Patents - stay tuned to the technology

Inventors list

Assignees list

Classification tree browser

Top 100 Inventors

Top 100 Assignees

Patent application title: DOSING REGIMEN OF AVELUMAB FOR THE TREATMENT OF CANCER

Inventors:  Glen Ian Andrews (San Diego, CA, US)  Carlo Leonel Bello (San Francisco, CA, US)  Satjit Singh Brar (San Diego, CA, US)  Shaonan Wang (Muehltal Traisa, DE)  Pascal Girard (Renens, CH)
IPC8 Class: AC07K1628FI
USPC Class:
Class name:
Publication date: 2022-07-14
Patent application number: 20220220205



Abstract:

The present invention relates to dosing regimen of avelumab for the treatment of cancer. In particular, the invention relates to improved dosing regimen of avelumab for the treatment of cancer.

Claims:

1-45. (canceled)

46. A method of treating a cancer in a patient, comprising administering avelumab to the patient according to a dosing regimen of 1200-2400 mg flat dose Q3W.

47. The method of claim 46, wherein the dosing regimen is 1200 mg flat dose Q3W.

48. The method of claim 46, wherein the cancer is selected from the group consisting of MCC, NSCLC, RCC, bladder cancer, ovarian cancer, head and neck cancer and gastric cancer.

49. The method of claim 48, wherein the cancer is NSCLC.

50. The method of claim 48, wherein the cancer is MCC.

51-69. (canceled)

70. The method of claim 47, wherein the cancer is selected from the group consisting of MCC, NSCLC, RCC, bladder cancer, ovarian cancer, head and neck cancer and gastric cancer.

71. The method of claim 70, wherein the cancer is NSCLC.

72. The method of claim 70, wherein the cancer is MCC.

Description:

FIELD

[0001] The present invention relates to dosing regimens of avelumab for the treatment of cancer. In particular, the invention relates to improved dosing regimens of avelumab for the treatment of cancer.

BACKGROUND

[0002] The programmed death 1 (PD-1) receptor and PD-1 ligands 1 and 2 (PD-L1 and PD-L2, respectively) play integral roles in immune regulation. Expressed on activated T25 cells, PD-1 is activated by PD-L1 (also known as B7-H1) and PD-L2 expressed by stromal cells, tumor cells, or both, initiating T-cell death and localized immune suppression (Dong et al., Nat Med 1999; 5:1365-69; Freeman et al. J Exp Med 2000; 192:1027-34), potentially providing an immune-tolerant environment for tumor development and growth. Conversely, inhibition of this interaction can enhance local T30 cell responses and mediate antitumor activity in nonclinical animal models (Iwai Y, et al. Proc Natl Acad Sci USA 2002; 99:12293-97).

[0003] Avelumab is a fully human mAb of the IgG1 isotype that specifically targets and blocks PD-L1. Avelumab is the International Nonproprietary Name (INN) for the anti-PD-L1 monoclonal antibody MSB0010718C and has been described by its full length heavy and light chain sequences in WO2013079174, where it is referred to as A09-246-2. The glycosylation and truncation of the C-terminal Lysine in its heavy chain is described in WO2017097407. Avelumab has been in clinical development for the treatment of Merkel Cell Carcinoma (MCC), non-small cell lung cancer (NSCLC), urothelial carcinoma (UC), renal cell carcinoma (RCC) and a number of other cancer conditions of a dosing regimen of 10 mg/kg Q2W.

SUMMARY OF THE INVENTION

[0004] This invention relates to dosing regimens of avelumab for the treatment of cancer. More specifically, the invention relates method of treating cancer in a patient, comprising administering to the patient a dosing regimen that provides a higher mean exposure, as measured by C.sub.trough or other suitable PK parameters, of avelumab in the patient, than the current dosing regimen of 10 mg/kg Q2W that are used in the clinical trials.

[0005] In one embodiment, the invention relates to a method of treating a cancer in a patient, comprising administering avelumab to the patient in a dosing regimen of 5-10 mg/Kg Q1W. In one aspect of this embodiment, the dosing regimen is 5 mg/kg Q1W, 6 mg/kg Q1W, 7 mg/kg Q1W, 8 mg/kg Q1W, 9 mg/kg Q1W or 10 mg/kg Q1W. More preferably, the dosing regimen is 5 mg/kg Q1W, 8 mg/kg Q1W or 10 mg/kg Q1W. Even more preferably, the dosing regimen is 10 mg/kg Q1W. In another aspect of this embodiment, and in combination with any other aspects of this embodiment, the cancer is selected from the group consisting of MCC, NSCLC, RCC, bladder cancer, ovarian cancer, head and neck cancer, gastric cancer, mesothelioma, urothelial carcinoma, breast cancer, adenocarcinoma of the stomach and thymoma. Preferably, the cancer is MCC, NSCLC, RCC, bladder cancer, ovarian cancer, head and neck cancer and gastric cancer. More preferably, the cancer is MSCLC or MCC. In another embodiment, the invention relates to a method of treating a cancer in a patient, comprising administering avelumab to the patient in a dosing regimen of 11-20 mg/kg Q2W. In one aspect of this embodiment, the dosing regimen is 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 mg/kg Q2W. Preferably, the dosing regimen is 13, 15, 17 or 20 mg/kg Q2W. More preferably, the dosing regimen is 15 or 20 mg/kg Q2W. Even more preferably, the dosing regimen is 20 mg/kg Q2W. In another aspect of this embodiment, and in combination with any other aspects of this embodiment, the cancer is selected from the group consisting of MCC, NSCLC, RCC, bladder cancer, ovarian cancer, head and neck cancer gastric cancer, mesothelioma, urothelial carcinoma, breast cancer, adenocarcinoma of the stomach and thymoma. Preferably, the cancer is MCC, NSCLC, RCC, bladder cancer, ovarian cancer, head and neck cancer gastric cancer. More preferably, the cancer is MSCLC or MCC.

[0006] In another embodiment, the invention relates to a method of treating a cancer in a patient, comprising administering avelumab to the patient in a dosing regimen of 15-30 mg/kg Q3W. In one aspect of this embodiment, the dosing regimen is, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28 29 or 30 mg/kg Q3W. Preferably, the dosing regimen is 15, 20, 25 or 30 mg/kg Q3W. More preferably, the dosing regimen is 15, 20 or 25 mg/kg Q3W. Even more preferably, the dosing regimen is 20 mg/kg Q3W. In another aspect of this embodiment, and in combination with any other aspects of this embodiment, the cancer is selected from the group consisting of MCC, NSCLC, RCC, bladder cancer, ovarian cancer, head and neck cancer gastric cancer, mesothelioma, urothelial carcinoma, breast cancer, adenocarcinoma of the stomach and thymoma. Preferably, the cancer is MCC, NSCLC, RCC, bladder cancer, ovarian cancer, head and neck cancer gastric cancer. More preferably, the cancer is MSCLC or MCC.

