG. 27) (22, 23).
[0247] To test whether heterologous expression of the CRISPR system (SpCas9, SpRNase III, tracrRNA, and pre-crRNA) can achieve targeted cleavage of mammalian chromosomes, Applicants transfected 293FT cells with different combinations of CRISPR components. Since DSBs in mammalian DNA are partially repaired by the indel-forming non-homologous end joining (NHEJ) pathway, Applicants used the SURVEYOR assay to detect endogenous target cleavage (FIG. 23D). Co-transfection of all four required CRISPR components resulted in efficient cleavage of the protospacer (FIG. 23D), which is subsequently verified by Sanger sequencing (FIG. 23E). Removing any of the remaining RNA or Cas9 components abolished the genome cleavage activity of the CRISPR system (FIG. 23D). These results define a minimal three-component system for efficient CRISPR-mediated genome modification in mammalian cells.
Example 6
Optical Control of Endogenous Mammalian Transcription
[0248] The ability to directly modulate transcription of the endogenous mammalian genome is critical for elucidating normal gene function and disease mechanisms. Here, Applicants describe the development of Light-Inducible Transcriptional Effectors (LITEs), a two-component system integrating the customizable TALE DNA-binding domain with the light-sensitive cryptochrome 2 protein and its interacting partner CIB1 from Arabidopsis thaliana. LITEs can be engineered and delivered to mediate positive and negative regulation of endogenous mammalian gene expression in a reversible manner, and changes in mRNA levels occur within minutes after optical illumination. Applicants have applied this system in cell lines, primary mouse neurons, as well as in the brain of awake, behaving mice in vivo.
[0249] An ideal optogenetic approach for controlling endogenous gene transcription would be readily generalizable to target any gene locus, would not require manipulation of the endogenous genomic sequence, would not depend on the addition of exogenous chemical co-factors, and would exhibit fast and reversible kinetics. The DNA-binding domain of transcription activator-like effectors (TALEs) (13, 14) from Xanthomonas sp. can be easily customized to bind specific DNA sequences in mammalian cells (15-17). TALE DNA-binding domains are modular and can be fused with a variety of effector domains, including nucleases, transcriptional activators, and transcriptional repressors to edit or modulate endogenous mammalian genomic loci (15-18). Applicants sought to combine TALEs with light-sensitive proteins to create a suite of tools for enabling spatiotemporally precise control of endogenous gene transcription.
[0250] Here, Applicants report the development of Light-Inducible Transcriptional Effectors (LITEs), a two-component system integrating the customizable TALE DNA-binding domain with the light-sensitive cryptochrome 2 protein and its interacting partner CIB1 from Arabidopsis thaliana (8, 19). LITEs can be engineered to mediate positive and negative regulation of endogenous mammalian gene expression in a reversible manner, and changes in transcript levels occur within minutes after stimulation. Like other optogenetic tools, LITEs can be packaged into viral vectors and genetically targeted to probe gene function within specific cell populations. Applicants demonstrate the application of this system in primary neurons as well as in the mouse brain in vivo.
[0251] In the design of the LITE system, Applicants sought to use light-inducible heterodimeric proteins to mediate the recruitment of transcriptional effector domains to a TALE targeted to an endogenous genomic locus. While several plant-based light-sensitive proteins have been developed for mammalian applications, some suffer from slow or irreversible kinetics while others depend on the supplementation of exogenous co-factors that are not present in mammalian cells (5, 6, 9). The Arabidopsis thaliana cryptochrome 2 (CRY2) was previously shown to employ flavin adenine dinucleotide--an abundant biomolecule in mammalian cells--as its light-sensing chromophore19. The flavin chromophore is reduced upon photoexcitation with blue light (peak ˜450 nm), triggering a conformational change in CRY2 that allows dimerization with its interacting protein partner CIB119. The dimerization between CRY2 and CIB1 occurs within seconds and is reversible within a few minutes following withdrawal of light illumination8. Based on these properties, Applicants selected CRY2 and CIB1 as light-sensing components for constructing LITEs.
[0252] Manipulating endogenous gene expression presents various challenges, as the rate of expression depends on many factors, including regulatory elements, mRNA processing, and transcript stability (22, 23). Applicants sought to investigate the feasibility of using the system to modulate endogenous gene expression in primary neurons and the intact brain. To this end, Applicants pursued viral transduction as an effective method for TALE and LITE gene delivery into neurons. However, lentiviral delivery can compromise TALE integrity due to recombination of the tandem repeat DNA-binding domains during reverse transcription (26). To overcome this challenge, Applicants developed an adeno-associated virus (AAV)-based vector for the delivery of TALE genes and efficient process for AAV production (FIGS. 37A-B, FIG. 42, and Example 7). AAV has an ssDNA-based genome and is therefore less susceptible to recombination (27-29).
[0253] AAV1/2 (serotype AAV1/2, i.e., hybrid or mosaic AAV1/AAV2 capsid AAV) heparin purified concentrated virus protocol
[0254] Media: D10+HEPES
500 ml bottle DMEM high glucose+Glutamax (GIBCO) 50 ml Hyclone FBS (heat-inactivated) (Thermo Fischer) 5.5 ml HEPES solution (1M, GIBCO) Cells: low passage HEK293FT (passage <10 at time of virus production, thaw new cells of passage 2-4 for virus production, grow up for 3-5 passages)
[0255] Transfection Reagent: Polyethylenimine (PEI) "Max"
Dissolve 50 mg PEI "Max" in 50 ml sterile Ultrapure H2O
Adjust pH to 7.1
[0256] Filter with 0.22 um fliptop filter Seal tube and wrap with parafilm Freeze aliquots at -20° C. (for storage, can also be used immediately)
[0257] Cell Culture
Culture low passage HEK293FT in D10+HEPES Passage everyday between 1:2 and 1:2.5 Advantageously do not allow cells to reach more than 85% confluency
[0258] For T75
[0259] Warm 10 ml HBSS (--Mg2+, --Ca2+, GIBCO)+1 ml TrypLE Express (GIBCO) per flask to 37° C. (Waterbath)
[0260] Aspirate media fully
[0261] Add 10 ml warm HBSS gently (to wash out media completely)
[0262] Add 1 ml TrypLE per Flask
[0263] Place flask in incubator (37° C.) for 1 min
[0264] Rock flask to detach cells
[0265] Add 9 ml D10+HEPES media (37° C.)
[0266] Pipette up and down 5 times to generate single cell suspension
[0267] Split at 1:2-1:2.5 (12 ml media for T75) ratio (if cells are growing more slowly, discard and thaw a new batch, they are not in optimal growth)
[0268] transfer to T225 as soon as enough cells are present (for ease of handling large amounts of cells)
[0269] AAV Production (5*15 cm Dish Scale Per Construct):
Plate 10 million cells in 21.5 ml media into a 15 cm dish Incubate for 18-22 hours at 37° C. Transfection is ideal at 80% confluence
[0270] Per Plate
Prewarm 22 ml media (D10+HEPES) Prepare Tube with DNA Mixture (Use Endofree Maxiprep DNA): 5.2 ug vector of interest plasmid 4.35 ug AAV 1 serotype plasmid 4.35 ug AAV 2 serotype plasmid 10.4 ug pDF6 plasmid (adenovirus helper genes)
→Vortex to mix
[0271] Add 434 uL DMEM (no serum!) Add 130 ul PEI solution Vortex 5-10 seconds Add DNA/DMEM/PEI mixture to prewarmed media →Vortex briefly to mix Replace media in 15 cm dish with DNA/DMEM/PEI mixture →Return to 37° C. incubator →Incubate 48 h before harvesting (make sure medium isn't turning too acidic)
[0272] Virus Harvest:
1. aspirate media carefully from 15 cm dish dishes (advantageously do not dislodge cells) 2. Add 25 ml RT DPBS (Invitrogen) to each plate and gently remove cells with a cell scraper. Collect suspension in 50 ml tubes. 3. Pellet cells at 800×g for 10 minutes. 4. Discard supernatant →pause point: freeze cell pellet at -80 C if desired 5. resuspend pellet in 150 mM NaCl, 20 mM Tris pH 8.0, use 10 ml per tissue culture plate. 6. Prepare a fresh solution of 10% sodium deoxycholate in dH2O. Add 1.25 ml of this per tissue culture plate for a final concentration of 0.5%. Add benzonase nuclease to a final concentration of 50 units per ml. Mix tube thoroughly. 7. Incubate at 37° C. for 1 hour (Waterbath). 8. Remove cellular debris by centrifuging at 3000×g for 15 mins. Transfer to fresh 50 ml tube and ensure all cell debris has been removed to prevent blocking of heparin columns.
[0273] Heparin Column Purification of AAV1/2:
1. Set up HiTrap heparin columns using a peristaltic pump so that solutions flow through the column at 1 ml per minute. It is important to ensure no air bubbles are introduced into the heparin column. 2. Equilibrate the column with 10 ml 150 mM NaCl, 20 mM Tris, pH 8.0 using the peristaltic pump. 3. Binding of virus: Apply 50 ml virus solution to column and allow to flow through. 4. Wash step 1: column with 20 ml 100 mM NaCl, 20 mM Tris, pH 8.0. (using the peristaltic pump) 5. Wash step 2: Using a 3 ml or 5 ml syringe continue to wash the column with 1 ml 200 mM NaCl, 20 mM Tris, pH 8.0, followed by 1 ml 300 mM NaCl, 20 mM Tris, pH 8.0. →Discard the flow-through. (prepare the syringes with different buffers during the 50 min flow through of virus solution above) 6. Elution Using 5 ml syringes and gentle pressure (flow rate of <1 ml/min) elute the virus from the column by applying:
1.5 ml 400 mM NaCl, 20 mM Tris, pH 8.0
3.0 ml 450 mM NaCl, 20 mM Tris, pH 8.0
1.5 ml 500 mM NaCl, 20 mM Tris, pH 8.0
[0274] Collect these in a 15 ml centrifuge tube.
[0275] Concentration of AAV1/2:
1. Concentration step 1: Concentrate the eluted virus using Amicon ultra 15 ml centrifugal filter units with a 100,000 molecular weight cutoff. Load column eluate into the concentrator and centrifuge at 2000×g for 2 minutes (at room temperature. Check concentrated volume--it should be approximately 500 μl. If necessary, centrifuge in 1 min intervals until correct volume is reached. 2. buffer exchange: Add 1 ml sterile DPBS to filter unit, centrifuge in 1 min intervals until correct volume (500 ul) is reached. 3. Concentration step 2: Add 500 ul concentrate to an Amicon Ultra 0.5 ml 100K filter unit. Centrifuge at 6000 g for 2 min. Check concentrated volume--it should be approximately 100 μl. If necessary, centrifuge in 1 min intervals until correct volume is reached. 4. Recovery: Invert filter insert and insert into fresh collection tube. Centrifuge at 1000 g for 2 min. →Aliquot and freeze at -80° C. →1 ul is typically required per injection site, small aliquots (e.g. 5 ul) are therefore recommended (avoid freeze-thaw of virus). →determine DNaseI-resistant GC particle titer using qPCR (see separate protocol)
[0276] Materials
Amicon Ultra, 0.5 ml, 100K; MILLIPORE; UFC510024
Amicon Ultra, 15 ml, 100K; MILLIPORE; UFC910024
[0277] Benzonase nuclease; Sigma-Aldrich, E1014 HiTrap Heparin cartridge; Sigma-Aldrich; 54836 Sodium deoxycholate; Sigma-Aldrich; D5670
[0278] AAV1 Supernatant Production Protocol
Media: D10+HEPES
[0279] 500 ml bottle DMEM high glucose+Glutamax (Invitrogen) 50 ml Hyclone FBS (heat-inactivated) (Thermo Fischer) 5.5 ml HEPES solution (1M, GIBCO)
[0280] Cells: low passage HEK293FT (passage <10 at time of virus production)
Thaw new cells of passage 2-4 for virus production, grow up for 2-5 passages Transfection reagent: Polyethylenimine (PEI) "Max" Dissolve 50 mg PEI "Max" in 50 ml sterile Ultrapure H2O
Adjust pH to 7.1
[0281] Filter with 0.22 um fliptop filter Seal tube and wrap with parafilm Freeze aliquots at -20° C. (for storage, can also be used immediately)
[0282] Cell Culture
Culture low passage HEK293FT in D10+HEPES Passage everyday between 1:2 and 1:2.5 Advantageously do let cells reach more than 85% confluency
For T75
[0283] Warm 10 ml HBSS (--Mg2+, --Ca2+, GIBCO)+1 ml TrypLE Express (GIBCO) per flask to 37° C. (Waterbath)
[0284] Aspirate media fully
[0285] Add 10 ml warm HBSS gently (to wash out media completely)
[0286] Add 1 ml TrypLE per Flask
[0287] Place flask in incubator (37° C.) for 1 min
[0288] Rock flask to detach cells
[0289] Add 9 ml D10+HEPES media (37° C.)
[0290] Pipette up and down 5 times to generate single cell suspension
[0291] Split at 1:2-1:2.5 (12 ml media for T75) ratio (if cells are growing more slowly, discard and thaw a new batch, they are not in optimal growth)
[0292] transfer to T225 as soon as enough cells are present (for ease of handling large amounts of cells)
[0293] AAV Production (Single 15 cm Dish Scale)
[0294] Plate 10 million cells in 21.5 ml media into a 15 cm dish
[0295] Incubate for 18-22 hours at 37° C.
[0296] Transfection is ideal at 80% confluence per plate
[0297] Prewarm 22 ml media (D10+HEPES)
[0298] Prepare tube with DNA mixture (use endofree maxiprep DNA):
[0299] 5.2 ug vector of interest plasmid
[0300] 8.7 ug AAV 1 serotype plasmid
[0301] 10.4 ug DF6 plasmid (adenovirus helper genes)
[0302] Vortex to mix
[0303] Add 434 uL DMEM (no serum!)
[0304] Add 130 ul PEI solution
[0305] Vortex 5-10 seconds
[0306] Add DNA/DMEM/PEI mixture to prewarmed media
[0307] Vortex briefly to mix
[0308] Replace media in 15 cm dish with DNA/DMEM/PEI mixture
[0309] Return to 37° C. incubator
[0310] Incubate 48 h before harvesting (advantageously monitor to ensure medium is not turning too acidic)
[0311] Virus Harvest:
[0312] Remove supernatant from 15 cm dish
[0313] Filter with 0.45 um filter (low protein binding) Aliquot and freeze at -80° C.
[0314] Transduction (primary neuron cultures in 24-well format, 5DIV)
[0315] Replace complete neurobasal media in each well of neurons to be transduced with fresh neurobasal (usually 400 ul out of 500 ul per well is replaced)
[0316] Thaw AAV supernatant in 37° C. waterbath
[0317] Let equilibrate in incubator for 30 min
[0318] Add 250 ul AAV supernatant to each well
[0319] Incubate 24 h at 37° C.
[0320] Remove media/supernatant and replace with fresh complete neurobasal
[0321] Expression starts to be visible after 48 h, saturates around 6-7 Days Post Infection
[0322] Constructs for pAAV plasmid with GOI should not exceed 4.8 kb including both ITRS
[0323] AAV Supernatant Production
[0324] HEK 293FT cells (Life Technologies) were grown in antibiotic-free D10 media (DMEM high glucose with GlutaMax and Sodium Pyruvate, 10% heat-inactivated Hyclone FBS, and 1% 1M HEPES) and passaged daily at 1:2-2.5. The total number of passages was kept below 10 and cells were never grown beyond 85% confluence. The day before transfection, 1×106 cells in 21.5 mL of D10 media were plated onto 15 cm dishes and incubated for 18-22 hours or until ˜80% confluence. For use as a transfection reagent, 1 mg/mL of PEI "Max" (Polysciences) was dissolved in water and the pH of the solution was adjusted to 7.1. For AAV production, 10.4 μg of pDF6 helper plasmid, 8.7 μg of pAAV1 serotype packaging vector, and 5.2 μg of pAAV vector carrying the gene of interest were added to 434 μL of serum-free DMEM and 1304, of PEI "Max" solution was added to the DMEM-diluted DNA mixture. The DNA/DMEM/PEI cocktail was vortexed and incubated at room temperature for 15 min. After incubation, the transfection mixture was added to 22 mL of complete media, vortexed briefly, and used to replace the media for a 15 cm dish of 293FT cells. For supernatant production, transfection supernatant was harvested at 48 hours, filtered through a 0.45 micron PVDF filter (Millipore), distributed into aliquots, and frozen for storage at -80° C.
[0325] To test the efficacy of AAV-mediated TALE delivery for modulating transcription in primary mouse cortical neurons, Applicants constructed six TALE-DNA binding domains targeting the genetic loci of three mouse neurotransmitter receptors: Grm5, Grin2a, and Grm2, which encode mGluR5, NMDA subunit 2A and mGluR2, respectively (FIG. 37C). To increase the likelihood of a target site accessibility, Applicants used mouse cortex DNase I sensitivity data from the UCSC genome browser to identify putative open chromatin regions. DNase I sensitive regions in the promoter of each target gene provided a guide for the selection of TALE binding sequences (FIG. 43). For each TALE, Applicants employed VP64 as a transcriptional activator or a quadruple tandem repeat of the mSin3 interaction domain (SID) (20, 30) as a repressor. Applicants have previously shown that a single SID fused to TALE downregulated a target gene effectively in 293FT cells (18). Hoping to further improve this TALE repressor, Applicants reasoned that four repeats of SID--analogous to the successful quadruple VP16 repeat architecture of VP64 (20)--might augment its repressive activity. This was indeed the case, as TALE-SID4X constructs enhanced repression ˜2-fold over TALE-SID in 293FT cells (FIG. 44).
[0326] Applicants found that four out of six TALE-VP64 constructs (T1, T2, T5 and T6) efficiently activated their target genes Grm5 and Grm2 in AAV-transduced primary neurons by up to 3- and 8-fold, respectively (FIG. 37C). Similarly, four out of six TALE-SID4X repressors (T9, T10, T11, T12) reduced the expression of their endogenous targets Grin2a and Grm2 by up to 2- and 8-fold, respectively (FIG. 37C). Together, these results indicate that constitutive TALEs can positively or negatively modulate endogenous target gene expression in neurons. Notably, efficient activation or repression by a given TALE did not predict its efficiency at transcriptional modulation in the opposite direction. Therefore, multiple TALEs may need to be screened to identify the most effective TALE for a particular locus.
[0327] As a confirmation of TALE expression and activity in vivo, Applicants performed stereotactic injection of concentrated AAV vectors into the mouse prefrontal cortex. Delivery of constitutive TALE-VP64 AAV vectors resulted in robust TALE expression in the mouse prefrontal cortex (FIG. 37D-E). Tissue punches from the AAV-transduced brain regions showed that a TALE-VP64 targeting the Grm2 gene locus is able to activate mRNA levels by up to 2.5-fold (FIG. 37F).
[0328] In order to deliver LITEs into neurons using AAV, Applicants had to ensure that the total viral genome size, with the LITE transgenes included, did not exceed 4.8 kb31,32. To that end, Applicants shortened the TALE N- and C-termini (keeping 136 aa in the N-terminus and 63 aa in the C-terminus) and exchanged the CRY2PHR and CIB1 domains (TALE-CIB1 and CRY2PHR-VP64; FIG. 38A). This switch allowed each component of LITE to fit into AAV vectors and did not reduce the efficacy of light-mediated transcription modulation (FIG. 45). These LITEs can be efficiently delivered into primary cortical neurons via co-transduction by a combination of two AAV vectors (FIG. 38B; delivery efficiencies of 83-92% for individual components with >80% co-transduction efficiency).
[0329] When implementing a neuron specific light-stimulation protocol, cultured neurons proved to be much more sensitive to blue light than Neuro-2a cells. Stimulation parameters that Applicants previously optimized for Neuro 2a cells (466 nm, 5 mW/cm2 intensity, 7% duty cycle with 1 s light pulse at 0.067 Hz for a total of 24 h) caused >50% toxicity in primary neurons. Applicants therefore tested survival with a lower duty cycle, as Applicants had previously observed that a wide range of duty cycles had little effect on LITE-mediated transcriptional activation (FIG. 40).
[0330] For a neuronal application of LITEs, Applicants selected the Grm2 TALE (T6), which exhibited the strongest level of target upregulation in primary neurons, based on Applicants' comparison of 6 constitutive TALE activators (FIG. 37C). Applicants investigated its function using 2 light pulsing frequencies with the same duty cycle of 0.8%. Both stimulation conditions achieved a ˜7-fold light-dependent increase in Grm2 mRNA levels (FIG. 38C). Further study confirmed that, significant target gene expression increases could be attained quickly (4-fold upregulation within 4 h; FIG. 38D). In addition, Applicants observed significant upregulation of mGluR2 protein after stimulation, demonstrating that changes effected by LITEs at the mRNA level are translated to the protein domain (FIG. 38E). Taken together, these results confirm that LITEs enable temporally precise optical control of endogenous gene expression in neurons.
[0331] As a compliment to Applicants' previously implemented LITE activators, Applicants next engineered a LITE repressor based on the TALE-SID4X constructs. Constitutive Grm2 TALEs (T11 and T12, FIG. 38F) mediated the highest level of transcription repression, and were chosen as LITE repressors (FIG. 38F-G). Both light-induced repressors mediated significant downregulation of Grm2 expression, with 1.95-fold and 1.75-fold reductions for T11 and T12, respectively, demonstrating the feasibility of optically controlled repression in neurons (FIG. 38G).
[0332] Light-mediated control of gene expression would be particularly desirable in vivo. In contrast to current chemically inducible expression systems, LITEs have the potential for finer anatomical localization. Moreover, the kinetics of the system do not depend on drug diffusion, metabolism, or clearance, and stimulation can be achieved without drug-related side effects. To apply the LITE system in vivo, Applicants stereotactically delivered a 1:1 mixture of high concentration AAV vectors (1012 DNAseI resistant particles/mL) carrying the Grm2-targeting T6-CIB1 and CRY2PHR-VP64 LITE components into the infralimbic cortex (ILC) of wildtype C57BL/6N mice. To provide optical stimulation of LITE-expressing neurons in vivo, Applicants also implanted a fiber optic cannula at the injection site (FIG. 38H)33. Neurons in the injection site were efficiently co-transduced by both viruses, with >80% of transduced cells expressing both TALE12-CIB1 and CRY2PHR-VP64 (FIGS. 381 and 48). 8 days post-surgery, Applicants stimulated the ILC by connecting a solid-state 473 nm laser to the implanted fiber cannula. Following a 12 h stimulation period (5 mW, 0.8% duty cycle using 0.5 s light pulses at 0.0167 Hz), brain tissue from the fiber optic cannula implantation site was analyzed (FIG. 38H) for changes in Grm2 mRNA. Applicants observed a significant increase in Grm2 mRNA after light stimulation compared with unstimulated ILC (2.1-fold, p<0.01 vs. 1.3-fold background FIG. 38J), successfully demonstrating the utility of the LITE system for altering gene expression in vivo. This experiment suggests the potential value of LITEs for probing gene functions in the brain.
[0333] The investigation of dynamic transcriptional networks in heterogeneous tissues such as the brain would benefit greatly from spatiotemporally precise in vivo gene regulation. Such a system would allow researchers to ask questions about the role of dynamic gene regulation in processes as diverse as development, learning, memory, and disease progression. LITEs can be used to enable temporally precise, spatially-targeted, and bi-modal control of endogenous gene expression in cell lines, primary neurons, and in the mouse brain in vivo. The TALE DNA binding component of LITEs can be customized to target a wide range of genomic loci. Independently, novel functionalities can be achieved via alteration of the LITE effector domain. This system provides a powerful addition to existing optogenetic platforms, establishing a highly generalizable mode of altering endogenous gene transcription using light. Future work will increase the potency of LITE-mediated transcription modulation, reduce the level of background activity, and expand the range of wavelengths through which LITEs may be controlled. This may be achieved through exploration of other naturally occurring light-sensitive proteins34-37 or through directed evolution38-41 of cryptochrome proteins. Finally, the modular design of the LITE system provides the opportunity for the development of a broad array of light-switchable tools for reverse-engineering genetic and epigenetic functions in a variety of biological systems.
[0334] LITE constructs were transfected into in Neuro 2A cells using GenJetAAV vectors carrying TALE or LITE constructs were used to transduce mouse primary embryonic cortical neurons as well as the mouse brain in vivo. RNA was extracted and reverse transcribed and mRNA levels were measured using TaqMan-based RT-qPCR. Light emitting diodes or solid-state lasers were used for light delivery in tissue culture and in vivo respectively.
REFERENCES
[0335] 1. Deisseroth, K. Optogenetics. Nature methods 8, 26-29 (2011).
[0336] 2. Zhang, F. et al. The microbial opsin family of optogenetic tools. Cell 147, 1446-1457 (2011).
[0337] 3. Yizhar, O., Fenno, L. E., Davidson, T. J., Mogri, M. & Deisseroth, K. Optogenetics in neural systems. Neuron 71, 9-34 (2011).
[0338] 4. Airan, R. D., Thompson, K. R., Fenno, L. E., Bernstein, H. & Deisseroth, K. Temporally precise in vivo control of intracellular signalling. Nature 458, 1025-1029 (2009).
[0339] 5. Levskaya, A., Weiner, O. D., Lim, W. A. & Voigt, C. A. Spatiotemporal control of cell signalling using a light-switchable protein interaction. Nature 461, 997-1001 (2009).
[0340] 6. Yazawa, M., Sadaghiani, A. M., Hsueh, B. & Dolmetsch, R. E. Induction of protein-protein interactions in live cells using light. Nat Biotechnol 27, 941-945 (2009).
[0341] 7. Strickland, D. et al. TULIPs: tunable, light-controlled interacting protein tags for cell biology. Nature methods 9, 379-384 (2012).
[0342] 8. Kennedy, M. J. et al. Rapid blue-light-mediated induction of protein interactions in living cells. Nature methods 7, 973-975 (2010).
[0343] 9. Shimizu-Sato, S., Huq, E., Tepperman, J. M. & Quail, P. H. A light-switchable gene promoter system. Nat Biotechnol 20, 1041-1044 (2002).
[0344] 10. Ye, H., Daoud-El Baba, M., Peng, R. W. & Fussenegger, M. A synthetic optogenetic transcription device enhances blood-glucose homeostasis in mice. Science 332, 1565-1568 (2011).
[0345] 11. Wang, X., Chen, X. & Yang, Y. Spatiotemporal control of gene expression by a light-switchable transgene system. Nature methods 9, 266-269 (2012).
[0346] 12. Polstein, L. R. & Gersbach, C. A. Light-inducible spatiotemporal control of gene activation by customizable zinc finger transcription factors. J Am Chem Soc 134, 16480-16483 (2012).
[0347] 13. Boch, J. et al. Breaking the code of DNA binding specificity of TAL-type III effectors. Science 326, 1509-1512 (2009).
[0348] 14. Moscou, M. J. & Bogdanove, A. J. A simple cipher governs DNA recognition by TAL effectors. Science 326, 1501 (2009).
[0349] 15. Zhang, F. et al. Efficient construction of sequence-specific TAL effectors for modulating mammalian transcription. Nat Biotechnol 29, 149-153 (2011).
[0350] 16. Miller, J. C. et al. A TALE nuclease architecture for efficient genome editing. Nat Biotechnol 29, 143-148 (2011).
[0351] 17. Geissler, R. et al. Transcriptional activators of human genes with programmable DNA-specificity. PLoS One 6, e19509 (2011).
[0352] 18. Cong, L., Zhou, R., Kuo, Y.-c., Cunniff, M. & Zhang, F. Comprehensive interrogation of natural TALE DNA-binding modules and transcriptional repressor domains. Nat Commun 3, 968 (2012).
[0353] 19. Liu, H. et al. Photoexcited CRY2 interacts with CIB1 to regulate transcription and floral initiation in Arabidopsis. Science 322, 1535-1539 (2008).
[0354] 20. Beerli, R. R., Segal, D. J., Dreier, B. & Barbas, C. F., 3rd Toward controlling gene expression at will: specific regulation of the erbB-2/HER-2 promoter by using polydactyl zinc finger proteins constructed from modular building blocks. Proc Natl Acad Sci USA 95, 14628-14633 (1998).
[0355] 21. Banerjee, R. et al. The signaling state of Arabidopsis cryptochrome 2 contains flavin semiquinone. J Biol Chem 282, 14916-14922 (2007).
[0356] 22. Moore, M. J. & Proudfoot, N.J. Pre-mRNA processing reaches back to transcription and ahead to translation. Cell 136, 688-700 (2009).
[0357] 23. Proudfoot, N.J., Furger, A. & Dye, M. J. Integrating mRNA processing with transcription. Cell 108, 501-512 (2002).
[0358] 24. Kang, H. J. et al. Spatio-temporal transcriptome of the human brain. Nature 478, 483-489 (2011).
[0359] 25. Colantuoni, C. et al. Temporal dynamics and genetic control of transcription in the human prefrontal cortex. Nature 478, 519-523 (2011).
[0360] 26. Holkers, M. et al. Differential integrity of TALE nuclease genes following adenoviral and lentiviral vector gene transfer into human cells. Nucleic Acids Res (2012).
[0361] 27. Fisher, K. J. et al. Recombinant adeno-associated virus for muscle directed gene therapy. Nat Med 3, 306-312 (1997).
[0362] 28. Ledley, F. Pharmaceutical Approach to Somatic Gene Therapy. Pharm Res 13, 1595-1614 (1996).
[0363] 29. Logan, G. J., Wang, L., Zheng, M., Coppel, R. L. & Alexander, I. E. Antigen fusion with C3d3 augments or inhibits humoral immunity to AAV genetic vaccines in a transgene-dependent manner. Immunol Cell Biol 88, 228-232 (2009).
[0364] 30. Ayer, D. E., Laherty, C. D., Lawrence, Q. A., Armstrong, A. P. & Eisenman, R. N. Mad proteins contain a dominant transcription repression domain. Molecular and Cellular Biology 16, 5772-5781 (1996).
[0365] 31. Wu, Z., Yang, H. & Colosi, P. Effect of Genome Size on AAV Vector Packaging. Mol Ther 18, 80-86 (2009).
[0366] 32. Dong JY, F. P., Frizzell RA Quantitative analysis of the packaging capacity of recombinant adeno-associated virus. Human Gene Therapy 7, 2101-2112 (1996).
[0367] 33. Zhang, F. et al. Optogenetic interrogation of neural circuits: technology for probing mammalian brain structures. Nat Protoc 5, 439-456 (2010).
