Patent application title: MATERIALS AND METHODS FOR THE PREPARATION OF BACTERIAL CAPSULAR POLYSACCHARIDES
Inventors:
IPC8 Class: AC12P1904FI
USPC Class:
1 1
Class name:
Publication date: 2022-05-12
Patent application number: 20220145343
Abstract:
Methods for preparing saccharide products such as bacterial capsular
polysaccharides are provided. The methods include: forming a reaction
mixture containing one or more bacterial capsular polysaccharide
synthases, a sugar acceptor, and one or more sugar donors; and
maintaining the reaction mixture under conditions sufficient to form the
bacterial capsular saccharide product. Vaccine compositions containing
bacterial capsular saccharide products prepared according to the methods
are also described.Claims:
1. A method for preparing a bacterial capsular saccharide product, the
method comprising: forming a reaction mixture containing one or more
bacterial capsular polysaccharide synthases, a sugar acceptor, and one or
more sugar donors; and maintaining the reaction mixture under conditions
sufficient to form the bacterial capsular saccharide product; wherein the
degree of polymerization of the bacterial capsular saccharide product
ranges from 2 to about 200, and wherein the polydispersity index
M.sub.w/M.sub.n of the bacterial capsular saccharide product ranges from
1 to about 1.5.
2. The method of claim 1, wherein the bacterial capsular saccharide product is a heteropolymer comprising disaccharide repeating units.
3. The method of claim 2, wherein forming the bacterial capsular saccharide product comprises glycosylating the sugar acceptor with monosaccharide residues of a first variety and monosaccharide residue of a second variety in alternating steps.
4. The method of claim 2, wherein forming the bacterial capsular saccharide product comprises glycosylating the sugar acceptor with alternating monosaccharide residues of a first variety and monosaccharide residues of a second variety in a single polymerization step.
5. The method of claim 1, the degree of polymerization of the bacterial capsular saccharide product ranges from 20 to about 200.
6. The method of claim 1, wherein the degree of polymerization of the bacterial capsulate saccharide product is greater than 50.
7. The method of claim 1, wherein the polydispersity index M.sub.w/M.sub.n of the bacterial capsular saccharide product ranges from 1.01 to about 1.15
8. The method of claim 1, wherein each bacterial capsular polysaccharide synthase is independently selected from N. meningitidis SiaD.sub.W (NmSiaD.sub.W), N. meningitidis SiaD.sub.Y (NmSiaD.sub.Y), a P. multocida heparosan synthase (PmHS1 and PmHS2), P. multocida hyaluronan synthase (PmHAS), S. pyogenes hyaluronan synthase (SpHAS), P. multocida chondroitin synthase (PmCS), E. coli K5 KfiA and KfiC, S. pneumoniae Type 3 capsular polysaccharide synthase (SpCps3 S), and S. pneumoniae Type 37 capsular polysaccharide synthase (SpCps37Tts).
9. The method of claim 8, wherein the reaction mixture comprises one bacterial capsular polysaccharide synthase, and wherein the bacterial capsular polysaccharide synthase is NmSiaD.sub.W.
10. The method of claim 1, wherein the bacterial capsular saccharide product comprises galactose-sialic acid disaccharide repeating units.
11. The method of claim 1, wherein the galactose-sialic acid disaccharide repeating units are (-6Gal.alpha.1-4Neu5Ac.alpha.2).
12. The method of claim 10, wherein the reaction mixture comprises a galactose donor, a sialic acid donor, or a combination thereof.
13. The method of claim 12, wherein the galactose donor is UDP-Gal.
14. The method of claim 12, wherein the sialic acid donor is CMP-Neu5Ac.
15. The method of claim 10, wherein forming the bacterial capsular saccharide product comprises glycosylating the sugar acceptor with galactose residues and sialic acid residues in alternating steps.
16. The method of claim 10, wherein forming the bacterial capsular saccharide product comprises glycosylating the sugar acceptor with alternating galactose residues and sialic acid residues in a single polymerization step.
17. The method of claim 16, wherein the reaction mixture comprises UDP-Gal and CMP-Neu5Ac, and wherein the ratio (UDP-Gal+CMP-Neu5Ac):(sugar acceptor) ranges from about 1:1 to about 250:1.
18. The method of claim 17, wherein the ratio is about 100:1.
19. The method of claim 1, wherein the sugar acceptor comprises a sialic acid residue at its non-reducing end.
20. The method of claim 1, wherein the sugar acceptor comprises a galactose residue at its non-reducing end.
21. The method of claim 1, wherein the sugar acceptor comprises an oligosaccharide moiety Gal.alpha.1-4Neu5Ac.alpha.2(-6Gal.alpha.1-4Neu5Ac.alpha.2).sub.n-, or an oligosaccharide moiety Neu5Ac.alpha.2(-6Gal.alpha.1-4Neu5Ac.alpha.2).sub.m-, wherein subscript n is 1, 2, 3, or 4 and subscript m is 1, 2, 3, 4, or 5.
22. The method of claim 1, wherein the acceptor comprises a purification handle.
23. The method of claim 1, wherein the reaction mixture further comprises a CMP-sialic acid synthetase, a nucleotide sugar pyrophosphorylase, a pyrophosphatase, a kinase, or a combination thereof.
24. The method of claim 23, wherein the CMP-sialic acid synthetase is NmCSS, wherein the nucleotide sugar pyrophosphorylase is BLUSP, wherein the pyrophosphatase is PmPpA, and wherein the kinase is SpGalK.
25. The method of claim 1, wherein the pH of the reaction mixture ranges from about 6 to about 9.
26. The method of claim 1, which is conducted in vitro.
27. A bacterial capsular saccharide product prepared according to the method of any one of claims 1-26.
28. A vaccine composition comprising a bacterial capsular saccharide product prepared according to the method of any one of claims 1-26 coupled to a carrier material.
Description:
CROSS REFERENCES TO RELATED APPLICATIONS
[0001] The present application claims priority to U.S. Provisional Pat. Appl. No. 62/803,278, filed on Feb. 8, 2019, which application is incorporated herein by reference in its entirety.
BACKGROUND OF THE INVENTION
[0003] Neisseria meningitidis is a Gram-negative bacterium that causes diseases only for humans. Among 13 serogroups characterized so far based on the structures of their capsular polysaccharides (CPSs), six including serogroups A, B, C, W, X, and Y are causative agents of life-threatening meningococcal diseases. The CPSs for four (B, C, W, and Y) of these serogroups contain N-acetylneuraminic acid (Neu5Ac), the most common form of sialic acid (Sia) and a common terminal nine-carbon .alpha.-keto acid in humans. The CPSs of serogroups B and C are homopolymers of .alpha.2-8- and .alpha.2-9-linked Neu5Ac, respectively. In comparison, serogroups W and Y are heteropolymers of unique disaccharide repeating units -4Neu5Ac.alpha.2-6Gal.alpha.1- and -4Neu5Ac.alpha.2-6Glc.alpha.1-, respectively, that have not been found in other organisms so far. The Neu5Ac in the CPSs of serogroups C, W, and Y can be modified by O-acetylation at C7 and C8 for serogroups C and at C7 and C9 for serogroups W and Y. The biosynthesis of these unusual polysaccharides is achieved by polymerases NmSiaD.sub.W and NmSiaD.sub.y. The genes encoding these proteins have been cloned, and the function of the expressed recombinant proteins has been confirmed by radiochemical assay and enzyme dissection. Claus, 2009; Claus 1997; Romanov, 2013; Romanov, 2014. However, the catalysis mechanism is not clearly understood.
[0004] N. meningitidis serogroup W has attracted an increasing attention after an outbreak after the Hajj pilgrimage in March 2000. Since 2009, increased cases of NmW infection with a high mortality rate (10% or higher) have been observed in the United Kingdom and the Netherlands. Despite the twentieth century's triumph in producing antibiotics for treating most bacterial infections, the continuous emergence of resistant strains of an increasing number of bacterial species has led to a focus on the development of vaccines. For Nm, CPSs have been valid targets for the development of glycoconjugate vaccines. Although protein-conjugated vaccines containing capsular polysaccharides of one or more serogroups of A, B, C, W, Y are available, there is a need for synthesizing structurally defined capsular polysaccharides for developing safer vaccines and as probes for basic research.
BRIEF SUMMARY OF THE INVENTION
[0005] Provided herein are methods for preparing a bacterial capsular saccharide products. The methods include: forming a reaction mixture containing one or more bacterial capsular polysaccharide synthases, a sugar acceptor, and one or more sugar donors; and maintaining the reaction mixture under conditions sufficient to form the bacterial capsular saccharide product. The degree of polymerization of the bacterial capsular saccharide product ranges from 2 to about 200, and the polydispersity index M.sub.w/M.sub.n of the bacterial capsular saccharide product ranges from 1 to about 1.5.
[0006] Using the methods described herein, monodisperse heteropolymeric products and heterooligomeric products may be prepared in step-wise fashion or in one-step polymerization processes. The desired products may be conveniently prepared via one-step multienzyme reactions employing bacterial capsular polysaccharide synthases, such as N. meningitidis SiaD.sub.W, in combination with further enzymes such as CMP-sialic acid synthetases, nucleotide sugar pyrophosphorylases, pyrophosphatases, and/or kinases.
[0007] Also provided herein are vaccine compositions containing the bacterial capsular saccharide products.
BRIEF DESCRIPTION OF THE DRAWINGS
[0008] FIG. 1 shows an SDS-PAGE gel analysis of NmSiaD.sub.W expression. Theoretical molecular weight of NmSiaD.sub.W is 121.5 kDa. BI: before induction; AL: after induction; L: cell lysate; P: purified fraction.
[0009] FIG. 2 shows the chemical synthesis of sialylmonosaccharide S1 from N-acetylneuraminic acid (Neu5Ac, 1).
[0010] FIG. 3 shows the sequential one-pot multienzyme (OPME) chemoenzymatic synthesis of oligosaccharides G2-G10 from monosaccharide S1.
[0011] FIG. 4A shows galactosyltransferase activity and sialyltransferase activity across a range of pH values. Buffers used were: Citric acid, pH 3-4.5; MES, pH 5.0-6.5; Tris-HCl, pH 7.0-9.0; CAPS, pH 10.0-11.0.
[0012] FIG. 4B shows the effects of metals on galactosyltransferase activity and sialyltransferase activity.
[0013] FIG. 5A shows the thermostability profile of NmSiaD.sub.W.
[0014] FIG. 5B shows the temperature profile of NmSiaD.sub.W.
[0015] FIG. 6 shows initial velocity plots of Gal.alpha.1-4Neu5Ac.alpha.ProNHCbz as acceptor with 2 mM or 10 mM of CMP-Neu5Ac as donor.
[0016] FIG. 7 shows the results of a polymerization study conducted with 10 oligosaccharide acceptors after 20 hour reaction.
[0017] FIG. 8A shows product profiles of 20-hour reactions using different ratios (1-50 equivalents) of donors versus acceptor (5 mM) where galactosyldisaccharide G2 was used as the acceptor.
[0018] FIG. 8B shows product profiles of 20-hour reactions using different ratios (1-50 equivalents) of donors versus acceptor (5 mM) where sialyltrisaccharide S3 was used as the acceptor.
DETAILED DESCRIPTION OF THE INVENTION
[0019] Provided herein are methods for preparing bacterial capsular polysaccharides and other useful saccharide products. The methods include forming a reaction mixture containing an acceptor, a first sugar donor, a second sugar donor, and a bacterial capsular polysaccharide synthase; and maintaining the reaction mixture under conditions sufficient to form the saccharide product; wherein the first sugar donor is a sialic acid donor. Capsular polysaccharide synthases from pathogenic bacteria such as Neisseria meningitidis, Actinobacillus pleuropneumoniae, Haemophilus influenzae, Bibersteinia trehalosi, and Escherichia coli can be employed in the methods provided herein.
[0020] The chemoenzymatic methods of the present disclosure can avoid the contamination introduced by purifying capsular polysaccharides from pathogens. Furthermore, size-controlled oligosaccharides can be obtained using the methods described herein while avoiding the heterogeneity of the bacterial polysaccharide vaccines. Oligosaccharides can be synthesized using one-pot reactions with excellent yields, compared to previously reported chemical synthesis methods with multiple steps and lower yields. Both galactoside products and sialoside products can be obtained using the methods provided herein. Size-controlled oligosaccharides prepared according to the methods provided herein are advantageous for enzymology studies and improved vaccine development.
[0021] Some embodiments of the present disclosure provide highly active recombinant NmSiaD.sub.W constructs that can be used in efficient one-pot multienzyme (OPME) sialylation and galactosylation systems for synthesizing size-controlled NmW CPS oligosaccharides and analogs. Recombinant NmSiaD.sub.W can be cloned and expressed in E. coli with a high expression level (150 mg/L culture). In order to monitor the formation of oligosaccharides and facilitate the product purification process, a carboxybenzyl (Cbz) group can be introduced to the reducing end of Neu5Ac. Although NmW CPS sialosides have been synthesized by a total synthesis method, the present disclosure provides the first success in obtaining pure oligosaccharides in preparative-scale using chemoenzymatic methods. Structurally defined chromophore-tagged oligosaccharides allowed detailed characterization, kinetics studies, and substrate specificity studies of NmSiaD.sub.W. The structurally-defined NmW CPS oligosaccharides synthesized can be employed as probes and carbohydrate standards, as well as for the development of improved bacterial carbohydrate-protein conjugate vaccines. The sequential OPME strategy can be extended for chemoenzymatic synthesis of other polysaccharides containing disaccharide repeating units.
I. METHODS FOR PREPARATION OF BACTERIAL CAPSULAR OLIGOSACCHARIDES AND POLYSACCHARIDES
[0022] Provided herein are methods for preparing a bacterial capsular saccharide product.
[0023] The methods include:
[0024] forming a reaction mixture containing one or more bacterial capsular polysaccharide synthases, a sugar acceptor, and one or more sugar donors; and
[0025] maintaining the reaction mixture under conditions sufficient to form the bacterial capsular saccharide product;
[0026] wherein the degree of polymerization of the bacterial capsular saccharide product ranges from 2 to about 200, and wherein the polydispersity index M.sub.w/M.sub.n of the bacterial capsular saccharide product ranges from 1 to about 1.5.
[0027] A. Bacterial Capsular Saccharide Products
[0028] In some embodiments, the bacterial capsular saccharide product is a heteropolymer comprising disaccharide repeating units. Examples of disaccharide repeating units include, but are not limited to, -4GlcA.beta.1-4GlcNAc.alpha.1- (as expressed in capsular polysaccharides produce by microbes such as E. coli serotype K5; and P. multocida, Type D), -3GlcNAc.beta.1-4GlcA.beta.1- (as expressed in capsular polysaccharides produce by microbes such as P. multocida, Type A; and S. pyogenes), -3GalNAc.beta.1-4GlcA.beta.1- (as expressed in capsular polysaccharides produce by microbes such as P. multocida, Type F), -4Neu5Ac.alpha.2-6Gal.alpha.1- (as expressed in capsular polysaccharides produce by microbes such as N. meningitidis, serogroup W135), -4Neu5Ac.alpha.2-6Glc.alpha.1- (as expressed in capsular polysaccharides produce by microbes such as N. meningitidis, serogroup Y), -3GlcA.beta.1-4Glc.beta.1- (as expressed in capsular polysaccharides produce by microbes such as S. pneumonia, Type 3), and -3GlcA.beta.1-4Glc.beta.1- (as expressed in capsular polysaccharides produce by microbes such as S. pneumonia, Type 37).
[0029] In some embodiments, the degree of polymerization (DP) of the bacterial capsular saccharide product ranges from 20 to about 200. The DP of a bacterial capsular polysaccharide product may range, for example, from about 20 to about 30, or from about 30 to about 40, or from about 40 to about 50, or from about 50 to about 60, or from about 60 to about 70, or from about 70 to about 80, or from about 80 to about 90, or from about 90 to about 100, or from about 100 to about 110, or from about 120 to about 130, or from about 130 to about 140, or from about 140 to about 150, or from about 150 to about 160, or from about 160 to about 170, or from about 170 to about 180, or from about 180 to about 190, or from about 190 to about 200. In some embodiments, the DP of a bacterial capsular polysaccharide may range from about from about 25 to about 115, or from about 30 to about 110, or from about 35 to about 105, or from about 40 to about 100, or from about 45 to about 95, or from about 50 to about 90, or from about 55 to about 85, or from about 60 to about 80, or from about 65 to about 75. In some embodiments, the DP of a bacterial capsular saccharide may from range about 5 to about 35, or from about 10 to about 30, or from about 15 to about 25.
[0030] The terms "about" and "around," as used herein to modify a numerical value (e.g., degree of polymerization), indicate a close range surrounding that explicit value. If "X" were the value, "about X" or "around X" would indicate a value from 0.9X to 1.1X. "About X" thus includes, for example, a value from 0.95X to 1.05X, or from 0.98X to 1.02X, or from 0.99X to 1.01X. Any reference to "about X" or "around X" specifically indicates at least the values X, 0.90X, 0.91X, 0.92X, 0.93X, 0.94X, 0.95X, 0.96X, 0.97X, 0.98X, 0.99X, 1.01X, 1.02X, 1.03X, 1.04X, 1.05X, 1.07X, 1.08X, 1.09X, and 1.10X. Accordingly, "about X" and "around X" are intended to teach and provide written description support for a claim limitation of, e.g., "0.98X."
[0031] Advantageously, the methods of the present disclosure can be employed for the preparation of oligomeric and polymeric products having a narrow size distribution. Products having a degree of polymerization within the preceding ranges or subranges may be further characterized in terms of polydispersity index (PDI), calculated as M.sub.w/M.sub.n, wherein M.sub.w is the weight average value of the population of polymers in the product and M.sub.n is the number average value for the population of polymers in the product. Typically, the PDI for a bacterial capsular saccharide product will range from about 1 to about 1.5. The PDI may range, for example, from about 1.01 up to about 1.5, or from about 1.01 up to about 1.4, or from about 1.01 up to about 1.3, or from about 1.01 up to about 1.2, or from about 1 up to about 1.01, for a product have a PD value lying within any of the ranges or subranges set forth above. In some embodiments, the PDI of the bacterial capsular saccharide product is no greater than about 1.01, 1.02, 1.03, 1.04, 1.05, 1.06, 1.07, 1.09, 1.10, 1.11, 1.12, 1.13, 1.14, 1.15, 1.16, 1.17, 1.18, 1.19, or 1.20.
[0032] Weight average and number average molecular weights may be determined by any suitable method including, for example, by osmotic pressure, vapor pressure, light scattering, ultracentrifugation, or size exclusion chromatography. Using size exclusion chromatography with an appropriately calibrated column, number average molecular weight M.sub.n may be determined according to Equation 1:
M n = W .SIGMA. .times. N i = .SIGMA. .function. ( M i .times. N i ) .SIGMA. .times. N i = .SIGMA. .function. ( H i ) .SIGMA. .function. ( H i / M i ) , ( 1 ) ##EQU00001##
and M.sub.w may be determined according to Equation 2:
M w = .SIGMA. .function. ( W i .times. M i ) W = .SIGMA. .function. ( H i .times. M i ) .SIGMA. .times. H i , ( 2 ) ##EQU00002##
wherein W is the total weight of polymers, W.sub.i is the weight of the i.sup.th polymer, M.sub.i is the molecular weight of the i.sup.th peak in a chromatogram, N.sub.i is the number of molecules with molecular weight N.sub.i, and H.sub.i is the height of the i.sup.th peak in the chromatogram. Known polysaccharides and oligosaccharide, e.g., products characterized by NMR and HRMS as described below, may be employed in certain instances for calibration of instruments and analytical methodology.
[0033] In some embodiments, the degree of polymerization of the bacterial capsulate saccharide product is greater than 50. In some embodiments, the polydispersity index M.sub.w/M.sub.n of the bacterial capsular saccharide product ranges from 1.01 to about 1.15.
[0034] Methods according to the present disclosure generally include two or more glycosylation steps, which may be conducted with or without isolation of intermediates during elongation of the acceptor sugar toward the desire products. In one non-limiting grouping of embodiments, the methods employ alternating one-pot, multienzyme glycosylation reactions with product purification at the end of each reaction. This strategy can provide particularly precise control of product size distribution. For example, one-pot multienzyme galactose activation and transfer system (referred to as OPME1 in the Examples described below) can be used to add an .alpha.1-4-linked Gal to a sialoside acceptor (e.g., Neu5Ac-alpha-ProNHCbz) to form a product elongated by one additional sugar. The elongated product can be purified and used as a starting material for the one-pot multienzyme (OPME) sialic acid activation and transfer system (referred to as OPME2) to add an a2-6-linked sialic acid to form a subsequent product elongated by another additional sugar. This subsequent product can be purified and used for the next round of glycosylation. In this fashion, oligomeric and polymeric products can be prepared by alternating OPME1 and OPME2 reactions with product purification at the end of each reaction.
[0035] In another non-limiting grouping of embodiments, oligosaccharides (e.g., disaccharides to decasaccharides) may be employed as an initial sugar acceptor in the presence of two or more sugar donors (e.g., nucleotide sugars such as UDP-Gal and CMP-sialic acid) in a single polymerization step. The sugar donors may be provided externally or generated in situ by OPME reactions. This method can be used to provide products having a narrow range of molecular weights.
[0036] Accordingly, some embodiments of the present disclosure provide methods wherein forming the bacterial capsular saccharide product comprises glycosylating the sugar acceptor with monosaccharide residues of a first variety and monosaccharide residue of a second variety in alternating steps.
[0037] In some embodiments, forming the bacterial capsular saccharide product comprises glycosylating the sugar acceptor with alternating monosaccharide residues of a first variety and monosaccharide residues of a second variety in a single polymerization step.
[0038] Also provided are bacterial capsular saccharide products prepared according to the methods described herein.
[0039] B. Bacterial Capsular Polysaccharide Synthases
[0040] A number of bacterial capsular polysaccharide synthases may be used in the methods of the present disclosure. Suitable synthases include, but are not limited to, those described by Litschko et al. (mBio, 2018, 9(3): e00641-18). The synthases are generally characterized by glycosyltransferase activity, hexose-1-phosphate transferase activity, or a combination thereof.
[0041] Catalytic domains exhibiting glycosyltransferase activity typically adopt a "GT-A" fold or a "GT-B" fold. In the GT-A fold, two Rossmann-like domains are tightly associated, forming a central, continuous .beta.-sheet. In the GT-B fold, two Rossmann-like domains are opposed to each other, forming a deep cleft that contains the catalytic center. Different mono-functional glycosyltransferases may also be employed in combination for the preparation of heteropolymeric or heterooligomeric products. Alternatively, synthases characterized by a two or more types of glycosyltransferase activity in the same polypeptide, e.g., N. meningitidis SiaD.sub.W, may be employed in the preparation of heteropolymeric or heterooligomeric products. Synthases characterized by hexose-1-phosphate transferase can be used for the assembly of products containing sugar residues linked by phosphodiester moieties. Examples of such enzymes include, but are not limited to, N. meningitidis serogroup L CslB, and may be employed alone or with enzymes having glycosyltransferase activity.
[0042] In some embodiments, each bacterial capsular polysaccharide synthase is independently selected from N. meningitidis SiaD.sub.W (NmSiaD.sub.W; UniProt Accession No. 033390), N. meningitidis SiaD.sub.Y (NmSiaD.sub.Y; UniProt Accession No. B5WYL7), a P. multocida heparosan synthase (PmHS1 and PmHS2, GenBank Accession Nos. AAL84705 and AAQ55110), P. multocida hyaluronan synthase (PmHAS, GenBank Accession Nos. AAC38318), S. pyogenes hyaluronan synthase (SpHAS, GenBank Accession No. AAA17983), P. multocida chondroitin synthase (PmCS, GenBank Accession No. AAF97500), E. coli K5 KfiA and KfiC (GenBank Accession Nos. CAA54711 and CAA54709), S. pneumoniae Type 3 capsular polysaccharide synthase (SpCps3S, GenBank Accession No. CAA87404), and S. pneumoniae Type 37 capsular polysaccharide synthase (SpCps37Tts, GenBank Accession No. CAB51329).
[0043] In some embodiments, the bacterial capsular polysaccharide synthase may include one or more heterologous amino acid sequences located at the N-terminus and/or the C-terminus of the enzyme. The bacterial capsular polysaccharide synthase may contain a number of heterologous sequences that are useful for expressing, purifying, and/or using the enzyme. The bacterial capsular polysaccharide synthase can contain, for example, a poly-histidine tag (e.g., a His.sub.6 tag, SEQ ID NO:9); a calmodulin-binding peptide (CBP) tag; a NorpA peptide tag; a Strep tag for recognition by/binding to streptavidin or a variant thereof, a FLAG peptide for recognition by/binding to anti-FLAG antibodies (e.g., M1, M2, M5); a glutathione S-transferase (GST); or a maltose binding protein (MBP) polypeptide.