[0007] In another embodiment, the invention relates to a method of treating a cancer in a patient, comprising administering avelumab to the patient in a dosing regimen of X mg/kg Q1W for n weeks followed by Y mg/kg Q2W, wherein X is 5-20, Y is 10-20, n is 6, 12 or 18. In one aspect of this embodiment, n is 12. In another aspect of the embodiment, n is 6. In another aspect of the embodiment, and in combination with any other aspect of this embodiment, X is 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 19, 18, 19 or 20. Preferably, X is 5, 10, 15 or 20. More preferably, X is 5, 10, or 15. Even more preferably, X is 10. In another aspect of the embodiment, and in combination with any other aspect of this embodiment, Y is 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20. Preferably, Y is 10, 15 or 20. More preferably, Y is 10. In another aspect of this embodiment, and in combination with any other aspects of this embodiment, the cancer is selected from the group consisting of MCC, NSCLC, RCC, bladder cancer, ovarian cancer, head and neck cancer gastric cancer, mesothelioma, urothelial carcinoma, breast cancer, adenocarcinoma of the stomach and thymoma. Preferably, the cancer is MCC, NSCLC, RCC, bladder cancer, ovarian cancer, head and neck cancer gastric cancer. More preferably, the cancer is MSCLC or MCC.

[0008] In some embodiments, a flat dose can be used in place of the mg/kg dose mentioned above. Correlation between mg/kg dose and the flat dose can be made, e.g., as follows: 5 mg/kg is about 500 mg flat dose; 10 mg/kg is about 800 mg; 11mg/mg is about 900 mg; 15 mg/kg is about 1240 mg flat dose; 20 mg is about 1600 mg flat dose and 30 mg/kg is about 2400 mg flat dose. Therefore, in another embodiment of the invention, the aforementioned embodiments based on a mg/kg dosing regimen of avelumab can be replaced with the corresponding flat dosing regimen as described herein.

[0009] In other embodiments, the invention relates to a method of treating a cancer in a patient, comprising administering avelumab to the patient a flat dosing regimen of avelumab. In one aspect of the embodiment, the flat dosing regimen is 400-800 mg flat dose Q1W. Preferably, the flat dosing regimen is 400 mg, 450 mg, 500 mg, 550 mg, 600 mg, 650 mg, 700 mg, 750 mg or 800 mg flat dose Q1W. Preferably, the flat dosing regimen is 800 mg flat dose Q1W. In another aspect of this embodiment, the flat dosing regimen is 880-1600 mg flat dose Q2W. Preferably the flat dosing regimen is 880 mg, 900 mg, 950 mg, 1000 mg, 1050 mg, 1100 mg, 1150 mg, 1200 mg, 1250 mg, 1300 mg, 1350 mg, 1400 mg, 1450 mg, 1500 mg, 1550 mg or 1600 mg flat dose Q2W. More preferably, the flat dosing regimen is 1200 mg or 1600 mg flat dose Q2W. In another aspect of this embodiment, the flat dosing regimen is 1200-2400 mg flat dose Q3W, preferably 1200 mg Q3W. Preferably, the flat dosing regimen is 1200 mg, 1250 mg, 1300 mg, 1350 mg, 1400 mg, 1450 mg 1500 mg, 1550 mg, 1600 mg, 1650 mg, 1700 mg, 1750 mg, 1800 mg, 1850 mg, 1900 mg, 1950 mg, 2000 mg, 2050 mg, 2100 mg, 2150 mg, 2200 mg, 2250 mg, 2300 mg, 2350 mg or 2400 mg flat dose Q3W. More preferably, the dosing regimen is 1200 mg flat dose Q3W. In another aspect of the embodiment, the flat dosing regimen is 400-1600 mg Q1W for n weeks followed by 800-1600 mg Q2W, wherein n is 6, 12 or 18. Preferably, the flat dosing regimen is 400 mg, 450 mg, 500 mg, 550 mg, 600 mg, 650 mg, 700 mg, 725 mg, 750 mg, 775 mg, 800 mg, 825 mg, 850 mg, 875 mg, 900 mg, 925 mg, 950 mg, 975 mg, 1000 mg, 1050 mg, 1100 mg, 1150 mg, 1200 mg, 1250 mg, 1300 mg, 1350 mg, 1400 mg, 1450 mg, 1500 mg, 1550 mg or 1600 mg Q1W for n weeks followed by 800 mg, 850 mg, 900 mg, 950 mg, 1000 mg, 1050 mg, 1100 mg, 1150 mg, 1200 mg, 1250 mg, 1300 mg, 1350 mg, 1400 mg, 1450 mg, 1500 mg, 1550 mg or 1600 mg Q2W. More preferably, the dosing regimen is 800 mg flat dose Q1W for n weeks followed by 800 mg flat dose Q2W. Even more preferably, n is 12. In another aspect of this embodiment, the flat dosing regimen is 400-800 mg flat dose Q2W. Preferably, the flat dosing regimen is 400 mg, 450 mg, 500 mg, 550 mg, 600 mg, 650 mg, 700 mg 750 mg or 800 mg flat dose Q2W. More preferably, the flat dosing regimen is 800 mg flat dose Q2W. In another aspect of this embodiment, and in combination with any other aspects of this embodiment not inconsistent, the cancer is selected from the group consisting of MCC, NSCLC, RCC, bladder cancer, ovarian cancer, head and neck cancer, gastric cancer, mesothelioma, urothelial carcinoma, breast cancer, adenocarcinoma of the stomach and thymoma. Preferably, the cancer is MCC, NSCLC, RCC, bladder cancer, ovarian cancer, head and neck cancer gastric cancer. More preferably, the cancer is NSCLC or MCC.

[0010] In another embodiment, the invention is directed to a method of treating a cancer comprising administering to the patient avelumab in a dosing regimen as described in any of the proceeding embodiments, wherein the patient has a TPS of PD-L1 expression of 1% and above, 5% and above, 10% and above, 20% and above, 30% and above, 40% and above, 50% and above, 60% and above, 70% and above, 80% and above 95% and above, or 95% and above. Preferably, the TPS of PD-L1 expression is 20% and above. More preferably, the TPS of PD-L1 expression is 50% and above.

[0011] In another embodiment, the invention is directed to a method of treating a cancer in a patient, comprising administering avelumab to the patient in a dosing regimen selected from the group consisting of 800 mg Q1W for 12 weeks followed by 800 mg Q2W, 10 mg/kg Q1W for 12 weeks followed by 10 mg/kg Q2W and 1200 mg Q3W, and wherein the tumor proportion score of PD-L1 expression is 5% and above, 20% and above, 50% and above or 80% and above. Preferably, tumor proportion score of PD-L1 expression is 20% and above. More preferably, the TPS of PD-L1 expression is 50% and above. In one aspect of this embodiment and the cancer is selected from NSCLC, urothelial cancer, RCC, ovarian cancer, head and neck cancer gastric cancer. More preferably, the cancer is NSCLC.