[0368] 34. Zoltowski, B. D. & Crane, B. R. Light Activation of the LOV Protein Vivid Generates a Rapidly Exchanging Dimer†.dagger-dbl.. Biochemistry 47, 7012-7019 (2008).
[0369] 35. Zoltowski, B. D. et al. Conformational Switching in the Fungal Light Sensor Vivid. Science 316, 1054-1057 (2007).
[0370] 36. Zhou, X. X., Chung, H. K., Lam, A. J. & Lin, M. Z. Optical Control of Protein Activity by Fluorescent Protein Domains. Science 338, 810-814 (2012).
[0371] 37. Strickland, D. et al. TULIPs: tunable, light-controlled interacting protein tags for cell biology. Nat Meth 9, 379-384 (2012).
[0372] 38. Shaner, N. C. et al. Improved monomeric red, orange and yellow fluorescent proteins derived from Discosoma sp. red fluorescent protein. Nat Biotech 22, 1567-1572 (2004).
[0373] 39. Mukherjee, A., Weyant, K., Walker, J. & Schroeder, C. Directed evolution of bright mutants of an oxygen-independent flavin-binding fluorescent protein from Pseudomonas putida. Journal of Biological Engineering 6, 20 (2012).
[0374] 40. Nguyen, A. W. & Daugherty, P. S. Evolutionary optimization of fluorescent proteins for intracellular FRET. Nat Biotech 23, 355-360 (2005).
[0375] 41. Shu, X. et al. Mammalian Expression of Infrared Fluorescent Proteins Engineered from a Bacterial Phytochrome. Science 324, 804-807 (2009).
[0376] 42. McClure, C., Cole, K. L., Wulff, P., Klugmann, M. & Murray, A. J. Production and titering of recombinant adeno-associated viral vectors. J Vis Exp, e3348 (2011).
[0377] Neuro 2a cells (Sigma-Aldrich) were grown in media containing a 1:1 ratio of OptiMEM (Life Technologies) to high-glucose DMEM with GlutaMax and Sodium Pyruvate (Life Technologies) supplemented with 5% HyClone heat-inactivated FBS (Thermo Scientific), 1% penicillin/streptomycin (Life Technologies), and passaged at 1:5 every 2 days. 120,000 cells were plated in each well of a 24-well plate 18-20 h prior to transfection. 1 h before transfection, media was changed to DMEM supplemented with 5% HyClone heat-inactivated FBS and 1% penicillin/streptomycin. Cells were transfected with 1.0 μg total of construct DNA (at equimolar ratios) per well with 1.5 μL of GenJet (SignaGen Laboratories) transfection reagent according to the manufacturer's instructions. Media was exchanged 24 h and 44 h post-transfection and light stimulation was started at 48 h. Stimulation parameters were: 5 mW/cm2, 466 nm, 7% duty cycle (1 s light pulse 0.067 Hz) for 24 h unless indicated otherwise in figure legends. RNA was extracted using the RNeasy kit (Qiagen) according to manufacturer's instructions and 1 μg of RNA per sample was reverse-transcribed using qScript (Quanta Biosystems). Relative mRNA levels were measured by quantitative real-time PCR (qRT-PCR) using TaqMan probes specific for the targeted gene as well as GAPDH as an endogenous control (Life Technologies, see Table 2 for Taqman probe IDs). ΔΔCt analysis was used to obtain fold-changes relative to negative controls transduced with GFP only and subjected to light stimulation. Toxicity experiments were conducted using the LIVE/DEAD assay kit (Life Technologies) according to instructions.
[0378] 293FT cells (Life Technologies) were grown in antibiotic-free D10 media (DMEM high glucose with GlutaMax and Sodium Pyruvate, 10% heat-inactivated Hyclone FBS, and 1% 1M HEPES) and passaged daily at 1:2-2.5. The total number of passages was kept below 10 and cells were never grown beyond 85% confluence. The day before transfection, 1×106 cells in 21.5 mL of D10 media were plated onto 15 cm dishes and incubated for 18-22 hours or until ˜80% confluence. For use as a transfection reagent, 1 mg/mL of PEI "Max" (Polysciences) was dissolved in water and the pH of the solution was adjusted to 7.1. For AAV production, 10.4 μg of pDF6 helper plasmid, 8.7 μg of pAAV1 serotype packaging vector, and 5.2 μg of pAAV vector carrying the gene of interest were added to 434 μL of serum-free DMEM and 130 μL of PEI "Max" solution was added to the DMEM-diluted DNA mixture. The DNA/DMEM/PEI cocktail was vortexed and incubated at room temperature for 15 min. After incubation, the transfection mixture was added to 22 mL of complete media, vortexed briefly, and used to replace the media for a 15 cm dish of 293FT cells. For supernatant production, transfection supernatant was harvested at 48 h, filtered through a 0.45 μm PVDF filter (Millipore), distributed into aliquots, and frozen for storage at -80° C.
[0379] Dissociated cortical neurons were prepared from C57BL/6N mouse embryos on E16 (Charles River Labs). Cortical tissue was dissected in ice-cold HBSS--(50 mL 10×HBSS, 435 mL dH2O, 0.3 M HEPES pH 7.3, and 1% penicillin/streptomycin). Cortical tissue was washed 3× with 20 mL of ice-cold HBSS and then digested at 37° C. for 20 min in 8 mL of HBSS with 240 μL of 2.5% trypsin (Life Technologies). Cortices were then washed 3 times with 20 mL of warm HBSS containing 1 mL FBS. Cortices were gently triturated in 2 ml of HBSS and plated at 150,000 cells/well in poly-D-lysine coated 24-well plates (BD Biosciences). Neurons were maintained in Neurobasal media (Life Technologies), supplemented with 1×B27 (Life Technologies), GlutaMax (Life Technologies) and 1% penicillin/streptomycin.
[0380] Primary cortical neurons were transduced with 250 μL of AAV1 supernatant on DIV 5. The media and supernatant were replaced with regular complete neurobasal the following day. Neurobasal was exchanged with Minimal Essential Medium (Life Technologies) containing 1×B27, GlutaMax (Life Technologies) and 1% penicillin/streptomycin 6 days after AAV transduction to prevent formation of phototoxic products from HEPES and riboflavin contained in Neurobasal during light stimulation.
[0381] Light stimulation was started 6 days after AAV transduction (DIV 11) with an intensity of 5 mW/cm2, duty cycle of 0.8% (250 ms pulses at 0.033 Hz or 500 ms pulses at 0.016 Hz), 466 nm blue light for 24 h unless indicated otherwise in figure legends. RNA extraction and reverse transcription were performed using the Cells-to-Ct kit according to the manufacturers instructions (Life Technologies). Relative mRNA levels were measured by quantitative real-time PCR (qRT-PCR) using TaqMan probes as described above for Neuro 2a cells.
[0382] For immunohistochemistry of primary neurons, cells were plated on poly-D-lysine/laminin coated coverslips (BD Biosciences) after harvesting. AAV1-transductions were performed as described above. Neurons were fixed 7 days post-transduction with 4% paraformaldehyde (Sigma Aldrich) for 15 min at RT. Blocking and permeabilization were performed with 10% normal goat serum (Life Technologies) and 0.5% Triton-X100 (Sigma-Aldrich) in DPBS (Life Technologies) for 1 h at room temperature. Neurons were incubated with primary antibodies overnight at 4° C., washed 3× with DPBS and incubated with secondary antibodies for 90 min at RT. For antibody providers and concentrations used, see Table 3. Coverslips were finally mounted using Prolong Gold Antifade Reagent with DAPI (Life Technologies) and imaged on an Axio Scope A.1 (Zeiss) with an X-Cite 120Q light source (Lumen Dynamics). Image were acquired using an AxioCam MRm camera and AxioVision 4.8.2.
[0383] For preparation of total protein lysates, primary cortical neurons were harvested after light stimulation (see above) in ice-cold lysis buffer (RIPA, Cell Signaling; 0.1% SDS, Sigma-Aldrich; and cOmplete ultra protease inhibitor mix, Roche Applied Science). Cell lysates were sonicated for 5 min at `M` setting in a Bioruptor sonicator (Diagenode) and centrifuged at 21,000×g for 10 min at 4° C. Protein concentration was determined using the RC DC protein assay (Bio-Rad). 30-40 μg of total protein per lane was separated under non-reducing conditions on 4-15% Tris-HCl gels (Bio-Rad) along with Precision Plus Protein Dual Color Standard (Bio-Rad) After wet electrotransfer to polyvinylidene difluoride membranes (Millipore) and membrane blocking for 45 min in 5% BLOT-QuickBlocker (Millipore) in Tris-buffered saline (TBS, Bio-Rad), western blots were probed with anti-mGluR2 (Abcam, 1:1.000) and anti-α-tubulin (Sigma-Aldrich 1:20,000) overnight at 4° C., followed by washing and anti-mouse-IgG HRP antibody incubation (Sigma-Aldrich, 1:5,000-1:10,000). For further antibody details see Table 3. Detection was performed via ECL Western blot substrate (SuperSignal West Femto Kit, Thermo Scientific). Blots were imaged with an AlphaImager (Innotech) system, and quantified using ImageJ software 1.46r.
[0384] Production of concentrated and purified AAV for stereotactic injection in-vivo was done using the same initial steps outlined above for production of AAV1 supernatant. However, for transfection, equal ratios of AAV1 and AAV2 serotype plasmids were used instead of AAV1 alone. 5 plates were transfected per construct and cells were harvested with a cell-scraper 48 h post transfection. Purification of AAV1/2 particles was performed using HiTrap heparin affinity columns (GE Healthcare)42. Applicants added a second concentration step down to a final volume of 100 μl per construct using an Amicon 500 μl concentration column (100 kDa cutoff, Millipore) to achieve higher viral titers. Titration of AAV was performed by qRT-PCR using a custom Taqman probe for WPRE (Life Technologies). Prior to qRT-PCR, concentrated AAV was treated with DNaseI (New England Biolabs) to achieve a measurement of DNaseI-resistant particles only. Following DNaseI heat-inactivation, the viral envelope was degraded by proteinase K digestion (New England Biolabs). Viral titer was calculated based on a standard curve with known WPRE copy numbers.
[0385] Adult (10-14 weeks old) male C57BL/6N mice were anaesthetized by intraperitoneal (i.p.) injection of Ketamine/Xylazine (100 mg/kg Ketamine and 10 mg/kg Xylazine) and pre-emptive analgesia was given (Buprenex, 1 mg/kg, i.p.). Craniotomy was performed according to approved procedures and 1 μl of AAV1/2 was injected into ILC at 0.35/1.94/-2.94 (lateral, anterior and inferior coordinates in mm relative to bregma). During the same surgical procedure, an optical cannula with fiber (Doric Lenses) was implanted into ILC unilaterally with the end of the optical fiber located at 0.35/1.94/-2.64 relative to bregma. The cannula was affixed to the skull using Metabond dental cement (Parkell Inc) and Jet denture repair (Lang dental) to build a stable cone around it. The incision was sutured and proper post-operative analgesics were administered for three days following surgery.
[0386] Mice were injected with a lethal dose of Ketamine/Xylazine anaesthetic and transcardially perfused with PBS and 4% paraformaldehyde (PFA). Brains were additionally fixed in 4% PFA at 4° C. overnight and then transferred to 30% sucrose for cryoprotection overnight at room temperature. Brains were then transferred into Tissue-Tek Optimal Cutting Temperature (OCT) Compound (Sakura Finetek) and frozen at -80° C. 18 μm sections were cut on a cryostat (Leica Biosystems) and mounted on Superfrost Plus glass slides (Thermo Fischer). Sections were post-fixed with 4% PFA for 15 min, and immunohistochemistry was performed as described for primary neurons above.
[0387] 8 days post-surgery, awake and freely moving mice were stimulated using a 473 nm laser source (OEM Laser Systems) connected to the optical implant via fiber patch cables and a rotary joint. Stimulation parameters were the same as used on primary neurons: 5 mW (total output), 0.8% duty cycle (500 ms light pulses at 0.016 Hz) for a total of 12 h. Experimental conditions, including transduced constructs and light stimulation are listed in Table 4.
[0388] After the end of light stimulations, mice were euthanized using CO2 and the prefrontal cortices (PFC) were quickly dissected on ice and incubated in RNA later (Qiagen) at 4° C. overnight. 200 μm sections were cut in RNA later at 4° C. on a vibratome (Leica Biosystems). Sections were then frozen on a glass coverslide on dry ice and virally transduced ILC was identified under a fluorescent stereomicroscope (Leica M165 FC). A 0.35 mm diameter punch of ILC, located directly ventrally to the termination of the optical fiber tract, was extracted (Harris uni-core, Ted Pella). The brain punch sample was then homogenized using an RNase-free pellet-pestle grinder (Kimble Chase) in 50 μl Cells-to-Ct RNA lysis buffer and RNA extraction, reverse transcription and qRT-PCR was performed as described for primary neuron samples.
[0389] All experiments were performed with a minimum of three independent biological replicates. Statistical analysis was performed with Prism (GraphPad) using student's t-test when comparing two conditions, ANOVA with Tukey's post-hoc analysis when comparing multiple samples with each other, ANOVA with Duncan's post-hoc analysis when comparing multiple samples to the negative control, and two-way ANOVA with Bonferroni post-hoc analysis to compare multiple groups over time.
Example 7
Development of AAV1 Supernatant Process
[0390] Traditional AAV particle generation required laborious production and purification processes, and made testing many constructs in parallel impractical (4). In this study, a simple yet highly effective process of AAV production using filtered supernatant from transfected 293FT cells (FIG. 42). Recent reports indicate that AAV particles produced in 293FT cells could be found not only it the cytoplasm but also at considerable amounts in the culture media (5). The ratio of viral particles between the supernatant and cytosol of host cells varied depending on the AAV serotype, and secretion was enhanced if polyethylenimine (PEI) was used to transfect the viral packaging plasmids (5). In the current study, it was found that 2×105 293 FT cells transfected with AAV vectors carrying TALEs (FIG. 37A) and packaged using AAV1 serotype were capable of producing 250 μl of AAV1 at a concentration of 5.6±0.24×1010 DNAseI resistant genome copies (gc) per mL. 250 μl of filtered supernatant was able to transduce 150,000 primary cortical neurons at efficiencies of 80-90% (FIGS. 37B and 42B). This is a dramatic increase over the 1-2% transduction efficiency achieved using lentivirus supernatant produced from the same number of 293FT cells (FIG. 42B).
TABLE-US-00004 TABLE 2 Product information for all Taqman probes (Life Technologies) Target Species Probe # Ngn2 mouse Mm00437603_g1 Grm5 (mGluR5) mouse Mm00690332_m1 Grm2 (mGluR2) mouse Mm01235831_m1 Grin2a (NMDAR2A) mouse Mm00433802_m1 GAPD (GAPDH) mouse 4352932E KLF4 human Hs00358836_m1 GAPD (GAPDH) human 4352934E WPRE custom
TABLE-US-00005 TABLE 3 Clone, product numbers and concentrations for antibodies used in this study Primary Antibodies Target Host Clone # Manufacturer Product # IsoType Concentration mGluR2 mouse mG2Na-s Abcam Ab15672 IgG 1:1000 α-tubulin mouse B-5-1-2 Sigma-Aldrich T5168 IgG1 1:20000 NeuN mouse A60 Millipore MAB377 IgG1 1:200 HA (Alexa Fluor mouse 6E2 Cell Signaling 3444 IgG1 1:100 594 conjugated) GFP chicken polyclonal Aves Labs GFP-1020 IgY 1:500 Secondary Antibodies Target Host Conjugate Manufacturer Product # Concentration mouse IgG goat HRP Sigma-Aldrich A9917 1:5000-10000 mouse IgG goat Alexa Fluor 594 Life Technologies A11005 1:1000 chicken IgG Goat Alexa Fluor 488 Life Technologies A11039 1:1000
TABLE-US-00006 TABLE 4 Viral transduction and light stimulation parameters for in vivo LITE-mediated activation of Grm2 in the mouse infralimbic cortex (ILC). Grm2 mRNA levels in the ipsilateral LITE-expressing hemisphere are compared with the contralateral mCherry-expressing control hemisphere for all three experimental conditions shown in FIG. 38J. ILC ILC Hemisphere (ipsilateral) Hemisphere Experimental Light (contralateral) condition AAV vector stimulation AAV vector GFP GFP yes mCherry LITEs/ TALE-CIB1::CRY2PHR- no mCherry no Light VP64 LITEs/ TALE-CIB1::CRY2PHR- yes mCherry +Light VP64
[0391] Sequences of constructs used in Neuro-2A cells (FIGS. 35, 36)
[0392] >TALE(Ngn2) (underlined)-NLS (in italics)-CRY2 (in bold)
TABLE-US-00007 (SEQ ID NO: 168) MSRTRLPSPPAPSPAFSADSFSDLLRQFDPSLFNTSLFDSLPPFGAHHTEAATGEWDEVQSGLR AADAPPPTMRVAVTAARPPRAKPAPRRRAAQPSDASPAAQVDLRTLGYSQQQQEKIKPKVRSTV AQHHEALVGHGFTHAHIVALSQHPAALGTVAVKYQDMIAALPEATHEAIVGVGKQWSGARALEA LLTVAGELRGPPLQLDTGQLLKIAKRGGVTAVEAVHAWRNALTGAPLNLTPEQVVAIASNNGGK QALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASH DGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNIGGKQALETVQRLLPVLCQAHGLTPEQVVA IASNNGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPE QVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNIGGKQALETVQRLLPVLCQAHG LTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNNGGKQALETVQRLLPVLC QAHGLTPEQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQRLL PVLCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNNGGKQALETV QRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQA LETVQRLLPVLCQAHGLTPEQVVAIASHDGGRPALESIVAQLSRPDPALAALTNDHLVALACLG GRPALDAVKKGLPHAPALIKRTNRRIPERTSHRVADHAQVVRVLGFFQCHSHPAQAFDDAMTQF GMSRHGLLQLFRRVGVTELEARSGTLPPASQRWDRILQASGMKRAKPSPTSTQTPDQASLHAFA DSLERDLDAPSPMHEGDQTRASASPKKKRKVEASKMDKKTIVWFRRDLRIEDNPALAAAAHEGS VFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSLKALGSDLTLIKTHNTISAILDCIRVTGA TKVVFNHLYDPVSLVRDHTVKEKLVERGISVQSYNGDLLYEPWEIYCEKGKPFTSFNSYWKKCL DMSIESVMLPPPWRLMPITAAAEAIWACSIEELGLENEAEKPSNALLTRAWSPGWSNADKLLNE FIEKQLIDYAKNSKKVVGNSTSLLSPYLHFGEISVRHVFQCARMKQIIWARDKNSEGEESADLF LRGIGLREYSRYICFNFPFTHEQSLLSHLRFFPWDADVDKFKAWRQGRTGYPLVDAGMRELWAT GWMHNRIRVIVSSFAVKFLLLPWKWGMKYFWDTLLDADLECDILGWQYISGSIPDGHELDRLDN PALQGAKYDPEGEYIRQWLPELARLPTEWIHHPWDAPLTVLKASGVELGTNYAKPIVDIDTARE LLAKAISRTREAQIMIGAAPDEIVADSFEALGANTIKEPGLCPSVSSNDQQVPSAVRYNGSKRV KPEEEEERDMKKSRGFDERELFSTAESSSSSSVFFVSQSCSLASEGKNLEGIQDSSDQITTSLG KNG
[0393] >TALE(Ngn2) (underlined)-NLS (in italics)-CRY2PHR (in bold)
TABLE-US-00008 (SEQ ID NO: 169) MSRTRLPSPPAPSPAFSADSFSDLLRQFDPSLFNTSLFDSLPPFGAHHTEAATGEWDEVQSGLR AADAPPPTMRVAVTAARPPRAKPAPRRRAAQPSDASPAAQVDLRTLGYSQQQQEKIKPKVRSTV AQHHEALVGHGFTHAHIVALSQHPAALGTVAVKYQDMIAALPEATHEAIVGVGKQWSGARALEA LLTVAGELRGPPLQLDTGQLLKIAKRGGVTAVEAVHAWRNALTGAPLNLTPEQVVAIASNNGGK QALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASH DGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNIGGKQALETVQRLLPVLCQAHGLTPEQVVA IASNNGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPE QVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNIGGKQALETVQRLLPVLCQAHG LTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNNGGKQALETVQRLLPVLC QAHGLTPEQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQRLL PVLCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNNGGKQALETV QRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQA LETVQRLLPVLCQAHGLTPEQVVAIASHDGGRPALESIVAQLSRPDPALAALTNDHLVALACLG GRPALDAVKKGLPHAPALIKRTNRRIPERTSHRVADHAQVVRVLGFFQCHSHPAQAFDDAMTQF GMSRHGLLQLFRRVGVTELEARSGTLPPASQRWDRILQASGMKRAKPSPTSTQTPDQASLHAFA DSLERDLDAPSPMHEGDQTRASASPKKKRKVEASKMDKKTIVWFRRDLRIEDNPALAAAAHEGS VFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSLKALGSDLTLIKTHNTISAILDCIRVTGA TKVVFNHLYDPVSLVRDHTVKEKLVERGISVQSYNGDLLYEPWEIYCEKGKPFTSFNSYWKKCL DMSIESVMLPPPWRLMPITAAAEAIWACSIEELGLENEAEKPSNALLTRAWSPGWSNADKLLNE FIEKQLIDYAKNSKKVVGNSTSLLSPYLHFGEISVRHVFQCARMKQIIWARDKNSEGEESADLF LRGIGLREYSRYICFNFPFTHEQSLLSHLRFFPWDADVDKFKAWRQGRTGYPLVDAGMRELWAT GWMHNRIRVIVSSFAVKFLLLPWKWGMKYFWDTLLDADLECDILGWQYISGSIPDGHELDRLDN PALQGAKYDPEGEYIRQWLPELARLPTEWIHHPWDAPLTVLKASGVELGTNYAKPIVDIDTARE LLAKAISRTREAQIMIGAAP
[0394] >CIB1 (in bold)-NLS (in italics)-VP64 (in bold, underlined) --2A_ GFP (underlined)
TABLE-US-00009 (SEQ ID NO: 170) MNGAIGGDLLLNFPDMSVLERQRAHLKYLNPTFDSPLAGFFADSSMITGGEMDSYLSTAGLNLP MMYGETTVEGDSRLSISPETTLGTGNFKKRKFDTETKDCNEKKKKMTMNRDDLVEEGEEEKSKI TEQNNGSTKSIKKMKHKAKKEENNFSNDSSKVTKELEKTDYIHVRARRGQATDSHSIAERVRRE KISERMKFLQDLVPGCDKITGKAGMLDEIINYVQSLQRQIEFLSMKLAIVNPRPDFDMDDIFAK EVASTPMTVVPSPEMVLSGYSHEMVHSGYSSEMVNSGYLHVNPMQQVNTSSDPLSCFNNGEAPS MWDSHVQNLYGNLGVASPKKKRKVEASGSGRADALDDFDLDMLGSDALDDFDLDMLGSDALDDF DLDMLGSDALDDFDLDMLINSRGSGEGRGSLLTCGDVEENPGPVSKGEELFTGVVPILVELDGD VNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFK SAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHN VYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNE KRDHMVLLEFVTAAGITLGMDELYK
[0395] >CIBN (in bold)-NLS (in italics)-VP64 (in bold, underlined) --2A_ GFP (underlined)
TABLE-US-00010 (SEQ ID NO: 171) MNGAIGGDLLLNFPDMSVLERQRAHLKYLNPTFDSPLAGFFADSSMITGGEMDSYLSTAGLNLP MMYGETTVEGDSRLSISPETTLGTGNFKKRKFDTETKDCNEKKKKMTMNRDDLVEEGEEEKSKI TEQNNGSTKSIKKMKHKAKKEENNFSNDSSKVTKELEKTDYIASPKKKRKVEASGSGRADALDD FDLDMLGSDALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLINSRGSGEGRGSLLTCGDV EENPGPVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWP TLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNR IELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNT PIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
[0396] >CIB1 (in bold)-NLS (in italics)-VP16 (in bold, underlined) --2A_ GFP (underlined)
TABLE-US-00011 (SEQ ID NO: 172) MNGAIGGDLLLNFPDMSVLERQRAHLKYLNPTFDSPLAGFFADSSMITGGEMDSYLSTAGLNLP MMYGETTVEGDSRLSISPETTLGTGNFKKRKFDTETKDCNEKKKKMTMNRDDLVEEGEEEKSKI TEQNNGSTKSIKKMKHKAKKEENNFSNDSSKVTKELEKTDYIHVRARRGQATDSHSIAERVRRE KISERMKFLQDLVPGCDKITGKAGMLDEIINYVQSLQRQIEFLSMKLAIVNPRPDFDMDDIFAK EVASTPMTVVPSPEMVLSGYSHEMVHSGYSSEMVNSGYLHVNPMQQVNTSSDPLSCFNNGEAPS MWDSHVQNLYGNLGVASPKKKRKVEASAPPTDVSLGDELHLDGEDVAMAHADALDDFDLDMLGD GDSPGPGFTPHDSAPYGALDMADFEFEQMFTDALGIDEYGGEFPGIRRSRGSGEGRGSLLTCGD VEENPGPVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPW PTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVN RIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQN TPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
[0397] >CIB1 (in bold)-NLS (in italics)-p65 (in bold, underlined) --2A_ GFP (underlined)
TABLE-US-00012 (SEQ ID NO: 173) MNGAIGGDLLLNFPDMSVLERQRAHLKYLNPTFDSPLAGFFADSSMITGGEMDSYLSTAGLNLP MMYGETTVEGDSRLSISPETTLGTGNFKKRKFDTETKDCNEKKKKMTMNRDDLVEEGEEEKSKI TEQNNGSTKSIKKMKHKAKKEENNFSNDSSKVTKELEKTDYIHVRARRGQATDSHSIAERVRRE KISERMKFLQDLVPGCDKITGKAGMLDEIINYVQSLQRQIEFLSMKLAIVNPRPDFDMDDIFAK EVASTPMTVVPSPEMVLSGYSHEMVHSGYSSEMVNSGYLHVNPMQQVNTSSDPLSCFNNGEAPS MWDSHVQNLYGNLGVASPKKKRKVEASPSGQISNQALALAPSSAPVLAQTMVPSSAMVPLAQPP APAPVLTPGPPQSLSAPVPHSTQAGEGTLSEALLHLQFDADEDLGALLGNSTDPGVFTDLASVD NSEFQQLLNQGVSMSHSTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGTSGLPNGLSGDEDFS SIADMDFSALLSQISSSGQSRGSGEGRGSLLTCGDVEENPGPVSKGEELFTGVVPILVELDGDV NGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKS AMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNV YIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEK RDHMVLLEFVTAAGITLGMDELYK
[0398] AAV constructs (constructs used in primary neurons and in-vivo, FIGS. 37-38)
[0399] >HA-TALE(12mer) (in bold)-NLS (in italics)-VP64 (in bold, underlined) --2A_ GFP (underlined)
TABLE-US-00013 (SEQ ID NO: 174) MYPYDVPDYAVDLRTLGYSQQQQEKIKPKVRSTVAQHHEALVGHGFTHAHIVALSQHPAALGTV AVKYQDMIAALPEATHEAIVGVGKQWSGARALEALLTVAGELRGPPLQLDTGQLLKIAKRGGVT AVEAVHAWRNALTGAPLNLTPEQVVAIASXXGGKQALETVQRLLPVLCQAHGLTPEQVVAIASX XGGKQALETVQRLLPVLCQAHGLTPEQVVAIASXXGGKQALETVQRLLPVLCQAHGLTPEQVVA IASXXGGKQALETVQRLLPVLCQAHGLTPEQVVAIASXXGGKQALETVQRLLPVLCQAHGLTPE QVVAIASXXGGKQALETVQRLLPVLCQAHGLTPEQVVAIASXXGGKQALETVQRLLPVLCQAHG LTPEQVVAIASXXGGKQALETVQRLLPVLCQAHGLTPEQVVAIASXXGGKQALETVQRLLPVLC QAHGLTPEQVVAIASXXGGKQALETVQRLLPVLCQAHGLTPEQVVAIASXXGGKQALETVQRLL PVLCQAHGLTPEQVVAIASXXGGKQALETVQRLLPVLCQAHGLTPEQVVAIASXXGGRPALESI VAQLSRPDPALAALTNDHLVALACLGGRPALDAVKKGLPHAPALIKRTNRRIPERTSHRVAASP KKKRKVEASGSGRADALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDML INSRGSGEGRGSLLTCGDVEENPGPVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATY GKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKI RHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITL GMDELYK
[0400] >HA-TALE(12mer) (in bold)-NLS (in italics)-SID4X (in bold, underlined) --2A_ phiLOV2.1 (underlined)
TABLE-US-00014 (SEQ ID NO: 175) MYPYDVPDYAVDLRTLGYSQQQQEKIKPKVRSTVAQHHEALVGHGFTHAHIVALSQHPAALGTV AVKYQDMIAALPEATHEAIVGVGKQWSGARALEALLTVAGELRGPPLQLDTGQLLKIAKRGGVT AVEAVHAWRNALTGAPLNLTPEQVVAIASXXGGKQALETVQRLLPVLCQAHGLTPEQVVAIASX XGGKQALETVQRLLPVLCQAHGLTPEQVVAIASXXGGKQALETVQRLLPVLCQAHGLTPEQVVA IASXXGGKQALETVQRLLPVLCQAHGLTPEQVVAIASXXGGKQALETVQRLLPVLCQAHGLTPE QVVAIASXXGGKQALETVQRLLPVLCQAHGLTPEQVVAIASXXGGKQALETVQRLLPVLCQAHG LTPEQVVAIASXXGGKQALETVQRLLPVLCQAHGLTPEQVVAIASXXGGKQALETVQRLLPVLC QAHGLTPEQVVAIASXXGGKQALETVQRLLPVLCQAHGLTPEQVVAIASXXGGKQALETVQRLL PVLCQAHGLTPEQVVAIASXXGGKQALETVQRLLPVLCQAHGLTPEQVVAIASXXGGRPALESI VAQLSRPDPALAALTNDHLVALACLGGRPALDAVKKGLPHAPALIKRTNRRIPERTSHRVAASP KKKRKVEASPKKKRKVEASGSGMNIQMLLEAADYLERREREAEHGYASMLPGSGMNIQMLLEAA DYLERREREAEHGYASMLPGSGMNIQMLLEAADYLERREREAEHGYASMLPGSGMNIQMLLEAA DYLERREREAEHGYASMLPSRSRGSGEGRGSLLTCGDVEENPGPIEKSFVITDPRLPDYPIIFA SDGFLELTEYSREEIMGRNARFLQGPETDQATVQKIRDAIRDQRETTVQLINYTKSGKKFWNLL HLQPVRDRKGGLQYFIGVQLVGSDHV
[0401] >HA-TALE(12mer) (in bold)-NLS (in italics)-CIB1 (underlined)
TABLE-US-00015 (SEQ ID NO: 176) MYPYDVPDYAVDLRTLGYSQQQQEKIKPKVRSTVAQHHEALVGHGFTHAHIVALSQHPAALGTV AVKYQDMIAALPEATHEAIVGVGKQWSGARALEALLTVAGELRGPPLQLDTGQLLKIAKRGGVT AVEAVHAWRNALTGAPLNLTPEQVVAIASXXGGKQALETVQRLLPVLCQAHGLTPEQVVAIASX XGGKQALETVQRLLPVLCQAHGLTPEQVVAIASXXGGKQALETVQRLLPVLCQAHGLTPEQVVA IASXXGGKQALETVQRLLPVLCQAHGLTPEQVVAIASXXGGKQALETVQRLLPVLCQAHGLTPE QVVAIASXXGGKQALETVQRLLPVLCQAHGLTPEQVVAIASXXGGKQALETVQRLLPVLCQAHG LTPEQVVAIASXXGGKQALETVQRLLPVLCQAHGLTPEQVVAIASXXGGKQALETVQRLLPVLC QAHGLTPEQVVAIASXXGGKQALETVQRLLPVLCQAHGLTPEQVVAIASXXGGKQALETVQRLL PVLCQAHGLTPEQVVAIASXXGGKQALETVQRLLPVLCQAHGLTPEQVVAIASXXGGRPALESI VAQLSRPDPALAALTNDHLVALACLGGRPALDAVKKGLPHAPALIKRTNRRIPERTSHRVAASP KKKRKVEASNGAIGGDLLLNFPDMSVLERQRAHLKYLNPTFDSPLAGFFADSSMITGGEMDSYL STAGLNLPMMYGETTVEGDSRLSISPETTLGTGNFKKRKFDTETKDCNEKKKKMTMNRDDLVEE GEEEKSKITEQNNGSTKSIKKMKHKAKKEENNFSNDSSKVTKELEKTDYIHVRARRGQATDSHS IAERVRREKISERMKFLQDLVPGCDKITGKAGMLDEIINYVQSLQRQIEFLSMKLAIVNPRPDF DMDDIFAKEVASTPMTVVPSPEMVLSGYSHEMVHSGYSSEMVNSGYLHVNPMQQVNTSSDPLSC FNNGEAPSMWDSHVQNLYGNLGV