[0044] In some embodiments, the reaction mixture comprises one bacterial capsular polysaccharide synthase, and the bacterial capsular polysaccharide synthase is NmSiaD.sub.W having an amino acid sequence set forth in SEQ ID NO:1. In some embodiments, the bacterial capsular polysaccharide synthase is NmSiaD.sub.W comprising a His6 tag, having an amino acid sequence set forth in SEQ ID NO:2.
[0045] In some embodiments, the bacterial capsular saccharide product comprises galactose-sialic acid disaccharide repeating units. In some embodiments, the galactose-sialic acid disaccharide repeating units are (-6Gal.alpha.1-4Neu5Ac.alpha.2). In some embodiments, NmSiaD.sub.W is the bacterial capsular polysaccharide synthase employed for the preparation of products containing the galactose-sialic acid disaccharide repeating units.
[0046] C. Sugar Donors and Acceptors
[0047] Sugar donors used in the methods of the present disclosure typically contain a nucleotide bonded to a monosaccharide. Suitable nucleotides include, but are not limited to, adenine, guanine, cytosine, uracil and thymine nucleotides with one, two or three phosphate groups. The sugar can be any suitable sugar. Monosaccharides include, but are not limited to, glucose (Glc), glucosamine (2-amino-2-deoxy-glucose; GlcNH.sub.2), N-acetylglucosamine (2-acetamido-2-deoxy-glucose; GlcNAc), galactose (Gal), galactosamine (2-amino-2-deoxy-galactose; GalNH.sub.2), N-acetylgalactosamine (2-acetamido-2-deoxy-galactose; GalNAc), mannose (Man), mannosamine (2-amino-2-deoxy-mannose; ManNH.sub.2), N-acetylmannosamine (2-acetamido-2-deoxy-mannose; ManNAc), glucuronic acid (GlcA), iduronic acid (IdoA), galacturonic acid (GalA), and sialic acids. Sialic acid is a general term for N- and O-substituted derivatives of neuraminic acid, and includes, but is not limited to, N-acetyl (Neu5Ac), N-glycolyl (Neu5Gc) derivatives, and 2-keto-3-deoxy-nonulosonic acid (Kdn), as well as O-acetyl, O-lactyl, O-methyl, O-sulfate and O-phosphate derivatives.
[0048] In some embodiments, the reaction mixture comprises a UDP-sugar, a CMP-sugar, or a combination thereof. In some embodiments, the reaction mixture comprises a galactose donor, a sialic acid donor, or a combination thereof. In some embodiments, the galactose donor is UDP-Gal. In some embodiments, the sialic acid donor is CMP-Neu5Ac.
[0049] Galactose donors such as UDP-Gal and sialic acid donors such as CMP-Neu5Ac may be used for forming bacterial capsular saccharide products by glycosylating the sugar acceptor with galactose residues and sialic acid residues in alternating steps as described above. Alternatively, galactose donors and sialic acid donors may be used for forming bacterial capsular saccharide products by glycosylating the sugar acceptor with alternating galactose residues and sialic acid residues in a single polymerization step. In some such embodiments, NmSiaD.sub.w is used for the glycosylation steps.
[0050] Advantageously, the size and size distribution of desired products may be controlled by varying the sugar acceptor (e.g., varying the acceptor size and/or sugar composition) and the stoichiometry of the sugar donors and the sugar acceptors used in the glycosylation steps. Reaction stoichiometry may be adjusted based upon factors including, but not limited to, the desired degree of polymerization in the target product, the desired polydispersity index, or the kinetic parameters of the particular bacterial capsular polysaccharide synthase employed. As described in more detail below, for example, the catalytic efficiency of NmSiaD.sub.w as an .alpha.1-4-galactosyltransferase has been found to depend, in part, on the size of the sugar acceptor whereas the catalytic efficiency of NmSiaD.sub.w as an .alpha.2-6-sialyltransferase has been found to exhibit far less dependence on the size of the sugar acceptor. In addition, a narrower product size distribution can be achieved by using octasaccharide G8, nonasaccharide S9, or decasaccharide G10 as an acceptor substrate in polymerization reactions. Oligosaccharides, as opposed to monosaccharides, may therefore be preferred starting acceptor substrates for polymerization reactions depending on the nature of the target product. In this manner, the ratio [galactose donor:sialic acid donor:sugar acceptor] and the identity of the sugar acceptor in reactions employing capsular polysaccharide synthases such as NmSiaD.sub.q may therefore be adjusted selected to provide products having a desired degree of polymerization and/or a desired polydispersity.
[0051] In some embodiments, the reaction mixture comprises the sugar donor(s) and the sugar acceptor in a ratio ranging from about 1:1 to about 250:1.
[0052] The ratio of the sugar donor(s) to the sugar acceptor may range, for example, from about 1:1 to about 25:1; or from about 25:1 to about 50:1; or from about 50:1 to about 75:1; or from about 75:1 to about 100:1; or from about 100:1 to about 125:1; or from about 125:1 to about 150:1; or from about 150:1 to about 175:1; or from about 175:1 to about 200:1; or from about 200:1 to about 225:1; or from about 225:1 to about 250:1.
[0053] The amount of the sugar donor in such ratios is intended to include the amount of a single sugar donor as well as the total amount of multiple sugar donors. As such, the ratios may be further differentiated as the ratio of a first sugar donor to a second sugar donor and a sugar acceptor, e.g., a ratio ranging from about 25:25:1 to about 25:50:1, or from about 30:45:1 to about 50:50:1. In some embodiments, the ratio can range from 25:25:1 to about 50:25:1, or from about 45:30:1 to about 50:50:1.
[0054] In some embodiments, the reaction mixture comprises UDP-Gal and CMP-Neu5Ac, and the ratio (UDP-Gal+CMP-Neu5Ac):(sugar acceptor) ranges from about 1:1 to about 250:1. In some embodiments, the ratio (UDP-Gal+CMP-Neu5Ac):(sugar acceptor) is about 100:1. In some embodiments, the ratio (UDP-Gal):(CMP-Neu5Ac):(sugar acceptor) is about 50:50:1.
[0055] A number of suitable acceptor sugars may be used in the methods provided herein. In some embodiments, the acceptor sugar contains a sialic acid (e.g., Neu5Ac) or a hexose (e.g., galactose) covalently bonded to a monosaccharide, an oligosaccharide, a polysaccharide, an amino acid, an oligopeptide, a polypeptide, a lipid, or another synthetic handle. In some embodiments, the sugar acceptor is a disaccharide, a trisaccharide, a tetrasaccharide, a pentasaccharide, a hexasaccharide, a heptasaccharide, an octasaccharide, a nonsaccharide, or a decasaccharide. In some embodiments, the sugar acceptor is an octasaccharide, a nonsaccharide, or a decasaccharide. The acceptor sugar may contain a purification handle, e.g., a hydrophobic moiety such as a perfluorinated alkyl group or a fatty acid moiety as described, for example, in WO 2014/201462. Products containing the purification handle may be separated from reaction mixtures via reverse phase chromatography, solid phase extraction, or like techniques. Purification handles may also include chromophores (e.g., aromatic substituents such as benzyloxycarbonyl) to aid in identification and purification of desired products. In some embodiments, the purification handle includes an (N-benzyloxycarbonyl)aminopropyl moiety. In some embodiments, the acceptor sugar has the structure:
##STR00001##
wherein R is a monosaccharide or an oligosaccharide. In some embodiments, R is an .alpha.- or .beta.-linked Neu5Ac residue or an .alpha.- or .beta.-linked galactose residue. In some embodiments R is an oligosaccharide moiety Gal.alpha.1-4Neu5Ac.alpha.2(-6Gal.alpha.1-4Neu5Ac.alpha.2).sub.n, wherein subscript n is 1, 2, 3, or 4. In some embodiments R is an oligosaccharide moiety Neu5Ac.alpha.2(-6Gal.alpha.1-4Neu5Ac.alpha.2).sub.m, wherein subscript m is 1, 2, 3, 4, or 5. In some embodiments, the sugar acceptor comprises a sialic acid residue (e.g., an .alpha.- or .beta.-linked Neu5Ac residue) at its non-reducing end. In some embodiments, the sugar acceptor comprises an .alpha.- or .beta.-linked galactose residue at its non-reducing end.
[0056] Following purification, the benzxyloxycarbonyl moiety may be removed (e.g., by combination with an acid such a formic acid or trifluoroacetic acid) to provide an aminopropyl moiety --(CH.sub.2).sub.3NH.sub.2 at the reducing end of the bacterial capsular polysaccharide product. The aminopropyl moiety, in turn may serve as conjugation handle for covalent coupling to a carrier material, e.g., in a vaccine composition.
[0057] The methods generally include providing reaction mixtures that contain at least one bacterial capsular polysaccharide synthase, a sugar acceptor, and one or more sugar donors. The synthase can be, for example, isolated or otherwise purified prior to addition to the reaction mixture. As used herein, a "purified" enzyme refers to an enzyme which is provided as a purified protein composition wherein the enzyme constitutes at least about 50% of the total protein in the purified protein composition. For example, the enzyme can constitute about 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% of the total protein in the purified protein composition. The amount of enzyme in a purified protein composition can be determined by any number of known methods including, for example, by polyacrylamide gel electrophoresis (e.g., SDS-PAGE) followed by detection with a staining reagent (e.g., Coomassie Brilliant Blue G-250, a silver nitrate stain, and/or a reagent containing a capsular polysaccharide antibody). The bacterial capsular polysaccharide synthases and other enzymes used in the methods can also be secreted by a cell present in the reaction mixture. Alternatively, a bacterial capsular polysaccharide synthase or other enzyme can catalyze the reaction within a cell expressing the enzyme.
[0058] Reaction mixtures can contain additional reagents for use in glycosylation techniques. For example, in certain embodiments, the reaction mixtures can contain buffers (e.g., 2-(N-morpholino)ethanesulfonic acid (MES), 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid (HEPES), 3-morpholinopropane-1-sulfonic acid (MOPS), 2-amino-2-hydroxymethyl-propane-1,3-diol (TRIS), potassium phosphate, sodium phosphate, phosphate-buffered saline, sodium citrate, sodium acetate, and sodium borate), cosolvents (e.g., dimethylsulfoxide, dimethylformamide, ethanol, methanol, tetrahydrofuran, acetone, and acetic acid), salts (e.g., NaCl, KCl, CaCl.sub.2, and salts of Mn.sup.2+ and Mg.sup.2+), detergents/surfactants (e.g., a non-ionic surfactant such as N,N-bis[3-(D-gluconamido)propyl]cholamide, polyoxyethylene (20) cetyl ether, dimethyldecylphosphine oxide, branched octylphenoxy poly(ethyleneoxy)ethanol, a polyoxyethylene-polyoxypropylene block copolymer, t-octylphenoxypolyethoxyethanol, polyoxyethylene (20) sorbitan monooleate, and the like; an anionic surfactant such as sodium cholate, N-lauroylsarcosine, sodium dodecyl sulfate, and the like; a cationic surfactant such as hexdecyltrimethyl ammonium bromide, trimethyl(tetradecyl) ammonium bromide, and the like; or a zwitterionic surfactant such as an amidosulfobetaine, 3-[(3-cholamidopropyl)dimethyl-ammonio]-1-propanesulfonate, and the like), chelators (e.g., ethylene glycol-bis(2-aminoethylether)-N,N,N',N'-tetraacetic acid (EGTA), 2-({2-[Bis(carboxymethyl)amino]ethyl} (carboxymethyl)amino)acetic acid (EDTA), and 1,2-bis(o-aminophenoxy)ethane-N,N,N',N'-tetraacetic acid (BAPTA)), reducing agents (e.g., dithiothreitol (DTT), .beta.-mercaptoethanol (BME), and tris(2-carboxyethyl)phosphine (TCEP)), and labels (e.g., fluorophores, radiolabels, and spin labels). Buffers, cosolvents, salts, detergents/surfactants, chelators, reducing agents, and labels can be used at any suitable concentration, which can be readily determined by one of skill in the art. In general, buffers, cosolvents, salts, detergents/surfactants, chelators, reducing agents, and labels are included in reaction mixtures at concentrations ranging from about 1 .mu.M to about 1 M. For example, a buffer, a cosolvent, a salt, a detergent/surfactant, a chelator, a reducing agent, or a label can be included in a reaction mixture at a concentration of about 1 .mu.M, or about 10 .mu.M, or about 100 .mu.M, or about 1 mM, or about 10 mM, or about 25 mM, or about 50 mM, or about 100 mM, or about 250 mM, or about 500 mM, or about 1 M. In some embodiments, the reaction mixture contains an acceptor sugar, one or more sugar donors, and a bacterial capsular polysaccharide synthase, as well as one or more components selected from a buffer, a cosolvent, a salt, a detergent/surfactant, a chelator, and a reducing agent. In some embodiments, the reaction mixture consists essentially of an acceptor sugar, one or more sugar donors, and a bacterial capsular polysaccharide synthase, as well as one or more components selected from a buffer, a cosolvent, a salt, a detergent/surfactant, a chelator, and a reducing agent.
[0059] Reactions are conducted under conditions sufficient to transfer the sugar of the sugar donor the acceptor sugar. The reactions can be conducted at any suitable temperature. In general, the reactions are conducted at a temperature of from about 4.degree. C. to about 40.degree. C. The reactions can be conducted, for example, at about 25.degree. C. or about 37.degree. C. The reactions can be conducted at any suitable pH. In general, the reactions are conducted at a pH of from about 4.5 to about 10. The reactions can be conducted, for example, at a pH of from about 5 to about 9, or from about 6 to about 9. The reactions can be conducted for any suitable length of time. In general, the reaction mixtures are incubated under suitable conditions for anywhere between about 1 minute and several hours. The reactions can be conducted, for example, for about 1 minute, or about 5 minutes, or about 10 minutes, or about 30 minutes, or about 1 hour, or about 2 hours, or about 4 hours, or about 8 hours, or about 12 hours, or about 24 hours, or about 48 hours, or about 72 hours. Other reaction conditions may be employed in the methods of the invention, depending on the identity of a particular bacterial capsular polysaccharide, sugar donor(s), or acceptor sugar.
[0060] D. One-Pot Multienzyme Reactions
[0061] Sugar donors such as sialic acid donors and galactose donors can be prepared prior to forming the bacterial capsular saccharide product, or the sugar donors can be prepared in situ immediately prior to formation of the bacterial capsular saccharide product. In some embodiments, the reaction mixture containing the bacterial capsular polysaccharide synthases further comprises one or more CMP-sialic acid synthetases, nucleotide sugar pyrophosphorylases, pyrophosphatases, kinases, or combinations thereof. The enzymes may be employed in one-pot reactions for convenient preparation of the desired bacterial capsular saccharide products.
[0062] In some embodiments, the methods include enzymatic preparation of sialic acid donors such as CMP-Neu5Ac. In some embodiments, the methods include forming a reaction mixture including a CMP-sialic acid synthetase, cytidine triphosphate, and N-acetylneuraminic acid (Neu5Ac) or a Neu5Ac analog, under conditions suitable to form CMP-Neu5Ac or a CMP-Neu5Ac analog. Any suitable CMP-sialic acid synthetase (i.e., N-acetylneuraminate cytidylyltransferase, EC 2.7.7.43) can be used in the methods of the invention. For example, CMP-sialic acid synthetases from E. coli, C. thermocellum, S. agalactiae, P. multocida, H. ducreyi, or N. meningitidis can be used. In some embodiments, the CMP-sialic acid synthetase is NmCSS, having an amino acid sequence set forth in SEQ ID NO:3.
[0063] In some embodiments, the sialic acid moiety of the sialic acid donor is prepared separately prior to use in the methods. Alternatively, the sialic acid moiety can be prepared in situ immediately prior to use in the methods. In some embodiments, the methods include forming a reaction mixture including a sialic acid aldolase, pyruvic acid or derivatives thereof, and N-acetylmannosamine or derivatives thereof, under conditions suitable to form Neu5Ac or a Neu5Ac analog. Any suitable sialic acid aldolase (i.e., N-acetylneuraminate pyruvate lyase, EC 4.1.3.3) can be used. For example, sialic acid aldolases from E. coli, L. plantarum, P. multocida, or N. meningitidis can be used.
[0064] In some embodiments, the methods include enzymatic preparation of sialic acid donors such as UDP-Gal. In some embodiments, the methods include forming a reaction mixture including a nucleotide sugar pyrophosphorylase, uridine triphosphate, and optionally a kinase, dehydrogenase, and/or a pyrophosphatase, and maintaining the mixture under conditions suitable to form UDP-Gal. The nucleotide sugar pyrophosphorylase may be, for example, a glucosamine uridyltransferase (GlmU), a Glc-1-P uridylyltransferase (GalU), or a promiscuous UDP-sugar pyrophosphorylase (USP). In some embodiments, GlmU from P. multocida (PmGlmU) may be employed. Suitable GalUs can be obtained, for example, from yeasts such as Saccharomycesfragilis, pigeon livers, mammalian livers such as bovine liver, Gram-positive bacteria such as Bifidobacterium bifidum, and Gram-negative bacteria such as Echerichia coli (EcGalU) (Chen X, Fang J W, Zhang J B, Liu Z Y, Shao J, Kowal P, Andreana P, and Wang P G. J. Am. chem. Soc. 2001, 123, 2081-2082). In some embodiments, the nucleotide-sugar pyrophosporylase is a USP. USPs include, but are not limited to, those obtained from Pisum sativum L. (PsUSP) and Arabidopsis thaliana (AtUSP), as well as enzymes obtained from protozoan parasites (such as Leishmania major and Trypanosoma cruzi) and hyperthermophilic archaea (such as Pyrococcusfuriosus DSM 3638). USPs also include human UDP-GalNAc pyrophosphorylase AGX1, E. coli EcGlmU, and Bifidobacterium longum BLUSP. In some embodiments, the nucleotide sugar pyrophosphorylase is BLUSP, having an amino acid sequence set forth in SEQ ID NO:4.
[0065] The reaction mixture may also contains a kinase or a dehydrogenase. The kinase may be, for example, an N-acetylhexosamine 1-kinase (NahK), a galactokinase (GalK), or a glucuronokinase (GlcAK). In some embodiments, the kinase is an NahK. The NahK can be, for example, Bifidobacterium infantis NahK_ATCC15697 or Bifidobacterium longum NahK_ATCC55813. NahK_ATCC15697 and NahK_ATCC55813 were cloned and characterized by the inventors. In some embodiments, the kinase is a GalK. The GalK can be, for example, Escherichia coli EcGalK (Chen X, Fang J W, Zhang J B, Liu Z Y, Shao J, Kowal P, Andreana P, and Wang P G. J. Am. chem. Soc. 2001, 123, 2081-2082) and Streptococcus pneumoniae TIGR4 SpGalK (Chen M, Chen L L, Zou Y, Xue M, Liang M, Jing L, Guan W Y, Shen J, Wang W, Wang L, Liu J, and Wang P G. Carbohydr. Res. 2011, 346, 2421-2425). In some embodiments, the kinase is SpGalK, having an amino acid sequence set forth in SEQ ID NO:5.
[0066] The reaction mixture formed in the methods of the invention can further include an inorganic pyrophosphatase (PpA). PpAs can catalyze the degradation of the pyrophosphate (PPi) that is formed during the conversion of a sugar-1-phosphate to a UDP-sugar. PPi degradation in this manner can drive the reaction towards the formation of the UDP-sugar products. The pyrophosphatase can be, but is not limited to, Pasteurella multocida PmPpA (Lau K, Thon V, Yu H, Ding L, Chen Y, Muthana M M, Wong D, Huang R, and Chen X. Chem. Commun. 2010, 46, 6066-6068). In some embodiments, the inorganic pyrophosphatase is PmPpA, having an amino acid sequence set forth in SEQ ID NO:6.
[0067] Enzymes employed in the methods of the present disclosure, including bacterial capsular polysaccharide synthases, CMP-sialic acid synthetases, nucleotide sugar pyrophosphorylases, pyrophosphatases, and/or kinases, may include amino acid sequences characterized by varying levels of sequence identity to any of the exemplary enzyme sequences set forth above. The amino acid sequence of a particular enzyme may have, for example, at least about 70%, e.g., at least about 71%, at least about 72%, at least about 73%, at least about 74%, at least about 75%, at least about 76%, at least about 77%, at least about 78%, at least about 79%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to any one of the amino acid sequences set forth in SEQ ID NOS:1-6.
[0068] "Identical" and "identity," in the context of two or more polypeptide sequences, refer to two or more sequences or subsequences that are the same. Sequences are "substantially identical" to each other if they have a specified percentage of nucleotides or amino acid residues that are the same (e.g., at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical over a specified region), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection.
[0069] For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
[0070] Methods of alignment of sequences for comparison are well-known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by manual alignment and visual inspection (see, e.g., Current Protocols in Molecular Biology (Ausubel et al., eds. 1995 supplement)). Additional examples of algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al., (1990) J. Mol. Biol. 215: 403-410 and Altschul et al. (1977) Nucleic Acids Res. 25: 3389-3402, respectively. Software for performing BLAST analyses is publicly available, for example, at the National Center for Biotechnology Information website. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. For amino acid sequences, the BLASTP program uses as defaults a word size (W) of 3, an expectation (E) of 10, and the BLOSUM62 scoring matrix (see, e.g., Henikoff and Henikoff, Proc. Natl. Acad. Sci. USA 89:10915 (1989)).
[0071] In some embodiments, the CMP-sialic acid synthetase, the nucleotide sugar pyrophosphorylase, the pyrophosphatase, and/or the kinase may be purified as described above. Other components (e.g., buffers, cosolvents, salts, detergents/surfactants, chelators, and/or reducing agents, as described above) can be included in the reaction mixture for forming the CMP-Neu5Ac and/or UDP-Gal. In some embodiments, the step of forming the galactose donor, the sialic acid donor, the sialic acid moiety of the sialic acid donor, and/or the step of forming the bacterial capsular saccharide product are performed in one pot. In some embodiments, the pH of the one-pot multienzyme reaction mixture ranges from about 6 to about 9. In some embodiments, the method is conducted in vitro.
II. VACCINE COMPOSITIONS
[0072] Also provided herein are vaccine compositions. The compositions contain one or more bacterial capsular saccharide products, include products prepared according to the method described herein, coupled to a carrier material. A vaccine composition according to the present disclosure can be used, for example, as an N. meningitidis serogroup W vaccine. Examples of carrier materials include, but are not limited to, carrier proteins such as a genetically modified cross-reacting material (CRM197) of diphtheria toxin, tetanus toxoid (TT), meningococcal outer membrane protein complex (OMPC), diphtheria toxoid (DD), and H. influenzae protein D (HiD). See, e.g., Pichichero (Human Vaccines & Immunotherapeutics 2013, 9(12): 2505-2523) and Berti et al. (Chem. Soc. Rev., 2018, 47, 9015-9025), which are incorporated herein by reference in their entirety.
[0073] Bacterial capsular saccharide products can be covalently bonded to proteins and other carrier materials using various chemistries for protein modification. A wide variety of such reagents are known in the art. Examples of such reagents include, but are not limited to, N-hydroxysuccinimidyl (NHS) esters and N-hydroxysulfosuccinimidyl (sulfo-NHS) esters (amine reactive); carbodiimides (amine and carboxyl reactive); hydroxymethyl phosphines (amine reactive); maleimides (thiol reactive); halogenated acetamides such as N-iodoacetamides (thiol reactive); aryl azides (primary amine reactive); fluorinated aryl azides (reactive via carbon-hydrogen (C--H) insertion); pentafluorophenyl (PFP) esters (amine reactive); imidoesters (amine reactive); isocyanates (hydroxyl reactive); vinyl sulfones (thiol, amine, and hydroxyl reactive); pyridyl disulfides (thiol reactive); and benzophenone derivatives (reactive via C--H bond insertion). Crosslinking reagents can react to form covalent bonds with functional groups in the bacterial capsular saccharide product (e.g., an aminopropyl group as described above) and in a protein or other carrier material (e.g., a primary amine, a thiol, a carboxylate, a hydroxyl group, or the like). Crosslinkers useful for attaching bacterial capsular saccharide products to proteins and other carrier materials include homobifunctional crosslinkers, which react with the same functional group in the bacterial capsular saccharide product and the carrier, as well as heterobifunctional crosslinkers, which react with functional groups in the bacterial capsular saccharide product and the carrier that differ from each other.