[0012] In another embodiment, the invention is directed to a method of treating a cancer comprising administering to the patient avelumab in a dosing regimen as described in any of the proceeding embodiments, further comprising administering to the patient at least one of a second anti-cancer treatment. In an aspect of this embodiment, the method further comprising administering one or two of a second anti-cancer treatment. Preferably, the second anti-cancer treatment is selected from the group consisting of a VEGFR antagonist, an anti-4-1BB antibody an anti-OX-40 antibody, an anti-MCSF antibody, an anti-PTK-7 antibody based antibody drug conjugate (ADC) wherein the drug payload is an antineoplastic agent, an IDO1 antagonist, an ALK antagonist, an anti-cancer vaccine, a radio therapy and a standard of care treatment of cancers of the relevant tumor type. Preferably, the VEGFR antagonist is axitinib, the anti-4-1BB antibody is PF0582566, the antiOX-40 antibody is PF4518600, the anti-MCSF antibody is PF-0360324, the ALK antagonist is crizotinib or lorlatinib (PF-06463922) and the anti-PTK7 antibody based ADC is PF-06647020.

BRIEF DESCRIPTION OF THE FIGURES AND DRAWINGS

[0013] FIG. 1 depicts the C.sub.trough v. ORR curve of 88 patients in phase III MCC trial.

[0014] FIG. 2. depicts the C.sub.trough v. ORR curve of 156 patients in phase III first line NSCLC patients

[0015] FIG. 3 depicts the C.sub.trough v. ORR curve of 184 patients in phase I, 2.sup.nd line NSCLC patients.

[0016] FIG. 4A and FIG. 4B depict the density plots showing the distribution of AUC.sub.0-336 h (.mu.gh/mL) after 10 mg/kg Q2W and flat 800 mg Q2W dosing using the PK SS model for the entire population (FIG. 4A) and split by quartiles of weight (FIG. 4B)

[0017] FIG. 5A and FIG. 5B depict the box and whisker plots showing the AUC.sub.0-336 h (.mu.gh/mL) after 10 mg/kg Q2W and 800 mg Q2W dosing using the PK SS model for the entire population (FIG. 5A) and split by quartiles of weight (FIG. 5B)

[0018] FIG. 6 depicts the density plot of mean probability of best overall response (BOR) in simulated studies with metastatic MCC (mMCC) based on the PK CYCLE model, for the 10 mg/kg Q2W and the 800 mg Q2W dose.

[0019] FIG. 7 depicts the box and whisker plot of mean probability of BOR in simulated studies with UC for the 10 mg/kg Q2W and 800 mg Q2W.

[0020] FIG. 8A and FIG. 8B depict the density plot (FIG. 8A) and box and whisker plot (FIG. 8B), using the PK CYCLE model, showing the probably of experiencing an immune-related adverse event (irAE) after 10 mg/kg Q2W and 800 mg Q2W dose.

[0021] FIG. 9A and FIG. 9B depict the density plot (FIG. 9A) and box and whisker plot (FIG. 9B), using the PK SS model, showing the probably of experiencing an irAE after 10 mg/kg Q2W and 800 mg Q2W dose.

DETAILED DESCRIPTION OF THE INVENTION

[0022] As used herein, the terms such as "area under curve" (AUC), C.sub.trough, C.sub.max, "best overall response" (BOR), "overall response rate" (ORR), Q1W, Q2W, Q3W have the meaning as they are generally known by one of the ordinary skill in the art.

[0023] As used herein, the term "anti-cancer treatment" refers to any standard of care treatment of cancers in any relevant tumor types, or the administration of any single pharmaceutical agent, any fixed dose combinations of two or more single pharmaceutical agents, other than the standard of care treatment of cancer, documented in the state of the art as having or potentially having an effect toward the treatment of cancer or in the relevant tumor types.

[0024] As used herein the term "standard of care treatment of cancers" refers to any non-surgical treatment of any particular tumor type that is suggested in the NCCN Guidelines Version 1 2017. For clarity, such standard of care treatment of cancers may be radiation or, the administration of a single pharmaceutical agent, a fixed dose combinations of two or more single pharmaceutical agents or the combination of two or more single pharmaceutical agents, provided that standard of care treatment of cancers does not already contain any PD-1 or PD-L1 antagonist.

[0025] As used herein the term "single pharmaceutical agent" means any composition that comprising a single substance as the only active pharmaceutical ingredient in the composition.

[0026] As used herein, the term "tumor proportion score" or "TPS" as used herein refers to the percentage of viable tumor cells showing partial or complete membrane staining in an immunohistochemistry test of a sample. "Tumor proportion score of PD-L1 expression" used here in refers to the percentage of viable tumor cells showing partial or complete membrane staining in a PD-L1 expression immunohistochemistry test of a sample. Exemplary samples include, without limitation, a biological sample, a tissue sample, a formalin-fixed paraffin-embedded (FFPE) human tissue sample and a formalin-fixed paraffin-embedded (FFPE) human tumor tissue sample. Exemplary PD-L1 expression immunohistochemistry tests include, without limitation, the PD-L1 IHC 22C3 PharmDx (FDA approved, Daco), Ventana PD-L1 SP263 assay, and the tests described in PCT/EP2017/073712.

[0027] "Administration" and "treatment," as it applies to an animal, human, experimental subject, cell, tissue, organ, or biological fluid, refers to contact of an exogenous pharmaceutical, therapeutic, diagnostic agent, or composition to the animal, human, subject, cell, tissue, organ, or biological fluid. Treatment of a cell encompasses contact of a reagent to the cell, as well as contact of a reagent to a fluid, where the fluid is in contact with the cell. "Administration" and "treatment" also means in vitro and ex vivo treatments, e.g., of a cell, by a reagent, diagnostic, binding compound, or by another cell. The term "subject" includes any organism, preferably an animal, more preferably a mammal (e.g., rat, mouse, dog, cat, and rabbit) and most preferably a human. "Treatment", as used in a clinical setting, is intended for obtaining beneficial or desired clinical results. For purposes of this invention, beneficial or desired clinical results include, but are not limited to, one or more of the following: reducing the proliferation of (or destroying) neoplastic or cancerous cells, inhibiting metastasis of neoplastic cells, shrinking or decreasing the size of tumor, remission of a disease (e.g., cancer), decreasing symptoms resulting from a disease (e.g., cancer), increasing the quality of life of those suffering from a disease (e.g., cancer), decreasing the dose of other medications required to treat a disease (e.g., cancer), delaying the progression of a disease (e.g., cancer), curing a disease (e.g., cancer), and/or prolong survival of patients having a disease (e.g., cancer).

[0028] An "antibody" is an immunoglobulin molecule capable of specific binding to a target, such as a carbohydrate, polynucleotide, lipid, polypeptide, etc., through at least one antigen recognition site, located in the variable region of the immunoglobulin molecule. As used herein, the term encompasses not only intact polyclonal or monoclonal antibodies, but also antigen binding fragments thereof (such as Fab, Fab', F(ab')2, Fv), single chain (scFv) and domain antibodies (including, for example, shark and camelid antibodies), and fusion proteins comprising an antibody, and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site. An antibody includes an antibody of any class, such as IgG, IgA, or IgM (or sub-class thereof), and the antibody need not be of any particular class. Depending on the antibody amino acid sequence of the constant region of its heavy chains, immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2. The heavy-chain constant regions that correspond to the different classes of immunoglobulins are called alpha, delta, epsilon, gamma, and mu, respectively. The subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known.