[0402] >CRY2PHR(in bold)-NLS (in italics)-VP64 (in bold, underlined) --2A_ GFP (underlined)
TABLE-US-00016 (SEQ ID NO: 177) MKMDKKTIVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLS QSLKALGSDLTLIKTHNTISAILDCIRVTGATKVVFNHLYDPVSLVRDHTVKEKLVERGISVQS YNGDLLYEPWEIYCEKGKPFTSFNSYWKKCLDMSIESVMLPPPWRLMPITAAAEAIWACSIEEL GLENEAEKPSNALLTRAWSPGWSNADKLLNEFIEKQLIDYAKNSKKVVGNSTSLLSPYLHFGEI SVRHVFQCARMKQIIWARDKNSEGEESADLFLRGIGLREYSRYICFNFPFTHEQSLLSHLRFFP WDADVDKFKAWRQGRTGYPLVDAGMRELWATGWMHNRIRVIVSSFAVKFLLLPWKWGMKYFWDT LLDADLECDILGWQYISGSIPDGHELDRLDNPALQGAKYDPEGEYIRQWLPELARLPTEWIHHP WDAPLTVLKASGVELGTNYAKPIVDIDTARELLAKAISRTREAQIMIGAAPASPKKKRKVEASG SGRADALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLINSRGSGEGR GSLLTCGDVEENPGPVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICT TGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVK FEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQ LADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKV
[0403] >CRY2PHR (in bold)-NLS (in italics)-SID4X (in bold, underlined) --2A_ phiLOV2.1 (underlined)
TABLE-US-00017 (SEQ ID NO: 178) MKMDKKTIVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLS QSLKALGSDLTLIKTHNTISAILDCIRVTGATKVVFNHLYDPVSLVRDHTVKEKLVERGISVQS YNGDLLYEPWEIYCEKGKPFTSFNSYWKKCLDMSIESVMLPPPWRLMPITAAAEAIWACSIEEL GLENEAEKPSNALLTRAWSPGWSNADKLLNEFIEKQLIDYAKNSKKVVGNSTSLLSPYLHFGEI SVRHVFQCARMKQIIWARDKNSEGEESADLFLRGIGLREYSRYICFNFPFTHEQSLLSHLRFFP WDADVDKFKAWRQGRTGYPLVDAGMRELWATGWMHNRIRVIVSSFAVKFLLLPWKWGMKYFWDT LLDADLECDILGWQYISGSIPDGHELDRLDNPALQGAKYDPEGEYIRQWLPELARLPTEWIHHP WDAPLTVLKASGVELGTNYAKPIVDIDTARELLAKAISRTREAQIMIGAAPASPKKKRKVEASG SGMNIQMLLEAADYLERREREAEHGYASMLPGSGMNIQMLLEAADYLERREREAEHGYASMLPG SGMNIQMLLEAADYLERREREAEHGYASMLPGSGMNIQMLLEAADYLERREREAEHGYASMLPS RSRGSGEGRGSLLTCGDVEENPGPIEKSFVITDPRLPDYPIIFASDGFLELTEYSREEIMGRNA RFLQGPETDQATVQKIRDAIRDQRETTVQLINYTKSGKKFWNLLHLQPVRDRKGGLQYFIGVQL VGSDHV
[0404] Sequences of FIGS. 39-48
[0405] >TALE(KLF4) (underlined)-NLS (in italics)-CRY2PHR (in bold)
TABLE-US-00018 (SEQ ID NO: 179) MSRTRLPSPPAPSPAFSADSFSDLLRQFDPSLFNTSLFDSLPPFGAHHTEAATGEWDEVQSGLR AADAPPPTMRVAVTAARPPRAKPAPRRRAAQPSDASPAAQVDLRTLGYSQQQQEKIKPKVRSTV AQHHEALVGHGFTHAHIVALSQHPAALGTVAVKYQDMIAALPEATHEAIVGVGKQWSGARALEA LLTVAGELRGPPLQLDTGQLLKIAKRGGVTAVEAVHAWRNALTGAPLNLTPEQVVAIASNGGGK QALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASN GGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPEQVVA IASNIGGKQALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPE QVVAIASNGGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNGGGKQALETVQRLLPVLCQAHG LTPEQVVAIASNIGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNGGGKQALETVQRLLPVLC QAHGLTPEQVVAIASNIGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNIGGKQALETVQRLL PVLCQAHGLTPEQVVAIASHDGGRPALESIVAQLSRPDPALAALTNDHLVALACLGGRPALDAV KKGLPHAPALIKRTNRRIPERTSHRVADHAQVVRVLGFFQCHSHPAQAFDDAMTQFGMSRHGLL QLFRRVGVTELEARSGTLPPASQRWDRILQASGMKRAKPSPTSTQTPDQASLHAFADSLERDLD APSPMHEGDQTRASASPKKKRKVEASKMDKKTIVWFRRDLRIEDNPALAAAAHEGSVFPVFIWC PEEEGQFYPGRASRWWMKQSLAHLSQSLKALGSDLTLIKTHNTISAILDCIRVTGATKVVFNHL YDPVSLVRDHTVKEKLVERGISVQSYNGDLLYEPWEIYCEKGKPFTSFNSYWKKCLDMSIESVM LPPPWRLMPITAAAEAIWACSIEELGLENEAEKPSNALLTRAWSPGWSNADKLLNEFIEKQLID YAKNSKKVVGNSTSLLSPYLHFGEISVRHVFQCARMKQIIWARDKNSEGEESADLFLRGIGLRE YSRYICFNFPFTHEQSLLSHLRFFPWDADVDKFKAWRQGRTGYPLVDAGMRELWATGWMHNRIR VIVSSFAVKFLLLPWKWGMKYFWDTLLDADLECDILGWQYISGSIPDGHELDRLDNPALQGAKY DPEGEYIRQWLPELARLPTEWIHHPWDAPLTVLKASGVELGTNYAKPIVDIDTARELLAKAISR TREAQIMIGAAP_
[0406] >HA-NLS (in italics)-TALE(p11, N136) (in bold)-SID (underlined)
TABLE-US-00019 (SEQ ID NO: 180) MYPYDVPDYASPKKKRKVEASVDLRTLGYSQQQQEKIKPKVRSTVAQHHEALVGHGFTHAHIVA LSQHPAALGTVAVKYQDMIAALPEATHEAIVGVGKQWSGARALEALLTVAGELRGPPLQLDTGQ LLKIAKRGGVTAVEAVHAWRNALTGAPLNLTPEQVVAIASNNGGKQALETVQRLLPVLCQAHGL TPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQ AHGLTPEQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNNGGKQALETVQRLLP VLCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQ RLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNGGGKQAL ETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASHDGG KQALETVQRLLPVLCQAHGLTPEQVVAIASNIGGKQALETVQRLLPVLCQAHGLTPEQVVAIAS NNGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNNGGKQALETVQRLLPVLCQAHGLTPEQVV AIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNGGGKQALETVQRLLPVLCQAHGLTP EQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAH GLTPEQVVAIASHDGGRPALESIVAQLSRPDPALAALTNDHLVALACLGGRPALDAVKKGLPHA PALIKRTNRRIPERTSHRVADHAQVVRVLGFFQCHSHPAQAFDDAMTQFGMSRHGLLQLFRRVG VTELEARSGTLPPASQRWDRILQASGMKRAKPSPTSTQTPDQASLHAFADSLERDLDAPSPMHE GDQTRASASGSGMNIQMLLEAADYLERREREAEHGYASMLP.
[0407] >HA-NLS (in italics)-TALE(p11, N136) (in bold)-SID4X (underlined)
TABLE-US-00020 (SEQ ID NO: 181) MYPYDVPDYASPKKKRKVEASVDLRTLGYSQQQQEKIKPKVRSTVAQHHEALVGHGFTHAHIVA LSQHPAALGTVAVKYQDMIAALPEATHEAIVGVGKQWSGARALEALLTVAGELRGPPLQLDTGQ LLKIAKRGGVTAVEAVHAWRNALTGAPLNLTPEQVVAIASNNGGKQALETVQRLLPVLCQAHGL TPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQ AHGLTPEQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNNGGKQALETVQRLLP VLCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQ RLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNGGGKQAL ETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASHDGG KQALETVQRLLPVLCQAHGLTPEQVVAIASNIGGKQALETVQRLLPVLCQAHGLTPEQVVAIAS NNGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNNGGKQALETVQRLLPVLCQAHGLTPEQVV AIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNGGGKQALETVQRLLPVLCQAHGLTP EQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAH GLTPEQVVAIASHDGGRPALESIVAQLSRPDPALAALTNDHLVALACLGGRPALDAVKKGLPHA PALIKRTNRRIPERTSHRVADHAQVVRVLGFFQCHSHPAQAFDDAMTQFGMSRHGLLQLFRRVG VTELEARSGTLPPASQRWDRILQASGMKRAKPSPTSTQTPDQASLHAFADSLERDLDAPSPMHE GDQTRASASGSGMNIQMLLEAADYLERREREAEHGYASMLPGSGMNIQMLLEAADYLERREREA EHGYASMLPGSGMNIQMLLEAADYLERREREAEHGYASMLPGSGMNIQMLLEAADYLERREREA EHGYASMLPSR
[0408] The following Arduino script was used to enable the individual control of each 4-well column of a light-stimulated 24-well plate:
TABLE-US-00021 //Basic control code for LITE LED array using Arduino UNO //LED column address initialization to PWM-ready Arduino outputs int led1_pin = 3; int led2_pin = 5; int led3_pin = 6; int led4_pin = 9; int led5_pin = 10; int led6_pin = 11; //Maximum setting for Arduino PWM int uniform_brightness = 255; //PWM settings for individual LED columns int led1_brightness = uniform_brightness/2; int led2_brightness = uniform_brightness/2; int led3_brightness = uniform_brightness/2; int led4_brightness = uniform_brightness/2; int led5_brightness = uniform_brightness/2; int led6_brightness = uniform_brightness/2; //`on` time in msec unsigned long uniform_stim_time = 1000; / //individual `on` time settings for LED columns unsigned long_led1_stim_time = uniform_stim_time; unsigned long_led2_stim_time = uniform_stim_time; unsigned long_led3_stim_time = uniform_stim_time; unsigned long_led4_stim_time = uniform_stim_time; unsigned long_led5_stim_time = uniform_stim_time; unsigned long_led6_stim_time = uniform_stim_time; //`off` time in msec unsigned long uniform_off_time = 14000; //individual `off` time settings for LED columns unsigned long led1_off_time = uniform_off_time; unsigned long led2_off_time = uniform_off_time; unsigned long led3_off_time = uniform_off_time; unsigned long led4_off_time = uniform_off_time; unsigned long led5_off_time = uniform_off_time; unsigned long led6_off_time = uniform_off_time; unsigned long currentMillis = 0; //initialize timing and state variables unsigned long led1_last_change = 0; unsigned long led2_last_change = 0; unsigned long led3_last_change = 0; unsigned long led4_last_change = 0; unsigned long led5_last_change = 0; unsigned long led6_last_change = 0; int led1_state = HIGH; int led2_state = HIGH; int led3_state = HIGH; int led4_state = HIGH; int led5_state = HIGH; int led6_state = HIGH; unsigned long led1_timer = 0; unsigned long led2_timer = 0; unsigned long led3_timer = 0; unsigned long led4_timer = 0; unsigned long led5_timer = 0; unsigned long led6_timer = 0; void setup( ) { // setup PWM pins for output pinMode(led1_pin, OUTPUT); pinMode(led2_pin, OUTPUT); pinMode(led3_pin, OUTPUT); pinMode(led4_pin, OUTPUT); pinMode(led5_pin, OUTPUT); pinMode(led6_pin, OUTPUT); //LED starting state analogWrite(led1_pin, led1_brightness); analogWrite(led2_pin, led2_brightness); analogWrite(led3_pin, led3_brightness); analogWrite(led4_pin, led4_brightness); analogWrite(led5_pin, led5_brightness); analogWrite(led6_pin, led6_brightness); } void loop( ) { currentMillis = millis( ); //identical timing loops for the 6 PWM output pins led1_timer = currentMillis - led1_last_change; if (led1_state == HIGH){ //led state is on if (led1_timer >= led1_stim_time){ //TRUE if stim time is complete analogWrite(led1_pin, 0); //turn LED off led1_state = LOW; //change LED state variable led1_last_change = currentMillis; //mark time of most recent change } } else{ //led1 state is off if (led1_timer >= led1_off_time){ //TRUE if off time is complete analogWrite(led1_pin, led1_brightness); //turn LED on led1_state = HIGH; //change LED state variable led1_last_change = currentMillis; //mark time of most recent change } } led2_timer = currentMillis - led2_last_change; if (led2_state == HIGH){ if (led2_timer >= led2_stim_time){ analogWrite(led2_pin, 0); led2_state = LOW; led2_last_change = currentMillis; } } else{ //led2 state is off if (led2_timer >= led2_off_time){ analogWrite(led2_pin, led2_brightness); led2_state = HIGH; led2_last_change = currentMillis; } } led3_timer = currentMillis - led3_last_change; if (led3_state == HIGH){ if (led3_timer >= led3_stim_time){ analogWrite(led3_pin, 0); led3_state = LOW; led3_last_change = currentMillis; } } else{ //led3 state is off if (led3_timer >= led3_off_time){ analogWrite(led3_pin, led3_brightness); led3_state = HIGH; led3_last_change = currentMillis; } } led4_timer = currentMillis - led4_last_change; if (led4_state == HIGH){ if (led4_timer >= led4_stim_time){ analogWrite(led4_pin, 0); led4_state = LOW; led4_last_change = currentMillis; } } else{ //led4 state is off if (led4_timer >= led4_off_time){ analogWrite(led4_pin, led4_brightness); led4_state = HIGH; led4_last_change = currentMillis; } } led5_timer = currentMillis - led5_last_change; if (led5_state == HIGH){ if (led5_timer >= led5_stim_time){ analogWrite(led5_pin, 0); led5_state = LOW; led5_last_change = currentMillis; } } else{ //led5 state is off if (led5_timer >= led5_off_time){ analogWrite(led5_pin, led5_brightness); led5_state = HIGH; led5_last_change = currentMillis; } } led6_timer = currentMillis - led6_last_change; if (led6_state == HIGH){ if (led6_timer >= led6_stim_time){ analogWrite(led6_pin, 0); led6_state = LOW; led6_last_change = currentMillis; } } else{ //led6 state is off if (led6_timer >= led6_off_time){ analogWrite(led6_pin, led6_brightness); led6_state = HIGH; led6_last_change = currentMillis; } } }
REFERENCES
[0409] 1 Banerjee, R. et al. The Signaling State of Arabidopsis Cryptochrome 2 Contains Flavin Semiquinone. Journal of Biological Chemistry 282, 14916-14922, doi:10.1074/jbc.M700616200 (2007).
[0410] 2 McClure, C., Cole, K. L., Wulff, P., Klugmann, M. & Murray, A. J. Production and titering of recombinant adeno-associated viral vectors. J Vis Exp, e3348, doi:10.3791/3348 (2011).
[0411] 3 Witten, Ilana B. et al. Recombinase-Driver Rat Lines: Tools, Techniques, and Optogenetic Application to Dopamine-Mediated Reinforcement. Neuron 72, 721-733, doi: at the website dx.doi.org/10.1016/j.neuron.2011.10.028 (2011).
[0412] 4 Grieger, J. C., Choi, V. W. & Samulski, R. J. Production and characterization of adeno-associated viral vectors. Nat Protoc 1, 1412-1428, doi:10.1038/nprot.2006.207 (2006).
[0413] 5 Lock M, A. M., Vandenberghe L H, Samanta A, Toelen J, Debyser Z, Wilson J M. Rapid, Simple, and Versatile Manufacturing of Recombinant Adeno-Associated Viral Vectors at Scale. Human Gene Therapy 21, 1259-1271, doi:10.1089/hum.2010.055 (2010).
Example 8
Cloning (Construction) of AAV Constructs
[0414] Construction of AAV-Promoter-TALE-Effector Backbone
[0415] For construction of AAV-promoter-TALE-effector a backbone was cloned by standard subcloning methods. Specifically, the vector contained an antibiotics resistance gene, such as ampicillin resistance and two AAV inverted terminal repeats (itr's) flanking the promoter-TALE-effector insert (sequences, see below). The promoter (hSyn), the effector domain (VP64, SID4X or CIB1 in this example)/the N- and C-terminal portion of the TALE gene containing a spacer with two typeIIS restriction sites (BsaI in this instance) were subcloned into this vector. To achieve subcloning, each DNA component was amplified using polymerase-chain reaction and then digested with specific restriction enzymes to create matching DNA sticky ends. The vector was similarly digested with DNA restriction enzymes. All DNA fragments were subsequently allowed to anneal at matching ends and fused together using a ligase enzyme.
[0416] Assembly of Individual TALEs into AAV-Promoter-TALE-Effector Backbone
[0417] For incorporating different TALE monomer sequences into the AAV-promoter-TALE-effector backbone described above, a strategy based on restriction of individual monomers with type IIS restriction enzymes and ligation of their unique overhangs to form an assembly of 12 to 16 monomers to form the final TALE and ligate it into the AAV-promoter-TALE-effector backbone by using the type IIS sites present in the spacer between the N- and C-term (termed golden gate assembly). This method of TALE monomer assembly has previously been described by us (NE Sanjana, L Cong, Y Zhou, M M Cunniff, G Feng & F Zhang A transcription activator-like effector toolbox for genome engineering Nature Protocols 7, 171-192 (2012) doi:10.1038/nprot.2011.431)
[0418] By using the general cloning strategy outlined above, AAV vectors containing different promoters, effector domains and TALE monomer sequences can be easily constructed.
Nucleotide Sequences:
TABLE-US-00022
[0419] Left AAV ITR (SEQ ID NO: 182) Cctgcaggcagctgcgcgctcgctcgctcactgaggccgcccgggcaaagcccgggcgtcgggc gacctttggtcgcccggcctcagtgagcgagcgagcgcgcagagagggagtggccaactccatc actaggggttcct_ Right AAV ITR (SEQ ID NO: 183) Aggaacccctagtgatggagttggccactccctctctgcgcgctcgctcgctcactgaggccgg gcgaccaaaggtcgcccgacgcccgggctttgcccgggcggcctcagtgagcgagcgagcgcgc agctgcctgcagg_ hSyn promoter (SEQ ID NO: 184) gtgtctagactgcagagggccctgcgtatgagtgcaagtgggttttaggaccaggatgaggcgg ggtgggggtgcctacctgacgaccgaccccgacccactggacaagcacccaacccccattcccc aaattgcgcatcccctatcagagagggggaggggaaacaggatgcggcgaggcgcgtgcgcact gccagcttcagcaccgcggacagtgccttcgcccccgcctggcggcgcgcgccaccgccgcctc agcactgaaggcgcgctgacgtcactcgccggtcccccgcaaactccccttcccggccaccttg gtcgcgtccgcgccgccgccggcccagccggaccgcaccacgcgaggcgcgagataggggggca cgggcgcgaccatctgcgctgcggcgccggcgactcagcgctgcctcagtctgcggtgggcagc ggaggagtcgtgtcgtgcctgagagcgcagtcgagaa_ TALE N-term (+136 AA truncation) (SEQ ID NO: 185) GTAGATTTGAGAACTTTGGGATATTCACAGCAGCAGCAGGAAAAGATCAAGCCCAAAGTGAGGT CGACAGTCGCGCAGCATCACGAAGCGCTGGTGGGTCATGGGTTTACACATGCCCACATCGTAGC CTTGTCGCAGCACCCTGCAGCCCTTGGCACGGTCGCCGTCAAGTACCAGGACATGATTGCGGCG TTGCCGGAAGCCACACATGAGGCGATCGTCGGTGTGGGGAAACAGTGGAGCGGAGCCCGAGCGC TTGAGGCCCTGTTGACGGTCGCGGGAGAGCTGAGAGGGCCTCCCCTTCAGCTGGACACGGGCCA GTTGCTGAAGATCGCGAAGCGGGGAGGAGTCACGGCGGTCGAGGCGGTGCACGCGTGGCGCAAT GCGCTCACGGGAGCACCCCTCAAC_ TALE C-term (+63 AA truncation) (SEQ ID NO: 186) CGGACCCCGCGCTGGCCGCACTCACTAATGATCATCTTGTAGCGCTGGCCTGCCTCGGCGGACG ACCCGCCTTGGATGCGGTGAAGAAGGGGCTCCCGCACGCGCCTGCATTGATTAAGCGGACCAAC AGAAGGATTCCCGAGAGGACATCACATCGAGTGGCA_ Ampicillin resistance gene (SEQ ID NO: 187) atgagtattcaacatttccgtgtcgcccttattcccttttttgcggcattttgccttcctgttt ttgctcacccagaaacgctggtgaaagtaaaagatgctgaagatcagttgggtgcacgagtggg ttacatcgaactggatctcaacagcggtaagatccttgagagttttcgccccgaagaacgtttt ccaatgatgagcacttttaaagttctgctatgtggcgcggtattatcccgtattgacgccgggc aagagcaactcggtcgccgcatacactattctcagaatgacttggttgagtactcaccagtcac agaaaagcatcttacggatggcatgacagtaagagaattatgcagtgctgccataaccatgagt gataacactgcggccaacttacttctgacaacgatcggaggaccgaaggagctaaccgcttttt tgcacaacatgggggatcatgtaactcgccttgatcgttgggaaccggagctgaatgaagccat accaaacgacgagcgtgacaccacgatgcctgtagcaatggcaacaacgttgcgcaaactatta actggcgaactacttactctagcttcccggcaacaattaatagactggatggaggcggataaag ttgcaggaccacttctgcgctcggcccttccggctggctggtttattgctgataaatctggagc cggtgagcgtgggtctcgcggtatcattgcagcactggggccagatggtaagccctcccgtatc gtagttatctacacgacggggagtcaggcaactatggatgaacgaaatagacagatcgctgaga taggtgcctcactgattaagcattgg_
Example 9
DNA Ratios
[0420] In this application, Applicants provide for varying plasmid ratios. The ratios of vector of interest plasmid: AAV serotype plasmid: pHelper plasmid may be varied. Specific values used in examples above are: 1:1.7:2 for AAV supernatant production down to 24-well scale. Values that may be used for production in 96-well format are: 1:2:1. Values may be varied in a wider range (e.g. up to fivefold excess of one plasmid) if desired.
[0421] Scalability
[0422] The present invention also comprehends AAV supernatant production as described herein being easily scaled up into higher throughput formats. The examples listed describe scaling from 15 cm dishes to 96-well plates for production. Through the same principle of scaling it may be possible to produce AAV in more dense well plate formats (e.g. 384-well, 1536-well etc.). The invention further comprehends using this process in even smaller volume units as would be possible with e.g. a microfluidic device capable of maintaining cell cultures in individual chambers. Hence, the present invention allows for an unprecedented throughput of production of different AAV viral particles. Applicants submit that one further important advantage of the invention described is that due to the highly efficient recovery of functional viral particles (due to minimal loss compared to extensive purification procedures traditionally used) AAV supernatant can be produced at the same scale as it will be applied. This is especially relevant for automated processing as it provides not only a simplified production and application process but also reduces the possibility for variability. In a preferred embodiment, the invention comprehends the automated production of 96 different AAV particles in 96-well plate format and application of the harvested supernatant to 3 replicate plates of cells to be transduced. This requires minimal pipetting steps, no necessary rearrangement (entire plates of virus can be applied to cells with a 96-channel pipette head) and minimal chance of pipetting error.
[0423] Filtering/Purification
[0424] Multiple methods may be used to purify the cell supernatant containing AAV particles after harvest and before application to cells for transduction. For a basic purification which mostly serves to remove any potential 293FT cells and large cell debris from the supernatant, filtration with a 22 micron or 45 micron pore size low protein binding filter or centrifugation for pelleting cells and cell debris may be employed. In the case of filtration, the flow-through will be harvested and used subsequently and in the case of centrifugation (at speeds in a range of e.g. 200 g for 10 min to 6000 g for 1-10 min) the supernatant will be used. In cases where more stringent purification is desired (e.g. for particularly sensitive cell types such as human ES cells or in a clinical application) it may be possible to follow up with subsequent purification steps. In an aspect of the invention, a sequence of molecular weight cutoff filters may be used (e.g. Amicon filters, millipore).
[0425] FBS Substitutes
[0426] The use of fetal bovine serum in the production of supernatant AA V may prove problematic for certain downstream applications. For example, the application of FBS-containing AAV supernatant to embryonic stem cells would result in uncontrolled differentiation of the pluripotent cultures. Also, the use of undefined FBS is incompatible with human clinical applications. In order to mitigate the issues arising from the use of FBS, the invention comprehends the culture medium used to support the AAV producing 293FT cells being replaced with a chemically-defined serum-free medium. For example, Pro293a from Lanza Biologics is a chemically-defined, serum-free medium designed to support the growth and protein production of adherent 293 lineage cells. With regards to the AAV supernatant production protocol details in the examples herein, all media components would simply be replaced with Pro293a or another suitable medium substitute.
[0427] Reasons to Use AAV
[0428] Non-integration: A major motivation for the use of AAV in the field of gene therapy is the relative lack of random genomic integration compared to lentivirus, retrovirus, and other integrating viral vectors. The majority of transduced recombinant AAV genetic material exists in the host cell as episomes, rather than at randomly integrated chromosomal locations. In human cells, if the appropriate helper genes are provided, the AAV genome can integrate at the well-characterized safe harbor locus AAVS 1. These characteristics reduce the chance for oncogenic integration, making AAV the current preferred viral system for human gene therapy. The non-integration of AAV also provides advantages for functional genomic studies. By providing trans genes or expression modulation systems via AAV, rather than an integrating virus, one can be assured that the cell population being used maintains an otherwise isogenic background.
[0429] Functional Genomics: Cell Type Addressability
[0430] The generation of large libraries of RNAi, ORFs, targeted nucleases (ZFNs, TALENs, CRISPR/Cas9), transcriptional modulators (TALE-TFs, CRISPR/dCAS9 effectors), and other gene expression tools has enabled large-scale arrayed functional genomics. These types of experiments, however, are limited to cell types to which such gene expression tools can be delivered in high-throughput. The high-throughput scalability of Applicants' AAV supernatant production protocol allows for the application of functional genomics techniques to cell types for which AAV is the ideal delivery mechanism. For example, AAV may be used to transduce primary cortical neurons with higher efficiency than lentiviral transduction or plasmid transfection, with lower toxicity than lentiviral delivery.
[0431] Pooling
[0432] The herein described AAV supernatant production method may be used to generate functional, pooled AAV supernatant. In an embodiment of the invention, several genes of interest, encoded on separate AAV backbone plasmids can be pooled at the plasmid stage to produce a final supernatant containing a mixture of the desired AAV vectors. Several types of gene delivery applications may benefit from a pooling approach. First, some experiments in which a large number of viral vectors must be functionally tested could be performed in a hierarchical pooled fashion. For example, groups of multiple RNAi or ORFs could be delivered in pooled AAV format to reduce the size of the initial search space, saving experimental time and cost. Second, complicated multicomponent gene expression systems may be produced via a pooled AAV format. For example, the differentiation of embryonic stem cells or reprogramming of one cell type to another often requires the delivery of numerous transcription factors simultaneously. Methods of the invention encompassing pooled AAV supernatant production could rapidly provide many different transcription factor combinations, simply by altering the mixtures of AAV backbone plasmids, which may be automated by liquid handling robotics. Third, artificial transcription factors, such as TALE-TFs and CRISPR/Cas9 activators, have been shown to have synergistic effects when provided in combination to target cells. Pooled AAV supernatant production could rapidly provide many different TALE-TF, CRISPR/Cas9, or other engineered gene expression modulators, simply by altering the mixtures of AAV backbone plasmids. This approach has been validated for pooled TALE-TFs designed to activate gene expression in mouse primary cortical neurons. Ten separate TALE-VP64 activators designed to target the Drd2 locus were produced by Applicants' standard AAV supernatant production method. Simultaneously, an equimolar mixture of all10 Drd2 targeting TALE-VP64 plasmids was made, referred to as the "10 TALE mixture". The identical AAV supernatant production protocol was used produce the pooled AAV mixture, with the exception that the gene of interest backbone plasmid was replaced by an equal mass of "10 TALE mixture" plasmids. All AAV supernatants were harvested and applied to mouse primary neuron cultures as previously described. Six days after transduction, cell lysis, reverse transcription and qPCR were performed on the neuron cultures to determine the expression levels of Drd2. Gene expression levels were elevated for several of the TALE-VP64 transduced cultures. The culture transduced with supernatant from the "10 TALE mixture" was found to activate expression from the Drd2 locus at a level equivalent to the most potent individual TALE-VP64.