[0074] Examples of homobifunctional crosslinkers include, but are not limited to, amine-reactive homobifunctional crosslinkers (e.g., dimethyl adipimidate, dimethyl suberimidate, dimethyl pimilimidate, disuccinimidyl glutarate, disuccinimidyl suberate, bis(sulfosuccinimidyl) suberate, bis(diazo-benzidine), ethylene glycobis(succinimidyl-succinate), disuccinimidyl tartrate, disulfosuccinimidyl tartrate, glutaraldehyde, dithiobis(succinimidyl propionate), dithiobis-(sulfosuccinimidyl propionate), dimethyl 3,3'-dithiobispropionimidate, bis 2-(succinimidyl-oxycarbonyloxy)ethyl-sulfone, and the like) as well as thiol-reactive homobifunctional crosslinkers (e.g., bismaleidohexane, 1,4-bis-[3-(2-pyridyldithio)propionamido]butane, and the like). Examples of heterobifunctional crosslinkers include, but are not limited to, amine- and thiol-reactive crosslinkers (e.g., succinimidyl 4-(N-maleimidomethyl)-cyclohexane-1-carboxylate, m-maleimidobenzoyl-N-hydroxysuccinimide ester, succinimidyl-4-(p-maleimidophenyl)butyrate, N-(.gamma.-maleimidobutyryloxy)succinimide ester, N-succinimidyl(4-iodoacetyl) aminobenzoate, 4-succinimidyl oxycarbonyl-.alpha.-(2-pyridyldithio)-toluene, sulfosuccinimidyl-6-.alpha.-methyl-.alpha.-(2-pyridyldithio)-toluamido-he- xanoate, N-succinimidyl-3-(2-pyridyldithio) propionate, N-hydroxysuccinimidyl 2,3-dibromopropionate, and the like). Further reagents include but are not limited to those described in Hermanson, Bioconjugate Techniques 2nd Edition, Academic Press, 2008.
[0075] Vaccine compositions, or compositions thereof, can be administered to a subject by any of the routes normally used for administration of vaccines. Methods of administration include, but are not limited to, intradermal, intramuscular, intraperitoneal, parenteral, intravenous, subcutaneous, vaginal, rectal, intranasal, inhalation or oral. Parenteral administration, such as subcutaneous, intravenous or intramuscular administration, is generally achieved by injection. Injectables can be prepared in conventional forms, either as liquid solutions or suspensions, solid forms suitable for solution or suspension in liquid prior to injection, or as emulsions. Injection solutions and suspensions can be prepared from sterile powders, granules, and tablets of the kind previously described. Administration can be systemic or local. Appropriate pharmaceutically acceptable carriers can be selected based on facts including, but not limited to, the particular composition being administered, as well as by the particular method used to administer the composition.
[0076] Preparations for parenteral administration include sterile aqueous or non-aqueous solutions, suspensions, and emulsions. Examples of non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate. Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media. Parenteral vehicles include sodium chloride solution, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's, or fixed oils. Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers (such as those based on Ringer's dextrose), and the like. Preservatives and other additives may also be present such as, for example, antimicrobials, anti-oxidants, chelating agents, and inert gases and the like.
[0077] In some embodiments, the vaccine composition is sufficiently immunogenic as a vaccine for effective immunization without administration of an adjuvant. In some embodiments, immunogenicity of a composition is enhanced by including an adjuvant. Any adjuvant may be used in conjunction with the vaccine composition. A large number of adjuvants are known; see, e.g., Allison, 1998, Dev. Biol. Stand., 92:3-11, Unkeless et al., 1998, Annu. Rev. Immunol., 6:251-281, and Phillips et al., 1992, Vaccine, 10:151-158. Exemplary adjuvants include, but are not limited to, cytokines, gel-type adjuvants (e.g., aluminum hydroxide, aluminum phosphate, calcium phosphate, etc.), microbial adjuvants (e.g., immunomodulatory DNA sequences that include CpG motifs; endotoxins such as monophosphoryl lipid A; exotoxins such as cholera toxin, E. coli heat labile toxin, and pertussis toxin; muramyl dipeptide, etc.), oil-emulsion and emulsifier-based adjuvants (e.g., Freund's Adjuvant, MF59 [Novartis], SAF, etc.), particulate adjuvants (e.g., liposomes, biodegradable microspheres, saponins, etc.), synthetic adjuvants (e.g., nonionic block copolymers, muramyl peptide analogues, polyphosphazene, synthetic polynucleotides, etc.) and/or combinations thereof.
III. EXAMPLES
[0078] Chemicals were purchased and used as received without further purification. NMR spectra were recorded in the NMR facility of the University of California using a VNMRS-600 NMR spectrometer (600 MHz for .sup.1H, 150 MHz for .sup.13C) or a 800 MHz Bruker Avance III spectrometer. Chemical shifts are reported in parts per million (ppm) on the 6 scale. High resolution (HR) electrospray ionization (ESI) mass spectra were obtained using a Thermo Electron LTQ-Orbitrap Hybrid MS at the Mass Spectrometry Facility in the University of California, Davis. UPLC detections were assayed using Agilent 1290 Infinity LC with an EclipsePlus C18 (Rapid Resolution HD, 1.8 .mu.m, 2.1.times.50 mm, 959757-902) or an AdvanceBio Glycan Map column (1.8 .mu.m, 2.1.times.150 mm, 859700-913) column from Agilent Technologies. Reverse phase chromatography was performed with C18 column (ODS-SM, 50 mm, 120 .ANG., 3.0.times.20 cm) from Yamazen Corporation on a CombiFlash Rf 200i system. Galactose was from Fisher Scientific. N-Acetylneuraminic acid (Neu5Ac) was from Inalco (Italy). Adenosine 5'-triphosphate (ATP), cytosine 5'-triphosphate (CTP) and uridine 5'-triphosphate (UTP) were purchased from Hangzhou Meiya Pharmaceutical Co. Ltd. UTP was also purchased from Chemfun Medical Technology Co. ATP was also purchased from Beta Pharm Inc.
[0079] Recombinant enzymes Neisseria meningitidis CMP-sialic acid synthetase (NmCSS), Pasteurella multocida inorganic pyrophosphatase (PmPpA), Streptococcus pneumoniae TIGR4 galactokinase (SpGalK), Bifidobacterium longum UDP-sugar pyrophosphorylase (BLUSP) were expressed and purified as described previously. See: Yu, H. et al. Bioorg. Med. Chem. 2004, 12, 6427-6435; Lau, K. et al. Chem. Commun. 2010, 46, 6066-6068; Chen, M. et al. Carbohydr. Res. 2011, 346, 2421-2425; and Muthana, M. et al. Chem. Commun. 2012, 48, 2728-2730. Neu5Ac.alpha.ProNHCbz was prepared as described previously.
Example 1. Cloning and Expression of NmSiaD.sub.W
[0080] A. Overexpression and Purification
[0081] The NmSiaD.sub.W gene (GenBank accession number Y13970) with sequence optimized for expression in E. coli was custom synthesized by GeneArt and cloned in pMA-RQ (ampR) vector. To subclone NmSiaD.sub.W as an C-His.sub.6-tagged fusion protein in pET22b(+) vector, two primers were designed for polymerase chain reaction (PCR) and the sequences were: forward primer:
TABLE-US-00001 5'-AGCTCATATGGCCGTTATTATTTTTGTG AATGGTATTCGTGCCG-3' (SEQ ID NO: 7, NdeI restriction site is italicized); and reverse primer: 5'-AGCTAAGCTTTTACTTCTCTTGGCCGAA AAACTGGTTTTCAATATCTGC-3' (SEQ ID NO: 8, HindIII restriction site is italicized).
[0082] PCR was performed in a 50-.mu.L reaction mixture containing plasmid DNA (50 ng), forward and reverse primers (0.5 .mu.M each), 5.times.reaction buffer (10 .mu.L), dNTP mixture (0.2 mM), and 1 U of Phusion High-Fidelity DNA Polymerase (New England Biolabs). The reaction mixture was subjected to 30 cycles of amplification with an annealing temperature of 72.degree. C. The resulting PCR product was purified and digested with NdeI and HindIII restriction enzymes. The purified and digested PCR product was ligated with a predigested pET22b(+) vector and transformed into E. coli DH5a cells. Selected clones were grown for minipreps and the purified plasmids were analyzed by DNA sequencing performed by Genewiz.
[0083] A plasmid with confirmed sequence was transformed into Escherichia coli BL21 (DE3). To express the recombinant NmSiaD.sub.W, bacteria were cultivated in 1 L of LB rich medium in the presence of 100 .mu.g/mL ampicillin. The expression was achieved by induction with 0.1 mM of isopropyl .beta.-D-1-thiogalactopyranoside (IPTG) when OD.sub.600 nm of the culture reached 0.6 followed by incubation at 16.degree. C. for 72 h. Cells were harvested (6000.times.g, 15 min, 16.degree. C.), re-suspended in lysis buffer (50 mM Tris-HCl, pH 8.0, 300 mM NaCl, 0.1% Triton X-100), and the mixture was subjected to sonication (amplitude 60%, 3 s on and 15 s off, 6 min). The supernatant was obtained by centrifugation (4300.times.g, 30 min, 4.degree. C.), loaded onto a Ni.sup.2+-NTA affinity column at 4.degree. C. that was pre-equilibrated with 6 column volumes of binding buffer containing Tris-HCl buffer (50 mM, pH 8.0), NaCl (300 mM), and imidazole (5 mM). It was washed with 10 column volumes of binding buffer and 10 column volumes of 10% and 20% elute buffer, respectively, and eluted with elute buffer containing Tris-HCl (50 mM, pH 8.0), NaCl (300 mM), imidazole (150 mM). The purified protein fractions were combined and concentrated. The resulting sample was dialyzed using dialysis buffer (Tris-HCl, 20 mM, pH 8.0 containing 10% glycerol) and stored at 4.degree. C.
[0084] B. Sodium Dodecylsulfate-Polyacrylamide Gel Electrophoresis (SDS-PAGE) Analysis.
[0085] Gels were prepared with 12% acrylamide in the presence of 0.1% SDS. Cells and protein samples were incubated in the loading buffer (50 mM Tris-HCl, pH 6.8, 0.1% bromophenol blue, 10% glycerol, 100 mM DTT) for 10 min at 95.degree. C. Denatured samples were loaded to the gel and the gel was developed at 150 V for 1 h. The gel was then stained with coomassie blue dye (1 g/L) in a solution of acetic acid:methanol:water (=1:4:5 by volume) and de-stained using the same solution without the dye.
[0086] C. Results
[0087] NmSiaD.sub.W has been cloned and expressed in Escherichia coli previously. In our attempts, initial cloning into pET15b vectors led to a low expression of soluble and active enzymes in Escherichia coli BL21 (DE3) cells. In order to improve the protein expression, NmSiaD.sub.W was recombined to pET22b (+) vectors and expressed as a C-terminal His-tagged protein. Soluble and active enzymes could be obtained by inducing Escherichia coli BL21 (DE3) cells with 0.1 mM of isopropyl .beta.-D-1-thiogalactopyranoside (IPTG) followed by incubation at 16.degree. C. for 72 hours. Purification was achieved by one-step nickel-nitrilotriacetic acid (Ni.sup.2+-NTA) affinity chromatography. About 150 mg of NmSiaD.sub.W could be obtained from 1 liter LB Broth cell culture. Sodium dodecylsulfate-polyacrylamide gel electrophoresis (SDS-PAGE) analysis indicated that the apparent molecular weights of purified NmSiaD.sub.W(FIG. 1) were about 120 kDa, which were consistent with their calculated molecular weights of 121.5 kDa. In our practice, NmSiaD.sub.W barely dissolved in the lysis buffer without detergent, but solubility greatly increased with 0.1% Triton X-100 in the lysis buffer, indicating the association of the enzyme with membranes.
Example 2. Preparative-Scale One-Pot Multienzyme Synthesis
[0088] A. General Procedure for Preparative Synthesis of Sialosides Using NmSiaD.sub.W
[0089] Reactions were performed in the presence of 5 mM acceptor (monosaccharide to decasaccharide), 50 mM UDP-Gal, 50 mM CMP-Neu5Ac, 100 mM Tris-HCl, pH 8.0, 10 mM MgCl.sub.2 and 50 .mu.g NmSiaD.sub.W with a total volume of 50 .mu.L. Reactions were performed in duplicate at 30.degree. C. After 1 h, 20 .mu.L reaction mixture was quenched by addition of 20 .mu.L pre-chilled ethanol and incubated at -20.degree. C. for 30 min before detection. After 20 h, another 20 .mu.L reaction mixture was quenched by addition of 20 .mu.L pre-chilled ethanol and incubated at -20.degree. C. for 30 min before detection. Products were detected using UPLC with AdvanceBio Glycan Map column, Agilent. Sample was eluted with a gradient from 90% to 50% acetonitrile in 25 minutes.
[0090] B. General Procedure for One-Pot Two-Enzyme Preparative Synthesis of Sialoside
[0091] Galactoside acceptor (1.0 equiv, 10 mM), CTP (1.3 equiv) and Neu5Ac (1.3 equiv) were dissolved in water containing 100 mM Tris-HCl, pH 8.5 and 20 mM MgCl.sub.2. After addition of appropriate amounts NmCSS (0.5-4 mg), NmSiaD.sub.W (0.5-4 mg), water was added to bring the final volume of reaction mixture to 15-64 mL. The reaction was carried out by incubating the solution in an incubator for 20 h at 30.degree. C. with agitation at 100 rpm. Product formation was monitored by UPLC (EclipsePlusC18 column or AdvanceBio Glycan Map column, Agilent). The reaction was quenched by adding the same volume of pre-chilled methanol and incubation at -20.degree. C. for 30 min. The supernatant was concentrated and purified by a C18 column. Water with 0.1% TFA (v/v) and acetonitrile were used as solvents with a gradient. The fraction that containing the product were collected, neutralized, concentrated and further purified by a C18 column. Water and acetonitrile were used as solvents with a gradient. Products were purified as sodium salts.
[0092] C. General Procedures for One-Pot Four-Enzyme Preparative Synthesis of Galactoside
[0093] Sialoside acceptor (1.0 equiv, 10 mM), UTP (1.3 equiv), ATP (1.3 equiv) and galactose (1.3 equiv) were dissolved in water containing 100 mM Tris-HCl, pH 8.5 and 20 mM MgCl.sub.2. After addition of appropriate amounts of SpGalK (1.0-8.5 mg), BLUSP (1.0-8.5 mg), PmPpA (1.0-8.0 mg), NmSiaD.sub.W (0.5-8.5 mg), water was added to bring the final volume of reaction mixture to 10-80 mL. The reaction was carried out by incubating the solution in an incubator for 20 h at 30.degree. C. with agitation at 100 rpm. Product formation was monitored by UPLC (EclipsePlusC18 column or AdvanceBio Glycan Map column, Agilent). The reaction was quenched by adding the same volume of pre-chilled methanol and incubation at -20.degree. C. for 30 min. The supernatant was concentrated and purified by a C18 column. Water with 0.1% TFA (v/v) and acetonitrile were used as solvents with a gradient. The fraction that containing the product were collected, neutralized, concentrated and further purified by a C18 column. Water and acetonitrile were used as solvents with a gradient. Products were purified as sodium salts.
[0094] D. pH Profile
[0095] Assays were carried out in duplicate at 30.degree. C. for 20 min in a total volume of 10 .mu.L in a buffer (200 mM) with a pH value in the range of 3.0-11.0 containing a donor substrate (1.2 mM) (UDP-Gal for GalT and CMP-Neu5Ac for SiaT assays), an acceptor substrate (1 mM) (S1 for GalT and G2 for SiaT assays), MgCl.sub.2 (10 mM), and NmSiaD.sub.W (19.8 .mu.g for GalT and 0.17 .mu.g for SiaT assays). Reactions were quenched by adding 10 .mu.L of pre-chilled ethanol followed by incubation at -20.degree. C. for 30 min. The precipitates were removed by centrifugation (11000.times.g, 5 min, 4.degree. C.). Reaction mixtures were assayed using an Agilent 1290 Infinity II LC System with a PDA detector (monitored at 215 nm) and an Eclipse Plus C18 column (Rapid Resolution HD, 1.8 .mu.m, 2.1.times.50 mm, 959757-902) at 30.degree. C. An elution solvent of 11% acetonitrile and 89% H.sub.2O containing 0.1% TFA was used for S1 and 10% acetonitrile and 90% H.sub.2O containing 0.1% TFA was used for G2. Buffers used were: Citric acid, pH 3.0-4.5; MES, pH 5.0-6.5; Tris-HCl, pH 7.0-9.0; CAPS, pH 10.0-11.0.
[0096] E. Metal Effects Screening
[0097] Assays were carried out in duplicate at 30.degree. C. for 20 min in a total volume of 10 .mu.L in a buffer (MES, 100 mM, pH 6.5 for GalT and Tris-HCl, 100 mM, pH 8.0 for SiaT assays) containing a donor substrate (1.2 mM) (UDP-Gal for GalT and CMP-Neu5Ac for SiaT assays), an acceptor substrate (1 mM) (S1 for GalT and G2 for SiaT assays), NmSiaD.sub.W (19.8 .mu.g for GalT and 0.17 .mu.g for SiaT assays), and the presence of EDTA, DTT, Mg.sup.2+, Ca.sup.2+, Li.sup.+, Na.sup.+, Co.sup.2+, Cu.sup.2+, Mn.sup.2+, or Ni.sup.2+ (10 mM). Reactions were quenched by adding 10 .mu.L of pre-chilled ethanol followed by incubation at -20.degree. C. for 30 min. Reaction mixtures were assayed as described above for pH profile studies.
[0098] F. Temperature Profile
[0099] Assays were carried out in duplicate at different temperatures for 20 min in a total volume of 10 .mu.L in a buffer (MES, 100 mM, pH 6.5 for GalT and Tris-HCl, 100 mM, pH 8.0 for SiaT assays) containing a donor substrate (1.2 mM) (UDP-Gal for GalT and CMP-Neu5Ac for SiaT assays), an acceptor substrate (1 mM) (S1 for GalT and G2 for SiaT assays), MgCl.sub.2 (10 mM), and NmSiaD.sub.W (19.8 .mu.g for GalT and 0.17 .mu.g for SiaT assays). Reactions were quenched by adding 10 .mu.L of pre-chilled ethanol to the reaction mixture followed by incubation at -20.degree. C. for 30 min. Products were assayed as described above for pH profile studies.
[0100] G. Thermostability
[0101] Enzyme was pre-heated at a given temperature for 30 min, then put on ice for 10 min. Reactions were performed at 30.degree. C. and activity assays were then carried out as described above for the temperature profile assays.
[0102] H. Results
[0103] To facilitate the enzyme characterization and product purification, a chromophore-tagged substrate was designed. 2-O--(N-Benzyloxycarbonyl)aminopropyl .alpha.-N-acetylneuraminide (Neu5Ac.alpha.ProNHCbz, S1 for sialyl monosaccharide) was chemically synthesized from Neu5Ac (FIG. 2) in a process similar to that reported previously. See, Sardzik 2011. Briefly, methylation of the carboxyl group in the commercially available Neu5Ac (1) followed by peracetylation produced per-O-acetylated Neu5Ac methyl ester (3) in 86% yield. Treatment of 3 with acetyl chloride in dichloromethane and anhydrous methanol formed per-O-acetylated Neu5Ac chloride (4), which was reacted with benzyl N-(3-hydroxypropyl) carbamate in the presence of AgOTf to produce protected Neu5Ac glycoside (5) in an excellent 91% yield. De-O-acetylation using NaOMe in MeOH and hydrolysis of methyl ester using sodium hydroxide produced the desired product Neu5Ac.alpha.ProNHCbz (S1, 3.79 g) in 84% yield.
[0104] To elongate Neu5Ac.alpha.ProNHCbz (S1) for the synthesis of galactosyl disaccharide Gal.alpha.1-4Neu5Ac.alpha.ProNHCbz (G2), an OPME .alpha.1-4-galactosylation system containing Streptococcus pneumoniae TIGR4 galactokinase (SpGalK) [Chen, M. 2011], Bifidobacterium longum UDP-sugar pyrophosphorylase (BLUSP) [Muthana, 2012], Pasteurella multocida inorganic pyrophosphatase (PmPpA) [Lau, 2010], and NmSiaD.sub.W was applied. In this system, SpGalK was used to phosphorylate the anomeric position of galactose. BLUSP catalyzed the formation of the activated sugar nucleotide donor UDP-Gal from galactose-1-phosphate and uridine 5'-triphosphate (UTP). PmPpA catalyzed the hydrolysis of inorganic pyrophosphate to drive the reaction forward. Finally, NmSiaD.sub.W catalyzed the transfer of galactose to the sialoside (FIG. 3).
[0105] To sialylate the obtained disaccharide G2 to form sialyl trisaccharide Neu5Ac.alpha.2-6Gal.alpha.1-4Neu5Ac.alpha.ProNHCbz (S3), an OPME .alpha.2-6-sialylation system containing Neisseria meningitidis CMP-sialic acid synthetase (NmCSS) [Yu 2004] and NmSiaD.sub.W was used. In this system, NmCSS catalyzed the formation of the activated sugar nucleotide donor CMP-Neu5Ac from CTP and Neu5Ac for NmSiaD.sub.W-catalyzed sialylation reaction (Scheme 2).
[0106] Using S1 as the acceptor substrate, the .alpha.1-4-galactosyltransferase activity of NmSiaD.sub.W was shown to be active in a broad pH range of 5.0-9.5 and optimal activities were observed at pH 6.5 and pH 9.0. In comparison, using galactosyldisaccharide G2 (see below and FIG. 3) as the acceptor substrate, the .alpha.2-6-sialyltransferase activity of NmSiaD.sub.W was shown to be active in a pH range of 6.0-9.5 with an optimum at pH 8.0 (FIG. 4A).
[0107] The addition of a metal ion such as Mn.sup.2+, Mg.sup.2+, Co.sup.2+, Na.sup.+, Ca.sup.2+, Li.sup.+, Ni.sup.2+ was not required and did not significantly affect either glycosyltransferase activities of NmSiaD.sub.W although the addition of Cu.sup.2+ completely abolished both activities (FIG. 4B).
[0108] The .alpha.1-4-galactosyltransferase domain of NmSiaD.sub.W seemed to be more stable than its a2-6-sialyltransferase domain. The activity of the former retained after being incubated for 30 minutes at a temperature up to 33.degree. C., while the activity of the latter decreased significantly after incubation for 30 minutes at a temperature higher than 30.degree. C. (FIG. 5A). Both glycosyltransferase activities were lost when NmSiaD.sub.W was incubated at 44.degree. C. for 30 minutes. The optimal temperature for the .alpha.1-4-galactosyltransferase activity was in a broad range of 20-33.degree. C., while the optimal sialyltransferase activity had a narrower range of 30-37.degree. C. (FIG. 5B). To retain the activity of other working enzymes, pH 8.0 and 20 mM MgCl.sub.2 were determined for reactions using the one-pot multi-enzyme (OPME) system.
[0109] The OPME .alpha.1-4-galactosylation and .alpha.2-6-sialylation systems can be repeated in sequence using the newly obtained elongated oligosaccharides as acceptor substrates to obtain longer chain oligosaccharide products. Knowing the optimal conditions of both glycosyltransferase activities of NmSiaD.sub.W, NmW CPS oligosaccharides ranging from galactosyldisaccharide G2 to galactosyldecasaccharide G10 were synthesized from sialylmonosaccharide Neu5Ac.alpha.ProNHCbz (S1) using a sequential one-pot multienzyme (OPME) process.
[0110] As shown in FIG. 3, an OPME .alpha.1-4-galactosylation system (OPME1) containing Streptococcus pneumoniae TIGR4 galactokinase (SpGalK), Bifidobacterium longum UDP-sugar pyrophosphorylase (BLUSP), Pasteurella multocida inorganic pyrophosphatase (PmPpA), and NmSiaD.sub.W was used to add an .alpha.1-4-linked galactose residue to a sialoside acceptor such as S1. In this system, SpGalK was responsible for the formation of galactose-1-phosphate (Gal-1-P) which was used by BLUSP to form activated sugar nucleotide uridine-5'-diphosphate galactose (UDP-Gal), the donor substrate of the .alpha.1-4-galactosyltransferase activity of NmSiaD.sub.W for the synthesis of galactosides such as G2. PmPpA was included to hydrolyze the inorganic pyrophosphate (PPi) formed in the BLUSP-catalyzed reaction to drive the reaction towards the formation of UDP-Gal.