[0029] The term "antigen binding fragment" or "antigen binding portion" of an antibody, as used herein, refers to one or more fragments of an intact antibody that retain the ability to specifically bind to a given antigen (e.g., PD-L1). Antigen binding functions of an antibody can be performed by fragments of an intact antibody. Examples of binding fragments encompassed within the term "antigen binding fragment" of an antibody include Fab; Fab'; F(ab')2; an Fd fragment consisting of the VH and CH1 domains; an Fv fragment consisting of the VL and VH domains of a single arm of an antibody; a single domain antibody (dAb) fragment (Ward et al., Nature 341:544-546, 1989), and an isolated complementarity determining region (CDR).

[0030] An antibody, an antibody conjugate, or a polypeptide that "preferentially binds" or "specifically binds" (used interchangeably herein) to a target (e.g., PD-L1 protein) is a term well understood in the art, and methods to determine such specific or preferential binding are also well known in the art. A molecule is said to exhibit "specific binding" or "preferential binding" if it reacts or associates more frequently, more rapidly, with greater duration and/or with greater affinity with a particular cell or substance than it does with alternative cells or substances. An antibody "specifically binds" or "preferentially binds" to a target if it binds with greater affinity, avidity, more readily, and/or with greater duration than it binds to other substances. For example, an antibody that specifically or preferentially binds to a PD-L1 epitope is an antibody that binds this epitope with greater affinity, avidity, more readily, and/or with greater duration than it binds to other PD-L1 epitopes or non-PD-L1 epitopes. It is also understood that by reading this definition, for example, an antibody (or moiety or epitope) that specifically or preferentially binds to a first target may or may not specifically or preferentially bind to a second target. As such, "specific binding" or "preferential binding" does not necessarily require (although it can include) exclusive binding. Generally, but not necessarily, reference to binding means preferential binding.

[0031] A "variable region" of an antibody refers to the variable region of the antibody light chain or the variable region of the antibody heavy chain, either alone or in combination. As known in the art, the variable regions of the heavy and light chain each consist of four framework regions (FR) connected by three complementarity determining regions (CDRs) also known as hypervariable regions. The CDRs in each chain are held together in close proximity by the FRs and, with the CDRs from the other chain, contribute to the formation of the antigen binding site of antibodies. There are at least two techniques for determining CDRs: (1) an approach based on cross-species sequence variability (i.e., Kabat et al. Sequences of Proteins of Immunological Interest, (5th ed., 1991, National Institutes of Health, Bethesda Md.)); and (2) an approach based on crystallographic studies of antigen-antibody complexes (Al-lazikani et al., 1997, J. Molec. Biol. 273:927-948). As used herein, a CDR may refer to CDRs defined by either approach or by a combination of both approaches.

[0032] A "CDR" of a variable domain are amino acid residues within the variable region that are identified in accordance with the definitions of the Kabat, Chothia, the accumulation of both Kabat and Chothia, AbM, contact, and/or conformational definitions or any method of CDR determination well known in the art. Antibody CDRs may be identified as the hypervariable regions originally defined by Kabat et al. See, e.g., Kabat et al., 1992, Sequences of Proteins of Immunological Interest, 5th ed., Public Health Service, NIH, Washington D.C. The positions of the CDRs may also be identified as the structural loop structures originally described by Chothia and others. See, e.g., Chothia et al., Nature 342:877-883, 1989. Other approaches to CDR identification include the "AbM definition," which is a compromise between Kabat and Chothia and is derived using Oxford Molecular's AbM antibody modeling software (now Accelrys.RTM.), or the "contact definition" of CDRs based on observed antigen contacts, set forth in MacCallum et al., J. Mol. Biol., 262:732-745, 1996. In another approach, referred to herein as the "conformational definition" of CDRs, the positions of the CDRs may be identified as the residues that make enthalpic contributions to antigen binding. See, e.g., Makabe et al., Journal of Biological Chemistry, 283:1156-1166, 2008. Still other CDR boundary definitions may not strictly follow one of the above approaches, but will nonetheless overlap with at least a portion of the Kabat CDRs, although they may be shortened or lengthened in light of prediction or experimental findings that particular residues or groups of residues or even entire CDRs do not significantly impact antigen binding. As used herein, a CDR may refer to CDRs defined by any approach known in the art, including combinations of approaches. The methods used herein may utilize CDRs defined according to any of these approaches. For any given embodiment containing more than one CDR, the CDRs may be defined in accordance with any of Kabat, Chothia, extended, AbM, contact, and/or conformational definitions.

[0033] "Isolated antibody" and "isolated antibody fragment" refers to the purification status and in such context means the named molecule is substantially free of other biological molecules such as nucleic acids, proteins, lipids, carbohydrates, or other material such as cellular debris and growth media. Generally, the term "isolated" is not intended to refer to a complete absence of such material or to an absence of water, buffers, or salts, unless they are present in amounts that substantially interfere with experimental or therapeutic use of the binding compound as described herein.

[0034] "Monoclonal antibody" or "mAb" or "Mab", as used herein, refers to a population of substantially homogeneous antibodies, i.e., the antibody molecules comprising the population are identical in amino acid sequence except for possible naturally occurring mutations that may be present in minor amounts. In contrast, conventional (polyclonal) antibody preparations typically include a multitude of different antibodies having different amino acid sequences in their variable domains, particularly their CDRs, which are often specific for different epitopes. The modifier "monoclonal" indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method. For example, the monoclonal antibodies to be used in accordance with the present invention may be made by the hybridoma method first described by Kohler et al. (1975) Nature 256: 495, or may be made by recombinant DNA methods (see, e.g., U.S. Pat. No. 4,816,567). The "monoclonal antibodies" may also be isolated from phage antibody libraries using the techniques described in Clackson et al. (1991) Nature 352: 624-628 and Marks et al. (1991) J. Mol. Biol. 222: 581-597, for example. See also Presta (2005) J. Allergy Clin. Immunol. 116:731.

[0035] "Chimeric antibody" refers to an antibody in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in an antibody derived from a particular species (e.g., human) or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in an antibody derived from another species (e.g., mouse) or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity.

[0036] "Human antibody" refers to an antibody that comprises human immunoglobulin protein sequences only. A human antibody may contain murine carbohydrate chains if produced in a mouse, in a mouse cell, or in a hybridoma derived from a mouse cell. Similarly, "mouse antibody" or "rat antibody" refer to an antibody that comprises only mouse or rat immunoglobulin sequences, respectively.

[0037] "Humanized antibody" refers to forms of antibodies that contain sequences from non-human (e.g., murine) antibodies as well as human antibodies. Such antibodies contain minimal sequence derived from non-human immunoglobulin. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin sequence. The humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. The prefix "hum", "hu" or "h" is added to antibody clone designations when necessary to distinguish humanized antibodies from parental rodent antibodies. The humanized forms of rodent antibodies will generally comprise the same CDR sequences of the parental rodent antibodies, although certain amino acid substitutions may be included to increase affinity, increase stability of the humanized antibody, or for other reasons.

[0038] Avelumab entered phase 1 clinical trial in early 2013 and has since then advanced to phase 3 trials in several different tumor types such as MCC, NSCLC, RCC, gastric cancer, ovarian cancer and bladder cancer. The dosing regimen in these trials was 10 mg/kg Q2W. Provided herein are improved dosing regimens for avelumab which could achieve a better overall response rate than the current 10 mg/kg Q2W dosing regimen.

[0039] Table 1 below provides the sequences of the anti-PD-L1 antibody avelumab for use in the treatment method, medicaments and uses of the present invention. Avelumab is described in International Patent Publication No. WO2013/079174, the disclosure of which is hereby incorporated by references in its entirety.

TABLE-US-00001 TABLE 1 Anti-human-PD-L1 antibody Avelumab Sequences Heavy chain SYIMM CDR1 (CDRH1) (SEQ ID NO: 1) Heavy chain SIYPSGGITFY CDR2 (CDRH2) (SEQ ID NO: 2) Heavy chain IKLGTVTTVDY CDR3 (CDRH3) (SEQ ID NO: 3) Light chain TGTSSDVGGYNYVS CDR1 (CDRL1) (SEQ ID NO: 4) Light chain DVSNRPS CDR2 (CDRL2) (SEQ ID NO: 5) Light chain SSYTSSSTRV CDR3 (CDRL3) (SEQ ID NO: 6) Heavy chain EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYIMMW variable VRQAPGKGLEWVSSIYPSGGITFYADKGRFTISRDN region SKNTLYLQMNSLRAEDTAVYYCARIKLGTVTTVDYW (VR) GQGTLVTVSS (SEQ ID NO: 7) Light chain QSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVS VR WYQQHPGKAPKLMIYDVSNRPSGVSNRFSGSKSGNT ASLTISGLQAEDEADYYCSSYTSSSTRVFGTGTKVT VL (SEQ ID NO: 8) Heavy chain EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYIMMW VRQAPGKGLEWVSSIYPSGGITFYADTVKGRFTISR DNSKNTLYLQMNSLRAEDTAVYYCARIKLGTVTTVD YWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAA LGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKD TLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMH EALHNHYTQKSLSLSPGK (SEQ ID NO: 9) Light chain QSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVS WYQQHPGKAPKLMIYDVSNRPSGVSNRFSGSKSGNT ASLTISGLQAEDEADYYCSSYTSSSTRVFGTGTKVT VLGQPKANPTVTLFPPSSEELQANKATLVCLISDFY PGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASS YLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS (SEQ ID NO: 10)

EXAMPLES

[0040] General methods for Examples 1-3: a population pharmacokinetic (PK) model was used to estimate individual exposure metrics using individual pharmacokinetic parameters for patients with MCC and NSCLC. The influence of exposure metrics (C.sub.trough,) on response was explored via logistic regression and was applied to model the relationships between exposure and the overall response rate (ORR). In the figures for each example, the heavy dot on each vertical bar represents a summary statistic of the observed data, divided into quartiles. The X axis for each quartile represents the mean C.sub.trough of the patients in each of the quartiles and the Y axis represents the probability of response for the individual quartile and it is corresponding 95% confidence interval. The curved thin line represents the logistic regression model fit, about all the observed data along with the 95% prediction interval about the regression (shaded red area).

Example 1

C.sub.trough and ORR Correlation of 88 Patients in a Phase 3 MCC Trial

[0041] 88 patients participated in a phase 3 MCC trial with the avelumab dosing of 10 mg/kg Q2W over one hour of IV infusion. Patients were divided into four quartiles based on the C.sub.through value of patients, with 22 patients in each quartile. The C.sub.trough value of each patient was calculated based on the existing model and the actual serum concentration of avelumab tested for each patient at various points during the trial. As shown in FIG. 1, the four quartiles of patients were represented by the four vertical bars in the figure. The C.sub.trough value of each quartile is represented by the mean C.sub.trough value of the quartile. The heavy dot on each vertical bar represents the probability of overall response rate for the group.

[0042] A positive correlation between C.sub.trough and ORR was observed (FIG. 1). Patients of the upper 4.sup.th quartile have a probability of ORR of about 60% (FIG.1). A mean C.sub.trough of around 44-50 ug/mL correlates to a probability of ORR of 50-60% (FIG. 1).

Example 2

C.sub.trough and ORR Correlation of 156 Patients in Phase 3 First Line NSCLC Trial

[0043] 156 patients participated in a phase 3 first line NSCLC trial with the avelumab dosing of 10 mg/kg Q2W over one hour of IV infusion. Patients were divided into four quartiles based on the C.sub.through value of patients, with 39 patients in each quartile. The C.sub.trough number of each patient was calculated based on the existing model and the actual serum concentration of avelumab tested for each patient at various points during the trial. As shown in FIG. 2, the four quartiles of patients were represented by the four vertical bars in the figure. The C.sub.trough value of each quartile is represented by the mean C.sub.trough value of the quartile. The heavy dot on each vertical bar represents the probability of overall response rate for the group.

[0044] A positive correlation between C.sub.trough and ORR was observed (FIG. 2). Patients of the upper 4.sup.th quartile have a probability of ORR of about 35% (FIG. 2). A mean C.sub.trough of around 44-54 ug/mL correlates to a probability of ORR of 35-50% (FIG. 2).

Example 3

C.sub.trough and ORR Correlation of 184 Patients in Phase 1b Second Line NSCLC Trial

[0045] 184 patients participated in a phase 1b second line NSCLC trial with the avelumab dosing of 10 mg/kg Q2W over one hour of IV infusion. Patients were divided into four quartiles based on the C.sub.through value of patients, with 46 patients in each quartile. The C.sub.trough number of each patient was calculated based on the existing model and the actual serum concentration of avelumab tested for each patient at various points during the trial. As shown in FIG. 3, the four quartiles of patients were represented by the four vertical bars in the figure. The C.sub.trough value of each quartile is represented by the mean C.sub.trough value of the quartile. The heavy dot on each vertical bar represents the probability of overall response rate for the group.

[0046] A positive correlation between C.sub.trough and ORR was observed. Patients of the upper 4.sup.th quartile have a probability of ORR of about 31% (FIG. 3). A mean C.sub.trough of around 60-85 ug/mL correlates to a probability of ORR of 35-50% (FIG. 3).

[0047] Tumor proportion score (TPS) of PD-L1 expression was tested of the tumor tissues collected during the clinical trial. TPS of PD-L1 expression was analyzed together with C.sub.through and response rate. Surprising ORRs were observed among the subset of patients with both high exposure any increased PD-L1 expression in the tumor cells. Among the 184 patients, 142 patients evaluated for C.sub.trough exposure, and 71 patients were in the upper half (top two quartiles). For patients in the upper half (top two quartiles) of the C.sub.trough exposure, TPS PD-L1 expression cutoff values of .gtoreq.1%, .gtoreq.5%, .gtoreq.50%, and .gtoreq.80% yielded ORRs of 25.4%, 25.6%, 33.3%, and 42.9%, respectively (Table 2).

TABLE-US-00002 TABLE 2 Avelumab response in 2L NSCLC patients with high exposure and high TPS of PD-L1 PD-L1 TPS Patient number ORR Non selected 184 14.1% 1% and above 59 25.4% 5% and above 39 25.6% 50% and above 21 33.3% 80% and above 14 42.9%

[0048] A consistent positive correlation between mean C.sub.trough and the probability of ORR was observed (Examples 1-3). Taking into consideration of the best probability of the ORR in each Example, which occurs generally in the 4.sup.th quartile (Examples 1-3), the correlation of the C.sub.trough and ORR is expected to continue within reasonable range above the 4.sup.th quartile. These data indicate that a mean C.sub.trough of 44-85 ug/mL correlates with a probability of ORR of 50% in various tumor types.

Example 4

Simulation of C.sub.trough of Various Avelumab Dosing Regimens

[0049] Table 3 provides a number of dosing regimens for avelumab. The population PK model generated for avelumab based on previous work, was used to simulate the C.sub.trough of selected dosing regimens, in MCC, SCCLC and in solid tumor types.

TABLE-US-00003 TABLE 3 Avelumab dosing regimens Proposed dosing regimen Notes 5-10 mg/kg Q1W Dosing range 10 mg/kg Q1W Preferred specific dose 5 mg/kg Q1W additional Preferred specific 8 mg/kg Q1W dose within the range 11-20 mg/kg Q2W Dosing range 11 mg Q2W Preferred specific dose 20 mg/kg Q2W Preferred specific dose 13, 15, 17 mg/kg Q2W Additional preferred specific dose 15-30 mg/kg Q3W Range 20 mg/kg Q3W Preferred specific doses 15, 20, 25, 30 mg/kg Q3W Additional Preferred specific dose within the range 5-20 mg/kg Q1W for n weeks Dosing range followed by 10 mg/kg Q2W n is 6 or 12 10 mg/kg Q1W for 12 weeks Preferred specific dose followed by 10 mg/kg Q2W 5, 15, 20 mg/kg Q1W for 6 or Additional Preferred specific 12 weeks followed by 10 mg/kg dose within the range Q2W 500-800 mg Q1W Correspond to 5-10 mg/kg Q1W 900-1600 mg Q2W Correspond to 11-20 mg/kg Q2W 1250-2400 mg Q3W Correspond to 15-30 mg/kg Q2W 500-1600 mg Q1W for n weeks Correspond to 5-20 mg/kg followed by 800 mg Q2W Q1W for n weeks followed by 10 mg/kg Q2W

[0050] General methods: Pharmacokinetic simulations of the avelumab dosing regimens were performed using the NONMEM version 7.3 software (ICON Development Solutions, Hanover, Md.). Two compartment IV model with linear elimination was used as the population PK model. This model is based on over three thousand PK observations from over seven hundred patients who participated in the avelumab clinical trials thus far. To conduct the simulations of the dosing regimen described in above Table 3, a dataset was created with dosing events, dosing amounts, a 1 hour rate of infusion, and covariates included in the population PK model. The steady-state C.sub.trough concentrations were calculated by removing the first 3 doses and then computing the average C.sub.trough from the remaining dosing event for the given dose amount. For loading dose schedules, the C.sub.trough was calculated for the loading portion of the regimen as well as for the continued dosing after the loading period.

[0051] Results of the above simulation are shown in the below Tables 4-6.

TABLE-US-00004 TABLE 4 Summary of median C.sub.trough for MCC under various dosing regimen 95% C.sub.trough Median C.sub.trough prediction interval No. Dosing regimen (ug/mL) (ug/mL) 1 5 mg/kg Q1W 59 29.0-109.8 2 10 mg/kg Q1W 116.5 56.3-208.5 3 10 mg/kg/Q2W 38.9 14.7-83.0 4 11 mg/kg Q2W 43.4 17.6-91.5 5 20 mg/kg Q2W 77.1 31.1-160.3 6 10 mg/kg Q3W 18.1 4.5-45.5 7 15 mg/kg Q3W 27.3 9.5-67.4 8 20 mg/kg Q3W 36.6 12.3-86.7 9 25 mg/kg Q3W 10 30 mg/kg Q3W 53.7 18.4-127.2 11 5 mg/kg Q1W for During Loading: During loading: 12 weeks followed 59.0 29.0-109.8 by 10 mg/kg Q2W After loading: After loading: 40.6 15.7-90.2 12 10 mg/kg Q1W for During loading: During loading: 12 weeks followed 116.5 56.3-208.5 by 10 mg/kg Q2W After loading: After loading: 45.3 17.4-100.4 13 20 mg/kg Q1W for During loading During loading: 12 weeks followed 225.8 115.4-430.3 by 10 mg/kg Q2W After loading: After loading: 55.3 17.4-100.4 14 5 mg/kg Q1W for During loading: During loading: 6 weeks followed 55.0 27.6-105.4 by 10 mg/kg Q2W After loading: After loading: 39.4 16.2-88.3 15 10 mg Q1W for During loading: During loading: 6 weeks followed 110.1 53.6-206.0 by 10 mg/kg Q2W After loading: After loading: 41.9 17.1-88.3 16 20 mg Q1W for During loading: During loading: 6 weeks followed 215.7 107.7-382.6 by 10 mg/kg Q2W After loading: After loading: 46.2 17.9-105.2

[0052] The dosing regimens Nos. 1-2, 4-5, 8-16 of Table 4, and ranges within these regimens such as 5-10 mg/kg Q1W, 11-20 mg/kg Q2W, 20-30 mg/kg Q3W, 5-20 mg/kg Q1W for 6-12 weeks followed by 10 mg/kg Q2W, provide an expected median C.sub.trough higher than the current 10 mg/kg Q2W dosing regimen (Table 4). From Example 1, a dosing regimen that provides a mean C.sub.trough of over 50 ug/mL correlates with a higher probability of ORR in MCC. The data shown in Table 4 for the avelumab dosing regimens 1-2, 10 and 11-16 indicate that these regimens could advantageously provide a higher expected probability of ORR for MCC.

TABLE-US-00005 TABLE 5 Summary of Median C.sub.trough under various dosing regimen for NSCLC. Median 95% C.sub.trough Ctrough prediction interval No. Dosing regimen (ug/mL) (ug/mL) 1 5 mg/kg Q1W 42.8 19.4-79.6 2 10 mg/kg Q1W 83.9 39.9-160.2 3 10 mg/kg/Q2W 20.6 4.8-51.2 4 11 mg/kg Q2W 22.2 5.8-56.6 5 20 mg/kg Q2W 39.9 11.5-96.3 6 10 mg/kg Q3W 6.3 0.0-20.1 7 15 mg/kg Q3W 9.1 0.2-34.1 8 20 mg/kg Q3W 12.8 0.5-46.7 9 25 mg/kg Q3W 14.2 0.9-54.6 10 30 mg/kg Q3W 17.6 1.8-66.7 11 5 mg/kg Q1W for During Loading: During loading: 12 weeks followed 42.8 19.4-79.6 by 10 mg/kg Q2W After loading: After loading: 20.2 5.2-47.5 12 10 mg/kg Q1W for During loading: During loading: 12 weeks followed 83.9 39.9-160 by 10 mg/kg Q2W After loading: After loading: 20.2 4.8-51.5 13 20 mg/kg Q1W for During loading During loading: 12 weeks followed 172.9 74.6-342.6 by 10 mg/kg Q2W After loading: After loading: 20.5 4.6-63.9 14 5 mg/kg Q1W for During loading: During loading: 6 weeks followed 42.9 19.5-82.1 by 10 mg/kg Q2W After loading: After loading: 20.9 5.2-51.7 15 10 mg Q1W for 6 During loading: During loading: weeks followed by 86.7 39.0-163 10 mg/kg Q2W After loading: After loading: 20.5 5.0-52.6 16 20 mg Q1W for 6 During loading: During loading: weeks followed by 163.4 79.3-332.5 10 mg/kg Q2W After loading: After loading: 19.6 4.9-56.4

[0053] The dosing regimens Nos. 1-2, 4-5, 10, 11-16 of Table 5, and ranges within these regimens, such as 5-10 mg/kg Q1W, 11-20 mg/kg Q2W, 5-20 mg/kg Q1W for 6-12 weeks followed by 10 mg/kg Q2W, provide an expected median C.sub.trough above the current 10 mg/kg Q2W dosing regimen (Table 5). Examples 1-3 above demonstrate that the mean C.sub.trough has a positive correlation with the probability of ORR. In Examples 2 and 3, a mean C.sub.trough of 44 ug/mL to 85 ug/mL corresponds to about 35% to about 50% probability of ORR, wherein the 4.sup.th quartile probability of ORR in Examples 2 and 3 was 35% and 31% respectively. The data from Table 5 demonstrate that regimens Nos. 1-2, 5 and 11-16 provide an expected mean C.sub.trough of about or over 44 ug/mL and thus could advantageously provide better probability of ORR in NSCLC patients. Other advantageous dosing regimens include, for example, regimens Nos. 2, 12-13 and 15-16, and the ranges within these regimens such as 10 mg-20 mg/kg Q1W for 6 or 12 weeks followed by 10 mg/kg Q2W, all of which correspond to a median C.sub.trough of about or more than 85 ug/mL. Other advantageous regimens for NSCLC are those providing a mean C.sub.trough between 44 ug/mL and 85 ug/ml, i.e. dosing regimen Nos. 1, 2, 5, 11, 12, 14, 15 of Table 5, and ranges within these regimens such as 5-10 mg/kg Q1W, 5-10 mg/kg Q1W for 6-12 weeks followed by 10 mg/kg Q2W.

TABLE-US-00006 TABLE 6 Summary of Median C.sub.trough under various avelumab dosing regimen for all solid tumor types. 95% C.sub.trough Median C.sub.trough prediction interval No. Dosing regimen (ug/mL) (ug/mL) 1 5 mg/kg Q1W 43 19.5-84 2 10 mg/kg Q1W 83.6 36.6-160 3 10 mg/kg/Q2W 19.9 4.7-53.3 4 11 mg/kg Q2W 22.9 6.4-57.9 5 20 mg/kg Q2W 40.2 11.1-100.5 6 10 mg/kg Q3W 6.3 0.0-33.5 7 15 mg/kg Q3W 9.2 0.0-33.5 8 20 mg/kg Q3W 11.6 0.4-41.9 9 25 mg/kg Q3W 10 30 mg/kg Q3W 16.7 1.7-58.2 11 5 mg/kg Q1W for During Loading: During loading: 12 weeks followed 43.0 19.5-84.5 by 10 mg/kg Q2W After loading: After loading: 20.2 4.7-53.2 12 10 mg/kg Q1W for During loading: During loading: 12 weeks followed 83.6 36.6-160 by 10 mg/kg Q2W After loading: After loading: 19.7 4.3-51.6 13 20 mg/kg Q1W for During loading During loading: 12 weeks followed 160.7 73.8-319 by 10 mg/kg Q2W After loading: After loading: 19.3 4.2-54.9 14 5 mg/kg Q1W for During loading: During loading: 6 weeks followed 42.2 19.6-83.7 by 10 mg/kg Q2W After loading: After loading: 20.9 5.1-51.1 15 10 mg Q1W for During loading: During loading: 6 weeks followed by 83.9 39.6-158 10 mg/kg Q2W After loading: After loading: 19.9 5.5-48.6 16 20 mg Q1W for During loading: During loading: 6 weeks followed by 163.8 78.0-314 10 mg/kg Q2W After loading: After loading: 19.9 5.3-52.0

[0054] Avelumab dosing regimen Nos. 1-2, 4-5, 11-16 in Table 6, and ranges within these regimens such as 5-10 mg/kg Q1W, 11-20 mg/kg Q2W, 5-20 mg/kg Q1W for 6-12 weeks followed by 10 mg/kg Q2W, provide an expected median C.sub.trough above the current 10 mg/kg Q2W dosing regimen, and could advantageously provide a better probability of ORR (see, Examples 1-3). From Examples 1-3, a mean C.sub.trough of 44-85 ug/mL corresponds to about 50% of ORR respectively. Thus, dosing regimens that provide a mean C.sub.trough of over 44 ug/mL could advantageously provide a higher probability of ORR in patients with solid tumors. As such, dosing regimen 1-2, 5 and 11-16 shown in Table 6, or ranges therein, such as 5-10 mg/kg Q1W, 5-20 mg/kg Q1W for 6 or 12 weeks followed by 10 mg/kg Q2W, are advantageous for treatment of solid tumor types. Other advantageous dosing regimens to treat solid tumor include avelumab dosing regimen Nos. 2, 12-13 and 15-16 and the ranges within these regimens such as 10 mg-20 mg/kg Q1W for 6 or 12 weeks followed by 10 mg/kg Q2W, all of which corresponding to a median C.sub.trough of about or more than 85 ug/mL. Other advantageous avelumab dosing regimens include dosing regimen Nos. 1-2, 5, 11-12 and 14-15 shown in Table 6, and ranges within these regimens such as, for example, 5-10 mg/kg Q1W, 5-10 mg/kg Q1W for 6 or 12 weeks followed by 10 mg/kg Q2W, all of which correspond to a median C.sub.trough between about 44 ug/mL and about 85 ug/mL in solid tumors. Exemplary solid tumor types suitable for treatment with the avelumab dosing regimens provided herein include, without limitation, MCC, NSCLC, RCC, bladder cancer, ovarian cancer, head and neck cancer, gastric cancer, mesothelioma, urothelial carcinoma, breast cancer, adenocarcinoma of the stomach and thymoma.

Example 5

Modeling of Safety and Efficacy for the 800 mg Q2W Dosing in Comparison with the 10 mg/kg Q2W Dosing

[0055] The clinical profile of avelumab has been evaluated from data in more than 1800 subjects in ongoing Phase I, II, and III trials in adult subjects with various solid tumors. The clinical pharmacology results are obtained from 1827 subjects from three studies with PK information available as of Jun. 9, 2016 (studies EMR100070-001 and EMR100070-003) and Nov. 20, 2015 (study EMR100070-002).

[0056] Exposure Metrics.

[0057] Based on the clinical pharmacology results of these more than 1800 subjects mentioned above, 10000 and 4000 simulated subjects were generated using the PK CYCLE model and PK SS model respectively to project the avelumab exposure metrics of AUC, C.sub.though and C.sub.max for both the 10 mg/kg Q2W dosing and the 800 mg Q2W dosing. Where PK CYCLE model represents the PK model generated using PK data from the first dose of avelumab and PK SS model represents the PK model generated using PK data after repeated dosing of avelumab. Such projected exposure metrics were then used in the below Exposure-efficacy correlation and Exposure-safety correlation simulation. The distribution plot of such projected avelumab AUC.sub.0-336 are shown in FIG. 4A, FIG. 4B, FIG. 5A and FIG. 5B. The plots depicted in FIG. 4A and FIG. 4B show that the simulated values of AUC.sub.0-336 have a close correspondence between the two dosing regimens. The graphs in FIG. 5A and FIG. 5B show that the total variability of avelumab AUC.sub.0-336 is lower in the 800 mg Q2W regimen than the 10 mg/kg Q2W regimen.

[0058] Exposure--Efficacy Correlation and Exposure--Safety Correlation.

[0059] A univariate logistic regression model has been developed to describe the exposure--best overall response (BOR) relationship for the n=88 observed subjects with mMCC. The exposure values that were used for developing the logistic regression model were simulated from the PK CYCLE and PK SS models. Four hundred sets of parameter estimates were sampled from the uncertainty distribution of the exposure-BOR logistic regression model. For each of these 400 parameter sets, 2500 subjects were sampled from the mMCC population of the n=10000 subjects simulated based on the PK CYCLE and PK SS models. The mean predicted probability of response (across the n=2500 simulated subjects) was then obtained for each of the 400 sets of logistic model parameter estimates.

[0060] The same procedure was followed for the UC indication, with n=153 observed subjects with UC.

[0061] The results are summarized in the graphs shown in FIG. 6 and FIG. 7. The graph in FIG. 6 shows the probability of BOR in individual simulated patients with mMCC have large overlap between, and are similar for the 10 mg/kg Q2W and the 800 mg Q2W dosing regimens. The graph in FIG. 7 shows that the mean probability of BOR is very similar between the 10 mg/kg Q2W and 800 mg Q2W dosing regimens for the UC with a lower variability for the 800 mg Q2W dosing.

[0062] Exposure--safety correlation was modelled similarly using the safety variables immune related AE of any grade (irAE) and infusion related reactions (IRR). The results are shown in FIG. 8A, FIG. 8B, FIG. 9A and FIG. 9B. The graphs depicted in FIG. 8A and FIG. 8B show very similar probability of experiencing an irAE between the two dosing regimens. The graphs depicted in FIG. 9A and FIG. 9B show that the 800 mg Q2W dosing regimen tends to have a lower variability comparing to the 10 mg/kg Q2W dosing.

Sequence CWU 1

1

1015PRTArtificial SequenceSynthetic Consruct 1Ser Tyr Ile Met Met1 5211PRTArtificial SequenceSynthetic Construct 2Ser Ile Tyr Pro Ser Gly Gly Ile Thr Phe Tyr1 5 10311PRTArtificial SequenceSynthetic Construct 3Ile Lys Leu Gly Thr Val Thr Thr Val Asp Tyr1 5 10414PRTArtificial SequenceSynthetic Construct 4Thr Gly Thr Ser Ser Asp Val Gly Gly Tyr Asn Tyr Val Ser1 5 1057PRTArtificial SequenceSynthetic Construct 5Asp Val Ser Asn Arg Pro Ser1 5610PRTArtificial SequenceSynthetic Construct 6Ser Ser Tyr Thr Ser Ser Ser Thr Arg Val1 5 107118PRTArtificial SequenceSynthetic Construct 7Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ile Met Met Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ser Ile Tyr Pro Ser Gly Gly Ile Thr Phe Tyr Ala Asp Lys Gly 50 55 60Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr Leu Gln65 70 75 80Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg 85 90 95Ile Lys Leu Gly Thr Val Thr Thr Val Asp Tyr Trp Gly Gln Gly Thr 100 105 110Leu Val Thr Val Ser Ser 1158110PRTArtificial SequenceSynthetic Construct 8Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Gly Tyr 20 25 30Asn Tyr Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Asp Val Ser Asn Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Ser Ser Tyr Thr Ser Ser 85 90 95Ser Thr Arg Val Phe Gly Thr Gly Thr Lys Val Thr Val Leu 100 105 1109450PRTArtificial SequenceSynthetic Construct 9Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ile Met Met Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ser Ile Tyr Pro Ser Gly Gly Ile Thr Phe Tyr Ala Asp Thr Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ile Lys Leu Gly Thr Val Thr Thr Val Asp Tyr Trp Gly Gln 100 105 110Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val 115 120 125Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala 130 135 140Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser145 150 155 160Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val 165 170 175Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro 180 185 190Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys 195 200 205Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp 210 215 220Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly225 230 235 240Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile 245 250 255Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu 260 265 270Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His 275 280 285Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg 290 295 300Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys305 310 315 320Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu 325 330 335Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr 340 345 350Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu 355 360 365Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp 370 375 380Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val385 390 395 400Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp 405 410 415Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His 420 425 430Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro 435 440 445Gly Lys 45010216PRTArtificial SequenceSynthetic Construct 10Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Gly Tyr 20 25 30Asn Tyr Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Asp Val Ser Asn Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Ser Ser Tyr Thr Ser Ser 85 90 95Ser Thr Arg Val Phe Gly Thr Gly Thr Lys Val Thr Val Leu Gly Gln 100 105 110Pro Lys Ala Asn Pro Thr Val Thr Leu Phe Pro Pro Ser Ser Glu Glu 115 120 125Leu Gln Ala Asn Lys Ala Thr Leu Val Cys Leu Ile Ser Asp Phe Tyr 130 135 140Pro Gly Ala Val Thr Val Ala Trp Lys Ala Asp Gly Ser Pro Val Lys145 150 155 160Ala Gly Val Glu Thr Thr Lys Pro Ser Lys Gln Ser Asn Asn Lys Tyr 165 170 175Ala Ala Ser Ser Tyr Leu Ser Leu Thr Pro Glu Gln Trp Lys Ser His 180 185 190Arg Ser Tyr Ser Cys Gln Val Thr His Glu Gly Ser Thr Val Glu Lys 195 200 205Thr Val Ala Pro Thr Glu Cys Ser 210 215



User Contributions:

Comment about this patent or add new information about this topic:

CAPTCHA
People who visited this patent also read:
Patent application numberTitle
20220144548Conveyor Cart Alignment Systems and Methods
20220144547METHOD AND SYSTEM FOR GENERATING RFID LABELS USING RFID ENCODER ATTACHMENT
20220144546STORAGE SYSTEM, BASE, CONTROL DEVICE, PROGRAM, AND TRANSPORT ROBOT
20220144545WAREHOUSE MANAGEMENT SYSTEM, ORDER PICKING AND WAREHOUSE SYSTEM AND ORDER PICKING METHOD WITH EYECATCHING TRANSMITTERS WHOSE COLORS ARE CHANGEABLE IN AN AUTOMATIC MANNER
20220144544METHOD AND COMPUTER PROGRAM FOR CONTROLLING STORAGE AND RETRIEVAL OF PERSONAL STORAGE CONTAINERS IN AN AUTOMATED STORAGE AND RETRIEVAL SYSTEM
New patent applications in this class:
DateTitle
2022-09-08Shrub rose plant named 'vlr003'
2022-08-25Cherry tree named 'v84031'
2022-08-25Miniature rose plant named 'poulty026'
2022-08-25Information processing system and information processing method
2022-08-25Data reassembly method and apparatus
Website © 2025 Advameg, Inc.