[0433] Multiple Harvests
[0434] Multiple supernatant AAV batches may be harvested from a single AAV producing 293FT culture. Specifically, following the 48 hour post-transfection harvested described in Applicants' standard AAV supernatant protocol, the culture medium may be replenished and harvested again 24 hours later (72 hours post-transfection). Both harvests contain functional AAV particles. In this presently described multiple harvest protocol, the value of producing twice as much AAV supernatant as Applicants' standard protocol saves time and resources when producing many AAV cultures in an arrayed format. This approach offers an advantage over current large-scale AAV production methods. In current methods, the amount of AAV that can be produced is limited by the mass of 293 cells producing the viral particles, as these methods typically require lysing the producer cells to harvest the AAV particles. By stably expressing the AAV expression plasmids in a 293 producer cell line, one could continually harvest AAV supernatant batches simply by maintaining the cell cultures, periodically collecting the supernatant, and replenishing the culture medium.
[0435] In additional embodiments, the invention comprises a method for obtaining and optionally storing a sample containing a set amount of a Dependovirus-based vector comprising or consisting essentially of: (a) creating infected or transfected cells by a process comprising or consisting essentially of one or more methods selected from: (i) transfecting plasmid(s) containing or consisting essentially of exogenous DNA including DNA for expression into Dependovirus-based vector-infected cells along with another helper plasmid that provides Dependovirus rep and/or cap genes which are obligatory for replication and packaging of the Dependovirus-based vector; or (ii) infecting susceptible cells with a Dependovirus-based vector containing or consisting essentially of exogenous DNA including DNA for expression, and helper virus wherein the Dependovirus-based vector lacks functioning cap and/or rep and the helper virus provides the cap and/or rev function that the Dependovirus-based vector lacks; or (iii) infecting susceptible cells with a Dependovirus-based vector containing or consisting essentially of exogenous DNA including DNA for expression, wherein the recombinant construct lacks functioning cap and/or rep, and transfecting said cells with a plasmid supplying cap and/or rep function that the Dependovirus-based vector lacks; or (iv) infecting susceptible cells with a Dependovirus-based vector containing or consisting essentially of exogenous DNA including DNA for expression, wherein the recombinant construct lacks functioning cap and/or rep, wherein said cells supply cap and/or rep function that the recombinant construct lacks; or (v) transfecting the susceptible cells with a Dependovirus-based vector lacking functioning cap and/or rep and plasmids for inserting exogenous DNA into the recombinant construct so that the exogenous DNA is expressed by the recombinant construct and for supplying rep and/or cap functions whereby transfection results in a Dependovirus-based vector containing or consisting essentially of the exogenous DNA including DNA for expression that lacks functioning cap and/or rep; and (b) incubating the infected or transfected cells, whereby there results infected or transfected cells and supernatant containing the Dependovirus-based vector lacking functioning cap and/or rep; (c) after incubating, extracting an aliquot from the supernatant; (d) filtering the aliquot, whereby the filtered aliquot contains and the method obtains a sample containing set amount of the Dependovirus-based vector relative to the type and amount of susceptible cells infected or transfected; and (e) optionally freezing the filtered aliquot, whereby the method optionally includes storing a sample containing set amount of the Dependovirus-based vector relative to the type and amount of susceptible cells infected or transfected.
[0436] In one aspect, the Dependovirus-based vector of the invention is derived from one or more Dependoviruses selected from one or more of: adeno associated virus (AAV), Adenovirus, parvovirus, Erythrovirus, Bocavirus and the like. In one aspect, the Dependovirus-based vector of the invention is derived from a recombinant adeno associated virus (rAAV).
[0437] The invention is further described by the following numbered paragraphs:
[0438] 1. A method for obtaining and optionally storing a sample containing a set amount of rAAV comprising or consisting essentially of:
[0439] (a) creating infected or transfected cells by a process comprising or consisting essentially of one or more methods selected from:
[0440] (i) transfecting plasmid(s) containing or consisting essentially of exogenous DNA including DNA for expression into AAV-infected cells along with another helper plasmid that provides AAV rep and/or cap genes which are obligatory for replication and packaging of the rAAV; or
[0441] (ii) infecting susceptible cells with a rAAV containing or consisting essentially of exogenous DNA including DNA for expression, and helper virus wherein the rAAV lacks functioning cap and/or rep and the helper virus provides the cap and/or rev function that the rAAV lacks; or
[0442] (iii) infecting susceptible cells with a rAAV containing or consisting essentially of exogenous DNA including DNA for expression, wherein the recombinant construct lacks functioning cap and/or rep, and transfecting said cells with a plasmid supplying cap and/or rep function that the rAAV lacks; or
[0443] (iv) infecting susceptible cells with a rAAV containing or consisting essentially of exogenous DNA including DNA for expression, wherein the recombinant construct lacks functioning cap and/or rep, wherein said cells supply cap and/or rep function that the recombinant construct lacks; or
[0444] (v) transfecting the susceptible cells with an AAV lacking functioning cap and/or rep and plasmids for inserting exogenous DNA into the recombinant construct so that the exogenous DNA is expressed by the recombinant construct and for supplying rep and/or cap functions whereby transfection results in an rAAV containing or consisting essentially of the exogenous DNA including DNA for expression that lacks functioning cap and/or rep; and
[0445] (b) incubating the infected or transfected cells, whereby there results infected or transfected cells and supernatant containing the rAAV lacking functioning cap and/or rep;
[0446] (c) after incubating, extracting an aliquot from the supernatant;
[0447] (d) filtering the aliquot, whereby the filtered aliquot contains and the method obtains a sample containing set amount of the rAAV relative to the type and amount of susceptible cells infected or transfected; and
[0448] (e) optionally freezing the filtered aliquot,
whereby the method optionally includes storing a sample containing set amount of the rAAV relative to the type and amount of susceptible cells infected or transfected.
[0449] 2. A method for screening rAAV comprising or consisting essentially of,
[0450] preparing the filtered aliquot or the stored filtered aliquot of paragraph 1,
[0451] if necessary, thawing the stored filtered aliquot,
[0452] contacting the filtered aliquot with cells, and
[0453] determining whether the exogenous DNA is expressed in an amount and/or duration sufficient for an intended use.
[0454] 3. The method of paragraph 2 wherein the contacting of the filtered aliquot with cells comprises or consists essentially of transducing said cells.
[0455] 4. The method of paragraph 3 wherein the contacting is for 5-6 days.
[0456] 5. The method of paragraph 2 wherein the rAAV expresses a TALE and the contacting includes or consists essentially of detecting nuclease, activator or repressor activity.
[0457] 6. The method of paragraph 2 wherein the rAAV expresses a LITE, and the contacting includes or consists essentially of inducing gene expression or subjecting the contacted cells to a suitable stimulus, and detecting whether a transcriptional effector has been induced.
[0458] 7. The method of paragraph 6 wherein detecting whether a transcriptional effector has been induced includes or consists essentially of detecting a color change.
[0459] 8. The method of paragraph 2 wherein the rAAV expresses a CRISPR system, and the contacting includes or consists essentially of detecting gene knockdown or other effects of the CRISPR system.
[0460] 9. The method of paragraph 1 or 2 wherein the AAV is AAV1, AAV2, AAV5 or an AAV having a hybrid or mosaic AAV1, AAV2 and/or AAV5 capsid.
[0461] 10. The method of paragraph 1 or 2 wherein the susceptible cells are 293FT cells.
[0462] 11. The method of paragraph 10 wherein 2×105 cells are transfected or infected.
[0463] 12. The method of paragraph 11 wherein a 250 μL filtered aliquot contains the recombinant AAV at a concentration of about 5.6+/-0.24×105.
[0464] 13. The method of any one of paragraphs 1 or 2 including freezing the filtered aliquot.
[0465] 14. The method of paragraph 13 wherein the filtered aliquot is frozen at about -80 C.
[0466] 15. The method of any one of paragraphs 1 or 2 including adding a secretion enhancer to the cells before, during or after and within the incubating.
[0467] 16. The method of paragraph 15 wherein the secretion enhancer is polyethylenimine (PEI).
[0468] 17. A method of high-throughput screening of a sample comprising or consisting essentially of contacting the supernatant containing the rAAV lacking functioning cap and/or rep of any one of paragraphs 1-16 with the sample and determining whether the exogenous DNA of paragraph 1 is present in the sample.
[0469] 18. The method of paragraph 17, wherein the supernatant is thawed from the filtered aliquot.
[0470] Having thus described in detail preferred embodiments of the present invention, it is to be understood that the invention defined by the above paragraphs is not to be limited to particular details set forth in the above description as many apparent variations thereof are possible without departing from the spirit or scope of the present invention.
Sequence CWU
1
1
350134PRTArtificial SequenceDescription of Artificial Sequence Synthetic
polypeptide 1Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser Asn Gly Gly
Gly Lys 1 5 10 15
Gln Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln Ala
20 25 30 His Gly
214DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 2tttattccct gacc
14332PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 3Leu Thr Pro Asp Gln Val Val Ala Ile
Ala Ser Gly Gly Lys Gln Ala 1 5 10
15 Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln Asp
His Gly 20 25 30
432PRTArtificial SequenceDescription of Artificial Sequence Synthetic
polypeptide 4Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln
Ala 1 5 10 15 Leu
Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly
20 25 30 532PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
5Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 632PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
6Leu Thr Pro Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 732PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
7Leu Thr Pro Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 832PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
8Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Glu Gln His Gly 20
25 30 932PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
9Leu Thr Pro Asp Gln Val Val Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 1032PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
10Leu Thr Leu Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 1132PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
11Leu Thr Pro Gln Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 1232PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
12Leu Thr Pro Asp Gln Val Val Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 1332PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
13Leu Thr Pro Asn Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 1432PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
14Leu Thr Leu Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 1532PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
15Leu Thr Pro Ala Gln Val Val Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 1632PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
16Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Ala Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 1732PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
17Leu Thr Leu Asp Gln Val Val Ala Ile Ala Ser Gly Ser Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 1832PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
18Leu Thr Gln Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 1932PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
19Leu Ser Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 2032PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
20Leu Thr Pro Asp Gln Val Val Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Leu
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 2132PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
21Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Leu
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 2232PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
22Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Arg Gln Ala His Gly 20
25 30 2332PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
23Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Asn Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 2432PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
24Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Ala Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 2532PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
25Leu Thr Pro Ala Gln Val Val Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 2632PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
26Leu Thr Leu Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 2732PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
27Leu Thr Pro Glu Gln Val Val Ala Ile Ala Cys Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 2832PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
28Leu Thr Pro Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Gln Leu Leu Pro Val Leu Cys Glu Gln His Gly 20
25 30 2932PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
29Leu Thr Pro Gln Gln Val Val Ala Ile Ala Ser Gly Gly Arg Pro Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 3032PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
30Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Ser Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 3132PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
31Leu Thr Pro Asn Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 3232PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
32Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Gly Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 3332PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
33Leu Thr Leu Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 3432PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
34Leu Thr Pro Ala Gln Ala Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 3532PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
35Leu Thr Pro Ala Gln Val Val Ala Ile Ala Ser Gly Gly Asn Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 3632PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
36Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Leu
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 3732PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
37Leu Thr Pro Asp Gln Val Val Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Leu
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 3832PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
38Leu Thr Pro Asp Gln Val Val Thr Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 3932PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
39Leu Thr Pro Ala Gln Val Val Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Arg Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 4032PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
40Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Asn Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 4132PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
41Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Thr His Gly 20
25 30 4232PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
42Leu Pro Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 4332PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
43Leu Thr Ser Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 4432PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
44Leu Thr Pro Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Glu Gln His Gly 20
25 30 4532PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
45Leu Ile Pro Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 4632PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
46Leu Thr Pro Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Met
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 4732PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
47Leu Thr Arg Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 4832PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
48Leu Thr Pro Asp Gln Val Val Ala Thr Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 4932PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
49Leu Ile Pro Asp Gln Val Val Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 5032PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
50Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asn His Gly 20
25 30 5132PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
51Leu Thr Leu Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Lys Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 5232PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
52Leu Thr Pro Asp Gln Leu Val Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 5332PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
53Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Gly His Gly 20
25 30 5432PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
54Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Glu His Gly 20
25 30 5532PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
55Leu Thr Leu Asp Lys Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 5632PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
56Leu Thr Pro Ala Gln Val Val Ala Ile Ala Ser Gly Ser Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 5732PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
57Leu Thr Pro Asp Lys Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 5832PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
58Leu Thr Gln Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Tyr Gln Asp His Gly 20
25 30 5932PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
59Leu Thr Pro Ala Gln Val Val Ala Ile Val Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 6032PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
60Leu Thr Pro Asp Lys Val Val Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 6132PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
61Leu Thr Gln Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 6232PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
62Leu Thr Pro Asp Gln Val Met Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 6332PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
63Leu Thr Thr Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 6432PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
64Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Ser Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 6532PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
65Leu Thr Pro Asp Gln Val Val Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Leu Val Leu Cys Gln Ala His Gly 20
25 30 6632PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
66Leu Thr Gln Glu Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 6732PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
67Leu Thr Pro Asp Gln Val Val Thr Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 6832PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
68Leu Ser Pro Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys His Asp His Gly 20
25 30 6932PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
69Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Met Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 7032PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
70Leu Ile Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 7132PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
71Leu Thr Pro Val Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 7232PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
72Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Lys Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 7332PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
73Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Met
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 7432PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
74Leu Thr Pro Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Phe Pro Val Leu Cys Gln Asp His Gly 20
25 30 7514DNAHomo sapiens 75tttattccct
gaca 147618DNAHomo
sapiens 76tcggcccctg ccggccca
187720DNAMus musculus 77tgcctgccct ccaggctcct
207840DNAHomo sapiens 78aaacggaagg gcctgagtcc
gagcagaaga agaagtttta 407940DNAHomo sapiens
79aggaggaagg gcctgagtcc gagcagaaga agaagggctc
408040DNAHomo sapiens 80gagcccttct tcttctgctc ggactcaggc ccttcctcct
408126RNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 81gaguccgagc agaagaagaa guuuua
268239DNAHomo sapiens 82aggaggaagg
gcctgagtcc gagcagaaga gaagggctc 398339DNAHomo
sapiens 83ggaggaaggg cctgagtccg agcagaagaa gaagggctc
398438DNAHomo sapiens 84ggaggaaggg cctgagtccg agcagaagag aagggctc
388540DNAHomo sapiens 85ggaggaaggg cctgagtccg
agcagaagaa agaagggctc 408637DNAHomo sapiens
86ggaggaaggg cctgagtccg agcagaagga agggctc
378736DNAHomo sapiens 87ggaggaaggg cctgagtccg agcagaagaa gggctc
368833DNAHomo sapiens 88ggaggaaggg cctgagtccg
agcagaaggg ctc 338933DNAHomo sapiens
89ggaggaaggg cctgagcccg agcagaaggg ctc
3390122DNAHomo sapiens 90ggaggaaggg cctgagtccg agcagaagaa gaagggctcc
catcacatca accggtggcg 60cattgccacg aagcaggcca atggggagga catcgatgtc
acctccaatg actagggtgg 120gc
12291122DNAHomo sapiens 91gcccacccta gtcattggag
gtgacatcga tgtcctcccc attggcctgc ttcgtggcaa 60tgcgccaccg gttgatgtga
tgggagccct tcttcttctg ctcggactca ggcccttcct 120cc
1229248RNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
92acnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnguuuuaga gcuaugcu
489367DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 93agcauagcaa guuaaaauaa ggctaguccg uuaucaacuu
gaaaaagugg caccgagucg 60gugcuuu
679462RNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 94nnnnnnnnnn
nnnnnnnnnn guuuuagagc uagaaauagc aaguuaaaau aaggcuaguc 60cg
629548DNAHomo
sapiens 95ctggaggagg aagggcctga gtccgagcag aagaagaagg gctcccat
489648DNAHomo sapiens 96atgggagccc ttcttcttct gctcggactc aggcccttcc
tcctccag 489730RNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 97gaguccgagc
agaagaagaa guuuuagagc 309820RNAHomo
sapiens 98gaguccgagc agaagaagau
209920RNAHomo sapiens 99gaguccgagc agaagaagua
2010020RNAHomo sapiens 100gaguccgagc agaagaacaa
2010120RNAHomo sapiens
101gaguccgagc agaagaugaa
2010220RNAHomo sapiens 102gaguccgagc agaaguagaa
2010320RNAHomo sapiens 103gaguccgagc agaugaagaa
2010420RNAHomo sapiens
104gaguccgagc acaagaagaa
2010520RNAHomo sapiens 105gaguccgagg agaagaagaa
2010620RNAHomo sapiens 106gaguccgugc agaagaagaa
2010720RNAHomo sapiens
107gagucggagc agaagaagaa
2010820RNAHomo sapiens 108gagaccgagc agaagaagaa
2010924DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 109aatgacaagc
ttgctagcgg tggg 2411039DNAHomo
sapiens 110aaaacggaag ggcctgagtc cgagcagaag aagaagttt
3911139DNAHomo sapiens 111aaacaggggc cgagattggg tgttcagggc
agaggtttt 3911238DNAHomo sapiens 112aaaacggaag
ggcctgagtc cgagcagaag aagaagtt 3811340DNAHomo
sapiens 113aacggaggga ggggcacaga tgagaaactc agggttttag
4011438DNAHomo sapiens 114agcccttctt cttctgctcg gactcaggcc
cttcctcc 3811540DNAHomo sapiens 115cagggaggga
ggggcacaga tgagaaactc aggaggcccc 4011638DNAHomo
sapiens 116ggaggaaggg cctgagtccg agcagaagaa gaagggct
3811740DNAHomo sapiens 117ggggcctcct gagtttctca tctgtgcccc
tccctccctg 4011880DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
118ggcaatgcgc caccggttga tgtgatggga gcccttctag gaggccccca gagcagccac
60tggggcctca acactcaggc
8011998DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 119ggacgaaaca ccggaaccat tcaaaacagc atagcaagtt
aaaataaggc tagtccgtta 60tcaacttgaa aaagtggcac cgagtcggtg cttttttt
98120186DNAArtificial SequenceDescription of
Artificial Sequence Synthetic polynucleotide 120ggacgaaaca
ccggtagtat taagtattgt tttatggctg ataaatttct ttgaatttct 60ccttgattat
ttgttataaa agttataaaa taatcttgtt ggaaccattc aaaacagcat 120agcaagttaa
aataaggcta gtccgttatc aacttgaaaa agtggcaccg agtcggtgct 180tttttt
18612173DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 121tgaatggtcc caaaacggaa gggcctgagt
ccgagcagaa gaagaagttt tagagctatg 60ctgttttgaa tgg
7312295DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
122gggttttaga gctatgctgt tttgaatggt cccaaaacgg gtcttcgaga agacgtttta
60gagctatgct gttttgaatg gtcccaaaac ttttt
9512395DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 123aaaaagtttt gggaccattc aaaacagcat agctctaaaa
cgtcttctcg aagacccgtt 60ttgggaccat tcaaaacagc atagctctaa aaccc
9512436DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 124aaacnnnnnn
nnnnnnnnnn nnnnnnnnnn nnnngt
3612536DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 125taaaacnnnn nnnnnnnnnn nnnnnnnnnn nnnnnn
3612684DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 126gtggaaagga
cgaaacaccg ggtcttcgag aagacctgtt ttagagctag aaatagcaag 60ttaaaataag
gctagtccgt tttt