[0111] All OPME reactions were carried out at 30.degree. C. for 20 h in preparative-scale (200-450 mg), except monosaccharide reaction which took 7 days in total. The products were obtained in excellent yields after purification with a C18 reverse phase column twice. For the first round, the product was eluted by water containing 0.1% TFA and acetonitrile with a gradient. Protonated product was easily separated from polar reactants. Then the fractions containing products were collected and neutralized by NaOH to avoid oligosaccharides exposed to acidic conditions for a long time. Then the crude product was concentrated and purified by C18 column again. The product was eluted by water and acetonitrile with a gradient to remove salts from neutralization. Finally, the product was purified as a sodium salt. The structures and the purities of the products were confirmed by .sup.1H and .sup.13C nuclear magnetic resonance (NMR) and high resolution mass spectrometry (HRMS). From S1, galactosyldisaccharide G2 (1.26 g) was synthesized and purified with an excellent 92% yield.
[0112] Subsequently, an OPME .alpha.2-6-sialylation system (OPME2) containing Neisseria meningitidis CMP-sialic acid synthetase (NmCSS) and NmSiaD.sub.W was used to sialylate the galactoside formed. In this system, NmCSS catalyzed the formation of cytidine-5'-monophosphate Neu5Ac (CMP-Neu5Ac), the activated sugar nucleotide donor for the .alpha.2-6-sialyltransferase activity of NmSiaD.sub.W for the synthesis of .alpha.2-6-linked sialosides such as S3 (FIG. 3). From G2, sialyltrisaccharide S3 (620 mg) was synthesized and purified with an excellent 96% yield.
[0113] Repeating the OPME .alpha.1-4-galactosylation and OPME .alpha.2-6-sialylation reactions sequentially with product purification after each OPME reaction to provide the acceptor substrate for the next OPME reaction led to the efficient synthesis of a series of NmW CPS oligosaccharides in 83-96% yields including G4 (556 mg, 91%), S5 (512 mg, 83%), G6 (440 mg, 88%), S7 (418 mg, 90%), G8 (380 mg, 96%), S9 (301 mg, 84%), and G10 (221 mg, 83%).
[0114] These reactions were carried out in 0.25-1.00 g scales in Tris-HCl buffer (100 mM, pH 8.0) containing MgCl.sub.2 (20 mM) with the consideration of acceptable and optimal reaction conditions of NmSiaD.sub.W and other enzymes involved in the sequential OPME reactions. Except for the synthesis of galactosyldisaccharide G2 from sialylmonosaccharide S1 which required a long reaction time (98 h), all other OPME reactions were carried out at 30.degree. C. for 20 h. Assisted by the Cbz-tag, product purification was conveniently achieved by passing the reaction mixture through a C18 reverse phase column twice. The first column purification used a gradient solution of 0.1% trifluoroacetic acid (TFA) in H.sub.2O and acetonitrile as an eluent to separate the protonated product from other components in the reaction mixture. The fractions containing the product were neutralized by NaOH immediately to minimize acid-catalyzed hydrolysis. The second C18 column purification used a gradient solution of water and acetonitrile to obtain the desired pure product whose structure and purity were confirmed by nuclear magnetic resonance (NMR), high resolution mass spectrometry (HRMS), and ultra-high performance liquid chromatography (UHPLC) analyses.
[0115] Heteronuclear Single Quantum Coherence-Total Correlation Spectroscopy (HSQC-TOCSY) studies for S1-G10 with 90 ms and 10 ms mixing times clearly show independent coupling networks of terminal and internal Neu5Ac or Gal residues. For example, for S3 which contains two Neu5Ac residues, the chemical shifts of the internal Neu5Ac are more downfield for H3.sub.eq, H4, H5 H6 (0.05-0.20 ppm difference), and C4 (4.28 ppm difference) but more upfield for H3.sub.ax (0.09 ppm difference), C3 (3.32 ppm difference), and C5 (2.27 ppm difference) than those of the terminal Neu5Ac with no significant differences for C6 (data not shown). In comparison, for G4 which contains two Gal residues, the chemical shifts of the protons on the Gal backbones (less than 0.05 ppm difference) and C1 (0.65 ppm difference) are slightly more upfield for the internal residue (data not shown).
Example 3. Synthesis and Characterization of Oligosaccharides
[0116] A. Chemical Synthesis of Acceptor Substrate Neu5Ac.alpha.ProNHCbz (S1)
[0117] Synthesis of Neu5Ac methyl ester (3). N-Acetylneuraminic acid (15.0 g, 0.49 mol) was suspended in dry methanol (200 mL) and Dowex 50WX4 (H.sup.+) resin (10 g) was added. The mixture was stirred at room temperature for overnight. The reaction was monitored by MS and TLC (EtOAc:MeOH:H.sub.2O=4:2:1, by volume). Upon completion, the resin was removed by filtration, and the filtrate was concentrated in vacuo and dried under vacuum to yield 2 as a white solid. The obtained solid was dissolved in anhydrous pyridine (200 mL), followed by the addition of acetic anhydride (70 mL) and 4-dimethylaminopyridine (DMAP, 400 mg). The reaction was stirred at room temperature for overnight and the reaction was monitored by TLC (Hexane:EtOAc=1:3 by volume). The reaction mixture was diluted with 500 mL of ethyl acetate and extracted with water for three times. The organic layer was dried with anhydrous magnesium sulfate, filtered, and concentrated in vacuo. The product was purified by silica gel column (hexane:EtOAc=1:2 to 1:4, by volume) to obtain 22.2 g of the peracetylated product (3) with a yield of 86% for two steps.
[0118] Synthesis of Neu5Ac.alpha.ProNHCbz (S1). Peracetylated Neu5Ac methyl ester (3, 6.0 g, 11.3 mmol) was dissolved in anhydrous dichloromethane (20 mL) in a round bottom flask (200 mL) and the reaction was placed in an ice-water bath. Acetyl chloride (80 mL) was added followed by the addition of anhydrous methanol (2 mL) under Argon and the reaction mixture was stirred for 20 minutes. The reaction flask was then sealed and the mixture was stirred at room temperature for 2 days. The reaction progress was monitored by TLC analysis (hexane:EtOAc=1:4, by volume). Upon completion, the reaction mixture was concentrated, co-evaporated with toluene for three times, and dried under vacuum. Without further purification of the crude product, molecular sieves 4 .ANG. (6.0 g), anhydrous dichloromethane (50 mL), and benzyl N-(3-hydroxypropyl) carbamate (4.78 g, 22.8 mmol) were added under argon. The mixture was placed in an ice-water bath and silver triflate (2.90 g, 11.3 mmol) was added. The reaction flask was covered with an aluminum foil and the mixture was stirred at room temperature for overnight. The reaction progress was monitored by TLC analysis (hexane:EtOAc=1:4, by volume). Upon completion, the reaction mixture was filtered over Celite and washed with DCM. The filtrate was concentrated for purification by silica gel column chromatography (hexane:EtOAc=1:1 to 1:4, by volume). Fractions were collected, concentrated, and dried under vacuum. (Note, when silver carbonate was used as a promoter instead of silver triflate, the glycosylation yield was much lower and glycal was formed as a major byproduct.)
[0119] The glycosylation product (5) was dissolved in anhydrous methanol (100 mL). Sodium methoxide was added until the pH was around 9.0, and the reaction mixture was stirred for overnight at r.t. The reaction was monitored by TLC analysis with two different developing solvent systems (EtOAc:hexane=4:1, by volume, to monitor consumption of starting material; and EtOAc:MeOH:H.sub.2O=8:2:0.5, by volume, to monitor the formation of the deacetlyated product). Upon completion, the reaction mixture was neutralized by adding Dowex 50WX4 (H.sup.+) resin. The resin was then removed by filtration and the filtrate was concentrated in vacuo and dried under vacuum. The product was dissolved in 100 mL of a solvent mixture (water:methanol=4:1, by volume). The pH of the reaction mixture was adjusted to 9.0 using 2.0 M of NaOH and the mixture was stirred for overnight at r.t. The reaction was monitored by TLC analysis (EtOAc:MeOH:H.sub.2O:AcOH=7:2:1:0.2, by volume). Up completion, the reaction mixture was neutralized by adding Dowex 50WX4 (H.sup.+) resin. The resin was then removed by filtration, and the filtrate was concentrated in vacuo. The crude product was purified by a silica gel column (EtOAc:MeOH:H.sub.2O=8:2:1, by volume) to produce S1 (3.79 g, 67% for four steps).
[0120] .sup.1H NMR (800 MHz, D.sub.2O) .delta. 7.46-7.37 (m, 5H, Ar--H), 5.08 (s, 2H, O--CH.sub.2--Ar), 3.87-3.75 (m, 4H, H-8, H-9, H-5, O--CH.sub.2--CH.sub.2), 3.70-3.64 (m, 2H, H-4, H-9), 3.61 (dd, J=11.9, 6.0 Hz, 1H, H-9), 3.59 (dt, J=9.1, 1.4 Hz, 1H, H-7), 3.50-3.45 (m, 1H, O--CH.sub.2--CH.sub.2), 3.23-3.11 (m, 2H, CH.sub.2--NH), 2.72 (dd, J=12.5, 4.6 Hz, 1H, H-3eq), 2.03 (d, J=1.2 Hz, 3H, CH.sub.3--CO), 1.73 (p, J=6.5 Hz, 2H, O--CH.sub.2--CH.sub.2--CH.sub.2--NH), 1.65 (t, J=12.2 Hz, 1H, H-3). .sup.13C NMR (200 MHz, D.sub.2O) .delta. 175.06 (COOH), 173.66 (CH.sub.3--CO), 158.33 (NH--COO), 136.52 (O--CH.sub.2--Ar), 128.76 (Ar), 128.29 (Ar), 127.60 (Ar), 100.55 (C-2), 72.55 (C-6), 71.70 (C-8), 68.25 (C-4), 68.14 (C-7), 66.76 (O--CH.sub.2--Ar), 62.50 (C-9), 62.07 (O--CH.sub.2--CH.sub.2), 51.90 (C-5), 40.35 (C-3), 37.52 (CH.sub.2--NH), 28.92 (O--CH.sub.2--CH.sub.2--CH.sub.2--NH), 22.01 (CH.sub.3--CO). HRMS (ESI) m/z calculated for C.sub.22H.sub.31N.sub.2O.sub.11.sup.- (M-H) 499.1928, found 499.1914.
[0121] B. One-Pot Four-Enzyme Preparative-Scale Synthesis of Acceptor Substrate Disaccharide Gal.alpha.1-4Neu5Ac.alpha.ProNHCbz (G2).
[0122] A reaction mixture in Tris-HCl buffer (100 mM, pH 8.5) in a total volume of 200 mL containing Neu5Ac.alpha.ProNHCbz (S1) (1.00 g, 2.0 mmol), galactose (0.72 g, 4.0 mmol), ATP disodium salt (2.42 g, 4.4 mmol), UTP trisodium salt (2.42 g, 4.4 mmol), MgCl.sub.2 (20 mM), SpGalK (22 mg), BLUSP (22 mg), PmPpA (22 mg), and NmSiaD.sub.W (22 mg) was incubated in a 250-mL bottle in a shaker (100 rpm) at 30.degree. C. for 98 hrs. The reaction progress was monitored by UHPLC (AdvanceBio Glycan Map, Agilent, 87% Acetonitrile+0.1% TFA in water, monitored at 215 nm). When an optimal yield was achieved, pre-chilled ethanol (200 mL) was added and the resulting mixture was incubated at 4.degree. C. for 30 min. The precipitates were removed by centrifugation (4300.times.g, 30 min, 4.degree. C.). The supernatant was concentrated and purified by a C18 column in a CombiFlash Rf 200i system with a gradient of water with 0.1% TFA (v/v) and acetonitrile (0-100% acetonitrile) for elution. Fractions containing the product were collected, neutralized, concentrated, and further purified by a C18 column to produce disaccharide Gal.alpha.1-4Neu5Ac.alpha.ProNHCbz (G2) as a sodium salt (1.26 g, 92%).
[0123] .sup.1H NMR (800 MHz, D.sub.2O) .delta. 7.46-7.37 (m, 5H, Ar--H), 5.09 (s, 2H, O--CH.sub.2--Ar), 5.08 (d, J=4.0 Hz, 1H, H''-1), 4.04 (t, J=10.3 Hz, 1H, H'-5), 3.96 (d, J=3.3 Hz, 1H, H''-3), 3.86 (td, J=6.3, 3.1 Hz, 1H, H'-8), 3.84-3.77 (m, 5H, H'-5, H'-9, H''-2, H''-5, O--CH.sub.2--CH.sub.2), 3.75-3.68 (m, 4H, H'-4, H''-4, H''-6), 3.64-3.59 (m, 2H, H'-7, H'-9), 3.52-3.47 (m, 1H, O--CH.sub.2--CH.sub.2), 3.23-3.14 (m, 2H, CH.sub.2--NH), 2.88 (dd, J=12.5, 4.7 Hz, 1H, H'-3.sub.eq), 2.03 (d, J=1.6 Hz, 3H, CH.sub.3--CO), 1.74 (p, J=6.6 Hz, 2H, O--CH.sub.2--CH.sub.2--CH.sub.2--NH), 1.62 (t, J=12.0 Hz, 1H, H'-3ax).
[0124] .sup.13C NMR (200 MHz, D.sub.2O) .delta. 174.32 (COOH), 173.49 (CH.sub.3--CO), 158.34 (NH--COO), 136.53 (O--CH.sub.2--Ar), 128.76 (Ar), 128.28 (Ar), 127.58 (Ar), 100.60 (C'-2), 94.72 (C''-1), 72.82 (C'-4), 72.19 (C'-6), 71.77 (C'-8), 71.02 (C''-5), 69.36 (C''-4), 69.05 (C''-3), 68.04 (C'-7), 67.88 (C''-2), 66.76 (O--CH.sub.2--Ar), 62.48 (C'-9), 62.07 (O--CH.sub.2--CH.sub.2), 60.73 (C''-6), 49.53 (C'-5), 37.47 (CH.sub.2--NH), 36.73 (C'-3), 28.91 (O--CH.sub.2--CH.sub.2--CH.sub.2--NH), 22.11 (CH.sub.3--CO). HRMS (ESI) m/z calculated for C.sub.28H.sub.41N.sub.2O.sub.16.sup.- (M-H) 661.2456, found 661.2458.
[0125] One-pot two-enzyme preparative-scale synthesis of trisaccharide Neu5Ac.alpha.2-6Gal.alpha.1-4Neu5Ac.alpha.ProNHCbz (S3). A reaction mixture in Tris-HCl buffer (100 mM, pH 8.5) in a total volume of 64 mL containing galactosyldisaccharide G2 (426 mg, 0.64 mmol), Neu5Ac (260 mg, 0.83 mmol), CTP disodium salt (445 mg, 0.83 mmol), MgCl.sub.2 (20 mM), NmCSS (4 mg), and NmSiaD.sub.W (4 mg) was incubated in a 250-mL bottle in a shaker (100 rpm) at 30.degree. C. for 15 hrs. The reaction progress was monitored by UHPLC (AdvanceBio Glycan Map, Agilent, 87% Acetonitrile+0.1% TFA in water, monitored at 215 nm). When an optimal yield was achieved, pre-chilled ethanol (64 mL) was added and the resulting mixture was incubated at 4.degree. C. for 30 min. Procedures for centrifugation, concentration, purification, collection and neutralization were similar to that described above for G2 to produce sialyltrisaccharide S3 as a sodium salt (620 mg, 96%).
[0126] .sup.1H NMR (800 MHz, D.sub.2O) .delta. 7.49-7.35 (m, 5H, Ar--H), 5.11 (s, 2H, O--CH.sub.2--Ar), 5.06 (d, J=3.9 Hz, 1H, H''-1), 4.03 (t, J=10.3 Hz, 1H, H'-5), 3.96 (d, J=3.4 Hz, 1H, H''-3), 3.90-3.74 (m, 10H), 3.73-3.59 (m, 8H), 3.56 (dd, J=9.0, 1.7 Hz, 1H), 3.50 (dt, J=10.6, 6.1 Hz, 1H, O--CH.sub.2--CH.sub.2), 3.24-3.15 (m, 2H, CH.sub.2--NH), 2.88 (dd, J=12.5, 4.7 Hz, 1H, H'-3.sub.eq), 2.73 (dd, J=12.4, 4.7 Hz, 1H, H'''-3.sub.eq), 2.07 (s, 3H, H'--CH.sub.3--CO), 2.03 (s, 3H, H'''--CH.sub.3--CO), 1.74 (p, J=6.8 Hz, 2H, O--CH.sub.2--CH.sub.2--CH.sub.2--NH), 1.70 (t, J=12.2 Hz, 1H, H'''-3.sub.ax), 1.61 (t, J=12.0 Hz, 1H, H'-3ax).
[0127] .sup.13C NMR (200 MHz, D.sub.2O) .delta. 174.97, 174.49, 173.48, 173.32, 158.37 (NH--COO), 136.56 (O--CH.sub.2--Ar), 128.75 (Ar), 128.27 (Ar), 127.56 (Ar), 100.59 (C'-2), 100.11 (C'''-2), 94.54 (C''-1), 72.69 (C'-4), 72.46 (C'''-6), 72.09, 71.83, 69.52, 69.19, 68.89 (C''-3), 68.37 (C'''-4), 68.27, 68.03, 67.84 (C''-2), 66.76 (O--CH.sub.2--Ar), 62.62, 62.60, 62.52 (C''-6), 62.06 (O--CH.sub.2--CH.sub.2), 51.79 (C'''-5), 49.52 (C'-5), 40.06 (C'''-3), 37.47 (CH.sub.2--NH), 36.64 (C'-3), 28.89 (O--CH.sub.2--CH.sub.2--CH.sub.2--NH), 22.42 (H'--CH.sub.3--CO), 22.00 (H'''--CH.sub.3--CO). HRMS (ESI) m/z calculated for C.sub.39H.sub.58N.sub.3O.sub.24.sup.- (M-H) 952.3410, found 952.3390.
[0128] One-pot four-enzyme preparative-scale synthesis of galactosyltetrasaccharide Gal.alpha.1-4Neu5Ac.alpha.2-6Gal.alpha.1-4Neu5Ac.alpha.ProNHCbz (G4). A reaction mixture in Tris-HCl buffer (100 mM, pH 8.5) in a total volume of 53 mL containing sialyltrisaccharide S3 (528 mg, 0.53 mmol), galactose (124 mg, 0.67 mmol), ATP disodium salt (380 mg, 0.67 mmol), UTP trisodium salt (379 mg, 0.67 mmol), MgCl.sub.2 (20 mM), SpGalK (4.8 mg), BLUSP (4.8 mg), PmPpA (4.8 mg) and NmSiaD.sub.W (2.4 mg) was incubated in a 125-mL bottle in a shaker (100 rpm) at 30.degree. C. for 16 hrs. The reaction progress was monitored by UHPLC (AdvanceBio Glycan Map, Agilent, 80% Acetonitrile+0.1% TFA in water, monitored at 215 nm). When an optimal yield was achieved, pre-chilled ethanol (53 mL) was added and the resulting mixture was incubated at 4.degree. C. for 30 min. Procedures for centrifugation, concentration, purification, collection and neutralization were similar to that described above for G2 to produce galactosyltetrasaccharide G4 as a sodium salt (556 mg, 91%).
[0129] .sup.1H NMR (800 MHz, D.sub.2O) .delta. 7.49-7.37 (m, 5H, Ar--H), 5.10 (s, 2H, O--CH.sub.2--Ar), 5.08 (d, J=4.0 Hz, 1H, H''''-1), 5.06 (d, J=3.9 Hz, 1H, H''-1), 4.04 (td, J=10.3, 5.9 Hz, 2H, H'-5, H'''-5), 3.96 (dd, J=10.1, 3.4 Hz, 2H, H''-3, H''''-3), 3.90-3.59 (m, 23H), 3.50 (dt, J=10.9, 6.2 Hz, 1H, O--CH.sub.2--CH.sub.2), 3.23-3.15 (m, 2H, CH.sub.2--NH), 2.88 (td, J=12.1, 4.6 Hz, 2H, H'-3eq, H'''-3.sub.eq), 2.08 (s, 3H, H'--CH.sub.3--CO), 2.03 (s, 3H, H'''--CH.sub.3--CO), 1.75 (h, J=7.4, 6.9 Hz, 2H, O--CH.sub.2--CH.sub.2--CH.sub.2--NH), 1.66 (t, J=12.1 Hz, 1H, H'''-3.sub.ax), 1.61 (t, J=12.0 Hz, 1H, H'-3.sub.ax).
[0130] .sup.13C NMR (200 MHz, D.sub.2O) .delta. 174.49, 174.30, 173.34, 173.18, 158.36 (NH--COO), 136.57 (O--CH.sub.2--Ar), 128.76 (Ar), 128.27 (Ar), 127.56 (Ar), 100.62 (C'-2), 100.23 (C'''-2), 95.05 (C''''-1), 94.40 (C''-1), 73.23, 72.49, 72.19, 72.09, 71.91, 71.79, 71.02, 69.56, 69.23, 69.21, 69.04 (C''''-3), 68.94 (C''-3), 68.17, 67.96, 67.86, 67.80, 66.76 (O--CH.sub.2--Ar), 62.86, 62.60, 62.46, 62.06 (O--CH.sub.2--CH.sub.2), 60.72 (C''''-4), 49.54 (C'-5), 49.46 (C'''-5), 37.48 (CH.sub.2--NH), 36.77 (C'''-3), 36.57 (C'-3), 28.90 (O--CH.sub.2--CH.sub.2--CH.sub.2--NH), 22.43 (H'--CH.sub.3--CO), 22.11 (H'''--CH.sub.3--CO). HRMS (ESI) m/z calculated for C.sub.45H.sub.68N.sub.3O.sub.29 (M-H) 1114.3939, found 1114.3918.
[0131] One-pot two-enzyme preparative-scale synthesis of sialylpentasaccharide Neu5Ac.alpha.2(-6Gal.alpha.1-4Neu5Ac(.times.2).sub.2-ProNHCbz (S5). A reaction mixture in Tris-HCl buffer (100 mM, pH 8.5) in a total volume of 43 mL containing galactosyltetrasaccharide G4 (502 mg, 0.43 mmol), Neu5Ac (175 mg, 0.56 mmol), CTP disodium salt (300 mg, 0.56 mmol), MgCl.sub.2 (20 mM), NmCSS (1.0 mg) and NmSiaD.sub.W (2.0 mg) was incubated in a 125-mL bottle in a shaker (100 rpm) at 30.degree. C. for 17 hrs. The reaction progress was monitored by UHPLC (AdvanceBio Glycan Map, Agilent, 75% Acetonitrile+0.1% TFA in water, monitored at 215 nm). When an optimal yield was achieved, pre-chilled ethanol (43 mL) was added and the resulting mixture was incubated at 4.degree. C. for 30 min. Procedures for centrifugation, concentration, purification, collection and neutralization were similar to that described above for G2 to produce sialylpentasaccharide S5 as a sodium salt (512 mg, 83%).
[0132] .sup.1H NMR (800 MHz, D.sub.2O) .delta. 7.46-7.37 (m, 5H, Ar--H), 5.10 (s, 2H, O--CH.sub.2--Ar), 5.06 (d, J=3.7 Hz, 2H, H.sup.II,IV-1), 4.03 (td, J=10.2, 5.7 Hz, 2H, H.sup.I,III-5), 3.96 (d, J=3.4 Hz, 2H, H.sup.II,IV-3), 3.92-3.59 (m, 29H), 3.58-3.54 (m, 1H), 3.50 (dt, J=11.6, 6.2 Hz, 1H, O--CH.sub.2--CH.sub.2), 3.24-3.17 (m, 2H, CH.sub.2--NH), 2.88 (dt, J=12.5, 4.4 Hz, 2H, H.sup.I,III-3eq), 2.72 (dd, J=12.4, 4.7 Hz, 1H, H.sup.V-3eq), 2.08 (s, 6H, H.sup.I,III--CH.sub.3--CO), 2.03 (s, 3H, H.sup.V--CH.sub.3--CO), 1.74 (p, J=6.8 Hz, 2H, O--CH.sub.2--CH.sub.2--CH.sub.2--NH), 1.70 (t, J=12.2 Hz, 1H, H.sup.V-3ax), 1.63 (dt, J=30.6, 12.0 Hz, 2H, H.sup.I,III-3.sub.ax).
[0133] .sup.13C NMR (200 MHz, D.sub.2O) .delta. 174.98, 174.51, 174.48, 173.49, 173.39, 173.06, 158.37, 136.56, 128.77, 128.28, 127.57, 100.58, 100.22, 100.14, 94.88, 94.61, 73.11, 72.76, 72.45, 72.11, 72.08, 72.04, 72.01, 71.84, 71.82, 69.59, 69.56, 69.19, 69.08, 68.91, 68.90, 68.38, 68.29, 68.18, 67.98, 67.85, 67.78, 66.76, 62.76, 62.66, 62.64, 62.63, 62.50, 62.46, 62.06, 51.80, 49.56, 49.47, 40.04, 37.48, 36.67, 28.91, 22.48, 22.02. HRMS (ESI) m/z calculated for C.sub.56H.sub.85N.sub.4O.sub.37.sup.- (M-H) 1405.4893, found 1405.4896.
[0134] One-pot four-enzyme preparative-scale synthesis of galactosylhexasaccharide Gal.alpha.1(-4Neu5Ac.alpha.2-6Gal.alpha.1).sub.2-4Neu5Ac.alpha.ProNHCbz (G6). A reaction mixture in Tris-HCl buffer (100 mM, pH 8.5) in a total volume of 31 mL containing sialylpentasaccharide S5 (450 mg, 0.31 mmol), galactose (73 mg, 0.40 mmol), ATP disodium salt (222 mg, 0.40 mmol), UTP trisodium salt (220 mg, 0.40 mmol), MgCl.sub.2 (20 mM), SpGalK (2.4 mg), BLUSP (2.4 mg), PmPpA (2.4 mg), and NmSiaD.sub.W (1.2 mg) was incubated in a bottle (125 mL) in a shaker (100 rpm) at 30.degree. C. for 16 hrs. The product formation was monitored by UHPLC (AdvanceBio Glycan Map, Agilent, 75% Acetonitrile+0.1% TFA in water, monitored at 215 nm). When an optimal yield was achieved, pre-chilled ethanol (31 mL) was added and the resulting mixture was incubated at 4.degree. C. for 30 min. Procedures for centrifugation, concentration, purification, collection and neutralization were similar to that described above for G2 to produce galactosylhexasaccharide G6 as a sodium salt (440 mg, 88%).
[0135] .sup.1H NMR (800 MHz, D.sub.2O) .delta. 7.53-7.29 (m, 5H, Ar--H), 5.11 (s, 2H, O--CH.sub.2--Ar), 5.08 (d, J=4.0 Hz, 1H, H.sup.VI-1), 5.05 (d, J=3.9 Hz, 2H, H.sup.II,IV-1), 4.03 (ddt, J=10.3, 6.6, 3.3 Hz, 3H, H.sup.I,III,V-5), 3.98-3.94 (m, 3H, H.sup.II,IV,VI-3), 3.91-3.57 (m, 34H), 3.50 (dt, J=11.1, 6.3 Hz, 1H, O--CH.sub.2--CH.sub.2), 3.24-3.16 (m, 2H, CH.sub.2--NH), 2.87 (ddd, J=12.4, 7.8, 4.8 Hz, 3H, H.sup.I,III,V-3eq), 2.08 (s, 6H, H.sup.I,III--CH.sub.3--CO), 2.02 (s, 3H, H.sup.V--CH.sub.3--CO), 1.74 (p, J=6.9 Hz, 2H, O--CH.sub.2--CH.sub.2--CH.sub.2--NH), 1.69-1.58 (m, 3H, H.sup.I,III,V-3.sub.ax).
[0136] .sup.13C NMR (200 MHz, D.sub.2O) .delta. 174.52, 174.47, 174.29, 173.38, 173.20, 173.08, 158.37, 136.57, 128.76, 128.27, 127.56, 100.57, 100.22, 95.04, 94.79, 94.64, 73.23, 72.99, 72.79, 72.16, 72.10, 72.07, 71.94, 71.88, 71.82, 71.01, 69.59, 69.23, 69.18, 69.09, 69.05, 68.97, 68.89, 68.19, 68.11, 67.98, 67.84, 67.81, 67.78, 66.76, 62.90, 62.77, 62.60, 62.58, 62.51, 62.06, 60.71, 49.55, 49.47, 49.46, 37.48, 36.74, 36.69, 36.63, 28.90, 22.47, 22.11. HRMS (ESI) m/z calculated for C.sub.62H.sub.95N.sub.4O.sub.42 (M-H) 1567.5421, found 1567.5397.
[0137] One-pot two-enzyme preparative-scale synthesis of sialylheptasaccharide Neu5Ac.alpha.2(-6Gal.alpha.1-4Neu5Ac.alpha.2).sub.3-ProNHCbz (S7). A reaction mixture in Tris-HCl buffer (100 mM, pH 8.5) in a total volume of 25 mL containing galactosylhexasaccharide G6 (390 mg, 0.25 mmol), Neu5Ac (102 mg, 0.33 mmol), CTP disodium salt (175 mg, 0.33 mmol), MgCl.sub.2 (20 mM), NmCSS (0.8 mg), and NmSiaD.sub.W (1.6 mg) was incubated in a 50-mL centrifuge tube in a shaker (100 rpm) at 30.degree. C. for 16 hrs. The product formation was monitored by UHPLC (AdvanceBio Glycan Map, Agilent, 72% Acetonitrile+0.1% TFA in water, monitored at 215 nm). When an optimal yield was achieved, pre-chilled ethanol (25 mL) was added and the resulting mixture was incubated at 4.degree. C. for 30 min. Procedures for centrifugation, concentration, purification, collection and neutralization were similar to that described above for G2 to produce sialylheptasaccharide S7 as a sodium salt (418 mg, 90%).
[0138] .sup.1H NMR (800 MHz, D.sub.2O) .delta. 7.49-7.36 (m, 5H, Ar--H), 5.11 (s, 2H, O--CH.sub.2--Ar), 5.05 (q, J=3.7 Hz, 3H, H.sup.II,IV,VI-1), 4.03 (td, J=10.3, 3.6 Hz, 3H, H.sub.I,III,V-5), 3.96 (d, J=3.4 Hz, 3H, H.sup.II,IV,VI-3), 3.91-3.60 (m, 39H), 3.56 (dd, J=11.9, 3.2 Hz, 2H), 3.50 (dt, J=10.7, 6.2 Hz, 1H, O--CH.sub.2--CH.sub.2), 3.23-3.16 (m, 2H, CH.sub.2--NH), 2.87 (dt, J=12.7, 5.6 Hz, 3H, H.sup.I,III,V-3eq), 2.72 (dd, J=12.4, 4.7 Hz, 1H, H.sup.VII-3eq), 2.08 (s, 9H, H.sup.I,III,V--CH.sub.3--CO), 2.03 (s, 3H, H.sup.VII--CH.sub.3--CO), 1.74 (p, J=7.0 Hz, 2H, O--CH.sub.2--CH.sub.2--CH.sub.2--NH), 1.70 (t, J=12.2 Hz, 1H, H.sup.VII-3.sub.ax), 1.63 (dt, J=33.5, 12.0 Hz, 3H, H.sup.I,III,V-3.sub.ax).
[0139] .sup.13C NMR (200 MHz, D.sub.2O) .delta. 174.96, 174.52, 174.49, 174.46, 173.48, 173.09, 173.05, 158.37, 136.57, 128.76, 128.27, 127.56, 100.57, 100.23, 100.21, 100.13, 95.07, 94.88, 94.67, 73.33, 73.11, 72.81, 72.44, 72.11, 72.08, 72.05, 71.96, 71.95, 71.82, 69.62, 69.59, 69.55, 69.17, 69.09, 69.03, 68.91, 68.39, 68.28, 68.19, 68.12, 67.97, 67.84, 67.80, 67.76, 66.76, 62.80, 62.65, 62.63, 62.61, 62.51, 62.06, 51.80, 49.56, 49.48, 40.04, 37.47, 36.77, 36.71, 36.64, 28.89, 22.51, 22.47, 22.00. HRMS (ESI) m/z calculated for C.sub.73H.sub.112N.sub.5O.sub.50.sup.- (M-H) 1858.6375, found 1858.6323.
[0140] One-pot four-enzyme preparative-scale synthesis of galactosyloctasaccharide Gal.alpha.1(-4Neu5Ac.alpha.2-6Gal.alpha.1).sub.3-4Neu5Ac.alpha.ProNHCbz (G8). A reaction mixture in Tris-HCl buffer (100 mM, pH 8.5) in a total volume of 19 mL containing sialylheptasaccharide S7 (370 mg, 0.19 mmol), galactose (47 mg, 0.25 mmol), ATP disodium salt (143 mg, 0.25 mmol), UTP trisodium salt (143 mg, 0.25 mmol), MgCl.sub.2 (20 mM), SpGalK (1.8 mg), BLUSP (1.8 mg), PmPpA (1.8 mg), and NmSiaD.sub.W (0.9 mg) was incubated in a 50-mL centrifuge tube in a shaker (100 rpm) at 30.degree. C. for 16 hrs. The product formation was monitored by UHPLC (AdvanceBio Glycan Map, Agilent, 72% Acetonitrile+0.1% TFA in water, monitored at 215 nm). When an optimal yield was achieved, pre-chilled ethanol (19 mL) was added and the resulting mixture was incubated at 4.degree. C. for 30 min. Procedures for centrifugation, concentration, purification, collection and neutralization were similar to that described above for G2 to produce galactosyloctasaccharide G8 as a sodium salt (380 mg, 95%).
[0141] .sup.1H NMR (800 MHz, D.sub.2O) .delta. 7.46-7.37 (m, 5H, Ar--H), 5.11 (s, 2H, O--Ar), 5.07 (d, J=4.0 Hz, 1H, H.sup.VIII-1), 5.05 (dd, J=6.8, 4.0 Hz, 3H, H.sup.II,IV,VI-1), 4.06-4.00 (m, 4H, H.sup.I,III,V,VII-5), 3.96 (t, J=3.9 Hz, 4H, H.sup.II,IV,VI,VIII-3), 3.90-3.58 (m, 45H), 3.49 (dd, J=10.6, 5.7 Hz, 1H, O--CH.sub.2--CH.sub.2), 3.23-3.17 (m, 2H, CH.sub.2--NH), 2.90-2.84 (m, 4H, H.sup.I,III,V,VII-3eq), 2.08 (s, 9H, H.sup.I,III,V--CH.sub.3--CO), 2.02 (s, 3H, H.sup.VII--CH.sub.3--CO), 1.74 (p, J=6.8 Hz, 2H, O--CH.sub.2--CH.sub.2--CH.sub.2--NH), 1.68-1.58 (m, 4H, H.sup.I,III,V,VII-3.sub.ax).
[0142] .sup.13C NMR (200 MHz, D.sub.2O) .delta. 174.52, 174.50, 174.46, 174.29, 173.20, 173.08, 158.37, 136.57, 128.76, 128.27, 127.56, 100.57, 100.23, 100.21, 95.08, 95.05, 94.77, 94.68, 73.33, 73.24, 72.97, 72.81, 72.16, 72.11, 72.08, 72.05, 71.95, 71.91, 71.88, 71.82, 71.01, 69.62, 69.59, 69.23, 69.17, 69.11, 69.05, 69.03, 68.97, 68.90, 68.19, 68.13, 67.97, 67.84, 67.81, 67.76, 66.75, 62.89, 62.80, 62.61, 62.59, 62.51, 62.06, 60.71, 49.56, 49.48, 49.46, 37.47, 36.78, 36.74, 36.72, 36.71, 36.59, 28.89, 22.51, 22.47, 22.11. HRMS (ESI) m/z calculated for C.sub.79H.sub.121N.sub.5O.sub.55.sup.2- (M/2-H) 1009.8413, found 1009.8401.
[0143] One-pot two-enzyme preparative-scale synthesis of sialylnonasaccharide Neu5Ac.alpha.2(-6Gal.alpha.1-4Neu5Ac.alpha.2).sub.4-ProNHCbz (S9). A reaction mixture in Tris-HCl buffer (100 mM, pH 8.5) in a total volume of 15 mL containing galactosyloctasaccharide G8 (310 mg, 0.15 mmol), Neu5Ac (61 mg, 0.20 mmol), CTP disodium salt (105 mg, 0.20 mmol), MgCl.sub.2 (20 mM), NmCSS (0.5 mg) and NmSiaD.sub.W (1.0 mg) was incubated in a 50-mL centrifuge tube in a shaker (100 rpm) at 30.degree. C. for 16 hrs. The product formation was monitored by UHPLC (AdvanceBio Glycan Map, Agilent, 71% Acetonitrile+0.1% TFA in water, monitored at 215 nm). When an optimal yield was achieved, pre-chilled ethanol (15 mL) was added and the resulting mixture was incubated at 4.degree. C. for 30 min. Procedures for centrifugation, concentration, purification, collection and neutralization were similar to that described above for G2 to produce sialylnonasaccharide S9 as a sodium salt (301 mg, 84%).
[0144] .sup.1H NMR (800 MHz, D.sub.2O) .delta. 7.46-7.38 (m, 5H, Ar--H), 5.11 (s, 2H, O--CH.sub.2--Ar), 5.05 (q, J=3.9 Hz, 4H, H.sup.II,IV,VI,VIII-1), 4.03 (td, J=10.3, 4.2 Hz, 4H, H.sup.I,III,V,VII-5), 3.96 (d, J=3.5 Hz, 4H, H.sup.II,IV,VI,VIII-3), 3.92-3.75 (m, 28H), 3.73-3.59 (m, 23H), 3.56 (dd, J=8.8, 1.8 Hz, 1H), 3.50 (dt, J=11.1, 6.4 Hz, 1H, O--CH.sub.2--CH.sub.2), 3.23-3.14 (m, 2H, CH.sub.2--NH), 2.90-2.84 (m, 4H, H.sup.I,III,V,VII-3eq), 2.72 (dd, J=12.5, 4.6 Hz, 1H, H.sup.IX-3eq), 2.08 (s, 12H, H.sup.I,III,V,VII--CH.sub.3--CO), 2.03 (s, 3H, H.sup.IX--CH.sub.3--CO), 1.74 (p, J=6.9 Hz, 2H, O--CH.sub.2--CH.sub.2--CH.sub.2--NH), 1.65 (ddt, J=36.8, 33.3, 12.1 Hz, 5H, H.sup.I,III,VI,IX-3ax).
[0145] .sup.13C NMR (200 MHz, D.sub.2O) .delta. 174.96, 174.53, 174.51, 174.48, 174.46, 173.48, 173.09, 173.06, 158.37, 136.57, 128.76, 128.27, 127.56, 100.57, 100.23, 100.21, 100.13, 95.09, 95.04, 94.87, 94.68, 73.34, 73.30, 73.10, 72.81, 72.45, 72.11, 72.11, 72.06, 71.97, 71.95, 71.92, 71.82, 69.62, 69.62, 69.59, 69.55, 69.17, 69.09, 69.05, 69.03, 68.91, 68.39, 68.29, 68.19, 68.14, 68.12, 67.97, 67.84, 67.79, 67.78, 67.76, 66.76, 62.84, 62.79, 62.61, 62.51, 62.06, 51.80, 49.56, 49.48, 40.04, 37.47, 36.78, 36.71, 36.64, 28.89, 23.23, 22.51, 22.47, 22.01. HRMS (ESI) m/z calculated for C.sub.90H.sub.138N.sub.6O.sub.63.sup.2- (M/2-H) 1155.3890, found 1155.3855.
[0146] One-pot four-enzyme preparative-scale synthesis of galactosyldecasaccharide Gal.alpha.1(-4Neu5Ac.alpha.2-6Gal.alpha.1).sub.4-4Neu5Ac.alpha.ProNHCbz (G10). A reaction mixture in Tris-HCl buffer (100 mM, pH 8.5) in a total volume of 10 mL containing sialylnonasaccharide S9 (250 mg, 0.10 mmol), galactose (25 mg, 0.13 mmol), ATP disodium salt (75 mg, 0.13 mmol), UTP trisodium salt (250 mg, 0.13 mmol), MgCl.sub.2 (20 mM), SpGalK (1.0 mg), BLUSP (1.0 mg), PmPpA (1.0 mg), and NmSiaD.sub.W (0.5 mg) was incubated in a 50-mL centrifuge tube in a shaker (100 rpm) at 30.degree. C. for 16 hrs. The product formation was monitored by UHPLC (AdvanceBio Glycan Map, Agilent, 70% acetonitrile+0.1% TFA in water, monitored at 215 nm). When an optimal yield was achieved, pre-chilled ethanol (10 mL) was added and the resulting mixture was incubated at 4.degree. C. for 30 min. Procedures for centrifugation, concentration, purification, collection and neutralization were similar to that described above for G2 to produce galactosyldecasaccharide G10 as a sodium salt (221 mg, 83%).
[0147] .sup.1H NMR (800 MHz, D.sub.2O) .delta. 7.54-7.35 (m, 5H, Ar--H), 5.11-5.04 (m, 7H, O--CH.sub.2--Ar, H.sup.II,IV,VII,VIII,X-1), 4.05 (t, J=10.1 Hz, 5H, H.sup.I,III,V,VII,IX-5), 3.95 (dd, J=6.2, 3.4 Hz, 5H, H.sup.II,IV,VI,VIII,X-3), 3.91-3.58 (m, 56H), 3.55-3.50 (m, 1H, O--CH.sub.2--CH.sub.2), 3.24-3.13 (m, 2H, CH.sub.2--NH), 2.95-2.78 (m, 5H, H.sup.I,III,V,VII,IX-3eq), 2.06 (s, 12H, H.sup.I,III,V,VII--CH.sub.3--CO), 2.02 (s, 3H, H.sup.IX--CH.sub.3--CO), 1.77-1.71 (m, 2H, O--CH.sub.2--CH.sub.2--CH.sub.2--NH), 1.71-1.60 (m, 5H, H.sup.I,III,V,VII,IX-3.sub.ax).
[0148] .sup.13C NMR (200 MHz, D.sub.2O) .delta. 174.46, 174.35, 171.70, 171.24, 171.16, 171.13, 158.34, 136.54, 128.75, 128.29, 127.57, 99.17, 94.73, 94.41, 94.36, 94.28, 72.37, 72.24, 71.88, 71.75, 71.70, 71.17, 71.05, 71.00, 70.98, 70.93, 69.54, 69.52, 69.31, 69.24, 69.22, 69.02, 68.13, 68.11, 68.04, 67.87, 67.79, 67.77, 67.76, 66.76, 63.21, 62.88, 62.84, 62.81, 62.06, 60.72, 49.34, 49.28, 37.36, 35.99, 35.54, 28.77, 22.33, 22.32, 22.11. HRMS (ESI) m/z calculated for C.sub.96H.sub.148N.sub.6O.sub.68.sup.2- (M/2-H) 1236.4153, found 1236.4109.
Example 4. Study of NmSiaD.sub.W Donor Specificity
[0149] A. Experimental Procedure
[0150] Galactosyltransferase activity was assayed in reaction buffer (100 mM MES, pH 6.5, 10 mM MgCl.sub.2) in the presence of 2 mM UDP-sugars and 1 mM Neu5Ac.alpha.2-6Gal.alpha.1-4Neu5Ac.alpha.ProNHCbz in a total volume of 10 .mu.L. Reaction was performed at 30.degree. C. with 0.11 .mu.g NmSiaD.sub.W for 10 min or 6.6 .mu.g NmSiaD.sub.W for 10 h. Reaction was quenched by addition of 10 .mu.L pre-chilled ethanol and incubated at -20.degree. C. for 30 min. UDP-sugar used were UDP-Gal, UDP-Glc, UDP-GalNAc, UDP-GlcNAc, UDP-Mannose, UDP-ManNAc, UDP-GalA and UDP-GlcA. GDP-Fuc and CMP-Neu5Ac were also included.
[0151] Sialyltransferase activity was assayed with one-pot multi-enzyme reactions. One-pot three-enzyme reactions were carried out in reaction buffer (100 mM Tris-HCl, pH 8.5) in the presence of 1.2 mM sialic acid precursors, 5 mM sodium pyruvate, 1.2 mM CTP and 1 mM Gal.alpha.1-4Neu5Ac.alpha.2-6Gal.alpha.1-4Neu5Ac.alpha.ProNHCbz. 5.0 .mu.g PmAldolase and 4.8 .mu.g NmCSS were included in a total volume of 10 .mu.L. Reaction was performed at 30.degree. C. with 0.13 .mu.g NmSiaD.sub.W for 10 min or 7.8 .mu.g NmSiaD.sub.W for 10 h. Reaction was quenched by addition of 10 .mu.L pre-chilled ethanol and incubated at -20.degree. C. for 30 min. Sialic acid precursors used were mannose, ManNAc6N.sub.3, ManNAc4N.sub.3, ManNAc6OMe, ManNAz, ManNAc6NAc and ManNAc6F.
[0152] One-pot two-enzyme reactions were carried out in reaction buffer (100 mM Tris-HCl, pH 8.5) in the presence of 1.2 mM sialic acid or its derivatives, 1.2 mM CTP and 1 mM Gal.alpha.1-4Neu5Ac.alpha.2-6Gal.alpha.1-4Neu5Ac.alpha.ProNHCbz. 4.8 .mu.g NmCSS was included in a total volume of 10 .mu.L. Reaction was performed at 30.degree. C. with 0.13 .mu.g NmSiaD.sub.W for 10 min or 7.8 .mu.g NmSiaD.sub.W for 10 h. Reaction was quenched by addition of 10 .mu.L pre-chilled ethanol and incubated at -20.degree. C. for 30 min. Sialic acids and their derivatives used were Neu5Ac, Neu5Gc, Neu5GcOMe, Neu5Ac8OMe, Neu5,9Ac2 and Neu5,9Ac.sub.2.
[0153] Samples were analyzed using UPLC with EcilpsePlusC18 column or AdvancBio Glycan Map column, Agilent. The samples were further analyzed by electrospray ionization (ESI)-HRMS using a Thermo Electron LTQ-Orbitrap Hybrid MS in a negative mode.
[0154] B. Results
[0155] Using sialyltrisaccharide S3 as the acceptor substrate, eight UDP-sugars as well as GDP-fucose and CMP-Neu5Ac were tested as potential donor substrates for the .alpha.1-4-galactosyltransferase activity of NmSiaD.sub.W. As shown in Table 1, compared to UDP-Gal which is the native donor substrate, UDP-Glc is a weaker donor substrate. Quite interestingly, UDP-GalNAc was shown to be tolerated as poor donor substrate as well. Other sugar nucleotides tested were not tolerated.
TABLE-US-00002 TABLE 1 Donor substrate specificity for the .alpha.l-4-galactosyltransferase activity of NmSiaD.sub.W using different sugar nucleotides. Percentage conversion (%) 11 .mu.g/mL 0.66 mg/mL NmSiaD.sub.W, NmSiaD.sub.W, Substrates 10 min 10 h 1 UDP-Gal 19.6 .+-. 0.4 100 2 UDP-Glc 0 11.6 .+-. 1.5 3 UDP-GalNAc 0 1.9 .+-. 0.2 4 UDP-GlcNAc 0 0 5 UDP-GalA 0 <1 6 UDP-GlcA 0 0 7 UDP-Mannose 0 0 8 UDP-ManNAc 0 0 9 GDP-Fucose 0 0 10 CMP-Neu5Ac 0 0 Abbreviations: UDP, uridine 5'-diphosphate; Gal, galactose; Glc, glucose, GalNAc, N-acetylgalactosamine; GlcNAc, N-acetylglucosamine; GalA, galacturonic acid; GlcA, glucuronic acid; ManNAc, N-acetylmannosamine; Neu5Ac, N-acetylneuraminic acid.
[0156] Using galactosyltetrasaccharide G4 as the acceptor substrate, the donor substrate specificity study for the .alpha.2-6-sialyltransferase activity of NmSiaD.sub.W was investigated using a two-step reaction. In the step 1, a CMP-sialic acid or its analog was generated in situ from a sialic acid, its analog, or its precursors in the presence of Neisseria meningitidis CMP-sialic acid synthetase (NmCSS) with or without Pasteurella multocida sialic acid aldolase (PmAldolase) and sodium pyruvate. In the step 2, galactosyltetrasaccharide G4 and NmSiaD.sub.W were added. As shown in Table 2, the .alpha.2-6-sialyltransferase activity of NmSiaD.sub.W was shown to tolerate different modifications at different sites on the sialic acid component in the donor substrate.