8412784DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 127aaaaacggac tagccttatt ttaacttgct atttctagct
ctaaaacagg tcttctcgaa 60gacccggtgt ttcgtccttt ccac
8412824DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 128caccgnnnnn
nnnnnnnnnn nnnn
2412924DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 129aaacnnnnnn nnnnnnnnnn nnnc
2413069DNAHomo sapiens 130ctggtcttcc acctctctgc
cctgaacacc caatctcggc ccctctcgcc accctcctgc 60atttctgtt
6913169DNAHomo sapiens
131aacagaaatg caggagggtg gcgagagggg ccgagattgg gtgttcaggg cagagaggtg
60gaagaccag
69132138DNAMus musculus 132acccaagcac tgagtgccat tagctaaatg catagggtac
cacccacagg tgccaggggc 60ctttcccaaa gttcccagcc ccttctccaa cctttcctgg
cccagaggct ttcccatgtg 120tgtggctgga ccctttga
138133138DNAMus musculus 133tcaaagggtc cagccacaca
catgggaaag cctctgggcc aggaaaggtt ggagaagggg 60ctgggaactt tgggaaaggc
ccctggcacc tgtgggtggt accctatgca tttagctaat 120ggcactcagt gcttgggt
13813446RNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
134nnnnnnnnnn nnnnnnnnng uuauuguacu cucaagauuu auuuuu
4613591RNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 135guuacuuaaa ucuugcagaa gcuacaaaga uaaggcuuca
ugccgaaauc aacacccugu 60cauuuuaugg caggguguuu ucguuauuua a
9113670DNAHomo sapiens 136ttttctagtg ctgagtttct
gtgactcctc tacattctac ttctctgtgt ttctgtatac 60tacctcctcc
7013770DNAHomo sapiens
137ggaggaggta gtatacagaa acacagagaa gtagaatgta gaggagtcac agaaactcag
60cactagaaaa
701387DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 138nnagaaw
713934PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 139Leu Thr Pro Glu Gln Val Val Ala
Ile Ala Ser Xaa Xaa Gly Gly Lys 1 5 10
15 Gln Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu
Cys Gln Ala 20 25 30
His Gly 14014DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 140tgcaagagta ggag
1414114DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 141tctgcaagag tagg
1414214DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
142ttggaggagc acca
1414314DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 143tgcactccac cttg
1414414DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 144tcaagcagct tctc
1414514DNAArtificial
SequenceDescription of Artificial Sequence Synthetic oligonucleotide
145tcagagctgt cctc
1414620DNAArtificial SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 146tgcctgccct ccaggctcct
20147288PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 147Met Asp Pro Ile Arg Ser
Arg Thr Pro Ser Pro Ala Arg Glu Leu Leu 1 5
10 15 Ser Gly Pro Gln Pro Asp Gly Val Gln Pro Thr
Ala Asp Arg Gly Val 20 25
30 Ser Pro Pro Ala Gly Gly Pro Leu Asp Gly Leu Pro Ala Arg Arg
Thr 35 40 45 Met
Ser Arg Thr Arg Leu Pro Ser Pro Pro Ala Pro Ser Pro Ala Phe 50
55 60 Ser Ala Asp Ser Phe Ser
Asp Leu Leu Arg Gln Phe Asp Pro Ser Leu 65 70
75 80 Phe Asn Thr Ser Leu Phe Asp Ser Leu Pro Pro
Phe Gly Ala His His 85 90
95 Thr Glu Ala Ala Thr Gly Glu Trp Asp Glu Val Gln Ser Gly Leu Arg
100 105 110 Ala Ala
Asp Ala Pro Pro Pro Thr Met Arg Val Ala Val Thr Ala Ala 115
120 125 Arg Pro Pro Arg Ala Lys Pro
Ala Pro Arg Arg Arg Ala Ala Gln Pro 130 135
140 Ser Asp Ala Ser Pro Ala Ala Gln Val Asp Leu Arg
Thr Leu Gly Tyr 145 150 155
160 Ser Gln Gln Gln Gln Glu Lys Ile Lys Pro Lys Val Arg Ser Thr Val
165 170 175 Ala Gln His
His Glu Ala Leu Val Gly His Gly Phe Thr His Ala His 180
185 190 Ile Val Ala Leu Ser Gln His Pro
Ala Ala Leu Gly Thr Val Ala Val 195 200
205 Lys Tyr Gln Asp Met Ile Ala Ala Leu Pro Glu Ala Thr
His Glu Ala 210 215 220
Ile Val Gly Val Gly Lys Gln Trp Ser Gly Ala Arg Ala Leu Glu Ala 225
230 235 240 Leu Leu Thr Val
Ala Gly Glu Leu Arg Gly Pro Pro Leu Gln Leu Asp 245
250 255 Thr Gly Gln Leu Leu Lys Ile Ala Lys
Arg Gly Gly Val Thr Ala Val 260 265
270 Glu Ala Val His Ala Trp Arg Asn Ala Leu Thr Gly Ala Pro
Leu Asn 275 280 285
148183PRTArtificial SequenceDescription of Artificial Sequence Synthetic
polypeptide 148Arg Pro Ala Leu Glu Ser Ile Val Ala Gln Leu Ser Arg
Pro Asp Pro 1 5 10 15
Ala Leu Ala Ala Leu Thr Asn Asp His Leu Val Ala Leu Ala Cys Leu
20 25 30 Gly Gly Arg Pro
Ala Leu Asp Ala Val Lys Lys Gly Leu Pro His Ala 35
40 45 Pro Ala Leu Ile Lys Arg Thr Asn Arg
Arg Ile Pro Glu Arg Thr Ser 50 55
60 His Arg Val Ala Asp His Ala Gln Val Val Arg Val Leu
Gly Phe Phe 65 70 75
80 Gln Cys His Ser His Pro Ala Gln Ala Phe Asp Asp Ala Met Thr Gln
85 90 95 Phe Gly Met Ser
Arg His Gly Leu Leu Gln Leu Phe Arg Arg Val Gly 100
105 110 Val Thr Glu Leu Glu Ala Arg Ser Gly
Thr Leu Pro Pro Ala Ser Gln 115 120
125 Arg Trp Asp Arg Ile Leu Gln Ala Ser Gly Met Lys Arg Ala
Lys Pro 130 135 140
Ser Pro Thr Ser Thr Gln Thr Pro Asp Gln Ala Ser Leu His Ala Phe 145
150 155 160 Ala Asp Ser Leu Glu
Arg Asp Leu Asp Ala Pro Ser Pro Met His Glu 165
170 175 Gly Asp Gln Thr Arg Ala Ser
180 14918DNAMus musculus 149tgaatgatga taatacga
1815011PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 150Ser
Pro Lys Lys Lys Arg Lys Val Glu Ala Ser 1 5
10 1517PRTSimian virus 40 151Pro Lys Lys Lys Arg Lys Val 1
5 15216PRTUnknownDescription of Unknown
Nucleoplasmin bipartite NLS sequence 152Lys Arg Pro Ala Ala Thr Lys Lys
Ala Gly Gln Ala Lys Lys Lys Lys 1 5 10
15 1539PRTUnknownDescription of Unknown C-myc NLS
sequence 153Pro Ala Ala Lys Arg Val Lys Leu Asp 1 5
15411PRTUnknownDescription of Unknown C-myc NLS sequence
154Arg Gln Arg Arg Asn Glu Leu Lys Arg Ser Pro 1 5
10 15538PRTHomo sapiens 155Asn Gln Ser Ser Asn Phe Gly Pro
Met Lys Gly Gly Asn Phe Gly Gly 1 5 10
15 Arg Ser Ser Gly Pro Tyr Gly Gly Gly Gly Gln Tyr Phe
Ala Lys Pro 20 25 30
Arg Asn Gln Gly Gly Tyr 35
15642PRTUnknownDescription of Unknown IBB domain from importin-alpha
sequence 156Arg Met Arg Ile Glx Phe Lys Asn Lys Gly Lys Asp Thr Ala Glu
Leu 1 5 10 15 Arg
Arg Arg Arg Val Glu Val Ser Val Glu Leu Arg Lys Ala Lys Lys
20 25 30 Asp Glu Gln Ile Leu
Lys Arg Arg Asn Val 35 40
1578PRTUnknownDescription of Unknown Myoma T protein sequence 157Val
Ser Arg Lys Arg Pro Arg Pro 1 5
1588PRTUnknownDescription of Unknown Myoma T protein sequence 158Pro
Pro Lys Lys Ala Arg Glu Asp 1 5 1598PRTHomo
sapiens 159Pro Gln Pro Lys Lys Lys Pro Leu 1 5
16012PRTMus musculus 160Ser Ala Leu Ile Lys Lys Lys Lys Lys Met Ala Pro
1 5 10 1615PRTInfluenza virus
161Asp Arg Leu Arg Arg 1 5 1627PRTInfluenza virus 162Pro
Lys Gln Lys Lys Arg Lys 1 5 16310PRTHepatitus
delta virus 163Arg Lys Leu Lys Lys Lys Ile Lys Lys Leu 1 5
10 16410PRTMus musculus 164Arg Glu Lys Lys Lys Phe Leu
Lys Arg Arg 1 5 10 16520PRTHomo sapiens
165Lys Arg Lys Gly Asp Glu Val Asp Gly Val Asp Glu Val Ala Lys Lys 1
5 10 15 Lys Ser Lys Lys
20 16617PRTHomo sapiens 166Arg Lys Cys Leu Gln Ala Gly Met
Asn Leu Glu Ala Arg Lys Thr Lys 1 5 10
15 Lys 16714DNAHomo sapiens 167ttcttactta taac
141681603PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
168Met Ser Arg Thr Arg Leu Pro Ser Pro Pro Ala Pro Ser Pro Ala Phe 1
5 10 15 Ser Ala Asp Ser
Phe Ser Asp Leu Leu Arg Gln Phe Asp Pro Ser Leu 20
25 30 Phe Asn Thr Ser Leu Phe Asp Ser Leu
Pro Pro Phe Gly Ala His His 35 40
45 Thr Glu Ala Ala Thr Gly Glu Trp Asp Glu Val Gln Ser Gly
Leu Arg 50 55 60
Ala Ala Asp Ala Pro Pro Pro Thr Met Arg Val Ala Val Thr Ala Ala 65
70 75 80 Arg Pro Pro Arg Ala
Lys Pro Ala Pro Arg Arg Arg Ala Ala Gln Pro 85
90 95 Ser Asp Ala Ser Pro Ala Ala Gln Val Asp
Leu Arg Thr Leu Gly Tyr 100 105
110 Ser Gln Gln Gln Gln Glu Lys Ile Lys Pro Lys Val Arg Ser Thr
Val 115 120 125 Ala
Gln His His Glu Ala Leu Val Gly His Gly Phe Thr His Ala His 130
135 140 Ile Val Ala Leu Ser Gln
His Pro Ala Ala Leu Gly Thr Val Ala Val 145 150
155 160 Lys Tyr Gln Asp Met Ile Ala Ala Leu Pro Glu
Ala Thr His Glu Ala 165 170
175 Ile Val Gly Val Gly Lys Gln Trp Ser Gly Ala Arg Ala Leu Glu Ala
180 185 190 Leu Leu
Thr Val Ala Gly Glu Leu Arg Gly Pro Pro Leu Gln Leu Asp 195
200 205 Thr Gly Gln Leu Leu Lys Ile
Ala Lys Arg Gly Gly Val Thr Ala Val 210 215
220 Glu Ala Val His Ala Trp Arg Asn Ala Leu Thr Gly
Ala Pro Leu Asn 225 230 235
240 Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser Asn Asn Gly Gly Lys
245 250 255 Gln Ala Leu
Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln Ala 260
265 270 His Gly Leu Thr Pro Glu Gln Val
Val Ala Ile Ala Ser His Asp Gly 275 280
285 Gly Lys Gln Ala Leu Glu Thr Val Gln Arg Leu Leu Pro
Val Leu Cys 290 295 300
Gln Ala His Gly Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser His 305
310 315 320 Asp Gly Gly Lys
Gln Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val 325
330 335 Leu Cys Gln Ala His Gly Leu Thr Pro
Glu Gln Val Val Ala Ile Ala 340 345
350 Ser Asn Ile Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Arg
Leu Leu 355 360 365
Pro Val Leu Cys Gln Ala His Gly Leu Thr Pro Glu Gln Val Val Ala 370
375 380 Ile Ala Ser Asn Asn
Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Arg 385 390
395 400 Leu Leu Pro Val Leu Cys Gln Ala His Gly
Leu Thr Pro Glu Gln Val 405 410
415 Val Ala Ile Ala Ser Asn Gly Gly Gly Lys Gln Ala Leu Glu Thr
Val 420 425 430 Gln
Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly Leu Thr Pro Glu 435
440 445 Gln Val Val Ala Ile Ala
Ser His Asp Gly Gly Lys Gln Ala Leu Glu 450 455
460 Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln
Ala His Gly Leu Thr 465 470 475
480 Pro Glu Gln Val Val Ala Ile Ala Ser Asn Ile Gly Gly Lys Gln Ala
485 490 495 Leu Glu
Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 500
505 510 Leu Thr Pro Glu Gln Val Val
Ala Ile Ala Ser His Asp Gly Gly Lys 515 520
525 Gln Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val
Leu Cys Gln Ala 530 535 540
His Gly Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser Asn Asn Gly 545
550 555 560 Gly Lys Gln
Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys 565
570 575 Gln Ala His Gly Leu Thr Pro Glu
Gln Val Val Ala Ile Ala Ser Asn 580 585
590 Gly Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Arg Leu
Leu Pro Val 595 600 605
Leu Cys Gln Ala His Gly Leu Thr Pro Glu Gln Val Val Ala Ile Ala 610
615 620 Ser His Asp Gly
Gly Lys Gln Ala Leu Glu Thr Val Gln Arg Leu Leu 625 630
635 640 Pro Val Leu Cys Gln Ala His Gly Leu
Thr Pro Glu Gln Val Val Ala 645 650
655 Ile Ala Ser His Asp Gly Gly Lys Gln Ala Leu Glu Thr Val
Gln Arg 660 665 670
Leu Leu Pro Val Leu Cys Gln Ala His Gly Leu Thr Pro Glu Gln Val
675 680 685 Val Ala Ile Ala
Ser Asn Asn Gly Gly Lys Gln Ala Leu Glu Thr Val 690
695 700 Gln Arg Leu Leu Pro Val Leu Cys
Gln Ala His Gly Leu Thr Pro Glu 705 710
715 720 Gln Val Val Ala Ile Ala Ser His Asp Gly Gly Lys
Gln Ala Leu Glu 725 730
735 Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly Leu Thr
740 745 750 Pro Glu Gln
Val Val Ala Ile Ala Ser His Asp Gly Gly Lys Gln Ala 755
760 765 Leu Glu Thr Val Gln Arg Leu Leu
Pro Val Leu Cys Gln Ala His Gly 770 775
780 Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser His Asp
Gly Gly Arg 785 790 795
800 Pro Ala Leu Glu Ser Ile Val Ala Gln Leu Ser Arg Pro Asp Pro Ala
805 810 815 Leu Ala Ala Leu
Thr Asn Asp His Leu Val Ala Leu Ala Cys Leu Gly 820
825 830 Gly Arg Pro Ala Leu Asp Ala Val Lys
Lys Gly Leu Pro His Ala Pro 835 840
845 Ala Leu Ile Lys Arg Thr Asn Arg Arg Ile Pro Glu Arg Thr
Ser His 850 855 860
Arg Val Ala Asp His Ala Gln Val Val Arg Val Leu Gly Phe Phe Gln 865
870 875 880 Cys His Ser His Pro
Ala Gln Ala Phe Asp Asp Ala Met Thr Gln Phe 885
890 895 Gly Met Ser Arg His Gly Leu Leu Gln Leu
Phe Arg Arg Val Gly Val 900 905
910 Thr Glu Leu Glu Ala Arg Ser Gly Thr Leu Pro Pro Ala Ser Gln
Arg 915 920 925 Trp
Asp Arg Ile Leu Gln Ala Ser Gly Met Lys Arg Ala Lys Pro Ser 930
935 940 Pro Thr Ser Thr Gln Thr
Pro Asp Gln Ala Ser Leu His Ala Phe Ala 945 950
955 960 Asp Ser Leu Glu Arg Asp Leu Asp Ala Pro Ser
Pro Met His Glu Gly 965 970
975 Asp Gln Thr Arg Ala Ser Ala Ser Pro Lys Lys Lys Arg Lys Val Glu
980 985 990 Ala Ser
Lys Met Asp Lys Lys Thr Ile Val Trp Phe Arg Arg Asp Leu 995
1000 1005 Arg Ile Glu Asp Asn
Pro Ala Leu Ala Ala Ala Ala His Glu Gly 1010 1015
1020 Ser Val Phe Pro Val Phe Ile Trp Cys Pro
Glu Glu Glu Gly Gln 1025 1030 1035
Phe Tyr Pro Gly Arg Ala Ser Arg Trp Trp Met Lys Gln Ser Leu
1040 1045 1050 Ala His
Leu Ser Gln Ser Leu Lys Ala Leu Gly Ser Asp Leu Thr 1055
1060 1065 Leu Ile Lys Thr His Asn Thr
Ile Ser Ala Ile Leu Asp Cys Ile 1070 1075
1080 Arg Val Thr Gly Ala Thr Lys Val Val Phe Asn His
Leu Tyr Asp 1085 1090 1095
Pro Val Ser Leu Val Arg Asp His Thr Val Lys Glu Lys Leu Val 1100
1105 1110 Glu Arg Gly Ile Ser
Val Gln Ser Tyr Asn Gly Asp Leu Leu Tyr 1115 1120
1125 Glu Pro Trp Glu Ile Tyr Cys Glu Lys Gly
Lys Pro Phe Thr Ser 1130 1135 1140
Phe Asn Ser Tyr Trp Lys Lys Cys Leu Asp Met Ser Ile Glu Ser
1145 1150 1155 Val Met
Leu Pro Pro Pro Trp Arg Leu Met Pro Ile Thr Ala Ala 1160
1165 1170 Ala Glu Ala Ile Trp Ala Cys
Ser Ile Glu Glu Leu Gly Leu Glu 1175 1180
1185 Asn Glu Ala Glu Lys Pro Ser Asn Ala Leu Leu Thr
Arg Ala Trp 1190 1195 1200
Ser Pro Gly Trp Ser Asn Ala Asp Lys Leu Leu Asn Glu Phe Ile 1205
1210 1215 Glu Lys Gln Leu Ile
Asp Tyr Ala Lys Asn Ser Lys Lys Val Val 1220 1225
1230 Gly Asn Ser Thr Ser Leu Leu Ser Pro Tyr
Leu His Phe Gly Glu 1235 1240 1245
Ile Ser Val Arg His Val Phe Gln Cys Ala Arg Met Lys Gln Ile
1250 1255 1260 Ile Trp
Ala Arg Asp Lys Asn Ser Glu Gly Glu Glu Ser Ala Asp 1265
1270 1275 Leu Phe Leu Arg Gly Ile Gly
Leu Arg Glu Tyr Ser Arg Tyr Ile 1280 1285
1290 Cys Phe Asn Phe Pro Phe Thr His Glu Gln Ser Leu
Leu Ser His 1295 1300 1305
Leu Arg Phe Phe Pro Trp Asp Ala Asp Val Asp Lys Phe Lys Ala 1310
1315 1320 Trp Arg Gln Gly Arg
Thr Gly Tyr Pro Leu Val Asp Ala Gly Met 1325 1330
1335 Arg Glu Leu Trp Ala Thr Gly Trp Met His
Asn Arg Ile Arg Val 1340 1345 1350
Ile Val Ser Ser Phe Ala Val Lys Phe Leu Leu Leu Pro Trp Lys
1355 1360 1365 Trp Gly
Met Lys Tyr Phe Trp Asp Thr Leu Leu Asp Ala Asp Leu 1370
1375 1380 Glu Cys Asp Ile Leu Gly Trp
Gln Tyr Ile Ser Gly Ser Ile Pro 1385 1390
1395 Asp Gly His Glu Leu Asp Arg Leu Asp Asn Pro Ala
Leu Gln Gly 1400 1405 1410
Ala Lys Tyr Asp Pro Glu Gly Glu Tyr Ile Arg Gln Trp Leu Pro 1415
1420 1425 Glu Leu Ala Arg Leu
Pro Thr Glu Trp Ile His His Pro Trp Asp 1430 1435
1440 Ala Pro Leu Thr Val Leu Lys Ala Ser Gly
Val Glu Leu Gly Thr 1445 1450 1455
Asn Tyr Ala Lys Pro Ile Val Asp Ile Asp Thr Ala Arg Glu Leu
1460 1465 1470 Leu Ala
Lys Ala Ile Ser Arg Thr Arg Glu Ala Gln Ile Met Ile 1475
1480 1485 Gly Ala Ala Pro Asp Glu Ile
Val Ala Asp Ser Phe Glu Ala Leu 1490 1495
1500 Gly Ala Asn Thr Ile Lys Glu Pro Gly Leu Cys Pro
Ser Val Ser 1505 1510 1515
Ser Asn Asp Gln Gln Val Pro Ser Ala Val Arg Tyr Asn Gly Ser 1520
1525 1530 Lys Arg Val Lys Pro
Glu Glu Glu Glu Glu Arg Asp Met Lys Lys 1535 1540
1545 Ser Arg Gly Phe Asp Glu Arg Glu Leu Phe
Ser Thr Ala Glu Ser 1550 1555 1560
Ser Ser Ser Ser Ser Val Phe Phe Val Ser Gln Ser Cys Ser Leu
1565 1570 1575 Ala Ser
Glu Gly Lys Asn Leu Glu Gly Ile Gln Asp Ser Ser Asp 1580
1585 1590 Gln Ile Thr Thr Ser Leu Gly
Lys Asn Gly 1595 1600
1691492PRTArtificial SequenceDescription of Artificial Sequence Synthetic
polypeptide 169Met Ser Arg Thr Arg Leu Pro Ser Pro Pro Ala Pro Ser
Pro Ala Phe 1 5 10 15
Ser Ala Asp Ser Phe Ser Asp Leu Leu Arg Gln Phe Asp Pro Ser Leu
20 25 30 Phe Asn Thr Ser
Leu Phe Asp Ser Leu Pro Pro Phe Gly Ala His His 35
40 45 Thr Glu Ala Ala Thr Gly Glu Trp Asp
Glu Val Gln Ser Gly Leu Arg 50 55
60 Ala Ala Asp Ala Pro Pro Pro Thr Met Arg Val Ala Val
Thr Ala Ala 65 70 75
80 Arg Pro Pro Arg Ala Lys Pro Ala Pro Arg Arg Arg Ala Ala Gln Pro
85 90 95 Ser Asp Ala Ser
Pro Ala Ala Gln Val Asp Leu Arg Thr Leu Gly Tyr 100
105 110 Ser Gln Gln Gln Gln Glu Lys Ile Lys
Pro Lys Val Arg Ser Thr Val 115 120
125 Ala Gln His His Glu Ala Leu Val Gly His Gly Phe Thr His
Ala His 130 135 140
Ile Val Ala Leu Ser Gln His Pro Ala Ala Leu Gly Thr Val Ala Val 145
150 155 160 Lys Tyr Gln Asp Met
Ile Ala Ala Leu Pro Glu Ala Thr His Glu Ala 165
170 175 Ile Val Gly Val Gly Lys Gln Trp Ser Gly
Ala Arg Ala Leu Glu Ala 180 185
190 Leu Leu Thr Val Ala Gly Glu Leu Arg Gly Pro Pro Leu Gln Leu
Asp 195 200 205 Thr
Gly Gln Leu Leu Lys Ile Ala Lys Arg Gly Gly Val Thr Ala Val 210
215 220 Glu Ala Val His Ala Trp
Arg Asn Ala Leu Thr Gly Ala Pro Leu Asn 225 230
235 240 Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser
Asn Asn Gly Gly Lys 245 250
255 Gln Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln Ala
260 265 270 His Gly
Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser His Asp Gly 275
280 285 Gly Lys Gln Ala Leu Glu Thr
Val Gln Arg Leu Leu Pro Val Leu Cys 290 295
300 Gln Ala His Gly Leu Thr Pro Glu Gln Val Val Ala
Ile Ala Ser His 305 310 315
320 Asp Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val
325 330 335 Leu Cys Gln
Ala His Gly Leu Thr Pro Glu Gln Val Val Ala Ile Ala 340
345 350 Ser Asn Ile Gly Gly Lys Gln Ala
Leu Glu Thr Val Gln Arg Leu Leu 355 360
365 Pro Val Leu Cys Gln Ala His Gly Leu Thr Pro Glu Gln
Val Val Ala 370 375 380
Ile Ala Ser Asn Asn Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Arg 385
390 395 400 Leu Leu Pro Val
Leu Cys Gln Ala His Gly Leu Thr Pro Glu Gln Val 405
410 415 Val Ala Ile Ala Ser Asn Gly Gly Gly
Lys Gln Ala Leu Glu Thr Val 420 425
430 Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly Leu Thr
Pro Glu 435 440 445
Gln Val Val Ala Ile Ala Ser His Asp Gly Gly Lys Gln Ala Leu Glu 450
455 460 Thr Val Gln Arg Leu
Leu Pro Val Leu Cys Gln Ala His Gly Leu Thr 465 470
475 480 Pro Glu Gln Val Val Ala Ile Ala Ser Asn
Ile Gly Gly Lys Gln Ala 485 490
495 Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His
Gly 500 505 510 Leu
Thr Pro Glu Gln Val Val Ala Ile Ala Ser His Asp Gly Gly Lys 515
520 525 Gln Ala Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala 530 535
540 His Gly Leu Thr Pro Glu Gln Val Val Ala Ile
Ala Ser Asn Asn Gly 545 550 555
560 Gly Lys Gln Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys
565 570 575 Gln Ala
His Gly Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser Asn 580
585 590 Gly Gly Gly Lys Gln Ala Leu
Glu Thr Val Gln Arg Leu Leu Pro Val 595 600
605 Leu Cys Gln Ala His Gly Leu Thr Pro Glu Gln Val
Val Ala Ile Ala 610 615 620
Ser His Asp Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Arg Leu Leu 625
630 635 640 Pro Val Leu
Cys Gln Ala His Gly Leu Thr Pro Glu Gln Val Val Ala 645
650 655 Ile Ala Ser His Asp Gly Gly Lys
Gln Ala Leu Glu Thr Val Gln Arg 660 665
670 Leu Leu Pro Val Leu Cys Gln Ala His Gly Leu Thr Pro
Glu Gln Val 675 680 685
Val Ala Ile Ala Ser Asn Asn Gly Gly Lys Gln Ala Leu Glu Thr Val 690
695 700 Gln Arg Leu Leu
Pro Val Leu Cys Gln Ala His Gly Leu Thr Pro Glu 705 710
715 720 Gln Val Val Ala Ile Ala Ser His Asp
Gly Gly Lys Gln Ala Leu Glu 725 730
735 Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly
Leu Thr 740 745 750
Pro Glu Gln Val Val Ala Ile Ala Ser His Asp Gly Gly Lys Gln Ala
755 760 765 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 770
775 780 Leu Thr Pro Glu Gln Val Val Ala
Ile Ala Ser His Asp Gly Gly Arg 785 790
795 800 Pro Ala Leu Glu Ser Ile Val Ala Gln Leu Ser Arg
Pro Asp Pro Ala 805 810
815 Leu Ala Ala Leu Thr Asn Asp His Leu Val Ala Leu Ala Cys Leu Gly
820 825 830 Gly Arg Pro
Ala Leu Asp Ala Val Lys Lys Gly Leu Pro His Ala Pro 835
840 845 Ala Leu Ile Lys Arg Thr Asn Arg
Arg Ile Pro Glu Arg Thr Ser His 850 855
860 Arg Val Ala Asp His Ala Gln Val Val Arg Val Leu Gly
Phe Phe Gln 865 870 875
880 Cys His Ser His Pro Ala Gln Ala Phe Asp Asp Ala Met Thr Gln Phe
885 890 895 Gly Met Ser Arg
His Gly Leu Leu Gln Leu Phe Arg Arg Val Gly Val 900
905 910 Thr Glu Leu Glu Ala Arg Ser Gly Thr
Leu Pro Pro Ala Ser Gln Arg 915 920
925 Trp Asp Arg Ile Leu Gln Ala Ser Gly Met Lys Arg Ala Lys
Pro Ser 930 935 940
Pro Thr Ser Thr Gln Thr Pro Asp Gln Ala Ser Leu His Ala Phe Ala 945
950 955 960 Asp Ser Leu Glu Arg
Asp Leu Asp Ala Pro Ser Pro Met His Glu Gly 965
970 975 Asp Gln Thr Arg Ala Ser Ala Ser Pro Lys
Lys Lys Arg Lys Val Glu 980 985
990 Ala Ser Lys Met Asp Lys Lys Thr Ile Val Trp Phe Arg Arg
Asp Leu 995 1000 1005
Arg Ile Glu Asp Asn Pro Ala Leu Ala Ala Ala Ala His Glu Gly 1010
1015 1020 Ser Val Phe Pro Val
Phe Ile Trp Cys Pro Glu Glu Glu Gly Gln 1025 1030
1035 Phe Tyr Pro Gly Arg Ala Ser Arg Trp Trp
Met Lys Gln Ser Leu 1040 1045 1050
Ala His Leu Ser Gln Ser Leu Lys Ala Leu Gly Ser Asp Leu Thr
1055 1060 1065 Leu Ile
Lys Thr His Asn Thr Ile Ser Ala Ile Leu Asp Cys Ile 1070
1075 1080 Arg Val Thr Gly Ala Thr Lys
Val Val Phe Asn His Leu Tyr Asp 1085 1090
1095 Pro Val Ser Leu Val Arg Asp His Thr Val Lys Glu
Lys Leu Val 1100 1105 1110
Glu Arg Gly Ile Ser Val Gln Ser Tyr Asn Gly Asp Leu Leu Tyr 1115
1120 1125 Glu Pro Trp Glu Ile
Tyr Cys Glu Lys Gly Lys Pro Phe Thr Ser 1130 1135
1140 Phe Asn Ser Tyr Trp Lys Lys Cys Leu Asp
Met Ser Ile Glu Ser 1145 1150 1155
Val Met Leu Pro Pro Pro Trp Arg Leu Met Pro Ile Thr Ala Ala
1160 1165 1170 Ala Glu
Ala Ile Trp Ala Cys Ser Ile Glu Glu Leu Gly Leu Glu 1175
1180 1185 Asn Glu Ala Glu Lys Pro Ser
Asn Ala Leu Leu Thr Arg Ala Trp 1190 1195
1200 Ser Pro Gly Trp Ser Asn Ala Asp Lys Leu Leu Asn
Glu Phe Ile 1205 1210 1215
Glu Lys Gln Leu Ile Asp Tyr Ala Lys Asn Ser Lys Lys Val Val 1220
1225 1230 Gly Asn Ser Thr Ser
Leu Leu Ser Pro Tyr Leu His Phe Gly Glu 1235 1240
1245 Ile Ser Val Arg His Val Phe Gln Cys Ala
Arg Met Lys Gln Ile 1250 1255 1260
Ile Trp Ala Arg Asp Lys Asn Ser Glu Gly Glu Glu Ser Ala Asp
1265 1270 1275 Leu Phe
Leu Arg Gly Ile Gly Leu Arg Glu Tyr Ser Arg Tyr Ile 1280
1285 1290 Cys Phe Asn Phe Pro Phe Thr
His Glu Gln Ser Leu Leu Ser His 1295 1300
1305 Leu Arg Phe Phe Pro Trp Asp Ala Asp Val Asp Lys
Phe Lys Ala 1310 1315 1320
Trp Arg Gln Gly Arg Thr Gly Tyr Pro Leu Val Asp Ala Gly Met 1325
1330 1335 Arg Glu Leu Trp Ala
Thr Gly Trp Met His Asn Arg Ile Arg Val 1340 1345
1350 Ile Val Ser Ser Phe Ala Val Lys Phe Leu
Leu Leu Pro Trp Lys 1355 1360 1365
Trp Gly Met Lys Tyr Phe Trp Asp Thr Leu Leu Asp Ala Asp Leu
1370 1375 1380 Glu Cys
Asp Ile Leu Gly Trp Gln Tyr Ile Ser Gly Ser Ile Pro 1385
1390 1395 Asp Gly His Glu Leu Asp Arg
Leu Asp Asn Pro Ala Leu Gln Gly 1400 1405
1410 Ala Lys Tyr Asp Pro Glu Gly Glu Tyr Ile Arg Gln
Trp Leu Pro 1415 1420 1425
Glu Leu Ala Arg Leu Pro Thr Glu Trp Ile His His Pro Trp Asp 1430
1435 1440 Ala Pro Leu Thr Val
Leu Lys Ala Ser Gly Val Glu Leu Gly Thr 1445 1450
1455 Asn Tyr Ala Lys Pro Ile Val Asp Ile Asp
Thr Ala Arg Glu Leu 1460 1465 1470
Leu Ala Lys Ala Ile Ser Arg Thr Arg Glu Ala Gln Ile Met Ile
1475 1480 1485 Gly Ala
Ala Pro 1490 170665PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 170Met Asn Gly Ala Ile Gly
Gly Asp Leu Leu Leu Asn Phe Pro Asp Met 1 5
10 15 Ser Val Leu Glu Arg Gln Arg Ala His Leu Lys
Tyr Leu Asn Pro Thr 20 25
30 Phe Asp Ser Pro Leu Ala Gly Phe Phe Ala Asp Ser Ser Met Ile
Thr 35 40 45 Gly
Gly Glu Met Asp Ser Tyr Leu Ser Thr Ala Gly Leu Asn Leu Pro 50
55 60 Met Met Tyr Gly Glu Thr
Thr Val Glu Gly Asp Ser Arg Leu Ser Ile 65 70
75 80 Ser Pro Glu Thr Thr Leu Gly Thr Gly Asn Phe
Lys Lys Arg Lys Phe 85 90
95 Asp Thr Glu Thr Lys Asp Cys Asn Glu Lys Lys Lys Lys Met Thr Met
100 105 110 Asn Arg
Asp Asp Leu Val Glu Glu Gly Glu Glu Glu Lys Ser Lys Ile 115
120 125 Thr Glu Gln Asn Asn Gly Ser
Thr Lys Ser Ile Lys Lys Met Lys His 130 135
140 Lys Ala Lys Lys Glu Glu Asn Asn Phe Ser Asn Asp
Ser Ser Lys Val 145 150 155
160 Thr Lys Glu Leu Glu Lys Thr Asp Tyr Ile His Val Arg Ala Arg Arg
165 170 175 Gly Gln Ala
Thr Asp Ser His Ser Ile Ala Glu Arg Val Arg Arg Glu 180
185 190 Lys Ile Ser Glu Arg Met Lys Phe
Leu Gln Asp Leu Val Pro Gly Cys 195 200
205 Asp Lys Ile Thr Gly Lys Ala Gly Met Leu Asp Glu Ile
Ile Asn Tyr 210 215 220
Val Gln Ser Leu Gln Arg Gln Ile Glu Phe Leu Ser Met Lys Leu Ala 225
230 235 240 Ile Val Asn Pro
Arg Pro Asp Phe Asp Met Asp Asp Ile Phe Ala Lys 245
250 255 Glu Val Ala Ser Thr Pro Met Thr Val
Val Pro Ser Pro Glu Met Val 260 265
270 Leu Ser Gly Tyr Ser His Glu Met Val His Ser Gly Tyr Ser
Ser Glu 275 280 285
Met Val Asn Ser Gly Tyr Leu His Val Asn Pro Met Gln Gln Val Asn 290
295 300 Thr Ser Ser Asp Pro
Leu Ser Cys Phe Asn Asn Gly Glu Ala Pro Ser 305 310
315 320 Met Trp Asp Ser His Val Gln Asn Leu Tyr
Gly Asn Leu Gly Val Ala 325 330
335 Ser Pro Lys Lys Lys Arg Lys Val Glu Ala Ser Gly Ser Gly Arg
Ala 340 345 350 Asp
Ala Leu Asp Asp Phe Asp Leu Asp Met Leu Gly Ser Asp Ala Leu 355
360 365 Asp Asp Phe Asp Leu Asp
Met Leu Gly Ser Asp Ala Leu Asp Asp Phe 370 375
380 Asp Leu Asp Met Leu Gly Ser Asp Ala Leu Asp
Asp Phe Asp Leu Asp 385 390 395
400 Met Leu Ile Asn Ser Arg Gly Ser Gly Glu Gly Arg Gly Ser Leu Leu
405 410 415 Thr Cys
Gly Asp Val Glu Glu Asn Pro Gly Pro Val Ser Lys Gly Glu 420
425 430 Glu Leu Phe Thr Gly Val Val
Pro Ile Leu Val Glu Leu Asp Gly Asp 435 440
445 Val Asn Gly His Lys Phe Ser Val Ser Gly Glu Gly
Glu Gly Asp Ala 450 455 460
Thr Tyr Gly Lys Leu Thr Leu Lys Phe Ile Cys Thr Thr Gly Lys Leu 465
470 475 480 Pro Val Pro
Trp Pro Thr Leu Val Thr Thr Leu Thr Tyr Gly Val Gln 485
490 495 Cys Phe Ser Arg Tyr Pro Asp His
Met Lys Gln His Asp Phe Phe Lys 500 505
510 Ser Ala Met Pro Glu Gly Tyr Val Gln Glu Arg Thr Ile
Phe Phe Lys 515 520 525
Asp Asp Gly Asn Tyr Lys Thr Arg Ala Glu Val Lys Phe Glu Gly Asp 530
535 540 Thr Leu Val Asn
Arg Ile Glu Leu Lys Gly Ile Asp Phe Lys Glu Asp 545 550
555 560 Gly Asn Ile Leu Gly His Lys Leu Glu
Tyr Asn Tyr Asn Ser His Asn 565 570
575 Val Tyr Ile Met Ala Asp Lys Gln Lys Asn Gly Ile Lys Val
Asn Phe 580 585 590
Lys Ile Arg His Asn Ile Glu Asp Gly Ser Val Gln Leu Ala Asp His
595 600 605 Tyr Gln Gln Asn
Thr Pro Ile Gly Asp Gly Pro Val Leu Leu Pro Asp 610
615 620 Asn His Tyr Leu Ser Thr Gln Ser
Ala Leu Ser Lys Asp Pro Asn Glu 625 630
635 640 Lys Arg Asp His Met Val Leu Leu Glu Phe Val Thr
Ala Ala Gly Ile 645 650
655 Thr Leu Gly Met Asp Glu Leu Tyr Lys 660
665 171500PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 171Met Asn Gly Ala Ile Gly Gly Asp Leu Leu Leu
Asn Phe Pro Asp Met 1 5 10
15 Ser Val Leu Glu Arg Gln Arg Ala His Leu Lys Tyr Leu Asn Pro Thr
20 25 30 Phe Asp
Ser Pro Leu Ala Gly Phe Phe Ala Asp Ser Ser Met Ile Thr 35
40 45 Gly Gly Glu Met Asp Ser Tyr
Leu Ser Thr Ala Gly Leu Asn Leu Pro 50 55
60 Met Met Tyr Gly Glu Thr Thr Val Glu Gly Asp Ser
Arg Leu Ser Ile 65 70 75
80 Ser Pro Glu Thr Thr Leu Gly Thr Gly Asn Phe Lys Lys Arg Lys Phe
85 90 95 Asp Thr Glu
Thr Lys Asp Cys Asn Glu Lys Lys Lys Lys Met Thr Met 100
105 110 Asn Arg Asp Asp Leu Val Glu Glu
Gly Glu Glu Glu Lys Ser Lys Ile 115 120
125 Thr Glu Gln Asn Asn Gly Ser Thr Lys Ser Ile Lys Lys
Met Lys His 130 135 140
Lys Ala Lys Lys Glu Glu Asn Asn Phe Ser Asn Asp Ser Ser Lys Val 145
150 155 160 Thr Lys Glu Leu