TABLE-US-00003 TABLE 2 Donor substrate specificity study for the .alpha.2-6-sialyltransferase activity of NmSiaD.sub.W using in-situ generated CMP-Sialic acids and analogs. Percentage conversion (%) Transferase Reaction 13 .mu.g/mL 0.78 mg/mL NmSiaD.sub.W, NmSiaD.sub.W, Donor Precursor CMP-Sialic acid 10 min 10 h 1 Neu5Ac Quantitative .sup.a 60 .+-. 1 Quantitative 2 Neu5Gc 90 .+-. 2 .sup.a 47 .+-. 3 88 .+-. 3 3 Neu5Ac8OMe 79 .+-. 1 .sup.a 0 76 .+-. 4 4 Neu5,9Ac 61 .+-. 2 .sup.a 0 0 5 Neu4,5Ac 53 .+-. 1 .sup.a 0 0 6 Kdn Quantitative .sup.a 0 Quantitative 7 ManNAc6N.sub.3 91 .+-. 10 .sup.b 0 38 .+-. 6 8 ManNAc4N.sub.3 90 .+-. 3 .sup.b 0 60 .+-. 0.3 9 ManNAz Quantitative .sup.b 23 .+-. 1 86 .+-. 4 10 ManNAc6NAc 87 .+-. 2 .sup.b 0 0 11 Man2N.sub.3 77 .+-. 1 .sup.b 0 0 12 2,4-diN.sub.3Man 53 .+-. 4 .sup.b 0 0 13 2,4,6-triN.sub.3Man 81 .+-. 1 .sup.b 0 0 .sup.a The step 1 of the reaction was carried out in the presence of NmCSS (0.75 mg/mL) for 10 h; .sup.b The step 1 of the reaction was carried out in the presence of NmCSS (0.75 mg/mL) and PmAldolase (2 mg/mL) for 10 h. Abbreviations: Neu5Ac, N-acetylneuraminic acid; Neu5Gc, N-glycolylneuraminic acid; Neu5Ac8OMe, 8-O-methyl-N-acetylneuraminic acid; Neu5,9Ac.sub.2, 9-O-acetyl-N-acetylneuraminic acid; Neu4,5Ac.sub.2, 4-O-acetyl-N-acetylneuraminic acid; Kdn, 2-keto-3-deoxynonulosonic acid; ManNAc6N.sub.3, 6-azido-6-deoxy-N-acetylmannosamine; ManNAc4N.sub.3, 4-azido-4-deoxy-N-acetylmannosamine; ManNAz, N-azidoacetylmannosamine; ManNAc6NAc, 6-N-acetyl-6-deoxy-N-acetylmannosamine; Man2N.sub.3, 2-azido-2-deoxy-mannose; 2,4-diN.sub.3Man, 2,4-diazido-2,4-dideoxy-mannose; 2,4,6-triN.sub.3Man, 2,4,6-triazido-2,4,6-trideoxy-mannose.
[0157] Using UDP-Gal as the donor substrate, the acceptor substrate specificity for the .alpha.1-4-galactosyltransferase activity of NmSiaD.sub.W was studied using eleven sialosides. As shown in Table 3, Neu5Ac.alpha.OMe as well as .alpha.2-3- and .alpha.2-6-linked sialosides containing Neu5Ac or its derivatives were suitable acceptor substrates. Quite interestingly, the .alpha.1-4-galactosyltransferase activity of NmSiaD.sub.W could also tolerate Neu5Ac.alpha.2-3Gal.beta.1-3GalNAc.beta.ProN.sub.3 (Entry 9 in Table 3) for the synthesis of the tetrasaccharide repeating unit in E. coli serotype K9 capsular polysaccharide.
TABLE-US-00004 TABLE 3 Acceptor substrate specificity study of the .alpha.l-4-galactosyltransferase activity of NmSiaD.sub.W using sialosides as potential acceptors. Sialoside Product 1 Neu5Ac.alpha.2-6Gal.beta.pNP 2 Neu5Ac.alpha.2-6Gal.beta.ProNH.sub.2 4 Neu5Ac.alpha.2-6Gal.beta.1-4.beta.ProN.sub.3 5 Neu5Ac.alpha.OMe 5 Neu5Ac9NAc.alpha.2-6Gal.beta.pNP 6 Neu5Ac9NAc.alpha.2-6Gal.beta.ProN.sub.3 7 Neu5Ac7N.sub.3.alpha.2-6Gal.alpha.1-4Neu5Ac.alpha.ProNHCbz 8 Neu5Ac9N.sub.3.alpha.2-6Gal.alpha.1-4Neu5Ac.alpha.ProNHCbz 9 Neu5Ac.alpha.2-3Gal.beta.1-3GalNAc.beta.ProN.sub.3 10 Leg5,7diN.sub.3.alpha.2-3Gal.beta.1-3GalNAc.beta.ProCl 11 Leg5,7Ac.sub.2.alpha.2-3Gal.beta.1-3GalNAc.beta.ProN.sub.3 Not Detected
[0158] Using CMP-Neu5Ac as the donor substrate, the acceptor substrate specificity for the .alpha.2-6-sialyltransferase activity of NmSiaD.sub.W was studied using six galactosides. As shown in Table 4, .beta.-linked galactosylmonosaccharide (Entry 5 in Table 4) and .beta.1-4-linked galactosyldisaccharides (Entries 2-4 in Table 4) was shown to be suitable acceptors. While .alpha.1-4-linked galactosyltrisaccharide (Entry 1 in Table 4) was a suitable acceptor, a-linked monosaccharide (Entry 6 in Table 4) was not tolerated.
TABLE-US-00005 TABLE 4 Acceptor substrate specificity study for the .alpha.2-6-sialyltransferase activity of NmSiaD.sub.W using galactosides as potential acceptors. Galactoside Product 1 Gal.alpha.1-4Neu5Ac.alpha.2-6Gal.beta.pNP 2 Gal.beta.1-4Glc 3 Gal.beta.1-4Glc.beta.MU 4 Gal.beta.1-4Glc.beta.2AA 5 Gal.beta.ProN.sub.3 6 Gal.alpha.OMe Not Detected
Example 5. Kinetics Studies
[0159] A. Experimental Procedure
[0160] Enzyme kinetics by varying acceptor concentrations. For galactosyltransferase acceptors, reactions were performed in duplicate at 30.degree. C. for 10 minutes in the presence of MES buffer (100 mM, pH 6.5), MgCl.sub.2 (10 mM) and 2 mM UDP-Gal with a total volume of 20 .mu.L, and varying concentrations (0.05, 0.1, 0.2, 0.3, 0.5, 0.7, 1.0, 2.0, 5.0 and 10.0 mM) of the acceptor substrate. The concentration of NmSiaD.sub.W varied from 0.011 to 4.049 .mu.M when different acceptors were used. Reactions were quenched by adding 20 .ANG. of pre-chilled ethanol followed by incubation at -20.degree. C. for 30 min. The apparent kinetic parameters were obtained by fitting the experimental data (the average values of duplicate assay results) into the Michaelis-Menten equation using Grafit 5.0.
[0161] For sialyltransferase acceptors, reactions were performed in duplicate at 30.degree. C. for 10 minutes in the presence of 100 mM Tris-HCl, pH 8.0, 10 mM MgCl.sub.2 and 10 mM CMP-Neu5Ac with a total volume of 20 .mu.L, and varying concentrations (0.1, 0.2, 0.3, 0.5, 0.7, 1.0, 1.5, 2.0, 3.0, 5.0 and 10.0 mM) of the acceptor substrate. The concentration of NmSiaD.sub.W varied from 0.011 to 0.018 .mu.M according to different acceptors. Reactions were quenched by adding 20 .mu.L of pre-chilled ethanol followed by incubation at -20.degree. C. for 30 min. Products were assayed using an Agilent 1290 Infinity II LC System with a PDA detector (monitored at 215 nm) and an Eclipse Plus C18 column (Rapid Resolution HID, 1.8 .mu.m, 2.1.times.50 mm, 959757-902) or an AdvanceBio Glycan Map column (1.8 .mu.m, 2.1.times.150 mm, 859700-913) (see Table 5 below for detailed elution conditions) at 30.degree. C. The apparent kinetic parameters were obtained by fitting the experimental data (the average values of duplicate assay results) into the Michaelis-Menten equation using Grafit 5.0.
TABLE-US-00006 TABLE 5 Elution conditions for NmSiaD.sub.W kinetics studies with different acceptors (S1-G10). [E] Acceptor (.mu.M) Column Solvent A Solvent B B % S1 4.049 Eclipse Plus 0.1% TFA in H.sub.2O Acetonitrile 11 C18 G2 0.014 AdvanceBio 35 mM NaCl, Acetonitrile 88 Glycan 0.1% TFA in H.sub.2O S3 0.048 AdvanceBio 35 mM NaCl, Acetonitrile 88-84 Glycan 0.1% TFA in H.sub.2O over 4 min G4 0.011 Eclipse Plus 10 mM tetrabutylammonium, 50 Acetonitrile 27-34 C18 mM ammonium formate, pH 4.5 over 4 min S5 0.018 AdvanceBio 35 mM NaCl, Acetonitrile 75 Glycan 0.1% TFA in H.sub.2O G6 0.014 AdvanceBio 35 mM NaCl, Acetonitrile 75 Glycan 0.1% TFA in H.sub.2O S7 0.018 AdvanceBio 35 mM NaCl, Acetonitrile 77-72 Glycan 0.1% TFA in H.sub.2O over 5 min G8 0.018 AdvanceBio 35 mM NaCl, Acetonitrile 72 Glycan 0.1% TFA in H.sub.2O S9 0.011 AdvanceBio 35 mM NaCl, Acetonitrile 71 Glycan 0.1% TFA in H.sub.2O G10 0.014 AdvanceBio 35 mM NaCl, Acetonitrile 70 Glycan 0.1% TFA in H.sub.2O
[0162] Enzyme kinetics by varying donor concentrations. For varying UDP-Gal concentrations, reactions were performed in duplicate at 30.degree. C. for 10 minutes in the presence of MES buffer (100 mM, pH 6.5), MgCl.sub.2 (10 mM), S3 or S9 (2 mM), UDP-Gal (0.1, 0.2, 0.5, 1.0, 2.0, 5.0 and 10.0 mM), and NmSiaD.sub.W (0.025 .mu.M for S3, 0.031 .mu.M for S9) in a total volume of 20 .mu.L. For varying CMP-Neu5Ac concentrations, reactions were performed in duplicate at 30.degree. C. for 10 minutes in the presence of Tris-HCl buffer (100 mM, pH 8.0), MgCl.sub.2 (10 mM), G2 or G10 (1 mM), CMP-Neu5Ac (0.2, 0.5, 1.0, 2.0, 5.0 and 10.0 mM), and NmSiaD.sub.W (0.025 .mu.M for G2, 0.062 .mu.M for G10) in a total volume of 20 .mu.L. Data analyses were carried out as described above.
[0163] B. Results
[0164] The synthesized Cbz-tagged monosaccharide and oligosaccharides of varied lengths (S1-G10) were used as acceptors for kinetics studies of NmSiaD.sub.W. Two distinctive kinetics behaviors were observed for two glycosyltransferase activities. For the galactosyltransferase activity using sialosides S1-S9, the catalytic efficiency (k.sub.cat/K.sub.M) was significantly improved as the length of the acceptor substrate increased. The improvement is mainly resulted from a higher binding affinity of the acceptor substrate. The overall catalytic efficiency increased more than 2100-fold from monosaccharide S1 to nonasaccharide S9 (Table 6A).
[0165] The K.sub.M of nonasaccharide S9 kept decreasing to lower than 0.05 mM. Since the lowest concentration in assay was 0.05 mM due to the absorptivity of Cbz tag, the calculated K.sub.M was not reliable. Substrate inhibition was found when the concentration of nonasaccharide was higher than 2 mM. Substrate inhibition may result from the extremely low K.sub.M of the nonasaccharide.
[0166] Acceptor substrate inhibition was observed when the concentration of S9 was higher than 2 mM. This can be explained by the low K.sub.M value of S9 which may compete with the donor binding to the enzyme, inhibiting an effective catalytic process by glycosyltransferases which follows an ordered sequential Bi-Bi mechanism where the enzyme binds the sugar nucleotide before the acceptor. On the other hand, the k.sub.cat (5.1-8.8 s.sup.-1) did not change significantly as the length of the sialoside acceptor varied. A similar preference for longer acceptor substrates was demonstrated previously for a GT4 family glucosyltransferase using lipid acceptors.
[0167] For the sialyltransferase activity using G2-G10 as the acceptors, it was found that the galactoside acceptors showed substrate inhibition activity from the disaccharide with 2 mM CMP-Neu5Ac as donor. Substrate inhibition may result from the ordered binding mode of glycosyltransferase. To overcome substrate inhibition for fitting in the Michaelis-Menten equation, the concentration of CMP-Neu5Ac was increased to 10 mM. The enzyme activity was slightly recovered around 1-2 mM acceptor (FIG. 4).
[0168] When using galactosides G2-G10 as acceptors, the catalytic efficiency (k.sub.cat/K.sub.M) of NmSiaD.sub.W .alpha.2-6-sialyltransferase activity was shown to be in a narrow range of 46-97 s.sup.-1 mM.sup.-1 without significant change as the length of the acceptor substrate was varied (Table 6B). The k.sub.cat was in a range of 7.03-23.1 s.sup.-1 and the K.sub.M fell in the range of 0.13-0.24 mM. When G4 was used as the acceptor, NmSiaD.sub.W .alpha.2-6-sialyltransferase activity had the highest catalytic efficiency (97 s.sup.-1 mM.sup.-1) compared to the other four acceptors (k.sub.cat K.sub.M=46-55 s.sup.-1 mM.sup.-1) mainly due to a relatively higher k.sub.cat (23.1+1.1 s.sup.-1) than those of G2, G6, G8, and G10 (7.03-11.9 s.sup.-1).
TABLE-US-00007 TABLE 6 Apparent kinetics data for NmSiaD.sub.W galactosyltransferase activity (A) and sialyltransferase activity (B) Acceptor k.sub.cat (s.sup.-1) K.sub.M (mM) k.sub.cat/K.sub.M (s.sup.-1 mM.sup.-1) (A) S1 / >>10.0 4.7 .times. 10.sup.-2 S3 8.8 .+-. 0.4 0.89 .+-. 0.10 10 S5 5.3 .+-. 0.2 0.10 .+-. 0.02 51 S7 5.5 .+-. 0.2 0.07 .+-. 0.01 83 S9 5.1 .+-. 0.3 <0.05 >1.0 .times. 10.sup.2 (B) G2 9.76 .+-. 0.55 0.18 .+-. 0.04 55 G4 23.1 .+-. 1.1 0.24 .+-. 0.04 97 G6 11.9 .+-. 0.5 0.23 .+-. 0.04 53 G8 10.3 .+-. 0.5 0.25 .+-. 0.04 46 G10 7.03 .+-. 0.39 0.13 .+-. 0.03 55
[0169] NmSiaD.sub.W kinetics studies where the concentrations of the donors were also conducted, using a fixed concentration of a representative short or long acceptor substrate. S3 or S9 was used as the acceptor substrate for varying the concentration of UDP-Gal and G2 or G10 was used as the acceptor substrate for varying the concentration of CMP-Neu5Ac. As shown below, the kinetics parameters for the .alpha.1-4-galactosyltransferase (Table 7) and the .alpha.2-6-sialyltransferase (Table 8) activities of NmSiaD.sub.W did not change significantly when different sizes of acceptors were used. Table 7 shows apparent kinetics data for NmSiaD.sub.W.alpha.1-4-galactosyltransferase activity using a fixed concentration of acceptor (S3 or S9). Table 8 shows apparent kinetics data for NmSiaD.sub.W .alpha.2-6-sialyltransferase activity using a fixed concentration of acceptor (G2 or G10). The averages of nonlinear regression standard errors from technical duplicates are shown.
TABLE-US-00008 TABLE 7 Acceptor k.sub.cat (s.sup.-1) K.sub.M (mM) k.sub.cat/K.sub.M (s.sup.-1 mM.sup.-1) S3 6.3 .+-. 0.2 0.12 .+-. 0.02 53 S9 9.0 .+-. 0.2 0.15 .+-. 0.02 60
TABLE-US-00009 TABLE 8 Acceptor k.sub.cat (s.sup.-1) K.sub.M (mM) k.sub.cat/K.sub.M (s.sup.-1 mM.sup.-1) G2 7.1 .+-. 0.2 0.27 .+-. 0.03 26 G10 6.1 .+-. 0.2 0.38 .+-. 0.05 16
Example 6. Polymerization Study
[0170] A. Experimental Method
[0171] For studies using acceptor substrates of varied lengths, reactions were performed in duplicate in a total volume of 50 .mu.L at 30.degree. C. in Tris-HCl buffer (100 mM, pH 8.5) containing MgCl.sub.2 (10 mM), UDP-Gal (50 mM), CMP-Neu5Ac (50 mM), an acceptor substrate (5 mM, selected from S1-G10) and NmSiaD.sub.W (50 .mu.g).
[0172] For donor ratio profile studies using G2 or S3 as the acceptor substrate, reactions were performed in duplicate in a total volume of 50 .mu.L at 30.degree. C. in Tris-HCl buffer (100 mM, pH 8.5) containing MgCl.sub.2 (10 mM), both UDP-Gal and CMP-Neu5Ac (5, 10, 25, 50, 100 and 250 mM), an acceptor substrate G2 or S3 (5 mM), and NmSiaD.sub.W (50 .mu.g).
[0173] For one-pot multienzyme (OPME) polymerization studies using G2 or S3 as the acceptor substrate, reactions were performed in two steps. A donor synthesis reaction was carried out in a total volume of 150 .mu.L at 30.degree. C. for 10 hours in Tris-HCl buffer (144 mM, pH 8.5) containing MgCl.sub.2 (14.4 mM), CTP (72 mM), Neu5Ac (72 mM), UTP (72 mM), ATP (72 mM), Gal (72 mM), SpGalK (100 .mu.g), BLUSP (50 .mu.g), PmPpA (100 .mu.g) and NmCSS (80 .mu.g). Then polymerization reactions were performed in duplicate in a total volume of 50 .mu.L each at 30.degree. C. containing a reaction mixture of the donor synthesis (35 .mu.L), G2 or S3 (5 mM), and NmSiaD.sub.W (50 .mu.g). Samples were taken and quenched at 1 h and 20 h, respectively, by transferring 20 .mu.L of reaction mixture into an equal volume of pre-chilled ethanol followed by incubation at -20.degree. C. for 30 min.
[0174] Reaction mixtures were analyzed using UHPLC (monitored at 215 nm) with an AdvanceBio Glycan Map column (a HILIC column from Agilent, 1.8 .mu.m, 2.1.times.150 mm, 859700-913) at 30.degree. C. Solvent A (35 mM NaCl, 0.1% TFA in H.sub.2O) and solvent B (acetonitrile) were used to establish an elution gradient, starting with 90% B at 1.300 mL/min and reaching to 40% B at 0.675 mL/min over 50 minutes. Relative yields were calculated from peak area integration and used to obtain number average molecular weight, weight average molecular weight, and polydispersity index.
[0175] Reaction mixtures were analyzed at 30.degree. C. using a Shimadzu LCMS-2020 system (monitored at 215 nm) with a XBridge BEH Amide Column (a HILIC column from Waters, 130 .ANG., 5 .mu.m, 4.6.times.250 mm). Solvent A (0.1% formic acid in H.sub.2O) and solvent B (acetonitrile) were used to establish an elution gradient, starting with 72.5% B at 1.300 mL/min and reaching to 12.5% B at 0.800 mL/min over 120 minutes.
[0176] B. Results
[0177] Despite the product profiles for several Nm glycosyltransferases have been well studied (see, e.g., Keys 2014; Fiebig 2018), study of polymerization for heteropolymers of Nm capsular polysaccharides is lacking. There are multiple concerns to be considered, including different reaction conditions, donor ratio, detection method, etc. Synthetic conditions with UDP-Gal and CMP-Neu5Ac can be applied to determine the product profile of NmSiaD.sub.W.
[0178] The availability of chromophore-tagged NmW CPS mono- and oligosaccharides with defined sizes and structures (S1-G10) allowed us to address several questions. Does the length of NmSiaD.sub.W oligosaccharide acceptor affect the maximal product sizes when both donors are provided? Does the identity of the monosaccharide at the reducing end of the oligosaccharide acceptor affect the maximal product sizes? What is the effect of the donor versus acceptor ratio on the product size distribution?
[0179] To answer the first two questions, NmSiaD.sub.W-catalyzed polymerization reactions were carried out with an acceptor (5 mM) selected from S1-G10 and 10 equivalents of both UDP-Gal and CMP-Neu5Ac donors. Reaction mixtures were analyzed using an UHPLC system with an AdvanceBio Glycan Mapping column (a HILIC column) using NaCl and acetonitrile gradients. Except for the reactions using S1 as the acceptor which were slow, no significant difference on the maximal product sizes was observed when oligosaccharide acceptors (G2-G10) of different sizes were used. Nevertheless, compared to reactions with a shorter acceptor (G2-S7), a narrower product size distribution was seen for reactions with a longer oligosaccharide acceptor (G8, S9, or G10). Therefore, using longer oligosaccharide acceptors (G8-G10) could be advantages for the production of monodisperse NmW capsular polysaccharides. The identity of the reducing-end monosaccharide did not seem to affect the maximal product sizes either. It was interesting to observe (see, e.g., FIG. 8) that sialosides seemed to be the preferred products when a sialoside was used as the starting acceptor substrate. In comparison, a galactoside starting acceptor led to the formation of both galactoside and sialoside products. The underlying reason could be related to the difference in the relative availability of two donor substrates in the reaction mixtures.
[0180] With 10 equivalents of both UDP-Gal and CMP-Neu5Ac in 20-hour reactions, the longest product tended to be degree of polymerization (DP) 33 (FIG. 7). The most abundant products are between DP17 to DP23. Although the product profile is slightly influenced by the starting acceptor, size distribution is similar among the 10 oligosaccharide acceptors tested. One exception was observed for monosaccharide due to the difficulty to produce disaccharide as the first step, the same as the problem found in one-pot four-enzyme galactosylation. However, differences occurred between sialoside and galactoside acceptors. Sialoside acceptors (mono-, tri-, penta-, hepta- and nona-saccharide) always resulted in sialoside products with an odd DP value. But the galactoside acceptors (di-, tetra-, hexa-, octa-, and deca-saccharide) ended with both galactoside and sialoside products with similar levels. The mechanism behind the product distribution may depend on different kinetic behaviors.
[0181] The effect of the donor verses acceptor ratio on the product size distribution was investigated using a series of ratios varying from 1 to 50 with either G2 or S3 as the acceptor. As shown in FIG. 8, the sizes of the products increased with the increase of the donor versus acceptor ratio independent of whether a galactoside G2 or a sialoside S3 was used as the acceptor. Polymers with DP59 or higher were observed. In comparison, NmSiaD.sub.W was reported to form products for up to DP19 using Neu5Ac.alpha.2-6Gal.alpha.1-4Neu5AcaMU as the acceptor and 4 equivalents of both donors. The strategy of using a high donor versus acceptor ratio was also applied previously for synthesizing monodisperse polysaccharides such as hyaluronan (up to 8 MDa) using Pasteurella multocida hyaluronan synthase (PmHAS) and heparosan (800 kDa) using Pasteurella multocida heparosan synthase 1 (PmHS1).
[0182] Assuming oligosaccharides S3-G8 were not part of the products in the 20-h reactions using 50 equivalents of donors (FIG. 8), more detailed analyses showed that when G2 was used as the acceptor substrate, the average molecular weights (M.sub.n or M.sub.w) of NmSiaD.sub.W products increased from 1.0 kDa to 6.1-6.6 kDa when the donor versus acceptor ratio changed from 1 to 50 (Table 9) and the product average molecular weights increased from 1.4 kDa to 7.5-8.6 kDa when S3 was used as the acceptor substrate (Table 10). NmSiaD.sub.W catalyzed the formation of low molecular weight polysaccharides with a narrow size distribution (polydispersity index: M.sub.w/M.sub.n=1.03-1.14) under the experimental conditions used. Table 9 shows the average molecular masses and polydispersity of product profiles of 20-hour reactions using different ratios (1-50 equivalents) of donors versus G2 (5 mM) in FIG. 8A. Table 10 shows the average molecular masses and polydispersity of product profiles of 20-hour reactions using different ratios (1-50 equivalents) of donors versus S3 (5 mM) in FIG. 8B.
TABLE-US-00010 TABLE 9 Donor Equivalents 1 2 5 10 20 50 M.sub.n 951 1310 2135 3072 5325 6050 (g/mol) M.sub.w 1051 1416 2237 3215 5487 6609 (g/mol) PDI 1.11 1.08 1.05 1.05 1.03 1.09 M.sub.n: number average molecular mass; M.sub.w: mass average molecular mass; PDI: polydispersity index, PDI = M.sub.w/M.sub.n.
TABLE-US-00011 TABLE 10 Donor Equivalents 1 2 5 10 20 50 M.sub.n (g/mol) 1333 1704 2567 4313 7051 7526 M.sub.w (g/mol) 1453 1888 2870 4436 7272 8554 PDI 1.09 1.11 1.12 1.03 1.03 1.14 M.sub.n: number average molecular mass; M.sub.w: mass average molecular mass; PDI: polydispersity index, PDI = M.sub.w/M.sub.n.
[0183] The application of in situ generation of sugar nucleotide donors (UDP-Gal and CMP-Neu5Ac) by OPME galactosylation and sialylation systems in polymerization reaction was investigated using G2 or S3 as the acceptor substrate and compared to the reactions using 10 equivalents of donor substrates. The OPME polymerization reactions were carried out in two steps where the sugar nucleotides were formed at 30.degree. C. for 10 hours in Tris-HCl buffer from ATP, UTP, Gal, CTP, Neu5Ac at pH 8.5 in the presence of SpGalK, BLUSP, PmPpA, and NmCSS. The reaction mixture was then added with G2 or S3, and NmSiaD.sub.W for polymerization reactions. Polymerization reactions with OPME systems were slower but reached similar levels as those using sugar nucleotides as starting materials in a 20-h reaction time (data not shown).
[0184] Chemoenzymatic reaction provides a green and efficient method to synthesize pathogenic capsular polysaccharide in preparative-scale. Previously, a total synthesis method was employed to achieve 35-50% yield in three steps. See, Wang 2013. With the high-efficiency one-pot multi-enzyme system provided herein, the yield can be higher than 80% after a single-step reaction. The reaction is undertaken on 200-450 mg scale, with the ability to enlarge to gram-scale synthesis. With the chemoenzymatic method according to the present disclosure, both galactoside and sialoside products can be obtained with an efficient manner, while only the sialoside products were obtained based on the previous report. Immunology studies can directly benefit from a full library of bacterial capsular oligosaccharides and can further guide a rational vaccine development based on the length of the oligosaccharide.
[0185] As described above, recombinant NmSiaD.sub.W was expressed in a high expression level, characterized in detail, and applied in synthesis. A library of NmW capsular polysaccharides were synthesized using one-pot multienzyme (OPME) chemoenzymatic glycosylation systems with high efficiency (83-96%). Kinetics studies indicated that galactosides inhibited the sialyltransferase activity of the enzyme. The catalytic efficiency of the galactosyltransferase activity increased with the increased length of the sialoside acceptors. More than 2300-fold improvement was observed when the acceptor length increased from monosaccharide to nonasaccharide. Substrate inhibition was also found in nonasaccharide. NmSiaD.sub.W was shown to be a promiscuous enzyme by a preliminary screening using libraries of potential donors and acceptors containing different sugars.
IV. EXEMPLARY EMBODIMENTS
[0186] Exemplary embodiments provided in accordance with the presently disclosed subject matter include, but are not limited to, the claims and the following embodiments:
[0187] 1. A method for preparing a bacterial capsular saccharide product, the method comprising:
[0188] forming a reaction mixture containing one or more bacterial capsular polysaccharide synthases, a sugar acceptor, and one or more sugar donors; and maintaining the reaction mixture under conditions sufficient to form the bacterial capsular saccharide product;
[0189] wherein the degree of polymerization of the bacterial capsular saccharide product ranges from 2 to about 200, and wherein the polydispersity index M.sub.w/M.sub.n of the bacterial capsular saccharide product ranges from 1 to about 1.5.
[0190] 2. The method of embodiment 1, wherein the bacterial capsular saccharide product is a heteropolymer comprising disaccharide repeating units.
[0191] 3. The method of embodiment 1 or embodiment 2, wherein forming the bacterial capsular saccharide product comprises glycosylating the sugar acceptor with monosaccharide residues of a first variety and monosaccharide residue of a second variety in alternating steps.
[0192] 4. The method of embodiment 1 or embodiment 2, wherein forming the bacterial capsular saccharide product comprises glycosylating the sugar acceptor with alternating monosaccharide residues of a first variety and monosaccharide residues of a second variety in a single polymerization step.
[0193] 5. The method of any one of embodiments 1-4, the degree of polymerization of the bacterial capsular saccharide product ranges from 20 to about 200.
[0194] 6. The method of any one of embodiments 1-5, wherein the degree of polymerization of the bacterial capsulate saccharide product is greater than 50.
[0195] 7. The method of any one of embodiments 1-6, wherein the polydispersity index M.sub.w/M.sub.n of the bacterial capsular saccharide product ranges from 1.01 to about 1.15
[0196] 8. The method of any one of embodiments 1-7, wherein each bacterial capsular polysaccharide synthase is independently selected from N. meningitidis SiaD.sub.w(NmSiaD.sub.W), N. meningitidis SiaD.sub.y (NmSiaD.sub.Y), a P. multocida heparosan synthase (PmHS1 and PmHS2), P. multocida hyaluronan synthase (PmHAS), S. pyogenes hyaluronan synthase (SpHAS), P. multocida chondroitin synthase (PmCS), E. coli K5 KfiA and KfiC, S. pneumoniae Type 3 capsular polysaccharide synthase (SpCps3S), and S. pneumoniae Type 37 capsular polysaccharide synthase (SpCps37Tts).
[0197] 9. The method of embodiment 8, wherein the reaction mixture comprises one bacterial capsular polysaccharide synthase, and wherein the bacterial capsular polysaccharide synthase is NmSiaD.sub.W.
[0198] 10. The method of any one of embodiments 1-9, wherein the bacterial capsular saccharide product comprises galactose-sialic acid disaccharide repeating units.
[0199] 11. The method of embodiment 10, wherein the galactose-sialic acid disaccharide repeating units are (-6Gal.alpha.1-4Neu5Ac.alpha.2).
[0200] 12. The method of embodiment 10 or embodiment 11, wherein the reaction mixture comprises a galactose donor, a sialic acid donor, or a combination thereof.
[0201] 13. The method of embodiment 12, wherein the galactose donor is UDP-Gal.
[0202] 14. The method of embodiment 12 or embodiment 13, wherein the sialic acid donor is CMP-Neu5Ac.
[0203] 15. The method of any one of embodiments 10-14, wherein forming the bacterial capsular saccharide product comprises glycosylating the sugar acceptor with galactose residues and sialic acid residues in alternating steps.
[0204] 16. The method of any one of embodiments 10-14, wherein forming the bacterial capsular saccharide product comprises glycosylating the sugar acceptor with alternating galactose residues and sialic acid residues in a single polymerization step.
[0205] 17. The method of embodiment 16, wherein the reaction mixture comprises UDP-Gal and CMP-Neu5Ac, and wherein the ratio (UDP-Gal+CMP-Neu5Ac):(sugar acceptor) ranges from about 1:1 to about 250:1.
[0206] 18. The method of embodiment 17, wherein the ratio is about 100:1.
[0207] 19. The method of any one of embodiments 1-18, wherein the sugar acceptor comprises a sialic acid residue at its non-reducing end.
[0208] 20. The method of any one of embodiments 1-18, wherein the sugar acceptor comprises a galactose residue at its non-reducing end.
[0209] 21. The method of any one of embodiments 1-20, wherein the sugar acceptor comprises an oligosaccharide moiety Gal.alpha.1-4Neu5Ac.alpha.2(-6Gal.alpha.1-4Neu5Ac.alpha.2).sub.n- or an oligosaccharide moiety Neu5Ac.alpha.2(-6Gal.alpha.1-4Neu5Ac.alpha.2).sub.m-, wherein subscript n is 1, 2, 3, or 4 and subscript m is 1, 2, 3, 4, or 5.
[0210] 22. The method of any one of embodiments 1-21, wherein the acceptor comprises a purification handle.
[0211] 23. The method of any one of embodiments 1-22, wherein the reaction mixture further comprises a CMP-sialic acid synthetase, a nucleotide sugar pyrophosphorylase, a pyrophosphatase, a kinase, or a combination thereof.
[0212] 24. The method of embodiment 23, wherein the CMP-sialic acid synthetase is NmCSS, wherein the nucleotide sugar pyrophosphorylase is BLUSP, wherein the pyrophosphatase is PmPpA, and wherein the kinase is SpGalK.
[0213] 25. The method of any one of embodiments 1-24, wherein the pH of the reaction mixture ranges from about 6 to about 9.
[0214] 26. The method of any one of embodiments 1-24, which is conducted in vitro.
[0215] 27. A bacterial capsular saccharide product prepared according to the method of any one of embodiments 1-26.
[0216] 28. A vaccine composition comprising a bacterial capsular saccharide product prepared according to the method of any one of embodiments 1-26 coupled to a carrier material.
V. REFERENCES
[0216]
[0217] Aguilera, J.-F. et al. Emerging infectious diseases 2002, 8, 761-767.
[0218] Batista, R. S. et al. Asian Pac J Trop Med 2017, 10 (11), 1019-1029.
[0219] Bergfeld, A. K. et al. J Biol Chem 2009, 284 (1), 6-16.
[0220] Boix, E. et al. J Biol Chem 2002, 277 (31), 28310-8.
[0221] Brouwer, M. C. et al. Curr Opin Infect Dis 2018, 31 (1), 78-84.
[0222] Chen, M. et al. Carbohydr Res 2011, 346 (15), 2421-5.
[0223] Chen, X. et al. ACS Chem Biol 2010, 5 (2), 163-76.
[0224] Claus, H. et al. Mol Microbiol 2009, 71 (4), 960-71.
[0225] Claus, H. et al. Mol Gen Genet 1997, 257, 28-34.
[0226] Fiebig, T. et al. J Biol Chem 2018, 293 (3), 953-962.
[0227] Gasparini, R. et al. Human Vaccines 2014, 7 (2), 170-182.
[0228] Gudlavalleti, S. K. et al. J Pharm Biomed Anal 2015, 107, 432-6.
[0229] Harrison, L. H. et al. Nat Rev Drug Discov 2010, 9 (6), 429-30.
[0230] Keys, T. G. et al. Nat Chem Biol 2014, 10 (6), 437-42.
[0231] Kopycki, J. et al. Biochem J 2013, 450 (1), 37-46.
[0232] Lairson, L. L. et al. Annu Rev Biochem 2008, 77, 521-55.
[0233] Lau, K.; Yu, H.; Chen, X.; et al. Chem Commun (Camb) 2010, 46 (33), 6066-8.
[0234] Li, W.; Yu, H.; Chen, X.; et al. Carbohydr Res 2017, 451, 51-58.
[0235] Livermore, D. M. Int J Antimicrob Agents 2012, 39 (4), 283-94.
[0236] Mishra, R. P. et al. Curr Opin Microbiol 2012, 15 (5), 596-602.
[0237] Muthana, M. M.; Yu, H.; Chen, X.; et al. Chem Commun (Camb) 2012, 48 (21), 2728-30.
[0238] Romanow, A. et al. J Biol Chem 2013, 288 (17), 11718-30.
[0239] Romanow, A. et al. J Biol Chem 2014, 289 (49), 33945-57.
[0240] Rouphael, N. G. et al. Methods Mol Biol 2012, 799, 1-20.
[0241] Sardzik, R. et al. Chem Commun (Camb) 2011, 47 (19), 5425-7.
[0242] Sharyan, A. et al. BMC Res Notes 2018, 11 (1), 482.
[0243] Wang,. et al. Angew Chem Int Ed Engl 2013, 52 (35), 9157-61.
[0244] Yoshino, M. et al. Springerplus 2015, 4, 292.
[0245] Yu, H.; Chen, X.; et al. Bioorg Med Chem 2004, 12 (24), 6427-35.
[0246] Although the foregoing has been described in some detail by way of illustration and example for purposes of clarity and understanding, one of skill in the art will appreciate that certain changes and modifications can be practiced within the scope of the appended claims. In addition, each reference provided herein is incorporated by reference in its entirety to the same extent as if each reference was individually incorporated by reference.
TABLE-US-00012 INFORMAL SEQUENCE LISTING (NmSiaDw) SEQ ID NO: 1 MAVIIFVNGIRAVNGLVKSSINTANAFAEEGLDVH LINFVGNITGAEHLYPPFHLHPNVKTSSIIDLFND IPENVSCRNTPFYSIHQQFFKAEYSAHYKHVLMKI ESLLSAEDSIIFTHPLQLEMYRLANNDIKSKAKLI VQIHGNYMEEIHNYEILARNIDYVDYLQTVSDEML EEMHSHFKIKKDKLVFIPNITYPISLEKKEADFFI KDNEDIDNAQKFKRISIVGSIQPRKNQLDAIKIIN KIKNENYILQIYGKSINKDYFELIKKYIKDNKLQN RILFKGESSEQEIYENTDILIMTSESEGFPYIFME GMVYDIPIVVYDFKYGANDYSNYNENGCVFKTGDI SGMAKKIIELLNNPEKYKELVQYNHNRFLKEYAKD VVMAKYFTILPRSFNNVSLSSAFSRKELDEFQNIT FSIEDSNDLAHIWNFELTNPAQNMNFFALVGKRKF PMDAHIQGTQCTIKIAHKKTGNLLSLLLKKRNQLN LSRGYTLIAEDNSYEKYIGAISNKGNFEIIANKKS SLVTINKSTLELHEIPHELHQNKLLIALPNMQTPL KITDDNLIPIQASIKLEKIGNTYYPCFLPSGIFNN ICLDYGEESKIINFSKYSYKYIYDSIRHIEQHTDI SDIIVCNVYSWELIRASVIESLMEFTGKWEKHFQT SPKIDYRFDHEGKRSMDDVFSEETFIMEFPRKNGI DKKTAAFQNIPNSIVMEYPQTNGYSMRSHSLKSNV VAAKHFLEKLNKIKVDIKFKKHDLANIKKMNRIIY EHLGININIEAFLKPRLEKFKREEKYFHDFFKRNN FKEVIFPSTYWNPGIICAAHKQGIKVSDIQYAAIT PYHPAYFKSPKSHYVADKLFLWSEYWNHELLPNPT REIGSGAAYWYALDDVRFSEKLNYDYIFLSQSRIS SRLLSFAIEFALKNPQLQLLFSKHPDENIDLKNRI IPDNLIISTESSIQGINESRVAVGVYSTSLFEALA CGKQTFVVKYPGYEIMSNEIDSGLFFAVETPEEML EKTSPNWVAVADIENQFFGQEK (NmSiaDw-Hise) SEQ ID NO: 2 MAVIIFVNGIRAVNGLVKSSINTANAFAEEGLDVH LINFVGNITGAEHLYPPFHLHPNVKTSSIIDLFND IPENVSCRNTPFYSIHQQFFKAEYSAHYKHVLMKI ESLLSAEDSIIFTHPLQLEMYRLANNDIKSKAKLI VQIHGNYMEEIHNYEILARNIDYVDYLQTVSDEML EEMHSHFKIKKDKLVFIPNITYPISLEKKEADFFI KDNEDIDNAQKFKRISIVGSIQPRKNQLDAIKIIN KIKNENYILQIYGKSINKDYFELIKKYIKDNKLQN RILFKGESSEQEIYENTDILIMTSESEGFPYIFME GMVYDIPIVVYDFKYGANDYSNYNENGCVFKTGDI SGMAKKIIELLNNPEKYKELVQYNHNRFLKEYAKD VVMAKYFTILPRSFNNVSLSSAFSRKELDEFQNIT FSIEDSNDLAHIWNFELTNPAQNMNFFALVGKRKF PMDAHIQGTQCTIKIAHKKTGNLLSLLLKKRNQLN LSRGYTLIAEDNSYEKYIGAISNKGNFEIIANKKS SLVTINKSTLELHEIPHELHQNKLLIALPNMQTPL KITDDNLIPIQASIKLEKIGNTYYPCFLPSGIFNN ICLDYGEESKIINFSKYSYKYIYDSIRHIEQHTDI SDIIVCNVYSWELIRASVIESLMEFTGKWEKHFQT SPKIDYRFDHEGKRSMDDVFSEETFIMEFPRKNGI DKKTAAFQNIPNSIVMEYPQTNGYSMRSHSLKSNV VAAKHFLEKLNKIKVDIKFKKHDLANIKKMNRIIY EHLGININIEAFLKPRLEKFKREEKYFHDFFKRNN FKEVIFPSTYWNPGIICAAHKQGIKVSDIQYAAIT PYHPAYFKSPKSHYVADKLFLWSEYWNHELLPNPT REIGSGAAYWYALDDVRFSEKLNYDYIFLSQSRIS SRLLSFAIEFALKNPQLQLLFSKHPDENIDLKNRI IPDNLIISTESSIQGINESRVAVGVYSTSLFEALA CGKQTFVVKYPGYEIMSNEIDSGLFFAVETPEEML EKTSPNWVAVADIENQFFGQEKLEHHHHHH (NmCSS) SEQ ID NO: 3 MEKQNIAVILARQNSKGLPLKNLRKMNGISLLGHT INAAISSKCFDRIIVSTDGGLIAEEAKNFGVEVVL RPAELASDTASSISGVIHALETIGSNSGTVTLLQP TSPLRTGAHIREAFSLFDEKIKGSVVSACPMEHHP LKTLLQINNGEYAPMRHLSDLEQPRQQLPQAFRPN GAIYINDTASLIANNCFFIAPTKLYIMSHQDSIDI DTELDLQQAENILNHKES (BLUSP) SEQ ID NO: 4 MTEINDKAQLDIAAAGDTDAVTSDTPEETVNTPEV DETFELSAAKMREHGMSETAINQFHHLYDVWRHEE ASSWIREDDIEPLGHVPSFHDVYETINHDKAVDAF AKTAFLKLNGGLGTSMGLDKAKSLLPVRRHKAKQM RFIDIIIGQVLTARTRLNVELPLTFMNSFHTSADT MKVLKHHRKFSQHDVPMEIIQHQEPKLVAATGEPV SYPANPELEWCPPGHGDLFSTIWESGLLDVLEERG FKYLFISNSDNLGARASRTLAQHFENTGAPFMAEV AIRTKADRKGGHIVRDKATGRLILREMSQVHPDDK EAAQDITKHPYFNTNSIWVRIDALKDKLAECDGVL PLPVIRNKKTVNPTDPDSEQVIQLETAMGAAIGLF NGSICVQVDRMRFLPVKTTNDLFIMRSDRFHLTDT YEMEDGNYIFPNVELDPRYYKNIHDFDERFPYAVP SLAAANSVSIQGDWTFGRDVMMFADAKLEDKGEPS YVPNGEYVGPQGIEPDDWV (SpGalK) SEQ ID NO: 5 MAQHLTTEALRKDFLAVFGQEADQTFFSPGRINLI GEHTDYNGGHVFPAAISLGTYGAARKRDDQVLRFY SANFEDKGIIEVPLADLKFEKEHNWTNYPKGVLHF LQEAGHVIDKGFDFYVYGNIPNGAGLSSSASLELL TGVVAEHLFDLKLERLDLVKIGKQTENNFIGVNSG IMDQFAIGMGADQRAIYLDTNTLEYDLVPLDLKDN VVVIMNTNKRRELADSKYNERRAECEKAVEELQVS LDIQTLGELDEWAVDQYSYLIKDENRLKRARHAVL ENQRTLKAQVALQAGDLETFGRLMNASHVSLEHDY EVTGLELDTLVHTAWAQEGVLGARMTGAGFGGCAI ALVQKDTVEAFKEAVGKHYEEWGYAPSFYIAEVAG GTRVLD (PmPpA) SEQ ID NO: 6 MGLETVPAGKALPDDIYWIEIPANSDPIKYEVDKE SGALFVDRFMATAMFYPANYGYVNNTLSLDGDPVD VLVPTPYPLQPGSVIRCRPVGVLKMTDEAGSDAKW AVPHSKLTKEYDHIKDVNDLPALLKAQIQHFFESY KALEAGKWVKVDGWEGVDAARQEILDSFERAKK SEQ ID NO: 7 AGCTCATATGGCCGTTATTATTTTTGTGAATGGTA TTCGTGCCG SEQ ID NO: 8 AGCTAAGCTTTTACTTCTCTTGGCCGAAAAACTGG TTTTCAATATCTGC SEQ ID NO: 9 HHHHHH
Sequence CWU
1
1
911037PRTArtificial SequenceDescription of Artificial Sequence Synthetic
polypeptide 1Met Ala Val Ile Ile Phe Val Asn Gly Ile Arg Ala Val Asn
Gly Leu1 5 10 15Val Lys
Ser Ser Ile Asn Thr Ala Asn Ala Phe Ala Glu Glu Gly Leu 20
25 30Asp Val His Leu Ile Asn Phe Val Gly
Asn Ile Thr Gly Ala Glu His 35 40
45Leu Tyr Pro Pro Phe His Leu His Pro Asn Val Lys Thr Ser Ser Ile 50
55 60Ile Asp Leu Phe Asn Asp Ile Pro Glu
Asn Val Ser Cys Arg Asn Thr65 70 75
80Pro Phe Tyr Ser Ile His Gln Gln Phe Phe Lys Ala Glu Tyr
Ser Ala 85 90 95His Tyr
Lys His Val Leu Met Lys Ile Glu Ser Leu Leu Ser Ala Glu 100
105 110Asp Ser Ile Ile Phe Thr His Pro Leu
Gln Leu Glu Met Tyr Arg Leu 115 120
125Ala Asn Asn Asp Ile Lys Ser Lys Ala Lys Leu Ile Val Gln Ile His
130 135 140Gly Asn Tyr Met Glu Glu Ile