Glu Lys Thr Asp Tyr Ile Ala Ser Pro Lys Lys Lys 165
170 175 Arg Lys Val Glu Ala Ser Gly Ser Gly
Arg Ala Asp Ala Leu Asp Asp 180 185
190 Phe Asp Leu Asp Met Leu Gly Ser Asp Ala Leu Asp Asp Phe
Asp Leu 195 200 205
Asp Met Leu Gly Ser Asp Ala Leu Asp Asp Phe Asp Leu Asp Met Leu 210
215 220 Gly Ser Asp Ala Leu
Asp Asp Phe Asp Leu Asp Met Leu Ile Asn Ser 225 230
235 240 Arg Gly Ser Gly Glu Gly Arg Gly Ser Leu
Leu Thr Cys Gly Asp Val 245 250
255 Glu Glu Asn Pro Gly Pro Val Ser Lys Gly Glu Glu Leu Phe Thr
Gly 260 265 270 Val
Val Pro Ile Leu Val Glu Leu Asp Gly Asp Val Asn Gly His Lys 275
280 285 Phe Ser Val Ser Gly Glu
Gly Glu Gly Asp Ala Thr Tyr Gly Lys Leu 290 295
300 Thr Leu Lys Phe Ile Cys Thr Thr Gly Lys Leu
Pro Val Pro Trp Pro 305 310 315
320 Thr Leu Val Thr Thr Leu Thr Tyr Gly Val Gln Cys Phe Ser Arg Tyr
325 330 335 Pro Asp
His Met Lys Gln His Asp Phe Phe Lys Ser Ala Met Pro Glu 340
345 350 Gly Tyr Val Gln Glu Arg Thr
Ile Phe Phe Lys Asp Asp Gly Asn Tyr 355 360
365 Lys Thr Arg Ala Glu Val Lys Phe Glu Gly Asp Thr
Leu Val Asn Arg 370 375 380
Ile Glu Leu Lys Gly Ile Asp Phe Lys Glu Asp Gly Asn Ile Leu Gly 385
390 395 400 His Lys Leu
Glu Tyr Asn Tyr Asn Ser His Asn Val Tyr Ile Met Ala 405
410 415 Asp Lys Gln Lys Asn Gly Ile Lys
Val Asn Phe Lys Ile Arg His Asn 420 425
430 Ile Glu Asp Gly Ser Val Gln Leu Ala Asp His Tyr Gln
Gln Asn Thr 435 440 445
Pro Ile Gly Asp Gly Pro Val Leu Leu Pro Asp Asn His Tyr Leu Ser 450
455 460 Thr Gln Ser Ala
Leu Ser Lys Asp Pro Asn Glu Lys Arg Asp His Met 465 470
475 480 Val Leu Leu Glu Phe Val Thr Ala Ala
Gly Ile Thr Leu Gly Met Asp 485 490
495 Glu Leu Tyr Lys 500 172693PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
172Met Asn Gly Ala Ile Gly Gly Asp Leu Leu Leu Asn Phe Pro Asp Met 1
5 10 15 Ser Val Leu Glu
Arg Gln Arg Ala His Leu Lys Tyr Leu Asn Pro Thr 20
25 30 Phe Asp Ser Pro Leu Ala Gly Phe Phe
Ala Asp Ser Ser Met Ile Thr 35 40
45 Gly Gly Glu Met Asp Ser Tyr Leu Ser Thr Ala Gly Leu Asn
Leu Pro 50 55 60
Met Met Tyr Gly Glu Thr Thr Val Glu Gly Asp Ser Arg Leu Ser Ile 65
70 75 80 Ser Pro Glu Thr Thr
Leu Gly Thr Gly Asn Phe Lys Lys Arg Lys Phe 85
90 95 Asp Thr Glu Thr Lys Asp Cys Asn Glu Lys
Lys Lys Lys Met Thr Met 100 105
110 Asn Arg Asp Asp Leu Val Glu Glu Gly Glu Glu Glu Lys Ser Lys
Ile 115 120 125 Thr
Glu Gln Asn Asn Gly Ser Thr Lys Ser Ile Lys Lys Met Lys His 130
135 140 Lys Ala Lys Lys Glu Glu
Asn Asn Phe Ser Asn Asp Ser Ser Lys Val 145 150
155 160 Thr Lys Glu Leu Glu Lys Thr Asp Tyr Ile His
Val Arg Ala Arg Arg 165 170
175 Gly Gln Ala Thr Asp Ser His Ser Ile Ala Glu Arg Val Arg Arg Glu
180 185 190 Lys Ile
Ser Glu Arg Met Lys Phe Leu Gln Asp Leu Val Pro Gly Cys 195
200 205 Asp Lys Ile Thr Gly Lys Ala
Gly Met Leu Asp Glu Ile Ile Asn Tyr 210 215
220 Val Gln Ser Leu Gln Arg Gln Ile Glu Phe Leu Ser
Met Lys Leu Ala 225 230 235
240 Ile Val Asn Pro Arg Pro Asp Phe Asp Met Asp Asp Ile Phe Ala Lys
245 250 255 Glu Val Ala
Ser Thr Pro Met Thr Val Val Pro Ser Pro Glu Met Val 260
265 270 Leu Ser Gly Tyr Ser His Glu Met
Val His Ser Gly Tyr Ser Ser Glu 275 280
285 Met Val Asn Ser Gly Tyr Leu His Val Asn Pro Met Gln
Gln Val Asn 290 295 300
Thr Ser Ser Asp Pro Leu Ser Cys Phe Asn Asn Gly Glu Ala Pro Ser 305
310 315 320 Met Trp Asp Ser
His Val Gln Asn Leu Tyr Gly Asn Leu Gly Val Ala 325
330 335 Ser Pro Lys Lys Lys Arg Lys Val Glu
Ala Ser Ala Pro Pro Thr Asp 340 345
350 Val Ser Leu Gly Asp Glu Leu His Leu Asp Gly Glu Asp Val
Ala Met 355 360 365
Ala His Ala Asp Ala Leu Asp Asp Phe Asp Leu Asp Met Leu Gly Asp 370
375 380 Gly Asp Ser Pro Gly
Pro Gly Phe Thr Pro His Asp Ser Ala Pro Tyr 385 390
395 400 Gly Ala Leu Asp Met Ala Asp Phe Glu Phe
Glu Gln Met Phe Thr Asp 405 410
415 Ala Leu Gly Ile Asp Glu Tyr Gly Gly Glu Phe Pro Gly Ile Arg
Arg 420 425 430 Ser
Arg Gly Ser Gly Glu Gly Arg Gly Ser Leu Leu Thr Cys Gly Asp 435
440 445 Val Glu Glu Asn Pro Gly
Pro Val Ser Lys Gly Glu Glu Leu Phe Thr 450 455
460 Gly Val Val Pro Ile Leu Val Glu Leu Asp Gly
Asp Val Asn Gly His 465 470 475
480 Lys Phe Ser Val Ser Gly Glu Gly Glu Gly Asp Ala Thr Tyr Gly Lys
485 490 495 Leu Thr
Leu Lys Phe Ile Cys Thr Thr Gly Lys Leu Pro Val Pro Trp 500
505 510 Pro Thr Leu Val Thr Thr Leu
Thr Tyr Gly Val Gln Cys Phe Ser Arg 515 520
525 Tyr Pro Asp His Met Lys Gln His Asp Phe Phe Lys
Ser Ala Met Pro 530 535 540
Glu Gly Tyr Val Gln Glu Arg Thr Ile Phe Phe Lys Asp Asp Gly Asn 545
550 555 560 Tyr Lys Thr
Arg Ala Glu Val Lys Phe Glu Gly Asp Thr Leu Val Asn 565
570 575 Arg Ile Glu Leu Lys Gly Ile Asp
Phe Lys Glu Asp Gly Asn Ile Leu 580 585
590 Gly His Lys Leu Glu Tyr Asn Tyr Asn Ser His Asn Val
Tyr Ile Met 595 600 605
Ala Asp Lys Gln Lys Asn Gly Ile Lys Val Asn Phe Lys Ile Arg His 610
615 620 Asn Ile Glu Asp
Gly Ser Val Gln Leu Ala Asp His Tyr Gln Gln Asn 625 630
635 640 Thr Pro Ile Gly Asp Gly Pro Val Leu
Leu Pro Asp Asn His Tyr Leu 645 650
655 Ser Thr Gln Ser Ala Leu Ser Lys Asp Pro Asn Glu Lys Arg
Asp His 660 665 670
Met Val Leu Leu Glu Phe Val Thr Ala Ala Gly Ile Thr Leu Gly Met
675 680 685 Asp Glu Leu Tyr
Lys 690 173792PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 173Met Asn Gly Ala Ile Gly
Gly Asp Leu Leu Leu Asn Phe Pro Asp Met 1 5
10 15 Ser Val Leu Glu Arg Gln Arg Ala His Leu Lys
Tyr Leu Asn Pro Thr 20 25
30 Phe Asp Ser Pro Leu Ala Gly Phe Phe Ala Asp Ser Ser Met Ile
Thr 35 40 45 Gly
Gly Glu Met Asp Ser Tyr Leu Ser Thr Ala Gly Leu Asn Leu Pro 50
55 60 Met Met Tyr Gly Glu Thr
Thr Val Glu Gly Asp Ser Arg Leu Ser Ile 65 70
75 80 Ser Pro Glu Thr Thr Leu Gly Thr Gly Asn Phe
Lys Lys Arg Lys Phe 85 90
95 Asp Thr Glu Thr Lys Asp Cys Asn Glu Lys Lys Lys Lys Met Thr Met
100 105 110 Asn Arg
Asp Asp Leu Val Glu Glu Gly Glu Glu Glu Lys Ser Lys Ile 115
120 125 Thr Glu Gln Asn Asn Gly Ser
Thr Lys Ser Ile Lys Lys Met Lys His 130 135
140 Lys Ala Lys Lys Glu Glu Asn Asn Phe Ser Asn Asp
Ser Ser Lys Val 145 150 155
160 Thr Lys Glu Leu Glu Lys Thr Asp Tyr Ile His Val Arg Ala Arg Arg
165 170 175 Gly Gln Ala
Thr Asp Ser His Ser Ile Ala Glu Arg Val Arg Arg Glu 180
185 190 Lys Ile Ser Glu Arg Met Lys Phe
Leu Gln Asp Leu Val Pro Gly Cys 195 200
205 Asp Lys Ile Thr Gly Lys Ala Gly Met Leu Asp Glu Ile
Ile Asn Tyr 210 215 220
Val Gln Ser Leu Gln Arg Gln Ile Glu Phe Leu Ser Met Lys Leu Ala 225
230 235 240 Ile Val Asn Pro
Arg Pro Asp Phe Asp Met Asp Asp Ile Phe Ala Lys 245
250 255 Glu Val Ala Ser Thr Pro Met Thr Val
Val Pro Ser Pro Glu Met Val 260 265
270 Leu Ser Gly Tyr Ser His Glu Met Val His Ser Gly Tyr Ser
Ser Glu 275 280 285
Met Val Asn Ser Gly Tyr Leu His Val Asn Pro Met Gln Gln Val Asn 290
295 300 Thr Ser Ser Asp Pro
Leu Ser Cys Phe Asn Asn Gly Glu Ala Pro Ser 305 310
315 320 Met Trp Asp Ser His Val Gln Asn Leu Tyr
Gly Asn Leu Gly Val Ala 325 330
335 Ser Pro Lys Lys Lys Arg Lys Val Glu Ala Ser Pro Ser Gly Gln
Ile 340 345 350 Ser
Asn Gln Ala Leu Ala Leu Ala Pro Ser Ser Ala Pro Val Leu Ala 355
360 365 Gln Thr Met Val Pro Ser
Ser Ala Met Val Pro Leu Ala Gln Pro Pro 370 375
380 Ala Pro Ala Pro Val Leu Thr Pro Gly Pro Pro
Gln Ser Leu Ser Ala 385 390 395
400 Pro Val Pro Lys Ser Thr Gln Ala Gly Glu Gly Thr Leu Ser Glu Ala
405 410 415 Leu Leu
His Leu Gln Phe Asp Ala Asp Glu Asp Leu Gly Ala Leu Leu 420
425 430 Gly Asn Ser Thr Asp Pro Gly
Val Phe Thr Asp Leu Ala Ser Val Asp 435 440
445 Asn Ser Glu Phe Gln Gln Leu Leu Asn Gln Gly Val
Ser Met Ser His 450 455 460
Ser Thr Ala Glu Pro Met Leu Met Glu Tyr Pro Glu Ala Ile Thr Arg 465
470 475 480 Leu Val Thr
Gly Ser Gln Arg Pro Pro Asp Pro Ala Pro Thr Pro Leu 485
490 495 Gly Thr Ser Gly Leu Pro Asn Gly
Leu Ser Gly Asp Glu Asp Phe Ser 500 505
510 Ser Ile Ala Asp Met Asp Phe Ser Ala Leu Leu Ser Gln
Ile Ser Ser 515 520 525
Ser Gly Gln Ser Arg Gly Ser Gly Glu Gly Arg Gly Ser Leu Leu Thr 530
535 540 Cys Gly Asp Val
Glu Glu Asn Pro Gly Pro Val Ser Lys Gly Glu Glu 545 550
555 560 Leu Phe Thr Gly Val Val Pro Ile Leu
Val Glu Leu Asp Gly Asp Val 565 570
575 Asn Gly His Lys Phe Ser Val Ser Gly Glu Gly Glu Gly Asp
Ala Thr 580 585 590
Tyr Gly Lys Leu Thr Leu Lys Phe Ile Cys Thr Thr Gly Lys Leu Pro
595 600 605 Val Pro Trp Pro
Thr Leu Val Thr Thr Leu Thr Tyr Gly Val Gln Cys 610
615 620 Phe Ser Arg Tyr Pro Asp His Met
Lys Gln His Asp Phe Phe Lys Ser 625 630
635 640 Ala Met Pro Glu Gly Tyr Val Gln Glu Arg Thr Ile
Phe Phe Lys Asp 645 650
655 Asp Gly Asn Tyr Lys Thr Arg Ala Glu Val Lys Phe Glu Gly Asp Thr
660 665 670 Leu Val Asn
Arg Ile Glu Leu Lys Gly Ile Asp Phe Lys Glu Asp Gly 675
680 685 Asn Ile Leu Gly His Lys Leu Glu
Tyr Asn Tyr Asn Ser His Asn Val 690 695
700 Tyr Ile Met Ala Asp Lys Gln Lys Asn Gly Ile Lys Val
Asn Phe Lys 705 710 715
720 Ile Arg His Asn Ile Glu Asp Gly Ser Val Gln Leu Ala Asp His Tyr
725 730 735 Gln Gln Asn Thr
Pro Ile Gly Asp Gly Pro Val Leu Leu Pro Asp Asn 740
745 750 His Tyr Leu Ser Thr Gln Ser Ala Leu
Ser Lys Asp Pro Asn Glu Lys 755 760
765 Arg Asp His Met Val Leu Leu Glu Phe Val Thr Ala Ala Gly
Ile Thr 770 775 780
Leu Gly Met Asp Glu Leu Tyr Lys 785 790
174967PRTArtificial SequenceDescription of Artificial Sequence Synthetic
polypeptide 174Met Tyr Pro Tyr Asp Val Pro Asp Tyr Ala Val Asp Leu
Arg Thr Leu 1 5 10 15
Gly Tyr Ser Gln Gln Gln Gln Glu Lys Ile Lys Pro Lys Val Arg Ser
20 25 30 Thr Val Ala Gln
His His Glu Ala Leu Val Gly His Gly Phe Thr His 35
40 45 Ala His Ile Val Ala Leu Ser Gln His
Pro Ala Ala Leu Gly Thr Val 50 55
60 Ala Val Lys Tyr Gln Asp Met Ile Ala Ala Leu Pro Glu
Ala Thr His 65 70 75
80 Glu Ala Ile Val Gly Val Gly Lys Gln Trp Ser Gly Ala Arg Ala Leu
85 90 95 Glu Ala Leu Leu
Thr Val Ala Gly Glu Leu Arg Gly Pro Pro Leu Gln 100
105 110 Leu Asp Thr Gly Gln Leu Leu Lys Ile
Ala Lys Arg Gly Gly Val Thr 115 120
125 Ala Val Glu Ala Val His Ala Trp Arg Asn Ala Leu Thr Gly
Ala Pro 130 135 140
Leu Asn Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser Xaa Xaa Gly 145
150 155 160 Gly Lys Gln Ala Leu
Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys 165
170 175 Gln Ala His Gly Leu Thr Pro Glu Gln Val
Val Ala Ile Ala Ser Xaa 180 185
190 Xaa Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Arg Leu Leu Pro
Val 195 200 205 Leu
Cys Gln Ala His Gly Leu Thr Pro Glu Gln Val Val Ala Ile Ala 210
215 220 Ser Xaa Xaa Gly Gly Lys
Gln Ala Leu Glu Thr Val Gln Arg Leu Leu 225 230
235 240 Pro Val Leu Cys Gln Ala His Gly Leu Thr Pro
Glu Gln Val Val Ala 245 250
255 Ile Ala Ser Xaa Xaa Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Arg
260 265 270 Leu Leu
Pro Val Leu Cys Gln Ala His Gly Leu Thr Pro Glu Gln Val 275
280 285 Val Ala Ile Ala Ser Xaa Xaa
Gly Gly Lys Gln Ala Leu Glu Thr Val 290 295
300 Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly
Leu Thr Pro Glu 305 310 315
320 Gln Val Val Ala Ile Ala Ser Xaa Xaa Gly Gly Lys Gln Ala Leu Glu
325 330 335 Thr Val Gln
Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly Leu Thr 340
345 350 Pro Glu Gln Val Val Ala Ile Ala
Ser Xaa Xaa Gly Gly Lys Gln Ala 355 360
365 Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln
Ala His Gly 370 375 380
Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser Xaa Xaa Gly Gly Lys 385
390 395 400 Gln Ala Leu Glu
Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln Ala 405
410 415 His Gly Leu Thr Pro Glu Gln Val Val
Ala Ile Ala Ser Xaa Xaa Gly 420 425
430 Gly Lys Gln Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val
Leu Cys 435 440 445
Gln Ala His Gly Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser Xaa 450
455 460 Xaa Gly Gly Lys Gln
Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val 465 470
475 480 Leu Cys Gln Ala His Gly Leu Thr Pro Glu
Gln Val Val Ala Ile Ala 485 490
495 Ser Xaa Xaa Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Arg Leu
Leu 500 505 510 Pro
Val Leu Cys Gln Ala His Gly Leu Thr Pro Glu Gln Val Val Ala 515
520 525 Ile Ala Ser Xaa Xaa Gly
Gly Lys Gln Ala Leu Glu Thr Val Gln Arg 530 535
540 Leu Leu Pro Val Leu Cys Gln Ala His Gly Leu
Thr Pro Glu Gln Val 545 550 555
560 Val Ala Ile Ala Ser Xaa Xaa Gly Gly Arg Pro Ala Leu Glu Ser Ile
565 570 575 Val Ala
Gln Leu Ser Arg Pro Asp Pro Ala Leu Ala Ala Leu Thr Asn 580
585 590 Asp His Leu Val Ala Leu Ala
Cys Leu Gly Gly Arg Pro Ala Leu Asp 595 600
605 Ala Val Lys Lys Gly Leu Pro His Ala Pro Ala Leu
Ile Lys Arg Thr 610 615 620
Asn Arg Arg Ile Pro Glu Arg Thr Ser His Arg Val Ala Ala Ser Pro 625
630 635 640 Lys Lys Lys
Arg Lys Val Glu Ala Ser Gly Ser Gly Arg Ala Asp Ala 645
650 655 Leu Asp Asp Phe Asp Leu Asp Met
Leu Gly Ser Asp Ala Leu Asp Asp 660 665
670 Phe Asp Leu Asp Met Leu Gly Ser Asp Ala Leu Asp Asp
Phe Asp Leu 675 680 685
Asp Met Leu Gly Ser Asp Ala Leu Asp Asp Phe Asp Leu Asp Met Leu 690
695 700 Ile Asn Ser Arg
Gly Ser Gly Glu Gly Arg Gly Ser Leu Leu Thr Cys 705 710
715 720 Gly Asp Val Glu Glu Asn Pro Gly Pro
Val Ser Lys Gly Glu Glu Leu 725 730
735 Phe Thr Gly Val Val Pro Ile Leu Val Glu Leu Asp Gly Asp
Val Asn 740 745 750
Gly His Lys Phe Ser Val Ser Gly Glu Gly Glu Gly Asp Ala Thr Tyr
755 760 765 Gly Lys Leu Thr
Leu Lys Phe Ile Cys Thr Thr Gly Lys Leu Pro Val 770
775 780 Pro Trp Pro Thr Leu Val Thr Thr
Leu Thr Tyr Gly Val Gln Cys Phe 785 790
795 800 Ser Arg Tyr Pro Asp His Met Lys Gln His Asp Phe
Phe Lys Ser Ala 805 810
815 Met Pro Glu Gly Tyr Val Gln Glu Arg Thr Ile Phe Phe Lys Asp Asp
820 825 830 Gly Asn Tyr
Lys Thr Arg Ala Glu Val Lys Phe Glu Gly Asp Thr Leu 835
840 845 Val Asn Arg Ile Glu Leu Lys Gly
Ile Asp Phe Lys Glu Asp Gly Asn 850 855
860 Ile Leu Gly His Lys Leu Glu Tyr Asn Tyr Asn Ser His
Asn Val Tyr 865 870 875
880 Ile Met Ala Asp Lys Gln Lys Asn Gly Ile Lys Val Asn Phe Lys Ile
885 890 895 Arg His Asn Ile
Glu Asp Gly Ser Val Gln Leu Ala Asp His Tyr Gln 900
905 910 Gln Asn Thr Pro Ile Gly Asp Gly Pro
Val Leu Leu Pro Asp Asn His 915 920
925 Tyr Leu Ser Thr Gln Ser Ala Leu Ser Lys Asp Pro Asn Glu
Lys Arg 930 935 940
Asp His Met Val Leu Leu Glu Phe Val Thr Ala Ala Gly Ile Thr Leu 945
950 955 960 Gly Met Asp Glu Leu
Tyr Lys 965 175922PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
175Met Tyr Pro Tyr Asp Val Pro Asp Tyr Ala Val Asp Leu Arg Thr Leu 1
5 10 15 Gly Tyr Ser Gln
Gln Gln Gln Glu Lys Ile Lys Pro Lys Val Arg Ser 20
25 30 Thr Val Ala Gln His His Glu Ala Leu
Val Gly His Gly Phe Thr His 35 40
45 Ala His Ile Val Ala Leu Ser Gln His Pro Ala Ala Leu Gly
Thr Val 50 55 60
Ala Val Lys Tyr Gln Asp Met Ile Ala Ala Leu Pro Glu Ala Thr His 65
70 75 80 Glu Ala Ile Val Gly
Val Gly Lys Gln Trp Ser Gly Ala Arg Ala Leu 85
90 95 Glu Ala Leu Leu Thr Val Ala Gly Glu Leu
Arg Gly Pro Pro Leu Gln 100 105
110 Leu Asp Thr Gly Gln Leu Leu Lys Ile Ala Lys Arg Gly Gly Val
Thr 115 120 125 Ala
Val Glu Ala Val His Ala Trp Arg Asn Ala Leu Thr Gly Ala Pro 130
135 140 Leu Asn Leu Thr Pro Glu
Gln Val Val Ala Ile Ala Ser Xaa Xaa Gly 145 150
155 160 Gly Lys Gln Ala Leu Glu Thr Val Gln Arg Leu
Leu Pro Val Leu Cys 165 170
175 Gln Ala His Gly Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser Xaa
180 185 190 Xaa Gly
Gly Lys Gln Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val 195
200 205 Leu Cys Gln Ala His Gly Leu
Thr Pro Glu Gln Val Val Ala Ile Ala 210 215
220 Ser Xaa Xaa Gly Gly Lys Gln Ala Leu Glu Thr Val
Gln Arg Leu Leu 225 230 235
240 Pro Val Leu Cys Gln Ala His Gly Leu Thr Pro Glu Gln Val Val Ala
245 250 255 Ile Ala Ser
Xaa Xaa Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Arg 260
265 270 Leu Leu Pro Val Leu Cys Gln Ala
His Gly Leu Thr Pro Glu Gln Val 275 280
285 Val Ala Ile Ala Ser Xaa Xaa Gly Gly Lys Gln Ala Leu
Glu Thr Val 290 295 300
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly Leu Thr Pro Glu 305
310 315 320 Gln Val Val Ala
Ile Ala Ser Xaa Xaa Gly Gly Lys Gln Ala Leu Glu 325
330 335 Thr Val Gln Arg Leu Leu Pro Val Leu
Cys Gln Ala His Gly Leu Thr 340 345
350 Pro Glu Gln Val Val Ala Ile Ala Ser Xaa Xaa Gly Gly Lys
Gln Ala 355 360 365
Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 370
375 380 Leu Thr Pro Glu Gln
Val Val Ala Ile Ala Ser Xaa Xaa Gly Gly Lys 385 390
395 400 Gln Ala Leu Glu Thr Val Gln Arg Leu Leu
Pro Val Leu Cys Gln Ala 405 410
415 His Gly Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser Xaa Xaa
Gly 420 425 430 Gly
Lys Gln Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys 435
440 445 Gln Ala His Gly Leu Thr
Pro Glu Gln Val Val Ala Ile Ala Ser Xaa 450 455
460 Xaa Gly Gly Lys Gln Ala Leu Glu Thr Val Gln
Arg Leu Leu Pro Val 465 470 475
480 Leu Cys Gln Ala His Gly Leu Thr Pro Glu Gln Val Val Ala Ile Ala
485 490 495 Ser Xaa
Xaa Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Arg Leu Leu 500
505 510 Pro Val Leu Cys Gln Ala His
Gly Leu Thr Pro Glu Gln Val Val Ala 515 520
525 Ile Ala Ser Xaa Xaa Gly Gly Lys Gln Ala Leu Glu
Thr Val Gln Arg 530 535 540
Leu Leu Pro Val Leu Cys Gln Ala His Gly Leu Thr Pro Glu Gln Val 545
550 555 560 Val Ala Ile
Ala Ser Xaa Xaa Gly Gly Arg Pro Ala Leu Glu Ser Ile 565
570 575 Val Ala Gln Leu Ser Arg Pro Asp
Pro Ala Leu Ala Ala Leu Thr Asn 580 585
590 Asp His Leu Val Ala Leu Ala Cys Leu Gly Gly Arg Pro
Ala Leu Asp 595 600 605
Ala Val Lys Lys Gly Leu Pro His Ala Pro Ala Leu Ile Lys Arg Thr 610
615 620 Asn Arg Arg Ile
Pro Glu Arg Thr Ser His Arg Val Ala Ala Ser Pro 625 630
635 640 Lys Lys Lys Arg Lys Val Glu Ala Ser
Pro Lys Lys Lys Arg Lys Val 645 650
655 Glu Ala Ser Gly Ser Gly Met Asn Ile Gln Met Leu Leu Glu
Ala Ala 660 665 670
Asp Tyr Leu Glu Arg Arg Glu Arg Glu Ala Glu His Gly Tyr Ala Ser
675 680 685 Met Leu Pro Gly
Ser Gly Met Asn Ile Gln Met Leu Leu Glu Ala Ala 690
695 700 Asp Tyr Leu Glu Arg Arg Glu Arg
Glu Ala Glu His Gly Tyr Ala Ser 705 710
715 720 Met Leu Pro Gly Ser Gly Met Asn Ile Gln Met Leu
Leu Glu Ala Ala 725 730
735 Asp Tyr Leu Glu Arg Arg Glu Arg Glu Ala Glu His Gly Tyr Ala Ser
740 745 750 Met Leu Pro
Gly Ser Gly Met Asn Ile Gln Met Leu Leu Glu Ala Ala 755
760 765 Asp Tyr Leu Glu Arg Arg Glu Arg
Glu Ala Glu His Gly Tyr Ala Ser 770 775
780 Met Leu Pro Ser Arg Ser Arg Gly Ser Gly Glu Gly Arg
Gly Ser Leu 785 790 795
800 Leu Thr Cys Gly Asp Val Glu Glu Asn Pro Gly Pro Ile Glu Lys Ser
805 810 815 Phe Val Ile Thr
Asp Pro Arg Leu Pro Asp Tyr Pro Ile Ile Phe Ala 820
825 830 Ser Asp Gly Phe Leu Glu Leu Thr Glu
Tyr Ser Arg Glu Glu Ile Met 835 840
845 Gly Arg Asn Ala Arg Phe Leu Gln Gly Pro Glu Thr Asp Gln
Ala Thr 850 855 860
Val Gln Lys Ile Arg Asp Ala Ile Arg Asp Gln Arg Glu Thr Thr Val 865
870 875 880 Gln Leu Ile Asn Tyr
Thr Lys Ser Gly Lys Lys Phe Trp Asn Leu Leu 885
890 895 His Leu Gln Pro Val Arg Asp Arg Lys Gly
Gly Leu Gln Tyr Phe Ile 900 905
910 Gly Val Gln Leu Val Gly Ser Asp His Val 915
920 176983PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 176Met Tyr Pro Tyr Asp Val Pro Asp
Tyr Ala Val Asp Leu Arg Thr Leu 1 5 10
15 Gly Tyr Ser Gln Gln Gln Gln Glu Lys Ile Lys Pro Lys
Val Arg Ser 20 25 30
Thr Val Ala Gln His His Glu Ala Leu Val Gly His Gly Phe Thr His
35 40 45 Ala His Ile Val
Ala Leu Ser Gln His Pro Ala Ala Leu Gly Thr Val 50
55 60 Ala Val Lys Tyr Gln Asp Met Ile
Ala Ala Leu Pro Glu Ala Thr His 65 70
75 80 Glu Ala Ile Val Gly Val Gly Lys Gln Trp Ser Gly
Ala Arg Ala Leu 85 90
95 Glu Ala Leu Leu Thr Val Ala Gly Glu Leu Arg Gly Pro Pro Leu Gln
100 105 110 Leu Asp Thr
Gly Gln Leu Leu Lys Ile Ala Lys Arg Gly Gly Val Thr 115
120 125 Ala Val Glu Ala Val His Ala Trp
Arg Asn Ala Leu Thr Gly Ala Pro 130 135
140 Leu Asn Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser
Xaa Xaa Gly 145 150 155
160 Gly Lys Gln Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys
165 170 175 Gln Ala His Gly
Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser Xaa 180
185 190 Xaa Gly Gly Lys Gln Ala Leu Glu Thr
Val Gln Arg Leu Leu Pro Val 195 200
205 Leu Cys Gln Ala His Gly Leu Thr Pro Glu Gln Val Val Ala
Ile Ala 210 215 220
Ser Xaa Xaa Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Arg Leu Leu 225
230 235 240 Pro Val Leu Cys Gln
Ala His Gly Leu Thr Pro Glu Gln Val Val Ala 245
250 255 Ile Ala Ser Xaa Xaa Gly Gly Lys Gln Ala
Leu Glu Thr Val Gln Arg 260 265
270 Leu Leu Pro Val Leu Cys Gln Ala His Gly Leu Thr Pro Glu Gln
Val 275 280 285 Val
Ala Ile Ala Ser Xaa Xaa Gly Gly Lys Gln Ala Leu Glu Thr Val 290
295 300 Gln Arg Leu Leu Pro Val
Leu Cys Gln Ala His Gly Leu Thr Pro Glu 305 310
315 320 Gln Val Val Ala Ile Ala Ser Xaa Xaa Gly Gly
Lys Gln Ala Leu Glu 325 330
335 Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly Leu Thr
340 345 350 Pro Glu
Gln Val Val Ala Ile Ala Ser Xaa Xaa Gly Gly Lys Gln Ala 355
360 365 Leu Glu Thr Val Gln Arg Leu
Leu Pro Val Leu Cys Gln Ala His Gly 370 375
380 Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser Xaa
Xaa Gly Gly Lys 385 390 395
400 Gln Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln Ala
405 410 415 His Gly Leu
Thr Pro Glu Gln Val Val Ala Ile Ala Ser Xaa Xaa Gly 420
425 430 Gly Lys Gln Ala Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys 435 440
445 Gln Ala His Gly Leu Thr Pro Glu Gln Val Val Ala Ile
Ala Ser Xaa 450 455 460
Xaa Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val 465
470 475 480 Leu Cys Gln Ala
His Gly Leu Thr Pro Glu Gln Val Val Ala Ile Ala 485
490 495 Ser Xaa Xaa Gly Gly Lys Gln Ala Leu
Glu Thr Val Gln Arg Leu Leu 500 505
510 Pro Val Leu Cys Gln Ala His Gly Leu Thr Pro Glu Gln Val
Val Ala 515 520 525
Ile Ala Ser Xaa Xaa Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Arg 530
535 540 Leu Leu Pro Val Leu
Cys Gln Ala His Gly Leu Thr Pro Glu Gln Val 545 550
555 560 Val Ala Ile Ala Ser Xaa Xaa Gly Gly Arg
Pro Ala Leu Glu Ser Ile 565 570
575 Val Ala Gln Leu Ser Arg Pro Asp Pro Ala Leu Ala Ala Leu Thr
Asn 580 585 590 Asp
His Leu Val Ala Leu Ala Cys Leu Gly Gly Arg Pro Ala Leu Asp 595
600 605 Ala Val Lys Lys Gly Leu
Pro His Ala Pro Ala Leu Ile Lys Arg Thr 610 615
620 Asn Arg Arg Ile Pro Glu Arg Thr Ser His Arg
Val Ala Ala Ser Pro 625 630 635
640 Lys Lys Lys Arg Lys Val Glu Ala Ser Asn Gly Ala Ile Gly Gly Asp
645 650 655 Leu Leu
Leu Asn Phe Pro Asp Met Ser Val Leu Glu Arg Gln Arg Ala 660
665 670 His Leu Lys Tyr Leu Asn Pro
Thr Phe Asp Ser Pro Leu Ala Gly Phe 675 680
685 Phe Ala Asp Ser Ser Met Ile Thr Gly Gly Glu Met
Asp Ser Tyr Leu 690 695 700
Ser Thr Ala Gly Leu Asn Leu Pro Met Met Tyr Gly Glu Thr Thr Val 705
710 715 720 Glu Gly Asp
Ser Arg Leu Ser Ile Ser Pro Glu Thr Thr Leu Gly Thr 725
730 735 Gly Asn Phe Lys Lys Arg Lys Phe
Asp Thr Glu Thr Lys Asp Cys Asn 740 745
750 Glu Lys Lys Lys Lys Met Thr Met Asn Arg Asp Asp Leu
Val Glu Glu 755 760 765
Gly Glu Glu Glu Lys Ser Lys Ile Thr Glu Gln Asn Asn Gly Ser Thr 770
775 780 Lys Ser Ile Lys
Lys Met Lys His Lys Ala Lys Lys Glu Glu Asn Asn 785 790
795 800 Phe Ser Asn Asp Ser Ser Lys Val Thr
Lys Glu Leu Glu Lys Thr Asp 805 810
815 Tyr Ile His Val Arg Ala Arg Arg Gly Gln Ala Thr Asp Ser
His Ser 820 825 830
Ile Ala Glu Arg Val Arg Arg Glu Lys Ile Ser Glu Arg Met Lys Phe
835 840 845 Leu Gln Asp Leu
Val Pro Gly Cys Asp Lys Ile Thr Gly Lys Ala Gly 850
855 860 Met Leu Asp Glu Ile Ile Asn Tyr
Val Gln Ser Leu Gln Arg Gln Ile 865 870
875 880 Glu Phe Leu Ser Met Lys Leu Ala Ile Val Asn Pro
Arg Pro Asp Phe 885 890
895 Asp Met Asp Asp Ile Phe Ala Lys Glu Val Ala Ser Thr Pro Met Thr
900 905 910 Val Val Pro
Ser Pro Glu Met Val Leu Ser Gly Tyr Ser His Glu Met 915
920 925 Val His Ser Gly Tyr Ser Ser Glu
Met Val Asn Ser Gly Tyr Leu His 930 935
940 Val Asn Pro Met Gln Gln Val Asn Thr Ser Ser Asp Pro
Leu Ser Cys 945 950 955
960 Phe Asn Asn Gly Glu Ala Pro Ser Met Trp Asp Ser His Val Gln Asn
965 970 975 Leu Tyr Gly Asn
Leu Gly Val 980 177830PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
177Met Lys Met Asp Lys Lys Thr Ile Val Trp Phe Arg Arg Asp Leu Arg 1
5 10 15 Ile Glu Asp Asn
Pro Ala Leu Ala Ala Ala Ala His Glu Gly Ser Val 20
25 30 Phe Pro Val Phe Ile Trp Cys Pro Glu
Glu Glu Gly Gln Phe Tyr Pro 35 40
45 Gly Arg Ala Ser Arg Trp Trp Met Lys Gln Ser Leu Ala His
Leu Ser 50 55 60
Gln Ser Leu Lys Ala Leu Gly Ser Asp Leu Thr Leu Ile Lys Thr His 65
70 75 80 Asn Thr Ile Ser Ala
Ile Leu Asp Cys Ile Arg Val Thr Gly Ala Thr 85
90 95 Lys Val Val Phe Asn His Leu Tyr Asp Pro
Val Ser Leu Val Arg Asp 100 105
110 His Thr Val Lys Glu Lys Leu Val Glu Arg Gly Ile Ser Val Gln
Ser 115 120 125 Tyr
Asn Gly Asp Leu Leu Tyr Glu Pro Trp Glu Ile Tyr Cys Glu Lys 130
135 140 Gly Lys Pro Phe Thr Ser
Phe Asn Ser Tyr Trp Lys Lys Cys Leu Asp 145 150
155 160 Met Ser Ile Glu Ser Val Met Leu Pro Pro Pro
Trp Arg Leu Met Pro 165 170
175 Ile Thr Ala Ala Ala Glu Ala Ile Trp Ala Cys Ser Ile Glu Glu Leu
180 185 190 Gly Leu
Glu Asn Glu Ala Glu Lys Pro Ser Asn Ala Leu Leu Thr Arg 195
200 205 Ala Trp Ser Pro Gly Trp Ser
Asn Ala Asp Lys Leu Leu Asn Glu Phe 210 215
220 Ile Glu Lys Gln Leu Ile Asp Tyr Ala Lys Asn Ser
Lys Lys Val Val 225 230 235
240 Gly Asn Ser Thr Ser Leu Leu Ser Pro Tyr Leu His Phe Gly Glu Ile
245 250 255 Ser Val Arg
His Val Phe Gln Cys Ala Arg Met Lys Gln Ile Ile Trp 260
265 270 Ala Arg Asp Lys Asn Ser Glu Gly
Glu Glu Ser Ala Asp Leu Phe Leu 275 280
285 Arg Gly Ile Gly Leu Arg Glu Tyr Ser Arg Tyr Ile Cys
Phe Asn Phe 290 295 300
Pro Phe Thr His Glu Gln Ser Leu Leu Ser His Leu Arg Phe Phe Pro 305
310 315 320 Trp Asp Ala Asp
Val Asp Lys Phe Lys Ala Trp Arg Gln Gly Arg Thr 325
330 335 Gly Tyr Pro Leu Val Asp Ala Gly Met
Arg Glu Leu Trp Ala Thr Gly 340 345
350 Trp Met His Asn Arg Ile Arg Val Ile Val Ser Ser Phe Ala
Val Lys 355 360 365
Phe Leu Leu Leu Pro Trp Lys Trp Gly Met Lys Tyr Phe Trp Asp Thr 370
375 380 Leu Leu Asp Ala Asp
Leu Glu Cys Asp Ile Leu Gly Trp Gln Tyr Ile 385 390
395 400 Ser Gly Ser Ile Pro Asp Gly His Glu Leu
Asp Arg Leu Asp Asn Pro 405 410
415 Ala Leu Gln Gly Ala Lys Tyr Asp Pro Glu Gly Glu Tyr Ile Arg
Gln 420 425 430 Trp
Leu Pro Glu Leu Ala Arg Leu Pro Thr Glu Trp Ile His His Pro 435
440 445 Trp Asp Ala Pro Leu Thr
Val Leu Lys Ala Ser Gly Val Glu Leu Gly 450 455
460 Thr Asn Tyr Ala Lys Pro Ile Val Asp Ile Asp
Thr Ala Arg Glu Leu 465 470 475
480 Leu Ala Lys Ala Ile Ser Arg Thr Arg Glu Ala Gln Ile Met Ile Gly
485 490 495 Ala Ala
Pro Ala Ser Pro Lys Lys Lys Arg Lys Val Glu Ala Ser Gly 500
505 510 Ser Gly Arg Ala Asp Ala Leu
Asp Asp Phe Asp Leu Asp Met Leu Gly 515 520
525 Ser Asp Ala Leu Asp Asp Phe Asp Leu Asp Met Leu
Gly Ser Asp Ala 530 535 540
Leu Asp Asp Phe Asp Leu Asp Met Leu Gly Ser Asp Ala Leu Asp Asp 545
550 555 560 Phe Asp Leu
Asp Met Leu Ile Asn Ser Arg Gly Ser Gly Glu Gly Arg 565
570 575 Gly Ser Leu Leu Thr Cys Gly Asp
Val Glu Glu Asn Pro Gly Pro Val 580 585
590 Ser Lys Gly Glu Glu Leu Phe Thr Gly Val Val Pro Ile
Leu Val Glu 595 600 605
Leu Asp Gly Asp Val Asn Gly His Lys Phe Ser Val Ser Gly Glu Gly 610
615 620 Glu Gly Asp Ala
Thr Tyr Gly Lys Leu Thr Leu Lys Phe Ile Cys Thr 625 630
635 640 Thr Gly Lys Leu Pro Val Pro Trp Pro
Thr Leu Val Thr Thr Leu Thr 645 650
655 Tyr Gly Val Gln Cys Phe Ser Arg Tyr Pro Asp His Met Lys
Gln His 660 665 670
Asp Phe Phe Lys Ser Ala Met Pro Glu Gly Tyr Val Gln Glu Arg Thr
675 680 685 Ile Phe Phe Lys
Asp Asp Gly Asn Tyr Lys Thr Arg Ala Glu Val Lys 690
695 700 Phe Glu Gly Asp Thr Leu Val Asn
Arg Ile Glu Leu Lys Gly Ile Asp 705 710
715 720 Phe Lys Glu Asp Gly Asn Ile Leu Gly His Lys Leu
Glu Tyr Asn Tyr 725 730
735 Asn Ser His Asn Val Tyr Ile Met Ala Asp Lys Gln Lys Asn Gly Ile
740 745 750 Lys Val Asn
Phe Lys Ile Arg His Asn Ile Glu Asp Gly Ser Val Gln 755
760 765 Leu Ala Asp His Tyr Gln Gln Asn
Thr Pro Ile Gly Asp Gly Pro Val 770 775
780 Leu Leu Pro Asp Asn His Tyr Leu Ser Thr Gln Ser Ala
Leu Ser Lys 785 790 795
800 Asp Pro Asn Glu Lys Arg Asp His Met Val Leu Leu Glu Phe Val Thr
805 810 815 Ala Ala Gly Ile
Thr Leu Gly Met Asp Glu Leu Tyr Lys Val 820
825 830 178774PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 178Met Lys Met Asp Lys Lys
Thr Ile Val Trp Phe Arg Arg Asp Leu Arg 1 5
10 15 Ile Glu Asp Asn Pro Ala Leu Ala Ala Ala Ala
His Glu Gly Ser Val 20 25
30 Phe Pro Val Phe Ile Trp Cys Pro Glu Glu Glu Gly Gln Phe Tyr
Pro 35 40 45 Gly
Arg Ala Ser Arg Trp Trp Met Lys Gln Ser Leu Ala His Leu Ser 50
55 60 Gln Ser Leu Lys Ala Leu
Gly Ser Asp Leu Thr Leu Ile Lys Thr His 65 70
75 80 Asn Thr Ile Ser Ala Ile Leu Asp Cys Ile Arg
Val Thr Gly Ala Thr 85 90
95 Lys Val Val Phe Asn His Leu Tyr Asp Pro Val Ser Leu Val Arg Asp
100 105 110 His Thr
Val Lys Glu Lys Leu Val Glu Arg Gly Ile Ser Val Gln Ser 115
120 125 Tyr Asn Gly Asp Leu Leu Tyr
Glu Pro Trp Glu Ile Tyr Cys Glu Lys 130 135
140 Gly Lys Pro Phe Thr Ser Phe Asn Ser Tyr Trp Lys
Lys Cys Leu Asp 145 150 155
160 Met Ser Ile Glu Ser Val Met Leu Pro Pro Pro Trp Arg Leu Met Pro
165 170 175 Ile Thr Ala
Ala Ala Glu Ala Ile Trp Ala Cys Ser Ile Glu Glu Leu 180
185 190 Gly Leu Glu Asn Glu Ala Glu Lys
Pro Ser Asn Ala Leu Leu Thr Arg 195 200
205 Ala Trp Ser Pro Gly Trp Ser Asn Ala Asp Lys Leu Leu
Asn Glu Phe 210 215 220
Ile Glu Lys Gln Leu Ile Asp Tyr Ala Lys Asn Ser Lys Lys Val Val 225
230 235 240 Gly Asn Ser Thr
Ser Leu Leu Ser Pro Tyr Leu His Phe Gly Glu Ile 245
250 255 Ser Val Arg His Val Phe Gln Cys Ala
Arg Met Lys Gln Ile Ile Trp 260 265
270 Ala Arg Asp Lys Asn Ser Glu Gly Glu Glu Ser Ala Asp Leu
Phe Leu 275 280 285
Arg Gly Ile Gly Leu Arg Glu Tyr Ser Arg Tyr Ile Cys Phe Asn Phe 290
295 300 Pro Phe Thr His Glu
Gln Ser Leu Leu Ser His Leu Arg Phe Phe Pro 305 310
315 320 Trp Asp Ala Asp Val Asp Lys Phe Lys Ala
Trp Arg Gln Gly Arg Thr 325 330
335 Gly Tyr Pro Leu Val Asp Ala Gly Met Arg Glu Leu Trp Ala Thr
Gly 340 345 350 Trp
Met His Asn Arg Ile Arg Val Ile Val Ser Ser Phe Ala Val Lys 355
360 365 Phe Leu Leu Leu Pro Trp
Lys Trp Gly Met Lys Tyr Phe Trp Asp Thr 370 375
380 Leu Leu Asp Ala Asp Leu Glu Cys Asp Ile Leu
Gly Trp Gln Tyr Ile 385 390 395
400 Ser Gly Ser Ile Pro Asp Gly His Glu Leu Asp Arg Leu Asp Asn Pro
405 410 415 Ala Leu
Gln Gly Ala Lys Tyr Asp Pro Glu Gly Glu Tyr Ile Arg Gln 420
425 430 Trp Leu Pro Glu Leu Ala Arg
Leu Pro Thr Glu Trp Ile His His Pro 435 440
445 Trp Asp Ala Pro Leu Thr Val Leu Lys Ala Ser Gly
Val Glu Leu Gly 450 455 460
Thr Asn Tyr Ala Lys Pro Ile Val Asp Ile Asp Thr Ala Arg Glu Leu 465
470 475 480 Leu Ala Lys
Ala Ile Ser Arg Thr Arg Glu Ala Gln Ile Met Ile Gly 485
490 495 Ala Ala Pro Ala Ser Pro Lys Lys
Lys Arg Lys Val Glu Ala Ser Gly 500 505
510 Ser Gly Met Asn Ile Gln Met Leu Leu Glu Ala Ala Asp
Tyr Leu Glu 515 520 525
Arg Arg Glu Arg Glu Ala Glu His Gly Tyr Ala Ser Met Leu Pro Gly 530
535 540 Ser Gly Met Asn
Ile Gln Met Leu Leu Glu Ala Ala Asp Tyr Leu Glu 545 550
555 560 Arg Arg Glu Arg Glu Ala Glu His Gly
Tyr Ala Ser Met Leu Pro Gly 565 570
575 Ser Gly Met Asn Ile Gln Met Leu Leu Glu Ala Ala Asp Tyr
Leu Glu 580 585 590
Arg Arg Glu Arg Glu Ala Glu His Gly Tyr Ala Ser Met Leu Pro Gly
595 600 605 Ser Gly Met Asn
Ile Gln Met Leu Leu Glu Ala Ala Asp Tyr Leu Glu 610
615 620 Arg Arg Glu Arg Glu Ala Glu His
Gly Tyr Ala Ser Met Leu Pro Ser 625 630
635 640 Arg Ser Arg Gly Ser Gly Glu Gly Arg Gly Ser Leu
Leu Thr Cys Gly 645 650
655 Asp Val Glu Glu Asn Pro Gly Pro Ile Glu Lys Ser Phe Val Ile Thr
660 665 670 Asp Pro Arg
Leu Pro Asp Tyr Pro Ile Ile Phe Ala Ser Asp Gly Phe 675
680 685 Leu Glu Leu Thr Glu Tyr Ser Arg
Glu Glu Ile Met Gly Arg Asn Ala 690 695
700 Arg Phe Leu Gln Gly Pro Glu Thr Asp Gln Ala Thr Val
Gln Lys Ile 705 710 715
720 Arg Asp Ala Ile Arg Asp Gln Arg Glu Thr Thr Val Gln Leu Ile Asn
725 730 735 Tyr Thr Lys Ser
Gly Lys Lys Phe Trp Asn Leu Leu His Leu Gln Pro 740
745 750 Val Arg Asp Arg Lys Gly Gly Leu Gln
Tyr Phe Ile Gly Val Gln Leu 755 760
765 Val Gly Ser Asp His Val 770
1791356PRTArtificial SequenceDescription of Artificial Sequence Synthetic
polypeptide 179Met Ser Arg Thr Arg Leu Pro Ser Pro Pro Ala Pro Ser
Pro Ala Phe 1 5 10 15
Ser Ala Asp Ser Phe Ser Asp Leu Leu Arg Gln Phe Asp Pro Ser Leu
20 25 30 Phe Asn Thr Ser
Leu Phe Asp Ser Leu Pro Pro Phe Gly Ala His His 35
40 45 Thr Glu Ala Ala Thr Gly Glu Trp Asp
Glu Val Gln Ser Gly Leu Arg 50 55
60 Ala Ala Asp Ala Pro Pro Pro Thr Met Arg Val Ala Val
Thr Ala Ala 65 70 75
80 Arg Pro Pro Arg Ala Lys Pro Ala Pro Arg Arg Arg Ala Ala Gln Pro
85 90 95 Ser Asp Ala Ser
Pro Ala Ala Gln Val Asp Leu Arg Thr Leu Gly Tyr 100
105 110 Ser Gln Gln Gln Gln Glu Lys Ile Lys
Pro Lys Val Arg Ser Thr Val 115 120
125 Ala Gln His His Glu Ala Leu Val Gly His Gly Phe Thr His
Ala His 130 135 140
Ile Val Ala Leu Ser Gln His Pro Ala Ala Leu Gly Thr Val Ala Val 145
150 155 160 Lys Tyr Gln Asp Met
Ile Ala Ala Leu Pro Glu Ala Thr His Glu Ala 165
170 175 Ile Val Gly Val Gly Lys Gln Trp Ser Gly
Ala Arg Ala Leu Glu Ala 180 185
190 Leu Leu Thr Val Ala Gly Glu Leu Arg Gly Pro Pro Leu Gln Leu
Asp 195 200 205 Thr
Gly Gln Leu Leu Lys Ile Ala Lys Arg Gly Gly Val Thr Ala Val 210
215 220 Glu Ala Val His Ala Trp
Arg Asn Ala Leu Thr Gly Ala Pro Leu Asn 225 230
235 240 Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser
Asn Gly Gly Gly Lys 245 250
255 Gln Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln Ala
260 265 270 His Gly
Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser His Asp Gly 275
280 285 Gly Lys Gln Ala Leu Glu Thr
Val Gln Arg Leu Leu Pro Val Leu Cys 290 295
300 Gln Ala His Gly Leu Thr Pro Glu Gln Val Val Ala
Ile Ala Ser Asn 305 310 315
320 Gly Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val
325 330 335 Leu Cys Gln
Ala His Gly Leu Thr Pro Glu Gln Val Val Ala Ile Ala 340
345 350 Ser Asn Gly Gly Gly Lys Gln Ala
Leu Glu Thr Val Gln Arg Leu Leu 355 360
365 Pro Val Leu Cys Gln Ala His Gly Leu Thr Pro Glu Gln
Val Val Ala 370 375 380
Ile Ala Ser Asn Ile Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Arg 385
390 395 400 Leu Leu Pro Val
Leu Cys Gln Ala His Gly Leu Thr Pro Glu Gln Val 405
410 415 Val Ala Ile Ala Ser His Asp Gly Gly
Lys Gln Ala Leu Glu Thr Val 420 425
430 Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly Leu Thr
Pro Glu 435 440 445
Gln Val Val Ala Ile Ala Ser Asn Gly Gly Gly Lys Gln Ala Leu Glu 450
455 460 Thr Val Gln Arg Leu
Leu Pro Val Leu Cys Gln Ala His Gly Leu Thr 465 470
475 480 Pro Glu Gln Val Val Ala Ile Ala Ser Asn
Gly Gly Gly Lys Gln Ala 485 490
495 Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His
Gly 500 505 510 Leu
Thr Pro Glu Gln Val Val Ala Ile Ala Ser Asn Ile Gly Gly Lys 515
520 525 Gln Ala Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala 530 535
540 His Gly Leu Thr Pro Glu Gln Val Val Ala Ile
Ala Ser Asn Gly Gly 545 550 555
560 Gly Lys Gln Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys
565 570 575 Gln Ala
His Gly Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser Asn 580
585 590 Ile Gly Gly Lys Gln Ala Leu
Glu Thr Val Gln Arg Leu Leu Pro Val 595 600
605 Leu Cys Gln Ala His Gly Leu Thr Pro Glu Gln Val
Val Ala Ile Ala 610 615 620
Ser Asn Ile Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Arg Leu Leu 625
630 635 640 Pro Val Leu
Cys Gln Ala His Gly Leu Thr Pro Glu Gln Val Val Ala 645
650 655 Ile Ala Ser His Asp Gly Gly Arg
Pro Ala Leu Glu Ser Ile Val Ala 660 665
670 Gln Leu Ser Arg Pro Asp Pro Ala Leu Ala Ala Leu Thr
Asn Asp His 675 680 685
Leu Val Ala Leu Ala Cys Leu Gly Gly Arg Pro Ala Leu Asp Ala Val 690
695 700 Lys Lys Gly Leu
Pro His Ala Pro Ala Leu Ile Lys Arg Thr Asn Arg 705 710
715 720 Arg Ile Pro Glu Arg Thr Ser His Arg
Val Ala Asp His Ala Gln Val 725 730
735 Val Arg Val Leu Gly Phe Phe Gln Cys His Ser His Pro Ala
Gln Ala 740 745 750
Phe Asp Asp Ala Met Thr Gln Phe Gly Met Ser Arg His Gly Leu Leu
755 760 765 Gln Leu Phe Arg
Arg Val Gly Val Thr Glu Leu Glu Ala Arg Ser Gly 770
775 780 Thr Leu Pro Pro Ala Ser Gln Arg
Trp Asp Arg Ile Leu Gln Ala Ser 785 790
795 800 Gly Met Lys Arg Ala Lys Pro Ser Pro Thr Ser Thr
Gln Thr Pro Asp 805 810
815 Gln Ala Ser Leu His Ala Phe Ala Asp Ser Leu Glu Arg Asp Leu Asp
820 825 830 Ala Pro Ser
Pro Met His Glu Gly Asp Gln Thr Arg Ala Ser Ala Ser 835
840 845 Pro Lys Lys Lys Arg Lys Val Glu
Ala Ser Lys Met Asp Lys Lys Thr 850 855
860 Ile Val Trp Phe Arg Arg Asp Leu Arg Ile Glu Asp Asn
Pro Ala Leu 865 870 875
880 Ala Ala Ala Ala His Glu Gly Ser Val Phe Pro Val Phe Ile Trp Cys
885 890 895 Pro Glu Glu Glu
Gly Gln Phe Tyr Pro Gly Arg Ala Ser Arg Trp Trp 900
905 910 Met Lys Gln Ser Leu Ala His Leu Ser
Gln Ser Leu Lys Ala Leu Gly 915 920
925 Ser Asp Leu Thr Leu Ile Lys Thr His Asn Thr Ile Ser Ala
Ile Leu 930 935 940
Asp Cys Ile Arg Val Thr Gly Ala Thr Lys Val Val Phe Asn His Leu 945
950 955 960 Tyr Asp Pro Val Ser
Leu Val Arg Asp His Thr Val Lys Glu Lys Leu 965
970 975 Val Glu Arg Gly Ile Ser Val Gln Ser Tyr
Asn Gly Asp Leu Leu Tyr 980 985
990 Glu Pro Trp Glu Ile Tyr Cys Glu Lys Gly Lys Pro Phe Thr
Ser Phe 995 1000 1005
Asn Ser Tyr Trp Lys Lys Cys Leu Asp Met Ser Ile Glu Ser Val 1010
1015 1020 Met Leu Pro Pro Pro
Trp Arg Leu Met Pro Ile Thr Ala Ala Ala 1025 1030
1035 Glu Ala Ile Trp Ala Cys Ser Ile Glu Glu
Leu Gly Leu Glu Asn 1040 1045 1050
Glu Ala Glu Lys Pro Ser Asn Ala Leu Leu Thr Arg Ala Trp Ser
1055 1060 1065 Pro Gly
Trp Ser Asn Ala Asp Lys Leu Leu Asn Glu Phe Ile Glu 1070
1075 1080 Lys Gln Leu Ile Asp Tyr Ala
Lys Asn Ser Lys Lys Val Val Gly 1085 1090
1095 Asn Ser Thr Ser Leu Leu Ser Pro Tyr Leu His Phe
Gly Glu Ile 1100 1105 1110
Ser Val Arg His Val Phe Gln Cys Ala Arg Met Lys Gln Ile Ile 1115
1120 1125 Trp Ala Arg Asp Lys
Asn Ser Glu Gly Glu Glu Ser Ala Asp Leu 1130 1135
1140 Phe Leu Arg Gly Ile Gly Leu Arg Glu Tyr
Ser Arg Tyr Ile Cys 1145 1150 1155
Phe Asn Phe Pro Phe Thr His Glu Gln Ser Leu Leu Ser His Leu
1160 1165 1170 Arg Phe
Phe Pro Trp Asp Ala Asp Val Asp Lys Phe Lys Ala Trp 1175
1180 1185 Arg Gln Gly Arg Thr Gly Tyr
Pro Leu Val Asp Ala Gly Met Arg 1190 1195
1200 Glu Leu Trp Ala Thr Gly Trp Met His Asn Arg Ile
Arg Val Ile 1205 1210 1215
Val Ser Ser Phe Ala Val Lys Phe Leu Leu Leu Pro Trp Lys Trp 1220
1225 1230 Gly Met Lys Tyr Phe
Trp Asp Thr Leu Leu Asp Ala Asp Leu Glu 1235 1240
1245 Cys Asp Ile Leu Gly Trp Gln Tyr Ile Ser
Gly Ser Ile Pro Asp 1250 1255 1260
Gly His Glu Leu Asp Arg Leu Asp Asn Pro Ala Leu Gln Gly Ala
1265 1270 1275 Lys Tyr
Asp Pro Glu Gly Glu Tyr Ile Arg Gln Trp Leu Pro Glu 1280
1285 1290 Leu Ala Arg Leu Pro Thr Glu
Trp Ile His His Pro Trp Asp Ala 1295 1300
1305 Pro Leu Thr Val Leu Lys Ala Ser Gly Val Glu Leu
Gly Thr Asn 1310 1315 1320
Tyr Ala Lys Pro Ile Val Asp Ile Asp Thr Ala Arg Glu Leu Leu 1325
1330 1335 Ala Lys Ala Ile Ser
Arg Thr Arg Glu Ala Gln Ile Met Ile Gly 1340 1345
1350 Ala Ala Pro 1355
1801001PRTArtificial SequenceDescription of Artificial Sequence Synthetic
polypeptide 180Met Tyr Pro Tyr Asp Val Pro Asp Tyr Ala Ser Pro Lys
Lys Lys Arg 1 5 10 15
Lys Val Glu Ala Ser Val Asp Leu Arg Thr Leu Gly Tyr Ser Gln Gln
20 25 30 Gln Gln Glu Lys
Ile Lys Pro Lys Val Arg Ser Thr Val Ala Gln His 35
40 45 His Glu Ala Leu Val Gly His Gly Phe
Thr His Ala His Ile Val Ala 50 55
60 Leu Ser Gln His Pro Ala Ala Leu Gly Thr Val Ala Val
Lys Tyr Gln 65 70 75
80 Asp Met Ile Ala Ala Leu Pro Glu Ala Thr His Glu Ala Ile Val Gly
85 90 95 Val Gly Lys Gln
Trp Ser Gly Ala Arg Ala Leu Glu Ala Leu Leu Thr 100
105 110 Val Ala Gly Glu Leu Arg Gly Pro Pro
Leu Gln Leu Asp Thr Gly Gln 115 120
125 Leu Leu Lys Ile Ala Lys Arg Gly Gly Val Thr Ala Val Glu
Ala Val 130 135 140
His Ala Trp Arg Asn Ala Leu Thr Gly Ala Pro Leu Asn Leu Thr Pro 145
150 155 160 Glu Gln Val Val Ala
Ile Ala Ser Asn Asn Gly Gly Lys Gln Ala Leu 165
170 175 Glu Thr Val Gln Arg Leu Leu Pro Val Leu
Cys Gln Ala His Gly Leu 180 185
190 Thr Pro Glu Gln Val Val Ala Ile Ala Ser His Asp Gly Gly Lys
Gln 195 200 205 Ala
Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His 210
215 220 Gly Leu Thr Pro Glu Gln
Val Val Ala Ile Ala Ser His Asp Gly Gly 225 230
235 240 Lys Gln Ala Leu Glu Thr Val Gln Arg Leu Leu
Pro Val Leu Cys Gln 245 250
255 Ala His Gly Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser Asn Gly
260 265 270 Gly Gly
Lys Gln Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu 275
280 285 Cys Gln Ala His Gly Leu Thr
Pro Glu Gln Val Val Ala Ile Ala Ser 290 295
300 Asn Asn Gly Gly Lys Gln Ala Leu Glu Thr Val Gln
Arg Leu Leu Pro 305 310 315
320 Val Leu Cys Gln Ala His Gly Leu Thr Pro Glu Gln Val Val Ala Ile
325 330 335 Ala Ser His
Asp Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Arg Leu 340
345 350 Leu Pro Val Leu Cys Gln Ala His
Gly Leu Thr Pro Glu Gln Val Val 355 360
365 Ala Ile Ala Ser His Asp Gly Gly Lys Gln Ala Leu Glu
Thr Val Gln 370 375 380
Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly Leu Thr Pro Glu Gln 385
390 395 400 Val Val Ala Ile
Ala Ser His Asp Gly Gly Lys Gln Ala Leu Glu Thr 405
410 415 Val Gln Arg Leu Leu Pro Val Leu Cys
Gln Ala His Gly Leu Thr Pro 420 425
430 Glu Gln Val Val Ala Ile Ala Ser Asn Gly Gly Gly Lys Gln
Ala Leu 435 440 445
Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly Leu 450
455 460 Thr Pro Glu Gln Val
Val Ala Ile Ala Ser His Asp Gly Gly Lys Gln 465 470
475 480 Ala Leu Glu Thr Val Gln Arg Leu Leu Pro
Val Leu Cys Gln Ala His 485 490
495 Gly Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser His Asp Gly
Gly 500 505 510 Lys
Gln Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln 515
520 525 Ala His Gly Leu Thr Pro
Glu Gln Val Val Ala Ile Ala Ser Asn Ile 530 535
540 Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Arg
Leu Leu Pro Val Leu 545 550 555
560 Cys Gln Ala His Gly Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser
565 570 575 Asn Asn
Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Arg Leu Leu Pro 580
585 590 Val Leu Cys Gln Ala His Gly
Leu Thr Pro Glu Gln Val Val Ala Ile 595 600
605 Ala Ser Asn Asn Gly Gly Lys Gln Ala Leu Glu Thr
Val Gln Arg Leu 610 615 620
Leu Pro Val Leu Cys Gln Ala His Gly Leu Thr Pro Glu Gln Val Val 625
630 635 640 Ala Ile Ala
Ser His Asp Gly Gly Lys Gln Ala Leu Glu Thr Val Gln 645
650 655 Arg Leu Leu Pro Val Leu Cys Gln
Ala His Gly Leu Thr Pro Glu Gln 660 665
670 Val Val Ala Ile Ala Ser Asn Gly Gly Gly Lys Gln Ala
Leu Glu Thr 675 680 685
Val Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly Leu Thr Pro 690
695 700 Glu Gln Val Val
Ala Ile Ala Ser His Asp Gly Gly Lys Gln Ala Leu 705 710
715 720 Glu Thr Val Gln Arg Leu Leu Pro Val
Leu Cys Gln Ala His Gly Leu 725 730
735 Thr Pro Glu Gln Val Val Ala Ile Ala Ser His Asp Gly Gly
Lys Gln 740 745 750
Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His
755 760 765 Gly Leu Thr Pro
Glu Gln Val Val Ala Ile Ala Ser His Asp Gly Gly 770
775 780 Arg Pro Ala Leu Glu Ser Ile Val
Ala Gln Leu Ser Arg Pro Asp Pro 785 790
795 800 Ala Leu Ala Ala Leu Thr Asn Asp His Leu Val Ala
Leu Ala Cys Leu 805 810
815 Gly Gly Arg Pro Ala Leu Asp Ala Val Lys Lys Gly Leu Pro His Ala
820 825 830 Pro Ala Leu
Ile Lys Arg Thr Asn Arg Arg Ile Pro Glu Arg Thr Ser 835
840 845 His Arg Val Ala Asp His Ala Gln
Val Val Arg Val Leu Gly Phe Phe 850 855
860 Gln Cys His Ser His Pro Ala Gln Ala Phe Asp Asp Ala
Met Thr Gln 865 870 875
880 Phe Gly Met Ser Arg His Gly Leu Leu Gln Leu Phe Arg Arg Val Gly
885 890 895 Val Thr Glu Leu
Glu Ala Arg Ser Gly Thr Leu Pro Pro Ala Ser Gln 900
905 910 Arg Trp Asp Arg Ile Leu Gln Ala Ser
Gly Met Lys Arg Ala Lys Pro 915 920
925 Ser Pro Thr Ser Thr Gln Thr Pro Asp Gln Ala Ser Leu His
Ala Phe 930 935 940
Ala Asp Ser Leu Glu Arg Asp Leu Asp Ala Pro Ser Pro Met His Glu 945
950 955 960 Gly Asp Gln Thr Arg
Ala Ser Ala Ser Gly Ser Gly Met Asn Ile Gln 965
970 975 Met Leu Leu Glu Ala Ala Asp Tyr Leu Glu
Arg Arg Glu Arg Glu Ala 980 985
990 Glu His Gly Tyr Ala Ser Met Leu Pro 995
1000 1811099PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 181Met Tyr Pro Tyr Asp Val Pro Asp
Tyr Ala Ser Pro Lys Lys Lys Arg 1 5 10
15 Lys Val Glu Ala Ser Val Asp Leu Arg Thr Leu Gly Tyr
Ser Gln Gln 20 25 30
Gln Gln Glu Lys Ile Lys Pro Lys Val Arg Ser Thr Val Ala Gln His
35 40 45 His Glu Ala Leu
Val Gly His Gly Phe Thr His Ala His Ile Val Ala 50
55 60 Leu Ser Gln His Pro Ala Ala Leu
Gly Thr Val Ala Val Lys Tyr Gln 65 70
75 80 Asp Met Ile Ala Ala Leu Pro Glu Ala Thr His Glu
Ala Ile Val Gly 85 90
95 Val Gly Lys Gln Trp Ser Gly Ala Arg Ala Leu Glu Ala Leu Leu Thr
100 105 110 Val Ala Gly
Glu Leu Arg Gly Pro Pro Leu Gln Leu Asp Thr Gly Gln 115
120 125 Leu Leu Lys Ile Ala Lys Arg Gly
Gly Val Thr Ala Val Glu Ala Val 130 135
140 His Ala Trp Arg Asn Ala Leu Thr Gly Ala Pro Leu Asn
Leu Thr Pro 145 150 155
160 Glu Gln Val Val Ala Ile Ala Ser Asn Asn Gly Gly Lys Gln Ala Leu
165 170 175 Glu Thr Val Gln
Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly Leu 180
185 190 Thr Pro Glu Gln Val Val Ala Ile Ala
Ser His Asp Gly Gly Lys Gln 195 200
205 Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln
Ala His 210 215 220
Gly Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser His Asp Gly Gly 225
230 235 240 Lys Gln Ala Leu Glu
Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln 245
250 255 Ala His Gly Leu Thr Pro Glu Gln Val Val
Ala Ile Ala Ser Asn Gly 260 265
270 Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val
Leu 275 280 285 Cys
Gln Ala His Gly Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser 290
295 300 Asn Asn Gly Gly Lys Gln
Ala Leu Glu Thr Val Gln Arg Leu Leu Pro 305 310
315 320 Val Leu Cys Gln Ala His Gly Leu Thr Pro Glu
Gln Val Val Ala Ile 325 330
335 Ala Ser His Asp Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Arg Leu
340 345 350 Leu Pro
Val Leu Cys Gln Ala His Gly Leu Thr Pro Glu Gln Val Val 355
360 365 Ala Ile Ala Ser His Asp Gly
Gly Lys Gln Ala Leu Glu Thr Val Gln 370 375
380 Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly Leu
Thr Pro Glu Gln 385 390 395
400 Val Val Ala Ile Ala Ser His Asp Gly Gly Lys Gln Ala Leu Glu Thr
405 410 415 Val Gln Arg
Leu Leu Pro Val Leu Cys Gln Ala His Gly Leu Thr Pro 420
425 430 Glu Gln Val Val Ala Ile Ala Ser
Asn Gly Gly Gly Lys Gln Ala Leu 435 440
445 Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln Ala
His Gly Leu 450 455 460
Thr Pro Glu Gln Val Val Ala Ile Ala Ser His Asp Gly Gly Lys Gln 465
470 475 480 Ala Leu Glu Thr
Val Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His 485
490 495 Gly Leu Thr Pro Glu Gln Val Val Ala
Ile Ala Ser His Asp Gly Gly 500 505
510 Lys Gln Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu
Cys Gln 515 520 525
Ala His Gly Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser Asn Ile 530
535 540 Gly Gly Lys Gln Ala
Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu 545 550
555 560 Cys Gln Ala His Gly Leu Thr Pro Glu Gln
Val Val Ala Ile Ala Ser 565 570
575 Asn Asn Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Arg Leu Leu
Pro 580 585 590 Val
Leu Cys Gln Ala His Gly Leu Thr Pro Glu Gln Val Val Ala Ile 595
600 605 Ala Ser Asn Asn Gly Gly
Lys Gln Ala Leu Glu Thr Val Gln Arg Leu 610 615
620 Leu Pro Val Leu Cys Gln Ala His Gly Leu Thr
Pro Glu Gln Val Val 625 630 635
640 Ala Ile Ala Ser His Asp Gly Gly Lys Gln Ala Leu Glu Thr Val Gln
645 650 655 Arg Leu
Leu Pro Val Leu Cys Gln Ala His Gly Leu Thr Pro Glu Gln 660
665 670 Val Val Ala Ile Ala Ser Asn
Gly Gly Gly Lys Gln Ala Leu Glu Thr 675 680
685 Val Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His
Gly Leu Thr Pro 690 695 700
Glu Gln Val Val Ala Ile Ala Ser His Asp Gly Gly Lys Gln Ala Leu 705
710 715 720 Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly Leu 725
730 735 Thr Pro Glu Gln Val Val Ala Ile
Ala Ser His Asp Gly Gly Lys Gln 740 745
750 Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys
Gln Ala His 755 760 765
Gly Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser His Asp Gly Gly 770
775 780 Arg Pro Ala Leu
Glu Ser Ile Val Ala Gln Leu Ser Arg Pro Asp Pro 785 790
795 800 Ala Leu Ala Ala Leu Thr Asn Asp His
Leu Val Ala Leu Ala Cys Leu 805 810
815 Gly Gly Arg Pro Ala Leu Asp Ala Val Lys Lys Gly Leu Pro
His Ala 820 825 830
Pro Ala Leu Ile Lys Arg Thr Asn Arg Arg Ile Pro Glu Arg Thr Ser
835 840 845 His Arg Val Ala
Asp His Ala Gln Val Val Arg Val Leu Gly Phe Phe 850
855 860 Gln Cys His Ser His Pro Ala Gln
Ala Phe Asp Asp Ala Met Thr Gln 865 870
875 880 Phe Gly Met Ser Arg His Gly Leu Leu Gln Leu Phe
Arg Arg Val Gly 885 890
895 Val Thr Glu Leu Glu Ala Arg Ser Gly Thr Leu Pro Pro Ala Ser Gln
900 905 910 Arg Trp Asp
Arg Ile Leu Gln Ala Ser Gly Met Lys Arg Ala Lys Pro 915
920 925 Ser Pro Thr Ser Thr Gln Thr Pro
Asp Gln Ala Ser Leu His Ala Phe 930 935
940 Ala Asp Ser Leu Glu Arg Asp Leu Asp Ala Pro Ser Pro
Met His Glu 945 950 955
960 Gly Asp Gln Thr Arg Ala Ser Ala Ser Gly Ser Gly Met Asn Ile Gln
965 970 975 Met Leu Leu Glu
Ala Ala Asp Tyr Leu Glu Arg Arg Glu Arg Glu Ala 980
985 990 Glu His Gly Tyr Ala Ser Met Leu
Pro Gly Ser Gly Met Asn Ile Gln 995 1000
1005 Met Leu Leu Glu Ala Ala Asp Tyr Leu Glu Arg
Arg Glu Arg Glu 1010 1015 1020
Ala Glu His Gly Tyr Ala Ser Met Leu Pro Gly Ser Gly Met Asn
1025 1030 1035 Ile Gln Met
Leu Leu Glu Ala Ala Asp Tyr Leu Glu Arg Arg Glu 1040
1045 1050 Arg Glu Ala Glu His Gly Tyr Ala
Ser Met Leu Pro Gly Ser Gly 1055 1060
1065 Met Asn Ile Gln Met Leu Leu Glu Ala Ala Asp Tyr Leu
Glu Arg 1070 1075 1080
Arg Glu Arg Glu Ala Glu His Gly Tyr Ala Ser Met Leu Pro Ser 1085
1090 1095 Arg
182141DNAArtificial SequenceDescription of Artificial Sequence Synthetic
polynucleotide 182cctgcaggca gctgcgcgct cgctcgctca ctgaggccgc
ccgggcaaag cccgggcgtc 60gggcgacctt tggtcgcccg gcctcagtga gcgagcgagc
gcgcagagag ggagtggcca 120actccatcac taggggttcc t
141183141DNAArtificial SequenceDescription of
Artificial Sequence Synthetic polynucleotide 183aggaacccct
agtgatggag ttggccactc cctctctgcg cgctcgctcg ctcactgagg 60ccgggcgacc
aaaggtcgcc cgacgcccgg gctttgcccg ggcggcctca gtgagcgagc 120gagcgcgcag
ctgcctgcag g
141184485DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 184gtgtctagac tgcagagggc cctgcgtatg
agtgcaagtg ggttttagga ccaggatgag 60gcggggtggg ggtgcctacc tgacgaccga
ccccgaccca ctggacaagc acccaacccc 120cattccccaa attgcgcatc ccctatcaga
gagggggagg ggaaacagga tgcggcgagg 180cgcgtgcgca ctgccagctt cagcaccgcg
gacagtgcct tcgcccccgc ctggcggcgc 240gcgccaccgc cgcctcagca ctgaaggcgc
gctgacgtca ctcgccggtc ccccgcaaac 300tccccttccc ggccaccttg gtcgcgtccg
cgccgccgcc ggcccagccg gaccgcacca 360cgcgaggcgc gagatagggg ggcacgggcg
cgaccatctg cgctgcggcg ccggcgactc 420agcgctgcct cagtctgcgg tgggcagcgg
aggagtcgtg tcgtgcctga gagcgcagtc 480gagaa
485185408DNAArtificial
SequenceDescription of Artificial Sequence Synthetic polynucleotide
185gtagatttga gaactttggg atattcacag cagcagcagg aaaagatcaa gcccaaagtg
60aggtcgacag tcgcgcagca tcacgaagcg ctggtgggtc atgggtttac acatgcccac
120atcgtagcct tgtcgcagca ccctgcagcc cttggcacgg tcgccgtcaa gtaccaggac
180atgattgcgg cgttgccgga agccacacat gaggcgatcg tcggtgtggg gaaacagtgg
240agcggagccc gagcgcttga ggccctgttg acggtcgcgg gagagctgag agggcctccc
300cttcagctgg acacgggcca gttgctgaag atcgcgaagc ggggaggagt cacggcggtc
360gaggcggtgc acgcgtggcg caatgcgctc acgggagcac ccctcaac
408186164DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 186cggaccccgc gctggccgca ctcactaatg
atcatcttgt agcgctggcc tgcctcggcg 60gacgacccgc cttggatgcg gtgaagaagg
ggctcccgca cgcgcctgca ttgattaagc 120ggaccaacag aaggattccc gagaggacat
cacatcgagt ggca 164187858DNAArtificial
SequenceDescription of Artificial Sequence Synthetic polynucleotide
187atgagtattc aacatttccg tgtcgccctt attccctttt ttgcggcatt ttgccttcct
60gtttttgctc acccagaaac gctggtgaaa gtaaaagatg ctgaagatca gttgggtgca
120cgagtgggtt acatcgaact ggatctcaac agcggtaaga tccttgagag ttttcgcccc
180gaagaacgtt ttccaatgat gagcactttt aaagttctgc tatgtggcgc ggtattatcc
240cgtattgacg ccgggcaaga gcaactcggt cgccgcatac actattctca gaatgacttg
300gttgagtact caccagtcac agaaaagcat cttacggatg gcatgacagt aagagaatta
360tgcagtgctg ccataaccat gagtgataac actgcggcca acttacttct gacaacgatc
420ggaggaccga aggagctaac cgcttttttg cacaacatgg gggatcatgt aactcgcctt
480gatcgttggg aaccggagct gaatgaagcc ataccaaacg acgagcgtga caccacgatg
540cctgtagcaa tggcaacaac gttgcgcaaa ctattaactg gcgaactact tactctagct
600tcccggcaac aattaataga ctggatggag gcggataaag ttgcaggacc acttctgcgc
660tcggcccttc cggctggctg gtttattgct gataaatctg gagccggtga gcgtgggtct
720cgcggtatca ttgcagcact ggggccagat ggtaagccct cccgtatcgt agttatctac
780acgacgggga gtcaggcaac tatggatgaa cgaaatagac agatcgctga gataggtgcc
840tcactgatta agcattgg
8581888PRTArtificial SequenceDescription of Artificial Sequence Synthetic
peptide 188Leu Asp Leu Ala Ser Leu Ile Leu 1 5
18932PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 189Leu Thr Pro Ala Gln Val Val Ala Ile Ala Ser
Gly Gly Lys Gln Ala 1 5 10
15 Leu Glu Thr Val Gln Gln Leu Leu Pro Val Leu Cys Gln Ala His Gly
20 25 30
19032PRTArtificial SequenceDescription of Artificial Sequence Synthetic
polypeptide 190Leu Thr Pro Ala Gln Val Val Ala Leu Ala Ser Gly Gly Lys
Gln Ala 1 5 10 15
Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly
20 25 30 19132PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
191Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Arg Pro Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Glu Gln His Gly 20
25 30 19232PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
192Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Ala Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 19332PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
193Leu Thr Gln Val Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 19432PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
194Leu Thr Pro Asp Gln Val Val Ala Ile Ala Arg Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 19532PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
195Leu Pro Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 19632PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
196Leu Thr Leu Asp Gln Val Val Ala Ile Ala Ser Gly Ser Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 19732PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
197Leu Ser Pro Asp Gln Val Val Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Leu
Gln Arg Leu Leu Pro Val Leu Cys Gln Thr His Ala 20
25 30 19832PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
198Leu Asn Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 19932PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
199Leu Thr Pro Asp Gln Val Met Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 20032PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
200Leu Thr Pro Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Arg Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 20132PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
201Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Thr 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 20232PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
202Leu Thr Pro Asp Gln Val Met Thr Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 20332PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
203Leu Thr Pro Ala Gln Val Val Thr Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 20432PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
204Leu Thr Pro Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Arg Ala His Gly 20
25 30 20532PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
205Leu Ser Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 20632PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
206Leu Thr Pro Asp Gln Val Val Gly Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 20732PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
207Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala Asn Gly 20
25 30 20832PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
208Leu Thr Pro Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Thr His Gly 20
25 30 20932PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
209Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Met Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 21032PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
210Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Met
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 21132PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
211Leu Thr Pro Asp Gln Val Val Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Ala Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 21232PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
212Leu Thr Pro Asp Gln Val Val Thr Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 21332PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
213Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Thr Val Leu Cys Gln Asp His Gly 20
25 30 21432PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
214Met Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 21532PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
215Leu Ala Pro Asp Gln Val Val Ala Val Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 21632PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
216Leu Thr Pro Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Lys Thr Val
Gln Gln Leu Leu Pro Val Leu Cys Glu Gln His Gly 20
25 30 21732PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
217Leu Thr Pro Asp Gln Val Val Ala Ile Ala Arg Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 21832PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
218Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Gln Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 21932PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
219Leu Thr Pro Asp Gln Val Leu Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Leu
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 22032PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
220Leu Thr Pro Glu Gln Val Val Ala Ile Ala Arg Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 22132PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
221Leu Thr Pro Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Met
Gln Arg Leu Leu Pro Val Leu Cys Arg Ala His Gly 20
25 30 22232PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
222Leu Thr Pro Asp Gln Val Val Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Met Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 22332PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
223Leu Thr Thr Asp Gln Val Val Thr Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 22432PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
224Leu Thr Pro Thr Gln Val Met Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 22532PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
225Leu Thr Pro Gln Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Ala Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 22632PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
226Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Met Leu Cys Gln Asp His Gly 20
25 30 22732PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
227Leu Thr Ser Ala Gln Val Val Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 22832PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
228Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Gln Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 22932PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
229Leu Thr Pro Asp Gln Val Val Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Ala Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 23032PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
230Leu Thr Pro Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Met Leu Cys Gln Ala His Gly 20
25 30 23132PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
231Leu Thr Leu Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala Arg Gly 20
25 30 23232PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
232Leu Thr Pro Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Leu
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 23332PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
233Leu Thr Pro Asp Gln Val Val Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asn His Gly 20
25 30 23432PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
234Leu Thr Pro Asp Gln Val Val Thr Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Met Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 23532PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
235Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Arg Val
Gln Arg Leu Leu Pro Val Leu Cys Glu Gln His Gly 20
25 30 23632PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
236Leu Thr Pro Glu Gln Val Val Ala Ile Ala Cys Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Ala Leu Leu Pro Val Leu Arg Gln Ala His Gly 20
25 30 23732PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
237Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Arg Asp His Gly 20
25 30 23832PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
238Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Met Leu Cys Gln Ala His Gly 20
25 30 23932PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
239Leu Thr Pro Glu Gln Val Val Ala Ile Ala Cys Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Arg His Ala His Gly 20
25 30 24032PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
240Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln His His Gly 20
25 30 24132PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
241Leu Ile Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln His His Gly 20
25 30 24232PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
242Leu Thr Arg Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Glu Gln His Gly 20
25 30 24332PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
243Leu Thr Pro Asp Gln Val Val Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Val Gly Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 24432PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
244Leu Thr Leu Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Glu Gln His Gly 20
25 30 24532PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
245Leu Thr Pro Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Met Leu Cys Gln Asp His Gly 20
25 30 24632PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
246Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Ser Lys Gln Ala 1
5 10 15 Leu Glu Thr Met
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 24732PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
247Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Lys Gln His Gly 20
25 30 24832PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
248Leu Thr Leu Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Thr His Gly 20
25 30 24932PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
249Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Ala Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 25032PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
250Leu Thr Pro Ala Gln Val Val Thr Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Glu Gln His Gly 20
25 30 25132PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
251Leu Thr Pro Ala Gln Val Met Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 25232PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
252Leu Thr Arg Glu Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Arg Gln Ala His Gly 20
25 30 25332PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
253Leu Thr Leu Ala Gln Val Val Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 25432PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
254Leu Thr Leu Glu Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 25532PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
255Leu Thr Pro Gln Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Glu Gln His Gly 20
25 30 25632PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
256Leu Ser Pro Asp Gln Val Val Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 25732PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
257Leu Thr Pro Asp Gln Val Val Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln His His Gly 20
25 30 25832PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
258Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Ala Leu Leu Pro Val Leu Arg Gln Ala His Gly 20
25 30 25932PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
259Leu Ser Gln Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 26032PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
260Leu Pro Pro Glu Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 26132PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
261Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Ala Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 26232PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
262Leu Thr Pro Asp Gln Val Val Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Glu His Gly 20
25 30 26332PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
263Leu Thr Leu Asp Gln Val Ala Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 26432PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
264Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Val Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 26532PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
265Leu Ile Pro Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 26632PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
266Leu Thr Pro Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Arg Gln Ala His Gly 20
25 30 26732PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
267Leu Thr Pro Ala Gln Val Val Ala Ile Ala Ser Gly Ser Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Thr His Gly 20
25 30 26832PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
268Leu Thr Pro Gln Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 26932PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
269Leu Thr Pro Asp Gln Val Val Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Val Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 27032PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
270Leu Ser Pro Asp Gln Val Val Thr Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Leu
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 27132PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
271Leu Thr Pro Val Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 27232PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
272Leu Thr Leu Asp Gln Val Val Ala Ile Ala Ser Gly Ser Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Thr His Gly 20
25 30 27332PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
273Leu Thr Pro Ala Gln Val Val Ala Ile Ala Cys Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Arg Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 27432PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
274Leu Thr Pro Ala Gln Val Val Ala Ile Ala Ser Gly Ser Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Phe Pro Val Leu Cys Gln Ala His Gly 20
25 30 27532PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
275Leu Pro Pro Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 27632PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
276Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Phe Gln Glu His Gly 20
25 30 27732PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
277Leu Thr Pro Ala Lys Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 27832PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
278Leu Thr Pro Val Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Ala Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 27932PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
279Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Gly Leu Cys Gln Asp His Gly 20
25 30 28032PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
280Leu Thr Leu Ala Gln Val Val Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 28132PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
281Leu Thr Pro Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Thr Val Leu Cys Gln Asp His Gly 20
25 30 28232PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
282Leu Pro Pro Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 28332PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
283Leu Thr Pro Ala Gln Ala Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 28432PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
284Leu Thr Pro Ala Gln Val Val Ala Ile Val Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Thr His Gly 20
25 30 28532PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
285Leu Thr Pro Asp Gln Val Val Ala Val Ala Gly Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 28632PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
286Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Gly Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 28732PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
287Leu Pro Pro Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Glu Ala His Gly 20
25 30 28832PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
288Leu Thr Thr Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 28932PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
289Leu Thr Pro Asp Gln Val Val Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Val Pro Val Leu Cys Gln Asp His Gly 20
25 30 29032PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
290Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Thr His Ala 20
25 30 29132PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
291Leu Thr Leu Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Thr His Gly 20
25 30 29232PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
292Leu Thr Pro Asn Gln Leu Val Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 29332PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
293Leu Ser Pro Ala Gln Val Val Ala Ile Ala Ser Gly Ser Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 29432PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
294Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Val Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 29532PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
295Leu Thr Pro Asp Gln Val Met Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 29632PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
296Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser Gly Gly Arg Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 29732PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
297Leu Thr Pro Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Trp Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 29832PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
298Leu Thr Pro Asp Lys Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 29932PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
299Leu Thr Pro Ala Gln Val Met Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 30032PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
300Leu Thr Gln Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala Asn Gly 20
25 30 30132PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
301Leu Thr Pro Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Pro Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Glu Gln His Gly 20
25 30 30232PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
302Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Ser Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Met
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 30332PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
303Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Ser Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Arg Gln Asp His Gly 20
25 30 30432PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
304Leu Thr Pro Tyr Gln Val Val Ala Ile Ala Ser Gly Ser Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 30532PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
305Leu Thr Pro Tyr Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 30632PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
306Leu Thr Leu Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Glu His Gly 20
25 30 30732PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
307Leu Thr Leu Glu Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Leu Val Leu Cys Gln Ala His Gly 20
25 30 30832PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
308Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Arg Arg Leu Leu Gln Val Leu Cys Gln Asp His Gly 20
25 30 30932PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
309Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Arg Gln Asp His Gly 20
25 30 31032PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
310Leu Thr Pro Asp Gln Val Val Ser Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 31132PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
311Leu Thr Pro Asp Gln Val Val Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Thr His Gly 20
25 30 31232PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
312Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Lys Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 31332PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
313Leu Thr Thr Asp Gln Val Val Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 31432PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
314Leu Ile Pro Gln Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 31532PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
315Leu Thr Leu Thr Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 31632PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
316Leu Thr Pro Thr Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 31732PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
317Leu Thr Pro Thr Gln Val Met Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 31832PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
318Leu Thr Pro Asp Gln Val Val Ala Val Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 31932PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
319Leu Thr Pro Ala Gln Val Val Ala Ile Ala Ser Gly Ser Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 32032PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
320Leu Thr Pro Gly Gln Val Val Ala Ile Ala Ser Gly Gly Lys Arg Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 32132PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
321Leu Thr Pro Asp Gln Val Val Val Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 32232PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
322Leu Pro Pro Asp Gln Val Val Ala Ile Ala Ser Gly Ser Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 32332PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
323Leu Thr Pro Asp Gln Val Val Thr Ile Ala Asn Gly Ser Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 32432PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
324Leu Thr Pro Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Gln Val Leu Cys Gln Asp His Gly 20
25 30 32532PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
325Leu Thr Pro Asp His Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 32632PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
326Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Gln Val Leu Cys Gln Asp His Gly 20
25 30 32732PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
327Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Arg Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Glu Gln His Gly 20
25 30 32832PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
328Leu His Pro Gly Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 32932PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
329Leu Thr Leu Asp Gln Val Val Ser Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 33032PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
330Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Ala Leu Cys Gln Asp His Gly 20
25 30 33132PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
331Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Pro Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Glu Gln His Gly 20
25 30 33232PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
332Leu Thr Pro Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Lys Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 33332PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
333Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Arg Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 33432PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
334Leu Asn Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 33532PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
335Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Lys Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 33632PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
336Leu Thr Leu Asp Gln Val Val Ala Ile Ala Asn Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 33732PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
337Leu Thr Pro Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Arg Asp His Gly 20
25 30 33832PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
338Leu Thr Pro Ala Gln Val Leu Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Thr Val Leu Cys Gln Asp His Gly 20
25 30 33932PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
339Leu Thr Pro Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Met
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 34032PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
340Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Gly Leu Cys Gln Ala His Gly 20
25 30 34132PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
341Leu Thr Arg Glu Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Ala Leu Leu Pro Val Leu Arg Gln Ala His Gly 20
25 30 34232PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
342Leu Thr Pro Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Val His Gly 20
25 30 34332PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
343Leu Thr Pro Asn Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Leu Val Leu Cys Gln Asp His Gly 20
25 30 34432PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
344Leu Thr Pro Asp Gln Val Met Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 20
25 30 34532PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
345Leu Thr Arg Glu Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 34633PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
346Leu Ser Thr Ala Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Gly Ile
Gly Glu Gln Leu Leu Lys Leu Arg Thr Ala Pro Tyr 20
25 30 Gly 34733PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
347Leu Ser Thr Ala Gln Val Val Ala Val Ala Ser Gly Gly Lys Pro Ala 1
5 10 15 Leu Glu Ala Val
Arg Ala Gln Leu Leu Ala Leu Arg Ala Ala Pro Tyr 20
25 30 Gly 34832PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
348Leu Thr Gln Val Gln Val Val Ala Ile Ala Ser Gly Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 34932PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
349Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Asn Gly Lys Gln Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30 35032PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
350Leu Thr Pro Asp Gln Val Val Ala Ile Ala Ser Gly Gly Lys Arg Ala 1
5 10 15 Leu Glu Thr Val
Gln Arg Leu Leu Pro Val Leu Cys Gln Asp His Gly 20
25 30
User Contributions:
Comment about this patent or add new information about this topic:
People who visited this patent also read: | |
Patent application number | Title |
---|---|
20160342962 | SYSTEMS AND METHODS FOR MANAGING FINANCIAL PAYMENTS BETWEEN PARTIES |
20160342961 | Cash-to-electronic deposit gateway |
20160342960 | USB AUTORUN DEVICE |
20160342959 | TRANSFER COSTS AND LOCK TIMEOUTS IN A RESOURCE TRANSFER SYSTEM |
20160342958 | PARALLEL PATHS IN A RESOURCE TRANSFER SYSTEM |