His Asn Tyr Glu Ile Leu Ala Arg Asn145 150
155 160Ile Asp Tyr Val Asp Tyr Leu Gln Thr Val Ser Asp
Glu Met Leu Glu 165 170
175Glu Met His Ser His Phe Lys Ile Lys Lys Asp Lys Leu Val Phe Ile
180 185 190Pro Asn Ile Thr Tyr Pro
Ile Ser Leu Glu Lys Lys Glu Ala Asp Phe 195 200
205Phe Ile Lys Asp Asn Glu Asp Ile Asp Asn Ala Gln Lys Phe
Lys Arg 210 215 220Ile Ser Ile Val Gly
Ser Ile Gln Pro Arg Lys Asn Gln Leu Asp Ala225 230
235 240Ile Lys Ile Ile Asn Lys Ile Lys Asn Glu
Asn Tyr Ile Leu Gln Ile 245 250
255Tyr Gly Lys Ser Ile Asn Lys Asp Tyr Phe Glu Leu Ile Lys Lys Tyr
260 265 270Ile Lys Asp Asn Lys
Leu Gln Asn Arg Ile Leu Phe Lys Gly Glu Ser 275
280 285Ser Glu Gln Glu Ile Tyr Glu Asn Thr Asp Ile Leu
Ile Met Thr Ser 290 295 300Glu Ser Glu
Gly Phe Pro Tyr Ile Phe Met Glu Gly Met Val Tyr Asp305
310 315 320Ile Pro Ile Val Val Tyr Asp
Phe Lys Tyr Gly Ala Asn Asp Tyr Ser 325
330 335Asn Tyr Asn Glu Asn Gly Cys Val Phe Lys Thr Gly
Asp Ile Ser Gly 340 345 350Met
Ala Lys Lys Ile Ile Glu Leu Leu Asn Asn Pro Glu Lys Tyr Lys 355
360 365Glu Leu Val Gln Tyr Asn His Asn Arg
Phe Leu Lys Glu Tyr Ala Lys 370 375
380Asp Val Val Met Ala Lys Tyr Phe Thr Ile Leu Pro Arg Ser Phe Asn385
390 395 400Asn Val Ser Leu
Ser Ser Ala Phe Ser Arg Lys Glu Leu Asp Glu Phe 405
410 415Gln Asn Ile Thr Phe Ser Ile Glu Asp Ser
Asn Asp Leu Ala His Ile 420 425
430Trp Asn Phe Glu Leu Thr Asn Pro Ala Gln Asn Met Asn Phe Phe Ala
435 440 445Leu Val Gly Lys Arg Lys Phe
Pro Met Asp Ala His Ile Gln Gly Thr 450 455
460Gln Cys Thr Ile Lys Ile Ala His Lys Lys Thr Gly Asn Leu Leu
Ser465 470 475 480Leu Leu
Leu Lys Lys Arg Asn Gln Leu Asn Leu Ser Arg Gly Tyr Thr
485 490 495Leu Ile Ala Glu Asp Asn Ser
Tyr Glu Lys Tyr Ile Gly Ala Ile Ser 500 505
510Asn Lys Gly Asn Phe Glu Ile Ile Ala Asn Lys Lys Ser Ser
Leu Val 515 520 525Thr Ile Asn Lys
Ser Thr Leu Glu Leu His Glu Ile Pro His Glu Leu 530
535 540His Gln Asn Lys Leu Leu Ile Ala Leu Pro Asn Met
Gln Thr Pro Leu545 550 555
560Lys Ile Thr Asp Asp Asn Leu Ile Pro Ile Gln Ala Ser Ile Lys Leu
565 570 575Glu Lys Ile Gly Asn
Thr Tyr Tyr Pro Cys Phe Leu Pro Ser Gly Ile 580
585 590Phe Asn Asn Ile Cys Leu Asp Tyr Gly Glu Glu Ser
Lys Ile Ile Asn 595 600 605Phe Ser
Lys Tyr Ser Tyr Lys Tyr Ile Tyr Asp Ser Ile Arg His Ile 610
615 620Glu Gln His Thr Asp Ile Ser Asp Ile Ile Val
Cys Asn Val Tyr Ser625 630 635
640Trp Glu Leu Ile Arg Ala Ser Val Ile Glu Ser Leu Met Glu Phe Thr
645 650 655Gly Lys Trp Glu
Lys His Phe Gln Thr Ser Pro Lys Ile Asp Tyr Arg 660
665 670Phe Asp His Glu Gly Lys Arg Ser Met Asp Asp
Val Phe Ser Glu Glu 675 680 685Thr
Phe Ile Met Glu Phe Pro Arg Lys Asn Gly Ile Asp Lys Lys Thr 690
695 700Ala Ala Phe Gln Asn Ile Pro Asn Ser Ile
Val Met Glu Tyr Pro Gln705 710 715
720Thr Asn Gly Tyr Ser Met Arg Ser His Ser Leu Lys Ser Asn Val
Val 725 730 735Ala Ala Lys
His Phe Leu Glu Lys Leu Asn Lys Ile Lys Val Asp Ile 740
745 750Lys Phe Lys Lys His Asp Leu Ala Asn Ile
Lys Lys Met Asn Arg Ile 755 760
765Ile Tyr Glu His Leu Gly Ile Asn Ile Asn Ile Glu Ala Phe Leu Lys 770
775 780Pro Arg Leu Glu Lys Phe Lys Arg
Glu Glu Lys Tyr Phe His Asp Phe785 790
795 800Phe Lys Arg Asn Asn Phe Lys Glu Val Ile Phe Pro
Ser Thr Tyr Trp 805 810
815Asn Pro Gly Ile Ile Cys Ala Ala His Lys Gln Gly Ile Lys Val Ser
820 825 830Asp Ile Gln Tyr Ala Ala
Ile Thr Pro Tyr His Pro Ala Tyr Phe Lys 835 840
845Ser Pro Lys Ser His Tyr Val Ala Asp Lys Leu Phe Leu Trp
Ser Glu 850 855 860Tyr Trp Asn His Glu
Leu Leu Pro Asn Pro Thr Arg Glu Ile Gly Ser865 870
875 880Gly Ala Ala Tyr Trp Tyr Ala Leu Asp Asp
Val Arg Phe Ser Glu Lys 885 890
895Leu Asn Tyr Asp Tyr Ile Phe Leu Ser Gln Ser Arg Ile Ser Ser Arg
900 905 910Leu Leu Ser Phe Ala
Ile Glu Phe Ala Leu Lys Asn Pro Gln Leu Gln 915
920 925Leu Leu Phe Ser Lys His Pro Asp Glu Asn Ile Asp
Leu Lys Asn Arg 930 935 940Ile Ile Pro
Asp Asn Leu Ile Ile Ser Thr Glu Ser Ser Ile Gln Gly945
950 955 960Ile Asn Glu Ser Arg Val Ala
Val Gly Val Tyr Ser Thr Ser Leu Phe 965
970 975Glu Ala Leu Ala Cys Gly Lys Gln Thr Phe Val Val
Lys Tyr Pro Gly 980 985 990Tyr
Glu Ile Met Ser Asn Glu Ile Asp Ser Gly Leu Phe Phe Ala Val 995
1000 1005Glu Thr Pro Glu Glu Met Leu Glu
Lys Thr Ser Pro Asn Trp Val 1010 1015
1020Ala Val Ala Asp Ile Glu Asn Gln Phe Phe Gly Gln Glu Lys1025
1030 103521045PRTArtificial SequenceDescription
of Artificial Sequence Synthetic polypeptide 2Met Ala Val Ile Ile
Phe Val Asn Gly Ile Arg Ala Val Asn Gly Leu1 5
10 15Val Lys Ser Ser Ile Asn Thr Ala Asn Ala Phe
Ala Glu Glu Gly Leu 20 25
30Asp Val His Leu Ile Asn Phe Val Gly Asn Ile Thr Gly Ala Glu His
35 40 45Leu Tyr Pro Pro Phe His Leu His
Pro Asn Val Lys Thr Ser Ser Ile 50 55
60Ile Asp Leu Phe Asn Asp Ile Pro Glu Asn Val Ser Cys Arg Asn Thr65
70 75 80Pro Phe Tyr Ser Ile
His Gln Gln Phe Phe Lys Ala Glu Tyr Ser Ala 85
90 95His Tyr Lys His Val Leu Met Lys Ile Glu Ser
Leu Leu Ser Ala Glu 100 105
110Asp Ser Ile Ile Phe Thr His Pro Leu Gln Leu Glu Met Tyr Arg Leu
115 120 125Ala Asn Asn Asp Ile Lys Ser
Lys Ala Lys Leu Ile Val Gln Ile His 130 135
140Gly Asn Tyr Met Glu Glu Ile His Asn Tyr Glu Ile Leu Ala Arg
Asn145 150 155 160Ile Asp
Tyr Val Asp Tyr Leu Gln Thr Val Ser Asp Glu Met Leu Glu
165 170 175Glu Met His Ser His Phe Lys
Ile Lys Lys Asp Lys Leu Val Phe Ile 180 185
190Pro Asn Ile Thr Tyr Pro Ile Ser Leu Glu Lys Lys Glu Ala
Asp Phe 195 200 205Phe Ile Lys Asp
Asn Glu Asp Ile Asp Asn Ala Gln Lys Phe Lys Arg 210
215 220Ile Ser Ile Val Gly Ser Ile Gln Pro Arg Lys Asn
Gln Leu Asp Ala225 230 235
240Ile Lys Ile Ile Asn Lys Ile Lys Asn Glu Asn Tyr Ile Leu Gln Ile
245 250 255Tyr Gly Lys Ser Ile
Asn Lys Asp Tyr Phe Glu Leu Ile Lys Lys Tyr 260
265 270Ile Lys Asp Asn Lys Leu Gln Asn Arg Ile Leu Phe
Lys Gly Glu Ser 275 280 285Ser Glu
Gln Glu Ile Tyr Glu Asn Thr Asp Ile Leu Ile Met Thr Ser 290
295 300Glu Ser Glu Gly Phe Pro Tyr Ile Phe Met Glu
Gly Met Val Tyr Asp305 310 315
320Ile Pro Ile Val Val Tyr Asp Phe Lys Tyr Gly Ala Asn Asp Tyr Ser
325 330 335Asn Tyr Asn Glu
Asn Gly Cys Val Phe Lys Thr Gly Asp Ile Ser Gly 340
345 350Met Ala Lys Lys Ile Ile Glu Leu Leu Asn Asn
Pro Glu Lys Tyr Lys 355 360 365Glu
Leu Val Gln Tyr Asn His Asn Arg Phe Leu Lys Glu Tyr Ala Lys 370
375 380Asp Val Val Met Ala Lys Tyr Phe Thr Ile
Leu Pro Arg Ser Phe Asn385 390 395
400Asn Val Ser Leu Ser Ser Ala Phe Ser Arg Lys Glu Leu Asp Glu
Phe 405 410 415Gln Asn Ile
Thr Phe Ser Ile Glu Asp Ser Asn Asp Leu Ala His Ile 420
425 430Trp Asn Phe Glu Leu Thr Asn Pro Ala Gln
Asn Met Asn Phe Phe Ala 435 440
445Leu Val Gly Lys Arg Lys Phe Pro Met Asp Ala His Ile Gln Gly Thr 450
455 460Gln Cys Thr Ile Lys Ile Ala His
Lys Lys Thr Gly Asn Leu Leu Ser465 470
475 480Leu Leu Leu Lys Lys Arg Asn Gln Leu Asn Leu Ser
Arg Gly Tyr Thr 485 490
495Leu Ile Ala Glu Asp Asn Ser Tyr Glu Lys Tyr Ile Gly Ala Ile Ser
500 505 510Asn Lys Gly Asn Phe Glu
Ile Ile Ala Asn Lys Lys Ser Ser Leu Val 515 520
525Thr Ile Asn Lys Ser Thr Leu Glu Leu His Glu Ile Pro His
Glu Leu 530 535 540His Gln Asn Lys Leu
Leu Ile Ala Leu Pro Asn Met Gln Thr Pro Leu545 550
555 560Lys Ile Thr Asp Asp Asn Leu Ile Pro Ile
Gln Ala Ser Ile Lys Leu 565 570
575Glu Lys Ile Gly Asn Thr Tyr Tyr Pro Cys Phe Leu Pro Ser Gly Ile
580 585 590Phe Asn Asn Ile Cys
Leu Asp Tyr Gly Glu Glu Ser Lys Ile Ile Asn 595
600 605Phe Ser Lys Tyr Ser Tyr Lys Tyr Ile Tyr Asp Ser
Ile Arg His Ile 610 615 620Glu Gln His
Thr Asp Ile Ser Asp Ile Ile Val Cys Asn Val Tyr Ser625
630 635 640Trp Glu Leu Ile Arg Ala Ser
Val Ile Glu Ser Leu Met Glu Phe Thr 645
650 655Gly Lys Trp Glu Lys His Phe Gln Thr Ser Pro Lys
Ile Asp Tyr Arg 660 665 670Phe
Asp His Glu Gly Lys Arg Ser Met Asp Asp Val Phe Ser Glu Glu 675
680 685Thr Phe Ile Met Glu Phe Pro Arg Lys
Asn Gly Ile Asp Lys Lys Thr 690 695
700Ala Ala Phe Gln Asn Ile Pro Asn Ser Ile Val Met Glu Tyr Pro Gln705
710 715 720Thr Asn Gly Tyr
Ser Met Arg Ser His Ser Leu Lys Ser Asn Val Val 725
730 735Ala Ala Lys His Phe Leu Glu Lys Leu Asn
Lys Ile Lys Val Asp Ile 740 745
750Lys Phe Lys Lys His Asp Leu Ala Asn Ile Lys Lys Met Asn Arg Ile
755 760 765Ile Tyr Glu His Leu Gly Ile
Asn Ile Asn Ile Glu Ala Phe Leu Lys 770 775
780Pro Arg Leu Glu Lys Phe Lys Arg Glu Glu Lys Tyr Phe His Asp
Phe785 790 795 800Phe Lys
Arg Asn Asn Phe Lys Glu Val Ile Phe Pro Ser Thr Tyr Trp
805 810 815Asn Pro Gly Ile Ile Cys Ala
Ala His Lys Gln Gly Ile Lys Val Ser 820 825
830Asp Ile Gln Tyr Ala Ala Ile Thr Pro Tyr His Pro Ala Tyr
Phe Lys 835 840 845Ser Pro Lys Ser
His Tyr Val Ala Asp Lys Leu Phe Leu Trp Ser Glu 850
855 860Tyr Trp Asn His Glu Leu Leu Pro Asn Pro Thr Arg
Glu Ile Gly Ser865 870 875
880Gly Ala Ala Tyr Trp Tyr Ala Leu Asp Asp Val Arg Phe Ser Glu Lys
885 890 895Leu Asn Tyr Asp Tyr
Ile Phe Leu Ser Gln Ser Arg Ile Ser Ser Arg 900
905 910Leu Leu Ser Phe Ala Ile Glu Phe Ala Leu Lys Asn
Pro Gln Leu Gln 915 920 925Leu Leu
Phe Ser Lys His Pro Asp Glu Asn Ile Asp Leu Lys Asn Arg 930
935 940Ile Ile Pro Asp Asn Leu Ile Ile Ser Thr Glu
Ser Ser Ile Gln Gly945 950 955
960Ile Asn Glu Ser Arg Val Ala Val Gly Val Tyr Ser Thr Ser Leu Phe
965 970 975Glu Ala Leu Ala
Cys Gly Lys Gln Thr Phe Val Val Lys Tyr Pro Gly 980
985 990Tyr Glu Ile Met Ser Asn Glu Ile Asp Ser Gly
Leu Phe Phe Ala Val 995 1000
1005Glu Thr Pro Glu Glu Met Leu Glu Lys Thr Ser Pro Asn Trp Val
1010 1015 1020Ala Val Ala Asp Ile Glu
Asn Gln Phe Phe Gly Gln Glu Lys Leu 1025 1030
1035Glu His His His His His His 1040
10453228PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 3Met Glu Lys Gln Asn Ile Ala Val Ile Leu Ala
Arg Gln Asn Ser Lys1 5 10
15Gly Leu Pro Leu Lys Asn Leu Arg Lys Met Asn Gly Ile Ser Leu Leu
20 25 30Gly His Thr Ile Asn Ala Ala
Ile Ser Ser Lys Cys Phe Asp Arg Ile 35 40
45Ile Val Ser Thr Asp Gly Gly Leu Ile Ala Glu Glu Ala Lys Asn
Phe 50 55 60Gly Val Glu Val Val Leu
Arg Pro Ala Glu Leu Ala Ser Asp Thr Ala65 70
75 80Ser Ser Ile Ser Gly Val Ile His Ala Leu Glu
Thr Ile Gly Ser Asn 85 90
95Ser Gly Thr Val Thr Leu Leu Gln Pro Thr Ser Pro Leu Arg Thr Gly
100 105 110Ala His Ile Arg Glu Ala
Phe Ser Leu Phe Asp Glu Lys Ile Lys Gly 115 120
125Ser Val Val Ser Ala Cys Pro Met Glu His His Pro Leu Lys
Thr Leu 130 135 140Leu Gln Ile Asn Asn
Gly Glu Tyr Ala Pro Met Arg His Leu Ser Asp145 150
155 160Leu Glu Gln Pro Arg Gln Gln Leu Pro Gln
Ala Phe Arg Pro Asn Gly 165 170
175Ala Ile Tyr Ile Asn Asp Thr Ala Ser Leu Ile Ala Asn Asn Cys Phe
180 185 190Phe Ile Ala Pro Thr
Lys Leu Tyr Ile Met Ser His Gln Asp Ser Ile 195
200 205Asp Ile Asp Thr Glu Leu Asp Leu Gln Gln Ala Glu
Asn Ile Leu Asn 210 215 220His Lys Glu
Ser2254509PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 4Met Thr Glu Ile Asn Asp Lys Ala Gln Leu Asp
Ile Ala Ala Ala Gly1 5 10
15Asp Thr Asp Ala Val Thr Ser Asp Thr Pro Glu Glu Thr Val Asn Thr
20 25 30Pro Glu Val Asp Glu Thr Phe
Glu Leu Ser Ala Ala Lys Met Arg Glu 35 40
45His Gly Met Ser Glu Thr Ala Ile Asn Gln Phe His His Leu Tyr
Asp 50 55 60Val Trp Arg His Glu Glu
Ala Ser Ser Trp Ile Arg Glu Asp Asp Ile65 70
75 80Glu Pro Leu Gly His Val Pro Ser Phe His Asp
Val Tyr Glu Thr Ile 85 90
95Asn His Asp Lys Ala Val Asp Ala Phe Ala Lys Thr Ala Phe Leu Lys
100 105 110Leu Asn Gly Gly Leu Gly
Thr Ser Met Gly Leu Asp Lys Ala Lys Ser 115 120
125Leu Leu Pro Val Arg Arg His Lys Ala Lys Gln Met Arg Phe
Ile Asp 130 135 140Ile Ile Ile Gly Gln
Val Leu Thr Ala Arg Thr Arg Leu Asn Val Glu145 150
155 160Leu Pro Leu Thr Phe Met Asn Ser Phe His
Thr Ser Ala Asp Thr Met 165 170
175Lys Val Leu Lys His His Arg Lys Phe Ser Gln His Asp Val Pro Met
180 185 190Glu Ile Ile Gln His
Gln Glu Pro Lys Leu Val Ala Ala Thr Gly Glu 195
200 205Pro Val Ser Tyr Pro Ala Asn Pro Glu Leu Glu Trp
Cys Pro Pro Gly 210 215 220His Gly Asp
Leu Phe Ser Thr Ile Trp Glu Ser Gly Leu Leu Asp Val225
230 235 240Leu Glu Glu Arg Gly Phe Lys
Tyr Leu Phe Ile Ser Asn Ser Asp Asn 245
250 255Leu Gly Ala Arg Ala Ser Arg Thr Leu Ala Gln His
Phe Glu Asn Thr 260 265 270Gly
Ala Pro Phe Met Ala Glu Val Ala Ile Arg Thr Lys Ala Asp Arg 275
280 285Lys Gly Gly His Ile Val Arg Asp Lys
Ala Thr Gly Arg Leu Ile Leu 290 295
300Arg Glu Met Ser Gln Val His Pro Asp Asp Lys Glu Ala Ala Gln Asp305
310 315 320Ile Thr Lys His
Pro Tyr Phe Asn Thr Asn Ser Ile Trp Val Arg Ile 325
330 335Asp Ala Leu Lys Asp Lys Leu Ala Glu Cys
Asp Gly Val Leu Pro Leu 340 345
350Pro Val Ile Arg Asn Lys Lys Thr Val Asn Pro Thr Asp Pro Asp Ser
355 360 365Glu Gln Val Ile Gln Leu Glu
Thr Ala Met Gly Ala Ala Ile Gly Leu 370 375
380Phe Asn Gly Ser Ile Cys Val Gln Val Asp Arg Met Arg Phe Leu
Pro385 390 395 400Val Lys
Thr Thr Asn Asp Leu Phe Ile Met Arg Ser Asp Arg Phe His
405 410 415Leu Thr Asp Thr Tyr Glu Met
Glu Asp Gly Asn Tyr Ile Phe Pro Asn 420 425
430Val Glu Leu Asp Pro Arg Tyr Tyr Lys Asn Ile His Asp Phe
Asp Glu 435 440 445Arg Phe Pro Tyr
Ala Val Pro Ser Leu Ala Ala Ala Asn Ser Val Ser 450
455 460Ile Gln Gly Asp Trp Thr Phe Gly Arg Asp Val Met
Met Phe Ala Asp465 470 475
480Ala Lys Leu Glu Asp Lys Gly Glu Pro Ser Tyr Val Pro Asn Gly Glu
485 490 495Tyr Val Gly Pro Gln
Gly Ile Glu Pro Asp Asp Trp Val 500
5055392PRTArtificial SequenceDescription of Artificial Sequence Synthetic
polypeptide 5Met Ala Gln His Leu Thr Thr Glu Ala Leu Arg Lys Asp Phe
Leu Ala1 5 10 15Val Phe
Gly Gln Glu Ala Asp Gln Thr Phe Phe Ser Pro Gly Arg Ile 20
25 30Asn Leu Ile Gly Glu His Thr Asp Tyr
Asn Gly Gly His Val Phe Pro 35 40
45Ala Ala Ile Ser Leu Gly Thr Tyr Gly Ala Ala Arg Lys Arg Asp Asp 50
55 60Gln Val Leu Arg Phe Tyr Ser Ala Asn
Phe Glu Asp Lys Gly Ile Ile65 70 75
80Glu Val Pro Leu Ala Asp Leu Lys Phe Glu Lys Glu His Asn
Trp Thr 85 90 95Asn Tyr
Pro Lys Gly Val Leu His Phe Leu Gln Glu Ala Gly His Val 100
105 110Ile Asp Lys Gly Phe Asp Phe Tyr Val
Tyr Gly Asn Ile Pro Asn Gly 115 120
125Ala Gly Leu Ser Ser Ser Ala Ser Leu Glu Leu Leu Thr Gly Val Val
130 135 140Ala Glu His Leu Phe Asp Leu
Lys Leu Glu Arg Leu Asp Leu Val Lys145 150
155 160Ile Gly Lys Gln Thr Glu Asn Asn Phe Ile Gly Val
Asn Ser Gly Ile 165 170
175Met Asp Gln Phe Ala Ile Gly Met Gly Ala Asp Gln Arg Ala Ile Tyr
180 185 190Leu Asp Thr Asn Thr Leu
Glu Tyr Asp Leu Val Pro Leu Asp Leu Lys 195 200
205Asp Asn Val Val Val Ile Met Asn Thr Asn Lys Arg Arg Glu
Leu Ala 210 215 220Asp Ser Lys Tyr Asn
Glu Arg Arg Ala Glu Cys Glu Lys Ala Val Glu225 230
235 240Glu Leu Gln Val Ser Leu Asp Ile Gln Thr
Leu Gly Glu Leu Asp Glu 245 250
255Trp Ala Val Asp Gln Tyr Ser Tyr Leu Ile Lys Asp Glu Asn Arg Leu
260 265 270Lys Arg Ala Arg His
Ala Val Leu Glu Asn Gln Arg Thr Leu Lys Ala 275
280 285Gln Val Ala Leu Gln Ala Gly Asp Leu Glu Thr Phe
Gly Arg Leu Met 290 295 300Asn Ala Ser
His Val Ser Leu Glu His Asp Tyr Glu Val Thr Gly Leu305
310 315 320Glu Leu Asp Thr Leu Val His
Thr Ala Trp Ala Gln Glu Gly Val Leu 325
330 335Gly Ala Arg Met Thr Gly Ala Gly Phe Gly Gly Cys
Ala Ile Ala Leu 340 345 350Val
Gln Lys Asp Thr Val Glu Ala Phe Lys Glu Ala Val Gly Lys His 355
360 365Tyr Glu Glu Val Val Gly Tyr Ala Pro
Ser Phe Tyr Ile Ala Glu Val 370 375
380Ala Gly Gly Thr Arg Val Leu Asp385
3906175PRTArtificial SequenceDescription of Artificial Sequence Synthetic
polypeptide 6Met Gly Leu Glu Thr Val Pro Ala Gly Lys Ala Leu Pro Asp
Asp Ile1 5 10 15Tyr Val
Val Ile Glu Ile Pro Ala Asn Ser Asp Pro Ile Lys Tyr Glu 20
25 30Val Asp Lys Glu Ser Gly Ala Leu Phe
Val Asp Arg Phe Met Ala Thr 35 40
45Ala Met Phe Tyr Pro Ala Asn Tyr Gly Tyr Val Asn Asn Thr Leu Ser 50
55 60Leu Asp Gly Asp Pro Val Asp Val Leu
Val Pro Thr Pro Tyr Pro Leu65 70 75
80Gln Pro Gly Ser Val Ile Arg Cys Arg Pro Val Gly Val Leu
Lys Met 85 90 95Thr Asp
Glu Ala Gly Ser Asp Ala Lys Val Val Ala Val Pro His Ser 100
105 110Lys Leu Thr Lys Glu Tyr Asp His Ile
Lys Asp Val Asn Asp Leu Pro 115 120
125Ala Leu Leu Lys Ala Gln Ile Gln His Phe Phe Glu Ser Tyr Lys Ala
130 135 140Leu Glu Ala Gly Lys Trp Val
Lys Val Asp Gly Trp Glu Gly Val Asp145 150
155 160Ala Ala Arg Gln Glu Ile Leu Asp Ser Phe Glu Arg
Ala Lys Lys 165 170
175744DNAArtificial SequenceDescription of Artificial Sequence Synthetic
primer 7agctcatatg gccgttatta tttttgtgaa tggtattcgt gccg
44849DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 8agctaagctt ttacttctct tggccgaaaa actggttttc
aatatctgc 4996PRTArtificial SequenceDescription of
Artificial Sequence Synthetic 6xHis tag 9His His His His His His1
5
User Contributions:
Comment about this patent or add new information about this topic: