Patent application title: T CELL RECRUITING POLYPEPTIDES BASED ON TCR ALPHA/BETA REACTIVITY
Inventors:
Annelies Roobrouck (Oudenaarde, BE)
Diane Van Hoorick (Laarne, BE)
Diane Van Hoorick (Laarne, BE)
João Vieira (Didcot, GB)
Assignees:
ABLYNX NV
IPC8 Class: AC07K1646FI
USPC Class:
1 1
Class name:
Publication date: 2021-12-23
Patent application number: 20210395398
Abstract:
T cell recruiting polypeptides are provided that bind the constant domain
of TCR on a T cell. The polypeptides can be used in methods for treatment
of cancers.Claims:
1.-81. (canceled)
82. A process for the production of the polypeptide, said process comprising culturing a host cell transformed or transfected with a nucleic acid or nucleic acid sequence encoding a polypeptide comprising a first and a second immunoglobulin single variable domain (ISV), wherein said first ISV specifically binds to the constant domain of the T cell receptor (TCR) present on a T cell; said second ISV specifically binds to a first antigen on a target cell; wherein said first antigen is different from said TCR; and wherein said target cell is different from said T cell under conditions allowing the expression of the polypeptide, and recovering the produced polypeptide from the culture.
83.-86. (canceled)
87. A method for the treatment or amelioration of a disease selected from the group consisting of a proliferative disease, an inflammatory disease, an infectious disease and an autoimmune disease, comprising administering to a subject in need thereof a polypeptide comprising a first and a second immunoglobulin single variable domain (ISV), wherein said first ISV specifically binds to the constant domain of the T cell receptor (TCR) present on a T cell; said second ISV specifically binds to a first antigen on a target cell; wherein said first antigen is different from said TCR; and wherein said target cell is different from said T cell.
88. The method according to claim 87, wherein said proliferative disease is cancer.
89. The method according to claim 88, wherein said cancer is chosen from the group consisting of carcinomas, gliomas, mesotheliomas, melanomas, lymphomas, leukemias, adenocarcinomas: breast cancer, ovarian cancer, cervical cancer, glioblastoma, multiple myeloma (including monoclonal gammopathy of undetermined significance, asymptomatic and symptomatic myeloma), prostate cancer, and Burkitt's lymphoma, head and neck cancer, colon cancer, colorectal cancer, non-small cell lung cancer, small cell lung cancer, cancer of the esophagus, stomach cancer, pancreatic cancer, hepatobiliary cancer, cancer of the gallbladder, cancer of the small intestine, rectal cancer, kidney cancer, bladder cancer, prostate cancer, penile cancer, urethral cancer, testicular cancer, vaginal cancer, uterine cancer, thyroid cancer, parathyroid cancer, adrenal cancer, pancreatic endocrine cancer, carcinoid cancer, bone cancer, skin cancer, retinoblastomas, Hodgkin's lymphoma, non-Hodgkin's lymphoma, Kaposi's sarcoma, multicentric Castleman's disease or AIDS-associated primary effusion lymphoma, neuroectodermal tumors, rhabdomyosarcoma; as well as any metastasis of any of the above cancers.
90. The method according to claim 88, wherein the treatment is a combination treatment.
91. (canceled)
92. The method according to claim 87, wherein said first ISV binds to the constant domain of a T cell receptor .alpha. (TCR-.alpha.) (SEQ ID NO: 348 and/or SEQ ID NO: 484) and/or the constant domain of the T cell receptor .beta. (TCR-.beta.) (SEQ ID NO: 349 and/or SEQ ID NO: 485), or polymorphic variants or isoforms thereof.
93. The method according to claim 87, wherein said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which: (i) CDR1 is chosen from the group consisting of: (a) SEQ ID NOs: 119-133; or (b) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 123 or with any of SEQ ID NOs: 119-133; and/or (ii) CDR2 is chosen from the group consisting of: (c) SEQ ID NOs: 134-163; or (d) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 153 or with any of SEQ ID NOs: 134-163; and/or (iii) CDR3 is chosen from the group consisting of: (e) SEQ ID NOs: 164-174; or (f) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 170 or with any of SEQ ID NOs: 164-174.
94. The method according to claim 87, further comprising a third ISV, which specifically binds to a second antigen on a target cell, wherein said second antigen is different from said first antigen.
95. The method according to claim 87, wherein said first antigen on a target cell is a tumour antigen, preferably a tumour associated antigen (TAA).
96. The method according to claim 94, wherein said second antigen on a target cell is a tumour antigen, preferably a tumour associated antigen (TAA).
97. The method according to claim 94, wherein said first antigen and said second antigen are present on the same target cell.
98. The method according to claim 94, wherein said first antigen and said second antigen are present on different target cells.
99. The method according to claim 87, further comprising a serum protein binding moiety.
100. The method according to claim 99, wherein said serum protein binding moiety is an ISV binding serum albumin.
101. The method according to claim 87, wherein said first ISV and said second ISV are linked via a linker.
102. The method according to claim 101, wherein said linker is chosen from the group consisting of linkers of 5GS, 7GS, 9GS, 10GS, 15GS, 18GS, 20GS, 25GS, 30GS and 35GS (SEQ ID NOs: 376 to 385).
103. The method according to claim 87, wherein said ISV is a Nanobody, a V.sub.HH, a humanized VHH, or a camelized V.sub.H.
104. The method according to claim 95, wherein said TAA is chosen from the group consisting of Melanoma-associated Chondroitin Sulfate Proteoglycan (MCSP), Epidermal Growth Factor Receptor (EGFR), Fibroblast Activation Protein (FAP), MART-1, carcinoembryonic antigen (CEA), gp100, MAGE-1, HER-2, LewisY antigens, CD123, CD44, CLL-1, CD96, CD47, CD32, CXCR4, Tim-3, CD25, TAG-72, Ep-CAM, PSMA, PSA, GD2, GD3, CD4, CD5, CD19, CD20, CD22, CD33, CD36, CD45, CD52, CD147, growth factor receptors including ErbB3 and ErbB4, Cytokine receptors including Interleukin-2 receptor gamma chain (CD132 antigen), Interleukin-10 receptor alpha chain (IL-10R-A), Interleukin-10 receptor beta chain (IL-10R-B), Interleukin-12 receptor beta-1 chain (IL-12R-beta1), Interleukin-12 receptor beta-2 chain (IL-12 receptor beta-2), Interleukin-13 receptor alpha-1 chain (IL-13R-alpha-1) (CD213a1 antigen), Interleukin-13 receptor alpha-2 chain (Interleukin-13 binding protein), Interleukin-17 receptor (IL-17 receptor), Interleukin-17B receptor (IL-17B receptor), Interleukin 21 receptor precursor (IL-21R), Interleukin-1 receptor type I (IL-1R-1) (CD121a), Interleukin-1 receptor type II (IL-1R-beta) (CDw121b), Interleukin-1 receptor antagonist protein (IL-1ra), Interleukin-2 receptor alpha chain (CD25 antigen), Interleukin-2 receptor beta chain (CD122 antigen), Interleukin-3 receptor alpha chain (IL-3R-alpha) (CD123 antigen), CD30, IL23R, IGF-1R, IL5R, IgE, CD248 (endosialin), CD44v6, gpA33, Ron, Trop2, PSCA, claudin 6, claudin 18.2, CLEC12A, CD38, ephA2, c-Met, CD56, MUC16, EGFRvIII, AGS-16, CD27L, Nectin-4, SLITRK6, mesothelin, folate receptor, tissue factor, axl, glypican-3, CA9, Cripto, CD138, CD37, MUC1, CD70, gastrin releasing peptide receptor, PAP, CEACAM5, CEACAM6, CXCR7, N-cadherin, FXYD2 gamma a, CD21, CD133, Na/K-ATPase, mIgM (membrane-bound IgM), mIgA (membrane-bound IgA), Mer, Tyro2, CD120, CD95, CA 195, DR5, DR6, DcR3 and CAIX, and related polymorphic variants and isoforms.
105. The method according to claim 96, wherein said TAA is chosen from the group consisting of Melanoma-associated Chondroitin Sulfate Proteoglycan (MCSP), Epidermal Growth Factor Receptor (EGFR), Fibroblast Activation Protein (FAP), MART-1, carcinoembryonic antigen (CEA), gp100, MAGE-1, HER-2, LewisY antigens, CD123, CD44, CLL-1, CD96, CD47, CD32, CXCR4, Tim-3, CD25, TAG-72, Ep-CAM, PSMA, PSA, GD2, GD3, CD4, CD5, CD19, CD20, CD22, CD33, CD36, CD45, CD52, CD147, growth factor receptors including ErbB3 and ErbB4, Cytokine receptors including Interleukin-2 receptor gamma chain (CD132 antigen), Interleukin-10 receptor alpha chain (IL-10R-A), Interleukin-10 receptor beta chain (IL-10R-B), Interleukin-12 receptor beta-1 chain (IL-12R-beta1), Interleukin-12 receptor beta-2 chain (IL-12 receptor beta-2), Interleukin-13 receptor alpha-1 chain (IL-13R-alpha-1) (CD213a1 antigen), Interleukin-13 receptor alpha-2 chain (Interleukin-13 binding protein), Interleukin-17 receptor (IL-17 receptor), Interleukin-17B receptor (IL-17B receptor), Interleukin 21 receptor precursor (IL-21R), Interleukin-1 receptor type I (IL-1R-1) (CD121a), Interleukin-1 receptor type II (IL-1R-beta) (CDw121b), Interleukin-1 receptor antagonist protein (IL-1ra), Interleukin-2 receptor alpha chain (CD25 antigen), Interleukin-2 receptor beta chain (CD122 antigen), Interleukin-3 receptor alpha chain (IL-3R-alpha) (CD123 antigen), CD30, IL23R, IGF-1R, IL5R, IgE, CD248 (endosialin), CD44v6, gpA33, Ron, Trop2, PSCA, claudin 6, claudin 18.2, CLEC12A, CD38, ephA2, c-Met, CD56, MUC16, EGFRvIII, AGS-16, CD27L, Nectin-4, SLITRK6, mesothelin, folate receptor, tissue factor, axl, glypican-3, CA9, Cripto, CD138, CD37, MUC1, CD70, gastrin releasing peptide receptor, PAP, CEACAM5, CEACAM6, CXCR7, N-cadherin, FXYD2 gamma a, CD21, CD133, Na/K-ATPase, mIgM (membrane-bound IgM), mIgA (membrane-bound IgA), Mer, Tyro2, CD120, CD95, CA 195, DR5, DR6, DcR3 and CAIX, and related polymorphic variants and isoforms.
106. The method according to claim 94, wherein said first antigen and said second antigen are chosen from the group consisting of: EGFR as a first antigen and CEA as a second antigen; CD19 as a first antigen and CD20 as a second antigen; CD19 as a first antigen and CD22 as a second antigen; CD123 as a first antigen and Tim-3 as a second antigen; and CD123 as a first antigen and CD69 as a second antigen.
Description:
RELATED APPLICATIONS
[0001] This application is a divisional application of U.S. application Ser. No. 15/573,288, filed Nov. 10, 2017, which is a national stage filing under 35 U.S.C. .sctn. 371 of International Application No. PCT/EP2016/060859, filed May 13, 2016, and claims the benefit under 35 U.S.C. .sctn. 119(e) of U.S. provisional application Ser. No. 62/319,486, filed Apr. 7, 2016, and of U.S. provisional application Ser. No. 62/160,757, filed May 13, 2015, the entire contents of each of which is incorporated by reference herein in its entirety.
REFERENCE TO A SEQUENCE LISTING SUBMITTED AS A TEXT FILE VIA EFS-WEB
[0002] The instant application contains a Sequence Listing which has been submitted in ASCII format via EFS-Web and is hereby incorporated by reference in its entirety. Said ASCII copy, created on Dec. 15, 2020, is named A0848.70180US03-SEQ-JRV, and is 572,050 bytes in size.
FIELD OF THE INVENTION
[0003] The present invention provides multispecific T cell recruiting polypeptides binding the constant domain of TCR on a T cell and at least one antigen on a target cell. The present invention also relates to the monovalent T cell recruiting polypeptides for use in these multispecific polypeptides. The invention also provides methods for treatment and kits providing the same.
BACKGROUND
[0004] Cancer takes an enormous human toll around the world. It is nowadays the world's leading cause of death, followed by heart disease and stroke. Cancers figure among the leading causes of morbidity and mortality worldwide, with approximately 14 million new cases and 8.2 million cancer related deaths in 2012. The number of new cases is expected to rise by about 70% over the next 2 decades (source: WHO Cancer). The total economic impact of premature death and disability from cancer worldwide was about $900 billion in 2008, representing 1.5% of the world's gross domestic product.
[0005] Available treatment regimens for solid tumours typically include a combination of surgical resection chemotherapy and radiotherapy. In 40 years of clinical experience little progress has been achieved, especially in advanced stages of cancer.
[0006] New therapies combatting cancer are eagerly awaited.
[0007] Antibody therapy is now an important part of the physician's armamentarium to battle diseases and especially cancer. Monoclonal antibodies have been established as a key therapeutic approach for a range of diseases already for several years. All of the contemporaneously approved antibody therapies rely on monospecific monoclonal antibodies (mAbs). Until today, most of the targets of the mAbs require either an agonistic or an antagonistic approach. Whereas targeting of cell-surface antigens themselves can mediate antitumour activity through the induction of apoptosis, most mAb-based activity against hematologic malignancies is reliant on either Fc-mediated effector functions such as complement dependent cytotoxicity (CDC) and antibody-dependent cell-mediated cytotoxicity (ADCC).
[0008] Immunotherapy has emerged as a rapidly growing area of cancer research. Immunotherapy is directing the body's immune surveillance system, and in particular T cells, to cancer cells.
[0009] Cytotoxic T cells (CTL) are T lymphocytes that kill cancer cells, cells that are infected (particularly with viruses), or cells that are damaged in other ways. T lymphocytes (or T cells) express the T cell receptor or TCR molecule and the CD3 receptor on the cell surface. The .alpha..beta. TCR-CD3 complex (or "TCR complex") is composed of six different type I single-spanning transmembrane proteins: the TCR.alpha. and TCR.beta. chains that form the TCR heterodimer responsible for ligand recognition, and the non-covalently associated CD3.gamma., CD3.delta., CD3.epsilon. and .zeta. chains, which bear cytoplasmic sequence motifs that are phosphorylated upon receptor activation and recruit a large number of signalling components (Call et al. 2004, Molecular Immunology 40: 1295-1305).
[0010] Both .alpha. and .beta. chains of the T cell receptor consist of a constant domain and a variable domain. Physiologically, the .alpha..beta. chains of the T cell receptor recognize the peptide loaded MHC complex and couple upon engagement to the CD3 chains. These CD3 chains subsequently transduce the engagement signal to the intracellular environment.
[0011] Considering the potential of naturally occurring cytotoxic T lymphocytes (CTLs) to mediate cell lysis, various strategies have been explored to recruit immune cells to mediate tumour cell killing. Since T lymphocytes lack the expression of Fc receptors, they are not recruited to a tumour site through the Fc tail of an anti-tumour monoclonal. As an alternative, the patient's T cells were modified with a second TCR of known specificity for a defined tumour antigen. This adoptive cell transfer is by nature highly personalized and labour intensive. However, the main problem of T cell therapies remains the large number of immune escape mechanisms known to occur in cancer patients (Nagorsen et al. 2012, Pharmacology & Therapeutics 136: 334-342).
[0012] Rather than eliciting specific T cell responses, which rely on expression by cancer cells of MHC molecules and the presence, generation, transport and display of specific peptide antigens, more recent developments have attempted to combine the advantages of immunotherapy with antibody therapy by engaging all T cells of a patient in a polyclonal fashion via recombinant antibody based technologies: "bispecifics".
[0013] Bispecific antibodies have been engineered that have a tumour recognition part on the one arm (target-binding arm) whereas the other arm of the molecule has specificity for a T cell antigen (effector-binding arm), mostly CD3. Through the simultaneous binding of the two arms to their respective antigens, T lymphocytes are directed towards and activated at the tumour cell where they can exert their cytolytic function.
[0014] The concept of using bispecific antibodies to activate T cells against tumour cells was described more than 20 years ago, but manufacturing problems and clinical failures sent the field into stagnation. Smaller format bispecifics were developed, which more easily penetrate tissues and tumours than conventional antibodies. In addition, the smaller format is better at creating the cytolytic synapses, which kill the target cell. It was thought that the smaller format bispecifics would be easier to manufacture and less immunogenic than conventional antibodies. However, the smaller bispecific BiTE molecules, consisting of two single chain variable fragments (scFvs) joined by a 5 amino acid peptide linker, presented a lack of stability (scFvs tend to aggregate), low expression titres and poor solubility. Moreover, the first clinical trials of Blinatumomab (a BiTE molecule), which recognizes CD3 chains, were prematurely stopped due to neurologic adverse events, cytokine release syndrome and infections on the one hand and the absence of objective clinical responses or robust signs of biological activity on the other hand. Efficacy aside, BiTEs must be continuously infused--probably due to the lack of an Fc domain--which does not contribute to patient compliance. The same problem holds true for DARTs (dual affinity retargeting molecules developed by MacroGenics), in which the heavy chain variable domain from one antibody (Ab) is linked with the light chain variable domain of another Ab. MacroGenics now attempts to solve this problem by fusing an Fc domain onto its next generation DARTs, which makes the molecule not only bigger, but also results in manufacturing problems and importation of other Fc functions. The larger format with Fc is expected to have a better PK, but re-introduces the risk of off-target activity. (Garber 2014, Nature reviews 13: 799-801)
[0015] Hence, there remains a need for alternative bispecific formats.
SUMMARY OF THE INVENTION
[0016] The invention solves this problem by providing multispecific polypeptides comprising a first and at least one further immunoglobulin single variable domain (ISV), wherein said first ISV has a high affinity for/binds to a constant domain of the T cell receptor (TCR); said at least one second ISV has a high affinity for/binds to an antigen present on a target cell. In a particular aspect, the binding of the first ISV will activate the inherent cytolytic potential of the T cell against a target cell independently of MHC.
[0017] Thus, in a first aspect the present invention provides a polypeptide comprising a first and a second immunoglobulin single variable domain (ISV), wherein
[0018] said first ISV has high affinity for/binds to the constant domain of the T cell receptor (TCR) present on a T cell;
[0019] said second ISV has high affinity for/binds to a first antigen on a target cell;
[0020] wherein said first antigen is different from said TCR; and
[0021] wherein said target cell is different from said T cell.
[0022] In a further aspect, the present invention provides a polypeptide as described herein, wherein said polypeptide directs the T cell to the target cell.
[0023] In a further aspect, the present invention provides a polypeptide as described herein, wherein said polypeptide induces T cell activation.
[0024] In a further aspect, the present invention provides a polypeptide as described herein, wherein said T cell activation is independent from MHC recognition.
[0025] In a further aspect, the present invention provides a polypeptide as described herein, wherein said T cell activation depends on presenting said polypeptide bound to said first antigen on a target cell to a T cell.
[0026] In a further aspect, the present invention provides a polypeptide as described herein, wherein said T cell activation causes one or more cellular response of said T cell, wherein said cellular response is selected from the group consisting of proliferation, differentiation, cytokine secretion, cytotoxic effector molecule release, cytotoxic activity, expression of activation markers and redirected target cell lysis.
[0027] In a further aspect, the present invention provides a polypeptide as described herein, wherein said T cell activation causes inhibition of an activity of said target cell by more than about 10%, such as 20%, 30%, or 40% or even more than 50%, such as more than 60%, such as 70%, 80%, or even more than 90%, such as 100%.
[0028] In a further aspect, the present invention provides a polypeptide as described herein, wherein said first ISV binds to the constant domain of a T cell receptor .alpha. (TCR-.alpha.) (SEQ ID NO: 348) and/or the constant domain of the T cell receptor .beta. (TCR-.beta.) (SEQ ID NO: 349), or polymorphic variants or isoforms thereof.
[0029] Alternatively, the present invention provides a polypeptide as described herein, wherein said first ISV binds to the constant domain of a T cell receptor .alpha. (TCR-.alpha.) (SEQ ID NO: 484) and/or the constant domain of the T cell receptor .beta. (TCR-.beta.) (SEQ ID NO: 485), or polymorphic variants or isoforms thereof.
[0030] In a further aspect, the present invention provides a polypeptide as described herein, wherein said polypeptide and/or first ISV has an on rate constant (Kon) for binding to said TCR selected from the group consisting of at least about 10.sup.2 M.sup.-1s.sup.-1, at least about 10.sup.3 M.sup.-1s.sup.-1, at least about 10.sup.4 M.sup.-1s.sup.-1, at least about 10.sup.5 M.sup.-1s.sup.-1, at least about 10.sup.6 M.sup.-1s.sup.-1, 10.sup.7 M.sup.-1s.sup.-1, at least about 10.sup.8 M.sup.-1s.sup.-1, at least about 10.sup.9 M.sup.-1s.sup.-1, and at least about 10.sup.10 M.sup.-1s.sup.-1, preferably as measured by surface plasmon resonance or BLI.
[0031] In a further aspect, the present invention provides a polypeptide as described herein, wherein said polypeptide and/or first ISV has an off rate constant (Koff) for binding to said TCR selected from the group consisting of at most about 10.sup.-3 s.sup.-1, at most about 10.sup.-4 s.sup.-1, at most about 10.sup.-5 s.sup.-1, at most about 10.sup.-6 s.sup.-1, at most about 10.sup.-7 s.sup.-1, at most about 10.sup.-8 s.sup.-1, at most about 10.sup.-9 s.sup.-1, and at most about 10.sup.-10 s.sup.-1, preferably as measured by surface plasmon resonance or BLI.
[0032] In a further aspect, the present invention provides a polypeptide as described herein, wherein said first ISV binds to said TCR with an EC50 value of between 100 nM and 1 pM, such as at an average EC50 value of 100 nM or less, even more preferably at an average EC50 value of 90 nM or less, such as less than 80, 70, 60, 50, 40, 30, 20, 10, 5 nM or even less, such as less than 4, 3, 2, or 1 nM or even less, such as less than 500, 400, 300, 200, 100, 90, 80, 70, 60, 50, 40, 30, 20, 10, 5 pM, or even less, such as less than 4 pM, preferably as measured by flow cytometry.
[0033] In a further aspect, the present invention provides a polypeptide as described herein, wherein said first ISV binds to said TCR with an average KD value of between 100 nM and 10 pM, such as at an average KD value of 90 nM or less, even more preferably at an average KD value of 80 nM or less, such as less than 70, 60, 50, 40, 30, 20, 10, 5 nM or even less, such as less than 4, 3, 2, or 1 nM, such as less than 500, 400, 300, 200, 100, 90, 80, 70, 60, 50, 40, 30, 20 pM, or even less, such as less than 10 pM. Preferably, the KD is determined by Kinexa, BLI or SPR, for instance as determined by Proteon.
[0034] In a further aspect, the present invention provides a polypeptide as described herein, wherein said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which:
[0035] (i) CDR1 is chosen from the group consisting of:
[0036] (a) SEQ ID NOs: 119-133; or (b) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 123 or with any of SEQ ID NOs: 199-133, provided that the polypeptide comprising the CDR1 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR1 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance; and/or
[0037] (ii) CDR2 is chosen from the group consisting of:
[0038] (c) SEQ ID NOs: 134-163; or (d) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 153 or with any of SEQ ID NOs: 134-163, provided that the polypeptide comprising the CDR2 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR2 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance; and/or
[0039] (iii) CDR3 is chosen from the group consisting of:
[0040] (e) SEQ ID NOs: 164-174; or (f) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 170 or with any of SEQ ID NOs: 164-174, provided that the polypeptide comprising the CDR3 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR3 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance.
[0041] In a further aspect, the present invention provides a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which CDR1 is chosen from the group consisting of
[0042] (a) SEQ ID NO: 123; and
[0043] (b) amino acid sequences that have 1, 2 or 3 amino acid difference(s) with SEQ ID NO: 123, wherein
[0044] at position 2 the D has been changed into A, S, E or G;
[0045] at position 4 the H has been changed into Y;
[0046] at position 5 the K has been changed into L;
[0047] at position 6 the I has been changed into L;
[0048] at position 8 the F has been changed into I or V; and/or
[0049] at position 10 the G has been changed into S.
[0050] In a further aspect, the present invention provides a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which CDR2 is chosen from the group consisting of
[0051] (a) SEQ ID NO: 153; and
[0052] (b) amino acid sequences that have 1, 2, 3, 4 or 5 amino acid difference(s) with SEQ ID NO: 153, wherein
[0053] at position 1 the H has been changed into T or R;
[0054] at position 3 the S has been changed into T or A;
[0055] at position 5 the G has been changed into S or A;
[0056] at position 7 the Q has been changed into D, E, T, A or V;
[0057] at position 8 the T has been changed into A or V; and/or
[0058] at position 9 the D has been changed into A, Q, N, V or S.
[0059] In a further aspect, the present invention provides a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which CDR3 is chosen from the group consisting of
[0060] (a) SEQ ID NO: 170; and
[0061] (b) amino acid sequences that have 1, 2 or 3 amino acid difference(s) with SEQ ID NO: 170, wherein
[0062] at position 1 the F has been changed into Y, L or G;
[0063] at position 4 the I has been changed into L;
[0064] at position 5 the Y has been changed into W; and/or
[0065] at position 8 the D has been changed into N or S.
[0066] Preferably, the polypeptide comprising the one or more CDRs with 5, 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDRs without the 5, 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance.
[0067] In a further aspect, the present invention provides a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which
[0068] (i) CDR1 is chosen from the group consisting of
[0069] (a) SEQ ID NO: 123; and
[0070] (b) amino acid sequences that have 1, 2, or 3 amino acid difference(s) with SEQ ID NO: 123, wherein
[0071] at position 2 the D has been changed into A, S, E or G;
[0072] at position 4 the H has been changed into Y;
[0073] at position 5 the K has been changed into L;
[0074] at position 6 the I has been changed into L;
[0075] at position 8 the F has been changed into I or V; and/or
[0076] at position 10 the G has been changed into S, provided that the polypeptide comprising the CDR1 with 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR1 without the 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance;
[0077] and in which
[0078] (ii) CDR2 is chosen from the group consisting of
[0079] (a) SEQ ID NO: 153; and
[0080] (b) amino acid sequences that have 1, 2, 3, 4, or 5 amino acid difference(s) with SEQ ID NO: 153, wherein
[0081] at position 1 the H has been changed into T or R;
[0082] at position 3 the S has been changed into T or A;
[0083] at position 5 the G has been changed into S or A;
[0084] at position 7 the Q has been changed into D, E, T, A or V;
[0085] at position 8 the T has been changed into A or V; and/or
[0086] at position 9 the D has been changed into A, Q, N, V or S, provided that the polypeptide comprising the CDR2 with 5, 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR2 without the 5, 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance;
[0087] and in which
[0088] (iii) CDR3 is chosen from the group consisting of
[0089] (a) SEQ ID NO: 170; and
[0090] (b) amino acid sequences that have 1, 2, or 3 amino acid difference(s) with SEQ ID NO: 170, wherein
[0091] at position 1 the F has been changed into Y, L or G;
[0092] at position 4 the I has been changed into L;
[0093] at position 5 the Y has been changed into W; and/or
[0094] at position 8 the D has been changed into N or S, provided that the polypeptide comprising the CDR3 with 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR3 without the 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance.
[0095] In a further aspect, the present invention provides a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which CDR1 is chosen from the group consisting of
[0096] (a) SEQ ID NO: 124; and
[0097] (b) amino acid sequences that have 1, or 2 amino acid difference(s) with SEQ ID NO: 124, wherein
[0098] at position 2 the E has been changed into Q; and/or
[0099] at position 6 the I has been changed into V.
[0100] In a further aspect, the present invention provides a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which CDR2 is chosen from the group consisting of
[0101] (a) SEQ ID NO: 145; and
[0102] (b) amino acid sequence that has 1 amino acid difference with SEQ ID NO: 145, wherein
[0103] at position 9 the N has been changed into D.
[0104] In a further aspect the present invention provides a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which CDR3 is chosen from the group consisting of
[0105] (a) SEQ ID NO: 167; and
[0106] (b) amino acid sequence that has 1 amino acid difference with SEQ ID NO: 167, wherein
[0107] at position 4 the L has been changed into 1.
[0108] Preferably, the polypeptide comprising the one or more CDRs with 2 or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDRs without the 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance.
[0109] In a further aspect, the present invention provides a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which
[0110] (i) CDR1 is chosen from the group consisting of
[0111] (a) SEQ ID NO: 124; and
[0112] (b) amino acid sequences that have 1, or 2 amino acid difference(s) with SEQ ID NO: 124, wherein
[0113] at position 2 the E has been changed into Q; and/or
[0114] at position 6 the I has been changed into V, provided that the polypeptide comprising the CDR1 with 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR1 without the 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance;
[0115] and in which
[0116] (ii) CDR2 is chosen from the group consisting of
[0117] (a) SEQ ID NO: 145; and
[0118] (b) amino acid sequence that has 1 amino acid difference with SEQ ID NO: 145, wherein
[0119] at position 9 the N has been changed into D, provided that the polypeptide comprising the CDR2 with 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR2 without the 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance;
[0120] and in which
[0121] (iii) CDR3 is chosen from the group consisting of
[0122] (a) SEQ ID NO: 167; and
[0123] (b) amino acid sequence that has 1 amino acid difference with SEQ ID NO: 167, wherein
[0124] at position 4 the L has been changed into I, provided that the polypeptide comprising the CDR3 with 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR3 without the 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance.
[0125] In a further aspect, the present invention provides a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which CDR1 is SEQ ID NO: 130.
[0126] In a further, aspect the present invention provides a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which CDR2 is chosen from the group consisting of
[0127] (a) SEQ ID NO: 157; and
[0128] (b) amino acid sequence that has 1 amino acid difference with SEQ ID NO: 157, wherein
[0129] at position 8 the T has been changed into I.
[0130] In a further aspect, the present invention provides a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which CDR3 is SEQ ID NO: 172.
[0131] Preferably, the polypeptide comprising the CDR with 1 amino acid difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDRs without the 1 amino acid difference, said affinity as measured by surface plasmon resonance.
[0132] In a further aspect, the present invention provides a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which
[0133] (i) CDR1 is SEQ ID NO: 130;
[0134] and in which
[0135] (ii) CDR2 is chosen from the group consisting of
[0136] (a) SEQ ID NO: 157; and
[0137] (b) amino acid sequence that has 1 amino acid difference with SEQ ID NO: 157, wherein
[0138] at position 8 the T has been changed into I, provided that the polypeptide comprising the CDR2 with 1 amino acid difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR2 without the 1 amino acid difference, said affinity as measured by surface plasmon resonance;
[0139] and in which
[0140] (iii) CDR3 is SEQ ID NO: 172.
[0141] In a further aspect, the present invention provides a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which:
[0142] (i) CDR1 is chosen from the group consisting of:
[0143] (a) SEQ ID NOs: 119-123, 125-127, 129, 132 and 133; and
[0144] (b) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 123; and/or
[0145] (ii) CDR2 is chosen from the group consisting of:
[0146] (c) SEQ ID NOs: 134-141, 143-144, 146-156, 159-163; and
[0147] (d) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 153; and/or
[0148] (iii) CDR3 is chosen from the group consisting of:
[0149] (e) SEQ ID NOs: 164-166, 169-171, 173-174; and
[0150] (f) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 170.
[0151] In a further aspect, the present invention provides a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which:
[0152] (i) CDR1 is chosen from the group consisting of:
[0153] (a) SEQ ID NOs: 119-123, 125-127, 129, 132 and 133; and
[0154] (b) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 123, provided that the polypeptide comprising the CDR1 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR1 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance; and/or
[0155] (ii) CDR2 is chosen from the group consisting of:
[0156] (c) SEQ ID NOs: 134-141, 143-144, 146-156, 159-163; and
[0157] (d) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 153, provided that the polypeptide comprising the CDR2 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR2 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance; and/or
[0158] (iii) CDR3 is chosen from the group consisting of:
[0159] (e) SEQ ID NOs: 164-166, 169-171, 173-174; and
[0160] (f) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 170, provided that the polypeptide comprising the CDR3 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR3 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance.
[0161] In a further aspect, the present invention provides a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which: CDR1 is represented by SEQ ID NO: 123, CDR2 is represented by SEQ ID NO: 153, and CDR3 is represented by SEQ ID NO: 170.
[0162] In a further aspect, the present invention provides a polypeptide as described herein, in which said first ISV is chosen from the group consisting of SEQ ID NOs: 1-104.
[0163] In a further aspect, the present invention provides a polypeptide as described herein, in which said first ISV cross-blocks the binding to the constant domain of the T cell receptor (TCR) by at least one of the polypeptides with SEQ ID NOs: 1-104.
[0164] In a further aspect, the present invention provides a polypeptide as described herein, in which said first ISV is cross-blocked from binding to the constant domain of the T cell receptor (TCR) by at least one of the polypeptides with SEQ ID NOs: 1-104.
[0165] In a further aspect, the present invention provides a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which:
[0166] (i) CDR1 is chosen from the group consisting of:
[0167] (a) SEQ ID NOs: 124, 128 and 131; and
[0168] (b) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 124; and/or
[0169] (ii) CDR2 is chosen from the group consisting of:
[0170] (c) SEQ ID NOs: 142 and 145; and
[0171] (d) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 145; and/or
[0172] (iii) CDR3 is chosen from the group consisting of:
[0173] (e) SEQ ID NOs: 167 and 168; and
[0174] (f) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 167.
[0175] In a further aspect, the present invention provides a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which:
[0176] (i) CDR1 is chosen from the group consisting of:
[0177] (a) SEQ ID NOs: 124, 128 and 131; and
[0178] (b) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 124, provided that the polypeptide comprising the CDR1 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR1 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance; and/or
[0179] (ii) CDR2 is chosen from the group consisting of:
[0180] (c) SEQ ID NOs: 142 and 145; and
[0181] (d) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 145, provided that the polypeptide comprising the CDR2 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR2 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance; and/or
[0182] (iii) CDR3 is chosen from the group consisting of:
[0183] (e) SEQ ID NOs: 167 and 168; and
[0184] (f) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 167, provided that the polypeptide comprising the CDR3 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR3 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance.
[0185] In a further aspect, the present invention provides a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which: CDR1 is represented by SEQ ID NO: 124, CDR2 is represented by SEQ ID NO: 145, and CDR3 is represented by SEQ ID NO: 167.
[0186] In a further aspect, the present invention provides a polypeptide as described herein, in which said first ISV is chosen from the group consisting of SEQ ID NOs: 105-115.
[0187] In a further aspect, the present invention provides a polypeptide as described herein, in which said first ISV cross-blocks the binding to the constant domain of the T cell receptor (TCR) by at least one of the polypeptides with SEQ ID NOs: 105-115.
[0188] In a further aspect, the present invention provides a polypeptide as described herein, in which the first ISV is cross-blocked from binding to the constant domain of the T cell receptor (TCR) by at least one of the polypeptides with SEQ ID NOs: 105-115.
[0189] In a further aspect the present invention provides a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which:
[0190] (i) CDR1 is chosen from the group consisting of
[0191] (a) SEQ ID NO: 130; and
[0192] (b) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 130; and/or
[0193] (ii) CDR2 is chosen from the group consisting of:
[0194] (c) SEQ ID NOs: 157-158; and
[0195] (d) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 157; and/or
[0196] (iii) CDR3 is chosen from the group consisting of:
[0197] (e) SEQ ID NO: 172; and
[0198] (f) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 172.
[0199] In a further aspect, the present invention provides a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which:
[0200] (i) CDR1 is chosen from the group consisting of
[0201] (a) SEQ ID NO: 130; and
[0202] (b) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 130, provided that the polypeptide comprising the CDR1 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR1 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance; and/or
[0203] (ii) CDR2 is chosen from the group consisting of:
[0204] (c) SEQ ID NOs: 157-158; and
[0205] (d) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 157, provided that the polypeptide comprising the CDR2 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR2 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance; and/or
[0206] (iii) CDR3 is chosen from the group consisting of:
[0207] (e) SEQ ID NO: 172; and
[0208] (f) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 172, provided that the polypeptide comprising the CDR3 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR3 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance.
[0209] In a further aspect, the present invention provides a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which: CDR1 is represented by SEQ ID NO: 130, CDR2 is represented by SEQ ID NO: 157, and CDR3 is represented by SEQ ID NO: 172.
[0210] In a further aspect, the present invention provides a polypeptide as described herein, in which said first ISV is chosen from the group consisting of SEQ ID NOs: 116-118.
[0211] In a further aspect, the present invention provides a polypeptide as described herein, in which said first ISV cross-blocks the binding to the constant domain of the T cell receptor (TCR) by at least one of the polypeptides with SEQ ID NOs: 116-118.
[0212] In a further aspect, the present invention provides a polypeptide as described herein in which said first ISV is cross-blocked from binding to the constant domain of the T cell receptor (TCR) by at least one of the polypeptides with SEQ ID NOs: 116-118.
[0213] In a further aspect, the present invention provides a polypeptide as described herein, further comprising a third ISV, which has high affinity for/binds to a second antigen on a target cell, wherein said second antigen is different from said first antigen.
[0214] In a further aspect, the present invention provides a polypeptide as described herein, wherein said first antigen on a target cell is a tumour antigen, preferably a tumour associated antigen (TAA).
[0215] In a further aspect, the present invention provides a polypeptide as described herein, wherein said second antigen on a target cell is a tumour antigen, preferably a tumour associated antigen (TAA).
[0216] In a further aspect, the present invention provides a polypeptide as described herein, wherein said first antigen and said second antigen are present on the same target cell.
[0217] In a further aspect, the present invention provides a polypeptide as described herein, wherein said first antigen and said second antigen are present on different target cells.
[0218] In a further aspect, the present invention provides a polypeptide as described herein, wherein said TAA's are independently chosen from the group consisting of Melanoma-associated Chondroitin Sulfate Proteoglycan (MCSP), Epidermal Growth Factor Receptor (EGFR), Fibroblast Activation Protein (FAP), MART-1, carcinoembryonic antigen (CEA), gp100, MAGE-1, HER-2, Lewis.sup.Y antigens, CD123, CD44, CLL-1, CD96, CD47, CD32, CXCR4, Tim-3, CD25, TAG-72, Ep-CAM, PSMA, PSA, GD2, GD3, CD4, CD5, CD19, CD20, CD22, CD33, CD36, CD45, CD52, CD147, growth factor receptors including ErbB3 and ErbB4, Cytokine receptors including Interleukin-2 receptor gamma chain (CD132 antigen), Interleukin-10 receptor alpha chain (IL-10R-A), Interleukin-10 receptor beta chain (IL-10R-B), Interleukin-12 receptor beta-1 chain (IL-12R-beta1), Interleukin-12 receptor beta-2 chain (IL-12 receptor beta-2), Interleukin-13 receptor alpha-1 chain (IL-13R-alpha-1) (CD213a1 antigen), Interleukin-13 receptor alpha-2 chain (Interleukin-13 binding protein), Interleukin-17 receptor (IL-17 receptor), Interleukin-17B receptor (IL-17B receptor), Interleukin 21 receptor precursor (IL-21R), Interleukin-1 receptor type I (IL-1R-1) (CD121a); Interleukin-1 receptor type II (IL-1R-beta) (CDw121b), Interleukin-1 receptor antagonist protein (IL-1ra), Interleukin-2 receptor alpha chain (CD25 antigen, Interleukin-2 receptor beta chain (CD122 antigen), Interleukin-3 receptor alpha chain (IL-3R-alpha) (CD123 antigen), CD30, IL23R, IGF-1R, IL5R, IgE, CD248 (endosialin), CD44v6, gpA33, Ron, Trop2, PSCA, claudin 6, claudin 18.2, CLEC12A, CD38, ephA2, c-Met, CD56, MUC16, EGFRvIII, AGS-16, CD27L, Nectin-4, SLITRK6, mesothelin, folate receptor, tissue factor, axl, glypican-3, CA9, Cripto, CD138, CD37, MUC1, CD70, gastrin releasing peptide receptor, PAP, CEACAM5, CEACAM6, CXCR7, N-cadherin, FXYD2 gamma a, CD21, CD133, Na/K-ATPase, mlgM (membrane-bound IgM), mIgA (membrane-bound IgA), Mer, Tyro2, CD120, CD95, CA 195, DR5, DR6, DcR3 and CAIX, including related polymorphic variants and isoforms.
[0219] In a further aspect, the present invention provides a polypeptide as described herein, wherein said TAA is CD20 (UniProt 11836), HER2 (Uniprot P04626), EGFR, CEA, polymorphic variants or isoforms thereof.
[0220] In a further aspect, the present invention provides a polypeptide as described herein, wherein said first antigen and said second antigen are chosen from the group consisting of:
[0221] EGFR as a first antigen and CEA as a second antigen;
[0222] CD19 as a first antigen and CD20 as a second antigen;
[0223] CD19 as a first antigen and CD22 as a second antigen;
[0224] CD123 as a first antigen and Tim-3 as a second antigen;
[0225] CD123 as a first antigen and CD69 as a second antigen.
[0226] In a further aspect, the present invention provides a polypeptide as described herein, further comprising a serum protein binding moiety.
[0227] In a further aspect, the present invention provides a polypeptide as described herein, wherein said serum protein binding moiety binds serum albumin.
[0228] In a further aspect, the present invention provides a polypeptide as described herein, wherein said serum protein binding moiety is an ISV binding serum albumin.
[0229] In a further aspect, the present invention provides a polypeptide as described herein, wherein said ISV binding serum albumin essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3 respectively), in which CDR1 is SFGMS (SEQ ID NO: 481), CDR2 is SISGSGSDTLYADSVKG (SEQ ID NO: 482) and CDR3 is GGSLSR (SEQ ID NO: 475), CDR determined according to Kabat definition; and/or in which CDR1 is GFTFSSFGMS (SEQ ID NO: 472) or GFTFRSFGMS (SEQ ID NO: 473), CDR2 is SISGSGSDTL (SEQ ID NO: 474) and CDR3 is GGSLSR (SEQ ID NO: 475), CDR determined according to Kontermann 2010.
[0230] In a further aspect, the present invention provides a polypeptide as described herein, wherein said ISV binding serum albumin is selected from Alb8, Alb23, Alb129, Alb132, Alb11, Alb11 (S112K)-A, Alb82, Alb82-A, Alb82-AA, Alb82-AAA, Alb82-G, Alb82-GG and Alb82-GGG (SEQ ID NOs: 400 to 412).
[0231] In a further aspect, the present invention provides a polypeptide as described herein, wherein said ISVs are directly linked to each other or are linked via a linker.
[0232] In a further aspect, the present invention provides a polypeptide as described herein, wherein said first ISV and/or said second ISV and/or possibly said third ISV and/or possibly said ISV binding serum albumin are linked via a linker.
[0233] In a further aspect, the present invention provides a polypeptide as described herein, wherein said linker is chosen from the group consisting of linkers of 5GS, 7GS, 9GS, 10GS, 15GS, 18GS, 20GS, 25GS, 30GS and 35GS (SEQ ID NOs: 376 to 385).
[0234] In a further aspect, the present invention provides a polypeptide as described herein, wherein said serum protein binding moiety is a non-antibody based polypeptide.
[0235] In a further aspect, the present invention provides a polypeptide as described herein, further comprising PEG.
[0236] In a further aspect, the present invention provides a polypeptide as described herein, wherein said ISV is a Nanobody, a V.sub.HH, a humanized V.sub.HH, or a camelized V.sub.H.
[0237] In a further aspect, the present invention provides a polypeptide wherein said first ISV is chosen from the group consisting of SEQ ID NOs: 1 to 118.
[0238] In a further aspect, the present invention provides a polypeptide as described herein, wherein said first ISV is chosen from the group consisting of SEQ ID NOs: 1 to 118, and wherein said second ISV is chosen from the group consisting of SEQ ID NOs: 350-358.
[0239] In a further aspect, the present invention provides a polypeptide chosen from the group consisting of SEQ ID NOs: 292, 295-296, 299-300, 303, 306-343, 387-388, 390, 414, 417-418, 421-422, 425, 428-464, 467-468, 470-471 and 486-487.
[0240] In a further aspect, the present invention provides a polypeptide that specifically binds the constant domain of the T cell receptor (TCR) and that comprises or essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which:
[0241] (i) CDR1 is chosen from the group consisting of:
[0242] (a) SEQ ID NOs: 119-133; or
[0243] (b) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of any of SEQ ID NOs: 119-133, provided that the polypeptide comprising the CDR1 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR1 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance; and/or
[0244] (ii) CDR2 is chosen from the group consisting of:
[0245] (c) SEQ ID NOs: 134-163; or
[0246] (d) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of any of SEQ ID NOs: 134-163, provided that the polypeptide comprising the CDR2 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR2 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance; and/or
[0247] (iii) CDR3 is chosen from the group consisting of:
[0248] (e) SEQ ID NOs: 164-174; or
[0249] (f) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of any of SEQ ID NOs: 164-174, provided that the polypeptide comprising the CDR3 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR3 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance.
[0250] The present invention also provides a polypeptide as described herein, in which:
[0251] (i) CDR1 is chosen from the group consisting of:
[0252] (a) SEQ ID NOs: 119-123, 125-127, 129, 132 and 133; and
[0253] (b) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 123, provided that the polypeptide comprising the CDR1 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR1 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance; and/or
[0254] (ii) CDR2 is chosen from the group consisting of:
[0255] (c) SEQ ID NOs: 134-141, 143-144, 146-156, 159-163; and
[0256] (d) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 153, provided that the polypeptide comprising the CDR2 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR2 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance; and/or
[0257] (iii) CDR3 is chosen from the group consisting of:
[0258] (e) SEQ ID NOs: 164-166, 169-171, 173-174; and
[0259] (f) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 170, provided that the polypeptide comprising the CDR3 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR3 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance.
[0260] In a further aspect, the present invention provides a polypeptide as described herein, in which CDR1 is chosen from the group consisting of
[0261] (a) SEQ ID NO: 123; and
[0262] (b) amino acid sequences that have 1, 2, 3 or 4 amino acid difference(s) with SEQ ID NO: 123, wherein
[0263] at position 2 the D has been changed into A, S, E or G;
[0264] at position 4 the H has been changed into Y;
[0265] at position 5 the K has been changed into L;
[0266] at position 6 the I has been changed into L;
[0267] at position 8 the F has been changed into I or V; and/or
[0268] at position 10 the G has been changed into S.
[0269] In a further aspect, the present invention provides a polypeptide as described herein, in which CDR2 is chosen from the group consisting of
[0270] (a) SEQ ID NO: 153; and
[0271] (b) amino acid sequences that have 1, 2, 3, 4 or 5 amino acid difference(s) with SEQ ID NO: 153, wherein
[0272] at position 1 the H has been changed into T or R;
[0273] at position 3 the S has been changed into T or A;
[0274] at position 5 the G has been changed into S or A;
[0275] at position 7 the Q has been changed into D, E, T, A or V;
[0276] at position 8 the T has been changed into A or V; and/or
[0277] at position 9 the D has been changed into A, Q, N, V or S.
[0278] In a further aspect, the present invention provides a polypeptide as described herein, in which CDR3 is chosen from the group consisting of
[0279] (a) SEQ ID NO: 170; and
[0280] (b) amino acid sequences that have 1, 2, 3 or 4 amino acid difference(s) with SEQ ID NO: 170, wherein
[0281] at position 1 the F has been changed into Y, L or G;
[0282] at position 4 the I has been changed into L;
[0283] at position 5 the Y has been changed into W; and/or
[0284] at position 8 the D has been changed into N or S.
[0285] In a further aspect, the present invention provides a polypeptide as described herein, in which CDR1 is represented by SEQ ID NO: 123, CDR2 is represented by SEQ ID NO: 153, and CDR3 is represented by SEQ ID NO: 170.
[0286] In a further aspect, the present invention provides a polypeptide as described herein, in which:
[0287] (i) CDR1 is chosen from the group consisting of:
[0288] (a) SEQ ID NOs: 124, 128 and 131; and
[0289] (b) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 124, provided that the polypeptide comprising the CDR1 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR1 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance; and/or
[0290] (ii) CDR2 is chosen from the group consisting of:
[0291] (c) SEQ ID NOs: 142 and 145; and
[0292] (d) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 145, provided that the polypeptide comprising the CDR2 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR2 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance; and/or
[0293] (iii) CDR3 is chosen from the group consisting of:
[0294] (e) SEQ ID NOs: 167 and 168; and
[0295] (f) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 167, provided that the polypeptide comprising the CDR3 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR3 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance.
[0296] In a further aspect, the present invention provides a polypeptide as described herein, in which CDR1 is chosen from the group consisting of
[0297] (a) SEQ ID NO: 124; and
[0298] (b) amino acid sequences that have 1, or 2 amino acid difference(s) with SEQ ID NO: 124, wherein
[0299] at position 2 the E has been changed into Q; and/or
[0300] at position 6 the I has been changed into V.
[0301] In a further aspect, the present invention provides a polypeptide as described herein, in which CDR2 is chosen from the group consisting of
[0302] (a) SEQ ID NO: 145; and
[0303] (b) amino acid sequence that has 1 amino acid difference with SEQ ID NO: 145, wherein
[0304] at position 9 the N has been changed into D.
[0305] In a further aspect, the present invention provides a polypeptide as described herein, in which CDR3 is chosen from the group consisting of
[0306] (a) SEQ ID NO: 167; and
[0307] (b) amino acid sequence that has 1 amino acid difference with SEQ ID NO: 167, wherein
[0308] at position 4 the L has been changed into I.
[0309] In a further aspect, the present invention provides a polypeptide as described herein, in which CDR1 is represented by SEQ ID NO: 124, CDR2 is represented by SEQ ID NO: 145, and CDR3 is represented by SEQ ID NO: 167.
[0310] In a further aspect, the present invention provides a polypeptide as described herein, in which:
[0311] (i) CDR1 is chosen from the group consisting of
[0312] (a) SEQ ID NO: 130; and
[0313] (b) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 130, provided that the polypeptide comprising the CDR1 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR1 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance; and/or
[0314] (ii) CDR2 is chosen from the group consisting of:
[0315] (c) SEQ ID NOs: 157-158; and
[0316] (d) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 157, provided that the polypeptide comprising the CDR2 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR2 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance; and/or
[0317] (iii) CDR3 is chosen from the group consisting of:
[0318] (e) SEQ ID NO: 172; and
[0319] (f) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 172, provided that the polypeptide comprising the CDR3 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR3 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance.
[0320] In a further aspect, the present invention provides a polypeptide as described herein, in which CDR1 is chosen from SEQ ID NO: 130.
[0321] In a further aspect, the present invention provides a polypeptide as described herein, in which CDR2 is chosen from the group consisting of
[0322] (a) SEQ ID NO: 157; and
[0323] (b) amino acid sequence that has 1 amino acid difference with SEQ ID NO: 157, wherein
[0324] at position 8 the T has been changed into I.
[0325] In a further aspect, the present invention provides a polypeptide as described herein, in which CDR3 is chosen from SEQ ID NO: 172.
[0326] In a further aspect, the present invention provides a polypeptide as described herein, in which CDR1 is represented by SEQ ID NO: 130, CDR2 is represented by SEQ ID NO: 157, and CDR3 is represented by SEQ ID NO: 172.
[0327] In another aspect, the invention provides a polypeptide that specifically binds carcinoembryonic antigen (CEA) and that comprises or essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which:
[0328] (i) CDR1 is chosen from the group consisting of:
[0329] (a) SEQ ID NO: 361 (GDTYGSYWMG); or
[0330] (b) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 361, provided that the polypeptide comprising the CDR1 with 4, 3, 2, or 1 amino acid(s) difference binds CEA with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR1 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance; and/or
[0331] (ii) CDR2 is chosen from the group consisting of:
[0332] (c) SEQ ID NO: 363 (AINRGGGYTV); or
[0333] (d) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 363, provided that the polypeptide comprising the CDR2 with 4, 3, 2, or 1 amino acid(s) difference binds CEA with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR2 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance; and/or
[0334] (iii) CDR3 is chosen from the group consisting of:
[0335] (e) SEQ ID NO: 365 (SGVLGGLHEDWFNY); or
[0336] (f) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 365, provided that the polypeptide comprising the CDR3 with 4, 3, 2, or 1 amino acid(s) difference binds CEA with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR3 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance.
[0337] In a further aspect, the present invention provides a polypeptide as described herein, in which CDR1 is represented by SEQ ID NO: 361, CDR2 is represented by SEQ ID NO: 363, and CDR3 is represented by SEQ ID NO: 365.
[0338] In another aspect, the invention provides a polypeptide that specifically binds CD20 and that comprises or essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which:
[0339] (i) CDR1 is chosen from the group consisting of:
[0340] (a) SEQ ID NO: 362 (GGTFSSYTMG); or
[0341] (b) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 362, provided that the polypeptide comprising the CDR1 with 4, 3, 2, or 1 amino acid(s) difference binds CD20 with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR1 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance; and/or
[0342] (ii) CDR2 is chosen from the group consisting of:
[0343] (c) SEQ ID NO: 364 (EVRWGGVTT); or
[0344] (d) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 364, provided that the polypeptide comprising the CDR2 with 4, 3, 2, or 1 amino acid(s) difference binds CD20 with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR2 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance; and/or
[0345] (iii) CDR3 is chosen from the group consisting of:
[0346] (e) SEQ ID NO: 366 (VRQMYMTVVPDY); or
[0347] (f) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 366, provided that the polypeptide comprising the CDR3 with 4, 3, 2, or 1 amino acid(s) difference binds CD20 with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR3 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance.
[0348] In a further aspect, the present invention provides a polypeptide as described herein, in which CDR1 is represented by SEQ ID NO: 362, CDR2 is represented by SEQ ID NO: 364, and CDR3 is represented by SEQ ID NO: 366.
[0349] In a further aspect, the present invention provides a polypeptide as described herein, which is a Nanobody, a V.sub.HH, a humanized V.sub.HH, or a camelized V.sub.H.
[0350] In a further aspect, the present invention provides a polypeptide as described herein, further comprising a serum protein binding moiety.
[0351] In a further aspect, the present invention provides a polypeptide as described herein, wherein said serum protein binding moiety binds serum albumin.
[0352] In a further aspect, the present invention provides a polypeptide as described herein, wherein said serum protein binding moiety is an ISV that binds serum albumin.
[0353] In a further aspect, the present invention provides a polypeptide as described herein, wherein said ISV that binds serum albumin essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3 respectively), in which CDR1 is SFGMS (SEQ ID NO: 481), CDR2 is SISGSGSDTLYADSVKG (SEQ ID NO: 482) and CDR3 is GGSLSR (SEQ ID NO: 475), CDR as determined according to Kabat definition; and/or in which CDR1 is GFTFSSFGMS (SEQ ID NO: 472) or GFTFRSFGMS (SEQ ID NO: 473), CDR2 is SISGSGSDTL (SEQ ID NO: 474) and CDR3 is GGSLSR (SEQ ID NO: 475); CDR as determined according to Kontermann 2010.
[0354] In a further aspect, the present invention provides a polypeptide as described herein, wherein said ISV that binds serum albumin is selected from Alb8, Alb23, Alb129, Alb132, Alb11, Alb11 (S112K)-A, Alb82, Alb82-A, Alb82-AA, Alb82-AAA, Alb82-G, Alb82-GG, and Alb82-GGG (SEQ ID NOs: 400 to 412).
[0355] In a further aspect, the present invention provides a polypeptide as described herein, wherein said ISV is directly linked or is linked via a linker.
[0356] In a further aspect, the present invention provides a polypeptide as described herein, wherein said linker is chosen from the group consisting of linkers of 5GS, 7GS, 9GS, 10GS, 15GS, 18GS, 20GS, 25GS, 30GS and 35GS (SEQ ID NOs:376 to 385).
[0357] In a further aspect, the present invention provides a polypeptide as described herein, further comprising a PEG moiety.
[0358] In a further aspect, the present invention provides a nucleic acid or nucleic acid sequence encoding a polypeptide as defined herein.
[0359] In a further aspect, the present invention provides a vector comprising a nucleic acid or nucleic acid sequence as defined herein.
[0360] In a further aspect, the present invention provides a host cell transformed or transfected with the nucleic acid or nucleic acid sequence as defined herein or with the vector as defined herein.
[0361] In a further aspect, the present invention provides a process for the production of the polypeptide as described herein, said process comprising culturing a host cell as defined herein under conditions allowing the expression of the polypeptide as defined herein and recovering the produced polypeptide from the culture.
[0362] In a further aspect, the present invention provides a pharmaceutical composition comprising the polypeptide as described herein, or, the polypeptide produced according to the process as described herein.
[0363] In a further aspect, the present invention provides a polypeptide as described herein, or produced according to the process as described herein, for use in treating a subject in need thereof.
[0364] In a further aspect, the present invention provides a method for delivering a prophylactic or therapeutic polypeptide to a specific location, tissue or cell type in the body, the method comprising the steps of administering to a subject a polypeptide as described herein, or produced according to the process as described herein.
[0365] In a further aspect, the present invention provides a polypeptide as described herein, or produced according to the process as described herein, for use in the prevention, treatment or amelioration of a disease selected from the group consisting of a proliferative disease, an inflammatory disease, an infectious disease and an autoimmune disease.
[0366] In a further aspect, the present invention provides a method for the prevention, treatment or amelioration of a disease selected from the group consisting of a proliferative disease, an inflammatory disease, an infectious disease and an autoimmune disease, comprising the step of administering to a subject in need thereof the polypeptide as described herein, or produced according to a process as described herein.
[0367] In a further aspect, the present invention provides a polypeptide for use in or a method for the prevention, treatment or amelioration of a disease as described herein, wherein said proliferative disease is cancer.
[0368] In a further aspect, the present invention provides a polypeptide for use in or a method for the prevention, treatment or amelioration of a disease as described herein, wherein said cancer is chosen from the group consisting of carcinomas, gliomas, mesotheliomas, melanomas, lymphomas, leukemias, adenocarcinomas: breast cancer, ovarian cancer, cervical cancer, glioblastoma, multiple myeloma (including monoclonal gammopathy of undetermined significance, asymptomatic and symptomatic myeloma), prostate cancer, and Burkitt's lymphoma, head and neck cancer, colon cancer, colorectal cancer, non-small cell lung cancer, small cell lung cancer, cancer of the esophagus, stomach cancer, pancreatic cancer, hepatobiliary cancer, cancer of the gallbladder, cancer of the small intestine, rectal cancer, kidney cancer, bladder cancer, prostate cancer, penile cancer, urethral cancer, testicular cancer, vaginal cancer, uterine cancer, thyroid cancer, parathyroid cancer, adrenal cancer, pancreatic endocrine cancer, carcinoid cancer, bone cancer, skin cancer, retinoblastomas, Hodgkin's lymphoma, non-Hodgkin's lymphoma, Kaposi's sarcoma, multicentric Castleman's disease or AIDS-associated primary effusion lymphoma, neuroectodermal tumors, rhabdomyosarcoma; as well as any metastasis of any of the above cancers, as well as non-cancer indications such as nasal polyposis.
[0369] In a further aspect, the present invention provides a polypeptide for use in or a method for the prevention, treatment or amelioration of a disease as described herein, wherein the treatment is a combination treatment.
[0370] In a further aspect, the present invention provides a kit comprising a polypeptide as defined herein, a nucleic acid or nucleic acid sequence as defined herein, a vector as defined herein, or a host cell as defined herein.
FIGURE LEGENDS
[0371] FIG. 1: Assessment of the expression of human TCR/CD3 and human CD3 on transfected CHO, HEK293 and Llana cell lines using 100 nM anti-human TCR .alpha./.beta. antibody (clone BW242/412) (black) and 100 nM anti-human CD3 antibody (clone OKT-3) (grey). The MCF value (mean channel fluorescence) was plotted for each cell line. The X-axis depicts the cell type and the transfected genes; CD3 indicates transfection with the CD3 complex (epsilon, delta, gamma and zeta chains), huTCR indicates transfection with the TCR .alpha./.beta. chains, wherein the variable domain used is between brackets.
[0372] FIG. 2: Quality assessment of soluble recombinant cynomolgus TCR .alpha./.beta. proteins using anti-non-human primate/Rat TCR.alpha./.beta. antibody clone R73; anti-human TCR .alpha./.beta. antibodies (solid circles) and an irrelevant anti-egg lysozyme Nanobody (cAblys) (open circles). The OD value was plotted against the concentration of the Nanobody.
[0373] FIGS. 3A-3D: Dose dependent binding of monovalent anti-TCR Nanobodies to human TCR/CD3 expressed on CHO-K1 cells (FIGS. 3A and 3C, panels of column labeled "CHO-K1 hu TCR(2XN9)/CD3 cells") and to primary human T cells (FIGS. 3B and 3D, panels of column labeled "Hu T cells"). The MCF value (mean channel fluorescence) was plotted against the concentration of the Nanobody.
[0374] FIGS. 4A and 4B: Dose dependent binding of monovalent anti-TCR Nanobodies to HEK293H human TCR(2IAN)/CD3 (closed circle), HEK293H human CD3 (cross) and to HEK293H reference cell line (open circles). The MCF value (mean channel fluorescence) was plotted against the concentration of the Nanobody.
[0375] FIGS. 5A and 5B: Dose dependent binding of monovalent anti-TCR Nanobodies (closed circles) and an irrelevant Nanobody (open circles) to soluble recombinant human TCR .alpha./.beta.(2XN9)-zipper protein. The OD at 450 nm was plotted against the concentration of the Nanobody.
[0376] FIGS. 6A and 6B: Kinetic analysis of T01700055A02 (FIG. 6A) and T01700056G05 (FIG. 6B) on soluble recombinant human TCR .alpha./.beta. (2XN9)-zipper protein interaction via BioLayer Interferometry on an Octet RED384 instrument. Applied analyte concentrations were: 1000, 333, 111, 37, 12.3, 4.1 and 1.4 nM. Langmuir fits to the kinetic data are indicated with the black lines, whereas sensorgrams are presented by the grey lines.
[0377] FIGS. 7A and 7B: T cell activation data of bead coupled monovalent anti-TCR Nanobodies (FIG. 7A). T cell activation data of monovalent anti-TCR Nanobodies presented in solution (FIG. 7B). Activation was measured by monitoring the CD69 upregulation on primary human T cells. The MCF value (mean channel fluorescence) was plotted for each Nanobody.
[0378] FIGS. 8A-8F: Binding of a dilution series of CD20xTCR (full line) and TCRxCD20 (dotted line) multispecific polypeptides to human TCR/CD3 expressed on CHO-K1 cells (FIGS. 8A and 8D, panels of column labeled "CHO-K1 huTCR (2XN9)/CD3 cells"), primary human T cells (FIGS. 8B and 8E, panels of column labeled "Human T cells") and Ramos cells (FIGS. 8C and 8F, panels of column labeled "Ramos cells"). The MCF value (mean channel fluorescence) was plotted against the concentration of the polypeptides.
[0379] FIGS. 9A-9D: Dose-dependent killing effect of CD20xTCR (full line) binding and TCRxCD20 (dotted line) binding bispecific polypeptides in a flow cytometry based human T cell mediated Ramos B cell killing assay. The % cell death (% of TOPRO positive cells) is plotted against the concentration of the polypeptides (FIGS. 9A, 9C and 9D, panels of column labeled "Ramos cells"). Dose-dependent killing effect of CD20xTCR (full line) binding bispecific polypeptides in a flow cytometry based human T cell mediated Raji B cell killing assay. The % cell death (% of TOPRO positive cells) was plotted against the concentration of the polypeptides (FIG. 9B, panels of column labeled "Raji cells").
[0380] FIG. 10: Dose-dependent binding of the anti-CD20 Nanobody on human CD20 Ramos (open symbols) and Raji (closed symbols) cells. The MCF value (mean channel fluorescence) was plotted against the concentration of the Nanobody.
[0381] FIGS. 11A-11C: Dose-dependent killing effect of CD20xTCR binding (full line) and TCRxCD20 binding (dotted line) bispecific polypeptides in the xCELLigence based assay using CHO-K1 human CD20 transfected cells (FIGS. 11A and 11C, panels of column labeled "CHO-K1 hu CD20 cells"). Dose-dependent killing effect of T017000055 in the xCELLigence based assay using CHO-K1 human CD20 transfected cells (full line, closed symbol) and CHO-K1 parental cell line (open circles) to illustrate TAA (CD20) dependent killing (FIG. 11B, panels of column labeled "CHO-K1 hu CD20 cells and CHO-K1 cells"). The cell index (CI) was plotted against the concentration of polypeptides.
[0382] FIG. 12: Dose-dependent killing effect of CD20 x TCR polypeptides using a 5GS linker (open squares), 9GS linker (open circles) and a 35GS linker (closed symbols) in a xCELLigence based killing assay using CHO-K1 human TCR(2XN9)/CD3 cells. The cell index (CI) was plotted against the concentration of polypeptides.
[0383] FIGS. 13A and 13B: Dose-dependent killing effect of T017000055 (FIG. 13A, labeled as "T017000055") and T017000076 (FIG. 13B, labeled as "T017000076") in a flow cytometry based human T cell mediated Ramos B cell killing assay using different effector (E) to target (T) ratio's (E:T ratio 10:1--closed circles, E:T ratio 5:1--open squares, E:T ratio 2:1--closed triangles and E:T ratio 1:1--open diamonds). The % cell death (% of TOPRO positive cells) was plotted against the concentration of the polypeptides.
[0384] FIG. 14: Time-dependent cytolytic activity of CD20/TCR binding polypeptides in the purified primary human T cell mediated killing assay in xCELLigence using CHO-K1 human CD20 target cells. The % specific lysis was plotted against the concentration of the construct. The different curves represent the analysis time after addition of the T cells.
[0385] FIGS. 15A-15C: Binding of a serial dilution of half-life extended polypeptides to human TCR/CD3 expressed on CHO-K1 cells (FIG. 15A, panels of column labeled "CHO-K1 huTCR (2XN9)/CD3 cells"), primary human T cells (FIG. 15B, panels of column labeled "Human T cells") and Ramos cells (FIG. 15C, panels of column labeled "Ramos cells"). The MCF value (mean channel fluorescence) was plotted against the concentration of the polypeptides.
[0386] FIGS. 16A-16D: Dose-dependent killing effect of CD20xTCR binding multispecific polypeptides versus CD20xTCRxALB11 binding polypeptides in a flow cytometry based human T cell mediated Ramos B cell killing assay (FIG. 16A, panel labeled as "T017000076 (square) vs T017000093 (triangle)"; FIG. 16C, panel labeled as "T017000068 (square) vs T017000095 (triangle)"). Dose-dependent killing effect of CD20xTCRxALB11 binding polypeptides in the absence or presence of 30 .mu.M HSA in a flow cytometry based human T cell mediated Ramos B cell killing assay (FIG. 16B, panel labeled as "T017000093 in the absence (full line) or presence of 30 .mu.M HSA (open symbol--dotted line)"; FIG. 16D, panel labeled as "T017000095 in the absence (full line) or presence of 30 .mu.M HSA (open symbol--dotted line)"). The % cell death (% of TOPRO positive cells) was plotted against the concentration of the polypeptides.
[0387] FIG. 17: Binding of 100 nM monovalent anti-HER2 Nanobody (5F07) to SKBR3, MCF-7 and MDA-MB-468 cell lines in flow cytometry to assess HER2 expression levels. The MCF value (mean channel fluorescence) was plotted for each cell line.
[0388] FIGS. 18A-18C: Dose-dependent killing effect of multispecific TCRxHER2 binding polypeptides (dotted line) and multispecific HER2xTCR binding polypeptides (full line) in an xCELLigence based human T cell mediated killing assay using SKBR-3 cells (FIG. 18A, panel labeled as "SKBR3 cells"), MCF-7 cells (FIG. 18B, panel labeled as "MCF-7 cells") and MDA-MB-468 cells (FIG. 18C, panel labeled as "-MDA-MB-468 cells"). Data were analysed after 18 h. The cell index (CI) was plotted against the concentration of the polypeptides.
[0389] FIG. 19: Dose-dependent INF-.gamma. production by human T cells after incubation of HER2-positive cells with multispecific TCRxHER2 binding polypeptides (dotted line) and multispecific HER2xTCR binding polypeptides (full line) in an xCELLigence based assay. Data were analysed after 72 h incubation. The OD was plotted against the concentration of the polypeptides.
[0390] FIGS. 20A and 20B: Dose-dependent killing effect of CD20xTCR binding (full line) and TCRxCD20 binding (dotted line) multispecific polypeptides in a flow cytometry based cynomolgus T cell mediated Ramos B cell killing assay. The % cell death (% of TOPRO positive cells) was plotted against the concentration of the polypeptides.
[0391] FIGS. 21A and 21B: Dose-dependent killing effect of CD20xTCR binding (full line) and TCRxCD20 binding (dotted line) bispecific polypeptides in the xCELLigence based cynomolgus T cell mediated CHO-K1 human CD20 killing assay. The CI was plotted against the concentration of polypeptides. FIGS. 22A-22C: Dose dependent binding of monovalent anti-TCR Nanobodies (closed circles) and an irrelevant Nanobody (open circles) to soluble recombinant cynomolgus TCR .alpha./.beta.-zipper protein. The OD at 450 nm was plotted against the concentration of the Nanobody.
[0392] FIGS. 23A and 23B: Kinetic analysis of T0170055A02 (FIG. 23A) and T0170056G05 (FIG. 23B) on soluble recombinant cynomolgus TCR.alpha./.beta.-zipper protein interaction via BioLayer Interferometry on an Octet RED384 instrument. Applied analyte concentrations were: 1000, 333, 111, 37, 12.3, 4.1 and 1.4 nM. Langmuir fits to the kinetic data are indicated with the black lines, whereas sensorgrams are presented by the grey lines.
[0393] FIGS. 24A and 24B: Dose-dependent killing effect of T017000076 (CD20xTCR binding multispecific construct) versus T017000093 (CD20xTCRxALB11 binding construct) in a flow cytometry based cynomolgus T cell mediated Ramos B cell killing assay (FIG. 24A). Dose-dependent killing of T017000093 in the presence of 30 .mu.M HSA in a flow cytometry based cynomolgus T cell mediated Ramos B cell killing assay (FIG. 24B, panel labeled as "T017000093 in presence of 30 .mu.M HSA (open triangle)"). The % cell death (% of TOPRO positive cells) was plotted against the concentration of the Nanobody.
[0394] FIG. 25: Dose-dependent killing effect of CD20xTCR binding multispecific construct versus CD20xTCRxALB11 binding construct and versus CD20xTCRxALB11 binding construct in the presence of 30 .mu.M HSA in a cynomolgus T cell mediated CHO-K1 human CD20 transfected cell xCELLigence based assay. The cell index (CI) ws plotted against the concentration of Nanobody.
[0395] FIG. 26: Dose-dependent killing effect of multispecific TCRxHER2 binding polypeptides (dotted line) and multispecific HER2xTCR binding polypeptides (full line) in an xCELLigence based cynomolgus T cell mediated HER2-positive SKBR-3 tumour killing assay. Data were analysed after 40 h incubation. The cell index (CI) was plotted against the concentration of the Nanobody.
[0396] FIG. 27: Study design for Ramos model as described in Example 19. Ramos cells were injected intravenously in to mice on day 1 (D1). PBMCs were injected intraperitoneally in to animals on day 3 (D3). Mice were treated from D3 to day 7 (D7) with T017000083 (TCR/CD20) IV once daily during 5 days (Q1Dx5) or T017000088 (irrelevant multispecific polypeptide) IV Q1Dx5.
[0397] FIGS. 28A-28D: Absolute Ramos B cell count on log scale in bone marrow (FIG. 28A) and spleen (FIG. 28B). Absolute PBMC derived B cell count on log scale in bone marrow (FIG. 28C) and spleen (FIG. 28D). Individual animal results are depicted. The number of B cells is shown in function of the different treatment groups. The open circles on top of the graphs show which active doses were statistically significant different from the irrelevant polypeptide (T017000088) based on the F-tests from the mixed-effects ANOVA analysis. All effects in the spleen are statistically significant at the 5% level of significance. Notably, the Y-axis value of 0.001 signifies no cells counted.
[0398] FIG. 29: Study design for PBMC B cell depletion model as described in Example 20. PBMCs were injected intraperitoneally to animals on day 3 (D3). Mice were treated from D3 to day 7 (D7) with T017000083 (TCR/CD20) IV once daily during 5 days (Q1Dx5) or T017000088 (irrelevant polypeptide) IV Q1Dx5.
[0399] FIG. 30: Absolute PBMC-derived B cell count on log scale. Individual animal results are depicted. The number of B cells is shown in function of the different treatment groups. Notably, Y-axis value of 0.001 signifies no cells counted.
[0400] FIGS. 31A and 31B: Determination of EGFR (FIG. 31A; with anti-EGFR antibody; Santa Cruz, sc-120 PE) or CEACAM5 (FIG. 31B; with anti-CEACAM antibody; Sino Biological, 11077-MM02-P) expression level on HER14, Hela, LoVo and LS174-T cell lines in flow cytometry. The MCF value (mean channel fluorescence) was plotted for each cell line.
[0401] FIGS. 32A-32D: Dose-dependent binding of the monovalent Nanobodies and multispecific polypeptides to HER14 (FIG. 32A), LS174T (FIG. 32B), primary human T cells (FIG. 32C) and LoVo cells (FIG. 32D). The mean channel fluorescence intensity was plotted against the concentration.
[0402] FIG. 33: Determination of EGFR and CEACAM5 expression levels of HER14, LoVo and LS174T cell lines using 100 nM of the EGFR and CEACAM Nanobodies in flow cytometry. The MFI value (mean fluorescence intensity) was plotted for each cell line.
[0403] FIGS. 34A-34E: Dose-dependent redirected LoVo (FIG. 34A; FIG. 34B), LST174T (FIG. 34C; FIG. 34D) and HER14 (FIG. 34E) target cell killing of multispecific polypeptides by human effector T cells in the xCELLigence based assay using an effector to target ratio of 15. The CI after an incubation time of 30 h-40 h (FIG. 34A, FIG. 34C) and 50 h-60 h (FIG. 34B, FIG. 34D, FIG. 34E) was plotted against the concentration of the multispecific polypeptides. (T017000107=circle, T017000109=square, T017000110=triangle).
[0404] FIG. 35: Study design of the in vivo Ramos model used in Example 26. Ramos cells were injected intravenously into mice on day 1 (D1). PBMCs were injected intraperitoneally to animals on day 3 (D3). Mice were treated from D3 to day 7 (D7) with T017000088, T017000106, T017000083, T017000104 or T017000105.
[0405] FIGS. 36A and 36B: Absolute Ramos B cell count on log scale in bone marrow (FIG. 36A) and spleen (FIG. 36B). Individual animal results are depicted. The number of Ramos B cells are shown in function of the different treatment groups. The stars on top of the graph show which active doses were statistically significant different from the control Nanobody (T017000088 or T017000106) based on the F-tests from the mixed-effects ANOVA analysis. All effects are statistically significant at the 5% level of significance.
[0406] FIGS. 37A and 37B: Absolute PBMC derived B cell count on log scale in bone marrow (FIG. 37A) and spleen (FIG. 37B). Individual animal results are depicted. The number of PBMC derived B cells are shown in function of the different treatment groups. The stars on top of the graph show which active doses were statistically significant different from the control Nanobody (T017000088 or T017000106) based on the F-tests from the mixed-effects ANOVA analysis. All effects are statistically significant at the 5% level of significance.
[0407] FIGS. 38A-38C: Dose-dependent redirected SKBR3 target cell killing of T017000102 by human effector T cells isolated from donor 932 (FIG. 38A), human CD4+ T cells isolated from donor 941 (FIG. 38B) and human CD8+ T cells isolated from donor 941 (FIG. 38C) in the xCELLigence based assay using an effector to target ratio of 15. The CI after an incubation time of 40 h was plotted against the concentration of the multispecific polypeptide.
[0408] FIGS. 39A-39F: Dose-dependent T cell activation of human effector T cells isolated from donor 932 (FIG. 39A; FIG. 39D), human CD4+ T cells isolated from donor 941 (FIG. 39B; FIG. 39E) and human CD8+ T cells isolated from donor 941 (FIG. 39C; FIG. 39F) by T017000102 in a redirected SKBR3 target cell killing setting. Activation was measured by monitoring the CD69 (FIG. 39A, FIG. 39B, FIG. 39C) upregulation and CD25 (FIG. 39D, FIG. 39E, FIG. 39F) upregulation. The mean fluorescence intensity (MFI) was plotted against the concentration.
[0409] FIGS. 40A-40F: Dose-dependent cytokine production by human effector T cells isolated from donor 932 (FIG. 40A; FIG. 40D), human CD4+ T cells isolated from donor 941 (FIG. 40B; FIG. 40E) and human CD8+ T cells isolated from donor 941 (FIG. 40C; FIG. 40F) by T017000102 in a redirected SKBR3 target cell killing setting. Human INF-.gamma. production (FIG. 40A, FIG. 40B, FIG. 40C) and human IL-6 (FIG. 40D, FIG. 40E, FIG. 40F) was measured after 72 h of incubation. The measured concentration human INF-.gamma. and human IL-6 (in pg/ml) was plotted against the concentration of the Nanobody.
[0410] FIGS. 41A-41D: Dose-dependent binding of HLE construct T017000108 to HER14 (FIG. 41A), LS174T (FIG. 41B), primary human T cells (FIG. 41C) and LoVo cells (FIG. 41D). The mean fluorescence intensity (MFI) was plotted against the concentration.
[0411] FIG. 42: Dose-dependent redirected LS174T target cell killing of T017000107 (solid line) and T017000108 (dotted line) by human effector T cells in the xCELLigence based assay using an effector to target ratio of 15. The CI after an incubation time of 48 h was plotted against the concentration of the multispecific polypeptides.
DETAILED DESCRIPTION OF THE INVENTION
[0412] The present inventors realized that formats bringing T cells and tumour cells together to induce an immune response should comply with various and frequently opposing requirements. The format should be broadly applicable. In particular, the format should preferably be useful in a broad range of patients and preferably also against a broad range of tumours. The format should preferably be safe and only target the intended cells. In addition, the format should preferably be small enough to easily penetrate tissues and tumours, while on the other hand the format should be patient friendly. For instance, the format should have an extended half-life, such that the format is not removed instantaneous upon administration by renal clearance. However, extending the half-life should preferably not introduce off-target activity and side effects or limit the penetration into tissues and tumours. Additionally, it was recognized that tumour cells often create escape mechanisms by the down-regulation of targeted antigens within a therapy. Accordingly, in a further preferred version, the format should simultaneously target multiple antigens.
[0413] The present invention realizes at least one of these requirements.
[0414] In particular, it was hypothesized that immunoglobulin single variable domains (ISVs) would in principle be ideal candidates, since they are small enough to easily penetrate (tumour) tissue and can be combined with other ISVs as building blocks. Next, ISVs directed against the constant TCR domains should have broad applicability. In contrast to the variable TCR domains, these constant TCR domains display less sequence variability, and consequently should be useful in a broad range of patients.
[0415] Unexpectedly, it turned out to be extremely difficult to generate ISVs via immunization in llamas against the constant domains of TCR. Either no significant immune response was mounted, or the generated ISVs were directed against the variable TCR domains. Only by implementing a rigorously carried out immunization and screening method using different cells and sequences for immunization and boosting as well as using different screening proteins, the inventors were able to isolate ISVs against the constant TCR domains. Although only three clusters of related ISVs were identified, these ISVs had an unexpected range of advantageous features. First, the ISVs were unexpectedly broadly applicable, i.e. the TCR ISVs were able to bind to T cells from different donors with high affinity. Formatted in a multispecific polypeptide, the TCR ISVs enabled tumour cell killing with different tumour associated antigens. Hence, the TCR ISVs can be used against a multitude of cancers. In addition, the multispecific polypeptides comprising the TCR ISVs remained active when bound to albumin. This contributes to a favourable PK profile and patient compliance, while minimizing side effects. The polypeptides of the invention only showed effects when bound both to the T cell and the target cell, which is indicative of its safety.
[0416] The present inventors considered that the simultaneous targeting of multiple antigens reduces the probability of generating tumour escape variants, because of which the therapeutic activity of T cell engaging strategy is improved. Multispecific polypeptides are provided which comprise a TCR ISV combined with immunoglobulin single variable domains against different target antigens and/or different epitopes on a particular antigen (biparatopic).
[0417] Immunoglobulin sequences, such as antibodies and antigen binding fragments derived there from (e.g., immunoglobulin single variable domains or ISVs) are used to specifically target their respective antigens in research and therapeutic applications. The generation of immunoglobulin single variable domains such as e.g., VHHs or Nanobodies may involve the immunization of an experimental animal such as a Llama, construction of phage libraries from immune tissue, selection of phage displaying antigen binding immunoglobulin single variable domains and screening of said domains and engineered constructs thereof for the desired specificities (WO 94/04678). Alternatively, similar immunoglobulin single variable domains such as e.g., dAbs can be generated by selecting phage displaying antigen binding immunoglobulin single variable domains directly from naive or synthetic libraries and subsequent screening of said domains and engineered constructs thereof for the desired specificities (Ward et al., Nature, 1989, 341: 544-546; Holt et al., Trends Biotechnol., 2003, 21(11):484-490; as well as for example WO 06/030220, WO 06/003388 and other published patent applications of Domantis Ltd.). Unfortunately, the use of monoclonal and/or heavily engineered antibodies also carries a high manufacturing cost and may result in suboptimal tumor penetration compared to other strategies.
[0418] The present invention provides multispecific polypeptides that specifically bind to the T cell receptor (TCR), with an unexpected range of advantageous features. First, the polypeptides are easy to manufacture. Moreover, the ISVs are unexpectedly broadly applicable, i.e. the TCR ISVs were able to bind to T cells from different donors with high affinity. Formatted in a multispecific polypeptide, the TCR ISVs enabled tumour cell killing with different tumour associated antigens. In contrast, no killing was observed when the polypeptides were not bound to T cells and target cell which underscores the safety of the polypeptides of the invention. Hence, the TCR ISVs can be used against a multitude of cancers. Moreover, the TCR ISVs can be considered as safe. In addition, the multispecific polypeptides comprising the TCR ISVs remained active when bound to albumin. This will contribute to a favourable PK profile and patient compliance, while minimizing side effects.
[0419] Accordingly, the present invention relates to a polypeptide comprising a first and a second immunoglobulin single variable domain (ISV), wherein the first ISV has high affinity for/binds to the constant domain of the T cell receptor (TCR) and the second ISV has high affinity for/binds to an antigen on a cell (target cell), preferably a tumour cell. The antigen is preferably specific for said target cell, such as e.g. a tumour associated antigen (TAA). The multispecific polypeptide of the invention directs the T cell to the cell, e.g. a tumour cell and induces T cell activation in order to allow said T cell to inhibit or kill said target cell, e.g. said tumour cell.
Definitions
[0420] a) Unless indicated or defined otherwise, all terms used have their usual meaning in the art, which will be clear to the skilled person. Reference is for example made to the standard handbooks mentioned in paragraph a) on page 46 of WO 08/020079.
[0421] b) The term "immunoglobulin single variable domain", interchangeably used with "single variable domain" and "ISV", defines molecules wherein the antigen binding site is present on, and formed by, a single immunoglobulin domain. This sets immunoglobulin single variable domains apart from "conventional" immunoglobulins or their fragments (such as Fabs, scFvs, etc.), wherein two immunoglobulin domains, in particular two variable domains, interact to form an antigen binding site. Typically, in conventional immunoglobulins, a heavy chain variable domain (VH) and a light chain variable domain (VL) interact to form an antigen binding site. In this case, the complementarity determining regions (CDRs) of both VH and VL will contribute to the antigen binding site, i.e. a total of 6 CDRs will be involved in antigen binding site formation. In contrast, the binding site of an immunoglobulin single variable domain is formed by a single VH or VL domain. Hence, the antigen binding site of an immunoglobulin single variable domain is formed by no more than three CDRs.
[0422] The terms "immunoglobulin single variable domain", "single variable domain", and "ISV" hence do not comprise conventional immunoglobulins or their fragments which require interaction of at least two variable domains for the formation of an antigen binding site. However, these terms do comprise fragments of conventional immunoglobulins wherein the antigen binding site is formed by a single variable domain.
[0423] The term "immunoglobulin single variable domain" or "ISV" includes (without being limiting) antigen-binding domains or fragments such as V.sub.HH domains or V.sub.H or V.sub.L domains, respectively. The terms antigen-binding molecules or antigen-binding protein are used interchangeably and include also the term Nanobodies. The immunoglobulin single variable domains can be light chain variable domain sequences (e.g., a V.sub.L-sequence), or heavy chain variable domain sequences (e.g., a V.sub.H-sequence); more specifically, they can be heavy chain variable domain sequences that are derived from a conventional four-chain antibody or heavy chain variable domain sequences that are derived from a heavy chain antibody. Accordingly, the immunoglobulin single variable domains can be domain antibodies, or immunoglobulin sequences that are suitable for use as domain antibodies, single domain antibodies, or immunoglobulin sequences that are suitable for use as single domain antibodies, "dAbs", or immunoglobulin sequences that are suitable for use as dAbs, or Nanobodies, including but not limited to V.sub.HH sequences, humanized VHH sequences or camelized VH sequences. The invention includes immunoglobulin sequences of different origin, comprising mouse, rat, rabbit, donkey, human and camelid immunoglobulin sequences. The immunoglobulin single variable domain includes fully human, humanized, otherwise sequence optimized or chimeric immunoglobulin sequences. The immunoglobulin single variable domain and structure of an immunoglobulin single variable domain can be considered--without however being limited thereto--to be comprised of four framework regions or "FR's", which are referred to in the art and herein as "Framework region 1" or "FR1"; as "Framework region 2" or "FR2"; as "Framework region 3" or "FR3"; and as "Framework region 4" or "FR4", respectively; which framework regions are interrupted by three complementary determining regions or "CDR's", which are referred to in the art as "Complementarity Determining Region 1" or "CDR1"; as "Complementarity Determining Region 2" or "CDR2"; and as "Complementarity Determining Region 3" or "CDR3", respectively. It is noted that the terms Nanobody or Nanobodies are registered trademarks of Ablynx N.V. and thus may also be referred to as Nanobody or Nanobodies, respectively.
[0424] c) Unless indicated otherwise, the terms "immunoglobulin sequence", "sequence", "nucleotide sequence" and "nucleic acid" are as described in paragraph b) on page 46 of WO 08/020079.
[0425] d) Unless indicated otherwise, all methods, steps, techniques and manipulations that are not specifically described in detail can be performed and have been performed in a manner known per se, as will be clear to the skilled person. Reference is for example again made to the standard handbooks and the general background art mentioned herein and to the further references cited therein; as well as to for example the following reviews Presta 2006 (Adv. Drug Deliv. Rev. 58 (5-6):640-656), Levin and Weiss 2006 (Mol. Biosyst. 2(1):49-57), Irving et al. 2005 (J. Immunol. Methods 248(1-2):31-45), Schmitz et al. 2000 (Placenta 21 Suppl. A: S106-112, Gonzales et al. 2005 (Tumour Biol. 26(1):31-43), which describe techniques for protein engineering, such as affinity maturation and other techniques for improving the specificity and other desired properties of proteins such as immunoglobulins.
[0426] e) Amino acid residues will be indicated according to the standard three-letter or one-letter amino acid code. Reference is made to Table A-2 on page 48 of the International application WO 08/020079 of Ablynx N.V. entitled "Immunoglobulin single variable domains directed against IL-6R and polypeptides comprising the same for the treatment of diseases and disorders associated with 11-6 mediated signalling".
[0427] f) For the purposes of comparing two or more nucleotide sequences, the percentage of "sequence identity" between a first nucleotide sequence and a second nucleotide sequence may be calculated or determined as described in paragraph e) on page 49 of WO 08/020079 (incorporated herein by reference), such as by dividing [the number of nucleotides in the first nucleotide sequence that are identical to the nucleotides at the corresponding positions in the second nucleotide sequence] by [the total number of nucleotides in the first nucleotide sequence] and multiplying by [100%], in which each deletion, insertion, substitution or addition of a nucleotide in the second nucleotide sequence--compared to the first nucleotide sequence--is considered as a difference at a single nucleotide (position); or using a suitable computer algorithm or technique, again as described in paragraph e) on pages 49 of WO 08/020079 (incorporated herein by reference).
[0428] g) For the purposes of comparing two or more immunoglobulin single variable domains or other amino acid sequences such e.g. the polypeptides of the invention etc., the percentage of "sequence identity" between a first amino acid sequence and a second amino acid sequence (also referred to herein as "amino acid identity") may be calculated or determined as described in paragraph f) on pages 49 and 50 of WO 08/020079 (incorporated herein by reference), such as by dividing [the number of amino acid residues in the first amino acid sequence that are identical to the amino acid residues at the corresponding positions in the second amino acid sequence] by [the total number of amino acid residues in the first amino acid sequence] and multiplying by [100%], in which each deletion, insertion, substitution or addition of an amino acid residue in the second amino acid sequence--compared to the first amino acid sequence--is considered as a difference at a single amino acid residue (position), i.e., as an "amino acid difference" as defined herein; or using a suitable computer algorithm or technique, again as described in paragraph f) on pages 49 and 50 of WO 08/020079 (incorporated herein by reference).
[0429] Also, in determining the degree of sequence identity between two immunoglobulin single variable domains, the skilled person may take into account so-called "conservative" amino acid substitutions, as described on page 50 of WO 08/020079.
[0430] Any amino acid substitutions applied to the polypeptides described herein may also be based on the analysis of the frequencies of amino acid variations between homologous proteins of different species developed by Schulz et al. 1978 (Principles of Protein Structure, Springer-Verlag), on the analyses of structure forming potentials developed by Chou and Fasman 1975 (Biochemistry 13: 211) and 1978 (Adv. Enzymol. 47: 45-149), and on the analysis of hydrophobicity patterns in proteins developed by Eisenberg et al. 1984 (Proc. Natl. Acad. Sci. USA 81: 140-144), Kyte & Doolittle 1981 (J Molec. Biol. 157: 105-132), and Goldman et al. 1986 (Ann. Rev. Biophys. Chem. 15: 321-353), all incorporated herein in their entirety by reference. Information on the primary, secondary and tertiary structure of Nanobodies is given in the description herein and in the general background art cited above. Also, for this purpose, the crystal structure of a V.sub.HH domain from a llama is for example given by Desmyter et al. 1996 (Nature Structural Biology, 3: 803), Spinelli et al. 1996 (Natural Structural Biology 3: 752-757), and Decanniere et al. 1999 (Structure, 7: 361). Further information about some of the amino acid residues that in conventional V.sub.H domains form the V.sub.H/V.sub.L interface and potential camelizing substitutions on these positions can be found in the prior art cited above.
[0431] h) Immunoglobulin single variable domains and nucleic acid sequences are said to be "exactly the same" if they have 100% sequence identity (as defined herein) over their entire length.
[0432] i) When comparing two immunoglobulin single variable domains, the term "amino acid difference" refers to an insertion, deletion or substitution of a single amino acid residue on a position of the first sequence, compared to the second sequence; it being understood that two immunoglobulin single variable domains can contain one, two or more such amino acid differences.
[0433] j) When a nucleotide sequence or amino acid sequence is said to "comprise" another nucleotide sequence or amino acid sequence, respectively, or to "essentially consist of" another nucleotide sequence or amino acid sequence, this has the meaning given in paragraph i) on pages 51-52 of WO 08/020079.
[0434] k) The term "in essentially isolated form" has the meaning given to it in paragraph j) on pages 52 and 53 of WO 08/020079.
[0435] l) The terms "domain" and "binding domain" have the meanings given to it in paragraph k) on page 53 of WO 08/020079.
[0436] m) The terms "antigenic determinant" and "epitope", which may also be used interchangeably herein, have the meanings given to it in paragraph l) on page 53 of WO 08/020079.
[0437] n) As further described in paragraph m) on page 53 of WO 08/020079, an amino acid sequence (such as an antibody, a polypeptide of the invention, or generally an antigen-binding protein or polypeptide or a fragment thereof) that can (specifically) bind to, that has affinity for and/or that has specificity for a specific antigenic determinant, epitope, antigen or protein (or for at least one part, fragment or epitope thereof) is said to be "against" or "directed against" said antigenic determinant, epitope, antigen or protein.
[0438] o) The term "specificity" refers to the number of different types of antigens or antigenic determinants to which a particular antigen-binding molecule or antigen-binding protein (such as an ISV, Nanobody or a polypeptide of the invention) can bind. The specificity of an antigen-binding protein can be determined based on affinity and/or avidity.
[0439] The affinity, represented by the equilibrium constant for the dissociation of an antigen with an antigen-binding protein (K.sub.D or KD), is a measure for the binding strength between an antigenic determinant, i.e. the target, and an antigen-binding site on the antigen-binding protein, i.e. the ISV or Nanobody: the lesser the value of the K.sub.D, the stronger the binding strength between an antigenic determinant and the antigen-binding molecule (alternatively, the affinity can also be expressed as the affinity constant (K.sub.A), which is 1/K.sub.D). As will be clear to the skilled person (for example on the basis of the further disclosure herein), affinity can be determined in a manner known per se, depending on the specific antigen of interest.
[0440] Avidity is the affinity of the polypeptide, i.e. the ligand is able to bind via two (or more) pharmacophores (ISV) in which the multiple interactions synergize to enhance the "apparent" affinity. Avidity is the measure of the strength of binding between the polypeptide of the invention and the pertinent antigens. The polypeptide of the invention is able to bind via its two (or more) building blocks, such as ISVs or Nanobodies, to the at least two targets, in which the multiple interactions, e.g. the first building block, ISV or Nanobody binding to the first target and the second building block, ISV, or Nanobody binding to the second target, synergize to enhance the "apparent" affinity. Avidity is related to both the affinity between an antigenic determinant and its antigen binding site on the antigen-binding molecule and the number of pertinent binding sites present on the antigen-binding molecules. For example, and without limitation, polypeptides that contain two or more building blocks, such as ISVs or Nanobodies directed against different targets on a cell may (and usually will) bind with higher avidity than each of the individual monomers or individual building blocks, such as, for instance, the monovalent ISVs or Nanobodies, comprised in the polypeptides of the invention.
[0441] Any K.sub.D value greater than 10.sup.-4 mol/liter (or any K.sub.A value lower than 10.sup.4 M.sup.-1) liters/mol is generally considered to indicate non-specific binding.
[0442] The polypeptides of the invention comprise a first and a second building block, e.g. a first and a second ISV, or a first and a second Nanobody. Preferably the affinity of each building block, e.g. ISV or Nanobody, is determined individually. In other words, the affinity is determined for the monovalent building block, ISV or Nanobody, independent of avidity effects due to the other building block, ISV or Nanobody, which might or might not be present. The affinity for a monovalent building block, ISV or Nanobody can be determined on the monovalent building block, ISV or Nanobody per se, i.e. when said monovalent building block, ISV or Nanobody is not comprised in the polypeptide of the invention. In the alternative or in addition, the affinity for a monovalent building block, ISV or Nanobody can be determined on one target while the other target is absent.
[0443] The binding of an antigen-binding protein to an antigen or antigenic determinant can be determined in any suitable manner known per se, including, for example, Scatchard analysis and/or competitive binding assays, such as radioimmunoassays (RIA), enzyme immunoassays (EIA) and sandwich competition assays, and the different variants thereof known per se in the art; as well as the other techniques mentioned herein.
[0444] The dissociation constant may be the actual or apparent dissociation constant, as will be clear to the skilled person. Methods for determining the dissociation constant will be clear to the skilled person, and for example include the techniques mentioned herein. In this respect, it will also be clear that it may not be possible to measure dissociation constants of more than 10.sup.-4 moles/liter or 10.sup.-3 moles/liter (e.g., of 10.sup.-2 moles/liter). Optionally, as will also be clear to the skilled person, the (actual or apparent) dissociation constant may be calculated on the basis of the (actual or apparent) association constant (K.sub.A), by means of the relationship [K.sub.D=1/K.sub.A].
[0445] The affinity denotes the strength or stability of a molecular interaction. The affinity is commonly given as by the K.sub.D, or dissociation constant, which has units of mol/liter (or M). The affinity can also be expressed as an association constant, K.sub.A, which equals 1/K.sub.D and has units of (mol/liter).sup.-1 (or M.sup.-1). In the present specification, the stability of the interaction between two molecules (such as an amino acid sequence, Nanobody or polypeptide of the invention and its intended target) will mainly be expressed in terms of the K.sub.D value of their interaction; it being clear to the skilled person that in view of the relation K.sub.A=1/K.sub.D, specifying the strength of molecular interaction by its K.sub.D value can also be used to calculate the corresponding K.sub.A value. The K.sub.D value characterizes the strength of a molecular interaction also in a thermodynamic sense as it is related to the free energy (DG) of binding by the well known relation DG=RTln(K.sub.D) (equivalently DG=-RTln(K.sub.A)), where R equals the gas constant, T equals the absolute temperature and ln denotes the natural logarithm.
[0446] The K.sub.D for biological interactions which are considered meaningful (e.g. specific) are typically in the range of 10.sup.-10M (0.1 nM) to 10.sup.-5M (10000 nM). The stronger an interaction is, the lower is its K.sub.D.
[0447] The K.sub.D can also be expressed as the ratio of the dissociation rate constant of a complex, denoted as k.sub.off, to the rate of its association, denoted k.sub.on(so that K.sub.D=k.sub.off/k.sub.on and K.sub.A=k.sub.on/k.sub.off). The off-rate k.sub.off has units s.sup.-1 (where s is the SI unit notation of second). The on-rate k.sub.on has units M.sup.-1s.sup.-1. The on-rate may vary between 10.sup.2 M.sup.-1s.sup.-1 to about 10.sup.7 M.sup.-1s.sup.-1, approaching the diffusion-limited association rate constant for biomolecular interactions. The off-rate is related to the half-life of a given molecular interaction by the relation t.sub.1/2=ln(2)/k.sub.off. The off-rate may vary between 10.sup.-6 s.sup.-1 (near irreversible complex with a t.sub.1/2 of multiple days) to 1 s.sup.-1 (t.sub.1/2=0.69 s).
[0448] The affinity of a molecular interaction between two molecules can be measured via different techniques known per se, such as the well-known surface plasmon resonance (SPR) biosensor technique (see for example Ober et al. 2001, Intern. Immunology, 13: 1551-1559). The term "surface plasmon resonance", as used herein, refers to an optical phenomenon that allows for the analysis of real-time biospecific interactions by detection of alterations in protein concentrations within a biosensor matrix, where one molecule is immobilized on the biosensor chip and the other molecule is passed over the immobilized molecule under flow conditions yielding k.sub.on, k.sub.off measurements and hence K.sub.D (or K.sub.A) values. This can for example be performed using the well-known BIAcore.RTM. system (BIAcore International AB, a GE Healthcare company, Uppsala, Sweden and Piscataway, N.J.). For further descriptions, see Jonsson et al. 1993 (Ann. Biol. Clin. 51: 19-26), Jonsson et al. 1991 (Biotechniques 11: 620-627), Johnsson, et al. 1995 (J. Mol. Recognit. 8: 125-131), and Johnnson, et al. 1991 (Anal. Biochem. 198: 268-277).
[0449] Another well-known biosensor technique to determine affinities of biomolecular interactions is bio-layer interferometry (BLI) (see for example Abdiche et al. 2008, Anal. Biochem. 377: 209-217). The term "bio-layer Interferometry" or "BLI", as used herein, refers to a label-free optical technique that analyzes the interference pattern of light reflected from two surfaces: an internal reference layer (reference beam) and a layer of immobilized protein on the biosensor tip (signal beam). A change in the number of molecules bound to the tip of the biosensor causes a shift in the interference pattern, reported as a wavelength shift (nm), the magnitude of which is a direct measure of the number of molecules bound to the biosensor tip surface. Since the interactions can be measured in real-time, association and dissociation rates and affinities can be determined. BLI can for example be performed using the well-known Octet.RTM. Systems (ForteBio, a division of Pall Life Sciences, Menlo Park, USA).
[0450] Alternatively, affinities can be measured in Kinetic Exclusion Assay (KinExA) (see for example Drake et al. 2004, Anal. Biochem., 328: 35-43), using the KinExA.RTM. platform (Sapidyne Instruments Inc, Boise, USA). The term "KinExA", as used herein, refers to a solution-based method to measure true equilibrium binding affinity and kinetics of unmodified molecules. Equilibrated solutions of an antibody/antigen complex are passed over a column with beads precoated with antigen (or antibody), allowing the free antibody (or antigen) to bind to the coated molecule. Detection of the antibody (or antigen) thus captured is accomplished with a fluorescently labeled protein binding the antibody (or antigen).
[0451] It will also be clear to the skilled person that the measured K.sub.D may correspond to the apparent K.sub.D if the measuring process somehow influences the intrinsic binding affinity of the implied molecules for example by artefacts related to the coating on the biosensor of one molecule. Also, an apparent K.sub.D may be measured if one molecule contains more than one recognition site for the other molecule. In such situation the measured affinity may be affected by the avidity of the interaction by the two molecules.
[0452] Another approach that may be used to assess affinity is the 2-step ELISA (Enzyme-Linked Immunosorbent Assay) procedure of Friguet et al. 1985 (J. Immunol. Methods, 77: 305-19). This method establishes a solution phase binding equilibrium measurement and avoids possible artefacts relating to adsorption of one of the molecules on a support such as plastic.
[0453] However, the accurate measurement of K.sub.D may be quite labour-intensive, and as consequence, often apparent K.sub.D values are determined to assess the binding strength of two molecules. It should be noted that as long as all measurements are made in a consistent way (e.g. keeping the assay conditions unchanged) apparent K.sub.D measurements can be used as an approximation of the true K.sub.D and hence, in the present document, K.sub.D and apparent K.sub.D should be treated with equal importance or relevance.
[0454] Finally, it should be noted that in many situations the experienced scientist may judge it to be convenient to determine the binding affinity relative to some reference molecule. For example, to assess the binding strength between molecules A and B, one may e.g. use a reference molecule C that is known to bind to B and that is suitably labelled with a fluorophore or chromophore group or other chemical moiety, such as biotin for easy detection in an ELISA or FACS (Fluorescent activated cell sorting) or other format (the fluorophore for fluorescence detection, the chromophore for light absorption detection, the biotin for streptavidin-mediated ELISA detection). Typically, the reference molecule C is kept at a fixed concentration and the concentration of A is varied for a given concentration or amount of B. As a result an IC50 value is obtained corresponding to the concentration of A at which the signal measured for C in absence of A is halved. Provided K.sub.D ref, the K.sub.D of the reference molecule, is known, as well as the total concentration c.sub.ref of the reference molecule, the apparent K.sub.D for the interaction A-B can be obtained from following formula: K.sub.D=IC50/(1+c.sub.ref/K.sub.D ref). Note that if c.sub.ref<<K.sub.D ref, K.sub.D.apprxeq.IC50. Provided the measurement of the IC50 is performed in a consistent way (e.g. keeping c.sub.ref fixed) for the binders that are compared, the strength or stability of a molecular interaction can be assessed by the IC50 and this measurement is judged as equivalent to K.sub.D or to apparent K.sub.D throughout this text.
[0455] p) The half-life of an amino acid sequence, compound or polypeptide of the invention can generally be defined as described in paragraph o) on page 57 of WO 08/020079 and as mentioned therein refers to the time taken for the serum concentration of the amino acid sequence, compound or polypeptide to be reduced by 50%, in vivo, for example due to degradation of the sequence or compound and/or clearance or sequestration of the sequence or compound by natural mechanisms. The in vivo half-life of an amino acid sequence, compound or polypeptide of the invention can be determined in any manner known per se, such as by pharmacokinetic analysis. Suitable techniques will be clear to the person skilled in the art, and may for example generally be as described in paragraph o) on page 57 of WO 08/020079. As also mentioned in paragraph o) on page 57 of WO 08/020079, the half-life can be expressed using parameters such as the t1/2-alpha, t1/2-beta and the area under the curve (AUC). Reference is for example made to the Experimental Part below, as well as to the standard handbooks, such as Kenneth et al. 1996 (Chemical Stability of Pharmaceuticals: A Handbook for Pharmacists) and Peters et al. 1996 (Pharmacokinete analysis: A Practical Approach). Reference is also made to Gibaldi & Perron 1982 (Pharmacokinetics, Dekker M, 2nd Rev. edition). The terms "increase in half-life" or "increased half-life" are as defined in paragraph o) on page 57 of WO 08/020079 and in particular refer to an increase in the t1/2-beta, either with or without an increase in the t1/2-alpha and/or the AUC or both.
[0456] q) In respect of a target or antigen, the term "interaction site" on the target or antigen means a site, epitope, antigenic determinant, part, domain or stretch of amino acid residues on the target or antigen that is a site for binding to a ligand, receptor or other binding partner, a catalytic site, a cleavage site, a site for allosteric interaction, a site involved in multimerisation (such as homomerization or heterodimerization) of the target or antigen; or any other site, epitope, antigenic determinant, part, domain or stretch of amino acid residues on the target or antigen that is involved in a biological action or mechanism of the target or antigen. More generally, an "interaction site" can be any site, epitope, antigenic determinant, part, domain or stretch of amino acid residues on the target or antigen to which an amino acid sequence or polypeptide of the invention can bind such that the target or antigen (and/or any pathway, interaction, signalling, biological mechanism or biological effect in which the target or antigen is involved) is modulated.
[0457] r) An immunoglobulin single variable domain or polypeptide is said to be "specific for" a first target or antigen compared to a second target or antigen when it binds to the first antigen with an affinity/avidity (as described above, and suitably expressed as a K.sub.D value, K.sub.A value, K.sub.off rate and/or K.sub.on rate) that is at least 10 times, such as at least 100 times, and preferably at least 1000 times, and up to 10.000 times or more better than the affinity with which said amino acid sequence or polypeptide binds to the second target or polypeptide. For example, the first antigen may bind to the target or antigen with a K.sub.D value that is at least 10 times less, such as at least 100 times less, and preferably at least 1000 times less, such as 10.000 times less or even less than that, than the K.sub.D with which said amino acid sequence or polypeptide binds to the second target or polypeptide. Preferably, when an immunoglobulin single variable domain or polypeptide is "specific for" a first target or antigen compared to a second target or antigen, it is directed against (as defined herein) said first target or antigen, but not directed against said second target or antigen.
[0458] s) The terms "cross-block", "cross-blocked" and "cross-blocking" are used interchangeably herein to mean the ability of an immunoglobulin single variable domain or polypeptide to interfere with the binding of the natural ligand to its receptor(s). The extent to which an immunoglobulin single variable domain or polypeptide of the invention is able to interfere with the binding of another compound such as the natural ligand to its target and therefore whether it can be said to cross-block according to the invention, can be determined using competition binding assays. One particularly suitable quantitative cross-blocking assay uses a FACS- or an ELISA-based approach or Alphascreen to measure competition between the labelled (e.g., His tagged or biotinylated) immunoglobulin single variable domain or polypeptide according to the invention and the other binding agent in terms of their binding to the target. The experimental part generally describes suitable FACS-, ELISA- or Alphascreen-displacement-based assays for determining whether a binding molecule cross-blocks or is capable of cross-blocking an immunoglobulin single variable domain or polypeptide according to the invention. It will be appreciated that the assay can be used with any of the immunoglobulin single variable domains or other binding agents described herein. Thus, in general, a cross-blocking amino acid sequence or other binding agent according to the invention is for example one which will bind to the target in the above cross-blocking assay such that, during the assay and in the presence of a second amino acid sequence or other binding agent of the invention, the recorded displacement of the immunoglobulin single variable domain or polypeptide according to the invention is between 60% and 100% (e.g., in ELISA/Alphascreen based competition assay) or between 80% to 100% (e.g., in FACS based competition assay) of the maximum theoretical displacement (e.g. displacement by cold (e.g., unlabeled) immunoglobulin single variable domain or polypeptide that needs to be cross-blocked) by the to be tested potentially cross-blocking agent that is present in an amount of 0.01 mM or less (cross-blocking agent may be another conventional monoclonal antibody such as IgG, classic monovalent antibody fragments (Fab, scFv) and engineered variants (e.g., diabodies, triabodies, minibodies, VHHs, dAbs, VHs, VLs)).
[0459] t) An amino acid sequence such as e.g. an immunoglobulin single variable domain or polypeptide according to the invention is said to be a "VHH1 type immunoglobulin single variable domain" or "VHH type 1 sequence", if said VHH1 type immunoglobulin single variable domain or VHH type 1 sequence has 85% identity (using the VHH1 consensus sequence as the query sequence and use the blast algorithm with standard setting, i.e., blosom62 scoring matrix) to the VHH1 consensus sequence (QVQLVESGGGLVQPGGSLRLSCAASGFTLDYYAIGWFRQAPGKEREGVSCISSSD GSTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAA) (SEQ ID NO: 483), and mandatorily has a cysteine in position 50, i.e., C50 (using Kabat numbering).
[0460] u) An amino acid sequence such as e.g., an immunoglobulin single variable domain or polypeptide according to the invention is said to be "cross-reactive" for two different antigens or antigenic determinants (such as serum albumin from two different species of mammal, such as human serum albumin and cynomolgus monkey serum albumin) if it is specific for (as defined herein) both these different antigens or antigenic determinants.
[0461] v) As further described in paragraph q) on pages 58 and 59 of WO 08/020079 (incorporated herein by reference), the amino acid residues of an immunoglobulin single variable domain are numbered according to the general numbering for V.sub.H domains given by Kabat et al. ("Sequence of proteins of immunological interest", US Public Health Services, NIH Bethesda, Md., Publication No. 91), as applied to V.sub.HH domains from Camelids in the article of Riechmann and Muyldermans, 2000 (J. Immunol. Methods 240 (1-2): 185-195; see for example FIG. 2 of this publication). It should be noted that--as is well known in the art for V.sub.H domains and for VHH domains--the total number of amino acid residues in each of the CDRs may vary and may not correspond to the total number of amino acid residues indicated by the Kabat numbering (that is, one or more positions according to the Kabat numbering may not be occupied in the actual sequence, or the actual sequence may contain more amino acid residues than the number allowed for by the Kabat numbering). This means that, generally, the numbering according to Kabat may or may not correspond to the actual numbering of the amino acid residues in the actual sequence. The total number of amino acid residues in a VH domain and a VHH domain will usually be in the range of from 110 to 120, often between 112 and 115. It should however be noted that smaller and longer sequences may also be suitable for the purposes described herein.
[0462] Determination of CDR regions may also be done according to different methods. In the CDR determination according to Kabat, FR1 of an immunoglobulin single variable domain comprises the amino acid residues at positions 1-30, CDR1 of an immunoglobulin single variable domain comprises the amino acid residues at positions 31-35, FR2 of an immunoglobulin single variable domain comprises the amino acids at positions 36-49, CDR2 of an immunoglobulin single variable domain comprises the amino acid residues at positions 50-65, FR3 of an immunoglobulin single variable domain comprises the amino acid residues at positions 66-94, CDR3 of an immunoglobulin single variable domain comprises the amino acid residues at positions 95-102, and FR4 of an immunoglobulin single variable domain comprises the amino acid residues at positions 103-113.
[0463] In the present application, however, unless indicated otherwise, CDR sequences were determined according to Kontermann and Dubel (Eds. 2010, Antibody Engineering, vol 2, Springer Verlag Heidelberg Berlin, Martin, Chapter 3, pp. 33-51). According to this method, FR1 comprises the amino acid residues at positions 1-25, CDR1 comprises the amino acid residues at positions 26-35, FR2 comprises the amino acids at positions 36-49, CDR2 comprises the amino acid residues at positions 50-58, FR3 comprises the amino acid residues at positions 59-94, CDR3 comprises the amino acid residues at positions 95-102, and FR4 comprises the amino acid residues at positions 103-113.
[0464] w) The Figures, Sequence Listing and the Experimental Part/Examples are only given to further illustrate the invention and should not be interpreted or construed as limiting the scope of the invention and/or of the appended claims in any way, unless explicitly indicated otherwise herein.
[0465] x) The half maximal inhibitory concentration (IC50) is a measure of the effectiveness of a compound in inhibiting a biological or biochemical function, e.g. a pharmacological effect. This quantitative measure indicates how much of the ISV or Nanobody (inhibitor) is needed to inhibit a given biological process (or component of a process, i.e. an enzyme, cell, cell receptor, chemotaxis, anaplasia, metastasis, invasiveness, etc) by half. In other words, it is the half maximal (50%) inhibitory concentration (IC) of a substance (50% IC, or IC50). The IC50 of a drug can be determined by constructing a dose-response curve and examining the effect of different concentrations of antagonist such as the ISV or Nanobody of the invention on reversing agonist activity. IC50 values can be calculated for a given antagonist such as the ISV or Nanobody of the invention by determining the concentration needed to inhibit half of the maximum biological response of the agonist.
[0466] The term half maximal effective concentration (EC50) refers to the concentration of a compound which induces a response halfway between the baseline and maximum after a specified exposure time. In the present context it is used as a measure of a polypeptide's, ISV's or Nanobody's potency. The EC50 of a graded dose response curve represents the concentration of a compound where 50% of its maximal effect is observed. Concentration is preferably expressed in molar units.
[0467] In biological systems, small changes in ligand concentration typically result in rapid changes in response, following a sigmoidal function. The inflection point at which the increase in response with increasing ligand concentration begins to slow is the EC50. This can be determined mathematically by derivation of the best-fit line. Relying on a graph for estimation is convenient in most cases. In case the EC50 is provided in the examples section, the experiments were designed to reflect the KD as accurate as possible. In other words, the EC50 values may then be considered as KD values. The term "average KD" relates to the average KD value obtained in at least 1, but preferably more than 1, such as at least 2 experiments. The term "average" refers to the mathematical term "average" (sums of data divided by the number of items in the data).
[0468] It is also related to IC50 which is a measure of a compound's inhibition (50% inhibition). For competition binding assays and functional antagonist assays, IC50 is the most common summary measure of the dose-response curve. For agonist/stimulator assays the most common summary measure is the EC50.
[0469] y) It must be noted that as used herein, the singular forms
"a", "an", and "the", include plural references unless the context clearly indicates otherwise. Thus, for example, reference to "a reagent" includes one or more of such different reagents and reference to "the method" includes reference to equivalent steps and methods known to those of ordinary skill in the art that could be modified or substituted for the methods described herein.
[0470] Unless otherwise indicated, the term "at least" preceding a series of elements is to be understood to refer to every element in the series. Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the present invention.
[0471] The term "and/or" wherever used herein includes the meaning of "and", "or" and "all or any other combination of the elements connected by said term".
[0472] The term "about" or "approximately" as used herein means within 20%, preferably within 15%, more preferably within 10%, and most preferably within 5% of a given value or range.
[0473] Throughout this specification and the claims which follow, unless the context requires otherwise, the word "comprise", and variations such as "comprises" and "comprising", will be understood to imply the inclusion of a stated integer or step or group of integers or steps but not the exclusion of any other integer or step or group of integer or step. When used herein the term "comprising" can be substituted with the term "containing" or "including" or sometimes when used herein with the term "having".
[0474] The present invention relates to a polypeptide comprising at least a first and at least one further immunoglobulin single variable domain (ISV), wherein said at least first ISV has high affinity for/binds to the constant domain of the T cell receptor (TCR) and said at least one further ISV has high affinity for/binds to an antigen on a target cell.
[0475] Typically, the multispecific polypeptides of the invention combine high affinity antigen recognition on the target cell with T cell activation, resulting in an activation that is independent of the T cells' natural specificity. The mode of action of the binding molecules that bind both to a cell surface molecule on a target cell such as a tumour antigen and to the T cell TCR is commonly known. Bringing a T cell in close vicinity to a target cell, i.e., engaging said T cell and clustering of the TCR complex results in killing of the target cell by the T cell. In the present invention this process is exploited in fighting against proliferative disease, inflammatory disease, infectious disease and autoimmune disease. Generally T cells are equipped with granules containing a deadly combination of pore-forming proteins, called perforins, and cell death-inducing proteases, called granzymes. Preferably, these proteins are delivered into target cells via a cytolytic synapse that forms if T cells are in close vicinity with a target cell that is aimed to be killed. Normally, close vicinity between a T cell and a target cell is achieved by the T cell binding to an MHC/peptide complex using its matching T cell receptor. The polypeptides of the invention bring a T cell into such close vicinity to a target cell in the absence of T cell receptor/MHC interaction.
[0476] Accordingly, the present invention relates to a polypeptide as described herein, wherein said polypeptide directs the T cell to the target cell.
[0477] With one arm (first ISV), the multispecific polypeptide has high affinity for/binds to the constant domain of the TCR subunit, a protein component of the signal-transducing complex of the T cell receptor on T cells. With another arm (second ISV and/or third ISV, etc.), the multispecific polypeptide recognizes, has high affinity for/binds an antigen(s) on target cells. Preferably, T cell activation is only seen when the multispecific polypeptides are presented to T cells on the surface of target cells. Antigen dependence on target cells for activation results in a favourable safety profile. In an embodiment, the multispecific polypeptides transiently tether T cells and target cells. Preferably, the multispecific polypeptide can induce resting polyclonal T cells, such as CD4.sup.+ and/or CD8.sup.+ T cells into activation, for highly potent redirected lysis of target cells. Preferably, the T cell is directed to a next target cell after lysis of the first target cell.
[0478] Proteins and polypeptides that comprise or essentially consist of two or more immunoglobulin single variable domains (such as at least two immunoglobulin single variable domains of the invention) will be referred to herein as "multivalent" proteins or polypeptides or as "multivalent constructs". Some non-limiting examples of such multivalent constructs will become clear from the further description herein. The polypeptides of the invention are "multivalent", i.e. comprising two or more building blocks or ISVs of which at least the first building block, ISV or Nanobody and the second building block, ISV or Nanobody are different, and directed against different targets, such as antigens or antigenic determinants. Polypeptides of the invention that contain at least two building blocks, ISVs or Nanobodies, in which at least one building block, ISV or Nanobody is directed against a first antigen (i.e., against the first target, such as e.g. the constant domain of a TCR) and at least one building block, ISV or Nanobody is directed against a second antigen (i.e., against the second target which is different from the first target, such as e.g. a TAA, such as CD20 or HER2), will also be referred to as "multispecific" polypeptides of the invention, and the building blocks, ISVs or Nanobodies present in such polypeptides will also be referred to herein as being in a "multivalent format" or "multispecifc format". Thus, for example, a "bispecific" polypeptide of the invention is a polypeptide that comprises at least one building block, ISV or Nanobody directed against a first target (e.g. TCR) and at least one further building block, ISV or Nanobody directed against a second target (i.e., directed against a second target different from said first target, such as e.g. a TAA, e.g. CD20 or HER2), whereas a "trispecific" polypeptide of the invention is a polypeptide that comprises at least one building block, ISV or Nanobody directed against a first target (e.g., TCR), a second building block, ISV or Nanobody directed against a second target different from said first target (e.g. a TAA, e.g. CD20 or HER2) and at least one further building block, ISV or Nanobody directed against a third antigen (i.e., different from both the first and the second target, such as another TAA); etc. As will be clear from the description, the invention is not limited to bispecific polypeptides, in the sense that a multispecific polypeptide of the invention may comprise at least a first building block, ISV or Nanobody against a first target, a second building block, ISV or Nanobody against a second target and any number of building blocks, ISVs or Nanobodies directed against one or more targets, which may be the same or different from the first and/or second target, respectively. The building blocks, ISVs or Nanobodies can optionally be linked via linker sequences.
[0479] The terms bispecific polypeptide, bispecific format, bispecific construct, bispecific Nanobody construct, bispecific and bispecific antibody are used interchangeably herein.
[0480] As will be clear from the further description above and herein, the immunoglobulin single variable domains of the invention can be used as "building blocks" to form polypeptides of the invention, e.g., by suitably combining them with other groups, residues, moieties or binding units, in order to form compounds or constructs as described herein (such as, without limitations, the bi-/tri-/tetra-/multivalent and bi-/tri-/tetra-/multispecific polypeptides of the invention described herein) which combine within one molecule one or more desired properties or biological functions.
[0481] It will be appreciated (as is also demonstrated in the Example section) that the ISV binding TCR and the ISV binding the antigen on a target cell can be positioned in any order in the polypeptide of the invention. More particularly, in one embodiment, the ISV binding TCR is positioned N-terminally and the ISV binding the antigen on a target cell is positioned C-terminally. In another embodiment, the ISV binding the antigen on a target cell is positioned N-terminally and the ISV binding TCR is positioned C-terminally.
[0482] In a preferred aspect, the polypeptide of the invention comprises at least a first, at least a second and at least a third immunoglobulin single variable domain (ISV), wherein said at least a first ISV has high affinity for/binds to the constant domain of the T cell receptor (TCR); said at least a second ISV has high affinity for/binds to a first antigen on a target cell, and said at least a third ISV has high affinity for/binds to a second antigen on a target cell, wherein said second antigen is different from said first antigen. Said first antigen and said second antigen can be on the same or on different target cells.
[0483] It will be appreciated (as is also demonstrated in the Example section) that the ISV binding TCR and the ISVs binding the first and second antigen on a target cell can be positioned in any order in the polypeptide of the invention. More particularly, in one embodiment, the ISV binding TCR is positioned N-terminally, the ISV binding the first antigen on a target cell is positioned centrally and the ISV binding the second antigen on a target cell is positioned C-terminally. In another embodiment, the ISV binding TCR is positioned N-terminally, the ISV binding the second antigen on a target cell is positioned centrally and the ISV binding the first antigen on a target cell is positioned C-terminally. In another embodiment, the ISV binding the first antigen on a target cell is positioned N-terminally, the ISV binding the second antigen on a target cell is positioned centrally and the ISV binding the TCR is positioned C-terminally. In another embodiment, the ISV binding the first antigen on a target cell is positioned N-terminally, the ISV binding the TCR is positioned centrally and the ISV binding the second antigen on a target cell is positioned C-terminally. In another embodiment, the ISV binding the second antigen on a target cell is positioned N-terminally, the ISV binding the TCR is positioned centrally and the ISV binding the first antigen on a target cell is positioned C-terminally. In another embodiment, the ISV binding the second antigen on a target cell is positioned N-terminally, the ISV binding the first antigen on a target cell is positioned centrally and the ISV binding the TCR is positioned C-terminally.
[0484] The invention further relates to compounds or constructs, and in particular proteins or polypeptides that comprise or essentially consist of one or more ISVs or polypeptides of the invention, and optionally further comprise one or more other groups, residues, moieties or binding units. As will become clear to the skilled person from the further disclosure herein, such further groups, residues, moieties, binding units or amino acid sequences may or may not provide further functionality to the polypeptide of the invention (and/or to the compound or construct in which it is present) and may or may not modify the properties of the polypeptide of the invention.
[0485] The compounds, constructs or polypeptides of the invention can generally be prepared by a method which comprises at least one step of suitably linking the one or more immunoglobulin single variable domains of the invention to the one or more further groups, residues, moieties or binding units, optionally via one or more suitable linkers, so as to provide the compound, construct or polypeptide of the invention. Polypeptides of the invention can also be prepared by a method which generally comprises at least the steps of providing a nucleic acid that encodes a polypeptide of the invention, expressing said nucleic acid in a suitable manner, and recovering the expressed polypeptide of the invention. Such methods can be performed in a manner known per se, which will be clear to the skilled person, for example on the basis of the methods and techniques further described herein.
[0486] The process of designing/selecting and/or preparing a compound, construct or polypeptide of the invention, starting from an amino acid sequence of the invention, is also referred to herein as "formatting" said amino acid sequence of the invention; and an amino acid of the invention that is made part of a compound, construct or polypeptide of the invention is said to be "formatted" or to be "in the format of" said compound, construct or polypeptide of the invention. Examples of ways in which an amino acid sequence of the invention can be formatted and examples of such formats will be clear to the skilled person based on the disclosure herein; and such formatted immunoglobulin single variable domains or polypeptides form a further aspect of the invention.
[0487] For example, such further groups, residues, moieties or binding units may be one or more additional immunoglobulin single variable domains, such that the compound or construct is a (fusion) protein or (fusion) polypeptide. In a preferred but non-limiting aspect, said one or more other groups, residues, moieties or binding units are immunoglobulin sequences. Even more preferably, said one or more other groups, residues, moieties or binding units are chosen from the group consisting of domain antibodies, immunoglobulin single variable domains that are suitable for use as a domain antibody, single domain antibodies, immunoglobulin single variable domains (ISVs) that are suitable for use as a single domain antibody, "dAb" 's, immunoglobulin single variable domains that are suitable for use as a dAb, or Nanobodies. Alternatively, such groups, residues, moieties or binding units may for example be chemical groups, residues, moieties, which may or may not by themselves be biologically and/or pharmacologically active. For example, and without limitation, such groups may be linked to the one or more immunoglobulin single variable domains or polypeptides of the invention so as to provide a "derivative" of an ISV or polypeptide of the invention, as further described herein.
[0488] Also within the scope of the present invention are compounds or constructs, which comprise or essentially consist of one or more derivatives as described herein, and optionally further comprise one or more other groups, residues, moieties or binding units, optionally linked via one or more linkers. Preferably, said one or more other groups, residues, moieties or binding units are immunoglobulin single variable domains. In the compounds or constructs described above, the one or more immunoglobulin single variable domains of the invention and the one or more groups, residues, moieties or binding units may be linked directly to each other and/or via one or more suitable linkers or spacers. For example, when the one or more groups, residues, moieties or binding units are immunoglobulin single variable domains, the linkers may also be immunoglobulin single variable domains, so that the resulting compound or construct is a fusion protein or fusion polypeptide.
[0489] In some embodiments, the polypeptides comprise at least two or more immunoglobulin single variable domains disclosed herein. In some embodiments, the polypeptides essentially consist of two or more immunoglobulin single variable domains disclosed herein. A polypeptide that "essentially consists of" two or more immunoglobulin single variable domains, is a polypeptide that in addition to the two or more immunoglobulin single variable domains disclosed herein does not have additional immunoglobulin single variable domains. For instance, a polypeptide that essentially consists of two immunoglobulin single variable domains does not include any additional immunoglobulin single variable domains. However, it should be appreciated that a polypeptide that essentially consists of two or more immunoglobulin single variable domains may include additional functionalities, such as a label, a toxin, one or more linkers, a binding sequence, etc. These additional functionalities include both amino acid based and non-amino acid based groups. In some embodiments, the polypeptides consist of one or more immunoglobulin single variable domains disclosed herein. It should be appreciated that the terms "polypeptide construct" and "polypeptide" can be used interchangeably herein (unless the context clearly dictates otherwise).
[0490] In some embodiments, the polypeptides include multivalent or multispecific constructs comprising immunoglobulin single variable domains disclosed herein. In some embodiments, the polypeptides comprise one or more antibody based-scaffolds and/or non-antibody based scaffolds disclosed herein. In some embodiments, the polypeptides comprise a serum binding protein moiety. In some embodiments, the serum binding protein moiety is an immunoglobulin single variable domain. In some embodiments, the immunoglobulin single variable domain is a Nanobody.
[0491] It will be appreciated that the order of the building blocks, such as e.g. a first building block, a second building block, a third building block etc., on the polypeptide (orientation) can be chosen according to the needs of the person skilled in the art, as well as the relative affinities which may depend on the location of these building blocks in the polypeptide. Whether the polypeptide comprises a linker, is a matter of design choice. However, some orientations, with or without linkers, may provide preferred binding characteristics in comparison to other orientations. For instance, the order of a first and a second building block in the polypeptide of the invention can be (from N-terminus to C-terminus): (i) first building block (e.g. a first ISV such as a first Nanobody)-[linker]-second building block (e.g. a second ISV such as a second Nanobody); or (ii) second building block (e.g. a second ISV such as a second Nanobody)-[linker]-first building block (e.g. a first ISV such as a first Nanobody); (wherein the linker is optional). All orientations are encompassed by the invention. Polypeptides that contain an orientation of building blocks that provides desired (binding) characteristics can be easily identified by routine screening, for instance as exemplified in the experimental section.
[0492] The first immunoglobulin single variable domain (ISV) of the polypeptide of the invention has high affinity for/binds to an effector cell, preferably the TCR of said effector cell, and even more preferably the constant domain of the T cell receptor (TCR).
[0493] An effector cell is a cell comprising a TCR complex, preferably an immune cell, such as a T cell, preferably a CD4.sup.+ T-helper cell (also known as CD4 cell, T-helper cell or T4 cell), more preferably a Cytotoxic T cell (also known as Tc cell, CTL or CD8.sup.+ T cells) or Natural Killer T cells (NKT cells). In some embodiments, the cell is present in vivo. In some embodiments, the cell is present in vitro. The effector cell of the invention relates in particular to mammalian cells, preferably to primate cells, and even more preferably to human cells.
[0494] As used herein, the terms "TCR complex" or "a TCR-CD3 complex" refers to the T cell receptor complex presented on the surface of T cells (see Kuhns et al. 2006, Immunity 24: 133-139). The TCR complex is composed of six different type I single-spanning transmembrane proteins: the TCR.alpha. and TCR.beta. chains that form the TCR heterodimer responsible for ligand recognition, and the non-covalently associated CD3.gamma., CD3.delta., CD3.epsilon. and .zeta. chains, which bear cytoplasmic sequence motifs that are phosphorylated upon receptor activation and recruit a large number of signalling components. Both .alpha. and .beta. chains of the T cell receptor consist of a constant domain and a variable domain. The sequences for the human CD3 and the human TCR.alpha./.beta. constant domains are provided in Table A-6 (SEQ ID NOs: 344-349; cf. UniProt identifiers: CD3 delta: P04234, CD3 gamma: P09693, CD3 epsilon: P07766, CD3 zeta: P20963, TCR alpha: P01848 and TCR beta: related to P01850).
[0495] In an embodiment, the present invention relates to a polypeptide as described herein, wherein said first ISV binds to the constant domain of a T cell receptor .alpha. (TCR-.alpha.) (SEQ ID NO: 348) and/or the constant domain of the T cell receptor .beta. (TCR-.beta.) (SEQ ID NO: 349), or polymorphic variants or isoforms thereof.
[0496] Alternatively, the present invention relates to a polypeptide as described herein, wherein said first ISV binds to the constant domain of a T cell receptor .alpha. (TCR-.alpha.) (SEQ ID NO: 484) and/or the constant domain of the T cell receptor .beta. (TCR-.beta.) (SEQ ID NO: 485), or polymorphic variants or isoforms thereof.
[0497] Isoforms are alternative protein sequences that can be generated from the same gene by a single or by the combination of biological events such as alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting, all as known in the art.
[0498] "T cell activation" as used herein refers to one or more cellular response(s) of a T cell, e.g. a cytotoxic T cell, such as selected from: proliferation, differentiation, cytokine secretion, cytotoxic effector molecule release, cytotoxic activity, expression of activation markers, and redirected target cell lysis. The polypeptides of the invention are capable of inducing T cell activation. Suitable assays to measure T cell activation are known in the art described herein, for instance as described in WO 99/54440 or by Schlereth et al. 2005 (Cancer Immunol. Immunother. 20: 1-12), or as exemplified in the examples or below.
[0499] In an embodiment, the present invention relates to a polypeptide as described herein, wherein said polypeptide induces T cell activation. Preferably, the polypeptide of the invention induces T cell activation only when said second and/or further ISV is bound to an antigen on a target cell.
[0500] In an embodiment, the present invention relates to a polypeptide as described herein, wherein said T cell activation depends on presenting said polypeptide bound to said first antigen on a target cell to a T cell.
[0501] T cell activation by the polypeptides of the invention can be monitored by upregulation of CD69, CD25 and various cell adhesion molecules, de novo expression and/or release of cytokines (e.g., IFN-.gamma., TNF-.alpha., IL-6, IL-2, IL-4 and IL-10), upregulation of granzyme and perforin expression, and/or cell proliferation, membrane blebbing, activation of procaspases 3 and/or 7, fragmentation of nuclear DNA and/or cleavage of caspase substrate poly (ADPribose) polymerase. Preferably, redirected lysis of target cells by multispecific polypeptides is independent of T cell receptor specificity, presence of MHC class I and/or 32 microglobulin, and/or of any co-stimulatory stimuli.
[0502] In an embodiment, the present invention relates to a polypeptide as described herein, wherein said T cell activation is independent from MHC recognition.
[0503] The polypeptides of the invention show redirected lysis in vitro with previously unstimulated peripheral polyclonal CD8.sup.+- and CD4.sup.+-positive T cells. The redirected lysis of target cells via the recruitment of T cells by the polypeptides of the invention involves cytolytic synapse formation and delivery of perforin and granzymes. Cell lysis by T cells has been described, e.g. by Atkinson and Bleackley 1995 (Crit. Rev. Immunol 15(3-4):359-384). Preferably, the engaged T cells are capable of serial target cell lysis, and are not affected by immune escape mechanisms interfering with peptide antigen processing and presentation, or clonal T cell differentiation (see, for example, WO 2007/042261). In vitro, redirected lysis is seen at low picomolar concentrations, suggesting that very low numbers of the polypeptides of the invention need to be bound to target cells for triggering T cells. As demonstrated in the examples, the low effector to target ratio might be indicative for serial target cell lysis. Accordingly, the present invention relates to potent polypeptides. Preferably, the polypeptide of the invention mediates killing of target cells, e.g. cancer cells, such as stimulating T cells in pore formation and delivering pro-apoptotic components of cytotoxic T cell granules.
[0504] In an embodiment, the present invention relates to a polypeptide as described herein, wherein said T cell activation causes one or more cellular response of said T cell, wherein said cellular response is selected from the group consisting of proliferation, differentiation, cytokine secretion, cytotoxic effector molecule release, cytotoxic activity, expression of activation markers and redirected target cell lysis.
[0505] As used herein, the term "potency" is a measure of the biological activity of an agent, such as a polypeptide, ISV or Nanobody. Potency of an agent can be determined by any suitable method known in the art, such as for instance as described in the experimental section. Cell culture based potency assays are often the preferred format for determining biological activity since they measure the physiological response elicited by the agent and can generate results within a relatively short period of time. Various types of cell based assays, based on the mechanism of action of the product, can be used, including but not limited to proliferation assays, cytotoxicity assays, cell killing assays, reporter gene assays, cell surface receptor binding assays, and assays to measure induction/inhibition of functionally essential proteins or other signal molecules (such as phosphorylated proteins, enzymes, cytokines, cAMP and the like), Ramos B cell depletion model, T cell mediated tumour cell killing assay (for instance as set out in the Examples section), all well known in the art. Results from cell based potency assays can be expressed as "relative potency" as determined by comparison of the multispecific polypeptide of the invention to the response obtained for the corresponding reference monovalent ISV, e.g. a polypeptide comprising only one ISV or one Nanobody, optionally further comprising an irrelevant Nanobody (cf. experimental section).
[0506] In an embodiment, the present invention relates to a polypeptide as described herein, wherein said T cell activation causes inhibition of an activity of said target cell, such as to delay or minimize the spread of the target cell, to inhibit or delay growth and/or proliferation of the target cell, and/or to kill the target cell (e.g., cause regression of the disorder and/or symptoms) by more than about 10%, such as 20%, 30%, or 40% or even more than 50%, such as more than 60%, such as 70%, 80%, or even more than 90%, such as 100%.
[0507] The first building block, ISV, Nanobody or VHH of the invention has a high affinity for its--the constant domain of TCR--target. The first building block, ISV or Nanobody of the invention may for example be directed against an antigenic determinant, epitope, part, domain, subunit or confirmation (where applicable) of said first target. The first building block, e.g. the first ISV, Nanobody or VHH, is preferably chosen for its high affinity for its target per se, disregarding the influence of any avidity effects.
[0508] Accordingly, the present invention relates to a polypeptide as described herein, wherein said first ISV binds to the constant domain of the T cell receptor (TCR) with an average KD value of between 100 nM and 10 .mu.M, such as at an average KD value of 90 nM or less, even more preferably at an average KD value of 80 nM or less, such as less than 70, 60, 50, 40, 30, 20, 10, 5 nM or even less, such as less than 4, 3, 2, or 1 nM, such as less than 500, 400, 300, 200, 100, 90, 80, 70, 60, 50, 40, 30, 20 .mu.M, or even less, such as less than 10 .mu.M. Preferably, the KD is determined by Kinexa, BLI or SPR, for instance as determined by Proteon. For instance, said KD is determined as set out in the Examples section.
[0509] Accordingly, the present invention relates to a polypeptide as described herein, wherein said first ISV has a high affinity when measured as a monovalent. Preferably said average KD is measured by surface plasmon resonance (SPR) on recombinant protein.
[0510] Accordingly, the present invention relates to a polypeptide as described herein, wherein said polypeptide has a dissociation constant (K.sub.D) to (or for binding) said TCR selected from the group consisting of: at most about 10.sup.-5 M, at most about 10.sup.-6 M, at most about 10.sup.-7 M, at most about 10.sup.-8 M, at most about 10.sup.-9 M, at most about 10.sup.-10 M, at most about 10.sup.-11 M, and at most about 10.sup.-12 M, preferably as measured by surface plasmon resonance.
[0511] The present invention also relates to a polypeptide as described herein, wherein said first ISV binds to said TCR with an EC50 value of between 100 nM and 1 .mu.M, such as at an average EC50 value of 100 nM or less, even more preferably at an average EC50 value of 90 nM or less, such as less than 80, 70, 60, 50, 40, 30, 20, 10, 5 nM or even less, such as less than 4, 3, 2, or 1 nM or even less, such as less than 500, 400, 300, 200, 100, 90, 80, 70, 60, 50, 40, 30, 20, 10, 5 .mu.M, or even less, such as less than 4 .mu.M.
[0512] Accordingly, the present invention relates to a polypeptide as described herein, wherein said average KD is determined by FACS, Biacore, ELISA, on a monovalent first ISV, such as a Nanobody, or a polypeptide comprising a monovalent first ISV, such as a Nanobody, for instance said EC50 is determined as set out in the Examples section.
[0513] It has been shown in the examples that the K.sub.D correlates well with the EC50.
[0514] In an embodiment, the present invention relates to a polypeptide as described herein, wherein said polypeptide has an on rate constant (Kon) to (or for binding) said TCR selected from the group consisting of at least about 10.sup.2 M.sup.-1s.sup.-1, at least about 10.sup.3 M.sup.-1s.sup.-1, at least about 10.sup.4 M.sup.-1s.sup.-1, at least about 10.sup.5 M.sup.-1s.sup.-1, at least about 10.sup.6 M.sup.-1s.sup.-1, 10.sup.7 M.sup.-1s.sup.-1, at least about 10.sup.8 M.sup.-1s.sup.-1, at least about 10.sup.9 M.sup.-1s.sup.-1, and at least about 10.sup.10 M.sup.-1s.sup.-1, preferably as measured by surface plasmon resonance or as performed in the examples section.
[0515] In an embodiment, the present invention relates to a polypeptide as described herein, wherein said polypeptide has an off rate constant (Koff) to (or for binding) said TCR selected from the group consisting of at most about 10.sup.-3 s.sup.-1, at most about 10.sup.-4 s.sup.-1, at most about 10.sup.-5 s.sup.-1, at most about 10.sup.-6 s.sup.-1, at most about 10.sup.-7 s.sup.-1, at most about 10.sup.-8 s.sup.-1, at most about 10.sup.-9 s.sup.-1, and at most about 10.sup.-10 s.sup.-1, preferably as measured by surface plasmon resonance or as performed in the examples section.
[0516] Amino acid sequence modifications of the binding molecules, ISVs, or polypeptides described herein are contemplated. For example, it may be desirable to improve the binding affinity and/or other biological properties of the antibody or ISV. Amino acid sequence variants of the binding molecules, ISVs, or polypeptides are prepared by introducing appropriate nucleotide changes into the binding molecules, ISVs, or polypeptides nucleic acid, or by peptide synthesis.
[0517] Such modifications include, for example, deletions from, and/or insertions into, and/or substitutions of, residues within the amino acid sequences of the binding molecules, ISVs or polypeptides. Any combination of deletion, insertion, and substitution is made to arrive at the final construct, provided that the final construct possesses the desired characteristics. The amino acid changes also may alter post-translational processes of the binding molecules, such as changing the number or position of glycosylation sites. Preferably, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids may be substituted in a CDR, while 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or 25 amino acids may be substituted in the framework regions (FRs). The substitutions are preferably conservative substitutions as described herein. Additionally or alternatively, 1, 2, 3, 4, 5, or 6 amino acids may be inserted or deleted in each of the CDRs (of course, dependent on their length), while 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or 25 amino acids may be inserted or deleted in each of the FRs.
[0518] A useful method for identification of certain residues or regions of the binding molecules, ISVs or polypeptides, that are preferred locations for mutagenesis is called "alanine scanning mutagenesis" as described by Cunningham and Wells 1989 (Science 244: 1081-1085). Here, a residue or group of target residues within the binding molecule is/are identified (e.g. charged residues such as Arg, Asp, His, Lys, and Glu) and replaced by a neutral or negatively charged amino acid (most preferably alanine or polyalanine) to affect the interaction of the amino acids with the epitope. Those amino acid locations demonstrating functional sensitivity to the substitutions then are refined by introducing further or other variants at, or for, the sites of substitution. Thus, while the site for introducing an amino acid sequence variation is predetermined, the nature of the mutation per se needs not to be predetermined. For example, to analyze the performance of a mutation at a given site, ala scanning or random mutagenesis is conducted at a target codon or region and the expressed binding molecule variants are screened for the desired activity.
[0519] Preferably, amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 residues to polypeptides containing a hundred or more residues.
[0520] Another type of variant is an amino acid substitution variant. These variants have preferably at least 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acid residues in the binding molecule, ISV or polypeptide replaced by a different residue. The sites of greatest interest for substitution mutagenesis include the CDRs, in particular the hypervariable regions, but FR alterations are also contemplated. For example, if a CDR sequence encompasses 6 amino acids, it is envisaged that one, two or three of these amino acids are substituted. Similarly, if a CDR sequence encompasses 15 amino acids it is envisaged that one, two, three, four, five or six of these amino acids are substituted.
[0521] Generally, if amino acids are substituted in one or more or all of the CDRs, it is preferred that the then-obtained "substituted" sequence is at least 60%, more preferably 65%, even more preferably 70%, particularly preferably 75%, more particularly preferably 80% or even more than 90% identical to the "original" CDR sequence. This means that it is dependent of the length of the CDR to which degree it is identical to the "substituted" sequence. For example, a CDR having 5 amino acids is preferably 80% identical to its substituted sequence in order to have at least one amino acid substituted. Accordingly, the CDRs of the binding molecule may have different degrees of identity to their substituted sequences, e.g., CDR1 may have 80%, while CDR3 may have 90%.
[0522] Preferred substitutions (or replacements) are conservative substitutions. However, any substitution (including non-conservative substitution or one or more from the "exemplary substitutions" listed in Table B-1 below) is envisaged as long as the polypeptide retains its capability to bind to the constant domain of the T cell receptor (TCR) present on a T cell via the first ISV and to a first antigen on a target cell via the second ISV and/or its CDRs have an identity to the then substituted sequence (at least 60%, more preferably 65%, even more preferably 70%, particularly preferably 75%, more particularly preferably 80% identical to the "original" CDR sequence).
[0523] Conservative substitutions are shown in Table B-1 below.
[0524] As indicated before, only after rigorous immunization and screening and selection methods, the present inventors were able to identify ISVs binding to the constant domains of TCR. Accordingly, the present invention relates to polypeptides comprising a first ISV chosen from the group consisting of SEQ ID NOs: 1-118 (cf. Table A-4). Sequence analysis further demonstrated that all ISVs binding to TCR comprised a very similar CDR3. Accordingly, the present invention relates to a polypeptide according to the invention in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which CDR3 has the amino acid sequence X.sub.1SR X.sub.2X.sub.3PYX.sub.4Y, in which X.sub.1 is F, Y, G, L or K, X.sub.2 is I or L, X.sub.3 is Y or W, and X.sub.4 is D, N or S.
[0525] Sequence analysis further revealed that there are only a limited number of sequence variations in the CDRs (cf. Example 4.2 and Tables A-1 to A-3).
TABLE-US-00001 TABLE B-1 Amino Acid Substitutions Original Exemplary Substitutions Preferred Substitutions Ala (A) val, leu, ile val Arg (R) lys, gln, asn lys Asn (N) gln, his, asp, lys, arg gln Asp (D) glu, asn glu Cys (C) ser, ala ser Gln (Q) asn, glu asn Glu (E) asp, gln asp Gly (G) ala ala His (H) asn, gln, lys, arg arg Ile (I) leu, val, met, ala, phe leu Leu (L) norleucine, ile, val, met, ala ile Lys (K) arg, gln, asn arg Met (M) leu, phe, ile leu Phe (F) leu, val, ile, ala, tyr tyr Pro (P) ala ala Ser (S) thr thr Thr (T) ser ser Trp (W) tyr, phe tyr Tyr (Y) trp, phe, thr, ser phe Val (V) ile, leu, met, phe, ala leu
[0526] Accordingly, the present invention relates to a polypeptide as described herein, wherein said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which:
[0527] (i) CDR1 is chosen from the group consisting of:
[0528] (a) SEQ ID NOs: 119-133; or
[0529] (b) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 123 or with any of SEQ ID NOs: 119-133; and/or
[0530] (ii) CDR2 is chosen from the group consisting of:
[0531] (c) SEQ ID NOs: 134-163; or
[0532] (d) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 153 or with any of SEQ ID NOs: 134-163; and/or
[0533] (iii) CDR3 is chosen from the group consisting of:
[0534] (e) SEQ ID NOs: 164-174; or
[0535] (f) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 170 or with any of SEQ ID NOs: 164-174.
[0536] Further preferred CDR sequences are depicted in Table A-4.
[0537] Generally, the combinations of CDR's listed in Table A-4 (i.e. those mentioned on the same line in Table A-4) are preferred. Thus, it is generally preferred that, when a CDR in an ISV is a CDR sequence mentioned in Table A-4 or suitably chosen from the group consisting of CDR sequences that have 4, 3, 2 or only 1 amino acid difference(s) with a CDR sequence listed in Table A-4, that at least one and preferably both of the other CDR's are suitably chosen from the CDR sequences that belong to the same combination in Table A-4 (i.e. mentioned on the same line in Table A-4) or are suitably chosen from the group consisting of CDR sequences that have 4, 3, 2 or only 1 amino acid difference(s) with the CDR sequence(s) belonging to the same combination.
[0538] Sequence analysis of the resulting binders further resulted in the identification of 3 distinct clusters. Corresponding alignments are provided (see Table A-1, Table A-2 and Table A-3). Clustering was based on sequence similarities and differences in CDR2 and CDR3. Cluster A is the most prominent comprising 104 clones (SEQ ID NOs: 1-104), cluster B comprises 11 clones (SEQ ID NOs: 105-115), and cluster C is represented by only 3 clones (SEQ ID NOs: 116-118). The clustering based on the structural similarities and differences in the amino acid sequence translated into functional similarities and differences as revealed by the examples. Representatives of all clusters were isolated based on high affinity binding to the constant domain of the TCR (Examples 3 & 4) and human T cell activation (Example 4.2). In general cluster A representatives demonstrated the best EC50 values. In addition, cluster A representatives were cross-reactive with the constant domain of cynomolgus TCR (cf. Example 18). Although cluster C representatives had somewhat less favourable EC50 values than cluster B representatives, cluster C representatives had lower IC50 values in a flow cytometry based T cell mediated Ramos killing assay (cf. Example 10).
[0539] Accordingly, the present invention relates to a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which CDR1 is chosen from the group consisting of
[0540] (a) SEQ ID NO: 123; and
[0541] (b) amino acid sequences that have 1, 2, 3 or 4 amino acid difference(s) with SEQ ID NO: 123, wherein
[0542] at position 2 the D has been changed into A, S, E or G;
[0543] at position 4 the H has been changed into Y;
[0544] at position 5 the K has been changed into L;
[0545] at position 6 the I has been changed into L;
[0546] at position 8 the F has been changed into I or V; and/or
[0547] at position 10 the G has been changed into S.
[0548] Accordingly, the present invention relates to a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which CDR2 is chosen from the group consisting of
[0549] (a) SEQ ID NO: 153; and
[0550] (b) amino acid sequences that have 1, 2, 3 or 4 amino acid difference(s) with SEQ ID NO: 153, wherein
[0551] at position 1 the H has been changed into T or R;
[0552] at position 3 the S has been changed into T or A;
[0553] at position 5 the G has been changed into S or A;
[0554] at position 7 the Q has been changed into D, E, T, A or V;
[0555] at position 8 the T has been changed into A or V; and/or
[0556] at position 9 the D has been changed into A, Q, N, V or S.
[0557] Accordingly, the present invention relates to a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which CDR3 is chosen from the group consisting of
[0558] (a) SEQ ID NO: 170; and
[0559] (b) amino acid sequences that have 1, 2, 3 or 4 amino acid difference(s) with SEQ ID NO: 170, wherein
[0560] at position 1 the F has been changed into Y, L or G;
[0561] at position 4 the I has been changed into L;
[0562] at position 5 the Y has been changed into W; and/or
[0563] at position 8 the D has been changed into N or S.
[0564] In an embodiment, the invention relates to a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which:
[0565] (i) CDR1 is chosen from the group consisting of:
[0566] (a) SEQ ID NOs: 119-123, 125-127, 129, 132 and 133; and
[0567] (b) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 123; and/or
[0568] (ii) CDR2 is chosen from the group consisting of:
[0569] (c) SEQ ID NOs: 134-141, 143-144, 146-156, 159-163; and
[0570] (d) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 153; and/or
[0571] (iii) CDR3 is chosen from the group consisting of:
[0572] (e) SEQ ID NOs: 164-166, 169-171, 173-174; and
[0573] (f) amino acid sequences that have 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 170.
[0574] In an embodiment, the invention relates to a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which: CDR1 is represented by SEQ ID NO: 123, CDR2 is represented by SEQ ID NO: 153, and CDR3 is represented by SEQ ID NO: 170.
[0575] Nanobodies of cluster B show relatively limited sequence variability in the CDRs.
[0576] Accordingly, the present invention relates to a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which CDR1 is chosen from the group consisting of
[0577] (a) SEQ ID NO: 124; and
[0578] (b) amino acid sequences that have 1, or 2 amino acid difference(s) with SEQ ID NO: 124, wherein
[0579] at position 2 the E has been changed into Q; and/or
[0580] at position 6 the I has been changed into V.
[0581] Accordingly, the present invention relates to a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which CDR2 is chosen from the group consisting of
[0582] (a) SEQ ID NO: 145; and
[0583] (b) amino acid sequence that has 1 amino acid difference with SEQ ID NO: 145, wherein
[0584] at position 9 the N has been changed into D.
[0585] Accordingly, the present invention relates to a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which CDR3 is chosen from the group consisting of
[0586] (a) SEQ ID NO: 167; and
[0587] (b) amino acid sequence that has 1 amino acid difference with SEQ ID NO: 167, wherein
[0588] at position 4 the L has been changed into I.
[0589] Accordingly, the present invention relates to a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which:
[0590] (i) CDR1 is chosen from the group consisting of:
[0591] (a) SEQ ID NOs: 124, 128 and 131; and
[0592] (b) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 124; and/or
[0593] (ii) CDR2 is chosen from the group consisting of:
[0594] (c) SEQ ID NOs: 142 and 145; and
[0595] (d) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 145; and/or
[0596] (iii) CDR3 is chosen from the group consisting of:
[0597] (e) SEQ ID NOs: 167 and 168; and
[0598] (f) amino acid sequences that have 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 167.
[0599] Accordingly, the present invention relates to a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which: CDR1 is represented by SEQ ID NO: 124, CDR2 is represented by SEQ ID NO: 145, and CDR3 is represented by SEQ ID NO: 167.
[0600] In Cluster C, the sequence variation is even more limited than within the other clusters.
[0601] Accordingly, the present invention relates to a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which CDR2 is chosen from the group consisting of
[0602] (a) SEQ ID NO: 157; and
[0603] (b) amino acid sequence that has 1 amino acid difference with SEQ ID NO: 157, wherein
[0604] at position 8 the T has been changed into I.
[0605] Accordingly, the present invention relates to a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which:
[0606] (i) CDR1 is chosen from the group consisting of
[0607] (a) SEQ ID NO: 130; and
[0608] (b) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 130; and/or
[0609] (ii) CDR2 is chosen from the group consisting of:
[0610] (c) SEQ ID NOs: 157-158; and
[0611] (d) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 157; and/or
[0612] (iii) CDR3 is chosen from the group consisting of:
[0613] (e) SEQ ID NO: 172; and
[0614] (f) amino acid sequences that have 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 172.
[0615] In an aspect, the present invention relates to a polypeptide as described herein, in which said first ISV essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which: CDR1 is represented by SEQ ID NO: 130, CDR2 is represented by SEQ ID NO: 157, and CDR3 is represented by SEQ ID NO: 172.
[0616] The second immunoglobulin single variable domain (ISV) of the polypeptide of the invention has a high affinity for/binds to an antigen on a target cell, preferably a cancer cell. A "target cell" as referred to herein, is a cell that presents a particular antigen on its surface. In a preferred aspect, the "target cell" is a cancer cell.
[0617] The membrane (also called plasma membrane or phospholipid bilayer) surrounds the cytoplasm of a cell, which is the outer boundary of the cell, i.e. the membrane is the surface of the cell. This membrane serves to separate and protect a cell from its surrounding environment and is made mostly from a double layer of phospholipids. Embedded within this membrane is a variety of protein molecules, such as channels, pumps and cellular receptors. Since the membrane is fluid, the protein molecules can travel within the membrane. The term "antigen on a target cell" as used herein denotes a molecule, which is displayed on the surface of a cell. In most cases, this molecule will be located in or on the plasma membrane of the cell such that at least part of this molecule remains accessible from outside the cell in tertiary form. A non-limiting example of a cell surface molecule, which is located in the plasma membrane, is a transmembrane protein comprising, in its tertiary conformation, regions of hydrophilicity and hydrophobicity. Here, at least one hydrophobic region allows the cell surface molecule to be embedded, or inserted in the hydrophobic plasma membrane of the cell while the hydrophilic regions extend on either side of the plasma membrane into the cytoplasm and extracellular space, respectively.
[0618] Said antigen can be any target on a cell, e.g. a tumour antigen. In a preferred embodiment, said antigen is specific for said target cell, e.g. cancer cell, such as a tumour associated antigen (TAA) on said cancer cell.
[0619] The term "tumour antigen" as used herein may be understood as those antigens that are presented on tumour cells. These antigens can be presented on the cell surface with an extracellular part, which is often combined with a transmembrane and cytoplasmic part of the molecule. These antigens can sometimes be presented only by tumour cells and never by a normal or healthy cell. Tumour antigens can be exclusively expressed on tumour cells or might represent a tumour specific mutation compared to normal cells. In this case, they are called tumour-specific antigens. However, this will not be the case generally. More common are antigens that are presented by tumour cells and normal cells, and they are called "tumour-associated antigens (TAA)". These tumour-associated antigens can be overexpressed on tumour cells compared to normal cells or are better accessible for antibody binding in tumour cells due to the less compact structure of the tumour tissue compared to normal tissue. TAA are preferably antigens that are expressed on cells of particular tumours, but that are preferably not expressed in normal cells. Often, TAA are antigens that are normally expressed in cells only at particular points in an organism's development (such as during fetal development) and that are being inappropriately expressed in the organism at the present point of development, or are antigens not expressed in normal tissues or cells of an organ now expressing the antigen.
[0620] In an embodiment, said first antigen on a target cell is a tumour antigen, preferably a tumour associated antigen (TAA).
[0621] In an embodiment, said second antigen on a target cell is a tumour antigen, preferably a tumour associated antigen (TAA).
[0622] In an embodiment, said antigen is present more abundantly on a cancer cell than on a normal cell.
[0623] The antigen on a target cell is preferably a tumor-associated antigen (TAA). Preferred TAAs include MART-1, carcinoembryonic antigen ("CEA"), gp100, MAGE-1, HER-2, CD20, Lewis' antigens, Melanoma-associated Chondroitin Sulfate Proteoglycan (MCSP), Epidermal Growth Factor Receptor (EGFR), Fibroblast Activation Protein (FAP), CD19 and CD33.
[0624] Cell surface antigens that are preferentially expressed on AML LSC compared with normal hematopoietic stem cells, and thus preferred as TAA, include CD123, CD44, CLL-1, CD96, CD47, CD32, CXCR4, Tim-3 and CD25.
[0625] Other tumor-associated antigens suitable as an antigen on a target cell for binding by the second ISV within the polypeptides of the invention include: TAG-72, Ep-CAM, PSMA, PSA, glycolipids such as GD2 and GD3.
[0626] The TAA of the invention include also hematopoietic differentiation antigens, i.e. glycoproteins usually associated with cluster differentiation (CD) grouping, such as CD4, CD5, CD19, CD20, CD22, CD33, CD36, CD45, CD52, CD69 and CD147; growth factor receptors, including HER2, ErbB3 and ErbB4; Cytokine receptors, including Interleukin-2 receptor gamma chain (CD132 antigen), Interleukin-10 receptor alpha chain (IL-10R-A), Interleukin-10 receptor beta chain (IL-10R-B), Interleukin-12 receptor beta-1 chain (IL-12R-beta1), Interleukin-12 receptor beta-2 chain (IL-12 receptor beta-2), Interleukin-13 receptor alpha-1 chain (IL-13R-alpha-1) (CD213a1 antigen), Interleukin-13 receptor alpha-2 chain (Interleukin-13 binding protein), Interleukin-17 receptor (IL-17 receptor), Interleukin-17B receptor (IL-17B receptor), Interleukin 21 receptor precursor (IL-21R), Interleukin-1 receptor type I (IL-1R-1) (CD121a), Interleukin-1 receptor type II (IL-1R-beta) (CDw121b), Interleukin-1 receptor antagonist protein (IL-1ra), Interleukin-2 receptor alpha chain (CD25 antigen), Interleukin-2 receptor beta chain (CD122 antigen), Interleukin-3 receptor alpha chain (IL-3R-alpha) (CD123 antigen); as well as others, such as CD30, IL23R, IGF-1R, IL5R, IgE, CD248 (endosialin), CD44v6, gpA33, Ron, Trop2, PSCA, claudin 6, claudin 18.2, CLEC12A, CD38, ephA2, c-Met, CD56, MUC16, EGFRvIII, AGS-16, CD27L, Nectin-4, SLITRK6, mesothelin, folate receptor, tissue factor, axl, glypican-3, CA9, Cripto, CD138, CD37, MUC1, CD70, gastrin releasing peptide receptor, PAP, CEACAM5, CEACAM6, CXCR7, N-cadherin, FXYD2 gamma a, CD21, CD133, Na/K-ATPase, mlgM (membrane-bound IgM), mIgA (membrane-bound IgA), Mer, Tyro2, CD120, CD95, CA 195, DR5, DR6, DcR3 and CAIX.
[0627] Accordingly the present invention relates to a polypeptide as described herein, wherein said TAA is chosen from the group consisting of Melanoma-associated Chondroitin Sulfate Proteoglycan (MCSP), Epidermal Growth Factor Receptor (EGFR), Fibroblast Activation Protein (FAP), MART-1, carcinoembryonic antigen ("CEA"), gp100, MAGE-1, HER-2, Lewis' antigens, CD123, CD44, CLL-1, CD96, CD47, CD32, CXCR4, Tim-3, CD25, TAG-72, Ep-CAM, PSMA, PSA, GD2, GD3, CD4, CD5, CD19, CD20, CD22, CD33, CD36, CD45, CD52, CD147; growth factor receptors, including ErbB3 and ErbB4; Cytokine receptors, including Interleukin-2 receptor gamma chain (CD132 antigen), Interleukin-10 receptor alpha chain (IL-10R-A), Interleukin-10 receptor beta chain (IL-10R-B), Interleukin-12 receptor beta-1 chain (IL-12R-beta1), Interleukin-12 receptor beta-2 chain (IL-12 receptor beta-2), Interleukin-13 receptor alpha-1 chain (IL-13R-alpha-1) (CD213a1 antigen), Interleukin-13 receptor alpha-2 chain (Interleukin-13 binding protein), Interleukin-17 receptor (IL-17 receptor), Interleukin-17B receptor (IL-17B receptor), Interleukin 21 receptor precursor (IL-21R), Interleukin-1 receptor type I (IL-1R-1) (CD121a), Interleukin-1 receptor type II (IL-1R-beta) (CDw121b), Interleukin-1 receptor antagonist protein (IL-1ra), Interleukin-2 receptor alpha chain (CD25 antigen), Interleukin-2 receptor beta chain (CD122 antigen), Interleukin-3 receptor alpha chain (IL-3R-alpha) (CD123 antigen), CD30, IL23R, IGF-1R, IL5R, IgE, CD248 (endosialin), CD44v6, gpA33, Ron, Trop2, PSCA, claudin 6, claudin 18.2, CLEC12A, CD38, ephA2, c-Met, CD56, MUC16, EGFRvIII, AGS-16, CD27L, Nectin-4, SLITRK6, mesothelin, folate receptor, tissue factor, axl, glypican-3, CA9, Cripto, CD138, CD37, MUC1, CD70, gastrin releasing peptide receptor, PAP, CEACAM5, CEACAM6, CXCR7, N-cadherin, FXYD2 gamma a, CD21, CD133, Na/K-ATPase, mlgM (membrane-bound IgM), mIgA (membrane-bound IgA), Mer, Tyro2, CD120, CD95, CA 195, DR5, DR6, DcR3 and CAIX, and related polymorphic variants and isoforms, preferably said TAA is CD20 (UniProt 11836), HER2 (Uniprot P04626), EGFR, or CEACAM, polymorphic variants and/or isoforms thereof.
[0628] The second building block, ISV, Nanobody or VHH of the invention has a high affinity for its antigen. The second building block, ISV or Nanobody of the invention may, for example, be directed against an antigenic determinant, epitope, part, domain, subunit or confirmation (where applicable) of said antigen on a target cell.
[0629] The target cell of the invention relates in particular to mammalian cells, preferably to primate cells, and even more preferably to human cells. The target cell is preferably a hyperproliferative cell such as e.g. a cancer cell.
[0630] The present invention relates to a polypeptide as described herein, wherein said second or further ISV binds to an antigen on a target cell with an average KD value of between 100 nM and 10 .mu.M, such as at an average KD value of 90 nM or less, even more preferably at an average KD value of 80 nM or less, such as less than 70, 60, 50, 40, 30, 20, 10, 5 nM or even less, such as less than 4, 3, 2, or 1 nM, such as less than 500, 400, 300, 200, 100, 90, 80, 70, 60, 50, 40, 30, 20 .mu.M, or even less, such as less than 10 .mu.M. Preferably, the KD is determined by Kinexa, BLI or SPR, for instance as determined by a Proteon.
[0631] Accordingly, the present invention relates to a polypeptide as described herein, wherein said second or further ISV has a high affinity for its antigen when measured as a monovalent.
[0632] Accordingly, the present invention relates to a polypeptide as described herein, wherein said average KD is measured by surface plasmon resonance (SPR) and/or KinExA or Proteon, for instance on recombinant protein, such as described in the Examples section.
[0633] The present invention also relates to a polypeptide as described herein, wherein said second or further ISV binds to an antigen on a target cell with an EC50 value of between 100 nM and 1 .mu.M, such as at an average EC50 value of 100 nM or less, even more preferably at an average EC50 value of 90 nM or less, such as less than 80, 70, 60, 50, 40, 30, 20, 10, 5 nM or even less, such as less than 4, 3, 2, or 1 nM or even less, such as less than 500, 400, 300, 200, 100, 90, 80, 70, 60, 50, 40, 30, 20, 10, 5 .mu.M, or even less, such as less than 4 .mu.M.
[0634] Accordingly, the present invention relates to a polypeptide as described herein, wherein said average EC50 is determined by FACS or ELISA, on a monovalent second ISV, such as a Nanobody, or a polypeptide comprising a monovalent second ISV, such as a Nanobody.
[0635] It has been shown in the examples that the KD correlates well with the EC50.
[0636] Simultaneous targeting of multiple antigens can reduce the probability of generating tumour escape variants, because of which the therapeutic activity of T cell engaging strategy is improved. The present invention provides multispecific polypeptides which comprise a TCR ISV combined with immunoglobulin single variable domains against different (target) antigens (on a target cell).
[0637] Preferred combinations of first and second antigens are provided below (it will be appreciated that the ISVs binding said antigens can be positioned in any order in the polypeptide of the invention):
TABLE-US-00002 first antigen second antigen EGFR (OMIM: 131550) CD20 (OMIM: 112210) EGFR (OMIM: 131550) CEA (OMIM: 114890) EGFR (OMIM: 131550) HER2 (OMIM: 164870) HER2 (OMIM: 164870) CD20 (OMIM: 112210) HER2 (OMIM: 164870) CEA (OMIM: 114890) CD20 (OMIM: 112210) CEA (OMIM: 114890)
[0638] Similarly, simultaneous targeting of multiple epitopes, antigenic determinants, parts, domains, subunits or conformations of a protein or antigen on a target cell can reduce the probability of generating tumour escape variants, because of which the therapeutic activity of T cell engaging strategy is improved (cf. Example 22). The present invention provides polypeptides which comprise an anti-TCR ISV combined with immunoglobulin single variable domains against different epitopes, antigenic determinants, parts, domains, subunits or conformations of an antigen on a target cell (also referred to as biparatopic constructs). Preferred combinations of first and second TAA ISVs are provided below (it will be appreciated that the ISVs binding said antigens can be positioned in any order in the polypeptide of the invention):
TABLE-US-00003 SEQ SEQ TAA1 ISV name ID NO: TAA2 ISV name ID NO: EGFR-1 7D12 355 EGFR-2 9G08 352 HER2-1 5F07 350 HER2-2 47D05 351 CEA-1 CEA#1 353 CEA-2 CEA#5 354
[0639] The polypeptides and compositions of the present invention can be used for the prevention and/or treatment of diseases and disorders of the present invention (herein also "diseases and disorders of the present invention") which include, but are not limited to cancer. The term "cancer" refers to the pathological condition in mammals that is typically characterized by dysregulated cellular proliferation or survival. Examples of cancer include, but are not limited to, carcinomas, gliomas, mesotheliomas, melanomas, lymphomas, leukemias, adenocarcinomas: breast cancer, ovarian cancer, cervical cancer, glioblastoma, multiple myeloma (including monoclonal gammopathy of undetermined significance, asymptomatic and symptomatic myeloma), prostate cancer, and Burkitt's lymphoma, head and neck cancer, colon cancer, colorectal cancer, non-small cell lung cancer, small cell lung cancer, cancer of the esophagus, stomach cancer, pancreatic cancer, hepatobiliary cancer, cancer of the gallbladder, cancer of the small intestine, rectal cancer, kidney cancer, bladder cancer, prostate cancer, penile cancer, urethral cancer, testicular cancer, vaginal cancer, uterine cancer, thyroid cancer, parathyroid cancer, adrenal cancer, pancreatic endocrine cancer, carcinoid cancer, bone cancer, skin cancer, retinoblastomas, Hodgkin's lymphoma, non-Hodgkin's lymphoma, Kaposi's sarcoma, multicentric Castleman's disease or AIDS-associated primary effusion lymphoma, neuroectodermal tumors, rhabdomyosarcoma (see e.g., Cancer, Principles and practice (DeVita et al. eds 1997) for additional cancers); as well as any metastasis of any of the above cancers, as well as non-cancer indications such as nasal polyposis, as well as other disorders and diseases described herein.
[0640] For a general description of immunoglobulin single variable domains, reference is made to the further description below, as well as to the prior art cited herein. In this respect, it should however be noted that this description and the prior art mainly describes immunoglobulin single variable domains of the so-called "V.sub.H3 class" (i.e., immunoglobulin single variable domains with a high degree of sequence homology to human germline sequences of the V.sub.H3 class such as DP-47, DP-51 or DP-29), which form a preferred aspect of this invention. It should, however, be noted that the invention in its broadest sense generally covers any type of immunoglobulin single variable domains and for example also covers the immunoglobulin single variable domains belonging to the so-called "V.sub.H4 class" (i.e., immunoglobulin single variable domains with a high degree of sequence homology to human germline sequences of the V.sub.H4 class such as DP-78), as for example described in WO 07/118670.
[0641] Generally, immunoglobulin single variable domains (in particular V.sub.HH sequences and sequence optimized immunoglobulin single variable domains) can in particular be characterized by the presence of one or more "Hallmark residues" (as described for example in Table B2) in one or more of the framework sequences (again as further described herein).
TABLE-US-00004 TABLE B-2 Hallmark Residues in VHHs Position Human V.sub.H3 Hallmark Residues 11 L, V; L, S, V, M, W, F, T, Q, E, predominantly L A, R, G, K, Y, N, P, I; preferably L 37 V, I, F; F.sup.(1), Y, V, L, A, H, S, usually V I, W, C, N, G, D, T, P, preferably F.sup.(1) or Y 44.sup.(8) G E.sup.(3), Q.sup.(3), G.sup.(2), D, A, K, R, L, P, S, V, H, T, N, W, M, I; preferably G.sup.(2), E.sup.(3) or Q.sup.(3); most preferably G.sup.(2) or Q.sup.(3). 45.sup.(8) L L.sup.(2), R.sup.(3), P, H, F, G, Q, S, E, T, Y, C, I, D, V; preferably L.sup.(2) or R.sup.(3) 47.sup.(8) W, Y F.sup.(1), L.sup.(1) or W.sup.(2) G, I, S, A, V, M, R, Y, E, P, T, C, H, K, Q, N, D; preferably W.sup.(2), L.sup.(1) or F.sup.(1) 83 R or K; R, K.sup.(5), T, E.sup.(5), Q, N, S, usually R I, V, G, M, L, A, D, Y, H; preferably K or R; most preferably K 84 A, T, D; P.sup.(5), S, H, L, A, V, I, T, predominantly A F, D, R, Y, N, Q, G, E; preferably P 103 W W.sup.(4), R.sup.(6), G, S, K, A, M, Y, L, F, T, N, V, Q, P.sup.(6), E, C; preferably W 104 G G, A, S, T, D, P, N, E, C, L; preferably G 108 L, M or T; Q, L.sup.(7), R, P, E, K, S, predominantly L T, M, A, H; preferably Q or L.sup.(7) Notes: .sup.(1)In particular, but not exclusively, in combination with KERE or KQRE at positions 43-46. .sup.(2)Usually as GLEW at positions 44-47. .sup.(3)Usually as KERE or KQRE at positions 43-46, e.g. as KEREL, KEREF, KQREL, KQREF, KEREG, KQREW or KQREG at positions 43-47. Alternatively, also sequences such as TERE (for example TEREL), TQRE (for example TQREL), KECE (for example KECEL or KECER), KQCE (for example KQCEL), RERE (for example REREG), RQRE (for example RQREL, RQREF or RQREW), QERE (for example QEREG), QQRE, (for example QQREW, QQREL or QQREF), KGRE (for example KGREG), KDRE (for example KDREV) are possible. Some other possible, but less preferred sequences include for example DECKL and NVCEL. .sup.(4)With both GLEW at positions 44-47 and KERE or KQRE at positions 43-46. .sup.(5)Often as KP or EP at positions 83-84 of naturally occurring V.sub.HH domains. .sup.(6)In particular, but not exclusively, in combination with GLEW at positions 44-47. .sup.(7)With the proviso that when positions 44-47 are GLEW, position 108 is always Q in (non- humanized) V.sub.HH sequences that also contain a W at 103. .sup.(8)The GLEW group also contains GLEW-like sequences at positions 44-47, such as for example GVEW, EPEW, GLER, DQ.EW, DLEW, GIEW, ELEW, GPEW, EWLP, and GPER.
[0642] The immunoglobulins of the invention may also contain a C-terminal extension (X)n (in which n is 1 to 10, preferably 1 to 5, such as 1, 2, 3, 4 or 5 (and preferably 1 or 2, such as 1); and each X is an (preferably naturally occurring) amino acid residue that is independently chosen, and preferably independently chosen from the group consisting of alanine (A), glycine (G), valine (V), leucine (L) or isoleucine (I)), for which reference is made to WO 12/175741 and WO 15/060643.
[0643] Apart from this and/or in addition, the immunoglobulin of the invention may have certain preferred amino acid residues at positions 11, 89, 110 and/or 112 as is described in further detail in WO 15/060643 (which is incorporated herein as reference).
[0644] Again, such immunoglobulin single variable domains may be derived in any suitable manner and from any suitable source, and may for example be naturally occurring V.sub.HH sequences (i.e., from a suitable species of Camelid, e.g., llama) or synthetic or semi-synthetic VHs or VLs (e.g., from human). Such immunoglobulin single variable domains may include "humanized" or otherwise "sequence optimized" VHHs, "camelized" immunoglobulin sequences (and in particular camelized heavy chain variable domain sequences, i.e., camelized VHs), as well as human VHs, human VLs, camelid VHHs that have been altered by techniques such as affinity maturation (for example, starting from synthetic, random or naturally occurring immunoglobulin sequences), CDR grafting, veneering, combining fragments derived from different immunoglobulin sequences, PCR assembly using overlapping primers, and similar techniques for engineering immunoglobulin sequences well known to the skilled person; or any suitable combination of any of the foregoing as further described herein. As mentioned herein, a particularly preferred class of immunoglobulin single variable domains of the invention comprises immunoglobulin single variable domains with an amino acid sequence that corresponds to the amino acid sequence of a naturally occurring V.sub.HH domain, but that has been "humanized", i.e. by replacing one or more amino acid residues in the amino acid sequence of said naturally occurring V.sub.HH sequence (and in particular in the framework sequences) by one or more of the amino acid residues that occur at the corresponding position(s) in a V.sub.H domain from a conventional 4-chain antibody from a human being (e.g. indicated above). This can be performed in a manner known per se, which will be clear to the skilled person, for example on the basis of the further description herein and the prior art on humanization referred to herein. Again, it should be noted that such humanized immunoglobulin single variable domains of the invention can be obtained in any suitable manner known per se and thus are not strictly limited to polypeptides that have been obtained using a polypeptide that comprises a naturally occurring V.sub.HH domain as a starting material.
[0645] Another particularly preferred class of immunoglobulin single variable domains of the invention comprises immunoglobulin single variable domains with an amino acid sequence that corresponds to the amino acid sequence of a naturally occurring V.sub.H domain, but that has been "camelized", i.e. by replacing one or more amino acid residues in the amino acid sequence of a naturally occurring V.sub.H domain from a conventional 4-chain antibody by one or more of the amino acid residues that occur at the corresponding position(s) in a V.sub.HH domain of a heavy chain antibody. This can be performed in a manner known per se, which will be clear to the skilled person, for example on the basis of the description herein. Such "camelizing" substitutions are preferably inserted at amino acid positions that form and/or are present at the V.sub.H--V.sub.L interface, and/or at the so-called Camelidae hallmark residues, as defined herein (see also for example WO 94/04678 and Davies and Riechmann 1994 (FEBS letters 339: 285-290) and 1996 (Protein Engineering 9: 531-537)). Preferably, the V.sub.H sequence that is used as a starting material or starting point for generating or designing the camelized immunoglobulin single variable domains is preferably a V.sub.H sequence from a mammal, more preferably the V.sub.H sequence of a human being, such as a V.sub.H3 sequence. However, it should be noted that such camelized immunoglobulin single variable domains of the invention can be obtained in any suitable manner known per se and thus are not strictly limited to polypeptides that have been obtained using a polypeptide that comprises a naturally occurring V.sub.H domain as a starting material.
[0646] For example, again as further described herein, both "humanization" and "camelization" can be performed by providing a nucleotide sequence that encodes a naturally occurring V.sub.HH domain or V.sub.H domain, respectively, and then changing, in a manner known per se, one or more codons in said nucleotide sequence in such a way that the new nucleotide sequence encodes a "humanized" or "camelized" immunoglobulin single variable domain of the invention, respectively. This nucleic acid can then be expressed in a manner known per se, so as to provide the desired immunoglobulin single variable domains of the invention. Alternatively, based on the amino acid sequence of a naturally occurring V.sub.HH domain or V.sub.H domain, respectively, the amino acid sequence of the desired humanized or camelized immunoglobulin single variable domains of the invention, respectively, can be designed and then synthesized de novo using techniques for peptide synthesis known per se. Also, based on the amino acid sequence or nucleotide sequence of a naturally occurring V.sub.HH domain or V.sub.H domain, respectively, a nucleotide sequence encoding the desired humanized or camelized immunoglobulin single variable domains of the invention, respectively, can be designed and then synthesized de novo using techniques for nucleic acid synthesis known per se, after which the nucleic acid thus obtained can be expressed in a manner known per se, so as to provide the desired immunoglobulin single variable domains of the invention.
[0647] Accordingly, the present invention relates to a polypeptide as described herein, wherein said ISV is a Nanobody, a V.sub.HH, a humanized V.sub.HH, or a camelized V.sub.H.
[0648] Generally, proteins or polypeptides that comprise or essentially consist of a single building block, single immunoglobulin single variable domain or single Nanobody will be referred to herein as "monovalent" proteins or polypeptides, as "monovalent constructs", as "monovalent building block", as "monovalent immunoglobulin single variable domain", or as "monovalent Nanobody", respectively.
[0649] In this respect, the present invention also relates to the monovalent building blocks that make up the polypeptides of the invention.
[0650] Accordingly, the present invention relates to an ISV or polypeptide that specifically binds the constant domain of the T cell receptor (TCR) and that comprises or essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which:
[0651] (i) CDR1 is chosen from the group consisting of:
[0652] (a) SEQ ID NOs: 119-133; or
[0653] (b) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of any of SEQ ID NOs: 119-133, provided that the polypeptide comprising the CDR1 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR1 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance;
[0654] and/or
[0655] (ii) CDR2 is chosen from the group consisting of:
[0656] (c) SEQ ID NOs: 134-163; or
[0657] (d) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of any of SEQ ID NOs: 134-163, provided that the polypeptide comprising the CDR2 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR2 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance;
[0658] and/or
[0659] (iii) CDR3 is chosen from the group consisting of:
[0660] (e) SEQ ID NOs: 164-174; or
[0661] (f) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of any of SEQ ID NOs: 164-174, provided that the polypeptide comprising the CDR3 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR3 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance.
[0662] As discussed above, ISVs were isolated that belong to different clusters, based on structural similarities and differences in CDR2 and CDR3.
[0663] Immunoglobulin single variable domains belonging to cluster A are represented by polypeptides according in which:
[0664] (i) CDR1 is chosen from the group consisting of:
[0665] (a) SEQ ID NOs: 119-123, 125-127, 129, 132 and 133; and
[0666] (b) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 123, provided that the polypeptide comprising the CDR1 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR1 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance;
[0667] and/or
[0668] (ii) CDR2 is chosen from the group consisting of:
[0669] (c) SEQ ID NOs: 134-141, 143-144, 146-156, 159-163; and
[0670] (d) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 153, provided that the polypeptide comprising the CDR2 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR2 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance;
[0671] and/or
[0672] (iii) CDR3 is chosen from the group consisting of:
[0673] (e) SEQ ID NOs: 164-166, 169-171, 173-174; and
[0674] (f) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 170, provided that the polypeptide comprising the CDR3 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR3 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance.
[0675] In another aspect, in the polypeptides belonging to cluster A, CDR1 is chosen from the group consisting of
[0676] (a) SEQ ID NO: 123; and
[0677] (b) amino acid sequences that have 1, 2, or 3 amino acid difference(s) with SEQ ID NO: 123, wherein
[0678] at position 2 the D has been changed into A, S, E or G;
[0679] at position 4 the H has been changed into Y;
[0680] at position 5 the K has been changed into L;
[0681] at position 6 the I has been changed into L;
[0682] at position 8 the F has been changed into I or V; and/or
[0683] at position 10 the G has been changed into S.
[0684] In another aspect, in the polypeptides belonging to cluster A, CDR2 is chosen from the group consisting of
[0685] (a) SEQ ID NO: 153; and
[0686] (b) amino acid sequences that have 1, 2, 3, 4 or 5 amino acid difference(s) with SEQ ID NO: 153, wherein
[0687] at position 1 the H has been changed into T or R;
[0688] at position 3 the S has been changed into T or A;
[0689] at position 5 the G has been changed into S or A;
[0690] at position 7 the Q has been changed into D, E, T, A or V;
[0691] at position 8 the T has been changed into A or V; and/or
[0692] at position 9 the D has been changed into A, Q, N, V or S.
[0693] In another aspect, in the polypeptides belonging to cluster A, CDR3 is chosen from the group consisting of
[0694] (a) SEQ ID NO: 170; and
[0695] (b) amino acid sequences that have 1, 2, or 3 amino acid difference(s) with SEQ ID NO: 170, wherein
[0696] at position 1 the F has been changed into Y, L or G;
[0697] at position 4 the I has been changed into L;
[0698] at position 5 the Y has been changed into W; and/or
[0699] at position 8 the D has been changed into N or S.
[0700] Accordingly, the present invention relates to an ISV or polypeptide that specifically binds the constant domain of the T cell receptor (TCR) and that comprises or essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which:
[0701] (i) CDR1 is chosen from the group consisting of:
[0702] (a) SEQ ID NO: 123; and
[0703] (b) amino acid sequences that have 1, 2, or 3 amino acid difference(s) with SEQ ID NO: 123, wherein
[0704] at position 2 the D has been changed into A, S, E or G;
[0705] at position 4 the H has been changed into Y;
[0706] at position 5 the K has been changed into L;
[0707] at position 6 the I has been changed into L;
[0708] at position 8 the F has been changed into I or V; and/or
[0709] at position 10 the G has been changed into S;
[0710] and
[0711] (ii) CDR2 is chosen from the group consisting of:
[0712] (a) SEQ ID NO: 153; and
[0713] (b) amino acid sequences that have 1, 2, 3, 4 or 5 amino acid difference(s) with SEQ ID NO: 153, wherein
[0714] at position 1 the H has been changed into T or R;
[0715] at position 3 the S has been changed into T or A;
[0716] at position 5 the G has been changed into S or A;
[0717] at position 7 the Q has been changed into D, E, T, A or V;
[0718] at position 8 the T has been changed into A or V; and/or
[0719] at position 9 the D has been changed into A, Q, N, V or S; and
[0720] (iii) CDR3 is chosen from the group consisting of:
[0721] (a) SEQ ID NO: 170; and
[0722] (b) amino acid sequences that have 1, 2, or 3 amino acid difference(s) with SEQ ID NO: 170, wherein
[0723] at position 1 the F has been changed into Y, L or G;
[0724] at position 4 the I has been changed into L;
[0725] at position 5 the Y has been changed into W; and/or
[0726] at position 8 the D has been changed into N or S.
[0727] In another aspect, the invention relates to a polypeptide in which CDR1 is represented by SEQ ID NO: 123, CDR2 is represented by SEQ ID NO: 153, and CDR3 is represented by SEQ ID NO: 170. Preferably the polypeptide is selected from any of SEQ ID NOs: 1 to 104.
[0728] Immunoglobulin single variable domains belonging to cluster B are represented by polypeptides according in which:
[0729] (i) CDR1 is chosen from the group consisting of:
[0730] (a) SEQ ID NOs: 124, 128 and 131; and
[0731] (b) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 124, provided that the polypeptide comprising the CDR1 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR1 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance;
[0732] and/or
[0733] (ii) CDR2 is chosen from the group consisting of:
[0734] (c) SEQ ID NOs: 142 and 145; and
[0735] (d) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 145, provided that the polypeptide comprising the CDR2 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR2 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance;
[0736] and/or
[0737] (iii) CDR3 is chosen from the group consisting of:
[0738] (e) SEQ ID NOs: 167 and 168; and
[0739] (f) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 167, provided that the polypeptide comprising the CDR3 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR3 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance.
[0740] In another aspect, in the polypeptides belonging to cluster B, CDR1 is chosen from the group consisting of
[0741] (a) SEQ ID NO: 124; and
[0742] (b) amino acid sequences that have 1, or 2 amino acid difference(s) with SEQ ID NO: 124, wherein
[0743] at position 2 the E has been changed into Q; and/or
[0744] at position 6 the I has been changed into V.
[0745] In another aspect, in the polypeptides belonging to cluster B, CDR2 is chosen from the group consisting of
[0746] (a) SEQ ID NO: 145; and
[0747] (b) amino acid sequence that has 1 amino acid difference with SEQ ID NO: 145, wherein
[0748] at position 9 the N has been changed into D.
[0749] In another aspect, in the polypeptides belonging to cluster B, CDR3 is chosen from the group consisting of
[0750] (a) SEQ ID NO: 167; and
[0751] (b) amino acid sequence that has 1 amino acid difference with SEQ ID NO: 167, wherein
[0752] at position 4 the L has been changed into 1.
[0753] Accordingly, the present invention relates to an ISV or polypeptide that specifically binds the constant domain of the T cell receptor (TCR) and that comprises or essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which:
[0754] (i) CDR1 is chosen from the group consisting of:
[0755] (a) SEQ ID NO: 124; and
[0756] (b) amino acid sequences that have 1, or 2 amino acid difference(s) with SEQ ID NO: 124, wherein
[0757] at position 2 the E has been changed into Q; and/or
[0758] at position 6 the I has been changed into V; and
[0759] (ii) CDR2 is chosen from the group consisting of:
[0760] (a) SEQ ID NO: 145; and
[0761] (b) amino acid sequence that has 1 amino acid difference with SEQ ID NO: 145, wherein
[0762] at position 9 the N has been changed into D; and (iii) CDR3 is chosen from the group consisting of:
[0763] (a) SEQ ID NO: 167; and
[0764] (b) amino acid sequence that has 1 amino acid difference with SEQ ID NO: 167, wherein
[0765] at position 4 the L has been changed into 1.
[0766] In another aspect, the invention relates to a polypeptide in which CDR1 is represented by SEQ ID NO: 124, CDR2 is represented by SEQ ID NO: 145, and CDR3 is represented by SEQ ID NO: 167. Preferably the polypeptide is selected from any of SEQ ID NOs: 105-115.
[0767] Immunoglobulin single variable domains belonging to cluster C are represented by polypeptides according in which:
[0768] (i) CDR1 is chosen from the group consisting of:
[0769] (a) SEQ ID NO: 130; and
[0770] (b) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 130, provided that the polypeptide comprising the CDR1 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR1 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance;
[0771] and/or
[0772] (ii) CDR2 is chosen from the group consisting of:
[0773] (c) SEQ ID NOs: 157-158; and
[0774] (d) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 157, provided that the polypeptide comprising the CDR2 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR2 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance;
[0775] and/or
[0776] (iii) CDR3 is chosen from the group consisting of:
[0777] (e) SEQ ID NO: 172; and
[0778] (f) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 172, provided that the polypeptide comprising the CDR3 with 4, 3, 2, or 1 amino acid(s) difference binds TCR with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR3 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance.
[0779] In another aspect, in the polypeptides belonging to cluster C, CDR1 is chosen from SEQ ID NO: 130.
[0780] In another aspect, in the polypeptides belonging to cluster C, CDR2 is chosen from the group consisting of
[0781] (a) SEQ ID NO: 157; and
[0782] (b) amino acid sequence that has 1 amino acid difference with SEQ ID NO: 157, wherein
[0783] at position 8 the T has been changed into I.
[0784] In another aspect, in the polypeptides belonging to cluster C, CDR3 is chosen from SEQ ID NO: 172.
[0785] Accordingly, the present invention relates to an ISV or polypeptide that specifically binds the constant domain of the T cell receptor (TCR) and that comprises or essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which:
[0786] (i) CDR1 is chosen from SEQ ID NO: 130;
[0787] and
[0788] (ii) CDR2 is chosen from the group consisting of:
[0789] (a) SEQ ID NO: 157; and
[0790] (b) amino acid sequence that has 1 amino acid difference with SEQ ID NO: 157, wherein
[0791] at position 8 the T has been changed into I; and
[0792] (iii) CDR3 is chosen from SEQ ID NO: 172.
[0793] In another aspect, the invention relates to a polypeptide in which CDR1 is represented by SEQ ID NO: 130, CDR2 is represented by SEQ ID NO: 157, and CDR3 is represented by SEQ ID NO: 172. Preferably the polypeptide is selected from any of SEQ ID NOs: 116-118.
[0794] In a further aspect, the invention relates to polypeptides that cross-block the binding to the constant domain of the T cell receptor (TCR) by at least one of the ISVs or polypeptides belonging to Cluster A, B or C.
[0795] Accordingly, the present invention relates to polypeptides that cross-block the binding to the constant domain of the T cell receptor (TCR) by at least one of the ISVs or polypeptides with SEQ ID NOs: 1-104.
[0796] In another aspect, the present invention relates to ISVs or polypeptides that cross-block the binding to the constant domain of the T cell receptor (TCR) by at least one of the ISVs or polypeptides with SEQ ID NOs: 105-115.
[0797] In yet another aspect, the present invention relates to ISVs or polypeptides that cross-block the binding to the constant domain of the T cell receptor (TCR) by at least one of the ISVs or polypeptides with SEQ ID NOs: 116-118.
[0798] In a further aspect, the invention relates to polypeptides that are cross-blocked from binding to the constant domain of the T cell receptor (TCR) by at least one of the ISVs or polypeptides belonging to Cluster A, B or C.
[0799] Accordingly, the present invention relates to polypeptides that are cross-blocked from binding to the constant domain of the T cell receptor (TCR) by at least one of the ISVs or polypeptides belonging to SEQ ID NOs: 1-104.
[0800] In another aspect, the present invention relates to polypeptides that are cross-blocked from binding to the constant domain of the T cell receptor (TCR) by at least one of the ISVs or polypeptides belonging to SEQ ID NOs: 105-115.
[0801] In another aspect, the present invention relates to polypeptides that are cross-blocked from binding to the constant domain of the T cell receptor (TCR) by at least one of the ISVs or polypeptides belonging to SEQ ID NOs: 116-118.
[0802] The present invention also relates to an ISV or polypeptide that specifically binds carcinoembryonic antigen (CEA) and that comprises or essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which:
[0803] (i) CDR1 is chosen from the group consisting of:
[0804] (a) SEQ ID NO: 361 (GDTYGSYWMG); or
[0805] (b) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 361, provided that the polypeptide comprising the CDR1 with 4, 3, 2, or 1 amino acid(s) difference binds CEA with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR1 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance;
[0806] and/or
[0807] (ii) CDR2 is chosen from the group consisting of:
[0808] (c) SEQ ID NO: 363 (AINRGGGYTV); or
[0809] (d) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of any of SEQ ID NO: 363, provided that the polypeptide comprising the CDR2 with 4, 3, 2, or 1 amino acid(s) difference binds CEA with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR2 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance;
[0810] and/or
[0811] (iii) CDR3 is chosen from the group consisting of:
[0812] (e) SEQ ID NO: 365 (SGVLGGLHEDWFNY); or
[0813] (f) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of any of SEQ ID NO: 365, provided that the polypeptide comprising the CDR3 with 4, 3, 2, or 1 amino acid(s) difference binds CEA with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR3 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance.
[0814] In another aspect, the invention relates to a polypeptide in which CDR1 is represented by SEQ ID NO: 361, CDR2 is represented by SEQ ID NO: 363, and CDR3 is represented by SEQ ID NO: 365. Preferred polypeptides include SEQ ID NOs: 353 and 354.
[0815] In a further aspect, the invention relates to polypeptides that cross-block the binding to carcinoembryonic antigen (CEA) by at least one of the ISVs or polypeptides with SEQ ID NOs: 353 or 354.
[0816] In a further aspect, the invention relates to polypeptides that are cross-blocked from binding to carcinoembryonic antigen (CEA) by at least one of the ISVs or polypeptides with SEQ ID NOs: 353 or 354.
[0817] The present invention also relates to an ISV or polypeptide that specifically binds CD20 and that comprises or essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which:
[0818] (i) CDR1 is chosen from the group consisting of:
[0819] (a) SEQ ID NO: 362 (GGTFSSYTMG); or
[0820] (b) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of SEQ ID NO: 362, provided that the polypeptide comprising the CDR1 with 4, 3, 2, or 1 amino acid(s) difference binds CD20 with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR1 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance;
[0821] and/or
[0822] (ii) CDR2 is chosen from the group consisting of:
[0823] (c) SEQ ID NO: 364 (EVRWGGVTT); or
[0824] (d) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of any of SEQ ID NO: 364, provided that the polypeptide comprising the CDR2 with 4, 3, 2, or 1 amino acid(s) difference binds CD20 with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR2 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance;
[0825] and/or
[0826] (iii) CDR3 is chosen from the group consisting of:
[0827] (e) SEQ ID NO: 366 (VRQMYMTVVPDY); or
[0828] (f) amino acid sequences that have 4, 3, 2, or 1 amino acid(s) difference with the amino acid sequence of any of SEQ ID NO: 366, provided that the polypeptide comprising the CDR3 with 4, 3, 2, or 1 amino acid(s) difference binds CD20 with about the same or a higher affinity compared to the binding by the polypeptide comprising the CDR3 without the 4, 3, 2, or 1 amino acid(s) difference, said affinity as measured by surface plasmon resonance.
[0829] In another aspect, the invention relates to a polypeptide in which CDR1 is represented by SEQ ID NO: 362, CDR2 is represented by SEQ ID NO: 364, and CDR3 is represented by SEQ ID NO: 366. A preferred polypeptide includes SEQ ID NO: 357.
[0830] In a further aspect, the invention relates to polypeptides that cross-block the binding to CD20 by the ISV or polypeptide with SEQ ID NO: 357.
[0831] In a further aspect, the invention relates to polypeptides that are cross-blocked from binding to CD20 by the ISV or polypeptide with SEQ ID NO: 357.
[0832] The invention further relates to compounds or constructs, and in particular proteins or polypeptides that comprise or essentially consist of one or more ISVs or polypeptides of the invention, and optionally further comprise one or more other groups, residues, moieties or binding units. As will become clear to the skilled person from the further disclosure herein, such further groups, residues, moieties, binding units or amino acid sequences may or may not provide further functionality to the polypeptide of the invention (and/or to the compound or construct in which it is present) and may or may not modify the properties of the polypeptide of the invention.
[0833] In a specific, but non-limiting aspect of the invention, which will be further described herein, the ISVs and polypeptides of the invention may have an increased half-life in serum (as further described herein) compared to the immunoglobulin single variable domain or polypeptide from which they have been derived. For example, an immunoglobulin single variable domain or polypeptide of the invention may be linked (chemically or otherwise) to one or more groups or moieties that extend the half-life (such as PEG), so as to provide a derivative of the ISV or polypeptide of the invention with increased half-life.
[0834] In a specific aspect of the invention, a compound or construct of the invention or a polypeptide of the invention may have an increased half-life, compared to the corresponding ISV or polypeptide of the invention. Some preferred, but non-limiting examples of such compounds, constructs and polypeptides will become clear to the skilled person based on the further disclosure herein, and for example comprise immunoglobulin single variable domains or polypeptides of the invention that have been chemically modified to increase the half-life thereof (for example, by means of pegylation); immunoglobulin single variable domains or polypeptides of the invention that comprise at least one additional binding site for binding to a serum protein (such as serum albumin); or constructs or polypeptides of the invention which comprise at least ISV or polypeptide of the invention that is linked to at least one moiety (and in particular at least one amino acid sequence) which increases the half-life of the ISV or polypeptide of the invention. Examples of ISVs or polypeptides of the invention which comprise such half-life extending moieties or immunoglobulin single variable domains will become clear to the skilled person based on the further disclosure herein; and for example include, without limitation, polypeptides in which the one or more immunoglobulin single variable domains or polypeptide of the invention are suitably linked to one or more serum proteins or fragments thereof (such as (human) serum albumin or suitable fragments thereof) or to one or more binding units that can bind to serum proteins (such as, for example, domain antibodies, immunoglobulin single variable domains that are suitable for use as a domain antibody, single domain antibodies, immunoglobulin single variable domains that are suitable for use as a single domain antibody, "dAb" 's, immunoglobulin single variable domains that are suitable for use as a dAb, or Nanobodies that can bind to serum proteins such as serum albumin (such as human serum albumin), serum immunoglobulins such as IgG, or transferrin; reference is made to the further description and references mentioned herein); ISVs or polypeptides in which an ISV or polypeptide of the invention is linked to an Fc portion (such as a human Fc) or a suitable part or fragment thereof; or polypeptides in which the one or more immunoglobulin single variable domains or polypeptide of the invention are suitable linked to one or more small proteins or peptides that can bind to serum proteins, such as, without limitation, the proteins and peptides described in WO 91/01743, WO 01/45746, WO 02/076489, WO 08/068280, WO 09/127691 and WO 11/095545.
[0835] Generally, the compounds, constructs or polypeptides of the invention with increased half-life preferably have a half-life that is at least 1.5 times, preferably at least 2 times, such as at least 5 times, for example at least 10 times or more than 20 times, greater than the half-life of the corresponding ISV or polypeptide of the invention per se. For example, the compounds, constructs or polypeptides of the invention with increased half-life may have a half-life e.g., in humans that is increased with more than 1 hours, preferably more than 2 hours, more preferably more than 6 hours, such as more than 12 hours, or even more than 24, 48 or 72 hours, compared to the corresponding ISV or polypeptide of the invention per se.
[0836] In a preferred, but non-limiting aspect of the invention, such compounds, constructs or polypeptides of the invention have a serum half-life e.g. in humans that is increased with more than 1 hours, preferably more than 2 hours, more preferably more than 6 hours, such as more than 12 hours, or even more than 24, 48 or 72 hours, compared to the corresponding ISV or polypeptide of the invention per se.
[0837] In another preferred, but non-limiting aspect of the invention, such compounds, constructs or polypeptides of the invention exhibit a serum half-life in human of at least about 12 hours, preferably at least 24 hours, more preferably at least 48 hours, even more preferably at least 72 hours or more. For example, compounds, constructs or polypeptides of the invention may have a half-life of at least 5 days (such as about 5 to 10 days), preferably at least 9 days (such as about 9 to 14 days), more preferably at least about 10 days (such as about 10 to 15 days), or at least about 11 days (such as about 11 to 16 days), more preferably at least about 12 days (such as about 12 to 18 days or more), or more than 14 days (such as about 14 to 19 days).
[0838] In the present invention, it was demonstrated that the inclusion of an albumin targeting binding unit in the construct as such did not have an essential impact on the obtained potency or efficacy. Although a minor loss of efficacy/potency was observed in the presence of HSA, the half-life extended TCR binding multispecific polypeptides were still potent in tumour cell killing. Albumin-based drug delivery has been demonstrated to be useful for achieving improved cancer therapy, largely due to its passive target toward tumour via the enhanced permeability and retention effect and the increased demand for albumin by tumour cells as source of energy and amino acids. However, albumin lacks not only the active mechanism to overcome the cell membrane barrier, but also the ability to penetrate into tumour tissues (Qianqian Guo et al. 2013, Polym. Chem. 4: 4584-4587).
[0839] In a particularly preferred but non-limiting aspect of the invention, the invention provides a polypeptide of the invention comprising a first and a second immunoglobulin single variable domain (ISV); and further comprising one or more (preferably one) serum albumin binding immunoglobulin single variable domain as described herein, e.g. the serum albumin binding immunoglobulin single variable domain referred to as Alb8, Alb23, Alb129, Alb132, Alb11, Alb11 (S112K)-A, Alb82, Alb82-A, Alb82-AA, Alb82-AAA, Alb82-G, Alb82-GG, Alb82-GGG (Table B-3).
TABLE-US-00005 TABLE B-3 Immunoglobulin single variable domains for use in HLE of the ISVs and polypeptides of the invention SEQ ID ISV Sequence NO Alb8 EVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDT 400 LYADSVKGRFTISRDNAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSS Alb23 EVQLLESGGGLVQPGGSLRLSCAASGFTFRSFGMSWVRQAPGKGPEWVSSISGSGSDT 401 LYADSVKGRFTISRDNSKNTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSS Alb129 EVQLVESGGGVVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDT 402 LYADSVKGRFTISRDNAKTTLYLQMNSLRPEDTATYYCTIGGSLSRSSQGTLVTVSSA Alb132 EVQLVESGGGVVQPGGSLRLSCAASGFTFRSFGMSWVRQAPGKGPEWVSSISGSGSD 403 TLYADSVKGRFTISRDNSKNTLYLQMNSLRPEDTATYYCTIGGSLSRSSQGTLVTVSSA Alb11 EVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDT 404 LYADSVKGRFTISRDNAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSS Alb11 EVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDT 405 (S112K)-A LYADSVKGRFTISRDNAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVKVSSA Alb82 EVQLVESGGGVVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDT 406 LYADSVKGRFTISRDNAKTTLYLQMNSLRPEDTALYYCTIGGSLSRSSQGTLVTVSS Alb82-A EVQLVESGGGVVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDT 407 LYADSVKGRFTISRDNAKTTLYLQMNSLRPEDTALYYCTIGGSLSRSSQGTLVTVSSA Alb82-AA EVQLVESGGGVVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDT 408 LYADSVKGRFTISRDNAKTTLYLQMNSLRPEDTALYYCTIGGSLSRSSQGTLVTVSSAA Alb82-AAA EVQLVESGGGVVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDT 409 LYADSVKGRFTISRDNAKTTLYLQMNSLRPEDTALYYCTIGGSLSRSSQGTLVTVSSAAA Alb82-G EVQLVESGGGVVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDT 410 LYADSVKGRFTISRDNAKTTLYLQMNSLRPEDTALYYCTIGGSLSRSSQGTLVTVSSG Alb82-GG EVQLVESGGGVVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDT 411 LYADSVKGRFTISRDNAKTTLYLQMNSLRPEDTALYYCTIGGSLSRSSQGTLVTVSSGG Alb82-GGG EVQLVESGGGVVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDT 412 LYADSVKGRFTISRDNAKTTLYLQMNSLRPEDTALYYCTIGGSLSRSSQGTLVTVSSGGG
[0840] Accordingly, the present invention relates to a polypeptide as described herein, further comprising a serum protein binding moiety.
[0841] The present invention relates to a polypeptide as described herein, wherein said serum protein binding moiety binds serum albumin.
[0842] The present invention relates to a polypeptide as described herein, wherein said serum protein binding moiety is an immunoglobulin single variable domain binding serum albumin.
[0843] The present invention relates to a polypeptide as described herein, wherein said ISV binding serum albumin essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3 respectively), in which CDR1 is SFGMS (SEQ ID NO: 481), CDR2 is SISGSGSDTLYADSVKG (SEQ ID NO: 482), and in which CDR3 is GGSLSR (SEQ ID NO: 475), CDR determined according to Kabat definition; and/or in which CDR1 is GFTFSSFGMS (SEQ ID NO: 472) or GFTFRSFGMS (SEQ ID NO: 473), CDR2 is SISGSGSDTL (SEQ ID NO: 474) and CDR3 is GGSLSR (SEQ ID NO: 475), CDR determined according to Kontermann 2010.
[0844] The present invention relates to a polypeptide as described herein, wherein said ISV binding serum albumin comprises AMb, Alb23, Alb129, Alb132, Alb11, Alb11 (S112K)-A, Alb82, Alb82-A, Alb82-AA, Alb82-AAA, Alb82-G, Alb82-GG, Alb82-GGG (Table-1B3).
[0845] In the polypeptides of the invention, the two or more building blocks, ISVs or Nanobodies and the optionally one or more polypeptides, one or more other groups, drugs, agents, residues, moieties or binding units may be directly linked to each other (as for example described in WO 99/23221) and/or may be linked to each other via one or more suitable spacers or linkers, or any combination thereof.
[0846] Suitable spacers or linkers for use in multivalent and multispecific polypeptides will be clear to the skilled person, and may generally be any linker or spacer used in the art to link amino acid sequences. Preferably, said linker or spacer is suitable for use in constructing proteins or polypeptides that are intended for pharmaceutical use.
[0847] Some particularly preferred spacers include the spacers and linkers that are used in the art to link antibody fragments or antibody domains. These include the linkers mentioned in the general background art cited above, as well as for example linkers that are used in the art to construct diabodies or ScFv fragments (in this respect, however, it should be noted that, whereas in diabodies and in ScFv fragments, the linker sequence used should have a length, a degree of flexibility and other properties that allow the pertinent V.sub.H and V.sub.L domains to come together to form the complete antigen-binding site, there is no particular limitation on the length or the flexibility of the linker used in the polypeptide of the invention, since each ISV or Nanobody by itself forms a complete antigen-binding site).
[0848] For example, a linker may be a suitable amino acid sequence, and in particular amino acid sequences of between 1 and 50, preferably between 1 and 30, such as between 1 and 10 amino acid residues.
[0849] Some preferred examples of such amino acid sequences include gly-ser linkers, for example of the type (gly.sub.xser.sub.y).sub.z, such as (for example (gly.sub.4ser).sub.3 or (gly.sub.3ser.sub.2).sub.3, as described in WO 99/42077, and the GS30, GS15, GS9 and GS7 linkers described in the applications by Ablynx mentioned herein (see for example WO 06/040153 and WO 06/122825), as well as hinge-like regions, such as the hinge regions of naturally occurring heavy chain antibodies or similar sequences (such as described in WO 94/04678). Preferred linkers are depicted in Table B-4.
TABLE-US-00006 TABLE B-4 Linkers SEQ ID Linker Sequence NO 5GS GGGGS 376 7GS SGGSGGS 377 9GS GGGGSGGGS 378 10GS GGGGSGGGGS 379 15GS GGGGSGGGGSGGGGS 380 18GS GGGGSGGGGSGGGGGGGS 381 20GS GGGGSGGGGSGGGGSGGGGS 382 25GS GGGGSGGGGSGGGGSGGGGSGGGGS 383 30GS GGGGSGGGGSGGGGSGGGGSGGGGSGGGGS 384 35GS GGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGS 385 Poly-A AAA 386
[0850] Some other particularly preferred linkers are poly-alanine (such as AAA), as well as the linkers GS30 (SEQ ID NO: 85 in WO 06/122825) and GS9 (SEQ ID NO: 84 in WO 06/122825).
[0851] Other suitable linkers generally comprise organic compounds or polymers, in particular those suitable for use in proteins for pharmaceutical use. For instance, poly(ethyleneglycol) moieties have been used to link antibody domains, see for example WO 04/081026.
[0852] It is encompassed within the scope of the invention that the length, the degree of flexibility and/or other properties of the linker(s) used (although not critical, as it usually is for linkers used in ScFv fragments) may have some influence on the properties of the final polypeptide of the invention, including but not limited to the affinity, specificity or avidity for the TCR, or for one or more of the other antigens. Based on the disclosure herein, the skilled person will be able to determine the optimal linker(s) for use in a specific polypeptide of the invention, optionally after some limited routine experiments.
[0853] For example, in multivalent polypeptides of the invention that comprise building blocks, ISVs or Nanobodies directed against a first and second target, the length and flexibility of the linker are preferably such that it allows each building block, ISV or Nanobody of the invention present in the polypeptide to bind to its cognate target, e.g. the antigenic determinant on each of the targets. Again, based on the disclosure herein, the skilled person will be able to determine the optimal linker(s) for use in a specific polypeptide of the invention, optionally after some limited routine experiments.
[0854] It is also within the scope of the invention that the linker(s) used confer one or more other favourable properties or functionality to the polypeptides of the invention, and/or provide one or more sites for the formation of derivatives and/or for the attachment of functional groups (e.g. as described herein for the derivatives of the ISVs, Nanobodies, or polypeptides of the invention). For example, linkers containing one or more charged amino acid residues can provide improved hydrophilic properties, whereas linkers that form or contain small epitopes or tags can be used for the purposes of detection, identification and/or purification. Again, based on the disclosure herein, the skilled person will be able to determine the optimal linkers for use in a specific polypeptide of the invention, optionally after some limited routine experiments.
[0855] Finally, when two or more linkers are used in the polypeptides of the invention, these linkers may be the same or different. Again, based on the disclosure herein, the skilled person will be able to determine the optimal linkers for use in a specific polypeptide of the invention, optionally after some limited routine experiments.
[0856] Usually, for ease of expression and production, a polypeptide of the invention will be a linear polypeptide. However, the invention in its broadest sense is not limited thereto. For example, when a polypeptide of the invention comprises three or more building blocks, ISVs or Nanobodies, it is possible to link them by use of a linker with three or more "arms", with each "arm" being linked to a building block, ISV or Nanobody, so as to provide a "star-shaped" construct. It is also possible, although usually less preferred, to use circular constructs.
[0857] Accordingly, the present invention relates to a polypeptide as described herein, wherein said first ISV and said second ISV and possibly said third ISV and/or said ISV binding serum albumin are directly linked to each other or are linked via a linker.
[0858] The present invention relates to a polypeptide as described herein, wherein said linker is chosen from the group consisting of linkers of 5GS, 7GS, 9GS, 10GS, 15GS, 18GS, 20GS, 25GS, 30GS and 35GS.
[0859] The present invention relates to a polypeptide as described herein, wherein said serum protein binding moiety is a non-antibody based polypeptide (e.g. PEG).
[0860] The invention also relates to methods for preparing the ISVs, polypeptides and constructs described herein. The ISVs, polypeptides and constructs of the invention can be prepared in a manner known per se, as will be clear to the skilled person from the further description herein. For example, the ISVs, polypeptides and constructs of the invention can be prepared in any manner known per se for the preparation of antibodies and in particular for the preparation of antibody fragments (including but not limited to (single) domain antibodies and ScFv fragments). Some preferred, but non-limiting methods for preparing the polypeptides and constructs include the methods and techniques described herein.
[0861] The method for producing an ISV, polypeptide or protein construct of the invention may comprise the following steps:
[0862] the expression, in a suitable host cell or host organism (also referred to herein as a "host of the invention") or in another suitable expression system of a nucleic acid that encodes said ISV, polypeptide or protein construct of the invention,
[0863] optionally followed by:
[0864] isolating and/or purifying the ISV, polypeptide or protein construct of the invention thus obtained.
[0865] In particular, such a method may comprise the steps of:
[0866] cultivating and/or maintaining a host of the invention under conditions that are such that said host of the invention expresses and/or produces at least one ISV, polypeptide or protein construct of the invention; optionally followed by:
[0867] isolating and/or purifying the ISV, polypeptide or protein construct of the invention thus obtained.
[0868] Accordingly, the present invention also relates to a nucleic acid or nucleotide sequence that encodes an ISV, polypeptide or protein construct of the invention (also referred to as "nucleic acid of the invention" or "nucleotide sequence of the invention"). A nucleic acid of the invention can be in the form of single or double stranded DNA or RNA, and is preferably in the form of double stranded DNA. For example, the nucleotide sequences of the invention may be genomic DNA, cDNA or synthetic DNA (such as DNA with a codon usage that has been specifically adapted for expression in the intended host cell or host organism).
[0869] According to one embodiment of the invention, the nucleic acid of the invention is in essentially isolated from, as defined herein. The nucleic acid of the invention may also be in the form of, be present in and/or be part of a vector, such as for example a plasmid, cosmid or YAC, which again may be in essentially isolated form.
[0870] The nucleic acids of the invention can be prepared or obtained in a manner known per se, based on the information on the polypeptides or protein constructs of the invention given herein, and/or can be isolated from a suitable natural source. Also, as will be clear to the skilled person, to prepare a nucleic acid of the invention, also several nucleotide sequences, such as at least one nucleotide sequence encoding an immunoglobulin single variable domain of the invention and for example nucleic acids encoding one or more linkers can be linked together in a suitable manner.
[0871] Techniques for generating the nucleic acids of the invention will be clear to the skilled person and may for instance include, but are not limited to, automated DNA synthesis; site-directed mutagenesis; combining two or more naturally occurring and/or synthetic sequences (or two or more parts thereof), introduction of mutations that lead to the expression of a truncated expression product; introduction of one or more restriction sites (e.g. to create cassettes and/or regions that may easily be digested and/or ligated using suitable restriction enzymes), and/or the introduction of mutations by means of a PCR reaction using one or more "mismatched" primers. These and other techniques will be clear to the skilled person, and reference is again made to the standard handbooks, such as Sambrook et al. and Ausubel et al., mentioned herein, as well as the Examples below.
[0872] The nucleic acid of the invention may also be in the form of, be present in and/or be part of a genetic construct, as will be clear to the person skilled in the art. Such genetic constructs generally comprise at least one nucleic acid of the invention that is optionally linked to one or more elements of genetic constructs known per se, such as for example one or more suitable regulatory elements (such as a suitable promoter(s), enhancer(s), terminator(s), etc.) and the further elements of genetic constructs referred to herein. Such genetic constructs comprising at least one nucleic acid of the invention will also be referred to herein as "genetic constructs of the invention".
[0873] The genetic constructs of the invention may be DNA or RNA, and are preferably double-stranded DNA. The genetic constructs of the invention may also be in a form suitable for transformation of the intended host cell or host organism, in a form suitable for integration into the genomic DNA of the intended host cell or in a form suitable for independent replication, maintenance and/or inheritance in the intended host organism. For instance, the genetic constructs of the invention may be in the form of a vector, such as for example a plasmid, cosmid, YAC, a viral vector or transposon. In particular, the vector may be an expression vector, i.e. a vector that can provide for expression in vitro and/or in vivo (e.g. in a suitable host cell, host organism and/or expression system).
[0874] In a preferred but non-limiting embodiment, a genetic construct of the invention comprises
[0875] a) at least one nucleic acid of the invention; operably connected to
[0876] b) one or more regulatory elements, such as a promoter and optionally a suitable terminator;
[0877] and optionally also
[0878] c) one or more further elements of genetic constructs known per se; in which the terms "regulatory element", "promoter", "terminator" and "operably connected" have their usual meaning in the art (as further described herein); and in which said "further elements" present in the genetic constructs may for example be 3'- or 5'-UTR sequences, leader sequences, selection markers, expression markers/reporter genes, and/or elements that may facilitate or increase (the efficiency of) transformation or integration. These and other suitable elements for such genetic constructs will be clear to the skilled person, and may for instance depend upon the type of construct used; the intended host cell or host organism; the manner in which the nucleotide sequences of the invention of interest are to be expressed (e.g. via constitutive, transient or inducible expression); and/or the transformation technique to be used. For example, regulatory sequences, promoters and terminators known per se for the expression and production of antibodies and antibody fragments (including but not limited to (single) domain antibodies and ScFv fragments) may be used in an essentially analogous manner.
[0879] Preferably, in the genetic constructs of the invention, said at least one nucleic acid of the invention and said regulatory elements, and optionally said one or more further elements, are "operably linked" to each other, by which is generally meant that they are in a functional relationship with each other. For instance, a promoter is considered "operably linked" to a coding sequence if said promoter is able to initiate or otherwise control/regulate the transcription and/or the expression of a coding sequence (in which said coding sequence should be understood as being "under the control of" said promoter). Generally, when two nucleotide sequences are operably linked, they will be in the same orientation and usually also in the same reading frame. They will usually also be essentially contiguous, although this may also not be required.
[0880] The nucleic acids of the invention and/or the genetic constructs of the invention may be used to transform a host cell or host organism, i.e. for expression and/or production of the polypeptide or protein construct of the invention. The host is preferably a non-human host. Suitable hosts or host cells will be clear to the skilled person, and may for example be any suitable fungal, prokaryotic or eukaryotic cell or cell line or any suitable fungal, prokaryotic or eukaryotic organism, for example:
[0881] a bacterial strain, including but not limited to gram-negative strains such as strains of Escherichia coli; of Proteus, for example of Proteus mirabilis; of Pseudomonas, for example of Pseudomonas fluorescens; and gram-positive strains such as strains of Bacillus, for example of Bacillus subtilis or of Bacillus brevis; of Streptomyces, for example of Streptomyces lividans; of Staphylococcus, for example of Staphylococcus carnosus; and of Lactococcus, for example of Lactococcus lactis;
[0882] a fungal cell, including but not limited to cells from species of Trichoderma, for example from Trichoderma reesei; of Neurospora, for example from Neurospora crassa; of Sordaria, for example from Sordaria macrospora; of Aspergillus, for example from Aspergillus niger or from Aspergillus sojae; or from other filamentous fungi;
[0883] a yeast cell, including but not limited to cells from species of Saccharomyces, for example of Saccharomyces cerevisiae; of Schizosaccharomyces, for example of Schizosaccharomyces pombe; of Pichia, for example of Pichia pastoris or of Pichia methanolica; of Hansenula, for example of Hansenula polymorpha; of Kluyveromyces, for example of Kluyveromyces lactis; of Arxula, for example of Arxula adeninivorans; of Yarrowia, for example of Yarrowia lipolytica;
[0884] an amphibian cell or cell line, such as Xenopus oocytes;
[0885] an insect-derived cell or cell line, such as cells/cell lines derived from lepidoptera, including but not limited to Spodoptera SF9 and Sf21 cells or cells/cell lines derived from Drosophila, such as Schneider and Kc cells;
[0886] a plant or plant cell, for example in tobacco plants; and/or
[0887] a mammalian cell or cell line, for example a cell or cell line derived from a human, a cell or a cell line from mammals including but not limited to CHO-cells, BHK-cells (for example BHK-21 cells) and human cells or cell lines such as HeLa, COS (for example COS-7) and PER.C6 cells;
[0888] as well as all other hosts or host cells known per se for the expression and production of antibodies and antibody fragments (including but not limited to (single) domain antibodies and ScFv fragments), which will be clear to the skilled person. Reference is also made to the general background art cited hereinabove, as well as to for example WO 94/29457; WO 96/34103; WO 99/42077; Frenken et al. 1998 (Res. Immunol. 149: 589-99); Riechmann and Muyldermans 1999 (J. Immunol. Met. 231: 25-38); van der Linden 2000 (J. Biotechnol. 80: 261-70); Joosten et al. 2003 (Microb. Cell Fact. 2: 1); Joosten et al. 2005 (Appl. Microbiol. Biotechnol. 66: 384-92); and the further references cited herein.
[0889] For expression of the ISVs, polypeptides or constructs in a cell, they may also be expressed as so-called "intrabodies", as for example described in WO 94/02610, WO 95/22618 and U.S. Pat. No. 7,004,940; WO 03/014960; in Cattaneo and Biocca 1997 (Intracellular Antibodies: Development and Applications. Landes and Springer-Verlag); and in Kontermann 2004 (Methods 34: 163-170).
[0890] According to one preferred, but non-limiting embodiment of the invention, the ISV, polypeptide or protein construct of the invention is produced in a bacterial cell, in particular a bacterial cell suitable for large scale pharmaceutical production, such as cells of the strains mentioned above.
[0891] According to another preferred, but non-limiting embodiment of the invention, the ISV, polypeptide or protein construct of the invention is produced in a yeast cell, in particular a yeast cell suitable for large scale pharmaceutical production, such as cells of the species mentioned above.
[0892] According to yet another preferred, but non-limiting embodiment of the invention, the ISV, polypeptide or construct of the invention is produced in a mammalian cell, in particular in a human cell or in a cell of a human cell line, and more in particular in a human cell or in a cell of a human cell line that is suitable for large scale pharmaceutical production, such as the cell lines mentioned hereinabove.
[0893] Suitable techniques for transforming a host or host cell of the invention will be clear to the skilled person and may depend on the intended host cell/host organism and the genetic construct to be used. Reference is again made to the handbooks and patent applications mentioned above.
[0894] After transformation, a step for detecting and selecting those host cells or host organisms that have been successfully transformed with the nucleotide sequence/genetic construct of the invention may be performed. This may for instance be a selection step based on a selectable marker present in the genetic construct of the invention or a step involving the detection of the polypeptide of the invention, e.g. using specific antibodies.
[0895] The transformed host cell (which may be in the form or a stable cell line) or host organisms (which may be in the form of a stable mutant line or strain) form further aspects of the present invention.
[0896] Preferably, these host cells or host organisms are such that they express, or are (at least) capable of expressing (e.g. under suitable conditions), an ISV, polypeptide or protein construct of the invention (and in case of a host organism: in at least one cell, part, tissue or organ thereof). The invention also includes further generations, progeny and/or offspring of the host cell or host organism of the invention, for instance obtained by cell division or by sexual or asexual reproduction.
[0897] Accordingly, in another aspect, the invention relates to a host or host cell that expresses (or that under suitable circumstances is capable of expressing) an ISV, polypeptide or protein construct of the invention; and/or that contains a nucleic acid encoding the same. Some preferred but non-limiting examples of such hosts or host cells can be as generally described in WO 04/041867, WO 04/041865 or WO 09/068627. For example, ISVs, polypeptides and protein constructs of the invention may with advantage be expressed, produced or manufactured in a yeast strain, such as a strain of Pichia pastoris. Reference is also made to WO 04/25591, WO 10/125187, WO 11/003622, and WO 12/056000 which also describes the expression/production in Pichia and other hosts/host cells of immunoglobulin single variable domains and polypeptides comprising the same.
[0898] To produce/obtain expression of the ISVs, polypeptides or protein constructs of the invention, the transformed host cell or transformed host organism may generally be kept, maintained and/or cultured under conditions such that the (desired) ISV, polypeptide or protein construct of the invention is expressed/produced. Suitable conditions will be clear to the skilled person and will usually depend upon the host cell/host organism used, as well as on the regulatory elements that control the expression of the (relevant) nucleotide sequence of the invention. Again, reference is made to the handbooks and patent applications mentioned above in the paragraphs on the genetic constructs of the invention.
[0899] Generally, suitable conditions may include the use of a suitable medium, the presence of a suitable source of food and/or suitable nutrients, the use of a suitable temperature, and optionally the presence of a suitable inducing factor or compound (e.g. when the nucleotide sequences of the invention are under the control of an inducible promoter); all of which may be selected by the skilled person. Again, under such conditions, the ISVs, polypeptides or protein constructs of the invention may be expressed in a constitutive manner, in a transient manner, or only when suitably induced.
[0900] It will also be clear to the skilled person that the ISV, polypeptide or protein construct of the invention may (first) be generated in an immature form (as mentioned above), which may then be subjected to post-translational modification, depending on the host cell/host organism used. Also, the ISV, polypeptide or protein construct of the invention may be glycosylated, again depending on the host cell/host organism used.
[0901] The ISV, polypeptide or protein construct of the invention may then be isolated from the host cell/host organism and/or from the medium in which said host cell or host organism was cultivated, using protein isolation and/or purification techniques known per se, such as (preparative) chromatography and/or electrophoresis techniques, differential precipitation techniques, affinity techniques (e.g. using a specific, cleavable amino acid sequence fused with the polypeptide or construct of the invention) and/or preparative immunological techniques (i.e. using antibodies against the amino acid sequence to be isolated).
[0902] The constructs of the invention can generally be prepared by a method which comprises at least the step of suitably linking ISVs or polypeptides of the invention to the one or more further groups, residues, moieties or binding units, optionally via the one or more suitable linkers, so as to provide the constructs of the invention. The ISVs, polypeptides and constructs of the invention can then further be modified, and in particular by chemical and/or biological (e.g. enzymatical) modification, of one or more of the amino acid residues that form the polypeptides or constructs of the invention, to obtain derivatives of the polypeptides or constructs of the invention.
[0903] The invention also relates to a pharmaceutical composition comprising the ISV, polypeptide, compound or construct of the invention.
[0904] In the above methods, the amino acid sequences, ISVs, Nanobodies, polypeptides, compounds or constructs of the invention and/or the compositions comprising the same can be administered in any suitable manner, depending on the specific pharmaceutical formulation or composition to be used. Thus, the amino acid sequences, ISVs, Nanobodies, polypeptides, compounds or constructs of the invention and/or the compositions comprising the same can for example be administered orally, intraperitoneally (e.g. intravenously, subcutaneously, intramuscularly, or via any other route of administration that circumvents the gastrointestinal tract), intranasally, transdermally, topically, by means of a suppository, by inhalation, again depending on the specific pharmaceutical formulation or composition to be used. The clinician will be able to select a suitable route of administration and a suitable pharmaceutical formulation or composition to be used in such administration, depending on the disease or disorder to be prevented or treated and other factors well known to the clinician.
[0905] As used herein, the term "therapeutic agent" refers to any agent that can be used in the treatment and/or management of a hyperproliferative cell disorder, e.g., cancer, or one or more symptoms thereof. In certain embodiments, the term "therapeutic agent" refers to a multispecific polypeptide of the invention. Preferably, a therapeutic agent is an agent which is known to be useful for, or has been or is currently being used for the treatment, prevention and/or management of a hyperproliferative cell disorder, e.g., cancer, or one or more symptoms thereof.
[0906] As used herein, a "therapeutically effective amount" in the context of cancer refers to the amount of a therapy alone, or in combination with other therapies, that provides a therapeutic benefit in the treatment and/or management of cancers. In one aspect, a therapeutically effective amount refers to the amount of a therapy sufficient to destroy, modify, control or remove primary, regional or metastatic cancer tissue. In another aspect, a therapeutically effective amount refers to the amount of a therapy sufficient to reduce the symptoms of a cancer. In another aspect, a therapeutically effective amount refers to the amount of a therapy sufficient to delay or minimize the spread of cancer. In a specific embodiment, a therapeutically effective amount of a therapy is an amount of a therapy sufficient to inhibit growth or proliferation of cancer cells, kill existing cancer cells (e.g., cause regression of the cancer), and/or prevent the spread of cancer cells to other tissues or areas (e.g., prevent metastasis). In another specific embodiment, a therapeutically effective amount of a therapy is the amount of a therapy sufficient to inhibit the growth of a tumor by at least 5%, preferably at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100% as measured by a standard method known in the art. Used in connection with an amount of a multispecific polypeptide of the invention, the term can encompass an amount that improves overall therapy, reduces or avoids unwanted effects, or enhances the therapeutic efficacy of or synergies with another therapy. In one embodiment, a therapeutically effective amount of a therapy reduces or avoids unwanted effects, or enhances the therapeutic efficacy of or synergies with another therapy by at least 5%, preferably at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100% relative to a control (e.g., a negative control such as phosphate buffered saline) in an assay known in the art or described herein.
[0907] As used herein, a "therapeutically effective amount" in the context of a non-cancer hyperproliferative cell disorder refers to the amount of a therapy alone, or in combination with other therapies, that provides a therapeutic benefit in the treatment and/or management of said disorder. In one aspect, a therapeutically effective amount refers to the amount of a therapy sufficient to destroy, modify, control or remove cells affected by a non-cancer hyperproliferative cell disorder. In another aspect, a therapeutically effective amount refers to the amount of a therapy sufficient to reduce the symptoms of a non-cancer hyperproliferative cell disorder. In another aspect, a therapeutically effective amount refers to the amount of a therapy sufficient to delay or minimize the spread of the non-cancer hyperproliferative cell disorder. In a specific embodiment, a therapeutically effective amount of a therapy is an amount of a therapy sufficient to inhibit growth or proliferation of the non-cancer hyperproliferative cell disorder, kill existing non-cancer hyperproliferative cells (e.g., cause regression of the disorder). In another specific embodiment, a therapeutically effective amount of a therapy is the amount of a therapy sufficient to inhibit the growth of the non-cancer hyperproliferative cells by at least 5%, preferably at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100% as measured by a standard method known in the art. Used in connection with an amount of a multispecific polypeptide of the invention, the term can encompass an amount that improves overall therapy, reduces or avoids unwanted effects, or enhances the therapeutic efficacy of or synergies with another therapy. In one embodiment, a therapeutically effective amount of a therapy reduces or avoids unwanted effects, or enhances the therapeutic efficacy of or synergies with another therapy by at least 5%, preferably at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100% relative to a control (e.g., a negative control such as phosphate buffered saline) in an assay known in the art.
[0908] As used herein, the term "therapy" refers to any protocol, method and/or agent that can be used in the treatment, prevention and/or management of a hyperproliferative cell disorder, e.g., cancer. In certain embodiments, the terms "therapies" and "therapy" refer to a biological therapy, supportive therapy, and/or other therapies useful in the treatment, prevention and/or management of a hyperproliferative cell disorder, e.g., cancer, or one or more symptoms thereof known to one of skill in the art such as medical personnel.
[0909] As used herein, the terms "treat", "treatment" and "treating" in the context of administering (a) therapy(ies) to a subject refer to the reduction or amelioration of the progression, severity, and/or duration of a disorder associated with a hyperproliferative cell disorder, e.g., cancer, and/or the amelioration of one or more symptoms thereof resulting from the administration of one or more therapies (including, but not limited to, the administration of one or more prophylactic or therapeutic agents). In specific embodiments, the terms "treat", "treatment" and "treating" in the context of administering (a) therapy(ies) to a subject refer to the reduction or amelioration of the progression, severity, and/or duration of a hyperproliferative cell disorder, e.g., cancer, refers to a reduction in cancer cells by at least 5%, preferably at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100% relative to a control (e.g., a negative control such as phosphate buffered saline). In other embodiments, the terms "treat", "treatment" and "treating" in the context of administering (a) therapy(ies) to a subject refer to the reduction or amelioration of the progression, severity, and/or duration of a hyperproliferative cell disorder, e.g., cancer, refers to no change in cancer cell number, a reduction in hospitalization time, a reduction in mortality, or an increase in survival time of the subject with cancer.
[0910] The amino acid sequences, ISVs, Nanobodies, polypeptides, compounds and/or constructs of the invention and/or the compositions comprising the same are administered according to a regime of treatment that is suitable for preventing and/or treating the hyperproliferative cell disorder, e.g., cancer, to be prevented or treated. The clinician will generally be able to determine a suitable treatment regimen, depending on factors such as the stage of the hyperproliferative cell disorder, e.g., cancer, to be treated, the severity of the hyperproliferative cell disorder, e.g., cancer, to be treated and/or the severity of the symptoms thereof, the specific amino acid sequence, ISV, Nanobody, polypeptide, compound and/or construct of the invention to be used, the specific route of administration and pharmaceutical formulation or composition to be used, the age, gender, weight, diet, general condition of the patient, and similar factors well known to the clinician.
[0911] Generally, the treatment regimen will comprise the administration of one or more amino acid sequences, ISVs, Nanobodies, polypeptides, compounds and/or constructs of the invention, or of one or more compositions comprising the same, in one or more pharmaceutically effective amounts or doses. The specific amount(s) or doses to be administered can be determined by the clinician, again based on the factors cited above.
[0912] Generally, for the prevention and/or treatment of a hyperproliferative cell disorder, e.g., cancer, mentioned herein and depending on the type of hyperproliferative cell disorder, e.g., cancer, and stage of the disease to be treated, the potency of the specific amino acid sequence, ISV, Nanobody, polypeptide, compound or construct of the invention to be used, the specific route of administration and the specific pharmaceutical formulation or composition used, the amino acid sequences, ISVs, Nanobodies, polypeptides, compounds or constructs of the invention will generally be administered in an amount between 1 gram and 0.01 milligram per kg body weight per day, preferably between 0.1 gram and 0.01 milligram per kg body weight per day, such as about 0.1, 1, 10, 100 or 1000 milligram per kg body weight per day, e.g. from 0.1 mg per kg to 25 mg per kg of the subject's body weight; either continuously (e.g. by infusion), as a single daily dose or as multiple divided doses during the day. The clinician will generally be able to determine a suitable daily dose, depending on the factors mentioned herein. It will also be clear that in specific cases, the clinician may choose to deviate from these amounts, for example on the basis of the factors cited above and his expert judgment. Generally, some guidance on the amounts to be administered can be obtained from the amounts usually administered for comparable conventional antibodies or antibody fragments against the same target administered via essentially the same route, taking into account however differences in affinity/avidity, efficacy, biodistribution, half-life and similar factors well known to the skilled person.
[0913] Usually, in the above method, a single amino acid sequence, ISV, Nanobody, polypeptide, compound or construct of the invention will be used. It is however within the scope of the invention to use two or more amino acid sequences, ISVs, Nanobodies, polypeptides compounds and/or constructs of the invention in combination.
[0914] The ISVs, Nanobodies, amino acid sequences, polypeptides, compounds and/or constructs of the invention may also be used in combination with one or more further pharmaceutically active compounds or principles, i.e. as a combined treatment regimen, which may or may not lead to a synergistic effect. Again, the clinician will be able to select such further compounds or principles, as well as a suitable combined treatment regimen, based on the factors cited above and his expert judgement.
[0915] In particular, the amino acid sequences, ISVs, Nanobodies, polypeptides, compounds and/or constructs of the invention may be used in combination with other pharmaceutically active compounds or principles that are or can be used for the prevention and/or treatment of the hyperproliferative cell disorder, e.g., cancer, disease and/or disorder cited herein, as a result of which a synergistic effect may or may not be obtained. Examples of such compounds and principles, as well as routes, methods and pharmaceutical formulations or compositions for administering them will be clear to the clinician.
[0916] When two or more substances or principles are to be used as part of a combined treatment regimen, they can be administered via the same route of administration or via different routes of administration, at essentially the same time or at different times (e.g. essentially simultaneously, consecutively, or according to an alternating regime). When the substances or principles are to be administered simultaneously via the same route of administration, they may be administered as different pharmaceutical formulations or compositions or part of a combined pharmaceutical formulation or composition, as will be clear to the skilled person.
[0917] In one aspect, the disclosure provides methods for the administration of immunoglobulin single variable domains and polypeptide constructs thereof comprising one or more immunoglobulin single variable domains, polypeptides, compounds and/or constructs. In some embodiments, the immunoglobulin single variable domain, polypeptide, compound and/or construct is administered as a pharmaceutical composition. The pharmaceutical composition, in addition to the immunoglobulin single variable domains and polypeptide constructs thereof includes a pharmaceutically-acceptable carrier.
[0918] As described in detail, the pharmaceutical compositions of the disclosure may be specially formulated for administration in solid or liquid form, including those adapted for the following: oral administration, for example, drenches (aqueous or non-aqueous solutions or suspensions), tablets, e.g., those targeted for buccal, sublingual, and systemic absorption, boluses, powders, granules, pastes for application to the tongue; parenteral administration, for example, by subcutaneous, intramuscular, intravenous or epidural injection as, for example, a sterile solution or suspension, or sustained-release formulation; topical application, for example, as a cream, ointment, or a controlled-release patch or spray applied to the skin, lungs, or oral cavity; intravaginally or intrarectally, for example, as a pessary, cream or foam; sublingually; ocularly; transdermally; or nasally, pulmonary and to other mucosal surfaces.
[0919] The phrase "pharmaceutically acceptable" is employed herein to refer to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
[0920] The phrase "pharmaceutically-acceptable carrier" as used herein means a pharmaceutically-acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, or solvent encapsulating material, involved in carrying or transporting the subject compound from one organ, or portion of the body, to another organ, or portion of the body. Each carrier must be "acceptable" in the sense of being compatible with the other ingredients of the formulation and not injurious to the patient. Some examples of materials which can serve as pharmaceutically-acceptable carriers include: sugars, such as lactose, glucose and sucrose; starches, such as corn starch and potato starch; cellulose, and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; powdered tragacanth; malt; gelatin; talc; excipients, such as cocoa butter and suppository waxes; oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; glycols, such as propylene glycol; polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol; esters, such as ethyl oleate and ethyl laurate; agar; buffering agents, such as magnesium hydroxide and aluminum hydroxide; alginic acid; pyrogen-free water; isotonic saline; Ringer's solution; ethyl alcohol; pH buffered solutions; polyesters, polycarbonates and/or polyanhydrides; and other non-toxic compatible substances employed in pharmaceutical formulations.
[0921] Formulations of the disclosure include those suitable for oral, nasal, topical (including buccal and sublingual), rectal, vaginal and/or parenteral administration. The formulations may conveniently be presented in unit dosage form and may be prepared by any methods well known in the art of pharmacy. The amount of active ingredient (e.g., immunoglobulin single variable domain or polypeptide constructs thereof) which can be combined with a carrier material to produce a single dosage form will vary depending upon the host being treated, and the particular mode of administration. The amount of active ingredient that can be combined with a carrier material to produce a single dosage form will generally be that amount of the compound which produces a therapeutic effect. Generally, this amount will range from about 1% to about 99% of active ingredient, preferably from about 5% to about 70%, most preferably from about 10% to about 30%.
[0922] In certain embodiments, a formulation comprises an excipient selected from the group consisting of cyclodextrins, liposomes, micelle forming agents, e.g., bile acids, and polymeric carriers, e.g., polyesters and polyanhydrides. In certain embodiments, an aforementioned formulation renders orally bioavailable an immunoglobulin single variable domain or polypeptide construct.
[0923] Methods of preparing these formulations or compositions include the step of bringing into association an immunoglobulin single variable domain or polypeptide construct with the carrier and, optionally, one or more accessory ingredients. In general, the formulations are prepared by uniformly and intimately bringing into association an immunoglobulin single variable domain or polypeptide construct with liquid carriers, or finely divided solid carriers, or both, and then, if necessary, shaping the product.
[0924] Formulations suitable for oral administration may be in the form of capsules, cachets, pills, tablets, lozenges (using a flavored basis, usually sucrose and acacia or tragacanth), powders, granules, or as a solution or a suspension in an aqueous or non-aqueous liquid, or as an oil-in-water or water-in-oil liquid emulsion, or as an elixir or syrup, or as pastilles (using an inert base, such as gelatin and glycerin, or sucrose and acacia) and/or as mouth washes and the like, each containing a predetermined amount of an immunoglobulin single variable domain or polypeptide construct as an active ingredient. An immunoglobulin single variable domain or polypeptide construct invention may also be administered as a bolus, electuary or paste.
[0925] In solid dosage forms for oral administration (capsules, tablets, pills, dragees, powders, granules and the like), the active ingredient is mixed with one or more pharmaceutically-acceptable carriers, such as sodium citrate or dicalcium phosphate, and/or any of the following: fillers or extenders, such as starches, lactose, sucrose, glucose, mannitol, and/or silicic acid; binders, such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinyl pyrrolidone, sucrose and/or acacia; humectants, such as glycerol; disintegrating agents, such as agar-agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate; solution retarding agents, such as paraffin; absorption accelerators, such as quaternary ammonium compounds; wetting agents, such as, for example, cetyl alcohol, glycerol monostearate, and non-ionic surfactants; absorbents, such as kaolin and bentonite clay; lubricants, such as talc, calcium stearate, magnesium stearate, solid polyethylene glycols, sodium lauryl sulfate, and mixtures thereof; and coloring agents. In the case of capsules, tablets and pills, the pharmaceutical compositions may also comprise buffering agents. Solid compositions of a similar type may also be employed as fillers in soft and hard-shelled gelatin capsules using such excipients as lactose or milk sugars, as well as high molecular weight polyethylene glycols and the like.
[0926] A tablet may be made by compression or molding, optionally with one or more accessory ingredients. Compressed tablets may be prepared using binder (for example, gelatin or hydroxy-propylmethyl cellulose), lubricant, inert diluent, preservative, disintegrant (for example, sodium starch glycolate or cross-linked sodium carboxymethyl cellulose), surface-active or dispersing agent. Molded tablets may be made in a suitable machine in which a mixture of the powdered compound is moistened with an inert liquid diluent.
[0927] The tablets, and other solid dosage forms of the pharmaceutical compositions, such as dragees, capsules, pills and granules, may optionally be scored or prepared with coatings and shells, such as enteric coatings and other coatings well known in the pharmaceutical-formulating art. They may also be formulated so as to provide slow or controlled release of the active ingredient therein using, for example, hydroxypropylmethyl cellulose in varying proportions to provide the desired release profile, other polymer matrices, liposomes and/or microspheres. They may be formulated for rapid release, e.g., freeze-dried. They may be sterilized by, for example, filtration through a bacteria-retaining filter, or by incorporating sterilizing agents in the form of sterile solid compositions that can be dissolved in sterile water, or some other sterile injectable medium immediately before use. These compositions may also optionally contain opacifying agents and may be of a composition that they release the active ingredient(s) only, or preferentially, in a certain portion of the gastrointestinal tract, optionally, in a delayed manner. Examples of embedding compositions that can be used include polymeric substances and waxes. The active ingredient can also be in micro-encapsulated form, if appropriate, with one or more of the above-described excipients.
[0928] Liquid dosage forms for oral administration include pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups and elixirs. In addition to the active ingredient, the liquid dosage forms may contain inert diluents commonly used in the art, such as, for example, water or other solvents, solubilizing agents and emulsifiers, such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, oils (in particular, cottonseed, groundnut, corn, germ, olive, castor and sesame oils), glycerol, tetrahydrofuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof.
[0929] Besides inert diluents, the oral compositions can also include adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, coloring, perfuming and preservative agents.
[0930] Suspensions, in addition to the active compounds, may contain suspending agents as, for example, ethoxylated isostearyl alcohols, polyoxyethylene sorbitol and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar and tragacanth, and mixtures thereof.
[0931] Formulations of the pharmaceutical compositions for rectal or vaginal administration may be presented as a suppository, which may be prepared by mixing an immunoglobulin single variable domain or polypeptide construct with one or more suitable nonirritating excipients or carriers comprising, for example, cocoa butter, polyethylene glycol, a suppository wax or a salicylate, and which is solid at room temperature, but liquid at body temperature and, therefore, will melt in the rectum or vaginal cavity and release the active compound.
[0932] Formulations suitable for vaginal administration also include pessaries, tampons, creams, gels, pastes, foams or spray formulations containing such carriers as are known in the art to be appropriate.
[0933] Dosage forms for the topical or transdermal administration of an immunoglobulin single variable domain or polypeptide construct include powders, sprays, ointments, pastes, creams, lotions, gels, solutions, patches and inhalants. The active compound may be mixed under sterile conditions with a pharmaceutically-acceptable carrier, and with any preservatives, buffers, or propellants which may be required.
[0934] The ointments, pastes, creams and gels may contain, excipients, such as animal and vegetable fats, oils, waxes, paraffins, starch, tragacanth, cellulose derivatives, polyethylene glycols, silicones, bentonites, silicic acid, talc and zinc oxide, or mixtures thereof.
[0935] Powders and sprays can contain excipients such as lactose, talc, silicic acid, aluminum hydroxide, calcium silicates and polyamide powder, or mixtures of these substances. Sprays can additionally contain customary propellants, such as chlorofluorohydrocarbons and volatile unsubstituted hydrocarbons, such as butane and propane.
[0936] Transdermal patches have the added advantage of providing controlled delivery of an immunoglobulin single variable domain or polypeptide construct to the body. Dissolving or dispersing the compound in the proper medium can make such dosage forms. Absorption enhancers can also be used to increase the flux of the compound across the skin. Either providing a rate controlling membrane or dispersing the compound in a polymer matrix or gel can control the rate of such flux.
[0937] Ophthalmic formulations, eye ointments, powders, solutions and the like, are also contemplated as being within the scope of this disclosure.
[0938] Pharmaceutical compositions suitable for parenteral administration comprise one or more an immunoglobulin single variable domains or polypeptide constructs in combination with one or more pharmaceutically-acceptable sterile isotonic aqueous or non-aqueous solutions, dispersions, suspensions or emulsions, or sterile powders which may be reconstituted into sterile injectable solutions or dispersions just prior to use, which may contain sugars, alcohols, antioxidants, buffers, bacteriostats, solutes which render the formulation isotonic with the blood of the intended recipient or suspending or thickening agents.
[0939] Examples of suitable aqueous and non-aqueous carriers, which may be employed in the pharmaceutical compositions include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate. Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
[0940] These compositions may also contain adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of the action of microorganisms upon the subject compounds may be ensured by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents which delay absorption such as aluminum monostearate and gelatin.
[0941] In some cases, in order to prolong the effect of a drug, it is desirable to slow the absorption of the drug from subcutaneous or intramuscular injection. This may be accomplished by the use of a liquid suspension of crystalline or amorphous material having poor water solubility. The rate of absorption of the drug then depends upon its rate of dissolution, which in turn, may depend upon crystal size and crystalline form. Alternatively, delayed absorption of a parenterally-administered drug form is accomplished by dissolving or suspending the drug in an oil vehicle.
[0942] Injectable depot forms are made by forming microencapsule matrices of the subject compounds in biodegradable polymers such as polylactide-polyglycolide. Depending on the ratio of drug to polymer, and the nature of the particular polymer employed, the rate of drug release can be controlled. Examples of other biodegradable polymers include poly(orthoesters) and poly-(anhydrides). Depot injectable formulations are also prepared by entrapping the drug in liposomes or microemulsions, which are compatible with body tissue.
[0943] In another aspect, kits are provided comprising a binding molecule of the invention, a nucleic acid molecule of the invention, a vector of the invention, or a host cell of the invention. The kit may comprise one or more vials containing the binding molecule and instructions for use. The kit may also contain means for administering the binding molecule of the present invention such as a syringe, pump, infuser or the like.
[0944] The embodiments illustrated and discussed in this specification are intended only to teach those skilled in the art the best way known to the inventors to make and use the invention. Modifications and variation of the above-described embodiments of the invention are possible without departing from the invention, as appreciated by those skilled in the art in light of the above teachings. It is therefore understood that, within the scope of the claims and their equivalents, the invention may be practiced otherwise than as specifically described.
[0945] The invention will now be further described by means of the following non-limiting preferred aspects, examples and figures.
[0946] The entire contents of all of the references (including literature references, issued patents, published patent applications, and co-pending patent applications) cited throughout this application are hereby expressly incorporated by reference, in particular for the teaching that is referenced hereinabove.
EXAMPLES
Example 1: Material and Methods
[0947] 1.1 TCR .alpha..alpha./CD3 Transfected Cell Lines
[0948] Transient and stable CHO-K1 (ATCC: CCL-61), HEK293H (Life technologies 11631-017), Llana (Fibroblast cells from llama Navel cord cells) cell lines with recombinant overexpression of all 6 chains of the full human T cell Receptor complex were generated. For this, the coding sequences of the TCR alpha (a) and TCR beta (P) chain were cloned in a pcDNA3.1-derived vector, downstream of a CMV promotor and a 2A-like viral peptide sequence was inserted between both chains to induce ribosomal skipping during translation of the polyprotein. In the same vector, the coding sequences of the epsilon, delta, gamma and zeta chains of the CD3 complex were cloned downstream of an additional CMV promotor, also using 2A-like viral peptide sequences between the respective chains. In addition, a stable HEK293H clone with recombinant overexpression of the 4 chains of the human CD3 was generated as described above using a single gene vector.
[0949] The used sequences for the human CD3 and the human TCR.alpha./.beta. constant domains were derived from UniProtKB (CD3 delta: P04234, CD3 gamma: P09693, CD3 epsilon: P07766, CD3 zeta: P20963, TCR .alpha.: P01848 and TCR .beta.: P01850; SEQ ID NOs: 344 to 349, respectively). The sequences for the human TCR.alpha./.beta. variable domains were derived from crystal structure sequences (PDB codes: 2IAN, 2XN9 and 3TOE) (human TCR .alpha. variable domains derived from 2IAN, 2XN9 and 3TOE with SEQ ID NOs: 393 to 395, respectively; human TCR 1 variable domains derived from 2IAN, 2XN9 and 3TOE with SEQ ID NOs: 476 to 478, respectively).
[0950] The cell surface expression of the human T cell receptor complex was confirmed by flow cytometry using a functional mouse IgG2b anti-human TCR.alpha./.beta. antibody, clone BW242/412 (Miltenyi 130-098-219) and a functional mouse IgG2a anti-CD3 PE labelled antibody, clone OKT-3 (eBioscience 12-0037) (FIG. 1).
[0951] 1.2 Soluble Recombinant TCR .alpha./.beta. Proteins
[0952] Soluble human and cynomolgus/rhesus monkey TCR .alpha./.beta. proteins were generated in house. The sequences for the extracellular part of the human TCR.alpha./.beta. constant domain were derived from UniProtKB (TCR .alpha.: P01848 and TCR 1: P01850; SEQ ID NOs: 479 and 480, respectively). The human TCR .alpha./.beta. variable domains were derived from crystal structure sequence (PDB code: 2XN9, SEQ ID NOs: 394 and 477, respectively for .alpha. and .beta. chain).
[0953] The sequences for the extracellular part of the cynomolgus/rhesus monkey TCR .alpha./.beta. constant domains were derived from GenBank files EHH63463 and AEA41868 respectively (SEQ ID NOs: 396 and 397). The sequences for the cynomolgus/rhesus monkey TCR .alpha./.beta. variable domains were derived from AEA41865 and AEA41866 (SEQ ID NOs: 398 and 399, respectively for .alpha. and .beta. chain).
[0954] The extracellular domains of human TCR .alpha./.beta. (2XN9) or cynomolgus/rhesus monkey TCR .alpha./.beta. were fused to a zipper protein coding sequence (O'Shea et al. 1993 Curr. Biol. 3(10): 658-667), produced by CHOK1SV cells (Lonza) using Lonza's GS Gene Expression System.TM. and subsequently purified.
[0955] Quality of the TCR .alpha./.beta. zipper proteins was assessed in an ELISA binding assay. Maxisorp 96-well ELISA plates (Nunc) were coated with 2 .mu.g/mL soluble recombinant human TCR .alpha./.beta. (2XN9)-zipper protein or soluble recombinant cynomolgus TCR .alpha./.beta.-zipper protein. After an overnight incubation, plates were washed and blocked with PBS+1% casein for 1 h at room temperature. Next, plates were incubated with serial dilutions of either a functional flag tagged Nanobody or the functional mouse IgG anti-non-human primate/Rat TCR.alpha./.beta. antibody, clone R73 (eBioscience 16-5960) for 1 h at room temperature while shaking, washed again and incubated with mouse anti-flag-HRP (Sigma, #A8592) respectively rabbit anti-mouse-HRP (Dako, #P0260). After 1 h, TMB One Solution (Promega #G7431) was added. The reaction was stopped with 2M H.sub.2SO.sub.4 and the dose dependent binding was determined by measuring the OD at 450 nm using the Tecan sunrise 4 (FIG. 2).
Example 2: Immunization of Llamas with TCR/CD3, Cloning of the Heavy Chain-Only Antibody Fragment Repertoires and Preparation of Phages
[0956] 2.1 Immunization
[0957] It was set out to generate heavy chain only antibodies in camelidae (e.g. llama and alpaca) against T cell receptor (TCR) .alpha. and/or .beta. constant chains. Although the native T cell receptor complex consists of both CD3 (gamma, delta, epsilon and zeta) chains, as well as TCR .alpha.- and .beta.-chains, it was hypothesized that the absence of CD3 chains would facilitate access to the constant domains of the TCR. Especially since the CD3 chains laterally surround, and limit access to the constant domains of the TCR .alpha.- and .beta.-chains. Contrary to our experience with other targets, the obtaining of an immune response against TCR .alpha.- or .beta.-chains was not as straight forward as expected.
[0958] In a final approach, after approval of the Ethical Committee (CRIA, LA1400575, Belgium--EC2012#1), the inventors attempted a complex immunization protocol with DNA encoding for T cell complex. In short, 3 additional llamas were immunized with a pVAX1-human TCR(2IAN)/CD3 (described in Example 1.2) plasmid vector (Invitrogen, Carlsbad, Calif., USA) and with a pVAX1-human TCR(2XN9)/CD3 (described in Example 1.2) plasmid vector (Invitrogen, Carlsbad, Calif., USA) according to standard protocols. Two llamas received additionally 1 subcutaneous injection of primary human T cells. Human T cells were collected from Buffy Coat blood, from healthy volunteers (Blood bank Gent) using RosetteSep (StemCell Technologies, #15061) followed by enriching on Ficoll-Paque.TM. PLUS (GE Healthcare #17-1440-03) according to manufactures instructions and stored in liquid nitrogen. After thawing, cells were washed, and re-suspended in D-PBS from Gibco and kept on ice prior to injection.
[0959] 2.2 Cloning of the Heavy Chain-Only Antibody Fragment Repertoires and Preparation of Phages
[0960] Per animal, blood samples were collected after the injection of one type of immunization antigen. From these blood samples, PBMC were prepared using Ficoll-Hypaque according to the manufacturer's instructions (Amersham Biosciences, Piscataway, N.J., USA). For each immunized llama, libraries were constructed by pooling the total RNA isolated from samples originating from a certain subset of the immunization schedule, i.e. after one type of immunization antigen.
[0961] In short, the PCR-amplified VHH repertoire was cloned via specific restriction sites into a vector designed to facilitate phage display of the VHH library. The vector was derived from pUC119. In frame with the VHH coding sequence, the vector encodes a C-terminal 3.times.FLAG and His6 tag. Phages were prepared according to standard protocols (see for example WO 04/041865, WO 04/041863, WO 04/062551, WO 05/044858 and other prior art and applications filed by Ablynx N.V. cited herein).
Example 3: Selection of TCR/CD3 Specific VHHs Via Phage Display
[0962] The vast majority of selected VHHs were directed against the variable regions of either the TCR .alpha. or TCR .beta. chain. Therefore different selection and counter-selection strategies had to be devised by the inventors.
[0963] In short, VHH repertoires obtained from all llamas and cloned as phage library were used in different selection strategies, applying a multiplicity of selection conditions. Selections using human TCR/CD3 transfected cell lines with the same variable domain as used during immunization resulted in only variable domain binders. Therefore, tools containing a different variable TCR.alpha./.beta. domain (transfected cells (described in Example 1.1), soluble protein (described in Example 1.2), or human primary T cells (isolated as described in Example 2.1)) were used during selections and proved to be crucial in identification of constant domain binders. Additional variables during selections included the antigen presentation method (in solution when using cells or coated onto plates when proteins), the antigen concentration, the orthologue used (human or cynomolgus recombinant TCR .alpha./P protein), and the number of selection rounds. All solid coated phase selections were done in Maxisorp 96-well plates (Nunc, Wiesbaden, Germany).
[0964] Selections were performed as follows: TCR.alpha./.beta.-CD3 antigen preparations for solid and solution phase selection formats were presented as described above at multiple concentrations. After 2 h incubation with the phage libraries, followed by extensive washing, bound phages were eluted with trypsin (1 mg/mL) for 15 minutes. The trypsin protease activity was immediately neutralized by applying 0.8 mM protease inhibitor ABSF. As control, selections without antigen were performed in parallel.
[0965] Phage outputs were used to infect E. coli for analysis of individual VHH clones. Periplasmic extracts were prepared according to standard protocols (see for example WO 03/035694, WO 04/041865, WO 04/041863, WO 04/062551 and other prior art and applications filed by Ablynx N.V. cited herein).
Example 4: Screening, Sequence Analysis and Purification
[0966] 4.1 Screening for TCR/CD3 Binding Nanobodies in a Flow Cytometry Assay
[0967] Periplasmic extracts were screened for cell expressed TCR/CD3 binding using human TCR/CD3 transfected CHO-K1 or HEK293H cells and the respective CHO-K1 or HEK293H reference cell line in a mixed cell line setup. To this end, a large batch of the reference cell lines were labelled with 8 .mu.M PKH26 and frozen. 5.times.10.sup.4 PKH labelled reference cells were mixed with 5.times.10.sup.4 target cells and incubated with periplasmic extracts for 30 min at 4.degree. C., and washed 3 times. Next, cells were incubated with 1 .mu.g/ml monoclonal ANTI-FLAG.RTM. M2 antibody (Sigma-Aldrich, cat #F1804) for 30 min at 4.degree. C., washed again, and incubated for 30 min at 4.degree. C. with goat anti-mouse APC labelled antibody (Jackson Immunoresearch 115-135-164, 1:100). Samples were washed, resuspended in FACS Buffer (D-PBS from Gibco, with 10% FBS from Sigma and 0.05% sodium azide from Merck) and then analysed via a BD FACSArray. First a P1 population which represented more than 80% of the total cell population was selected based on FSC-SSC distribution. In this gate, 20,000 cells were counted during acquisition. Based on PKH26-SSC distribution, the PKH labelled parental population and the human TCR/CD3 unlabeled target population was selected. For these 2 populations the mean APC value was calculated.
[0968] 4.2 Screening for TCR/CD3 Binding Nanobodies in a Human T Cell Activation Assay
[0969] After several attempts, it turned out that activation of purified human T cells by antibodies or Nanobodies according to standard protocols, i.e. coated onto a 96 well plate, was not sensitive enough (data not shown).
[0970] In order to assess activity, a different assay was developed, based on bead coupled T cell activation. In short, goat anti-mouse IgG dynabeads (Life technologies #11033) were coated with mouse anti-flag IgG antibodies (Sigma F1804), (15 .mu.g/1E7 beads). After an incubation period of 2 h at 4.degree. C., beads were washed and incubated with 80 .mu.l periplasmic extract for 20 min at 4.degree. C. while shaking. Non-coupled Nanobodies were washed away before adding the bead complex together with soluble mouse anti-CD28 antibody (Pelicluster CD28--Sanquin #M1650) to purified primary human T cells (isolated as described in Example 2.1). As control condition, non-stimulated human T cells were used. In brief, goat anti-mouse IgG dynabeads coupled to mouse anti-flag IgG were incubated in 80 .mu.l periplasmic extract containing irrelevant Nanobodies. After removal of the non-coupled Nanobodies during a wash step, the irrelevant Nanobody-bead complex was added to purified primary human T cells.
[0971] After an incubation of 24 h at 37.degree. and 5% CO.sub.2 the activation status of the human T cells was determined by measuring the CD69 expression level in flow cytometry using monoclonal mouse anti-human CD69PE (BD Biosciences #557050).
[0972] 4.3 Sequence Analysis of the Obtained Nanobodies
[0973] Nanobodies which scored positive in the flow cytometric binding screen and the T cell activation assay were sequenced.
[0974] The sequence analysis demonstrated that all anti-TCR ISVs comprised a very similar CDR3. In particular, the CDR3 has the amino acid sequence X.sub.1SR X.sub.2X.sub.3PYX.sub.4Y, in which X.sub.1 is F, Y, G, L or K, X.sub.2 is I or L, X.sub.3 is Y or W, and X.sub.4 is D, N or S.
[0975] The sequence analysis further resulted in the identification of 3 distinct clusters. Corresponding alignments are provided (Table A-1, Table A-2, Table A-3). Clustering was based on sequence similarities and differences in CDR2 and CDR3. Cluster A is the most prominent comprising 104 clones (SEQ ID NOs: 1-104), cluster B comprises 11 clones (SEQ ID NOs: 105-115), and cluster C is represented by only 3 clones (SEQ ID NOs: 116-118).
[0976] Sequence variability of the CDRs was determined for the different clusters. For cluster A, the amino acid sequence of the CDRs of clone 56G05 was used as a reference, against which the CDRs of all other cluster A clones were compared. The sequence variability against 56G05 is depicted in the tables below.
TABLE-US-00007 56G05 CDR1 Kabat 26 27 28 29 30 31 32 33 34 35 numbering absolute 1 2 3 4 5* 6 7 8 9 10 numbering 56G05 G D V H K I N F L G sequence variations A Y L L I S variations S V variations E variations G *in case position 5 is an L, then position 6 is also L
TABLE-US-00008 56G05 CDR2 Kabat 50 51 52 53 54 55 56 57 58 numbering absolute 1 2 3 4 5 6 7 8 9 numbering 56G05 H I S I G D Q T D sequence variations T T S D V A variations R A A E A Q variations T N variations A V variations V S
TABLE-US-00009 56G05 CDR3 Kabat 95 96 97 98 99 100 100a 101 102 numbering absolute 1 2 3 4 5 6 7 8 9 numbering 56G05 F S R I Y P Y D Y sequence variations Y L W N variations G S variations L
[0977] For cluster B, the amino acid sequence of the CDRs of clone 55C07 was used as a reference, against which the CDRs of all other cluster B clones were compared. The sequence variability against 55C07 is depicted in the tables below.
TABLE-US-00010 55C07 CDR1 Kabat 26 27 28 29 30 31 32 33 34 35 numbering absolute 1 2 3 4 5 6 7 8 9 10 numbering 55C07 G E T F K I N I W G sequence variations Q V
TABLE-US-00011 55C07 CDR2 Kabat 50 51 52 53 54 55 56 57 58 numbering absolute 1 2 3 4 5 6 7 8 9 numbering 55C07 S L T I G G A T N sequence variations D
TABLE-US-00012 55C07 CDR3 Kabat 95 96 97 98 99 100 100a 101 102 numbering absolute 1 2 3 4 5 6 7 8 9 numbering 55C07 K S R L Y P Y D Y sequence variations I
[0978] For cluster C, the amino acid sequence of the CDRs of clone 61G01 was used as a reference, against which the CDRs of all other cluster C clones were compared. The sequence variability against 61G01 is depicted in the tables below.
TABLE-US-00013 61G01 CDR1 Kabat 26 27 28 29 30 31 32 33 34 35 numbering absolute 1 2 3 4 5 6 7 8 9 10 numbering 61G01 G E I G R I N F Y R sequence variations
TABLE-US-00014 61G01 CDR2 Kabat 50 51 52 53 54 55 56 57 58 numbering absolute 1 2 3 4 5 6 7 8 9 numbering 61G01 T I T I A D K T D sequence variations I
TABLE-US-00015 61G01 CDR3 Kabat 95 96 97 98 99 100 100a 101 102 numbering absolute 1 2 3 4 5 6 7 8 9 numbering 61G01 G S R L Y P Y D Y sequence variations
[0979] The clustering based on the sequence transmuted into functional differences (see infra).
[0980] 4.4 Purification of Monovalent Nanobodies
[0981] Representative Nanobodies for each cluster were selected and expressed in E. coli TG1 as triple Flag, His6-tagged proteins. Expression was induced by addition of 1 mM IPTG and allowed to continue for 4 hours at 37.degree. C. After spinning the cell cultures, periplasmic extracts were prepared by freeze-thawing the pellets. These extracts were used as starting material and Nanobodies were purified via IMAC and size exclusion chromatography (SEC).
[0982] The Nanobodies were purified to 95% purity as assessed via SDS-PAGE (data not shown).
Example 5: Binding of Anti-TCR Nanobodies to Human TCR/CD3 Expressed on CHO-K1 Cells and to Purified Primary Human T Cells
[0983] Binding of purified monovalent anti-TCR Nanobodies to human TCR(2XN9)/CD3 expressed on CHO-K1 cells and to purified primary human T cells was evaluated in flow cytometry as outlined in Example 4.1. Dilution series of Nanobodies 55A02 (cluster A), 56G05 (cluster A), 68G05 (cluster B) and 61G01 (cluster C) starting from 1 .mu.M were applied to the cells.
[0984] The results are shown in FIG. 3.
[0985] Nanobodies clearly bound to human TCR/CD3 expressed on CHO-K1 cells. The cluster A representatives showed the best affinity, followed by the cluster B representative and the cluster C representative. Nanobodies bound to purified primary human T cells, although with slightly lower potency compared to the CHO-K1 human TCR(2XN9)/CD3 cells. The representatives of cluster A showed the best affinity for binding human primary T cells, in line with the data on the CHO-K1 (2XN9)/CD3. The EC50 values obtained from the dose response curve are represented in Table C-1.
TABLE-US-00016 TABLE C-1 EC50 (M) of anti-TCR monovalent Nanobodies for binding CHO-K1 human TCR(2XN9)/CD3 cells and for binding purified primary T cells as determined in flow cytometry. CHO-K1TCR(2XN9)/CD3 Primary human T cells Cluster sample ID EC50 (M) 95% LCI 95% UCI EC50 (M) 95% LCI 95% UCI A T0170055A02 8.4E-09 7.2E-09 9.7E-09 9.1E-08 8.1E-08 1.0E-07 A T0170056G05 8.9E-09 8.3E-09 9.4E-09 9.1E-08 8.3E-08 9.9E-08 B T0170068G05 1.2E-08 1.0E-08 1.3E-08 >1E-07 / / C T0170061G01 3.1E-08 2.8E-08 3.4E-08 >1E-07 / /
Example 6: Determination of Binding Epitope
[0986] Binding of purified monovalent anti-TCR Nanobodies to human TCR(2IAN)/CD3 expressed on HEK293H cells was evaluated and compared with the binding to HEK293H cells transfected with human CD3 in flow cytometry, as outlined in Example 5. Dilution series of anti-TCR Nanobodies starting from 1 .mu.M were applied to the cells. The parental HEK293H cell line was included as TCR/CD3 negative cell line.
[0987] The results are shown in FIG. 4.
[0988] Nanobodies clearly bound to human TCR(2IAN)/CD3 expressed on HEK293H but not to the HEK293H cells transfected with human CD3 only, nor to the HEK293H parental cell line. The EC50 values obtained from the dose response curve are depicted in Table C-2.
TABLE-US-00017 TABLE C-2 EC50 (M) of anti-TCR monovalent Nanobodies for binding human TCR(2IAN)/CD3 or human CD3 expressed on HEK293H cells, as determined in flow cytometry. HEK293H wt HEK293H CD3 HEK293H TCR/CD3 cluster Sample ID EC50 MCF at 1 .mu.M EC50 MCF at 1 .mu.M EC50 MCF at 1 .mu.M A T0170055A02 No fit 246 No fit 1194 5.5E-08 91229 A T0170056G05 No fit 299 No fit 352 8.4E-08 86510 B T0170068G05 No fit 206 No fit 240 >1E-07 31202 C T0170061G01 No fit 374 No fit 495 >1E-07 10032
[0989] In conclusion, the clones were specific for binding to human TCR .alpha./p. No binding was observed to human CD3.
Example 7: Binding of Anti-TCR Nanobodies to Soluble Recombinant Human TCR .alpha./.beta. Protein
[0990] 7.1 Binding of Anti-TCR Nanobodies to Human T Cell Receptor Protein in ELISA
[0991] Binding of purified monovalent TCR Nanobodies to soluble recombinant human TCR .alpha./.beta. protein was evaluated in ELISA (as described in Example 1.2) using 2 .mu.g/ml directly coated soluble recombinant human TCR .alpha./P protein.
[0992] The results are shown in FIG. 5. The EC50 values obtained from the dose response curve are depicted in Table C-3.
TABLE-US-00018 TABLE C-3 EC50 (M) of anti-TCR monovalent Nanobodies for binding soluble recombinant human TCR(2XN9) protein, as determined in ELISA. Cluster sample ID EC50 (M) 95% LCI 95% UCI A T0170055A02 1.9E-09 1.7E-09 2.2E-09 A T0170056G05 4.0E-09 3.5E-09 4.6E-09 B T0170068G05 1.6E-08 1.3E-08 1.9E-08 C T0170061G01 5.2E-08 4.2E-08 6.5E-08
[0993] In conclusion, representative clones of all clusters bind to soluble recombinant human TCR .alpha./P protein.
[0994] 7.2 Binding of Anti-TCR Nanobodies to Human T Cell Receptor Protein in BLI
[0995] Binding affinities were measured using Bio-Layer Interferometry (BLI) on an Octet RED384 instrument (Pall ForteBio Corp.). Recombinant human soluble TCR(2XN9)-zipper protein was covalently immobilized on amine-reactive sensors (ForteBio) via NHS/EDC coupling chemistry. For kinetic analysis, sensors were first dipped into running buffer (10 mM Hepes, 150 mM NaCl, 0.05% p20, pH7.4 from GE Healthcare Life Sciences) to determine baseline setting. Subsequently, sensors were dipped into wells containing different concentrations of purified Nanobodies (range between 1.4 nM and 1 mM) for the association step (180 s) and transferred to wells containing running buffer for the dissociation (15 min) step. Affinity constants (KD) were calculated applying a 1:1 interaction model using the ForteBio Data Analysis software.
[0996] The results are depicted in FIG. 6. The binding characteristics are listed in Table C-4.
TABLE-US-00019 TABLE C-4 Kinetic analysis of anti-TCR monovalent Nanobodies for binding soluble recombinant human TCR(2XN9) protein as determined with the Octet RED384 instrument. Human sTCR (2XN9)-zipper Cluster sample ID kon(1/Ms) koff(1/s) KD (M) A T0170055A02 4.9E+04 8.4E-04 1.7E-08 A T0170056G05 5.0E+04 1.2E-03 2.4E-08
[0997] In conclusion, the binding affinity for cluster A representatives determined using BLI on human soluble 2XN9 showed correlation with the affinities determined on CHO-K1(2XN9)/CD3 cells in flow cytometry (cf. Example 5).
Example 8: Determination of Purified Primary Human T Cell Activation Capacity
[0998] Functionality of purified monovalent anti-TCR Nanobodies was evaluated in the human T cell activation assay. Goat anti-mouse IgG dynabeads (Life technologies #11033) were coated with mouse anti-Flag IgG antibodies (Sigma F1804), (15 .mu.g/1E7 beads). After an incubation period of 2 h at 4.degree. C., beads were washed and incubated with a fixed (1 .mu.g) amount of purified Flag tagged Nanobody for 20 min at 4.degree. C. while shaking. Non-coupled Nanobodies were washed away before adding the bead complex together with soluble mouse anti-CD28 antibody (Pelicluster CD28--Sanquin #M1650) to purified primary human T cells isolated (isolated as described in Example 2.1) from distinct healthy donors.
[0999] In addition, the effect of monovalent TCR binding by the Nanobodies was evaluated by the incubation of the Nanobody with the purified primary human T cells without prior capture onto anti-mouse IgG dynabeads, in the presence of anti-CD28 antibody.
[1000] The activation status of the purified primary human T cells was monitored by measuring the CD69 expression in flow cytometry using monoclonal mouse anti-human CD69PE (BD Biosciences #557050) after an incubation of 24 h at 37.degree. C. and 5% CO.sub.2, as described in Example 4.2.
[1001] In conclusion, anti-TCR Nanobodies of all clusters showed clear CD69 upregulation after capturing onto anti-mouse IgG dynabeads. The irrelevant Nanobody did not show any CD69 upregulation (FIG. 7A). In addition, none of the Nanobodies presented in solution were able to activate purified primary human T cells as measured by increased expression of CD69 (FIG. 7B).
Example 9: Binding of Multispecific TCR Binding Polypeptides to Human T Cell Receptor Complex Expressed on Cells
[1002] To demonstrate that redirection of engaged T cells to tumour cells is possible by the Nanobodies, the CD20 antigen was chosen as exemplary tumour target.
[1003] Different TCR binding building blocks (i.e. Nanobodies) were formatted into a multispecific construct with a human CD20 targeting Nanobody (see Table C-5). The effector and tumour Nanobodies were genetically linked with a 35GS linker and subsequently expressed in the yeast Pichia according to standard protocols (multispecific polypeptides).
[1004] Irrelevant constructs were generated by replacing the effector or tumour Nanobody with an irrelevant anti-egg lysozyme (cAblys) Nanobody (Table C-5)
TABLE-US-00020 TABLE C-5 Sample ID and description of multispecific constructs. Cluster Sample ID SEQ ID NO Description Target Nanobody .times. Effector Nanobody A T017000014 300 20CD019C07-35GS-T0170028B01-FLAG3-HIS6 A T017000015 301 cAbLys3(D1E)-35GS-T0170028B01-FLAG3-HIS6 ctrl T017000018 302 20CD019C07-35GS-cAbLys3-FLAG3-HIS6 A T017000054 321 20CD019C07-35GS-T0170055A03-FLAG3-HIS6 A T017000055 322 20CD019C07-35GS-T0170055A02-FLAG3-HIS6 A T017000058 323 20CD019C07-35GS-T0170040C01-FLAG3-HIS6 A T017000060 324 20CD019C07-35GS-T0170028B01-FLAG3-HIS6 A T017000076 334 20CD019C07-35GS-T0170056G05-FLAG3-HIS6 A T017000063 325 20CD019C07-35GS-T0170069B08-FLAG3-HIS6 A T017000064 326 20CD019C07-35GS-T0170068E08-FLAG3-HIS6 B T017000068 328 20CD019C07-35GS-T0170055C07-FLAG3-HIS6 B T017000070 330 20CD019C07-35GS-T0170055B06-FLAG3-HIS6 A T017000069 329 20CD019C07-35GS-T0170055B11-FLAG3-HIS6 A T017000050 319 20CD019C07-35GS-T0170069C08-FLAG3-HIS6 A T017000065 327 20CD019C07-35GS-T0170067E06-FLAG3-HIS6 A T017000078 336 20CD019C07-35GS-T0170069F05-FLAG3-HIS6 A T017000079 337 20CD019C07-35GS-T0170067D01-FLAG3-HIS6 C T017000051 320 20CD019C07-35GS-T0170061G01-FLAG3-HIS6 A T017000075 333 20CD019C07-35GS-T0170067E03-FLAG3-HIS6 Effector Nb .times. Target Nb A T017000019 303 T0170028B01-35GS-20CD019C07-FLAG3-HIS6 A T017000025 305 T0170028B01-35GS-cAbLys3-FLAG3-HIS6 ctrl T017000023 304 cAbLys3(D1E)-35GS-20CD019C07-FLAG3-HIS6 A T017000041 314 T0170055A03-35GS-20CD019C07-FLAG3-HIS6 A T017000042 315 T0170055A02-35GS-20CD019C07-FLAG3-HIS6 A T017000044 316 T0170040C01-35GS-20CD019C07-FLAG3-HIS6 A T017000046 317 T0170028B01-35GS-20CD019C07-FLAG3-HIS6 A T017000074 332 T0170056G05-35GS-20CD019C07-FLAG3-HIS6 A T017000029 306 T0170069B08-35GS-20CD019C07-FLAG3-HIS6 A T017000035 311 T0170068E08-35GS-20CD019C07-FLAG3-HIS6 B T017000031 308 T0170055C07-35GS-20CD019C07-FLAG3-HIS6 B T017000033 310 T0170055B06-35GS-20CD019C07-FLAG3-HIS6 A T017000032 309 T0170055B11-35GS-20CD019C07-FLAG3-HIS6 A T017000037 312 T0170069C08-35GS-20CD019C07-FLAG3-HIS6 A T017000077 335 T0170067E06-35GS-20CD019C07-FLAG3-HIS6 A T017000049 318 T0170069F05-35GS-20CD019C07-FLAG3-HIS6 A T017000030 307 T0170067D01-35GS-20CD019C07-FLAG3-HIS6 C T017000038 313 T0170061G01-35GS-20CD019C07-FLAG3-HIS6 A T017000073 331 T0170067E03-35GS-20CD019C07-FLAG3-HIS6
[1005] Binding of the multispecific constructs to human TCR/CD3 expressed on CHO-K1 cells, purified primary human T cells and CD20 positive Ramos cells (ATCC: CRL-1596) was evaluated in flow cytometry as outlined in Example 5. The results are presented in FIG. 8.
[1006] The EC50 values obtained from the dose response curve are depicted in Table C-6.
[1007] The data indicate similar binding of the TCRxCD20 multispecific polypeptides compared to their monovalent counterparts. However, a reduced binding of the CD20XTCR multispecific polypeptides to CHO-K1 human TCR(2XN9)/CD3 cells and purified primary human T cells was detected compared to their monovalent counterparts. On the human CD20 positive Ramos cell line, the multispecific polypeptide with the CD20 at the C terminus showed reduced binding in comparison to the polypeptides with the CD20 at the N terminus.
Example 10: Functional Characterization of Multispecific CD20xTCR Binding Polypeptides in a Flow Cytometry Based Killing Assay
[1008] In order to assess whether multispecific polypeptides were able to kill tumour cells, cytotoxicity assays were performed with isolated human T cells as effector cells.
[1009] Human T cells were isolated as described in Example 2.1. The quality and purity of the purified human T cells was checked with anti-CD3 (eBioscience #12-0037-73), anti-CD8 (BD Biosciences #345775), anti-CD4 (BD Biosciences #345771), anti-CD45RO (BD Biosciences #555493), anti-CD45RA (BD Biosciences #550855), anti-CD19 (BD Biosciences #555413), anti-CD25 (BD Pharmigen #557138) and anti-CD69 (BD Pharmigen #557050) fluorescently labelled antibodies in a flow cytometric assay. Human CD20 expressing Ramos cells and human CD20 expressing Raji cells (ECACC: 85011429), labelled with the PKH-26 membrane dye as described above were used as target cells. 2.5.times.10.sup.5 effector and 2.5.times.10.sup.4 target cells were co-incubated in 96-well V-bottom plates at an effector versus target ratio of 10:1. For measurement of the concentration-dependent cell lysis, serial dilutions of multispecific polypeptides (Table C-5) were added to the samples and incubated for 18 h in a 5% CO.sub.2 atmosphere at 37.degree. C. After incubation, cells were pelleted by centrifugation and washed with FACS buffer. Subsequently, cells were resuspended in FACS buffer supplemented with 5 nM TOPRO3 (Molecular Probes cat #T3605) to distinguish live from dead cells. Cells were analysed using a FACS Array flow cytometer (BD Biosciences). Per sample, a total sample volume of 80 .mu.l was acquired. Gating was set on PKH26 positive cells, and within this population the TOPRO3 positive cells were determined.
[1010] The CD20xTCR binding multispecific polypeptides showed dose dependent killing of the Ramos cells (FIG. 9A). T017000014 (cluster A, 20CD019C07-35GS-T0170028B01-FLAG3-HIS6) showed a dose dependent killing on both Ramos (FIG. 9A) and Raji (FIG. 9B) cells confirming that the observed cytotoxic effect was not restricted to a single tumour cell line. The expression level of the tumour antigen CD20 was determined for both cell lines (FIG. 10).
[1011] The IC50 values and the % lysis obtained from the dose response curve are depicted in Table C-7 (% lysis=% death cells at 500 nM of Nanobody minus % dead cells of the no Nanobody control).
[1012] These results demonstrate that the TCR multispecific polypeptides can induce T cell mediated killing of tumour target positive cell lines. When either the targeting Nanobody or the effector Nanobody was replaced by an irrelevant Nanobody, no effect on the viability of the Ramos cells could be observed. There was no clear preference of the orientation between the individual binding blocks in the multispecific polypeptide.
Example 11: Functional Characterization of Multispecific CD20xTCR Binding Polypeptides in an xCELLigence Based Killing Assay
[1013] The TCR binding multispecific polypeptides were also tested for their cell toxicity on human CD20 transfected adherent target cells in the presence of human effector T cells using real-time electrical impedance based technique. Here, fluctuations in impedance induced by the adherence of cells to the surface of an electrode were measured. T cells are non-adherent and therefore do not impact the impedance measurements.
[1014] In brief, the xCELLigence station was placed in a 37.degree. C. incubator at 5% CO.sub.2. 50 .mu.l of assay medium was added to each well of E-plate 96 (ACEA Biosciences; cat #05 232 368 001) and a blank reading on the xCELLigence system was performed to measure background impedance in absence of cells. Subsequently, human CD20 transfected CHO-K1 or CHO-K1 reference cells (1.times.10.sup.4) were seeded onto the E-plates 96, and 50 .mu.l of a serial dilution of multispecific polypeptide was added. After 30 min at RT, 50 .mu.l of human T cells were added per well (3.times.10.sup.5) to have an effector to target ratio of 30:1. The plate was placed in the xCELLigence station and impedance was measured every 15 min during 3 days. The data were analysed using a fixed time point indicated in the results.
[1015] The IC50 values are depicted in Table C-8.
TABLE-US-00021 TABLE C-8 IC50 (M) of the multispecific polypeptides in the xCELLigence based human T cell mediated CHO-K1 CD20 killing assay using an effector to target ratio of 30 to 1, analysed at 44 h after seeding. ID monovalent sample ID IC50 sample ID IC50 Cluster Nanobody (CD20 .times. TCR) n (M) (TCR .times. CD20) n (M) A T0170055A02 T017000055 2 1.4E-09 T017000042 2 4.2E-09 A T0170056G05 T017000076 3 3.6E-10 T017000074 3 1.5E-09 B T0170055C07 T017000068 1 1.3E-08 T017000031 1 2.1E-09 C T0170061G01 T017000051 1 2.7E-08 T017000038 1 4.1E-09
[1016] The multispecific polypeptides showed tumour antigen dependent killing. The multispecific polypeptides were not able to induce T cell mediated killing of CHO-K1 reference cells, but induced dose dependent human T cell mediated killing of the CD20 transfected CHO-K1 cells. An example is shown in FIG. 11.
[1017] These results confirm the outcome obtained in the flow cytometry based killing assay of Example 10. In addition, only when the tumour target antigen is present T cell mediated killing was observed, indicating that the multispecific polypeptides are critically dependent on their target for induction of cytotoxicity.
Example 12: Linker Length Evaluation of the Multispecific Polypeptides
[1018] To evaluate the impact of the linker length used in the CD20/TCR binding multispecific polypeptides on the cytotoxic capacity, the effector and tumour building blocks were genetically linked with a 5GS (SEQ ID NO: 376), 9GS (SEQ ID NO: 378) or 35GS (SEQ ID NO: 385) linker and subsequently expressed in Pichia according to standard protocols (see Table C-9).
TABLE-US-00022 TABLE C-9 Sample ID and description of multispecific construct to evaluate impact of linker length. Cluster Sample ID SEQ ID NO Description Target Nanobody .times. Effector Nanobody A T017000002 292 20CD019C07-5GS-T0170028B01-FLAG3-HIS6 A T017000008 296 20CD019C07-9GS-T0170028B01-FLAG3-HIS6 A T017000014 300 20CD019C07-35GS-T0170028B01-FLAG3-HIS6 A T017000060 324 20CD019C07-35GS-T0170028B01-FLAG3-HIS6 Effector Nanobody .times. Target Nanobody A T017000013 299 T0170028B01-9GS-20CD019C07-FLAG3-HIS6 A T017000019 303 T0170028B01-35GS-20CD019C07-FLAG3-HIS6 A T017000046 317 T0170028B01-35GS-20CD019C07-FLAG3-HIS6 Control Polypeptides ctrl T017000003 293 cAbLys3(D1E)-5GS-T0170028B01-FLAG3-HIS6 ctrl T017000006 294 20CD019C07-5GS-cAbLys3-FLAG3-HIS6 ctrl T017000009 297 cAbLys3(D1E)-9GS-T0170028B01-FLAG3-HIS6 ctrl T017000012 298 20CD019C07-9GS-cAbLys3-FLAG3-HIS6 ctrl T017000015 301 cAbLys3(D1E)-35GS-T0170028B01-FLAG3-HIS6 ctrl T017000018 302 20CD019C07-35GS-cAbLys3-FLAG3-HIS6 ctrl T017000023 304 cAbLys3(D1E)-35GS-20CD019C07-FLAG3-HIS6 ctrl T017000025 305 T0170028B01-35GS-cAbLys3-FLAG3-HIS6
[1019] The impact of the linker length used in the CD20/TCR binding multispecific polypeptides on the human primary effector T cell induced cellular toxicity on the adherent CHO-K1 human CD20 transfected target cells was evaluated using real-time electrical impedance based technique as described Example 11.
[1020] The results are summarized in FIG. 12.
[1021] All multispecific polypeptides, i.e. all linker lengths demonstrated specific cell killing. Unexpectedly, the TCR multispecific polypeptides with the longest linker (35GS linker) showed the best potency. In view of these results, further experiments were performed with multispecific polypeptides comprising the 35GS linker.
Example 13: Influence of Effector to Target Ratio on the Killing Effect of the Multispecific Polypeptides
[1022] To evaluate the effect of different effector to target (E:T) ratios on the killing properties of the polypeptides, CD20xTCR binding multispecific polypeptides were incubated with 2.5.times.10.sup.4 PKH labelled Ramos cells in the presence of respectively 2.5.times.10.sup.5 (E:T=10:1), 1.25.times.10.sup.5 (E:T=5:1), 5.times.10.sup.4 (E:T=2:1) and 2.5.times.10.sup.4 (E:T=1:1) human primary T cells as described in Example 10.
[1023] Exemplary results are shown in FIG. 13. The IC50 values are depicted in Table C-10.
TABLE-US-00023 TABLE C-10 IC50 (M) of the multispecific polypeptides in the flow cytometry based T cell mediated Ramos killing assay using different effector to target ratios. ID monovalent sample ID IC50 95% 95% % Cluster Nanobody (CD20 .times. TCR) E:T n (M) LCI UCI lysis A T0170056G05 T017000076 10 1 7.5E-10 5.2E-10 1.1E-09 25 A T0170056G05 T017000076 5 1 8.9E-10 5.2E-10 1.5E-09 17 A T0170056G05 T017000076 2 1 1.6E-09 6.1E-10 4.1E-09 10 A T0170056G05 T017000076 1 1 4.6E-09 3.0E-10 6.9E-08 4 A T0170055A02 T017000055 10 1 4.1E-09 3.1E-09 5.3E-09 28 A T0170055A02 T017000055 5 1 2.5E-09 1.6E-09 4.0E-09 15 A T0170055A02 T017000055 2 1 7.4E-10 3.4E-10 1.6E-09 9 A T0170055A02 T017000055 1 1 3.4E-09 1.8E-10 6.4E-08 3
[1024] Both constructs were able to kill the human CD20 target cells at different E:T ratios, even at a ratio of 1:1, after an incubation time of 18 h with little difference in potency. Although there was an impact of the E:T ratio on the % lysis, this might also be linked to the incubation time (see below).
Example 14: Time Dependent Cytolytic Activity of CD20/TCR Binding Multispecific Constructs in the Purified Primary Human T Cell Mediated Assay in xCELLigence
[1025] To evaluate the impact of incubation time on the killing properties of the CD20xTCR binding multispecific constructs, specific lysis of target cells was calculated for different time-points in xCELLigence. In brief, the xCELLigence station was placed in a 37.degree. C. incubator at 5% CO.sub.2. 50 .mu.l of assay medium was added to each well of E-pate 96 (ACEA Biosciences; cat #05 232 368 001) and a blank reading on the xCELLigence system was performed to measure background impedance in absence of cells. Subsequently, human CD20 transfected CHO-K1 or CHO-K1 reference cells (1.times.10.sup.4) were seeded onto the E-plates 96. After 20 h, 3.times.10.sup.5 purified primary human T cells (described supra) and 100 nM or 1.5 nM multispecific constructs were added, respectively. The cell index (CI) was measured every 15 min during 5 days. Using the normalized CI (the normalized cell index--NCI, is calculated by dividing the cell index value at a particular time point by the cell index value of the time-point when purified primary human T cells were added) specific lysis at different time points of the condition with constructs was calculated in relation to the condition lacking construct. (% specific lysis=((NCI.sub.no construct-NCI.sub.with construct)/NCI.sub.no construct)).times.100.
[1026] The results are depicted in FIG. 14.
[1027] Already one hour after the addition of human primary T cells and the multispecific construct, an increase of cell lysis can be observed which clearly increased further upon longer incubation times. The maximal effect was clearly dependent on the incubation time but the obtained IC50 value did not change with increased incubation times. The irrelevant construct did not show any killing of the human CD20 transfected CHO-K1 cells.
Example 15: Exploration of Half-Life Extension (HLE)
[1028] It was hypothesized that HLE via albumin binding might be suitable to comply with various requirements, including (i) half-life extension (HLE) of the moiety; and (ii) efficacy of the multispecific polypeptide. Preferably, the HLE function would not impair the penetration of tumours and tissues.
[1029] Alb11 (SEQ ID NO: 404), a Nanobody binding to human serum albumin (HSA) was linked to the multispecific CD20xTCR binding polypeptides to increase the in vivo half-life of the formatted molecules (WO 06/122787). A number of formats were generated based on the CD20 tumour targeting building block at the N-terminus, the TCR.alpha./.beta. recruiting building blocks in the middle and the albumin targeting Nanobody at the C-terminus using a 35GS linker and expressed as indicated above. An overview of the explored formats is shown in Table C-11.
TABLE-US-00024 TABLE C-11 Sample ID and description of HLE constructs. Cluster Sample ID SEQ ID NO Description A T017000093 340 20CD019C07-35GS- T0170056G05-35GS- ALB11-FLAG3-HIS6 B T017000095 341 20CD019C07-35GS- T0170055C07-35GS- ALB11-FLAG3-HIS6
[1030] As the addition of the Alb11 Nanobody might influence the affinity or potency of the construct and the binding of HSA to the Alb11 Nanobody might have an impact on the affinity or potency of the half-life extended constructs, the half-life extended constructs were characterized for binding to TCR overexpressing CHO-K1 and primary human T cells. In addition, the potency in the functional T cell dependent Ramos B cell killing assay was evaluated in the presence and absence of HSA (described in 15.1 and 15.2 below).
[1031] 15.1 Impact of Alb11 Building Block on the Binding Properties
[1032] Analogous to the experiments described in Example 5, binding of half-life extended anti-TCR polypeptides to CHO-K1 human TCR(2XN9)/CD3 cells, primary human T cells and Ramos cells was evaluated in a flow cytometric assay in the absence of HSA.
[1033] The results are provided in FIG. 15. The EC50 values obtained in this assay are listed in Table C-12. Comparison of the CD20-35GS-TCR HLE construct with the non-HLE constructs showed similar binding on all three cell lines tested. The data presented showed that coupling of the Alb11 building block did not influence the binding properties.
[1034] 15.2 Impact of Human Serum Albumin on Potency in Human T Cell Mediated B Cell Killing Assay
[1035] The functionality of half-life extended anti-TCR polypeptides was evaluated in the human T cell mediated Ramos killing assay as described in Example 10 in the presence and absence of 301M HSA and compared with the functionality of the non-HLE multispecific constructs.
[1036] The results are depicted in FIG. 16. The IC50 values obtained in this assay are listed in Table C-13.
TABLE-US-00025 TABLE C-13 IC50 (M) of and % lysis by the HLE polypeptides in the T cell dependent B cell (Ramos) killing assay to evaluate the effect of HLE. sample IC50 95% 95% % Cluster ID (M) LCI UCI lysis A T017000076 1.1E-10 7.6E-11 1.5E-10 25 A T017000093 3.4E-10 2.4E-10 4.9E-10 28 A T017000093 2.7E-10 2.1E-10 3.5E-10 26 A T017000093 +HSA 1.6E-09 1.1E-09 2.2E-09 21 B T017000068 5.6E-10 2.7E-10 1.2E-09 12 B T017000095 3.3E-09 1.8E-09 5.8E-09 16 B T017000095 1.1E-09 6.5E-10 2.0E-09 16 B T017000095 +HSA 5.7E-09 2.0E-09 1.6E-08 9
[1037] The results indicate that the inclusion of the albumin targeting Nanobody in the construct as such did not have an essential impact on the obtained potency or efficacy. Although a minor loss of efficacy/potency was observed in the presence of HSA, the half-life extended TCR multispecific polypeptides were still potent in tumour cell killing.
Example 16: Functional Characterization of Multispecific Polypeptides in an xCELLigence Based Human T Cell Mediated HER2-Positive Tumour Killing Assay
[1038] In order to assess the general applicability of the TCR building blocks in directing T cells to tumour cells, TCR binding building blocks were combined with building block that binds a different TAA, in this case a Nanobody binding to HER2.
[1039] The anti-TCR building block was combined with a Nanobody that binds the HER2 solid tumour antigen in two orientations (Table C-14) and characterized in the xCELLigence based human T cell mediated HER2-positive tumour killing assay as described in Example 11 using two HER2 expressing cell lines (SKBR3 (ATCC: HTB-30), MCF-7 (ATCC: HTB-22)) and a HER2 negative reference cell line (MDA-MB-468 (ATCC HTB-132)) as target cell population. Human HER2 expression levels were confirmed using 100 nM of the monovalent anti-HER2 Nanobody HER2005F07 (SEQ ID NO: 350) in flow cytometry as described in Example 5. Results are shown in FIG. 17.
TABLE-US-00026 TABLE C-14 Sample ID and description of HER2/TCR binding polypeptides. Cluster Sample ID SEQ ID NO Description Target Nb .times. Effector Nb A T017000102 342 HER2005F07(Q108L)- 35GS-T0170056G05- FLAG3-HIS6 Effector Nb .times. Target Nb A T017000103 343 T0170056G05-35GS- HER2005F07(Q108L)- FLAG3-HIS6
[1040] In brief, SKBR3 (4.times.10.sup.4 cells/well), MDA-MB-468 (4.times.10.sup.4 cells/well) or MCF-7 (2.times.10.sup.4 cells/well) were seeded in 96 well E-plates and incubated with 6.times.10.sup.5 cells or 3.times.10.sup.5 cells human primary T cells (effector target ratio of 15 to 1) in the presence or absence of the multispecific constructs and followed over time. Data were analysed after 18 h and are shown in FIG. 18.
[1041] The IC50 values obtained in this assay are listed in Table C-15.
[1042] The data indicate specific killing of HER2-positive tumour cell lines by directing human primary T cells to the tumour cells via the anti-TCR Nanobody. Hence, the TCR binding building blocks are broadly applicable for directing cytotoxic T cells to tumours. Despite the large difference in tumour antigen density on SKBR3 and MCF-7 cells, both were efficiently killed by the addition of multispecific polypeptide constructs.
Example 17: Effect of HER2/TCR Binding Polypeptides on IFN-.gamma. Release by Human T Cells in the HER2-Positive Tumour Cell Killing Assay
[1043] To further evaluate the broad applicability of the TCR binding building blocks, the induction of cytokine release was monitored during the human T cell mediated SKBR3 killing assay based on xCELLigence. The release of the cytokine IFN-7 was measured by ELISA. Briefly, SKBR3 cells were seeded in 96 E-plate in the presence of purified human primary T cells with or without multispecific HER2/TCR binding or irrelevant polypeptides as described in Example 16. 72 h after the addition of the human primary T cells/polypeptides to the E-plates, IFN-7 production by the human primary T cells was measured. Maxisorp 96-well ELISA plates (Nunc) were coated with anti-human IFN-7 antibody (BD Biosciences #551221). After overnight incubation, plates were washed and blocked with PBS+2% BSA for 1 h at room temperature. Next, plates were incubated with 1001 of the supernatants (2 fold diluted) and 1 .mu.g/ml biotinylated anti-human IFN-7 antibody (BD Biosciences, #554550) for 2 h 30 min while shaking, washed again and incubated with streptavidin-HRP (Dakocytomation #P0397). After 30 min, TMB One Solution (Promega #G7431) was added. The reaction was stopped with 2M H.sub.2SO.sub.4 and the polypeptide dose dependent production of IFN-7 was determined by measurement of the OD at 405 nm using the Tecan sunrise 4.
[1044] The results are shown in FIG. 19. The EC50 values obtained in this assay are listed in Table C-16.
[1045] The multispecific HER2/TCR binding polypeptides induced a dose dependent production of the cytokine IFN-7, indicating that the human T cells were activated only in presence of the relevant polypeptide.
Example 18: Cynomolgus Cross-Reactivity of Anti-TCR Nanobodies
[1046] The cross-reactivity of the TCR binding building blocks with cynomolgus monkey TCR was evaluated.
[1047] 18.1 Functional Characterization of the Multispecific Polypeptides in a Cynomolgus T Cell Mediated Ramos CD20 Positive Tumour Killing Assay
[1048] In a first experiment, a flow cytometric killing assay was set up, essentially as described in Example 10, using 2.5.times.10.sup.5 primary cynomolgus T cells (isolated using Pan T Cell Isolation Kit MACS #130-091-993) as effector cells and 2.5.times.10.sup.4 human CD20 positive Ramos cells as target cells.
[1049] The IC50 values and the % lysis obtained from the dose response curve are depicted in Table C-17. The results are shown in FIG. 20.
[1050] The TCR binding multispecific polypeptides that contained a TCR binding building block belonging to cluster A showed dose dependent killing of the Ramos cells using cynomolgus T cells.
[1051] 18.2 Functional Characterization of the Multispecific Polypeptides in a Cynomolgus T Cell Mediated CHO-K1 Human CD20 Positive Cell Killing Assay
[1052] To further assess the cross-reactivity of the TCR binding building blocks in the TCR/CD20 binding multispecific constructs, the xCELLigence based killing assay using purified primary cynomolgus T cells essentially as described in Example 11 was used.
[1053] The assay used an effector to target ratio of 30 to 1, i.e. 3.times.10.sup.5 effector cynomolgus T cells (isolated using Pan T Cell Isolation Kit MACS #130-091-993) and 1.times.10.sup.4 target CHO-K1 human CD20 cells.
[1054] The IC50 values obtained in this assay are listed in Table C-18. The results are summarized in FIG. 21.
[1055] It can be concluded that the TCR binding multispecific polypeptides that contain a TCR binding building block belonging to cluster A showed dose dependent killing of the CHO-K1 CD20 transfected cells using cynomolgus T cells. Hence, cluster A Nanobodies cross-react with primary cynomolgus T cells and can elicit potent killing based on these cynomolgus T cells.
[1056] 18.3 Binding of Anti-TCR Nanobodies to Cynomolgus T Cell Receptor Protein (ELISA)
[1057] Binding of purified monovalent anti-TCR Nanobodies to soluble recombinant cynomolgus TCR .alpha./P protein was evaluated in ELISA (as described in Example 1.2) using 2 .mu.g/ml directly coated recombinant soluble cynomolgus TCR-.alpha./.beta. zipper protein.
[1058] The EC50 values obtained from the dose response curve are depicted in Table C-19.
[1059] An exemplary result is shown in FIG. 22.
TABLE-US-00027 TABLE C-19 EC50 (M) of anti-TCR monovalent Nanobodies for binding to soluble recombinant cynomolgus TCR/CD3 protein as determined in ELISA. sample EC50 95% 95% Cluster ID (M) LCI UCI A T0170055A02 1.6E-07 1.5E-07 1.7E-07 A T0170056G05 7.7E-08 6.6E-08 9.1E-08 B T0170068G05 8.7E-08 8.5E-08 8.9E-08 C T0170061G01 >1E7.sup.
[1060] The results indicate that the anti-TCR Nanobodies from cluster A and cluster B bind to the recombinant soluble cynomolgus TCR-.alpha./.beta. zipper protein.
[1061] 18.4 Evaluation of Cynomolgus Cross-Reactivity in Bio-Layer Interferometry
[1062] Binding affinities of the monovalent anti-TCR Nanobodies were measured using Bio-Layer Interferometry (BLI) on an Octet RED384 instrument (Pall ForteBio Corp.) essentially as described in Example 7.1 using cynomolgus TCR .alpha./.beta. zipper. The results are depicted in FIG. 23, the binding characteristics of the anti-TCR Nanobodies are listed in Table C-20.
TABLE-US-00028 TABLE C-20 Binding characteristics of monovalent anti-TCR Nanobodies determined in Octet using directly coated cynoTCR-zipper protein. Cluster sample ID kon(1/Ms) koff(1/s) KD (M) A T0170055A02 1.1E+05 2.4E-02 2.1E-07 A T0170056G05 1.1E+05 1.6E-02 1.5E-07
[1063] The cluster A Nanobodies bind to the soluble recombinant cynomolgus TCR .alpha./.beta. zipper with a 10 fold lower affinity compared to soluble recombinant human TCR .alpha./.beta. zipper.
[1064] 18.5 Functional Characterization of Half-Life Extended Multispecific Polypeptides in a Cynomolgus T Cell Mediated Ramos CD20 Positive Tumour Killing Assay
[1065] Analogous to the set up described in Example 18.1, the half-life extended TCR binding polypeptides were evaluated in a cynomolgus T cell mediated Ramos killing assay.
[1066] The IC50 values obtained in this assay are listed in Table C-21. The results are depicted in FIG. 24.
TABLE-US-00029 TABLE C-21 IC50 of and % lysis by HLE multispecific polypeptides in the cynomolgus T cell dependent B cell (Ramos) killing assay to evaluate the effect of HLE. sample IC50 95% 95% % Cluster ID (M) LCI UCI lysis A T017000076 5.2E-10 2.9E-10 9.5E-10 29 A T017000093 1.0E-09 5.5E-10 2.0E-09 28 A T017000093 +HSA 8.2E-10 4.7E-10 1.4E-09 18
[1067] The HLE extended TCR binding multispecific polypeptides that contain a TCR binding building block belonging to cluster A showed dose dependent killing of the Ramos cells using purified primary cynomolgus T cells. The inclusion of the ALB11 in the construct as such did not impact the potency (overlapping CI). Upon addition of HSA, a small drop in efficacy was observed while the potency was not affected.
[1068] 18.6 Functional Characterization of Half-Life Extended CD20xTCR Binding Multispecific Polypeptides in a Cynomolgus T Cell Mediated CHO-CD20 Positive Tumour Cell Killing Assay
[1069] To confirm the data in the flow cytometry based assay, the HLE constructs were tested in the xCELLigence based CHO-K1 human CD20 killing using purified primary cynomolgus T cells as described in Example 11.
[1070] The results are shown in FIG. 25. The IC50 values obtained from the dose response curve are depicted in Table C-22.
TABLE-US-00030 TABLE C-22 IC50 (M) of the TCR/CD20 binding multispecific and HLE constructs in the cynomolgus T cell mediated CHO-K1 human CD20 tumour killing assay to evaluate the effect of ALB11 and HSA. sample ID IC50 (M) 95% LCI 95% UCI T017000076 1.4E-10 9.5E-11 2.1E-10 T017000093 1.9E-10 1.3E-10 2.8E-10 T017000093 +HSA 7.4E-10 5.0E-10 1.1E-09
[1071] The HLE TCR binding multispecific polypeptides showed dose dependent killing of CHO-K1 human CD20 transfected cells using cynomolgus T cells, confirming that the ALB11 has no impact on the cynomolgus cross-reactivity of the TCR binding building block.
[1072] 18.7 Functional Characterization of Multispecific Polypeptides in a Cynomolgus T Cell Mediated HER2 Positive Tumour Cell Killing Assay
[1073] The multispecific polypeptides were functionally characterized in a cynomolgus T cell mediated HER2 positive tumour cell killing assay. In short, the TCR/HER2 binding multispecific polypeptides were evaluated in a xCELLigence based killing assay essentially as described in Example 16, using 6.times.10.sup.5 cynomolgus T cells as effector cells and 4.times.10.sup.4 SKBR3 as target cells (effector to target of 30 to 1). Data were analysed after 18 h.
[1074] The results are depicted in FIG. 26. The IC50 values obtained in this assay are listed in Table C-23.
[1075] The cynomolgus cross-reactivity of the TCR binding building block was confirmed using the HER2/TCR binding multispecific constructs.
Example 19: In Vivo Proof-of-Concept in a Ramos B Cell Depletion Model
[1076] In this B cell depletion model, Ramos cells (a Burkitt's lymphoma cell line) and human PBMC were injected respectively intravenously and intraperitoneally in to NOG mice. Ramos B cell and PBMC-derived B cell killing by Nanobody-mediated recruitment of T cells present in the PBMC population was evaluated reflecting the potential of multispecific polypeptides to activate T cells by direct linkage of T cells via TCR to target B cells via CD20, resulting in target cell killing.
[1077] The in vivo efficacy of the bi-specific polypeptide T017000083 (CD20xTCR binding) on B cell depletion in a Ramos NOG mouse model was evaluated and compared with the irrelevant multispecific polypeptide T017000088 (irrelevant Nanobody+TCR binding Nanobody). The study demonstrated a statistically significant effect in bone marrow and spleen on Ramos B cell depletion and on PBMC derived B cell depletion in spleen.
[1078] In detail, the B cell depletion was evaluated in mice, intravenously injected with 10.sup.6 Ramos cells in 200 .mu.L of Roswell Park Memorial Institute (RPMI) medium 1640 at day one (D1). This injection took place 24 hours after a whole body irradiation of mice with a .gamma.-source (1.44 Gy, 60Co) (D0). 10.sup.7 PBMCs (500 .mu.L in PBS) were injected on D3 (i.e. two days after tumor cell injection) after randomization of the mice into groups each of 24 animals. The treatment started on D3 one hour after PBMC injection and was repeated for 5 consecutive days in total until D7 (FIG. 27). Three dose levels of the TCR/CD20 binding polypeptides were tested (0.5 mg/kg, 5 mg/kg and 23 mg/kg).
[1079] On D20 or on D21, mice were sacrificed and spleen and bone marrow (femur) were collected for FACS analysis (mCD45, hCD45, hCD19, hCD20, hCD10) to analyze and quantify the presence of Ramos B cells (hCD19+ hCD20+ hCD45+ mCD45- hCD10+) and PBMC-derived B cells (hCD19+ hCD20+ hCD45+ mCD45- hCD10-).
[1080] Results for Ramos B cell depletion are represented in FIG. 28A and FIG. 28B. Mice treated with an irrelevant multispecific polypeptide were considered as control group for analyses. From FIG. 28A, a dose response pattern was seen in the bone marrow for T017000083 (CD20/TCR) versus the irrelevant multispecific polypeptide for reducing Ramos cell numbers. The 2 highest dose levels for the CD20/TCR binding multispecific polypeptide were statistically significantly different from the irrelevant multispecific polypeptide. Statistical analysis has been performed with F-tests from the mixed-effects ANOVA analysis. For the spleen, all tested dose levels of T017000083 were statistically significantly different from the irrelevant multispecific polypeptide, as depicted in FIG. 28B. The dose response pattern in spleen was less pronounced since all doses were close to or estimated to be on the maximum effect and thus very similar.
[1081] Results for PBMC-derived B cell depletion are represented in FIG. 28C and FIG. 28D. In bone marrow, a dose response pattern was seen for T017000083 as depicted in FIG. 28C. The estimated difference in human B cell numbers for T017000083 versus the irrelevant multispecific polypeptide for the 2 highest dose levels was statistically significantly different at the 5% level of significance. In the spleen, B cell counts were statistically significantly different from the irrelevant multispecific polypeptide-treated group in all the groups treated with T017000083, and this at all tested dose levels. The dose response pattern was less pronounced since all doses were close to or estimated to be on the maximum effect and thus very similar, although an increase in estimated difference with increasing dose was observed.
[1082] In conclusion, these results demonstrate that CD20/TCR multispecific polypeptides are able to significantly decrease Ramos B cells and PBMC-derived B cells in spleen and Ramos B cells in bone marrow in this model. This confirms the polypeptide-induced T cell activation by cross-linking T cells to target B cells and killing of the latter.
Example 20: In Vivo Proof-of-Concept in a PBMC B Cell Depletion Model
[1083] In this B cell depletion model, human PBMC were injected intraperitoneally in to NOG mice. PBMC-derived B cell killing by polypeptide-mediated recruitment of T cells present in the PBMC population was evaluated reflecting the potential of the polypeptides of the invention to activate T cells by direct linkage of T cells via TCR to target B cells via CD20, resulting in target cell killing.
[1084] The in vivo efficacy of the multispecific polypeptide T017000083 (CD20xTCR binding) on B cell depletion in a PBMC NOG mouse model was evaluated and compared with the irrelevant polypeptide T017000088. The study demonstrated a clear effect on PBMC derived B cell depletion in spleen.
[1085] In detail, the B cell depletion was evaluated in mice, intraperitoneally injected with 3.times.10.sup.7 PBMCs in 500 .mu.L of PBS at day three (D3) after a whole body irradiation of mice with a .gamma.-source (1.44 Gy, 60Co) (D0) and randomization of the mice into groups each of 12 animals. The treatment started on D3 one hour after PBMC injection and was repeated for 5 consecutive days, in total until day 7 (D7) (FIG. 29). Three dose levels of the CD20/TCR binding polypeptide were tested (0.5 mg/kg, 5 mg/kg and 23 mg/kg).
[1086] On day 18 (D18), mice were sacrificed and the spleen was collected for FACS analysis (mCD45, hCD45, hCD19, hCD20) to analyze and quantify the presence of PBMC-derived human B cells (hCD19+ hCD20+ hCD45+ mCD45-).
[1087] Results for PBMC-derived B cell depletion are represented in FIG. 30. In the spleen, B cell counts were clearly different from the irrelevant polypeptide-treated group in all the groups treated with T017000083 and this at all tested dose levels. The dose response pattern is not pronounced since all doses are close to or estimated to be on the maximum effect and thus very similar.
[1088] In conclusion, these results demonstrate that a CD20/TCR binding multispecific polypeptide is able to significantly decrease PBMC-derived B cells in spleen in this model. This confirms the polypeptide-induced T cell activation by cross-linking T cells to target B cells and killing of the latter.
Example 21: Targeting of Tumour Cells with Multispecific T Cell Engaging Polypeptides
[1089] The therapeutic activity of T cell engaging strategy can be improved by the simultaneous targeting of multiple tumour associated antigens. Often tumour cells create an escape mechanism by the down-regulation of targeted antigens within a therapy. The simultaneous targeting of multiple antigens is likely to reduce the probability of generating tumour escape variants. The individual affinity of the respective tumour targeting Nanobodies may be varied such that preferable binding to either a single marker or simultaneous binding to both tumour markers is achieved. Antigens present on different cell populations can be combined or even soluble proteins can be targeted in combination with a tumour associated antigen.
[1090] As the Nanobody platform is ideally suited to combine different specificities into a multispecific format, the anti-TCR Nanobodies of the invention are combined into formats illustrating these concepts, i.e. with different tumour antigen binding Nanobodies in a multispecific polypeptide.
[1091] For the double tumour antigen targeting concept, a Nanobody reactive towards a first tumour antigen (TA1, e.g. CEA) is linked to a second Nanobody with different specificity (TA2, e.g. EGFR), different from TA1, in combination with a TCR reactive Nanobody. The specific order of the building blocks is varied within the format as well as the applied linker lengths in between the different building blocks. Combinations of TA1 and TA2 which are tested are depicted in Table C-24.
TABLE-US-00031 TABLE C-24 Combination of TCR, TA1, TA2 and Alb binding building blocks in multispecific polypeptides. T cell ISV TA1 ISV TA2 ISV ALB-ISV TCR CEA Irr + TCR CEA Irr - TCR CEA EGFR + TCR CEA EGFR - TCR Irr EGFR + TCR Irr EGFR -
[1092] In order to test half-life extension, an Alb Nanobody is included as well in the polypeptides as set out in Table C-24.
[1093] To demonstrate the specific killing, a mixed cell culture assay system is used where TA1 single positive (e.g. MC38-huCEA or MKN45) and TA2 single positive tumour cells (e.g. Hela or Her14) are co-incubated. The expression level of the respective tumour antigens was determined in different cell lines and is represented in FIG. 31. Upon addition of the polypeptides of the invention, primary human T cells and albumin if required, the T cell mediated cytotoxicity is monitored based on a cytometric read out. A comparison is made with respect to double negative cells or formats containing one or more irrelevant Nanobodies.
[1094] In order to verify the specific killing, the induced killing of double positive tumour (for TA1 and TA2, e.g. LS174T or LoVo) cells is compared with the induced killing of single positive tumour cells. For this, a T cell mediated cytoxicity assay is used as described above with a single type of tumour cells positive for both markers (cf. Example 19).
Example 22: Targeting of Tumour Cells with Multispecific T Cell Engaging Polypeptides
[1095] As mentioned above, the therapeutic activity of T cell engaging strategy can be improved by the simultaneous targeting of multiple tumour associated antigens. Not only do tumour cells create an escape mechanism by the down-regulation of targeted antigens within a therapy, but also by introducing (point-)mutations. Also in this case, simultaneous targeting of multiple epitopes on an antigen is likely to reduce the probability of generating tumour escape variants. Moreover, targeting multiple epitopes on a single antigen can increase the affinity of binding (avidity effect).
[1096] As the Nanobody platform is ideally suited to combine different specificities into a multivalent format, the anti-TCR Nanobodies of the invention are combined into formats illustrating these concepts, i.e. with different tumour antigen binding Nanobodies in a multispecific polypeptide.
[1097] For the multivalent tumour antigen targeting concept, two Nanobodies reactive towards an antigen are linked (TA1 and TA2, respectively), followed by a TCR reactive Nanobody. The specific order of the building blocks is varied within the format as well as the applied linker lengths in between the different building blocks. Combinations of TA1 and TA2 which are tested are depicted in Table C-25.
TABLE-US-00032 TABLE C-25 Combination of TCR, TA1, TA2 and Alb binding building blocks in multispecific polypeptides. T cell ISV TA1 ISV TA2 ISV ALB-ISV TCR EGFR-1 (7D12) EGFR-2 (9G08) + TCR EGFR-1 (7D12) EGFR-2 (9G08) - TCR Her2-1 (5F07) Her2-2 (47D05) + TCR Her2-1 (5F07) Her2-2 (47D05) -
[1098] In order to test half-life extension, an albumin binding Nanobody is included as well in the polypeptides as set out in Table C-25.
[1099] The potency and efficacy of these multivalent formats is evaluated and compared with the respective bispecific formats in an in vitro tumour cell killing assay comparable to the assay described in Example 10 but with the relevant cell lines (e.g. Hela, Her14, Ls174T, SKBR3, MCF7). Additionally, the effector-target ratio is varied such that an estimate is made whether a multivalent/multispecific polypeptide has a higher efficacy with lower effector target ratios.
Example 23: Binding of Monovalent Nanobodies and Multispecific Polypeptides to Cells in Flow Cytometry
[1100] As described earlier, the therapeutic activity of T cell engaging strategy can be improved by the simultaneous targeting of multiple tumour associated antigens, as tumour cells often create an escape mechanism by the down-regulation of targeted antigens within a therapy. The simultaneous targeting of multiple antigens is likely to reduce the generation of tumour escape variants.
[1101] For this double tumour antigen targeting concept, a Nanobody reactive towards a first tumour antigen (EGFR) was linked to a second Nanobody with different specificity (CEACAM5), in combination with a TCR reactive Nanobody. The specific order of the building blocks was varied within the format. The effector and tumour Nanobodies were genetically linked with 35GS linker and subsequently expressed in the yeast Pichia according to standard protocols. Irrelevant constructs were generated by replacing the tumour Nanobody with an irrelevant anti-egg lysozyme (cAblys) Nanobody (Table C-26).
TABLE-US-00033 TABLE C-26 Sample ID and description of multispecific polypeptides. Sample ID SEQ ID NO TAA1 TAA2 T cell ISV Description T017000107 390 EGFR CEACAM5 TCR EGFR038G07-35GS- NbCEA5-35GS- T0170056G05-FLAG3-HIS6 T017000109 391 Irrelevant CEACAM5 TCR cAbLys3(D1E, Q5V, A6E, Q108L)-35GS-NbCEA5- 35GS-T0170056G05- FLAG3-HIS6 T017000110 392 EGFR Irr TCR EGFR038G07-35GS- cAbLys3(D1E, Q5V, A6E, Q108L)-35GS- T0170056G05-FLAG3-HIS6
[1102] Dose-dependent binding of the monovalent Nanobodies and multispecific polypeptides to cancer cell lines expressing CEACAM5 and EGFR (LoVo; ATCC CCL-229 and LS174T; ECACC 87060401), a cell line expressing EGFR (HER14; NIH3T3 (ATCC CRL-1658) transfected with EGFR), and to purified primary human T cells (isolated as described in Example 2.1) was evaluated in flow cytometry as outlined in Example 5. The results are presented in FIG. 32.
[1103] The expression level of the respective tumour antigens on the different cells was determined in flow cytometry using 100 nM of a monovalent anti-EGFR Nanobody (EGFR038G07) and a monovalent anti-CEA Nanobody, as described in Example 5. Results are shown in FIG. 33.
[1104] The EC50 values obtained from the dose response curve for binding HER14 cells are depicted in Table C-27. The EC50 values obtained from the dose response curve for binding LS174T and LoVo cells are depicted in Table C-28.
TABLE-US-00034 TABLE C-27 EC50 (M) of monovalent Nanobodies and multispecific polypeptides for binding HER14 cells as determined in flow cytometry. HER14 sample ID EC50 (M) 95% LCI 95% UCI Top T017000107 1.6E-09 1.4E-09 1.9E-09 146111 T017000109 / / / / T017000110 7.3E-09 6.4E-09 8.3E-09 164582 EGFR038G07 1.8E-09 1.6E-09 2.1E-09 166237 NbCEA5 / / /
TABLE-US-00035 TABLE C-28 EC50 (M) of monovalent Nanobodies and multispecific polypeptides for binding LoVo and LS174T cells as determined in flow cytometry. LS174T LoVo sample ID EC50 (M) 95% LCI 95% UCI Top EC50 (M) 95% LCI 95% UCI Top T017000107 1.1E-08 9.7E-09 1.3E-08 64605 3.2E-09 2.7E-09 3.7E-09 88604 T017000109 2.5E-08 2.2E-08 2.9E-08 50982 3.6E-08 1.4E-08 9.1E-08 18514 T017000110 6.3E-09 5.5E-09 7.2E-09 40779 2.4E-09 2.1E-09 2.8E-09 95866 EGFR038G07 9.3E-10 8.1E-10 1.1E-09 32191 5.4E-10 4.8E-10 6.2E-10 52268 NbCEA5 5.9E-10 5.3E-10 6.6E-10 42978 1.2E-09 6.4E-10 2.4E-09 11238
[1105] The data showed binding of the EGFR monovalent Nanobody and of the multispecific polypeptides containing the EGFR building block to the HER14 cells, expressing only EGFR. No binding of the CEACAM monovalent Nanobody and the multispecific polypeptides containing only the CEACAM5 tumour anchor building block was observed. All monovalent and multispecific polypeptides showed binding to the EGFR, CEACAM5 double positive cell lines LS174T and LoVo, as expected. There was also binding of the multispecific polypeptides to the human primary T cells. A drop in affinity of the multispecific polypeptides versus the monovalent TCR building block was observed due to the C-terminal position of the TCR building block.
Example 24: Binding of Monovalent Nanobodies to Human EGFR and CEACAM5 Protein (SPR)
[1106] Binding affinity of the purified EGFR monovalent Nanobody was evaluated by means of a surface plasmon resonance (SPR) based affinity determination on a Biacore T100 instrument. Thereto, hEGFR (Sino Biological, #10001-H08H) was immobilized onto a CM5 chip via amine coupling, using EDC and NHS chemistry. Purified Nanobodies were injected for 2 minutes at different concentrations (between 1.37 and 3000 nM) and allowed to dissociate for 15 min at a flow rate of 45 .mu.l/min. In between sample injections, the surfaces were regenerated with 50 mM NaOH. HBS-EP+ (Hepes buffer pH7.4) was used as running buffer.
[1107] Binding affinities of the purified CEACAM5 monovalent Nanobody was evaluated by means of an SPR based affinity determination on a Biacore T100 instrument. Thereto, hCEACAM-5 (R&D Systems, #4128-CM) was immobilized onto a CM5 chip via amine coupling, using EDC and NHS chemistry. Purified Nanobodies were injected for 2 minutes at different concentrations (between 0.31 and 2000 nM) and allowed to dissociate for 15 min at a flow rate of 45 .mu.l/min. In between sample injections, the surfaces were regenerated with 10 mM Glycine pH 1.5. HBS-EP+(Hepes buffer pH7.4) was used as running buffer.
[1108] The kinetic constants were calculated from the sensorgrams using the BIAEvaluation software (1:1 interaction). The affinity constants (KD) were calculated from resulting association and dissociation rate constants kon and koff, and are shown in Table C-29.
TABLE-US-00036 TABLE C-29 Affinity constant of monovalent Nanobodies for binding hEGFR and hCEACAM5, determined in Biacore using directly coated proteins. hCEACAM5 hEGFR ECD kon (1/Ms) Koff (1/s) KD (M) kon (1/Ms) koff (1/s) KD (M) EGFR038G07 / / / 5.58E+05 4.26E-04 7.63E-10 NbCEA5 9.9E+05 5.1E-04 5.1E-10 / / /
Example 25: Redirected Cell Killing of Multispecific Polypeptides by Human Effector T Cells in the xCELLigence Based Assay
[1109] The multispecific polypeptides were functionally characterized in a human T cell mediated EGFR/CEACAM positive tumour cell killing assay. In short, the multispecific constructs were evaluated in a xCELLigence based killing assay essentially as described in Example 16, using 6.times.10.sup.5 human T cells as effector cells and 4.times.10.sup.4 LS174T cells (ECACC 87060401) or LoVo cells (ATCC CCL-229) respectively as target cells (effector to target of 15 to 1). Data were analysed after 30-40 h and after 50-60 h.
[1110] The results are depicted in FIG. 34. The IC50 values obtained in this assay are listed in Tables 30 and 31.
TABLE-US-00037 TABLE 30 IC50 (M) of the multispecific polypeptides in the human T cell mediated xCELLigence based killing assay using an effector to target ratio of 15. Data were analysed after 30-40 h. LoVo LS174T ID construct n IC50 (M) 95% LCI 95% UCI n IC50 (M) 95% LCI 95% UCI T017000107 1 3.0E-10 2.6E-10 3.6E-10 1 1.0E-08 6.1E-09 1.7E-08 T017000109 1 9.3E-09 6.7E-09 1.3E-08 1 1.0E-07 4.9E-08 2.2E-07 T017000110 1 1.5E-09 1.3E-09 1.9E-09 1 2.6E-08 1.1E-08 6.0E-08
[1111] The data on the EGFR+/CEA+ LoVo cells showed a .about.28 fold difference in potency between the CEACAM5 only and the EGFR-CEA multispecific constructs and a .about.8 fold difference in potency between the EGFR only constructs and the EGFR-CEA multispecific constructs. On EGFR+/CEA+ LS174T cells, a .about.7 fold difference in potency between the CEACAM5 only and the EGFR-CEA multispecific constructs was observed and .about.2 fold difference between the EGFR only constructs and the EGFR-CEA multispecific constructs. These results showed that potency enhancements were obtained with multispecific constructs reactive against two different antigens present on a cell.
Example 26: In Vivo B Cell Depletion by Half-Life Extended (HLE) Polypeptides in a Ramos B Cell Depletion Model
[1112] In this B cell depletion model, Burkitt's lymphoma Ramos cells and human PBMC were injected respectively intravenously and intraperitoneally in to mice after which Ramos B cell and PBMC-derived B cell killing by Nanobody-mediated recruitment of T cells present in PBMC population was evaluated: i.e. the potential of Nanobodies, HLE and non-HLE (NHLE), to activate T cells by direct linking of T cells via TCR to target B cells via CD20, resulting in target cell killing.
[1113] The polypeptides used in this study are described in Table 32:
TABLE-US-00038 TABLE 32 Sample ID and description of multispecific polypeptides used in in vivo study. Sample ID SEQ ID NO TAA TCR ISV HLE Description T017000083 338 CD20 TCR NHLE 20CD019C07(E1D)- 35GS-T0170055A02-A T017000088 339 Irr TCR NHLE RSV007B02(E1D)- 35GS-T0170055A02-A T017000104 387 CD20 TCR HLE 20CD019C07(E1D)- 35GS-T0170055A02- 35GS-ALB11-A T017000105 388 CD20 TCR NHLE 20CD019C07(E1D)- 35GS-T0170056G05-A T017000106 389 Irr TCR HLE RSV007B02(E1D)- 35GS-T0170055A02- 35GS-ALB11-A
[1114] The in vivo efficacy of a HLE bispecific Nanobody, T017000104 (TCR and CD20-specific coupled to an albumin targeting building block) in a Ramos NOG mouse model was evaluated and compared with the irrelevant Nanobody T017000106. The non-half-life extended (NHLE) Nanobody T017000105 (TCR and CD20-specific) and T0107000083 (TCR and CD20-specific) were compared to the NHLE irrelevant Nanobody T017000088 (irrelevant and TCR-specific). The study demonstrated a statistically significant effect in bone marrow and spleen on PBMC derived B cell depletion for T017000104 and T017000105 compared to their respective irrelevant control NBs. The Ramos cells were significantly reduced in T017000104 and T017000105 treated mice, both in spleen and bone marrow.
[1115] In detail, the B cell depletion was evaluated in the mice, intravenously injected with Ramos cells at day one (D1) and intraperitoneally with PBMCs at D3. Mice were treated from D3 to D7 (FIG. 35). Tumors were induced by intravenous injection of 10' Ramos cells in 200 .mu.L of Roswell Park Memorial Institute (RPMI) 1640 medium (D1) 24 hours after a whole body irradiation of mice with a .gamma.-source (1.44 Gy, 60Co) (D0). PBMCs were injected on D3 (i.e. two days after tumor cell injection) after randomization of the mice into groups each of 12 animals (11 animals for group 6) based on body weight. The animals received one single intraperitoneal (IP) injection of 10.sup.7 PBMCs (500 .mu.L in PBS). The treatment started on D3 one hour after PBMC injection and was repeated for 5 consecutive days in total for groups 1-4 and 6, whereas group 5 received only two injections (D3 and D5).
[1116] On D20 or on D21, the mice were sacrificed and spleen and bone marrow (femur) were collected for FACS analysis (mCD45, hCD45, hCD19, hCD20, hCD10) and analyzed for presence of Ramos B cells and PBMC-derived B cells.
[1117] Results for Ramos B cell depletion are represented in FIG. 36. Test items T017000083 and T017000105, and T017000104 were compared to their respective control groups (groups 1 and 2) based on presence/absence of HLE. In bone marrow, a statistically significant difference in Ramos B cell number between the control Nanobodies and the NHLE Nanobodies T017000083 and T017000105 was observed (FIG. 36A). In spleen the difference was significant only for T017000105 (FIG. 36B). The HLE Nanobody T017000104 significantly reduced the Ramos cells in spleen and bone marrow irrespective of the dosing frequency applied (FIGS. 36A and B). Statistical analysis has been performed with F-tests from the mixed-effects ANOVA analysis.
[1118] Results for PBMC-derived B cell depletion are represented in FIG. 37. In bone marrow, a reduction was observed in absolute B cell count in all treatment groups, compared to the irrelevant control Nanobody and this effect was significant for Nanobodies T017000083 and T017000104 (FIG. 37 A). In the spleen, the effect was more pronounced and significant for all treatment groups (FIG. 37 B).
[1119] In conclusion, these results demonstrate that both the anti-CD20/anti-TCR polypeptide and the HLE anti-CD20/anti-TCR polypeptide are able to significantly decrease Ramos B cells and PBMC-derived B cells in spleen and bone marrow in this B cell depletion model. This confirms the Nanobody-induced T cell activation by cross-linking T cells to target B cells and killing of the latter.
Example 27: Role of Human Effector CD4+ and CD8+ T Cells in T Cell Activation
[1120] To investigate the role of CD4+, respectively CD8+ human T cells in the redirected killing, targeting of tumour cells with multispecific T cell engaging polypeptides was performed using T cell subsets. In this case, the HER2-positive cell line SKBR3 and Nanobody T017000102 (targeting HER2 and TCR) were used.
[1121] 27.1 Redirected Cell Killing of Multispecific Polypeptides by Human Effector CD4+ and CD8.sup.+ T Cells in the xCELLigence Based Assay
[1122] Human T cells were collected as described in Example 2.1. After thawing, human CD4+, respectively CD8+ T cells were isolated using the CD4+(Miltenyi Biotec #130-096-533), respectively CD8+(Miltenyi Biotech #130-096-495) T cell isolation kit. SKBR3 cells, were seeded in 96 well E-plates (2.times.10.sup.4 cells/well) and incubated with 3.times.10.sup.5 human primary effector T cells, human primary effector CD4+ T cells or human primary effector CD8+ T cells (effector target ratio of 15:1) in the presence or absence of multispecific constructs and followed over time, as described in Example 16. Data were analysed after 40 h.
[1123] Results are shown in FIG. 38. The IC50 values are depicted in Table 33.
TABLE-US-00039 TABLE 33 IC50 (M) of the multispecific polypeptides in the xCELLigence based human T cell mediated SKBR3 killing assay using an effector to target ratio of 15 to 1. IC50 (M) 95% LCI 95% UCI T cells 2.4E-11 1.9E-11 3.0E-11 CD8+ T cells 2.9E-11 2.1E-11 4.1E-11 CD4+ T cells 1.2E-11 1.1E-11 1.3E-11
[1124] The data showed dose dependent specific killing of HER2-positive tumour cell lines by directing human primary T cells, human CD4+ or human CD8+ T cells to the tumour cells via the TCR polypeptide.
[1125] 27.2 Effect of HER2/TCR Binding Polypeptides on CD69 and CD25 Expression on Human Effector CD4+ and CD8+ T Cells in a HER2-Positive Tumour Cell Killing Assay
[1126] Primary human T cells and CD4+ and CD8+ T cell subpopulations were isolated and a redirected HER2-positive tumour cell killing assay using SKBR3 cells was performed as described in Example 27.1. T cell activation was determined by measuring CD69 and CD25 upregulation after 24 h and 72 h of incubation respectively on the human primary T cells and on the CD4+ and CD8+ human T cell populations. CD69 and CD25 expression was measured in flow cytometry, using monoclonal mouse anti-human CD69PE (BD Biosciences #557050) and mouse anti-human CD25PE (BD Pharmigen #557138) antibody, for CD69 and CD25 measurement respectively.
[1127] Exemplary results are shown in FIG. 39.
[1128] The data showed dose dependent upregulation of CD69 and CD25 on human primary T cells, human CD4+ and human CD8+ T cells.
[1129] 27.3 Effect of HER2/TCR Binding Polypeptides on IFN-.gamma. and IL-6 Release by Human Effector CD4+ and CD8+ T Cells in a HER2-Positive Tumour Cell Killing Assay
[1130] Primary human T cells and CD4+ and CD8+ T cell subpopulations were isolated and a redirected HER2-positive tumour cell killing assay using SKBR3 cells was performed as described in Example 27.1. The release of the cytokine IFN-7 was measured by ELISA as described in Example 17 and the release of IL-6 was measured in ELISA using the human IL-6 Quantikine ELISA Kit (R&D Systems, #D6050) according to manufactures instructions.
[1131] Exemplary results are shown in FIG. 40.
[1132] The data showed dose dependent IFN-.gamma. and IL-6 release by human primary T cells, human CD4+ and human CD8+ T cells.
Example 28: Exploration of Half-Life Extension (HLE)
[1133] It was hypothesized that HLE via albumin binding might be suitable to comply with various requirements, including (i) half-life extension (HLE) of the moiety; and (ii) efficacy of the multispecific polypeptide. Preferably, the HLE function would not impair the penetration of tumours and tissues.
[1134] Alb11 (SEQ ID NO: 404), a Nanobody binding to human serum albumin (HSA) was linked to the multispecific EGFRxCEAxTCR binding polypeptide to increase the in vivo half-life of the formatted molecule (WO 06/122787). A format was generated with the albumin targeting Nanobody at the C-terminus using a 35GS linker and expressed as indicated above. The explored format is shown in Table 34.
TABLE-US-00040 TABLE 34 Sample ID and description of the multispecific HLE polypeptide. Sample ID SEQ ID NO Description T017000108 486 EGFR038G07-35GS-NbCEA5-35GS- T0170056G05-35GS-ALB11-FLAG3-HIS6
[1135] As the addition of the Alb11 Nanobody might influence the affinity or potency of the construct, the half-life extended multispecific polypeptide was characterized for binding to EGFR and CEA expressing cell lines and primary human T cells. In addition, the potency in the functional T cell dependent LS174T killing assay was evaluated (described in 28.1 and 28.2 below).
[1136] 28.1 Impact of the Alb11 Building Block on the Binding Properties
[1137] Dose-dependent binding of the HLE multispecific polypeptide to cancer cell lines expressing CEACAM5 and EGFR (LS174T and LoVo), a cell line expressing EGFR (HER14; NIH3T3 transfected with EGFR), and to purified primary human T cells (isolated as described in Example 2.1) was evaluated in flow cytometry as outlined in Example 5, in the absence of HSA.
[1138] The results are presented in FIG. 41. The EC50 value obtained from the dose response curve for binding to HER14 cells is depicted in Table 35. The EC50 values obtained from the dose response curves for binding to LS174T and LoVo cells are depicted in Table 36.
TABLE-US-00041 TABLE 35 EC50 (M) of T017000108 for binding to HER14 cells as determined in flow cytometry. HER14 sample ID EC50 (M) 95% LCI 95% UCI Top T017000108 1.9E-09 1.7E-09 2.2E-09 158884
TABLE-US-00042 TABLE 36 EC50 (M) of T017000108 for binding to LoVo and LS174T as determined in flow cytometry. LS174T LoVo sample ID EC50 (M) 95% LCI 95% UCI Top EC50 (M) 95% LCI 95% UCI Top T017000108 1.4E-08 1.2E-08 1.6E-08 70202 3.3E-09 2.9E-09 3.9E-09 92787
[1139] Comparison of the HLE construct with the non-HLE construct showed similar binding to all three cell lines tested. The data presented showed that coupling of the Alb11 building block did not influence the binding properties.
[1140] 28.2 Impact of the Alb11 Nanobody in the Redirected Cell Killing by Human Effector T Cells in the xCELLigence Based Assay
[1141] The functionality of the half-life extended multispecific polypeptide was evaluated in the absence of HSA in the human T cell mediated LS174T killing assay as described in Example 10 and compared with the functionality of the non-HLE multispecific constructs.
[1142] The results are depicted in FIG. 42. The obtained IC50 values are listed in Table 37.
TABLE-US-00043 TABLE 37 IC50 (M) of the multispecific polypeptides in the human T cell mediated xCELLigence based killing assay using an effector to target ratio of 15. Data were analysed after 40-50 h. sample ID IC50 (M) 95% LCI 95% UCI T017000107 7.9E-10 5.9E-10 1.1E-09 T017000108 5.5E-09 4.1E-09 7.3E-09
[1143] The results indicate that the inclusion of the albumin targeting Nanobody in the construct as such did not have an essential impact on the obtained potency or efficacy.
TABLE-US-00044 TABLE A-1 Sequence alignment of TCR cluster A binders-part 1 1 10 20 30 40 50 60 70 80 Kabat # | | | | | | | | | SEQ ID NO: 50 T0170PMP056G05: EVQLVESGGGLVQPGGSLRLSCVASGDVHKINFLGWYRQAPGKEREKVAHISIGDQTDYADSAKGRFTISRDE- SKNMV SEQ ID NO: 8 T0170PMP053D01: ..................K...A...A............T.E....M..T.T...DV................- A.... SEQ ID NO: 60 T0170PMP067D01: ..................K...A...A............T.E....M..T.T...EV................- A.... SEQ ID NO: 47 T0170PMP056F01: ..................K.P.A...A............T.E....M..T.T...EV................- A.... SEQ ID NO: 76 T0170PMP069A06: ..................K...A...A............T.E....M..T.T...EV..E.............- A.... SEQ ID NO: 65 T0170PMP067F02: ..................K...A...A............T.E....M..T.T...EV...H............- A.... SEQ ID NO: 66 T0170PMP068C03: ..................K...A...A............T.E....M..T.T...EVA...............- A.... SEQ ID NO: 26 T0170PMP055E05: ..................K...A...A..............E....M..T.T...EV................- A.... SEQ ID NO: 19 T0170PMP055C02: ..................K...A...A............T.E....M....T...EV................- A.... SEQ ID NO: 61 T0170PMP067D06: ..................K...A...A..............E....M..T.T...EV................- AT... SEQ ID NO: 50 T0170PMP069C08: .........................................................................- ..... SEQ ID NO: 28 T0170PMP055F03: ................................I....................S......E............- ..... SEQ ID NO: 54 T0170PMP061A02: ................................I..................A.S......E............- ..... SEQ ID NO: 45 T0170PMP056D11: ................................I................R...S......E............- ..... SEQ ID NO: 77 T0170PMP069B02: ............R...................I....................S......E............- ..... SEQ ID NO: 96 T0170PMP070G02: ................................I....................S......E............- ..... SEQ ID NO: 2 T0170PMP028B01: ......................A...S..................GL..T.T...T.....Y...........- AR... SEQ ID NO: 4 T0170PMP028G06: ......................A...S...................L..T.T...T.....Y...........- AR... SEQ ID NO: 29 T0170PMP055F06: ......................A...S...................L..T.T...A.....Y...........- AR... SEQ ID NO: 1 T0170PMP027A05: ......................A...S...................L..T.T...T.................- A.... SEQ ID NO: 6 T0170PMP040C01: ......................A...S...................L..T.T...T.................- A.... SEQ ID NO: 3 T0170PMP028F10: ................R...P.A...S...................M..T.T...A.................- A.... SEQ ID NO: 5 T0170PMP029F08: ......................A...S...................M..T.T...A.................- A.... SEQ ID NO: 13 T0170PMP055A08: ..........S...........A...S...................M..T.T...A.................- A.... SEQ ID NO: 32 T0170PMP055G09: ..........S...........A...S...................V..T.T...A.................- A.... SEQ ID NO: 69 T0170PMP068D05: ..........S........P..A...S...................M..T.T...A.................- A.... SEQ ID NO: 75 T0170PMP068F08: ..........S...........A...S..................GM..T.T...A.................- A.... SEQ ID NO: 95 T0170PMP070F11: ..........S...........A...S..........C........M..T.T...A.................- A.... SEQ ID NO: 87 T0170PMP069E11: ......................A...E.....I......C.....DM..T.T...A.................- A.... SEQ ID NO: 99 T0170PMP084B07: ......................A...E.....I............DM..T.T...E.Q...............- A.... SEQ ID NO: 10 T0170PMP055A01: ............R.........A.........I........A....M....T...A.................- A.... SEQ ID NO: 11 T0170PMP055A02: ......................A.........I........A....M....T...A.................- A.... SEQ ID NO: 22 T0170PMP055D03: ......................A.........I........A....M....T...A.N...............- A.... SEQ ID NO: 24 T0170PMP055D10: ......................A.........I........A....M....T...A...G.............- A....
TABLE-US-00045 TABLE A-2 Sequence alignment of TCR cluster A binders-part 1 continued 79 90 100 110 Kabat # | ab | |a | SEQ ID NO: 50 T0170PMP056G05: YLQMNSLKPEDTAVYFCRAFSRIYPYDYWGQGTLVTVSS SEQ ID NO: 8 T0170PMP053D01: ....T..........V...G..L...N............ SEQ ID NO: 60 T0170PMP067D01: ....T..........V...G..L...N............ SEQ ID NO: 47 T0170PMP056F01: ....T..........V...G..L...N............ SEQ ID NO: 76 T0170PMP069A06: ....TG.........V...G..L...N............ SEQ ID NO: 65 T0170PMP067F02: ....T..........V...G..L...N......Q..... SEQ ID NO: 66 T0170PMP068C03: ....T..........V...G..L...N......Q..... SEQ ID NO: 26 T0170PMP055E05: ....T.......T..V...G..L...N......Q..... SEQ ID NO: 19 T0170PMP055C02: ....T..T.......V...G..L...N......Q..... SEQ ID NO: 61 T0170PMP067D06: ....T..............G......N......Q..... SEQ ID NO: 50 T0170PMP069C08: ....................................... SEQ ID NO: 28 T0170PMP055F03: ...............L....................... SEQ ID NO: 54 T0170PMP061A02: ...............L....................... SEQ ID NO: 45 T0170PMP056D11: ...............L....................... SEQ ID NO: 77 T0170PMP069B02: ...............L.................Q..... SEQ ID NO: 96 T0170PMP070G02: ...........A...L.................Q..... SEQ ID NO: 2 T0170PMP028B01: ...................G..L...N......Q..... SEQ ID NO: 4 T0170PMP028G06: ...................G..L...N............ SEQ ID NO: 29 T0170PMP055F06: ...................G..L...N............ SEQ ID NO: 1 T0170PMP027A05: ..............H....G..L...N......Q..... SEQ ID NO: 6 T0170PMP040C01: ...................G..L...N......Q..... SEQ ID NO: 3 T0170PMP028F10: ...................G..L...N......Q..... SEQ ID NO: 5 T0170PMP029F08: ...................G..L...N............ SEQ ID NO: 13 T0170PMP055A08: .......S...........G..L...N............ SEQ ID NO: 32 T0170PMP055G09: .......S...........G..L...N......Q..... SEQ ID NO: 69 T0170PMP068D05: .......S...........G..L...N......Q..... SEQ ID NO: 75 T0170PMP068F08: .......S...........G..L...N......Q..... SEQ ID NO: 95 T0170PMP070F11: .......S...........G..L...N......Q..... SEQ ID NO: 87 T0170PMP069E11: ...................L..L...N............ SEQ ID NO: 99 T0170PMP084B07: ...................L..L...N............ SEQ ID NO: 10 T0170PMP055A01: ...................Y......N............ SEQ ID NO: 11 T0170PMP055A02: ...................Y......N............ SEQ ID NO: 22 T0170PMP055D03: ...................Y......N............ SEQ ID NO: 24 T0170PMP055D10: ...................Y......N............
TABLE-US-00046 TABLE A-3 Sequence alignment of TCR cluster A binders-part 2 1 10 20 30 40 50 60 70 78 Kabat # | | | | | | | | | SEQ ID NO: 50 T0170PMP056G05: EVQLVESGGGLVQPGGSLRLSCVASGDVHKINFLGWYRQAPGKEREKVAHISIGDQTDYADSAKGRFTISRDE- SKNMV SEQ ID NO: 71 T0170PMP068E01: ...............E......A.........I........A....M....T...A.................- A.... SEQ ID NO: 101 T0170PMP084E03: ......................A.........I........A....M....T...A.................- A.... SEQ ID NO: 102 T0170PMP084E05: ......................A.........I...H....A....M....T...A.................- A.... SEQ ID NO: 30 T0170PMP055F08: ......................A.........I........A....M....T...A...........A.....- A.... SEQ ID NO: 37 T0170PMP056C01: ......................A...G.....I........A....M....T...A.................- A.... SEQ ID NO: 49 T0170PMP056G02: ...........A..........A.........I........A....M....T...A.................- A.... SEQ ID NO: 57 T0170PMP067A03: ......................A.........I........A..H.M....T...A.................- A.... SEQ ID NO: 59 T0170PMP067C09: ......................A.........I........A....M....T...A.................- AE... SEQ ID NO: 74 T0170PMP068F06: ......................A.........I........A....M....T...A.................- A..V. SEQ ID NO: 82 T0170PMP069D02: ..........M...........A.........I........A....M....T...A.................- A.... SEQ ID NO: 93 T0170PMP070D07: ......................A.........I........A....M....T...A.................- A.... SEQ ID NO: 100 T0170PMP084C02: ......................A.........I........A....M....T...A.................- A.... SEQ ID NO: 55 T0170PMP061B04: ......................A.........I........A....M....T...A.................- A.... SEQ ID NO: 83 T0170PMP069D07: ......................A.........I......V.A....M....T...A.................- A.... SEQ ID NO: 36 T0170PMP056B11: .............A....T...A.........I........A....M....T...A.................- A.... SEQ ID NO: 104 T0170PMP084F10: ..........W..A........A.........I........A....M....T...A.................- A.... SEQ ID NO: 39 T0170PMP056C03: ......................A.........I........A....M....T...T.................- A.... SEQ ID NO: 80 T0170PMP069C04: ......................A.........I........A.G..M....T...A.................- A.... SEQ ID NO: 44 T0170PMP056D02: ......................A.........I........A....M....T...A.................- A.... SEQ ID NO: 56 T0170PMP067A01: ......................A.........I........A...GM....T...A.................- A.... SEQ ID NO: 58 T0170PMP067B06: ......................A.........I........AR...M....T...A.................- A.... SEQ ID NO: 88 T0170PMP069F05: ......................A.........I........A....M....T...A.................- A.... SEQ ID NO: 103 T0170PMP084F04: ......................A.........I...H....A....M....T...A.................- A.... SEQ ID NO: 21 T0170PMP055C10: ......................A.........V........A....M....T...A.................- A.... SEQ ID NO: 9 T0170PMP053E10: ......................R.........I........A....M....T...A....E............- A.... SEQ ID NO: 15 T0170PMP055B01: ......................R.........I........A....M....T...A.V..E............- A.... SEQ ID NO: 79 T0170PMP069C01: ......................R.........I........A....MI...T...A....E............- A.... SEQ ID NO: 62 T0170PMP067D09: ......................A.........I........A....M....T...A.S..G............- A.... SEQ ID NO: 63 T0170PMP067E03: ......................A.........I........A....M....T...A.S...............- A.... SEQ ID NO: 43 T0170PMP056D01: .........D............A.......................M....T.A.A....EF...........- P.... SEQ ID NO: 64 T0170PMP067E06: .........D............A.......................M....T.A.A....EF...........- P.... SEQ ID NO: 86 T0170PMP069E09: ......................A.......................M....T.A.A....EF...........- P.... SEQ ID NO: 81 T0170PMP069C05: .........D............A.......................M....T.A.A....EF...........- P.... SEQ ID NO: 90 T0170PMP070B08: .........D............A.......................M....T.A.A....EF...........- P.... SEQ ID NO: 12 T0170PMP055A03: ...................................................T....A................- A....
TABLE-US-00047 TABLE A-4 Sequence alignment of TCR cluster A binders-part 2 continued 79 90 100 110 Kabat # | ab | |a | SEQ ID NO: 50 T0170PMP056G05: YLQMNSLKPEDTAVYFCRAFSRIYPYDYWGQGTLVTVSS SEQ ID NO: 71 T0170PMP068E01: ...................Y......N............ SEQ ID NO: 101 T0170PMP084E03: .........G.........Y......N............ SEQ ID NO: 102 T0170PMP084E05: ...................Y......N............ SEQ ID NO: 30 T0170PMP055F08: ...................Y......N............ SEQ ID NO: 37 T0170PMP056C01: ...................Y......N............ SEQ ID NO: 49 T0170PMP056G02: ...................Y......N............ SEQ ID NO: 57 T0170PMP067A03: ...................Y......N............ SEQ ID NO: 59 T0170PMP067C09: ...................Y......N............ SEQ ID NO: 74 T0170PMP068F06: ...................Y......N............ SEQ ID NO: 82 T0170PMP069D02: ...................Y......N............ SEQ ID NO: 93 T0170PMP070D07: ...........A.......Y......N............ SEQ ID NO: 100 T0170PMP084C02: ....D..............Y......N............ SEQ ID NO: 55 T0170PMP061B04: .............A.....Y......N............ SEQ ID NO: 83 T0170PMP069D07: .............A.....Y......N............ SEQ ID NO: 36 T0170PMP056B11: ...................Y......N............ SEQ ID NO: 104 T0170PMP084F10: ...................Y......N............ SEQ ID NO: 39 T0170PMP056C03: ...................Y......N......Q..... SEQ ID NO: 80 T0170PMP069C04: ...................Y......N......Q..... SEQ ID NO: 44 T0170PMP056D02: ...................Y......N...R..Q..... SEQ ID NO: 56 T0170PMP067A01: ...................Y......N......Q..... SEQ ID NO: 58 T0170PMP067B06: ...................Y......N......Q..... SEQ ID NO: 88 T0170PMP069F05: ...............L...Y......N......Q..... SEQ ID NO: 103 T0170PMP084F04: .............A.....Y......N......Q..... SEQ ID NO: 21 T0170PMP055C10: H..................Y......N......Q..... SEQ ID NO: 9 T0170PMP053E10: ...................Y......N......Q..... SEQ ID NO: 15 T0170PMP055B01: ...................Y......N......Q..... SEQ ID NO: 79 T0170PMP069C01: ...................Y......N......Q..... SEQ ID NO: 62 T0170PMP067D09: ...L.N.............Y......N............ SEQ ID NO: 63 T0170PMP067E03: ...L.N.............Y......N............ SEQ ID NO: 43 T0170PMP056D01: H..............L...G......N......Q..... SEQ ID NO: 64 T0170PMP067E06: ...............L...G......N......Q..... SEQ ID NO: 86 T0170PMP069E09: ...............L...G......N......Q..... SEQ ID NO: 81 T0170PMP069C05: ...............L...G......S......Q..... SEQ ID NO: 90 T0170PMP070B08: .........V.....L...G......N............ SEQ ID NO: 12 T0170PMP055A03: ...................G.............Q.....
TABLE-US-00048 TABLE A-5 Sequence alignment of TCR cluster A binders-part 3 1 10 20 30 40 50 60 70 78 Kabat # | | | | | | | | | SEQ ID NO: 50 T0170PMP056G05: EVQLVESGGGLVQPGGSLRLSCVASGDVHKINFLGWYRQAPGKEREKVAHISIGDQTDYADSAKGRFTISRDE- SKNMV SEQ ID NO: 41 T0170PMP056C07: ...................................................T....A................- A.... SEQ ID NO: 92 T0170PMP070C09: .................P.................................T....A................- A.... SEQ ID NO: 98 T0170PMP082B04: ...................P...............................T.A..A................- A.... SEQ ID NO: 33 T0170PMP056A02: .................A.................................T.....................- A.... SEQ ID NO: 31 T0170PMP055G05: ......................A............H...............T...A.................- A.... SEQ ID NO: 78 T0170PMP069B08: ......................A.....Y......H...............T...A.................- A.... SEQ ID NO: 20 T0170PMP055C06: ............H.........A............H..P............T...V.................- A.... SEQ ID NO: 23 T0170PMP055D06: ......................A............H...............T...V.................- A.... SEQ ID NO: 25 T0170PMP055E01: ......................A...E.Y......................T.A.VA....F...........- A.... SEQ ID NO: 27 T0170PMP055F02: ......................A...E.Y......................T.A.VA....F...........- A.... SEQ ID NO: 38 T0170PMP056C02: ......................A...E.Y......................T.A.VA....F.Q.........- A.... SEQ ID NO: 97 T0170PMP070G06: ...................P..A...E.Y......................T.A.VA....F...........- A.... SEQ ID NO: 89 T0170PMP069G08: ......................A...E.Y.......Q..............T.A.VA....F...........- A.... SEQ ID NO: 94 T0170PMP070E07: ......................A...E.Y......................T.A.VA....F..........G- A.... SEQ ID NO: 70 T0170PMP068D07: ......................A...E.Y......................T.A.VA....F...........- V.... SEQ ID NO: 51 T0170PMP056G11: ......................A...E.Y......................T.A.AA....F..........G- A.... SEQ ID NO: 67 T0170PMP068C07: ......................A...E.Y......................T.A.AA....F...........- A.... SEQ ID NO: 84 T0170PMP069E02: ......................A...E.Y......................T.A.AA....F...........- A.... SEQ ID NO: 68 T0170PMP068C11: ......................A...E.Y......................T.A.AA....F...........- A.... SEQ ID NO: 72 T0170PMP068E08: ......................A...E.Y......................T.A.AA....F...........- A.... SEQ ID NO: 46 T0170PMP056E02: ..............E.......A...E.Y......................T.A.VA....F....L......- A.... SEQ ID NO: 35 T0170PMP056A10: ......................AV..S..LL..............GV....T.A.A...SHF...........- A.... SEQ ID NO: 42 T0170PMP056C10: ......................AV..S..LL...............M.T..T.A.A...SHF...........- A.... SEQ ID NO: 16 T0170PMP055B02: ......................A...S..LL........C......M....T.A.A...SHF...........- A.... SEQ ID NO: 34 T0170PMP056A08: ......................A...S..LL...............M....T.A.A...SHF...........- A.... SEQ ID NO: 40 T0170PMP056C04: ......................A...S..LL...............M....T.A.A...SHF...........- A.... SEQ ID NO: 53 T0170PMP057D06: ......................A...S..LL...............M....T.A.A...SHF...........- A.... SEQ ID NO: 7 T0170PMP053A03: ......................AV..S..LL...............M....T.A.A...SHF...........- A.... SEQ ID NO: 85 T0170PMP069E07: ......................A...S..LL...............M....T.A.A...SHF...........- A.... SEQ ID NO: 18 T0170PMP055B11: ......................A...S..LL...............M....T.A.A....HF...........- A.... SEQ ID NO: 48 T0170PMP056F08: ..................G...A...S..LL...............M....T.A.A....HF...........- A.... SEQ ID NO: 91 T0170PMP070B09: ......................A...S..LL....................T.A.A...SHF...........- A.... SEQ ID NO: 73 T0170PMP068F04: ......................A...S..LL...............M....T.A.V...SYF...........- A.... SEQ ID NO: 14 T0170PMP055A10: ......................A...S..LL...............M......A.A....HF...........- A.... SEQ ID NO: 17 T0170PMP055B03: ...................P..A...S..LL...............M....T.A.A....HF...........- A.... SEQ ID NO: 52 T0170PMP057B02: ..........W...........A...S.Y.....S.......H...L..T.T...AA................- AR...
TABLE-US-00049 TABLE A-6 Sequence alignment of TCR cluster A binders-part 3 continued 79 90 100 110 Kabat # | ab | |a | SEQ ID NO: 50 T0170PMP056G05: YLQMNSLKPEDTAVYFCRAFSRIYPYDYWGQGTLVTVSS SEQ ID NO: 41 T0170PMP056C07: ...................G..........R........ SEQ ID NO: 92 T0170PMP070C09: ...................G................... SEQ ID NO: 98 T0170PMP082B04: ...................G................... SEQ ID NO: 33 T0170PMP056A02: ...................G...W.........Q..... SEQ ID NO: 31 T0170PMP055G05: ...................G.............Q..... SEQ ID NO: 78 T0170PMP069B08: ...................G................... SEQ ID NO: 20 T0170PMP055C06: .....N.............G.............Q..... SEQ ID NO: 23 T0170PMP055D06: F....N.............G.............Q..... SEQ ID NO: 25 T0170PMP055E01: ...................G...W.........Q..... SEQ ID NO: 27 T0170PMP055F02: ...................G...W............... SEQ ID NO: 38 T0170PMP056C02: ...................G...W.........Q..... SEQ ID NO: 97 T0170PMP070G06: ...................G...W.........Q..... SEQ ID NO: 89 T0170PMP069G08: ...................G...W............... SEQ ID NO: 94 T0170PMP070E07: ...................G...W............... SEQ ID NO: 70 T0170PMP068D07: ...................G...W............... SEQ ID NO: 51 T0170PMP056G11: ...................G...W.........Q..... SEQ ID NO: 67 T0170PMP068C07: ...................G...W.........Q..... SEQ ID NO: 84 T0170PMP069E02: ...................G...W............... SEQ ID NO: 68 T0170PMP068C11: ...................G.............Q..... SEQ ID NO: 72 T0170PMP068E08: .......R...........G...W.........Q..... SEQ ID NO: 46 T0170PMP056E02: ...................G...W............... SEQ ID NO: 35 T0170PMP056A10: .......R...........G.............Q..... SEQ ID NO: 42 T0170PMP056C10: .......R...........G.............Q..... SEQ ID NO: 16 T0170PMP055B02: .......R...........G................... SEQ ID NO: 34 T0170PMP056A08: .......R...........G................... SEQ ID NO: 40 T0170PMP056C04: .......R...........G..........H........ SEQ ID NO: 53 T0170PMP057D06: .......R...........G.............Q..... SEQ ID NO: 7 T0170PMP053A03: .......R...........G................... SEQ ID NO: 85 T0170PMP069E07: .....G.R...........G................... SEQ ID NO: 18 T0170PMP055B11: .......R...........G................... SEQ ID NO: 48 T0170PMP056F08: .......R...........G................... SEQ ID NO: 91 T0170PMP070B09: .....N.R...........G................... SEQ ID NO: 73 T0170PMP068F04: .......R...........G.............Q..... SEQ ID NO: 14 T0170PMP055A10: .......R...........G..........R..Q..... SEQ ID NO: 17 T0170PMP055B03: .......R...........G.............Q..... SEQ ID NO: 52 T0170PMP057B02: .............L...H.G..L...N......Q.....
TABLE-US-00050 TABLE A-7 Sequence alignment of TCR cluster B binders 1 10 20 30 40 50 60 70 77 Kabat # | a | | | | | | | | SEQ ID NO: 106 T0170PMP055C07: EVQLVE-SGGGLVQPGGSLRLSCITSGETFKINIWGWYRQAPGKQRELVASLTIGGATNYADSVKGRFTISED- SAKNT SEQ ID NO: 105 T0170PMP055B06: ......-...................................................D..............- ..... SEQ ID NO: 115 T0170PMP070C01: ......-..................................................................- ...D. SEQ ID NO: 108 T0170PMP056B02: ......-.................................T................................- ..... SEQ ID NO: 109 T0170PMP056D07: ......-....................Q.............................................- ..... SEQ ID NO: 112 T0170PMP069E03: ......-..................................................................- ..... SEQ ID NO: 111 T0170PMP068G05: ......E..................................................................- ..... SEQ ID NO: 114 T0170PMP070A09: ......-..................................................................- ..... SEQ ID NO: 107 T0170PMP055D01: ......-.....................................R............................- ..... SEQ ID NO: 110 T0170PMP068B03: ......-........................V........G................................- ..... SEQ ID NO: 113 T0170PMP069E06: ......-................L.......V........G................................- ..... 78 90 100 110 Kabat # | abc | |a | SEQ ID NO: 106 T0170PMP055C07: VYLQMNSLKPEDTAVYFCNAKSRLYPYDYWGQGTLVTVSS SEQ ID NO: 105 T0170PMP055B06: .........A........................Q..... SEQ ID NO: 115 T0170PMP070C01: ........................................ SEQ ID NO: 108 T0170PMP056B02: ..................................Q..... SEQ ID NO: 109 T0170PMP056D07: ..................................Q..... SEQ ID NO: 112 T0170PMP069E03: ..............................D...Q..... SEQ ID NO: 111 T0170PMP068G05: .......................I.......R..Q..... SEQ ID NO: 114 T0170PMP070A09: .......................I.......R..Q..... SEQ ID NO: 107 T0170PMP055D01: ..........................I.......Q..... SEQ ID NO: 110 T0170PMP068B03: ...............................R..Q..... SEQ ID NO: 113 T0170PMP069E06: .....S............................Q.....
TABLE-US-00051 TABLE A-8 Sequence alignment of TCR cluster C binders 1 10 20 30 40 50 60 70 78 Kabat # | | | | | | | | | SEQ ID NO: 116 T0170PMP061G01 EVQLVESGGGLVQPGGSLRLSCAASGEIGRINFYRWYRQAPGNQREVVATITIADKTDYADSAKGRFTISRDE- SRNMV SEQ ID NO: 118 T0170PMP075D02 .........................................................................- ..... SEQ ID NO: 117 T0170PMP062D02 .............................................G..........I................- ..... 79 90 100 110 Kabat # | abc | |a | SEQ ID NO: 116 T0170PMP061G01 YLQMSSLKPEDTAVYFCHAGSRLYPYDYWGQGTQVTVSS SEQ ID NO: 118 T0170PMP075D02 ..........N............................ SEQ ID NO: 117 T0170PMP062D02 ....G..................................
TABLE-US-00052 TABLE A-4 Sequences for CDRs and frameworks, plus preferred combinations as provided in formula I, namely FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4. ''SEQ'' refers to the given SEQ ID NO. The first column refers to the SEQ ID NO of the complete ISV, i.e. FR1-CDR1-FR2-CDR2-FR3- CDR3-FR4. CDR1, CDR2 and CDR3 were determined according to Kontermann, 2010. SEQ Nanobody SEQ FR1 SEQ CDR1 SEQ FR2 SEQ CDR2 SEQ FR3 SEQ CDR3 SEQ FR4 1 T0170PMP 175 EVQLVESGGGLVQ 119 GSVHKIN 203 WYRQAPGKE 134 TITIGD 235 YADSAKGRFTISRDEAKNMV 164 GSRLYPYNY 285 WGQGTQ 027A05 PGGSLRLSCAAS FLG RELVA TTD YLQMNSLKPEDTAVHFCRA VTVSS 2 T0170PMP 175 EVQLVESGGGLVQ 119 GSVHKIN 204 WYRQAPGKE 134 TITIGD 236 YADYAKGRFTISRDEARNMV 164 GSRLYPYNY 285 WGQGTQ 028B01 PGGSLRLSCAAS FLG RGLVA TTD YLQMNSLKPEDTAVYFCRA VTVSS 3 T0170PMP 176 EVQLVESGGGLVQ 119 GSVHKIN 205 WYRQAPGKE 135 TITIGD 237 YADSAKGRFTISRDEAKNMV 164 GSRLYPYNY 285 WGQGTQ 028F10 PGRSLRLPCAAS FLG REMVA AID YLQMNSLKPEDTAVYFCRA VTVSS 4 T0170PMP 175 EVQLVESGGGLVQ 119 GSVHKIN 203 WYRQAPGKE 134 TITIGD 236 YADYAKGRFTISRDEARNMV 164 GSRLYPYNY 286 WGQGTL 028G06 PGGSLRLSCAAS FLG RELVA TTD YLQMNSLKPEDTAVYFCRA VTVSS 5 T0170PMP 175 EVQLVESGGGLVQ 119 GSVHKIN 205 WYRQAPGKE 135 TITIGD 237 YADSAKGRFTISRDEAKNMV 164 GSRLYPYNY 286 WGQGTL 029F08 PGGSLRLSCAAS FLG REMVA AID YLQMNSLKPEDTAVYFCRA VTVSS 6 T0170PMP 175 EVQLVESGGGLVQ 119 GSVHKIN 203 WYRQAPGKE 134 TITIGD 237 YADSAKGRFTISRDEAKNMV 164 GSRLYPYNY 285 WGQGTQ 040C01 PGGSLRLSCAAS FLG RELVA TTD YLQMNSLKPEDTAVYFCRA VTVSS 7 T0170PMP 177 EVQLVESGGGLVQ 120 GSVHLLN 205 WYRQAPGKE 136 HITIAD 238 YSHFAKGRFTISRDEAKNMV 165 GSRIYPYDY 286 WGQGTL 053A03 PGGSLRLSCAVS FLG REMVA AID YLQMNSLRPEDTAVYFCRA VTVSS 8 T0170PMP 178 EVQLVESGGGLVQ 121 GAVHKIN 206 WYRQTPEKE 137 TITIGD 239 YADSAKGRFTISRDEAKNMV 164 GSRLYPYNY 286 WGQGTL 053D01 PGGSLKLSCAAS FLG REMVA DVD YLQMTSLKPEDTAVYVCRA VTVSS 9 T0170PMP 179 EVQLVESGGGLVQ 122 GDVHKIN 207 WYRQAPAKE 138 HITIGD 240 YAESAKGRFTISRDEAKNMV 166 YSRIYPYNY 285 WGQGTQ 053E10 PGGSLRLSCRAS ILG REMVA AID YLQMNSLKPEDTAVYFCRA VTVSS 10 T0170PMP 180 EVQLVESGGGLVR 122 GDVHKIN 207 WYRQAPAKE 138 HITIGD 237 YADSAKGRFTISRDEAKNMV 166 YSRIYPYNY 286 WGQGTL 055A01 PGGSLRLSCAAS ILG REMVA AID YLQMNSLKPEDTAVYFCRA VTVSS 11 T0170PMP 175 EVQLVESGGGLVQ 122 GDVHKIN 207 WYRQAPAKE 138 HITIGD 237 YADSAKGRFTISRDEAKNMV 166 YSRIYPYNY 286 WGQGTL 055A02 PGGSLRLSCAAS ILG REMVA AID YLQMNSLKPEDTAVYFCRA VTVSS 12 T0170PMP 181 EVQLVESGGGLVQ 123 GDVHKIN 208 WYRQAPGKE 139 HITIGD 237 YADSAKGRFTISRDEAKNMV 165 GSRIYPYDY 285 WGQGTQ 055A03 PGGSLRLSCVAS FLG REKVA QAD YLQMNSLKPEDTAVYFCRA VTVSS 13 T0170PMP 182 EVQLVESGGGSVQ 119 GSVHKIN 205 WYRQAPGKE 135 TITIGD 241 YADSAKGRFTISRDEAKNMV 164 GSRLYPYNY 286 WGQGTL 055A08 PGGSLRLSCAAS FLG REMVA AID YLQMNSLSPEDTAVYFCRA VTVSS 14 T0170PMP 175 EVQLVESGGGLVQ 120 GSVHLLN 205 WYRQAPGKE 140 HISIAD 242 YAHFAKGRFTISRDEAKNMV 165 GSRIYPYDY 287 WGRGTQ 055A10 PGGSLRLSCAAS FLG REMVA AID YLQMNSLRPEDTAVYFCRA VTVSS 15 T0170PMP 179 EVQLVESGGGLVQ 122 GDVHKIN 207 WYRQAPAKE 141 HITIGD 240 YAESAKGRFTISRDEAKNMV 166 YSRIYPYNY 285 WGQGTQ 055B01 PGGSLRLSCRAS ILG REMVA ATV YLQMNSLKPEDTAVYFCRA VTVSS 16 T0170PMP 175 EVQLVESGGGLVQ 120 GSVHLLN 209 WYRQCPGKE 136 HITIAD 238 YSHFAKGRFTISRDEAKNMV 165 GSRIYPYDY 286 WGQGTL 055B02 PGGSLRLSCAAS FLG REMVA AID YLQMNSLRPEDTAVYFCRA VTVSS 17 T0170PMP 183 EVQLVESGGGLVQ 120 GSVHLLN 205 WYRQAPGKE 136 HITIAD 242 YAHFAKGRFTISRDEAKNMV 165 GSRIYPYDY 285 WGQGTQ 055B03 PGGSLRPSCAAS FLG REMVA AID YLQMNSLRPEDTAVYFCRA VTVSS 18 T0170PMP 175 EVQLVESGGGLVQ 120 GSVHLLN 205 WYRQAPGKE 136 HITIAD 242 YAHFAKGRFTISRDEAKNMV 165 GSRIYPYDY 286 WGQGTL 055B11 PGGSLRLSCAAS FLG REMVA AID YLQMNSLRPEDTAVYFCRA VTVSS 19 T0170PMP 178 EVQLVESGGGLVQ 121 GAVHKIN 206 WYRQTPEKE 143 HITIGD 244 YADSAKGRFTISRDEAKNMV 164 GSRLYPYNY 285 WGQGTQ 055C02 PGGSLKLSCAAS FLG REMVA EVD YLQMTSLTPEDTAVYVCRA VTVSS 20 T0170PMP 185 EVQLVESGGGLVH 123 GDVHKIN 211 WHRQPPGKE 144 HITIGD 245 YADSAKGRFTISRDEAKNMV 165 GSRIYPYDY 285 WGQGTQ 055C06 PGGSLRLSCAAS FLG REKVA VTD YLQMNNLKPEDTAVYFCRA VTVSS 21 T0170PMP 175 EVQLVESGGGLVQ 125 GDVHKIN 207 WYRQAPAKE 138 HITIGD 247 YADSAKGRFTISRDEAKNMV 166 YSRIYPYNY 285 WGQGTQ 055C10 PGGSLRLSCAAS VLG REMVA AID HLQMNSLKPEDTAVYFCRA VTVSS 22 T0170PMP 175 EVQLVESGGGLVQ 122 GDVHKIN 207 WYRQAPAKE 146 HITIGD 237 YADSAKGRFTISRDEAKNMV 166 YSRIYPYNY 286 WGQGTL 055D03 PGGSLRLSCAAS ILG REMVA ATN YLQMNSLKPEDTAVYFCRA VTVSS 23 T0170PMP 175 EVQLVESGGGLVQ 123 GDVHKIN 213 WHRQAPGKE 144 HITIGD 248 YADSAKGRFTISRDEAKNMV 165 GSRIYPYDY 285 WGQGTQ 055D06 PGGSLRLSCAAS FLG REKVA VTD FLQMNNLKPEDTAVYFCRA VTVSS 24 T0170PMP 175 EVQLVESGGGLVQ 122 GDVHKIN 207 WYRQAPAKE 138 HITIGD 249 YAGSAKGRFTISRDEAKNMV 166 YSRIYPYNY 286 WGQGTL 055D10 PGGSLRLSCAAS ILG REMVA AID YLQMNSLKPEDTAVYFCRA VTVSS 25 T0170PMP 175 EVQLVESGGGLVQ 126 GEVYKIN 208 WYRQAPGKE 147 HITIAD 250 YADFAKGRFTISRDEAKNMV 169 GSRIWPYDY 285 WGQGTQ 055E01 PGGSLRLSCAAS FLG REKVA VAD YLQMNSLKPEDTAVYFCRA VTVSS 26 T0170PMP 178 EVQLVESGGGLVQ 121 GAVHKIN 214 WYRQAPEKE 148 TITIGD 251 YADSAKGRFTISRDEAKNMV 164 GSRLYPYNY 285 WGQGTQ 055E05 PGGSLKLSCAAS FLG REMVA EVD YLQMTSLKPEDTTVYVCRA VTVSS 27 T0170PMP 175 EVQLVESGGGLVQ 126 GEVYKIN 208 WYRQAPGKE 147 HITIAD 250 YADFAKGRFTISRDEAKNMV 169 GSRIWPYDY 286 WGQGTL 055F02 PGGSLRLSCAAS FLG REKVA VAD YLQMNSLKPEDTAVYFCRA VTVSS 28 T0170PMP 181 EVQLVESGGGLVQ 122 GDVHKIN 208 WYRQAPGKE 149 HISISD 252 YAESAKGRFTISRDESKNMV 170 FSRIYPYDY 286 WGQGTL 055F03 PGGSLRLSCVAS ILG REKVA QTD YLQMNSLKPEDTAVYLCRA VTVSS 29 T0170PMP 175 EVQLVESGGGLVQ 119 GSVHKIN 203 WYRQAPGKE 135 TITIGD 236 YADYAKGRFTISRDEARNMV 164 GSRLYPYNY 286 WGQGTL 055F06 PGGSLRLSCAAS FLG RELVA AID YLQMNSLKPEDTAVYFCRA VTVSS 30 T0170PMP 175 EVQLVESGGGLVQ 122 GDVHKIN 207 WYRQAPAKE 138 HITIGD 253 YADSAKGRFAISRDEAKNMV 166 YSRIYPYNY 286 WGQGTL 055F08 PGGSLRLSCAAS ILG REMVA AID YLQMNSLKPEDTAVYFCRA VTVSS 31 T0170PMP 175 EVQLVESGGGLVQ 123 GDVHKIN 213 WHRQAPGKE 138 HITIGD 237 YADSAKGRFTISRDEAKNMV 165 GSRIYPYDY 285 WGQGTQ 055G05 PGGSLRLSCAAS FLG REKVA AID YLQMNSLKPEDTAVYFCRA VTVSS 32 T0170PMP 182 EVQLVESGGGSVQ 119 GSVHKIN 215 WYRQAPGKE 135 TITIGD 241 YADSAKGRFTISRDEAKNMV 164 GSRLYPYNY 285 WGQGTQ 055G09 PGGSLRLSCAAS FLG REVVA AID YLQMNSLSPEDTAVYFCRA VTVSS 33 T0170PMP 186 EVQLVESGGGLVQ 123 GDVHKIN 208 WYRQAPGKE 150 HITIGD 237 YADSAKGRFTISRDEAKNMV 169 GSRIWPYDY 285 WGQGTQ 056A02 PGGSARLSCVAS FLG REKVA QTD YLQMNSLKPEDTAVYFCRA VTVSS 34 T0170PMP 175 EVQLVESGGGLVQ 120 GSVHLLN 205 WYRQAPGKE 136 HITIAD 238 YSHFAKGRFTISRDEAKNMV 165 GSRIYPYDY 286 WGQGTL 056A08 PGGSLRLSCAAS FLG REMVA AID YLQMNSLRPEDTAVYFCRA VTVSS 35 T0170PMP 177 EVQLVESGGGLVQ 120 GSVHLLN 216 WYRQAPGKE 136 HITIAD 238 YSHFAKGRFTISRDEAKNMV 165 GSRIYPYDY 285 WGQGTQ 056A10 PGGSLRLSCAVS FLG RGVVA AID YLQMNSLRPEDTAVYFCRA VTVSS 36 T0170PMP 187 EVQLVESGGGLVQ 122 GDVHKIN 207 WYRQAPAKE 138 HITIGD 237 YADSAKGRFTISRDEAKNMV 166 YSRIYPYNY 286 WGQGTL 056B11 AGGSLTLSCAAS ILG REMVA AID YLQMNSLKPEDTAVYFCRA VTVSS 37 T0170PMP 175 EVQLVESGGGLVQ 127 GGVHKIN 207 WYRQAPAKE 138 HITIGD 237 YADSAKGRFTISRDEAKNMV 166 YSRIYPYNY 286 WGQGTL 056C01 PGGSLRLSCAAS ILG REMVA AID YLQMNSLKPEDTAVYFCRA VTVSS 38 T0170PMP 175 EVQLVESGGGLVQ 126 GEVYKIN 208 WYRQAPGKE 147 HITIAD 254 YADFAQGRFTISRDEAKNMV 169 GSRIWPYDY 285 WGQGTQ 056C02 PGGSLRLSCAAS FLG REKVA VAD YLQMNSLKPEDTAVYFCRA VTVSS 39 T0170PMP 175 EVQLVESGGGLVQ 122 GDVHKIN 207 WYRQAPAKE 151 HITIGD 237 YADSAKGRFTISRDEAKNMV 166 YSRIYPYNY 285 WGQGTQ 056C03 PGGSLRLSCAAS ILG REMVA TTD YLQMNSLKPEDTAVYFCRA VTVSS 40 T0170PMP 175 EVQLVESGGGLVQ 120 GSVHLLN 205 WYRQAPGKE 136 HITIAD 238 YSHFAKGRFTISRDEAKNMV 165 GSRIYPYDY 288 WGHGTL 056C04 PGGSLRLSCAAS FLG REMVA AID YLQMNSLRPEDTAVYFCRA VTVSS 41 T0170PMP 181 EVQLVESGGGLVQ 123 GDVHKIN 208 WYRQAPGKE 139 HITIGD 237 YADSAKGRFTISRDEAKNMV 165 GSRIYPYDY 289 WGRGTL 056C07 PGGSLRLSCVAS FLG REKVA QAD YLQMNSLKPEDTAVYFCRA VTVSS 42 T0170PMP 177 EVQLVESGGGLVQ 120 GSVHLLN 218 WYRQAPGKE 136 HITIAD 238 YSHFAKGRFTISRDEAKNMV 165 GSRIYPYDY 285 WGQGTQ 056C10 PGGSLRLSCAVS FLG REMVT AID YLQMNSLRPEDTAVYFCRA VTVSS 43 T0170PMP 188 EVQLVESGGDLVQ 123 GDVHKIN 205 WYRQAPGKE 136 HITIAD 255 YAEFAKGRFTISRDEPKNMV 171 GSRIYPYNY 285 WGQGTQ 056D01 PGGSLRLSCAAS FLG REMVA AID HLQMNSLKPEDTAVYLCRA VTVSS 44 T0170PMP 175 EVQLVESGGGLVQ 122 GDVHKIN 207 WYRQAPAKE 138 HITIGD 237 YADSAKGRFTISRDEAKNMV 166 YSRIYPYNY 287 WGRGTQ 056D02 PGGSLRLSCAAS ILG REMVA AID YLQMNSLKPEDTAVYFCRA VTVSS 45 T170PMP 181 EVQLVESGGGLVQ 122 GDVHKIN 208 WYRQAPGKE 152 RISISD 252 YAESAKGRFTISRDESKNMV 170 FSRIYPYDY 286 WGQGTL 056D11 PGGSLRLSCVAS ILG REKVA QTD YLQMNSLKPEDTAVYLCRA VTVSS 46 T0170PMP 189 EVQLVESGGGLVQ 126 GEVYKIN 208 WYRQAPGKE 147 HITIAD 256 YADFAKGRLTISRDEAKNMV 169 GSRIWPYDY 286 WGQGTL 056E02 PEGSLRLSCAAS FLG REKVA VAD YLQMNSLKPEDTAVYFCRA VTVSS 47 T0170PMP 190 EVQLVESGGGLVQ 121 GAVHKIN 206 WYRQTPEKE 148 TITIGD 239 YADSAKGRFTISRDEAKNMV 164 GSRLYPYNY 286 WGQGTL 056F01 PGGSLKLPCAAS FLG REMVA EVD YLQMTSLKPEDTAVYVCRA VTVSS 48 T0170PMP 191 EVQLVESGGGLVQ 120 GSVHLLN 205 WYRQAPGKE 136 HITIAD 242 YAHFAKGRFTISRDEAKNMV 165 GSRIYPYDY 286 WGQGTL 056F08 PGGSLGLSCAAS FLG REMVA AID YLQMNSLRPEDTAVYFCRA VTVSS 49 T0170PMP 192 EVQLVESGGGLAQ 122 GDVHKIN 207 WYRQAPAKE 138 HITIGD 237 YADSAKGRFTISRDEAKNMV 166 YSRIYPYNY 286 WGQGTL 056G02 PGGSLRLSCAAS ILG REMVA AID YLQMNSLKPEDTAVYFCRA VTVSS 50 T0170PMP 181 EVQLVESGGGLVQ 123 GDVHKIN 208 WYRQAPGKE 153 HISIGD 257 YADSAKGRFTISRDESKNMV 170 FSRIYPYDY 286 WGQGTL 056G05/ PGGSLRLSCVAS FLG REKVA QTD YLQMNSLKPEDTAVYFCRA VTVSS T0170PMP 069C08 51 T0170PMP 175 EVQLVESGGGLVQ 126 GEVYKIN 208 WYRQAPGKE 154 HITIAD 258 YADFAKGRFTISRDGAKNMV 169 GSRIWPYDY 285 WGQGTQ 056G11 PGGSLRLSCAAS FLG REKVA AAD YLQMNSLKPEDTAVYFCRA VTVSS 52 T0170PMP 193 EVQLVESGGGWVQ 129 GSVYKIN 219 WYRQAPGHE 155 TITIGD 259 YADSAKGRFTISRDEARNMV 164 GSRLYPYNY 285 WGQGTQ 057B02 PGGSLRLSCAAS FLS RELVA AAD YLQMNSLKPEDTALYFCHA VTVSS 53 T0170PMP 175 EVQLVESGGGLVQ 120 GSVHLLN 205 WYRQAPGKE 136 HITIAD 238 YSHFAKGRFTISRDEAKNMV 165 GSRIYPYDY 285 WGQGTQ 057D06 PGGSLRLSCAAS FLG REMVA AID YLQMNSLRPEDTAVYFCRA VTVSS 54 T0170PMP 181 EVQLVESGGGLVQ 122 GDVHKIN 208 WYRQAPGKE 156 HIAISD 252 YAESAKGRFTISRDESKNMV 170 FSRIYPYDY 286 WGQGTL 061A02 PGGSLRLSCVAS ILG REKVA QTD YLQMNSLKPEDTAVYLCRA VTVSS 55 T0170PMP 175 EVQLVESGGGLVQ 122 GDVHKIN 207 WYRQAPAKE 138 HITIGD 260 YADSAKGRFTISRDEAKNMV 166 YSRIYPYNY 286 WGQGTL 061B04 PGGSLRLSCAAS ILG REMVA AID YLQMNSLKPEDTAAYFCRA VTVSS 56 T0170PMP 175 EVQLVESGGGLVQ 122 GDVHKIN 222 WYRQAPAKE 138 HITIGD 237 YADSAKGRFTISRDEAKNMV 166 YSRIYPYNY 285 WGQGTQ 067A01 PGGSLRLSCAAS ILG RGMVA AID YLQMNSLKPEDTAVYFCRA VTVSS 57 T0170PMP 175 EVQLVESGGGLVQ 122 GDVHKIN 223 WYRQAPAKE 138 HITIGD 237 YADSAKGRFTISRDEAKNMV 166 YSRIYPYNY 286 WGQGTL 067A03 PGGSLRLSCAAS ILG HEMVA AID YLQMNSLKPEDTAVYFCRA VTVSS 58 T0170PMP 175 EVQLVESGGGLVQ 122 GDVHKIN 224 WYRQAPARE 138 HITIGD 237 YADSAKGRFTISRDEAKNMV 166 YSRIYPYNY 285 WGQGTQ 067B06 PGGSLRLSCAAS ILG REMVA AID YLQMNSLKPEDTAVYFCRA VTVSS 59 T0170PMP 175 EVQLVESGGGLVQ 122 GDVHKIN 207 WYRQAPAKE 138 HITIGD 263 YADSAKGRFTISRDEAENMV 166 YSRIYPYNY 286 WGQGTL 067C09 PGGSLRLSCAAS ILG REMVA AID YLQMNSLKPEDTAVYFCRA VTVSS 60 T0170PMP 178 EVQLVESGGGLVQ 121 GAVHKIN 206 WYRQTPEKE 148 TITIGD 239 YADSAKGRFTISRDEAKNMV 164 GSRLYPYNY 286 WGQGTL
067D01 PGGSLKLSCAAS FLG REMVA EVD YLQMTSLKPEDTAVYVCRA VTVSS 61 T0170PMP 178 EVQLVESGGGLVQ 121 GAVHKIN 214 WYRQAPEKE 148 TITIGD 264 YADSAKGRFTISRDEATNMV 171 GSRIYPYNY 285 WGQGTQ 067D06 PGGSLKLSCAAS FLG REMVA EVD YLQMTSLKPEDTAVYFCRA VTVSS 62 T0170PMP 175 EVQLVESGGGLVQ 122 GDVHKIN 207 WYRQAPAKE 159 HITIGD 265 YAGSAKGRFTISRDEAKNMV 166 YSRIYPYNY 286 WGQGTL 067D09 PGGSLRLSCAAS ILG REMVA ATS YLQLNNLKPEDTAVYFCRA VTVSS 63 T0170PMP 175 EVQLVESGGGLVQ 122 GDVHKIN 207 WYRQAPAKE 159 HITIGD 266 YADSAKGRFTISRDEAKNMV 166 YSRIYPYNY 286 WGQGTL 067E03 PGGSLRLSCAAS ILG REMVA ATS YLQLNNLKPEDTAVYFCRA VTVSS 64 T0170PMP 188 EVQLVESGGDLVQ 123 GDVHKIN 205 WYRQAPGKE 136 HITIAD 267 YAEFAKGRFTISRDEPKNMV 171 GSRIYPYNY 285 WGQGTQ 067E06 PGGSLRLSCAAS FLG REMVA AID YLQMNSLKPEDTAVYLCRA VTVSS 65 T0170PMP 178 EVQLVESGGGLVQ 121 GAVHKIN 206 WYRQTPEKE 148 TITIGD 268 YAHSAKGRFTISRDEAKNMV 164 GSRLYPYNY 285 WGQGTQ 067F02 PGGSLKLSCAAS FLG REMVA EVD YLQMTSLKPEDTAVYVCRA VTVSS 66 T0170PMP 178 EVQLVESGGGLVQ 121 GAVHKIN 206 WYRQTPEKE 160 TITIGD 239 YADSAKGRFTISRDEAKNMV 164 GSRLYPYNY 285 WGQGTQ 068C03 PGGSLKLSCAAS FLG REMVA EVA YLQMTSLKPEDTAVYVCRA VTVSS 67 T0170PMP 175 EVQLVESGGGLVQ 126 GEVYKIN 208 WYRQAPGKE 154 HITIAD 250 YADFAKGRFTISRDEAKNMV 169 GSRIWPYDY 285 WGQGTQ 068C07 PGGSLRLSCAAS FLG REKVA AAD YLQMNSLKPEDTAVYFCRA VTVSS 68 T0170PMP 175 EVQLVESGGGLVQ 126 GEVYKIN 208 WYRQAPGKE 154 HITIAD 250 YADFAKGRFTISRDEAKNMV 165 GSRIYPYDY 285 WGQGTQ 068C11 PGGSLRLSCAAS FLG REKVA AAD YLQMNSLKPEDTAVYFCRA VTVSS 69 T0170PMP 194 EVQLVESGGGSVQ 119 GSVHKIN 205 WYRQAPGKE 135 TITIGD 241 YADSAKGRFTISRDEAKNMV 164 GSRLYPYNY 285 WGQGTQ 068D05 PGGSLRPSCAAS FLG REMVA AID YLQMNSLSPEDTAVYFCRA VTVSS 70 T0170PMP 175 EVQLVESGGGLVQ 126 GEVYKIN 208 WYRQAPGKE 147 HITIAD 269 YADFAKGRFTISRDEVKNMV 169 GSRIWPYDY 286 WGQGTL 068D07 PGGSLRLSCAAS FLG REKVA VAD YLQMNSLKPEDTAVYFCRA VTVSS 71 T0170PMP 195 EVQLVESGGGLVQ 122 GDVHKIN 207 WYRQAPAKE 138 HITIGD 237 YADSAKGRFTISRDEAKNMV 166 YSRIYPYNY 286 WGQGTL 068E01 PGESLRLSCAAS ILG REMVA AID YLQMNSLKPEDTAVYFCRA VTVSS 72 T0170PMP 175 EVQLVESGGGLVQ 126 GEVYKIN 208 WYRQAPGKE 154 HITIAD 270 YADFAKGRFTISRDEAKNMV 169 GSRIWPYDY 285 WGQGTQ 068E08 PGGSLRLSCAAS FLG REKVA AAD YLQMNSLRPEDTAVYFCRA VTVSS 73 T0170PMP 175 EVQLVESGGGLVQ 120 GSVHLLN 205 WYRQAPGKE 161 HITIAD 271 YSYFAKGRFTISRDEAKNMV 165 GSRIYPYDY 285 WGQGTQ 068F04 PGGSLRLSCAAS FLG REMVA VTD YLQMNSLRPEDTAVYFCRA VTVSS 74 T0170PMP 175 EVQLVESGGGLVQ 122 GDVHKIN 207 WYRQAPAKE 138 HITIGD 272 YADSAKGRFTISRDEAKNVV 166 YSRIYPYNY 286 WGQGTL 068F06 PGGSLRLSCAAS ILG REMVA AID YLQMNSLKPEDTAVYFCRA VTVSS 75 T0170PMP 182 EVQLVESGGGSVQ 119 GSVHKIN 226 WYRQAPGKE 135 TITIGD 241 YADSAKGRFTISRDEAKNMV 164 GSRLYPYNY 285 WGQGTQ 068F08 PGGSLRLSCAAS FLG RGMVA AID YLQMNSLSPEDTAVYFCRA VTVSS 76 T0170PMP 178 EVQLVESGGGLVQ 121 GAVHKIN 206 WYRQTPEKE 148 TITIGD 273 YEDSAKGRFTISRDEAKNMV 164 GSRLYPYNY 286 WGQGTL 069A06 PGGSLKLSCAAS FLG REMVA EVD YLQMTGLKPEDTAVYVCRA VTVSS 77 T0170PMP 197 EVQLVESGGGLVR 122 GDVHKIN 208 WYRQAPGKE 149 HISISD 252 YAESAKGRFTISRDESKNMV 170 FSRIYPYDY 285 WGQGTQ 069B02 PGGSLRLSCVAS ILG REKVA QTD YLQMNSLKPEDTAVYLCRA VTVSS 78 T0170PMP 175 EVQLVESGGGLVQ 132 GDVYKIN 213 WHRQAPGKE 138 HITIGD 237 YADSAKGRFTISRDEAKNMV 165 GSRIYPYDY 286 WGQGTL 069B08 PGGSLRLSCAAS FLG REKVA AID YLQMNSLKPEDTAVYFCRA VTVSS 79 T0170PMP 179 EVQLVESGGGLVQ 122 GDVHKIN 227 WYRQAPAKE 138 HITIGD 240 YAESAKGRFTISRDEAKNMV 166 YSRIYPYNY 285 WGQGTQ 069C01 PGGSLRLSCRAS ILG REMIA AID YLQMNSLKPEDTAVYFCRA VTVSS 80 T0170PMP 175 EVQLVESGGGLVQ 122 GDVHKIN 228 WYRQAPAKG 138 HITIGD 237 YADSAKGRFTISRDEAKNMV 166 YSRIYPYNY 285 WGQGTQ 069C04 PGGSLRLSCAAS ILG REMVA AID YLQMNSLKPEDTAVYFCRA VTVSS 81 T0170PMP 188 EVQLVESGGDLVQ 123 GDVHKIN 205 WYRQAPGKE 136 HITIAD 267 YAEFAKGRFTISRDEPKNMV 173 GSRIYPYSY 285 WGQGTQ 069C05 PGGSLRLSCAAS FLG REMVA AID YLQMNSLKPEDTAVYLCRA VTVSS 82 T0170PMP 198 EVQLVESGGGMVQ 122 GDVHKIN 207 WYRQAPAKE 138 HITIGD 237 YADSAKGRFTISRDEAKNMV 166 YSRIYPYNY 286 WGQGTL 069D02 PGGSLRLSCAAS ILG REMVA AID YLQMNSLKPEDTAVYFCRA VTVSS 83 T0170PMP 175 EVQLVESGGGLVQ 122 GDVHKIN 229 WYRQVPAKE 138 HITIGD 260 YADSAKGRFTISRDEAKNMV 166 YSRIYPYNY 286 WGQGTL 069D07 PGGSLRLSCAAS ILG REMVA AID YLQMNSLKPEDTAAYFCRA VTVSS 84 T0170PMP 175 EVQLVESGGGLVQ 126 GEVYKIN 208 WYRQAPGKE 154 HITIAD 250 YADFAKGRFTISRDEAKNMV 169 GSRIWPYDY 286 WGQGTL 069E02 PGGSLRLSCAAS FLG REKVA AAD YLQMNSLKPEDTAVYFCRA VTVSS 85 T0170PMP 175 EVQLVESGGGLVQ 120 GSVHLLN 205 WYRQAPGKE 136 HITIAD 275 YSHFAKGRFTISRDEAKNMV 165 GSRIYPYDY 286 WGQGTL 069E07 PGGSLRLSCAAS FLG REMVA AID YLQMNGLRPEDTAVYFCRA VTVSS 86 T0170PMP 175 EVQLVESGGGLVQ 123 GDVHKIN 205 WYRQAPGKE 136 HITIAD 267 YAEFAKGRFTISRDEPKNMV 171 GSRIYPYNY 285 WGQGTQ 069E09 PGGSLRLSCAAS FLG REMVA AID YLQMNSLKPEDTAVYLCRA VTVSS 87 T0170PMP 175 EVQLVESGGGLVQ 133 GEVHKIN 230 WYRQCPGKE 135 TITIGD 237 YADSAKGRFTISRDEAKNMV 174 LSRLYPYNY 286 WGQGTL 069E11 PGGSLRLSCAAS ILG RDMVA AID YLQMNSLKPEDTAVYFCRA VTVSS 88 T0170PMP 175 EVQLVESGGGLVQ 122 GDVHKIN 207 WYRQAPAKE 138 HITIGD 276 YADSAKGRFTISRDEAKNMV 166 YSRIYPYNY 285 WGQGTQ 069F05 PGGSLRLSCAAS ILG REMVA AID YLQMNSLKPEDTAVYLCRA VTVSS 89 T0170PMP 175 EVQLVESGGGLVQ 126 GEVYKIN 231 WQRQAPGKE 147 HITIAD 250 YADFAKGRFTISRDEAKNMV 169 GSRIWPYDY 286 WGQGTL 069G08 PGGSLRLSCAAS FLG REKVA VAD YLQMNSLKPEDTAVYFCRA VTVSS 90 T0170PMP 188 EVQLVESGGDLVQ 123 GDVHKIN 205 WYRQAPGKE 136 HITIAD 277 YAEFAKGRFTISRDEPKNMV 171 GSRIYPYNY 286 WGQGTL 070B08 PGGSLRLSCAAS FLG REMVA AID YLQMNSLKPVDTAVYLCRA VTVSS 91 T0170PMP 175 EVQLVESGGGLVQ 120 GSVHLLN 208 WYRQAPGKE 136 HITIAD 278 YSHFAKGRFTISRDEAKNMV 165 GSRIYPYDY 286 WGQGTL 070B09 PGGSLRLSCAAS FLG REKVA AID YLQMNNLRPEDTAVYFCRA VTVSS 92 T0170PMP 200 EVQLVESGGGLVQ 123 GDVHKIN 208 WYRQAPGKE 139 HITIGD 237 YADSAKGRFTISRDEAKNMV 165 GSRIYPYDY 286 WGQGTL 070C09 PGGSPRLSCVAS FLG REKVA QAD YLQMNSLKPEDTAVYFCRA VTVSS 93 T0170PMP 175 EVQLVESGGGLVQ 122 GDVHKIN 207 WYRQAPAKE 138 HITIGD 280 YADSAKGRFTISRDEAKNMV 166 YSRIYPYNY 286 WGQGTL 070D07 PGGSLRLSCAAS ILG REMVA AID YLQMNSLKPEDAAVYFCRA VTVSS 94 T0170PMP 175 EVQLVESGGGLVQ 126 GEVYKIN 208 WYRQAPGKE 147 HITIAD 258 YADFAKGRFTISRDGAKNMV 169 GSRIWPYDY 286 WGQGTL 070E07 PGGSLRLSCAAS FLG REKVA VAD YLQMNSLKPEDTAVYFCRA VTVSS 95 T0170PMP 182 EVQLVESGGGSVQ 119 GSVHKIN 232 WYCQAPGKE 135 TITIGD 241 YADSAKGRFTISRDEAKNMV 164 GSRLYPYNY 285 WGQGTQ 070F11 PGGSLRLSCAAS FLG REMVA AID YLQMNSLSPEDTAVYFCRA VTVSS 96 T0170PMP 181 EVQLVESGGGLVQ 122 GDVHKIN 208 WYRQAPGKE 149 HISISD 281 YAESAKGRFTISRDESKNMV 170 FSRIYPYDY 285 WGQGTQ 070G02 PGGSLRLSCVAS ILG REKVA QTD YLQMNSLKPEDAAVYLCRA VTVSS 97 T0170PMP 183 EVQLVESGGGLVQ 126 GEVYKIN 208 WYRQAPGKE 147 HITIAD 250 YADFAKGRFTISRDEAKNMV 169 GSRIWPYDY 285 WGQGTQ 070G06 PGGSLRPSCAAS FLG REKVA VAD YLQMNSLKPEDTAVYFCRA VTVSS 98 T0170PMP 201 EVQLVESGGGLVQ 123 GDVHKIN 208 WYRQAPGKE 162 HITIAD 237 YADSAKGRFTISRDEAKNMV 165 GSRIYPYDY 286 WGQGTL 082B04 PGGSLRPSCVAS FLG REKVA QAD YLQMNSLKPEDTAVYFCRA VTVSS 99 T0170PMP 175 EVQLVESGGGLVQ 133 GEVHKIN 233 WYRQAPGKE 163 TITIGD 237 YADSAKGRFTISRDEAKNMV 174 LSRLYPYNY 286 WGQGTL 084B07 PGGSLRLSCAAS ILG RDMVA ETQ YLQMNSLKPEDTAVYFCRA VTVSS 100 T0170PMP 175 EVQLVESGGGLVQ 122 GDVHKIN 207 WYRQAPAKE 138 HITIGD 283 YADSAKGRFTISRDEAKNMV 166 YSRIYPYNY 286 WGQGTL 084C02 PGGSLRLSCAAS ILG REMVA AID YLQMDSLKPEDTAVYFCRA VTVSS 101 T0170PMP 175 EVQLVESGGGLVQ 122 GDVHKIN 207 WYRQAPAKE 138 HITIGD 284 YADSAKGRFTISRDEAKNMV 166 YSRIYPYNY 286 WGQGTL 084E03 PGGSLRLSCAAS ILG REMVA AID YLQMNSLKPGDTAVYFCRA VTVSS 102 T0170PMP 175 EVQLVESGGGLVQ 122 GDVHKIN 234 WHRQAPAKE 138 HITIGD 237 YADSAKGRFTISRDEAKNMV 166 YSRIYPYNY 286 WGQGTL 084E05 PGGSLRLSCAAS ILG REMVA AID YLQMNSLKPEDTAVYFCRA VTVSS 103 T0170PMP 175 EVQLVESGGGLVQ 122 GDVHKIN 234 WHRQAPAKE 138 HITIGD 260 YADSAKGRFTISRDEAKNMV 166 YSRIYPYNY 285 WGQGTQ 084F04 PGGSLRLSCAAS ILG REMVA AID YLQMNSLKPEDTAAYFCRA VTVSS 104 T0170PMP 202 EVQLVESGGGWVQ 122 GDVHKIN 207 WYRQAPAKE 138 HITIGD 237 YADSAKGRFTISRDEAKNMV 166 YSRIYPYNY 286 WGQGTL 084F10 AGGSLRLSCAAS ILG REMVA AID YLQMNSLKPEDTAVYFCRA VTVSS 105 T0170PMP 184 EVQLVESGGGLVQ 124 GETFKIN 210 WYRQAPGKQ 142 SLTIGG 243 YADSVKGRFTISEDSAKNTV 167 KSRLYPYDY 285 WGQGTQ 055B06 PGGSLRLSCITS IWG RELVA AID YLQMNSLKAEDTAVYFCNA VTVSS 106 T0170PMP 184 EVQLVESGGGLVQ 124 GETFKIN 210 WYRQAPGKQ 145 SLTIGG 246 YADSVKGRFTISEDSAKNTV 167 KSRLYPYDY 286 WGQGTL 055C07 PGGSLRLSCITS IWG RELVA ATN YLQMNSLKPEDTAVYFCNA VTVSS 107 T0170PMP 184 EVQLVESGGGLVQ 124 GETFKIN 212 WYRQAPGKR 145 SLTIGG 246 YADSVKGRFTISEDSAKNTV 168 KSRIYPYDY 285 WGQGTQ 055D01 PGGSLRLSCITS IWG RELVA ATN YLQMNSLKPEDTAVYFCNA VTVSS 108 T0170PMP 184 EVQLVESGGGLVQ 124 GETFKIN 217 WYRQTPGKQ 145 SLTIGG 246 YADSVKGRFTISEDSAKNTV 167 KSRLYPYDY 285 WGQGTQ 056B02 PGGSLRLSCITS IWG RELVA ATN YLQMNSLKPEDTAVYFCNA VTVSS 109 T0170PMP 184 EVQLVESGGGLVQ 128 GQTFKIN 210 WYRQAPGKQ 145 SLTIGG 246 YADSVKGRFTISEDSAKNTV 167 KSRLYPYDY 285 WGQGTQ 056D07 PGGSLRLSCITS IWG RELVA ATN YLQMNSLKPEDTAVYFCNA VTVSS 110 T0170PMP 184 EVQLVESGGGLVQ 131 GETFKVN 225 WYRQGPGKQ 145 SLTIGG 246 YADSVKGRFTISEDSAKNTV 167 KSRLYPYDY 287 WGRGTQ 068B03 PGGSLRLSCITS IWG RELVA ATN YLQMNSLKPEDTAVYFCNA VTVSS 111 T0170PMP 196 EVQLVEESGGGLV 124 GETFKIN 210 WYRQAPGKQ 145 SLTIGG 246 YADSVKGRFTISEDSAKNTV 168 KSRIYPYDY 287 WGRGTQ 068G05 QPGGSLRLSCITS IWG RELVA ATN YLQMNSLKPEDTAVYFCNA VTVSS 112 T0170PMP 184 EVQLVESGGGLVQ 124 GETFKIN 210 WYRQAPGKQ 145 SLTIGG 246 YADSVKGRFTISEDSAKNTV 167 KSRLYPYDY 290 WDQGTQ 069E03 PGGSLRLSCITS IWG RELVA ATN YLQMNSLKPEDTAVYFCNA VTVSS 113 T0170PMP 199 EVQLVESGGGLVQ 131 GETFKVN 225 WYRQGPGKQ 145 SLTIGG 274 YADSVKGRFTISEDSAKNTV 167 KSRLYPYDY 285 WGQGTQ 069E06 PGGSLRLSCLTS IWG RELVA ATN YLQMSSLKPEDTAVYFCNA VTVSS 114 T0170PMP 184 EVQLVESGGGLVQ 124 GETFKIN 210 WYRQAPGKQ 145 SLTIGG 246 YADSVKGRFTISEDSAKNTV 168 KSRIYPYDY 287 WGRGTQ 070A09 PGGSLRLSCITS IWG RELVA ATN YLQMNSLKPEDTAVYFCNA VTVSS 115 T0170PMP 184 EVQLVESGGGLVQ 124 GETFKIN 210 WYRQAPGKQ 145 SLTIGG 279 YADSVKGRFTISEDSAKDTV 167 KSRLYPYDY 286 WGQGTL 070C01 PGGSLRLSCITS IWG RELVA ATN YLQMNSLKPEDTAVYFCNA VTVSS 116 T0170PMP 175 EVQLVESGGGLVQ 130 GEIGRIN 220 WYRQAPGNQ 157 TITIAD 261 YADSAKGRFTISRDESRNMV 172 GSRLYPYDY 285 WGQGTQ 061G01 PGGSLRLSCAAS FYR REVVA KID YLQMSSLKPEDTAVYFCHA VTVSS 117 T0170PMP 175 EVQLVESGGGLVQ 130 GEIGRIN 221 WYRQAPGNQ 158 TITIAD 262 YADSAKGRFTISRDESRNMV 172 GSRLYPYDY 285 WGQGTQ 062D02 PGGSLRLSCAAS FYR RGVVA KID YLQMGSLKPEDTAVYFCHA VTVSS 118 T0170PMP 175 EVQLVESGGGLVQ 130 GEIGRIN 220 WYRQAPGNQ 157 TITIAD 282 YADSAKGRFTISRDESRNMV 172 GSRLYPYDY 285 WGQGTQ 075D02 PGGSLRLSCAAS FYR REVVA KID YLQMSSLKPENTAVYFCHA VTVSS
TABLE-US-00053 TABLE A-5 Sequences of multispecific polypeptides (with and without tags). ''SEQ'' refers to the given SEQ ID NO; ''ID'' refers to identification name; ''Sequence'' denotes amino acid sequence SEQ ID Sequence 291 1017000001 EVQLVESGGGLVQGGGSLSLSCAASGRTFSSYAMAWFRQPPGKEREFVASISWSGENTNYRNSVKGRFTISRD- NAKNTVYLQMNSLKPEDTAVYYCAA KIAKTYPDNWYWTKSNNYNYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVE- SGGGLVQGGGSLSLSCAASGRTFSSY AMAWFRQPPGKEREFVASISWSGENTNYRNSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAAKIAKTY- PDNWYWTKSNNYNYWGQGTLVTVSSG AADYKDHDGDYKDHDIDYKDDDDKGAAHHHHHH 292 1017000002 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGSVHKINFLGWYRQAPGKER- GLVATITIGDTTDYADYAKGRFTISR DEARNMVYLQMNSLKPEDTAVYFCRAGSRLYPYNYWGQGTLVTVSSGAADYKDHDGDYKDHDIDYKDDDDKG- AAHHHHHH 293 1017000003 EVQLQASGGGSVQAGGSLRLSCAASGYTIGPYCMGWFRQAPGKEREGVAAINMGGGITYYADSVKGRFTISQD- NAKNTVYLLMNSLEPEDTAIYYCAA DSTIYASYYECGHGLSTGGYGYDSWGQGTQVTVSSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGSVHKIN- FLGWYRQAPGKERGLVATITIGDTTD YADYAKGRFTISRDEARNMVYLQMNSLKPEDTAVYFCRAGSRLYPYNYWGQGTLVTVSSGAADYKDHDGDYK- DHDIDYKDDDDKGAAHHHHHH 294 1017000006 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSDVQLQASGGGSVQAGGSLRLSCAASGYTIGPYCMGWFRQAPGKER- EGVAAINMGGGITYYADSVKGRFTIS QDNAKNTVYLLMNSLEPEDTAIYYCAADSTIYASYYECGHGLSTGGYGYDSWGQGTQVTVSSGAADYKDHDG- DYKDHDIDYKDDDDKGAAHHHHHH 295 1017000007 EVQLVESGGGLVQPGGSLRLSCAASGSVHKINFLGWYRQAPGKERGLVATITIGDTTDYADYAKGRFTISRDE- ARNMVYLQMNSLKPEDTAVYFCRAG SRLYPYNYWGQGTLVTVSSGGGGSEVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFV- AEVRWGGVTTYSNSLKDRFSISEDSV KNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLVTVSSGAADYKDHDGDYKDHDIDYKDDDDKG- AAHHHHHH 296 1017000008 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGSEVQLVESGGGLVQPGGSLRLSCAASGSVHKINFLGWYRQAP- GKERGLVATITIGDTTDYADYAKGRF TISRDEARNMVYLQMNSLKPEDTAVYFCRAGSRLYPYNYWGQGTLVTVSSGAADYKDHDGDYKDHDIDYKDD- DDKGAAHHHHHH 297 1017000009 EVQLQASGGGSVQAGGSLRLSCAASGYTIGPYCMGWFRQAPGKEREGVAAINMGGGITYYADSVKGRFTISQD- NAKNTVYLLMNSLEPEDTAIYY.CA ADSTIYASYYECGHGLSTGGYGYDSWGQGTQVTVSSGGGGSGGGSEVQLVESGGGLVQPGGSLRLSCAASGS- VHKINFLGWYRQAPGKERGLVATITI GDTTDYADYAKGRFTISRDEARNMVYLQMNSLKPEDTAVYFCRAGSRLYPYNYWGQGTLVTVSSGAADYKDH- DGDYKDHDIDYKDDDDKGAAHHHHHH 298 1017000012 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGSDVQLQASGGGSVQAGGSLRLSCAASGYTIGPYCMGWFRQAP- GKEREGVAAINMGGGITYYADSVKGR FTISQDNAKNTVYLLMNSLEPEDTAIYYCAADSTIYASYYECGHGLSTGGYGYDSWGQGTQVTVSSGAADYK- DHDGDYKDHDIDYKDDDDKGAAHHHH HH 299 1017000013 EVQLVESGGGLVQPGGSLRLSCAASGSVHKINFLGWYRQAPGKERGLVATITIGDTTDYADYAKGRFTISRDE- ARNMVYLQMNSLKPEDTAVYFCRAG SRLYPYNYWGQGTLVTVSSGGGGSGGGSEVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKE- REFVAEVRWGGVTTYSNSLKDRFSIS EDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLVTVSSGAADYKDHDGDYKDHDIDYKDD- DDKGAAHHHHHH 300 1017000014 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCAASGSVHKINFLGWYRQAP GKERGLVATITIGDTTDYADYAKGRFTISRDEARNMVYLQMNSLKPEDTAVYFCRAGSRLYPYNYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 301 1017000015 EVQLQASGGGSVQAGGSLRLSCAASGYTIGPYCMGWFRQAPGKEREGVAAINMGGGITYYADSVKGRFTISQD- NAKNTVYLLMNSLEPEDTAIYYCAA DSTIYASYYECGHGLSTGGYGYDSWGQGTQVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEV- QLVESGGGLVQPGGSLRLSCAASGSV HKINFLGWYRQAPGKERGLVATIIIGDTTDYADYAKGRFTISRDEARNMVYLQMNSLKPEDTAVYFCRAGSR- LYPYNYWGQGTLVTVSSGAADYKDHD GDYKDHDIDYKDDDDKGAAHHHHHH 302 1017000018 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSDVQLQASGGGSVQAG- GSLRLSCAASGYTIGPYCMGWFRQAP GKEREGVAAINMGGGITYYADSVKGRFTISQDNAKNTVYLLMNSLEPEDTAIYYCAADSTIYASYYECGHGL- STGGYGYDSWGQGTQVTVSSGAADYK DHDGDYKDHDIDYKDDDDKGAAHHHHHH 303 1017000019 EVQLVESGGGLVQPGGSLRLSCAASGSVHKINFLGWYRQAPGKERGLVATITIGDTTDYADYAKGRFTISRDE- ARNMVYLQMNSLKPEDTAVYFCRAG SRLYPYNYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 304 1017000023 EVQLQASGGGSVQAGGSLRLSCAASGYTIGPYCMGWFRQAPGKEREGVAAINMGGGITYYADSVKGRFTISQD- NAKNTVYLLMNSLEPEDTAIYYCAA DSTIYASYYECGHGLSTGGYGYDSWGQGTQVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEV- QLVESGGGLVQPGGSLRLSCTFSGGT FSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQ- MYMTVVPDYWGQGTLVTVSSGAADYK DHDGDYKDHDIDYKDDDDKGAAHHHHHH 305 1017000025 EVQLVESGGGLVQPGGSLRLSCAASGSVHKINFLGWYRQAPGKERGLVATITIGDTTDYADYAKGRFTISRDE- ARNMVYLQMNSLKPEDTAVYFCRAG SRLYPYNYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSDVQLQASGGGSVQAGGSL- RLSCAASGYTIGPYCMGWFRQAPGKE REGVAAINMGGGITYYADSVKGRFTISQDNAKNTVYLLMNSLEPEDTAIYYCAADSTIYASYYECGHGLSTG- GYGYDSWGQGTQVTVSSGAADYKDHD GDYKDHDIDYKDDDDKGAAHHHHHH 306 1017000029 EVQLVESGGGLVQPGGSLRLSCAASGDVYKINFLGWHRQAPGKEREKVAHITIGDATDYADSAKGRFTISRDE- AKNMVYLQMNSLKPEDTAVYFCRAG SRIYPYDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 307 1017000030 EVQLVESGGGLVQPGGSLKLSCAASGAVHKINFLGWYRQTPEKEREMVATITIGDEVDYADSAKGRFTISRDE- AKNMVYLQMTSLKPEDTAVYVCRAG SRLYPYNYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 308 1017000031 EVQLVESGGGLVQPGGSLRLSCITSGETFKINIWGWYRQAPGKQRELVASLTIGGATNYADSVKGRFTISEDS- AKNTVYLQMNSLKPEDTAVYFCNAK SRLYPYDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 309 1017000032 EVQLVESGGGLVQPGGSLRLSCAASGSVHLLNFLGWYRQAPGKEREMVAHITIADATDYAHFAKGRFTISRDE- AKNMVYLQMNSLRPEDTAVYFCRAG SRIYPYDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 310 1017000033 EVQLVESGGGLVQPGGSLRLSCITSGETFKINIWGWYRQAPGKQRELVASLTIGGATDYADSVKGRFTISEDS- AKNTVYLQMNSLKAEDTAVYFCNAK SRLYPYDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 311 1017000035 EVQLVESGGGLVQPGGSLRLSCAASGEVYKINFLGWYRQAPGKEREKVAHITIADAADYADFAKGRFTISRDE- AKNMVYLQMNSLRPEDTAVYFCRAG SRIWPYDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 312 1017000037 EVQLVESGGGLVQPGGSLRLSCVASGDVHKINFLGWYRQAPGKEREKVAHISIGDQTDYADSAKGRFTISRDE- SKNMVYLQMNSLKPEDTAVYFCRAF SRIYPYDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 313 1017000038 EVQLVESGGGLVQPGGSLRLSCAASGEIGRINFYRWYRQAPGNQREVVATITIADKTDYADSAKGRFTISRDE- SRNMVYLQMSSLKPEDTAVYFCHAG SRLYPYDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 314 1017000041 EVQLVESGGGLVQPGGSLRLSCVASGDVHKINFLGWYRQAPGKEREKVAHITIGDQADYADSAKGRFTISRDE- AKNMVYLQMNSLKPEDTAVYFCRAG SRIYPYDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 315 1017000042 EVQLVESGGGLVQPGGSLRLSCAASGDVHKINILGWYRQAPAKEREMVAHITIGDATDYADSAKGRFTISRDE- AKNMVYLQMNSLKPEDTAVYFCRAY SRIYPYNYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 316 1017000044 EVQLVESGGGLVQPGGSLRLSCAASGSVHKINFLGWYRQAPGKERELVATITIGDTTDYADSAKGRFTISRDE- AKNMVYLQMNSLKPEDTAVYFCRAG SRLYPYNYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 317 1017000046 EVQLVESGGGLVQPGGSLRLSCAASGSVHKINFLGWYRQAPGKERGLVATITIGDTTDYADYAKGRFTISRDE- ARNMVYLQMNSLKPEDTAVYFCRAG SRLYPYNYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 318 1017000049 EVQLVESGGGLVQPGGSLRLSCAASGDVHKINILGWYRQAPAKEREMVAHITIGDATDYADSAKGRFTISRDE- AKNMVYLQMNSLKPEDTAVYLCRAY SRIYPYNYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD
DDKGAAHHHHHH 319 1017000050 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCVASGDVHKINFLGWYRQAP GKEREKVAHISIGDQTDYADSAKGRFTISRDESKNMVYLQMNSLKPEDTAVYFCRAFSRIYPYDYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 320 1017000051 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCAASGEIGRINFYRWYRQAP GNQREVVATITIADKTDYADSAKGRFTISRDESRNMVYLQMSSLKPEDTAVYFCHAGSRLYPYDYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 321 1017000054 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCVASGDVHKINFLGWYRQAP GKEREKVAHITIGDQADYADSAKGRFTISRDEAKNMVYLQMNSLKPEDTAVYFCRAGSRIYPYDYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 322 1017000055 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCAASGDVHKINILGWYRQAP AKEREMVAHITIGDATDYADSAKGRFTISRDEAKNMVYLQMNSLKPEDTAVYFCRAYSRIYPYNYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 323 1017000058 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCAASGSVHKINFLGWYRQAP GKERELVATITIGDTTDYADSAKGRFTISRDEAKNMVYLQMNSLKPEDTAVYFCRAGSRLYPYNYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 324 1017000060 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCAASGSVHKINFLGWYRQAP GKERGLVATIIIGDTTDYADYAKGRFTISRDEARNMVYLQMNSLKPEDTAVYFCRAGSRLYPYNYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 325 1017000063 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCAASGDVYKINFLGWHRQAP GKEREKVAHITIGDATDYADSAKGRFTISRDEAKNMVYLQMNSLKPEDTAVYFCRAGSRIYPYDYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 326 1017000064 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCAASGEVYKINFLGWYRQAP GKEREKVAHITIADAADYADFAKGRFTISRDEAKNMVYLQMNSLRPEDTAVYFCRAGSRIWPYDYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 327 1017000065 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGDLVQPG- GSLRLSCAASGDVHKINFLGWYRQAP GKEREMVAHITIADATDYAEFAKGRFTISRDEPKNMVYLQMNSLKPEDTAVYLCRAGSRIYPYNYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 328 1017000068 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCITSGETFKINIWGWYRQAP GKQRELVASLTIGGATNYADSVKGRFTISEDSAKNTVYLQMNSLKPEDTAVYFCNAKSRLYPYDYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 329 1017000069 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCAASGSVHLLNFLGWYRQAP GKEREMVAHITIADATDYAHFAKGRFTISRDEAKNMVYLQMNSLRPEDTAVYFCRAGSRIYPYDYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 330 1017000070 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCITSGETFKINIWGWYRQAP GKQRELVASLTIGGATDYADSVKGRFTISEDSAKNTVYLQMNSLKAEDTAVYFCNAKSRLYPYDYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 331 1017000073 EVQLVESGGGLVQPGGSLRLSCAASGDVHKINILGWYRQAPAKEREMVAHITIGDATSYADSAKGRFTISRDE- AKNMVYLQLNNLKPEDTAVYFCRAY SRIYPYNYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 332 1017000074 EVQLVESGGGLVQPGGSLRLSCVASGDVHKINFLGWYRQAPGKEREKVAHISIGDQTDYADSAKGRFTISRDE- SKNMVYLQMNSLKPEDTAVYFCRAF SRIYPYDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 333 1017000075 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCAASGDVHKINILGWYRQAP AKEREMVAHITIGDATSYADSAKGRFTISRDEAKNMVYLQLNNLKPEDTAVYFCRAYSRIYPYNYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 334 1017000076 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCVASGDVHKINFLGWYRQAP GKEREKVAHISIGDQTDYADSAKGRFTISRDESKNMVYLQMNSLKPEDTAVYFCRAFSRIYPYDYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 335 1017000077 EVQLVESGGDLVQPGGSLRLSCAASGDVHKINFLGWYRQAPGKEREMVAHITIADATDYAEFAKGRFTISRDE- PKNMVYLQMNSLKPEDTAVYLCRAG SRIYPYNYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 336 1017000078 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCAASGDVHKINILGWYRQAP AKEREMVAHITIGDATDYADSAKGRFTISRDEAKNMVYLQMNSLKPEDTAVYLCRAYSRIYPYNYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 337 1017000079 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLKLSCAASGAVHKINFLGWYRQTP EKEREMVATITIGDEVDYADSAKGRFTISRDEAKNMVYLQMTSLKPEDTAVYVCRAGSRLYPYNYWGQGTLV- TVSSGAADYKDHDGDYKDHDIDYKDD DDKGAAHHHHHH 338 1017000083 DVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCAASGDVHKINILGWYRQAP AKEREMVAHITIGDATDYADSAKGRFTISRDEAKNMVYLQMNSLKPEDTAVYFCRAYSRIYPYNYWGQGTLV- TVSSA 339 1017000088 DVQLVESGGGLVQAGDSLRLSCAASGRTFSSYAMGWFRQAPGKEREFVAAISWSDGSTYYADSVKGRFTISRD- NAKNTVYLQMNSLKPEDTAVYYCAA DLTSTNPGSYIYIWAYDYWGQGTQVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESG- GGLVQPGGSLRLSCAASGDVHKINIL GWYRQAPAKEREMVAHITIGDATDYADSAKGRFTISRDEAKNMVYLQMNSLKPEDTAVYFCRAYSRIYPYNY- WGQGTLVTVSSA 340 1017000093 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCVASGDVHKINFLGWYRQAP GKEREKVAHISIGDQTDYADSAKGRFTISRDESKNMVYLQMNSLKPEDTAVYFCRAFSRIYPYDYWGQGTLV- TVSSGGGGSGGGGSGGGGSGGGGSGG GGSGGGGSGGGGSEVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTL- YADSVKGRFTISRDNAKTTLYLQMNS LRPEDTAVYYCTIGGSLSRSSQGTLVTVSSGAADYKDHDGDYKDHDIDYKDDDDKGAAHHHHHH 341 1017000095 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCITSGETFKINIWGWYRQAP GKQRELVASLTIGGATNYADSVKGRFTISEDSAKNTVYLQMNSLKPEDTAVYFCNAKSRLYPYDYWGQGTLV- TVSSGGGGSGGGGSGGGGSGGGGSGG GGSGGGGSGGGGSEVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTL- YADSVKGRFTISRDNAKTTLYLQMNS LRPEDTAVYYCTIGGSLSRSSQGTLVTVSSGAADYKDHDGDYKDHDIDYKDDDDKGAAHHHHHH 342 1017000102 EVQLVESGGGLVQAGGSLRLSCAASGITFSINTMGWYRQAPGKQRELVALISSIGDTYYADSVKGRFTISRDN- AKNTVYLQMNSLKPEDTAVYYCKRF RTAAQGTDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGS- LRLSCVASGDVHKINFLGWYRQAPGK EREKVAHISIGDQTDYADSAKGRFTISRDESKNMVYLQMNSLKPEDTAVYFCRAFSRIYPYDYWGQGTLVTV- SSGAADYKDHDGDYKDHDIDYKDDDD KGAAHHHHHH 343 1017000103 EVQLVESGGGLVQPGGSLRLSCVASGDVHKINFLGWYRQAPGKEREKVAHISIGDQTDYADSAKGRFTISRDE- SKNMVYLQMNSLKPEDTAVYFCRAF SRIYPYDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQAGGSL- RLSCAASGITFSINTMGWYRQAPGKQ RELVALISSIGDTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCKRFRTAAQGTDYWGQGTLVTV- SSGAADYKDHDGDYKDHDIDYKDDDD KGAAHHHHHH 387 1017000104 DVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCAASGDVHKINILGWYRQAP AKEREMVAHITIGDATDYADSAKGRFTISRDEAKNMVYLQMNSLKPEDTAVYFCRAYSRIYPYNYWGQGTLV- TVSSGGGGSGGGGSGGGGSGGGGSGG GGSGGGGSGGGGSEVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTL- YADSVKGRFTISRDNAKTTLYLQMNS LRPEDTAVYYCTIGGSLSRSSQGTLVTVSSA 388 1017000105 DVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCVASGDVHKINFLGWYRQAP GKEREKVAHISIGDQTDYADSAKGRFTISRDESKNMVYLQMNSLKPEDTAVYFCRAFSRIYPYDYWGQGTLV- TVSSA 389 1017000106 DVQLVESGGGLVQAGDSLRLSCAASGRTFSSYAMGWFRQAPGKEREFVAAISWSDGSTYYADSVKGRFTISRD- NAKNTVYLQMNSLKPEDTAVYYCAA
DLTSTNPGSYIYIWAYDYWGQGTQVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESG- GGLVQPGGSLRLSCAASGDVHKINIL GWYRQAPAKEREMVAHITIGDATDYADSAKGRFTISRDEAKNMVYLQMNSLKPEDTAVYFCRAYSRIYPYNY- WGQGTLVTVSSGGGGSGGGGSGGGGS GGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSIS- GSGSDTLYADSVKGRFTISRDNAKTT LYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSSA 390 1017000107 EVQLVESGGGLVQAGGSLRLSCAASGRTFSSYVMGWFRQATGKEREFVATIAWDSGSTYYADSVKGRFTISRD- NAKNTVHLQMNSLKPEDTAVYYCAA SYNVYYNNYYYPISRDEYDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVE- SGGGSVQAGGSLRLSCAASGDTYGSY WMGWFRQAPGKEREGVAAINRGGGYTVYADSVKGRFTISRDTAKNTVYLQMNSLRPDDTADYYCAASGVLGG- LHEDWFNYWGQGTLVTVSSGGGGSGG GGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVASGDVHKINFLGWYRQAPGKE- REKVAHISIGDQTDYADSAKGRFTIS RDESKNMVYLQMNSLKPEDTAVYFCRAFSRIYPYDYWGQGTLVTVSSGAADYKDHDGDYKDHDIDYKDDDDK- GAAHHHHHH 391 1017000109 EVQLVESGGGSVQAGGSLRLSCAASGYTIGPYCMGWFRQAPGKEREGVAAINMGGGITYYADSVKGRFTISQD- NAKNTVYLLMNSLEPEDTAIYYCAA DSTIYASYYECGHGLSTGGYGYDSWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEV- QLVESGGGSVQAGGSLRLSCAASGDT YGSYWMGWFRQAPGKEREGVAAINRGGGYTVYADSVKGRFTISRDTAKNTVYLQMNSLRPDDTADYYCAASG- VLGGLHEDWFNYWGQGTLVTVSSGGG GSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVASGDVHKINFLGWYRQA- PGKEREKVAHISIGDQTDYADSAKGR FTISRDESKNMVYLQMNSLKPEDTAVYFCRAFSRIYPYDYWGQGTLVTVSSGAADYKDHDGDYKDHDIDYKD- DDDKGAAHHHHHH 392 1017000110 EVQLVESGGGLVQAGGSLRLSCAASGRTFSSYVMGWFRQATGKEREFVATIAWDSGSTYYADSVKGRFTISRD- NAKNTVHLQMNSLKPEDTAVYYCAA SYNVYYNNYYYPISRDEYDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVE- SGGGSVQAGGSLRLSCAASGYTIGPY CMGWFRQAPGKEREGVAAINMGGGITYYADSVKGRFTISQDNAKNTVYLLMNSLEPEDTAIYYCAADSTIYA- SYYECGHGLSTGGYGYDSWGQGTLVT VSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVASGDVHKINFL- GWYRQAPGKEREKVAHISIGDQTDYA DSAKGRFTISRDESKNMVYLQMNSLKPEDTAVYFCRAFSRIYPYDYWGQGTLVTVSSGAADYKDHDGDYKDH- DIDYKDDDDKGAAHHHHHH 413 1017000001 EVQLVESGGGLVQGGGSLSLSCAASGRTFSSYAMAWFRQPPGKEREFVASISWSGENTNYRNSVKGRFTISRD- NAKNTVYLQMNSLKPEDTAVYYCAA KIAKTYPDNWYWTKSNNYNYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVE- SGGGLVQGGGSLSLSCAASGRTFSSY AMAWFRQPPGKEREFVASISWSGENTNYRNSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAAKIAKTY- PDNWYWTKSNNYNYWGQGTLVTVSS 414 1017000002 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGSVHKINFLGWYRQAPGKER- GLVATITIGDTTDYADYAKGRFTISR DEARNMVYLQMNSLKPEDTAVYFCRAGSRLYPYNYWGQGTLVTVSS 415 1017000003 EVQLQASGGGSVQAGGSLRLSCAASGYTIGPYCMGWFRQAPGKEREGVAAINMGGGITYYADSVKGRFTISQD- NAKNTVYLLMNSLEPEDTAIYYCAA DSTIYASYYECGHGLSTGGYGYDSWGQGTQVTVSSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGSVHKIN- FLGWYRQAPGKERGLVATITIGDTTD YADYAKGRFTISRDEARNMVYLQMNSLKPEDTAVYFCRAGSRLYPYNYWGQGTLVTVSS 416 1017000006 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSDVQLQASGGGSVQAGGSLRLSCAASGYTIGPYCMGWFRQAPGKER- EGVAAINMGGGITYYADSVKGRFTIS QDNAKNTVYLLMNSLEPEDTAIYYCAADSTIYASYYECGHGLSTGGYGYDSWGQGTQVTVSS 417 1017000007 EVQLVESGGGLVQPGGSLRLSCAASGSVHKINFLGWYRQAPGKERGLVATITIGDTTDYADYAKGRFTISRDE- ARNMVYLQMNSLKPEDTAVYFCRAG SRLYPYNYWGQGTLVTVSSGGGGSEVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFV- AEVRWGGVTTYSNSLKDRFSISEDSV KNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLVTVSS 418 1017000008 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGSEVQLVESGGGLVQPGGSLRLSCAASGSVHKINFLGWYRQAP- GKERGLVATITIGDTTDYADYAKGRF IISRDEARNMVYLQMNSLKPEDTAVYFCRAGSRLYPYNYWGQGTLVTVSS 419 1017000009 EVQLQASGGGSVQAGGSLRLSCAASGYTIGPYCMGWFRQAPGKEREGVAAINMGGGITYYADSVKGRFTISQD- NAKNTVYLLMNSLEPEDTAIYYCAA DSTIYASYYECGHGLSTGGYGYDSWGQGTQVTVSSGGGGSGGGSEVQLVESGGGLVQPGGSLRLSCAASGSV- HKINFLGWYRQAPGKERGLVATITIG DTTDYADYAKGRFTISRDEARNMVYLQMNSLKPEDTAVYFCRAGSRLYPYNYWGQGTLVTVSS 420 1017000012 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGSDVQLQASGGGSVQAGGSLRLSCAASGYTIGPYCMGWFRQAP- GKEREGVAAINMGGGITYYADSVKGR FTISQDNAKNTVYLLMNSLEPEDTAIYYCAADSTIYASYYECGHGLSTGGYGYDSWGQGTQVTVSS 421 1017000013 EVQLVESGGGLVQPGGSLRLSCAASGSVHKINFLGWYRQAPGKERGLVATITIGDTTDYADYAKGRFTISRDE- ARNMVYLQMNSLKPEDTAVYFCRAG SRLYPYNYWGQGTLVTVSSGGGGSGGGSEVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKE- REFVAEVRWGGVTTYSNSLKDRFSIS EDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLVTVSS 422 1017000014 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCAASGSVHKINFLGWYRQAP GKERGLVATIIIGDTTDYADYAKGRFTISRDEARNMVYLQMNSLKPEDTAVYFCRAGSRLYPYNYWGQGTLV- TVSS 423 1017000015 EVQLQASGGGSVQAGGSLRLSCAASGYTIGPYCMGWFRQAPGKEREGVAAINMGGGITYYADSVKGRFTISQD- NAKNTVYLLMNSLEPEDTAIYYCAA DSTIYASYYECGHGLSTGGYGYDSWGQGTQVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEV- QLVESGGGLVQPGGSLRLSCAASGSV HKINFLGWYRQAPGKERGLVATIIIGDTTDYADYAKGRFTISRDEARNMVYLQMNSLKPEDTAVYFCRAGSR- LYPYNYWGQGTLVTVSS 424 1017000018 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSDVQLQASGGGSVQAG- GSLRLSCAASGYTIGPYCMGWFRQAP GKEREGVAAINMGGGITYYADSVKGRFTISQDNAKNTVYLLMNSLEPEDTAIYYCAADSTIYASYYECGHGL- STGGYGYDSWGQGTQVTVSS 425 1017000019 EVQLVESGGGLVQPGGSLRLSCAASGSVHKINFLGWYRQAPGKERGLVATITIGDTTDYADYAKGRFTISRDE- ARNMVYLQMNSLKPEDTAVYFCRAG SRLYPYNYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSS 426 1017000023 EVQLQASGGGSVQAGGSLRLSCAASGYTIGPYCMGWFRQAPGKEREGVAAINMGGGITYYADSVKGRFTISQD- NAKNTVYLLMNSLEPEDTAIYYCAA DSTIYASYYECGHGLSTGGYGYDSWGQGTQVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEV- QLVESGGGLVQPGGSLRLSCTFSGGT FSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQ- MYMTVVPDYWGQGTLVTVSS 427 1017000025 EVQLVESGGGLVQPGGSLRLSCAASGSVHKINFLGWYRQAPGKERGLVATITIGDTTDYADYAKGRFTISRDE- ARNMVYLQMNSLKPEDTAVYFCRAG SRLYPYNYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSDVQLQASGGGSVQAGGSL- RLSCAASGYTIGPYCMGWFRQAPGKE REGVAAINMGGGITYYADSVKGRFTISQDNAKNTVYLLMNSLEPEDTAIYYCAADSTIYASYYECGHGLSTG- GYGYDSWGQGTQVTVSS 428 1017000029 EVQLVESGGGLVQPGGSLRLSCAASGDVYKINFLGWHRQAPGKEREKVAHITIGDATDYADSAKGRFTISRDE- AKNMVYLQMNSLKPEDTAVYFCRAG SRIYPYDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSS 429 1017000030 EVQLVESGGGLVQPGGSLKLSCAASGAVHKINFLGWYRQTPEKEREMVATITIGDEVDYADSAKGRFTISRDE- AKNMVYLQMTSLKPEDTAVYVCRAG SRLYPYNYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSS 430 1017000031 EVQLVESGGGLVQPGGSLRLSCITSGETFKINIWGWYRQAPGKQRELVASLTIGGATNYADSVKGRFTISEDS- AKNTVYLQMNSLKPEDTAVYFCNAK SRLYPYDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSS 431 1017000032 EVQLVESGGGLVQPGGSLRLSCAASGSVHLLNFLGWYRQAPGKEREMVAHITIADATDYAHFAKGRFTISRDE- AKNMVYLQMNSLRPEDTAVYFCRAG SRIYPYDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSS 432 1017000033 EVQLVESGGGLVQPGGSLRLSCITSGETFKINIWGWYRQAPGKQRELVASLTIGGATDYADSVKGRFTISEDS- AKNTVYLQMNSLKAEDTAVYFCNAK SRLYPYDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSS 433 1017000035 EVQLVESGGGLVQPGGSLRLSCAASGEVYKINFLGWYRQAPGKEREKVAHITIADAADYADFAKGRFTISRDE- AKNMVYLQMNSLRPEDTAVYFCRAG SRIWPYDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSS 434 1017000037 EVQLVESGGGLVQPGGSLRLSCVASGDVHKINFLGWYRQAPGKEREKVAHISIGDQTDYADSAKGRFTISRDE- SKNMVYLQMNSLKPEDTAVYFCRAF SRIYPYDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSS 435 1017000038 EVQLVESGGGLVQPGGSLRLSCAASGEIGRINFYRWYRQAPGNQREVVATITIADKTDYADSAKGRFTISRDE- SRNMVYLQMSSLKPEDTAVYFCHAG SRLYPYDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSS 436 1017000041 EVQLVESGGGLVQPGGSLRLSCVASGDVHKINFLGWYRQAPGKEREKVAHITIGDQADYADSAKGRFTISRDE- AKNMVYLQMNSLKPEDTAVYFCRAG SRIYPYDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSS 437 1017000042 EVQLVESGGGLVQPGGSLRLSCAASGDVHKINILGWYRQAPAKEREMVAHITIGDATDYADSAKGRFTISRDE- AKNMVYLQMNSLKPEDTAVYFCRAY SRIYPYNYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSS 438 1017000044 EVQLVESGGGLVQPGGSLRLSCAASGSVHKINFLGWYRQAPGKERELVATITIGDTTDYADSAKGRFTISRDE- AKNMVYLQMNSLKPEDTAVYFCRAG SRLYPYNYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSS 439 1017000046 EVQLVESGGGLVQPGGSLRLSCAASGSVHKINFLGWYRQAPGKERGLVATITIGDTTDYADYAKGRFTISRDE- ARNMVYLQMNSLKPEDTAVYFCRAG SRLYPYNYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSS
440 1017000049 EVQLVESGGGLVQPGGSLRLSCAASGDVHKINILGWYRQAPAKEREMVAHITIGDATDYADSAKGRFTISRDE- AKNMVYLQMNSLKPEDTAVYLCRAY SRIYPYNYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSS 441 1017000050 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCVASGDVHKINFLGWYRQAP GKEREKVAHISIGDQTDYADSAKGRFTISRDESKNMVYLQMNSLKPEDTAVYFCRAFSRIYPYDYWGQGTLV- TVSS 442 1017000051 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCAASGEIGRINFYRWYRQAP GNQREVVATIIIADKTDYADSAKGRFTISRDESRNMVYLQMSSLKPEDTAVYFCHAGSRLYPYDYWGQGTLV- TVSS 443 1017000054 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCVASGDVHKINFLGWYRQAP GKEREKVAHITIGDQADYADSAKGRFTISRDEAKNMVYLQMNSLKPEDTAVYFCRAGSRIYPYDYWGQGTLV- TVSS 444 1017000055 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCAASGDVHKINILGWYRQAP AKEREMVAHITIGDATDYADSAKGRFTISRDEAKNMVYLQMNSLKPEDTAVYFCRAYSRIYPYNYWGQGTLV- TVSS 445 1017000058 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCAASGSVHKINFLGWYRQAP GKERELVATIIIGDTTDYADSAKGRFTISRDEAKNMVYLQMNSLKPEDTAVYFCRAGSRLYPYNYWGQGTLV- TVSS 446 1017000060 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCAASGSVHKINFLGWYRQAP GKERGLVATIIIGDTTDYADYAKGRFTISRDEARNMVYLQMNSLKPEDTAVYFCRAGSRLYPYNYWGQGTLV- TVSS 447 1017000063 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCAASGDVYKINFLGWHRQAP GKEREKVAHITIGDATDYADSAKGRFTISRDEAKNMVYLQMNSLKPEDTAVYFCRAGSRIYPYDYWGQGTLV- TVSS 448 1017000064 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCAASGEVYKINFLGWYRQAP GKEREKVAHITIADAADYADFAKGRFTISRDEAKNMVYLQMNSLRPEDTAVYFCRAGSRIWPYDYWGQGTLV- TVSS 449 1017000065 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGDLVQPG- GSLRLSCAASGDVHKINFLGWYRQAP GKEREMVAHITIADATDYAEFAKGRFTISRDEPKNMVYLQMNSLKPEDTAVYLCRAGSRIYPYNYWGQGTLV- TVSS 450 1017000068 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCITSGETFKINIWGWYRQAP GKQRELVASLTIGGATNYADSVKGRFTISEDSAKNTVYLQMNSLKPEDTAVYFCNAKSRLYPYDYWGQGTLV- TVSS 451 1017000069 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCAASGSVHLLNFLGWYRQAP GKEREMVAHITIADATDYAHFAKGRFTISRDEAKNMVYLQMNSLRPEDTAVYFCRAGSRIYPYDYWGQGTLV- TVSS 452 1017000070 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCITSGETFKINIWGWYRQAP GKQRELVASLTIGGATDYADSVKGRFTISEDSAKNTVYLQMNSLKAEDTAVYFCNAKSRLYPYDYWGQGTLV- TVSS 453 1017000073 EVQLVESGGGLVQPGGSLRLSCAASGDVHKINILGWYRQAPAKEREMVAHITIGDATSYADSAKGRFTISRDE- AKNMVYLQLNNLKPEDTAVYFCRAY SRIYPYNYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSS 454 1017000074 EVQLVESGGGLVQPGGSLRLSCVASGDVHKINFLGWYRQAPGKEREKVAHISIGDQTDYADSAKGRFTISRDE- SKNMVYLQMNSLKPEDTAVYFCRAF SRIYPYDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSS 455 1017000075 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCAASGDVHKINILGWYRQAP AKEREMVAHITIGDATSYADSAKGRFTISRDEAKNMVYLQLNNLKPEDTAVYFCRAYSRIYPYNYWGQGTLV- TVSS 456 1017000076 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCVASGDVHKINFLGWYRQAP GKEREKVAHISIGDQTDYADSAKGRFTISRDESKNMVYLQMNSLKPEDTAVYFCRAFSRIYPYDYWGQGTLV- TVSS 457 1017000077 EVQLVESGGDLVQPGGSLRLSCAASGDVHKINFLGWYRQAPGKEREMVAHITIADATDYAEFAKGRFTISRDE- PKNMVYLQMNSLKPEDTAVYLCRAG SRIYPYNYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL- RLSCTFSGGTFSSYTMGWFRQAPGKE REFVAEVRWGGVTTYSNSLKDRFSISEDSVKNAVYLQMNSLKPEDTAVYYCAAVRQMYMTVVPDYWGQGTLV- TVSS 458 1017000078 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCAASGDVHKINILGWYRQAP AKEREMVAHITIGDATDYADSAKGRFTISRDEAKNMVYLQMNSLKPEDTAVYLCRAYSRIYPYNYWGQGTLV- TVSS 459 1017000079 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLKLSCAASGAVHKINFLGWYRQTP EKEREMVATIIIGDEVDYADSAKGRFTISRDEAKNMVYLQMTSLKPEDTAVYVCRAGSRLYPYNYWGQGTLV- TVSS 460 1017000093 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCVASGDVHKINFLGWYRQAP GKEREKVAHISIGDQTDYADSAKGRFTISRDESKNMVYLQMNSLKPEDTAVYFCRAFSRIYPYDYWGQGTLV- TVSSGGGGSGGGGSGGGGSGGGGSGG GGSGGGGSGGGGSEVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTL- YADSVKGRFTISRDNAKTTLYLQMNS LRPEDTAVYYCTIGGSLSRSSQGTLVTVSS 461 1017000095 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCITSGETFKINIWGWYRQAP GKQRELVASLTIGGATNYADSVKGRFTISEDSAKNTVYLQMNSLKPEDTAVYFCNAKSRLYPYDYWGQGTLV- TVSSGGGGSGGGGSGGGGSGGGGSGG GGSGGGGSGGGGSEVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTL- YADSVKGRFTISRDNAKTTLYLQMNS LRPEDTAVYYCTIGGSLSRSSQGTLVTVSS 462 1017000102 EVQLVESGGGLVQAGGSLRLSCAASGITFSINTMGWYRQAPGKQRELVALISSIGDTYYADSVKGRFTISRDN- AKNTVYLQMNSLKPEDTAVYYCKRF RTAAQGTDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGS- LRLSCVASGDVHKINFLGWYRQAPGK EREKVAHISIGDQTDYADSAKGRFTISRDESKNMVYLQMNSLKPEDTAVYFCRAFSRIYPYDYWGQGTLVTV- SS 463 1017000103 EVQLVESGGGLVQPGGSLRLSCVASGDVHKINFLGWYRQAPGKEREKVAHISIGDQTDYADSAKGRFTISRDE- SKNMVYLQMNSLKPEDTAVYFCRAF SRIYPYDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQAGGSL- RLSCAASGITFSINTMGWYRQAPGKQ RELVALISSIGDTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCKRFRTAAQGTDYWGQGTLVTV- SS 464 1017000107 EVQLVESGGGLVQAGGSLRLSCAASGRTFSSYVMGWFRQATGKEREFVATIAWDSGSTYYADSVKGRFTISRD- NAKNTVHLQMNSLKPEDTAVYYCAA SYNVYYNNYYYPISRDEYDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVE- SGGGSVQAGGSLRLSCAASGDTYGSY WMGWFRQAPGKEREGVAAINRGGGYTVYADSVKGRFTISRDTAKNTVYLQMNSLRPDDTADYYCAASGVLGG- LHEDWFNYWGQGTLVTVSSGGGGSGG GGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVASGDVHKINFLGWYRQAPGKE- REKVAHISIGDQTDYADSAKGRFTIS RDESKNMVYLQMNSLKPEDTAVYFCRAFSRIYPYDYWGQGTLVTVSS 465 1017000109 EVQLVESGGGSVQAGGSLRLSCAASGYTIGPYCMGWFRQAPGKEREGVAAINMGGGITYYADSVKGRFTISQD- NAKNTVYLLMNSLEPEDTAIYYCAA DSTIYASYYECGHGLSTGGYGYDSWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEV- QLVESGGGSVQAGGSLRLSCAASGDT YGSYWMGWFRQAPGKEREGVAAINRGGGYTVYADSVKGRFTISRDTAKNTVYLQMNSLRPDDTADYYCAASG- VLGGLHEDWFNYWGQGTLVTVSSGGG GSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVASGDVHKINFLGWYRQA- PGKEREKVAHISIGDQTDYADSAKGR FTISRDESKNMVYLQMNSLKPEDTAVYFCRAFSRIYPYDYWGQGTLVTVSS 466 1017000110 EVQLVESGGGLVQAGGSLRLSCAASGRTFSSYVMGWFRQATGKEREFVATIAWDSGSTYYADSVKGRFTISRD- NAKNTVHLQMNSLKPEDTAVYYCAA SYNVYYNNYYYPISRDEYDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVE- SGGGSVQAGGSLRLSCAASGYTIGPY CMGWFRQAPGKEREGVAAINMGGGITYYADSVKGRFTISQDNAKNTVYLLMNSLEPEDTAIYYCAADSTIYA- SYYECGHGLSTGGYGYDSWGQGTLVT VSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVASGDVHKINFL- GWYRQAPGKEREKVAHISIGDQTDYA DSAKGRFTISRDESKNMVYLQMNSLKPEDTAVYFCRAFSRIYPYDYWGQGTLVTVSS 467 1017000104 DVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCAASGDVHKINILGWYRQAP AKEREMVAHITIGDATDYADSAKGRFTISRDEAKNMVYLQMNSLKPEDTAVYFCRAYSRIYPYNYWGQGTLV- TVSSGGGGSGGGGSGGGGSGGGGSGG GGSGGGGSGGGGSEVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTL- YADSVKGRFTISRDNAKTTLYLQMNS LRPEDTAVYYCTIGGSLSRSSQGTLVTVSS 468 1017000105 DVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCVASGDVHKINFLGWYRQAP GKEREKVAHISIGDQTDYADSAKGRFTISRDESKNMVYLQMNSLKPEDTAVYFCRAFSRIYPYDYWGQGTLV- TVSS
469 1017000106 DVQLVESGGGLVQAGDSLRLSCAASGRTFSSYAMGWFRQAPGKEREFVAAISWSDGSTYYADSVKGRFTISRD- NAKNTVYLQMNSLKPEDTAVYYCAA DLTSTNPGSYIYIWAYDYWGQGTQVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESG- GGLVQPGGSLRLSCAASGDVHKINIL GWYRQAPAKEREMVAHITIGDATDYADSAKGRFTISRDEAKNMVYLQMNSLKPEDTAVYFCRAYSRIYPYNY- WGQGTLVTVSSGGGGSGGGGSGGGGS GGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGNSLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSIS- GSGSDTLYADSVKGRFTISRDNAKTT LYLQMNSLRPEDTAVYYCTIGGSLSRSSQGTLVTVSS 470 1017000083 DVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPG- GSLRLSCAASGDVHKINILGWYRQAP AKEREMVAHIIIGDATDYADSAKGRFTISRDEAKNMVYLQMNSLKPEDTAVYFCRAYSRIYPYNYWGQGTLV- TVSS 471 1017000088 DVQLVESGGGLVQAGDSLRLSCAASGRTFSSYAMGWFRQAPGKEREFVAAISWSDGSTYYADSVKGRFTISRD- NAKNTVYLQMNSLKPEDTAVYYCAA DLTSTNPGSYIYIWAYDYWGQGTQVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESG- GGLVQPGGSLRLSCAASGDVHKINIL GWYRQAPAKEREMVAHITIGDATDYADSAKGRFTISRDEAKNMVYLQMNSLKPEDTAVYFCRAYSRIYPYNY- WGQGTLVTVSS 486 1017000108 EVQLVESGGGLVQAGGSLRLSCAASGRTFSSYVMGWFRQATGKEREFVATIAWDSGSTYYADSVKGRFTISRD- NAKNTVHLQMNSLKPEDTAVYYCAA SYNVYYNNYYYPISRDEYDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVE- SGGGSVQAGGSLRLSCAASGDTYGSY WMGWFRQAPGKEREGVAAINRGGGYTVYADSVKGRFTISRDTAKNTVYLQMNSLRPDDTADYYCAASGVLGG- LHEDWFNYWGQGTLVTVSSGGGGSGG GGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVASGDVHKINFLGWYRQAPGKE- REKVAHISIGDQTDYADSAKGRFTIS RDESKNMVYLQMNSLKPEDTAVYFCRAFSRIYPYDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGS- GGGGSGGGGSEVQLVESGGGLVQPGN SLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYADSVKGRFTISRDNAKTTLYLQMNSLRP- EDTAVYYCTIGGSLSRSSQGTLVTVS SGAADYKDHDGDYKDHDIDYKDDDDKGAAHHHHHH 487 1017000108 EVQLVESGGGLVQAGGSLRLSCAASGRTFSSYVMGWFRQATGKEREFVATIAWDSGSTYYADSVKGRFTISRD- NAKNTVHLQMNSLKPEDTAVYYCAA SYNVYYNNYYYPISRDEYDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVE- SGGGSVQAGGSLRLSCAASGDTYGSY WMGWFRQAPGKEREGVAAINRGGGYTVYADSVKGRFTISRDTAKNTVYLQMNSLRPDDTADYYCAASGVLGG- LHEDWFNYWGQGTLVTVSSGGGGSGG GGSGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCVASGDVHKINFLGWYRQAPGKE- REKVAHISIGDQTDYADSAKGRFTIS RDESKNMVYLQMNSLKPEDTAVYFCRAFSRIYPYDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGS- GGGGSGGGGSEVQLVESGGGLVQPGN SLRLSCAASGFTFSSFGMSWVRQAPGKGLEWVSSISGSGSDTLYADSVKGRFTISRDNAKTTLYLQMNSLRP- EDTAVYYCTIGGSLSRSSQGTLVTVS S
TABLE-US-00054 TABLE A-6 Sequences of component; of TCR complex. ''SEQ'' refers to the given SEQ ID NO; ID'' refers to identification name; ''Sequence'' demotes amino add sequence SEQ ID SEQUENCE 344 Human CD3 MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRC- NGTDIYKDKESTVQVHYRMCQSCVE delta LDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGG- NWARNK (P04234) 345 Human CD3 MEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWN- LGSNAKDPRGMYQCKGSQNKSKPLQ gamma VYYRMCQNCIELNAATISGFLFAEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKD- REDDQYSHLQGNQLRRN (P09692) 346 Human CD3 MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDK- NIGSDEDHLSLKEFSELEQSGYYVC epsilon YPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVT- RGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQR (P07766) DLYSGLNQRRI 347 Human CD3 MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYN- ELNLGRREEYDVLDKRRGRDPEMGG zeta KPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (P20963) 348 Human TCR PNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFA- CANAFNNSIIPEDTFFPSPESSCDV alpha KLVEKSFETDTNFRILLLKVAGFNLLMTLRLWSSLNFQNLSVIG constant domain (P01848) 349 Human TCR EDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSR- YCLSSRLRVSATFWQNPRNHFRCQV beta QFYGLSENDEWTVSAEAWGRADCGFTSVSYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKD- FQDRAKPVTQI constant domain (P01850) 393 Human TCR IQVEQSPPDLILQEGANSTLRCNFSDSVNNLQWFHQNPWGQLINLFYIPSGTKQNGRLSATTVATERYSLLYI- SSSQTTDSGVYFCAALIQGAQKLVF alpha GQGTRLTIN variable domain derived from 2IAN 476 Human TCR NAGVTQTPKFRILKIGQSMTLQCTQDMNHNYMYWYRQDPGMGLKLIYYSVGAGITDKGEVPNGYNVSRSTTED- FPLRLELAAPSQTSVYFCASTYHGT beta GYFGEGSWLTVV variable domain derived from 2IAN 394 Human TCR QLLEQSPQFLSIQEGENLTVYCNSSSVFSSLQWYRQEPGEGPVLLVTVVTGGEVKKLKRLTFQFGDARKDSSL- HITAAQPGDTGLYLCAGAGSQGNLI alpha FGKGTKLSVK variable domain derived from 2XN9 477 Human TCR DGGITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKES- FPLTVTSAQKNPTAFYLCASSSRSS beta YEQYFGPGTRLTVT variable domain derived from 2XN9 395 Human TCR GDAKTTQPNSMESNEEEPVHLPCNHSTISGTDYIHWYRQLPSQGPEYVIHGLTSNVNNRMASLAIAEDRKSST- LILHRATLRDAAVYYCTVYGGATNK alpha LIFGTGTLLAVQ variable domain derived from 310E 478 Human TCR VVSQHPSWVIAKSGTSVKIECRSLDFQATTMFWYRQFPKQSLMLMATSNEGSKATYEQGVEKDKFLINHASLT- LSTLTVTSAHPEDSSFYICSARGGS beta YNSPLHFGNGTRLTVT variable domain derived from 310E 396 Cyno TCR PYIQNPDPAVYQLRGSKSNDTSVCLFTDFDSVMNVSQSKDSDVHITDKTVLDMRSMDFKSNGAVAWSNKSDFA- CTSAFKDSVIPADTFFPSPESSC alpha constant domain 397 Rhesus TCR EDLKKVFPPKVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALEDSR- YSLSSRLRVSATFWHNPRNHFRCQV beta QFYGLSEDDEWTEDRDKPITQKISAEAWGRADC constant domain 398 Rhesus TCR QQIMQIPQYQHVQEGEDFTTYCNSSTTLSNIQWYKQRPGGHPVFLIMLVKSGEVKKQKRLIFQFGEAKKNSSL- HITATQTTDVGTYFCATTGVNNLFF alpha GTGTRLTVL variable domain 399 Rhesus TCR AGPVNAGVTQTPKFQVLKTGQSMTLQCAQDMNHDYMYWYRQDPGMGLRLIHYSVGEGSTEKGEVPDGYNVTRS- NTEDFPLRLESAAPSQTSVYFCASS beta YWTGRSYEQYFGPGTRLTVI variable domain 479 Human TCR PNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKSVLDMRSMDFKSNSAVAWSNKSDFA- CANAFNNSIIPEDTFFPSPESSC alpha constant domain 480 Human TCR EDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSR- YSLSSRLRVSATFWQNPRNHFRCQV beta QFYGLSENDEWTQDRAKPVTQIVSAEAWGRADC constant domain 484 Human TCR PNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFA- CANAFNNSIIPEDTFFPSPESSCDV alpha KLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSS constant domain (P01848) 485 Human TCR EDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSR- YCLSSRLRVSATFWQNPRNHFRCQV beta QFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSVSYQQGVLSATILYEILLGKATLYAVLVSAL- VLMAMVKRKDF constant domain
TABLE-US-00055 TABLE A-7 Sequences of TAA binding building blocks and control Nanobodies. ''SEQ'' refers to a given SEQ ID NO; ''ID'' refers to identification name; ''Sequence'' denotes amino acid sequence SEQ ID SEQUENCE 350 HER2005F07 EVQLVESGGGLVQAGGSLRLSCAASGITFSINTMGWYRQAPGKQRELVALISSIGDTYYADSVKGRFTISRDN- AKNTVYLQMNSLKPEDTAVYYCKRF (Q108L) RTAAQGTDYWGQGTLVTVSS 351 HER2047D05 EVQLVESGGGLVQPGGSLRLSCAASGSIFGFNDMAWYRQAPGKQRELVALISRVGVTSSADSVKGRFTISRVN- AKDTVYLQMNSLKPEDTAVYYCYMD (L108Q) QRLDGSTLAYWGQGTQVTVSS 352 EGFR009G08 EVQLVESGGGLVQAGGSLRLSCAASGRTFSSYAMGWFRQAPGKEREFVVAINWSSGSTYYADSVKGRFTISRD- NAKNTMYLQMNSLKPEDTAVYYCAA GYQINSGNYNFKDYEYDYWGQGTQVTVSS 353 NbCEA5 EVQLVESGGGSVQAGGSLRLSCAASGDTYGSYWMGWFRQAPGKEREGVAAINRGGGYTVYADS- VKGRFTISRDTAKNTVYLQMNSLRPDDTADYYCAA (CEA#1) SGVLGGLHEDWFNYWGQGTLVTVSS 354 T023200005 EVQLVESGGGSVQAGGSLRLSCAASGDTYGSYWMGWFRQAPGQEREAVAAINRGGGYTVYADSVKGRFTISRD- NAKNTLYLQMNSLRPDDTADYYCAA (CEA#5) SGVLGGLHEDWFNYWGQGTLVTVSS 355 7D12 EVQLVESGGGSVQTGGSLRLTCAASGRTSRSYGMGWFRQAPGKEREFVSGISWRGDSTGYADSVK- GRFTISRDNAKNTVDLQMNSLKPEDTAIYYCAA (EGFR#1) AAGSAWYGTLYEYDYWGQGTLVTVSS 356 T023200033 EVQLVESGGGSVQAGGSLRLTCAASGSTSRSYGMGWFRQAPGKEREFVSGISWRGDSTGYADSVKGRFTISRD- NAKNTVDLQMNSLKPEDTAIYYCAA (EGFR#33) AAGSTWYGTLYEYDYWGQGTLVTVSS 357 20CD019C07 EVQLVESGGGLVQPGGSLRLSCTFSGGTFSSYTMGWFRQAPGKEREFVAEVRWGGVTTYSNSLKDRFSISEDS- VKNAVYLQMNSLKPEDTAVYYCAAV RQMYMTVVPDYWGQGTLVTVSS 358 EGFR038G07 EVQLVESGGGLVQAGGSLRLSCAASGRTFSSYVMGWFRQATGKEREFVATIAWDSGSTYYADSVKGRFTISRD- NAKNTVHLQMNSLKPEDTAVYYCAA SYNVYYNNYYYPISRDEYDYWGQGTLVTVSS 359 cAblys3 DVQLQASGGGSVQAGGSLRLSCAASGYTIGPYCMGWFRQAPGKEREGVAAINMGGGITYYADSVKGRFTISQD- NAKNTVYLLMNSLEPEDTAIYYCAA DSTIYASYYECGHGLSTGGYGYDSWGQGTQVTVSS 360 RSV007B02 EVQLVESGGGLVQAGDSLRLSCAASGRTFSSYAMGWFRQAPGKEREFVAAISWSDGSTYYADSVKGRFTISRD- NAKNTVYLQMNSLKPEDTAVYYCAA DLTSTNPGSYTYIWAYDYWGQGTQVTVSS
TABLE-US-00056 TABLE A-8 Sequences for CDRs and frameworks of TAA binding building blocks, plus preferred combinations as provided in formula I, namely FR1-CDR1- FR2-CDR2-FR3-CDR3-FR4. ''SEQ'' refers to the given SEQ ID NO. The first column refers to the SEQ ID NO of the complete ISV, i.e. FR1-CDR1- FR2-CDR2-FR3-CDR3-FR4. CDR1, CDR2 and CDR3 were determined according to Kontermann, 2010. SEQ Nanobody SEQ FR1 SEQ CDR1 SEQ FR2 SEQ CDR2 SEQ FR3 SEQ CDR3 SEQ FR4 353 NbCEA5 367 EVQLVESGGGSVQ 361 GDTYGSY 369 WFRQAPGKE 363 AINRGG 372 YADSVKGRFTISRDTAKNTV 365 SGVLGGLHED 375 WGQGTL (CEA#1) AGGSLRLSCAAS WMG REGVA GYTV YLQMNSLRPDDTADYYCAA WFNY VTVSS 354 T023200005 367 EVQLVESGGGSVQ 361 GDTYGSY 370 WFRQAPGQE 363 AINRGG 373 YADSVKGRFTISRDNAKNTL 365 SGVLGGLHED 375 WGQGTL (CEA#5) AGGSLRLSCAAS WMG REAVA GYTV YLQMNSLRPDDTADYYCAA WFNY VTVSS 357 20CD019C07 368 EVQLVESGGGLVQ 362 GGTFSSY 371 WFRQAPGKE 364 EVRWGG 374 YSNSLKDRFSISEDSVKNAV 366 VRQMYMTVVP 375 WGQGTL PGGSLRLSCTFS TMG REFVA VTT YLQMNSLKPEDTAVYYCAA DY VTVSS
TABLE-US-00057 TABLE C-6 EC50 (M) of multispecific TCR binding polypeptides for binding to CHO-K1 human TCR(2XN9)/CD3, purified primary human T cells and Ramos cells as determined in flow cytometry. CHO-K1 huTCR(2XN9)/CD3 human T cells Ramos cells Cluster sample ID EC50 (M) 95% LCI 95% UCI EC50 (M) 95% LCI 95% UCI EC50 (M) 95% LCI 95% UCI A T017000055 1.1E-07 9.8E-08 1.3E-07 1.3E-07 3.0E-08 5.6E-07 1.8E-09 1.6E-09 1.9E-09 A T017000042 1.7E-08 1.4E-08 1.9E-08 2.3E-07 2.0E-07 2.6E-07 2.0E-08 1.8E-08 2.2E-08 A T017000076 7.8E-08 7.1E-08 8.6E-08 1.3E-07 1.3E-08 1.3E-06 1.8E-09 1.7E-09 2.0E-09 A T017000074 1.6E-08 1.5E-08 1.7E-08 1.9E-07 1.7E-07 2.1E-07 1.6E-08 1.4E-08 1.7E-08 B T017000068 1.9E-07 1.5E-07 2.3E-07 6.2E-09 4.2E-09 8.9E-09 1.8E-09 1.7E-09 2.0E-09 B T017000031 2.0E-08 1.8E-08 2.3E-08 3.5E-07 3.1E-07 4.0E-07 2.3E-08 2.0E-08 2.5E-08 C T017000051 4.6E-07 4.1E-07 5.1E-07 >1E-07 / / 2.7E-09 2.4E-09 2.9E-09 C T017000038 1.7E-08 1.6E-08 1.9E-08 >1E-07 / / 2.1E-08 1.9E-08 2.3E-08
TABLE-US-00058 TABLE C-7 IC50 (M) of the multispecific polypeptides in the flow cytometry based T cell mediated Ramos killing assay using an effector to target ratio of 10 to 1. ID monovalent ID construct IC50 % % lysis ID construct IC50 % % lysis Cluster Nanobody (CD20 .times. TCR) n (M) lysis (stdev) (TCR .times. CD20) n (M) lysis (stdev) A T0170056G05 T017000076 8 3.0E-10 25 14 T017000074 6 9.2E-10 18 11 A T0170055A02 T017000055 19 5.3E-10 29 13 T017000042 5 5.7E-09 17 11 B T0170055C07 T017000068 7 1.0E-09 22 7 T017000031 3 1.1E-09 29 9 C T0170061G01 T017000051 2 5.7E-10 16 2 T017000038 2 2.7E-09 27 4
TABLE-US-00059 TABLE C-12 EC50 values of the half-life extended polypeptides in cell based binding to CHO-K1 human TCR(2XN9)/CD3, primary human T cells and Ramos cells as determined in flow cytometry. CHO-K1-K1 huTCR (2XN9)/CD3 human T cells Ramos cells Cluster sample ID EC50 (M) 95% LCI 95% UCI EC50 (M) 95% LCI 95% UCI EC50 (M) 95% LCI 95% UCI A T017000093 7.7E-08 7.0E-08 8.4E-08 4.8E-07 4.8E-08 4.8E-06 1.5E-09 1.3E-09 1.6E-09 B T017000095 2.7E-07 2.2E-07 3.4E-07 2.2E-07 5.1E-08 9.8E-07 3.7E-09 3.3E-09 4.1E-09
TABLE-US-00060 TABLE C-15 IC50 values of the HER2/TCR binding polypeptides in the T cell mediated HER2-positive tumour killing assay. xCELLigence based cytotoxicity (readout 18 h) - SKBR3 (E/T = 15:1) ID monovalent ID construct IC50 95% 95% ID construct IC50 95% 95% Cluster Nb (HER2 .times. TCR) n (M) LCI UCI (TCR .times. HER2) n (M) LCI UCI A T0170056G05 T017000102 1 1.4E-11 1.1E-11 1.7E-11 T017000103 1 3.8E-12 3.2E-12 4.7E-12 ID monovalent ID construct EC50 95% 95% ID construct IC50 95% 95% Cluster Nb (HER2 .times. TCR) n (M) LCI2 UCI2 (TCR .times. HER2) n (M) LCI UCI xCELLigence based cytotoxicity (readout 18 h) - MCF-7 (E/T = 15:1) A T0170056G05 T017000102 1 1.2E-10 9.0E-11 1.0E-10 T017000103 1 5.9E-11 5.0E-11 7.0E-11 xCELLigence based cytotoxicity (readout 18 h) - MDA-MB-468(E/T = 15:1) A T0170056G05 T017000102 1 No fit T017000103 1 No fit
TABLE-US-00061 TABLE C-16 IC50 (M) of the HER2/TCR bindins polypeptides for IFN-13 secretion bv human T cells in the human T cell mediated xCELLigence based HER2 dependent killing assay. ID monovalent ID construct IC50 95% 95% ID construct IC50 95% 95% Nb (HER2 .times. TCR) n (M) LCI UCI (TCR .times. HER2) n (M) LCI UCI T0170056G05 T017000102 1 2.8E-11 1.4E-11 5.6E-11 T017000103 1 1.1E-10 5.6E-11 2.2E-10
TABLE-US-00062 TABLE C-17 IC50 (M) of and % lysis by the TCR/CD20 binding multispecific constructs in the cynomolgus T cell mediated B cell (Ramos) killing assay to evaluate the cynomolgus functionality of the TCR building block. ID monovalent ID construct IC50 % % lysis ID construct IC50 % % lysis Cluster Nb (CD20 .times. TCR) n (M) lysis (stdev) (TCR .times. CD20) n (M) lysis (stdev) A T0170055A02 T017000055 2 5.69E-10 17 6 T017000042 1 1.7E-10 18 A T0170056G05 T017000076 2 3.09E-10 20 1 T017000074 2 2.4E-10 31 2.21 B T0170055C07 T017000068 1 T017000031 1 7.9E-10 10
TABLE-US-00063 TABLE C-18 IC50 (M) of the TCR/CD20 binding multispecific polypeptides in the cynomolgus T cell mediated xCELLigence based CHO-K1 human CD20 killing assay. ID monovalent ID construct IC50 95% 95% ID construct IC50 95% 95% Cluster Nb (CD20 .times. TCR) n (M) LCI UCI (TCR .times. CD20) n (M) LCI UCI A T0170055A02 T017000055 1 9.9E-10 4.2E-10 2.3E-09 T017000042 1 8.9E-10 6.0E-10 1.3E-09 A T0170056G05 T017000076 1 6.7E-10 2.2E-10 2.0E-09 T017000074 1 1.2E-10 6.4E-11 2.3E-10 B T0170055C07 T017000068 ND ND ND T017000031 1 1.2E-09 7.2E-10 1.9E-09
TABLE-US-00064 TABLE C-23 IC50 (M) of the TCR/Her2 binding multispecific polypeptides in the cynomolgus T cell mediated xCELLigence based SKBR3 killing assay. ID monovalent ID construct IC50 95% 95% ID construct IC50 95% 95% Nb (HER2 .times. TCR) n (M) LCI UCI (TCR .times. HER2) n (M) LCI UCI T0170056G05 T017000102 1 4.6E-11 1.3E-11 1.7E-10 T017000103 1 1.2E-11 7.3E-12 2.1E-11
TABLE-US-00065 TABLE 31 IC50 (M) of the multispecific polypeptides in the human T cell mediated xCELLigence based killing assay using an effector to target ratio of 15. Data were analysed after 50-60 h. LoVo LS174T HER14 ID construct n IC50 (M) 95% LCI 95% UCI n IC50 (M) 95% LCI 95% UCI n IC50 (M) 95% LCI 95% UCI T017000107 1 6.1E-11 5.4E-11 7.0E-11 1 5.3E-09 4.2E-09 6.6E-09 1 1.4E-10 1.2E-10 1.6E-10 T017000109 1 2.0E-09 1.8E-09 2.2E-09 1 3.6E-08 2.7E-08 4.9E-08 1 / / / T017000110 1 6.0E-10 5.3E-10 6.8E-10 1 8.9E-09 5.8E-09 1.4E-08 1 4.2E-10 3.7E-10 4.7E-10
Sequence CWU
1
1
4871117PRTArtificial SequenceNanobody sequence 1Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ser Val
His Lys Ile Asn 20 25 30Phe
Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Glu Leu Val 35
40 45Ala Thr Ile Thr Ile Gly Asp Thr Thr
Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val His Phe Cys Arg 85
90 95Ala Gly Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 1152117PRTArtificial SequenceNanobody
sequence 2Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Ser Val His Lys Ile Asn 20
25 30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly
Lys Glu Arg Gly Leu Val 35 40
45Ala Thr Ile Thr Ile Gly Asp Thr Thr Asp Tyr Ala Asp Tyr Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Arg Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Gly
Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Gln 100
105 110Val Thr Val Ser Ser
1153117PRTArtificial SequenceNanobody sequence 3Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Arg1 5
10 15Ser Leu Arg Leu Pro Cys Ala Ala Ser Gly Ser Val
His Lys Ile Asn 20 25 30Phe
Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Glu Met Val 35
40 45Ala Thr Ile Thr Ile Gly Asp Ala Thr
Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 1154117PRTArtificial SequenceNanobody
sequence 4Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Ser Val His Lys Ile Asn 20
25 30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly
Lys Glu Arg Glu Leu Val 35 40
45Ala Thr Ile Thr Ile Gly Asp Thr Thr Asp Tyr Ala Asp Tyr Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Arg Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Gly
Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser
1155117PRTArtificial SequenceNanobody sequence 5Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ser Val
His Lys Ile Asn 20 25 30Phe
Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Glu Met Val 35
40 45Ala Thr Ile Thr Ile Gly Asp Ala Thr
Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser 1156117PRTArtificial SequenceNanobody
sequence 6Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Ser Val His Lys Ile Asn 20
25 30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly
Lys Glu Arg Glu Leu Val 35 40
45Ala Thr Ile Thr Ile Gly Asp Thr Thr Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Gly
Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Gln 100
105 110Val Thr Val Ser Ser
1157117PRTArtificial SequenceNanobody sequence 7Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Val Ser Gly Ser Val
His Leu Leu Asn 20 25 30Phe
Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Glu Met Val 35
40 45Ala His Ile Thr Ile Ala Asp Ala Thr
Asp Tyr Ser His Phe Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Arg Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser 1158117PRTArtificial SequenceNanobody
sequence 8Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Lys
Leu Ser Cys Ala Ala Ser Gly Ala Val His Lys Ile Asn 20
25 30Phe Leu Gly Trp Tyr Arg Gln Thr Pro Glu
Lys Glu Arg Glu Met Val 35 40
45Ala Thr Ile Thr Ile Gly Asp Asp Val Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Thr Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Val
Cys Arg 85 90 95Ala Gly
Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser
1159117PRTArtificial SequenceNanobody sequence 9Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Arg Ala Ser Gly Asp Val
His Lys Ile Asn 20 25 30Ile
Leu Gly Trp Tyr Arg Gln Ala Pro Ala Lys Glu Arg Glu Met Val 35
40 45Ala His Ile Thr Ile Gly Asp Ala Thr
Asp Tyr Ala Glu Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Tyr Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 11510117PRTArtificial SequenceNanobody
sequence 10Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Arg Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Asp Val His Lys Ile Asn 20
25 30Ile Leu Gly Trp Tyr Arg Gln Ala Pro Ala
Lys Glu Arg Glu Met Val 35 40
45Ala His Ile Thr Ile Gly Asp Ala Thr Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Tyr
Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser
11511117PRTArtificial SequenceNanobody sequence 11Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Asp Val
His Lys Ile Asn 20 25 30Ile
Leu Gly Trp Tyr Arg Gln Ala Pro Ala Lys Glu Arg Glu Met Val 35
40 45Ala His Ile Thr Ile Gly Asp Ala Thr
Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Tyr Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser 11512117PRTArtificial SequenceNanobody
sequence 12Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Val Ala Ser Gly Asp Val His Lys Ile Asn 20
25 30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly
Lys Glu Arg Glu Lys Val 35 40
45Ala His Ile Thr Ile Gly Asp Gln Ala Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Gly
Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Gln 100
105 110Val Thr Val Ser Ser
11513117PRTArtificial SequenceNanobody sequence 13Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Ser Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ser Val
His Lys Ile Asn 20 25 30Phe
Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Glu Met Val 35
40 45Ala Thr Ile Thr Ile Gly Asp Ala Thr
Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Ser Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser 11514117PRTArtificial SequenceNanobody
sequence 14Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Ser Val His Leu Leu Asn 20
25 30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly
Lys Glu Arg Glu Met Val 35 40
45Ala His Ile Ser Ile Ala Asp Ala Thr Asp Tyr Ala His Phe Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Gly
Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp Gly Arg Gly Thr Gln 100
105 110Val Thr Val Ser Ser
11515117PRTArtificial SequenceNanobody sequence 15Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Arg Ala Ser Gly Asp Val
His Lys Ile Asn 20 25 30Ile
Leu Gly Trp Tyr Arg Gln Ala Pro Ala Lys Glu Arg Glu Met Val 35
40 45Ala His Ile Thr Ile Gly Asp Ala Thr
Val Tyr Ala Glu Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Tyr Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 11516117PRTArtificial SequenceNanobody
sequence 16Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Ser Val His Leu Leu Asn 20
25 30Phe Leu Gly Trp Tyr Arg Gln Cys Pro Gly
Lys Glu Arg Glu Met Val 35 40
45Ala His Ile Thr Ile Ala Asp Ala Thr Asp Tyr Ser His Phe Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Gly
Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser
11517117PRTArtificial SequenceNanobody sequence 17Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Pro Ser Cys Ala Ala Ser Gly Ser Val
His Leu Leu Asn 20 25 30Phe
Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Glu Met Val 35
40 45Ala His Ile Thr Ile Ala Asp Ala Thr
Asp Tyr Ala His Phe Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Arg Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 11518117PRTArtificial SequenceNanobody
sequence 18Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Ser Val His Leu Leu Asn 20
25 30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly
Lys Glu Arg Glu Met Val 35 40
45Ala His Ile Thr Ile Ala Asp Ala Thr Asp Tyr Ala His Phe Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Gly
Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser
11519117PRTArtificial SequenceNanobody sequence 19Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Lys Leu Ser Cys Ala Ala Ser Gly Ala Val
His Lys Ile Asn 20 25 30Phe
Leu Gly Trp Tyr Arg Gln Thr Pro Glu Lys Glu Arg Glu Met Val 35
40 45Ala His Ile Thr Ile Gly Asp Glu Val
Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Thr Ser Leu
Thr Pro Glu Asp Thr Ala Val Tyr Val Cys Arg 85
90 95Ala Gly Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 11520117PRTArtificial SequenceNanobody
sequence 20Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val His Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Asp Val His Lys Ile Asn 20
25 30Phe Leu Gly Trp His Arg Gln Pro Pro Gly
Lys Glu Arg Glu Lys Val 35 40
45Ala His Ile Thr Ile Gly Asp Val Thr Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Asn Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Gly
Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Gln 100
105 110Val Thr Val Ser Ser
11521117PRTArtificial SequenceNanobody sequence 21Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Asp Val
His Lys Ile Asn 20 25 30Val
Leu Gly Trp Tyr Arg Gln Ala Pro Ala Lys Glu Arg Glu Met Val 35
40 45Ala His Ile Thr Ile Gly Asp Ala Thr
Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val His Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Tyr Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 11522117PRTArtificial SequenceNanobody
sequence 22Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Asp Val His Lys Ile Asn 20
25 30Ile Leu Gly Trp Tyr Arg Gln Ala Pro Ala
Lys Glu Arg Glu Met Val 35 40
45Ala His Ile Thr Ile Gly Asp Ala Thr Asn Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Tyr
Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser
11523117PRTArtificial SequenceNanobody sequence 23Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Asp Val
His Lys Ile Asn 20 25 30Phe
Leu Gly Trp His Arg Gln Ala Pro Gly Lys Glu Arg Glu Lys Val 35
40 45Ala His Ile Thr Ile Gly Asp Val Thr
Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Phe Leu65
70 75 80Gln Met Asn Asn Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 11524117PRTArtificial SequenceNanobody
sequence 24Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Asp Val His Lys Ile Asn 20
25 30Ile Leu Gly Trp Tyr Arg Gln Ala Pro Ala
Lys Glu Arg Glu Met Val 35 40
45Ala His Ile Thr Ile Gly Asp Ala Thr Asp Tyr Ala Gly Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Tyr
Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser
11525117PRTArtificial SequenceNanobody sequence 25Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Glu Val
Tyr Lys Ile Asn 20 25 30Phe
Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Glu Lys Val 35
40 45Ala His Ile Thr Ile Ala Asp Val Ala
Asp Tyr Ala Asp Phe Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Ile Trp Pro Tyr Asp Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 11526117PRTArtificial SequenceNanobody
sequence 26Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Lys
Leu Ser Cys Ala Ala Ser Gly Ala Val His Lys Ile Asn 20
25 30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Glu
Lys Glu Arg Glu Met Val 35 40
45Ala Thr Ile Thr Ile Gly Asp Glu Val Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Thr Ser Leu Lys Pro Glu Asp Thr Thr Val Tyr Val
Cys Arg 85 90 95Ala Gly
Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Gln 100
105 110Val Thr Val Ser Ser
11527117PRTArtificial SequenceNanobody sequence 27Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Glu Val
Tyr Lys Ile Asn 20 25 30Phe
Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Glu Lys Val 35
40 45Ala His Ile Thr Ile Ala Asp Val Ala
Asp Tyr Ala Asp Phe Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Ile Trp Pro Tyr Asp Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser 11528117PRTArtificial SequenceNanobody
sequence 28Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Val Ala Ser Gly Asp Val His Lys Ile Asn 20
25 30Ile Leu Gly Trp Tyr Arg Gln Ala Pro Gly
Lys Glu Arg Glu Lys Val 35 40
45Ala His Ile Ser Ile Ser Asp Gln Thr Asp Tyr Ala Glu Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ser Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Leu
Cys Arg 85 90 95Ala Phe
Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser
11529117PRTArtificial SequenceNanobody sequence 29Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ser Val
His Lys Ile Asn 20 25 30Phe
Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Glu Leu Val 35
40 45Ala Thr Ile Thr Ile Gly Asp Ala Thr
Asp Tyr Ala Asp Tyr Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Arg Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser 11530117PRTArtificial SequenceNanobody
sequence 30Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Asp Val His Lys Ile Asn 20
25 30Ile Leu Gly Trp Tyr Arg Gln Ala Pro Ala
Lys Glu Arg Glu Met Val 35 40
45Ala His Ile Thr Ile Gly Asp Ala Thr Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Ala Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Tyr
Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser
11531117PRTArtificial SequenceNanobody sequence 31Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Asp Val
His Lys Ile Asn 20 25 30Phe
Leu Gly Trp His Arg Gln Ala Pro Gly Lys Glu Arg Glu Lys Val 35
40 45Ala His Ile Thr Ile Gly Asp Ala Thr
Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 11532117PRTArtificial SequenceNanobody
sequence 32Glu Val Gln Leu Val Glu Ser Gly Gly Gly Ser Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Ser Val His Lys Ile Asn 20
25 30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly
Lys Glu Arg Glu Val Val 35 40
45Ala Thr Ile Thr Ile Gly Asp Ala Thr Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Ser Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Gly
Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Gln 100
105 110Val Thr Val Ser Ser
11533117PRTArtificial SequenceNanobody sequence 33Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Ala Arg Leu Ser Cys Val Ala Ser Gly Asp Val
His Lys Ile Asn 20 25 30Phe
Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Glu Lys Val 35
40 45Ala His Ile Thr Ile Gly Asp Gln Thr
Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Ile Trp Pro Tyr Asp Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 11534117PRTArtificial SequenceNanobody
sequence 34Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Ser Val His Leu Leu Asn 20
25 30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly
Lys Glu Arg Glu Met Val 35 40
45Ala His Ile Thr Ile Ala Asp Ala Thr Asp Tyr Ser His Phe Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Gly
Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser
11535117PRTArtificial SequenceNanobody sequence 35Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Val Ser Gly Ser Val
His Leu Leu Asn 20 25 30Phe
Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Gly Val Val 35
40 45Ala His Ile Thr Ile Ala Asp Ala Thr
Asp Tyr Ser His Phe Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Arg Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 11536117PRTArtificial SequenceNanobody
sequence 36Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly
Gly1 5 10 15Ser Leu Thr
Leu Ser Cys Ala Ala Ser Gly Asp Val His Lys Ile Asn 20
25 30Ile Leu Gly Trp Tyr Arg Gln Ala Pro Ala
Lys Glu Arg Glu Met Val 35 40
45Ala His Ile Thr Ile Gly Asp Ala Thr Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Tyr
Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser
11537117PRTArtificial SequenceNanobody sequence 37Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Gly Val
His Lys Ile Asn 20 25 30Ile
Leu Gly Trp Tyr Arg Gln Ala Pro Ala Lys Glu Arg Glu Met Val 35
40 45Ala His Ile Thr Ile Gly Asp Ala Thr
Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Tyr Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser 11538117PRTArtificial SequenceNanobody
sequence 38Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Glu Val Tyr Lys Ile Asn 20
25 30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly
Lys Glu Arg Glu Lys Val 35 40
45Ala His Ile Thr Ile Ala Asp Val Ala Asp Tyr Ala Asp Phe Ala Gln 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Gly
Ser Arg Ile Trp Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Gln 100
105 110Val Thr Val Ser Ser
11539117PRTArtificial SequenceNanobody sequence 39Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Asp Val
His Lys Ile Asn 20 25 30Ile
Leu Gly Trp Tyr Arg Gln Ala Pro Ala Lys Glu Arg Glu Met Val 35
40 45Ala His Ile Thr Ile Gly Asp Thr Thr
Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Tyr Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 11540117PRTArtificial SequenceNanobody
sequence 40Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Ser Val His Leu Leu Asn 20
25 30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly
Lys Glu Arg Glu Met Val 35 40
45Ala His Ile Thr Ile Ala Asp Ala Thr Asp Tyr Ser His Phe Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Gly
Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp Gly His Gly Thr Leu 100
105 110Val Thr Val Ser Ser
11541117PRTArtificial SequenceNanobody sequence 41Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Val Ala Ser Gly Asp Val
His Lys Ile Asn 20 25 30Phe
Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Glu Lys Val 35
40 45Ala His Ile Thr Ile Gly Asp Gln Ala
Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp
Gly Arg Gly Thr Leu 100 105
110Val Thr Val Ser Ser 11542117PRTArtificial SequenceNanobody
sequence 42Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Val Ser Gly Ser Val His Leu Leu Asn 20
25 30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly
Lys Glu Arg Glu Met Val 35 40
45Thr His Ile Thr Ile Ala Asp Ala Thr Asp Tyr Ser His Phe Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Gly
Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Gln 100
105 110Val Thr Val Ser Ser
11543117PRTArtificial SequenceNanobody sequence 43Glu Val Gln Leu Val Glu
Ser Gly Gly Asp Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Asp Val
His Lys Ile Asn 20 25 30Phe
Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Glu Met Val 35
40 45Ala His Ile Thr Ile Ala Asp Ala Thr
Asp Tyr Ala Glu Phe Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Pro Lys Asn Met Val His Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Leu Cys Arg 85
90 95Ala Gly Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 11544117PRTArtificial SequenceNanobody
sequence 44Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Asp Val His Lys Ile Asn 20
25 30Ile Leu Gly Trp Tyr Arg Gln Ala Pro Ala
Lys Glu Arg Glu Met Val 35 40
45Ala His Ile Thr Ile Gly Asp Ala Thr Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Tyr
Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp Gly Arg Gly Thr Gln 100
105 110Val Thr Val Ser Ser
11545117PRTArtificial SequenceNanobody sequence 45Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Val Ala Ser Gly Asp Val
His Lys Ile Asn 20 25 30Ile
Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Glu Lys Val 35
40 45Ala Arg Ile Ser Ile Ser Asp Gln Thr
Asp Tyr Ala Glu Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ser Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Leu Cys Arg 85
90 95Ala Phe Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser 11546117PRTArtificial SequenceNanobody
sequence 46Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Glu
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Glu Val Tyr Lys Ile Asn 20
25 30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly
Lys Glu Arg Glu Lys Val 35 40
45Ala His Ile Thr Ile Ala Asp Val Ala Asp Tyr Ala Asp Phe Ala Lys 50
55 60Gly Arg Leu Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Gly
Ser Arg Ile Trp Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser
11547117PRTArtificial SequenceNanobody sequence 47Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Lys Leu Pro Cys Ala Ala Ser Gly Ala Val
His Lys Ile Asn 20 25 30Phe
Leu Gly Trp Tyr Arg Gln Thr Pro Glu Lys Glu Arg Glu Met Val 35
40 45Ala Thr Ile Thr Ile Gly Asp Glu Val
Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Thr Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Val Cys Arg 85
90 95Ala Gly Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser 11548117PRTArtificial SequenceNanobody
sequence 48Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Gly
Leu Ser Cys Ala Ala Ser Gly Ser Val His Leu Leu Asn 20
25 30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly
Lys Glu Arg Glu Met Val 35 40
45Ala His Ile Thr Ile Ala Asp Ala Thr Asp Tyr Ala His Phe Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Gly
Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser
11549117PRTArtificial SequenceNanobody sequence 49Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Ala Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Asp Val
His Lys Ile Asn 20 25 30Ile
Leu Gly Trp Tyr Arg Gln Ala Pro Ala Lys Glu Arg Glu Met Val 35
40 45Ala His Ile Thr Ile Gly Asp Ala Thr
Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Tyr Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser 11550117PRTArtificial SequenceNanobody
sequence 50Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Val Ala Ser Gly Asp Val His Lys Ile Asn 20
25 30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly
Lys Glu Arg Glu Lys Val 35 40
45Ala His Ile Ser Ile Gly Asp Gln Thr Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ser Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Phe
Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser
11551117PRTArtificial SequenceNanobody sequence 51Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Glu Val
Tyr Lys Ile Asn 20 25 30Phe
Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Glu Lys Val 35
40 45Ala His Ile Thr Ile Ala Asp Ala Ala
Asp Tyr Ala Asp Phe Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Gly Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Ile Trp Pro Tyr Asp Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 11552117PRTArtificial SequenceNanobody
sequence 52Glu Val Gln Leu Val Glu Ser Gly Gly Gly Trp Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Ser Val Tyr Lys Ile Asn 20
25 30Phe Leu Ser Trp Tyr Arg Gln Ala Pro Gly
His Glu Arg Glu Leu Val 35 40
45Ala Thr Ile Thr Ile Gly Asp Ala Ala Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Arg Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Leu Tyr Phe
Cys His 85 90 95Ala Gly
Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Gln 100
105 110Val Thr Val Ser Ser
11553117PRTArtificial SequenceNanobody sequence 53Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ser Val
His Leu Leu Asn 20 25 30Phe
Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Glu Met Val 35
40 45Ala His Ile Thr Ile Ala Asp Ala Thr
Asp Tyr Ser His Phe Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Arg Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 11554117PRTArtificial SequenceNanobody
sequence 54Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Val Ala Ser Gly Asp Val His Lys Ile Asn 20
25 30Ile Leu Gly Trp Tyr Arg Gln Ala Pro Gly
Lys Glu Arg Glu Lys Val 35 40
45Ala His Ile Ala Ile Ser Asp Gln Thr Asp Tyr Ala Glu Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ser Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Leu
Cys Arg 85 90 95Ala Phe
Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser
11555117PRTArtificial SequenceNanobody sequence 55Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Asp Val
His Lys Ile Asn 20 25 30Ile
Leu Gly Trp Tyr Arg Gln Ala Pro Ala Lys Glu Arg Glu Met Val 35
40 45Ala His Ile Thr Ile Gly Asp Ala Thr
Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Ala Tyr Phe Cys Arg 85
90 95Ala Tyr Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser 11556117PRTArtificial SequenceNanobody
sequence 56Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Asp Val His Lys Ile Asn 20
25 30Ile Leu Gly Trp Tyr Arg Gln Ala Pro Ala
Lys Glu Arg Gly Met Val 35 40
45Ala His Ile Thr Ile Gly Asp Ala Thr Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Tyr
Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Gln 100
105 110Val Thr Val Ser Ser
11557117PRTArtificial SequenceNanobody sequence 57Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Asp Val
His Lys Ile Asn 20 25 30Ile
Leu Gly Trp Tyr Arg Gln Ala Pro Ala Lys Glu His Glu Met Val 35
40 45Ala His Ile Thr Ile Gly Asp Ala Thr
Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Tyr Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser 11558117PRTArtificial SequenceNanobody
sequence 58Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Asp Val His Lys Ile Asn 20
25 30Ile Leu Gly Trp Tyr Arg Gln Ala Pro Ala
Arg Glu Arg Glu Met Val 35 40
45Ala His Ile Thr Ile Gly Asp Ala Thr Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Tyr
Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Gln 100
105 110Val Thr Val Ser Ser
11559117PRTArtificial SequenceNanobody sequence 59Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Asp Val
His Lys Ile Asn 20 25 30Ile
Leu Gly Trp Tyr Arg Gln Ala Pro Ala Lys Glu Arg Glu Met Val 35
40 45Ala His Ile Thr Ile Gly Asp Ala Thr
Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Glu Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Tyr Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser 11560117PRTArtificial SequenceNanobody
sequence 60Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Lys
Leu Ser Cys Ala Ala Ser Gly Ala Val His Lys Ile Asn 20
25 30Phe Leu Gly Trp Tyr Arg Gln Thr Pro Glu
Lys Glu Arg Glu Met Val 35 40
45Ala Thr Ile Thr Ile Gly Asp Glu Val Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Thr Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Val
Cys Arg 85 90 95Ala Gly
Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser
11561117PRTArtificial SequenceNanobody sequence 61Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Lys Leu Ser Cys Ala Ala Ser Gly Ala Val
His Lys Ile Asn 20 25 30Phe
Leu Gly Trp Tyr Arg Gln Ala Pro Glu Lys Glu Arg Glu Met Val 35
40 45Ala Thr Ile Thr Ile Gly Asp Glu Val
Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Thr Asn Met Val Tyr Leu65
70 75 80Gln Met Thr Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 11562117PRTArtificial SequenceNanobody
sequence 62Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Asp Val His Lys Ile Asn 20
25 30Ile Leu Gly Trp Tyr Arg Gln Ala Pro Ala
Lys Glu Arg Glu Met Val 35 40
45Ala His Ile Thr Ile Gly Asp Ala Thr Ser Tyr Ala Gly Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Leu Asn Asn Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Tyr
Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser
11563117PRTArtificial SequenceNanobody sequence 63Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Asp Val
His Lys Ile Asn 20 25 30Ile
Leu Gly Trp Tyr Arg Gln Ala Pro Ala Lys Glu Arg Glu Met Val 35
40 45Ala His Ile Thr Ile Gly Asp Ala Thr
Ser Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Leu Asn Asn Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Tyr Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser 11564117PRTArtificial SequenceNanobody
sequence 64Glu Val Gln Leu Val Glu Ser Gly Gly Asp Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Asp Val His Lys Ile Asn 20
25 30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly
Lys Glu Arg Glu Met Val 35 40
45Ala His Ile Thr Ile Ala Asp Ala Thr Asp Tyr Ala Glu Phe Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Pro Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Leu
Cys Arg 85 90 95Ala Gly
Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Gln 100
105 110Val Thr Val Ser Ser
11565117PRTArtificial SequenceNanobody sequence 65Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Lys Leu Ser Cys Ala Ala Ser Gly Ala Val
His Lys Ile Asn 20 25 30Phe
Leu Gly Trp Tyr Arg Gln Thr Pro Glu Lys Glu Arg Glu Met Val 35
40 45Ala Thr Ile Thr Ile Gly Asp Glu Val
Asp Tyr Ala His Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Thr Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Val Cys Arg 85
90 95Ala Gly Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 11566117PRTArtificial SequenceNanobody
sequence 66Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Lys
Leu Ser Cys Ala Ala Ser Gly Ala Val His Lys Ile Asn 20
25 30Phe Leu Gly Trp Tyr Arg Gln Thr Pro Glu
Lys Glu Arg Glu Met Val 35 40
45Ala Thr Ile Thr Ile Gly Asp Glu Val Ala Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Thr Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Val
Cys Arg 85 90 95Ala Gly
Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Gln 100
105 110Val Thr Val Ser Ser
11567117PRTArtificial SequenceNanobody sequence 67Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Glu Val
Tyr Lys Ile Asn 20 25 30Phe
Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Glu Lys Val 35
40 45Ala His Ile Thr Ile Ala Asp Ala Ala
Asp Tyr Ala Asp Phe Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Ile Trp Pro Tyr Asp Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 11568117PRTArtificial SequenceNanobody
sequence 68Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Glu Val Tyr Lys Ile Asn 20
25 30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly
Lys Glu Arg Glu Lys Val 35 40
45Ala His Ile Thr Ile Ala Asp Ala Ala Asp Tyr Ala Asp Phe Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Gly
Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Gln 100
105 110Val Thr Val Ser Ser
11569117PRTArtificial SequenceNanobody sequence 69Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Ser Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Pro Ser Cys Ala Ala Ser Gly Ser Val
His Lys Ile Asn 20 25 30Phe
Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Glu Met Val 35
40 45Ala Thr Ile Thr Ile Gly Asp Ala Thr
Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Ser Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 11570117PRTArtificial SequenceNanobody
sequence 70Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Glu Val Tyr Lys Ile Asn 20
25 30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly
Lys Glu Arg Glu Lys Val 35 40
45Ala His Ile Thr Ile Ala Asp Val Ala Asp Tyr Ala Asp Phe Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Val Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Gly
Ser Arg Ile Trp Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser
11571117PRTArtificial SequenceNanobody sequence 71Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Glu1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Asp Val
His Lys Ile Asn 20 25 30Ile
Leu Gly Trp Tyr Arg Gln Ala Pro Ala Lys Glu Arg Glu Met Val 35
40 45Ala His Ile Thr Ile Gly Asp Ala Thr
Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Tyr Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser 11572117PRTArtificial SequenceNanobody
sequence 72Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Glu Val Tyr Lys Ile Asn 20
25 30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly
Lys Glu Arg Glu Lys Val 35 40
45Ala His Ile Thr Ile Ala Asp Ala Ala Asp Tyr Ala Asp Phe Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Gly
Ser Arg Ile Trp Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Gln 100
105 110Val Thr Val Ser Ser
11573117PRTArtificial SequenceNanobody sequence 73Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ser Val
His Leu Leu Asn 20 25 30Phe
Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Glu Met Val 35
40 45Ala His Ile Thr Ile Ala Asp Val Thr
Asp Tyr Ser Tyr Phe Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Arg Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 11574117PRTArtificial SequenceNanobody
sequence 74Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Asp Val His Lys Ile Asn 20
25 30Ile Leu Gly Trp Tyr Arg Gln Ala Pro Ala
Lys Glu Arg Glu Met Val 35 40
45Ala His Ile Thr Ile Gly Asp Ala Thr Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Val Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Tyr
Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser
11575117PRTArtificial SequenceNanobody sequence 75Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Ser Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ser Val
His Lys Ile Asn 20 25 30Phe
Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Gly Met Val 35
40 45Ala Thr Ile Thr Ile Gly Asp Ala Thr
Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Ser Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 11576117PRTArtificial SequenceNanobody
sequence 76Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Lys
Leu Ser Cys Ala Ala Ser Gly Ala Val His Lys Ile Asn 20
25 30Phe Leu Gly Trp Tyr Arg Gln Thr Pro Glu
Lys Glu Arg Glu Met Val 35 40
45Ala Thr Ile Thr Ile Gly Asp Glu Val Asp Tyr Glu Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Thr Gly Leu Lys Pro Glu Asp Thr Ala Val Tyr Val
Cys Arg 85 90 95Ala Gly
Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser
11577117PRTArtificial SequenceNanobody sequence 77Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Arg Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Val Ala Ser Gly Asp Val
His Lys Ile Asn 20 25 30Ile
Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Glu Lys Val 35
40 45Ala His Ile Ser Ile Ser Asp Gln Thr
Asp Tyr Ala Glu Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ser Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Leu Cys Arg 85
90 95Ala Phe Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 11578117PRTArtificial SequenceNanobody
sequence 78Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Asp Val Tyr Lys Ile Asn 20
25 30Phe Leu Gly Trp His Arg Gln Ala Pro Gly
Lys Glu Arg Glu Lys Val 35 40
45Ala His Ile Thr Ile Gly Asp Ala Thr Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Gly
Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser
11579117PRTArtificial SequenceNanobody sequence 79Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Arg Ala Ser Gly Asp Val
His Lys Ile Asn 20 25 30Ile
Leu Gly Trp Tyr Arg Gln Ala Pro Ala Lys Glu Arg Glu Met Ile 35
40 45Ala His Ile Thr Ile Gly Asp Ala Thr
Asp Tyr Ala Glu Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Tyr Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 11580117PRTArtificial SequenceNanobody
sequence 80Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Asp Val His Lys Ile Asn 20
25 30Ile Leu Gly Trp Tyr Arg Gln Ala Pro Ala
Lys Gly Arg Glu Met Val 35 40
45Ala His Ile Thr Ile Gly Asp Ala Thr Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Tyr
Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Gln 100
105 110Val Thr Val Ser Ser
11581117PRTArtificial SequenceNanobody sequence 81Glu Val Gln Leu Val Glu
Ser Gly Gly Asp Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Asp Val
His Lys Ile Asn 20 25 30Phe
Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Glu Met Val 35
40 45Ala His Ile Thr Ile Ala Asp Ala Thr
Asp Tyr Ala Glu Phe Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Pro Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Leu Cys Arg 85
90 95Ala Gly Ser Arg Ile Tyr Pro Tyr Ser Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 11582117PRTArtificial SequenceNanobody
sequence 82Glu Val Gln Leu Val Glu Ser Gly Gly Gly Met Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Asp Val His Lys Ile Asn 20
25 30Ile Leu Gly Trp Tyr Arg Gln Ala Pro Ala
Lys Glu Arg Glu Met Val 35 40
45Ala His Ile Thr Ile Gly Asp Ala Thr Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Tyr
Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser
11583117PRTArtificial SequenceNanobody sequence 83Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Asp Val
His Lys Ile Asn 20 25 30Ile
Leu Gly Trp Tyr Arg Gln Val Pro Ala Lys Glu Arg Glu Met Val 35
40 45Ala His Ile Thr Ile Gly Asp Ala Thr
Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Ala Tyr Phe Cys Arg 85
90 95Ala Tyr Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser 11584117PRTArtificial SequenceNanobody
sequence 84Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Glu Val Tyr Lys Ile Asn 20
25 30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly
Lys Glu Arg Glu Lys Val 35 40
45Ala His Ile Thr Ile Ala Asp Ala Ala Asp Tyr Ala Asp Phe Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Gly
Ser Arg Ile Trp Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser
11585117PRTArtificial SequenceNanobody sequence 85Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ser Val
His Leu Leu Asn 20 25 30Phe
Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Glu Met Val 35
40 45Ala His Ile Thr Ile Ala Asp Ala Thr
Asp Tyr Ser His Phe Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Gly Leu
Arg Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser 11586117PRTArtificial SequenceNanobody
sequence 86Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Asp Val His Lys Ile Asn 20
25 30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly
Lys Glu Arg Glu Met Val 35 40
45Ala His Ile Thr Ile Ala Asp Ala Thr Asp Tyr Ala Glu Phe Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Pro Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Leu
Cys Arg 85 90 95Ala Gly
Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Gln 100
105 110Val Thr Val Ser Ser
11587117PRTArtificial SequenceNanobody sequence 87Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Glu Val
His Lys Ile Asn 20 25 30Ile
Leu Gly Trp Tyr Arg Gln Cys Pro Gly Lys Glu Arg Asp Met Val 35
40 45Ala Thr Ile Thr Ile Gly Asp Ala Thr
Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Leu Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser 11588117PRTArtificial SequenceNanobody
sequence 88Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Asp Val His Lys Ile Asn 20
25 30Ile Leu Gly Trp Tyr Arg Gln Ala Pro Ala
Lys Glu Arg Glu Met Val 35 40
45Ala His Ile Thr Ile Gly Asp Ala Thr Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Leu
Cys Arg 85 90 95Ala Tyr
Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Gln 100
105 110Val Thr Val Ser Ser
11589117PRTArtificial SequenceNanobody sequence 89Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Glu Val
Tyr Lys Ile Asn 20 25 30Phe
Leu Gly Trp Gln Arg Gln Ala Pro Gly Lys Glu Arg Glu Lys Val 35
40 45Ala His Ile Thr Ile Ala Asp Val Ala
Asp Tyr Ala Asp Phe Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Ile Trp Pro Tyr Asp Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser 11590117PRTArtificial SequenceNanobody
sequence 90Glu Val Gln Leu Val Glu Ser Gly Gly Asp Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Asp Val His Lys Ile Asn 20
25 30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly
Lys Glu Arg Glu Met Val 35 40
45Ala His Ile Thr Ile Ala Asp Ala Thr Asp Tyr Ala Glu Phe Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Pro Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Val Asp Thr Ala Val Tyr Leu
Cys Arg 85 90 95Ala Gly
Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser
11591117PRTArtificial SequenceNanobody sequence 91Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ser Val
His Leu Leu Asn 20 25 30Phe
Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Glu Lys Val 35
40 45Ala His Ile Thr Ile Ala Asp Ala Thr
Asp Tyr Ser His Phe Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Asn Leu
Arg Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser 11592117PRTArtificial SequenceNanobody
sequence 92Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Pro Arg
Leu Ser Cys Val Ala Ser Gly Asp Val His Lys Ile Asn 20
25 30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly
Lys Glu Arg Glu Lys Val 35 40
45Ala His Ile Thr Ile Gly Asp Gln Ala Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Gly
Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser
11593117PRTArtificial SequenceNanobody sequence 93Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Asp Val
His Lys Ile Asn 20 25 30Ile
Leu Gly Trp Tyr Arg Gln Ala Pro Ala Lys Glu Arg Glu Met Val 35
40 45Ala His Ile Thr Ile Gly Asp Ala Thr
Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Ala Ala Val Tyr Phe Cys Arg 85
90 95Ala Tyr Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser 11594117PRTArtificial SequenceNanobody
sequence 94Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Glu Val Tyr Lys Ile Asn 20
25 30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly
Lys Glu Arg Glu Lys Val 35 40
45Ala His Ile Thr Ile Ala Asp Val Ala Asp Tyr Ala Asp Phe Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Gly
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Gly
Ser Arg Ile Trp Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser
11595117PRTArtificial SequenceNanobody sequence 95Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Ser Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ser Val
His Lys Ile Asn 20 25 30Phe
Leu Gly Trp Tyr Cys Gln Ala Pro Gly Lys Glu Arg Glu Met Val 35
40 45Ala Thr Ile Thr Ile Gly Asp Ala Thr
Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Ser Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 11596117PRTArtificial SequenceNanobody
sequence 96Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Val Ala Ser Gly Asp Val His Lys Ile Asn 20
25 30Ile Leu Gly Trp Tyr Arg Gln Ala Pro Gly
Lys Glu Arg Glu Lys Val 35 40
45Ala His Ile Ser Ile Ser Asp Gln Thr Asp Tyr Ala Glu Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ser Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Ala Ala Val Tyr Leu
Cys Arg 85 90 95Ala Phe
Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Gln 100
105 110Val Thr Val Ser Ser
11597117PRTArtificial SequenceNanobody sequence 97Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Pro Ser Cys Ala Ala Ser Gly Glu Val
Tyr Lys Ile Asn 20 25 30Phe
Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Glu Lys Val 35
40 45Ala His Ile Thr Ile Ala Asp Val Ala
Asp Tyr Ala Asp Phe Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Ile Trp Pro Tyr Asp Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 11598117PRTArtificial SequenceNanobody
sequence 98Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Pro Ser Cys Val Ala Ser Gly Asp Val His Lys Ile Asn 20
25 30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly
Lys Glu Arg Glu Lys Val 35 40
45Ala His Ile Thr Ile Ala Asp Gln Ala Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Gly
Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser
11599117PRTArtificial SequenceNanobody sequence 99Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Glu Val
His Lys Ile Asn 20 25 30Ile
Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Asp Met Val 35
40 45Ala Thr Ile Thr Ile Gly Asp Glu Thr
Gln Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Leu Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser 115100117PRTArtificial SequenceNanobody
sequence 100Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Asp Val His Lys Ile Asn 20
25 30Ile Leu Gly Trp Tyr Arg Gln Ala Pro Ala
Lys Glu Arg Glu Met Val 35 40
45Ala His Ile Thr Ile Gly Asp Ala Thr Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asp Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Tyr
Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser
115101117PRTArtificial SequenceNanobody sequence 101Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Asp
Val His Lys Ile Asn 20 25
30Ile Leu Gly Trp Tyr Arg Gln Ala Pro Ala Lys Glu Arg Glu Met Val
35 40 45Ala His Ile Thr Ile Gly Asp Ala
Thr Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Gly Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Tyr Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser 115102117PRTArtificial SequenceNanobody
sequence 102Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Asp Val His Lys Ile Asn 20
25 30Ile Leu Gly Trp His Arg Gln Ala Pro Ala
Lys Glu Arg Glu Met Val 35 40
45Ala His Ile Thr Ile Gly Asp Ala Thr Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Tyr
Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser
115103117PRTArtificial SequenceNanobody sequence 103Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Asp
Val His Lys Ile Asn 20 25
30Ile Leu Gly Trp His Arg Gln Ala Pro Ala Lys Glu Arg Glu Met Val
35 40 45Ala His Ile Thr Ile Gly Asp Ala
Thr Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Ala Tyr Phe Cys Arg 85
90 95Ala Tyr Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 115104117PRTArtificial SequenceNanobody
sequence 104Glu Val Gln Leu Val Glu Ser Gly Gly Gly Trp Val Gln Ala Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Asp Val His Lys Ile Asn 20
25 30Ile Leu Gly Trp Tyr Arg Gln Ala Pro Ala
Lys Glu Arg Glu Met Val 35 40
45Ala His Ile Thr Ile Gly Asp Ala Thr Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Tyr
Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser
115105117PRTArtificial SequenceNanobody sequence 105Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ile Thr Ser Gly Glu
Thr Phe Lys Ile Asn 20 25
30Ile Trp Gly Trp Tyr Arg Gln Ala Pro Gly Lys Gln Arg Glu Leu Val
35 40 45Ala Ser Leu Thr Ile Gly Gly Ala
Thr Asp Tyr Ala Asp Ser Val Lys 50 55
60Gly Arg Phe Thr Ile Ser Glu Asp Ser Ala Lys Asn Thr Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Ala Glu Asp Thr Ala Val Tyr Phe Cys Asn 85
90 95Ala Lys Ser Arg Leu Tyr Pro Tyr Asp Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 115106117PRTArtificial SequenceNanobody
sequence 106Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ile Thr Ser Gly Glu Thr Phe Lys Ile Asn 20
25 30Ile Trp Gly Trp Tyr Arg Gln Ala Pro Gly
Lys Gln Arg Glu Leu Val 35 40
45Ala Ser Leu Thr Ile Gly Gly Ala Thr Asn Tyr Ala Asp Ser Val Lys 50
55 60Gly Arg Phe Thr Ile Ser Glu Asp Ser
Ala Lys Asn Thr Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Asn 85 90 95Ala Lys
Ser Arg Leu Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser
115107117PRTArtificial SequenceNanobody sequence 107Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ile Thr Ser Gly Glu
Thr Phe Lys Ile Asn 20 25
30Ile Trp Gly Trp Tyr Arg Gln Ala Pro Gly Lys Arg Arg Glu Leu Val
35 40 45Ala Ser Leu Thr Ile Gly Gly Ala
Thr Asn Tyr Ala Asp Ser Val Lys 50 55
60Gly Arg Phe Thr Ile Ser Glu Asp Ser Ala Lys Asn Thr Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Asn 85
90 95Ala Lys Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 115108117PRTArtificial SequenceNanobody
sequence 108Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ile Thr Ser Gly Glu Thr Phe Lys Ile Asn 20
25 30Ile Trp Gly Trp Tyr Arg Gln Thr Pro Gly
Lys Gln Arg Glu Leu Val 35 40
45Ala Ser Leu Thr Ile Gly Gly Ala Thr Asn Tyr Ala Asp Ser Val Lys 50
55 60Gly Arg Phe Thr Ile Ser Glu Asp Ser
Ala Lys Asn Thr Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Asn 85 90 95Ala Lys
Ser Arg Leu Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Gln 100
105 110Val Thr Val Ser Ser
115109117PRTArtificial SequenceNanobody sequence 109Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ile Thr Ser Gly Gln
Thr Phe Lys Ile Asn 20 25
30Ile Trp Gly Trp Tyr Arg Gln Ala Pro Gly Lys Gln Arg Glu Leu Val
35 40 45Ala Ser Leu Thr Ile Gly Gly Ala
Thr Asn Tyr Ala Asp Ser Val Lys 50 55
60Gly Arg Phe Thr Ile Ser Glu Asp Ser Ala Lys Asn Thr Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Asn 85
90 95Ala Lys Ser Arg Leu Tyr Pro Tyr Asp Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 115110117PRTArtificial SequenceNanobody
sequence 110Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ile Thr Ser Gly Glu Thr Phe Lys Val Asn 20
25 30Ile Trp Gly Trp Tyr Arg Gln Gly Pro Gly
Lys Gln Arg Glu Leu Val 35 40
45Ala Ser Leu Thr Ile Gly Gly Ala Thr Asn Tyr Ala Asp Ser Val Lys 50
55 60Gly Arg Phe Thr Ile Ser Glu Asp Ser
Ala Lys Asn Thr Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Asn 85 90 95Ala Lys
Ser Arg Leu Tyr Pro Tyr Asp Tyr Trp Gly Arg Gly Thr Gln 100
105 110Val Thr Val Ser Ser
115111118PRTArtificial SequenceNanobody sequence 111Glu Val Gln Leu Val
Glu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly1 5
10 15Gly Ser Leu Arg Leu Ser Cys Ile Thr Ser Gly
Glu Thr Phe Lys Ile 20 25
30Asn Ile Trp Gly Trp Tyr Arg Gln Ala Pro Gly Lys Gln Arg Glu Leu
35 40 45Val Ala Ser Leu Thr Ile Gly Gly
Ala Thr Asn Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Glu Asp Ser Ala Lys Asn Thr Val Tyr65
70 75 80Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys 85
90 95Asn Ala Lys Ser Arg Ile Tyr Pro Tyr Asp Tyr
Trp Gly Arg Gly Thr 100 105
110Gln Val Thr Val Ser Ser 115112117PRTArtificial SequenceNanobody
sequence 112Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ile Thr Ser Gly Glu Thr Phe Lys Ile Asn 20
25 30Ile Trp Gly Trp Tyr Arg Gln Ala Pro Gly
Lys Gln Arg Glu Leu Val 35 40
45Ala Ser Leu Thr Ile Gly Gly Ala Thr Asn Tyr Ala Asp Ser Val Lys 50
55 60Gly Arg Phe Thr Ile Ser Glu Asp Ser
Ala Lys Asn Thr Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Asn 85 90 95Ala Lys
Ser Arg Leu Tyr Pro Tyr Asp Tyr Trp Asp Gln Gly Thr Gln 100
105 110Val Thr Val Ser Ser
115113117PRTArtificial SequenceNanobody sequence 113Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Leu Thr Ser Gly Glu
Thr Phe Lys Val Asn 20 25
30Ile Trp Gly Trp Tyr Arg Gln Gly Pro Gly Lys Gln Arg Glu Leu Val
35 40 45Ala Ser Leu Thr Ile Gly Gly Ala
Thr Asn Tyr Ala Asp Ser Val Lys 50 55
60Gly Arg Phe Thr Ile Ser Glu Asp Ser Ala Lys Asn Thr Val Tyr Leu65
70 75 80Gln Met Ser Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Asn 85
90 95Ala Lys Ser Arg Leu Tyr Pro Tyr Asp Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 115114117PRTArtificial SequenceNanobody
sequence 114Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ile Thr Ser Gly Glu Thr Phe Lys Ile Asn 20
25 30Ile Trp Gly Trp Tyr Arg Gln Ala Pro Gly
Lys Gln Arg Glu Leu Val 35 40
45Ala Ser Leu Thr Ile Gly Gly Ala Thr Asn Tyr Ala Asp Ser Val Lys 50
55 60Gly Arg Phe Thr Ile Ser Glu Asp Ser
Ala Lys Asn Thr Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Asn 85 90 95Ala Lys
Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp Gly Arg Gly Thr Gln 100
105 110Val Thr Val Ser Ser
115115117PRTArtificial SequenceNanobody sequence 115Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ile Thr Ser Gly Glu
Thr Phe Lys Ile Asn 20 25
30Ile Trp Gly Trp Tyr Arg Gln Ala Pro Gly Lys Gln Arg Glu Leu Val
35 40 45Ala Ser Leu Thr Ile Gly Gly Ala
Thr Asn Tyr Ala Asp Ser Val Lys 50 55
60Gly Arg Phe Thr Ile Ser Glu Asp Ser Ala Lys Asp Thr Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Asn 85
90 95Ala Lys Ser Arg Leu Tyr Pro Tyr Asp Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser 115116117PRTArtificial SequenceNanobody
sequence 116Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Glu Ile Gly Arg Ile Asn 20
25 30Phe Tyr Arg Trp Tyr Arg Gln Ala Pro Gly
Asn Gln Arg Glu Val Val 35 40
45Ala Thr Ile Thr Ile Ala Asp Lys Thr Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ser Arg Asn Met Val Tyr Leu65 70 75
80Gln Met Ser Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys His 85 90 95Ala Gly
Ser Arg Leu Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Gln 100
105 110Val Thr Val Ser Ser
115117117PRTArtificial SequenceNanobody sequence 117Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Glu
Ile Gly Arg Ile Asn 20 25
30Phe Tyr Arg Trp Tyr Arg Gln Ala Pro Gly Asn Gln Arg Gly Val Val
35 40 45Ala Thr Ile Thr Ile Ala Asp Lys
Ile Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ser Arg Asn Met Val Tyr Leu65
70 75 80Gln Met Gly Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys His 85
90 95Ala Gly Ser Arg Leu Tyr Pro Tyr Asp Tyr Trp
Gly Gln Gly Thr Gln 100 105
110Val Thr Val Ser Ser 115118117PRTArtificial SequenceNanobody
sequence 118Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Glu Ile Gly Arg Ile Asn 20
25 30Phe Tyr Arg Trp Tyr Arg Gln Ala Pro Gly
Asn Gln Arg Glu Val Val 35 40
45Ala Thr Ile Thr Ile Ala Asp Lys Thr Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ser Arg Asn Met Val Tyr Leu65 70 75
80Gln Met Ser Ser Leu Lys Pro Glu Asn Thr Ala Val Tyr Phe
Cys His 85 90 95Ala Gly
Ser Arg Leu Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Gln 100
105 110Val Thr Val Ser Ser
11511910PRTArtificial SequenceCDR1 119Gly Ser Val His Lys Ile Asn Phe Leu
Gly1 5 1012010PRTArtificial SequenceCDR1
120Gly Ser Val His Leu Leu Asn Phe Leu Gly1 5
1012110PRTArtificial SequenceCDR1 121Gly Ala Val His Lys Ile Asn Phe
Leu Gly1 5 1012210PRTArtificial
SequenceCDR1 122Gly Asp Val His Lys Ile Asn Ile Leu Gly1 5
1012310PRTArtificial SequenceCDR1 123Gly Asp Val His Lys
Ile Asn Phe Leu Gly1 5
1012410PRTArtificial SequenceCDR1 124Gly Glu Thr Phe Lys Ile Asn Ile Trp
Gly1 5 1012510PRTArtificial SequenceCDR1
125Gly Asp Val His Lys Ile Asn Val Leu Gly1 5
1012610PRTArtificial SequenceCDR1 126Gly Glu Val Tyr Lys Ile Asn Phe
Leu Gly1 5 1012710PRTArtificial
SequenceCDR1 127Gly Gly Val His Lys Ile Asn Ile Leu Gly1 5
1012810PRTArtificial SequenceCDR1 128Gly Gln Thr Phe Lys
Ile Asn Ile Trp Gly1 5
1012910PRTArtificial SequenceCDR1 129Gly Ser Val Tyr Lys Ile Asn Phe Leu
Ser1 5 1013010PRTArtificial SequenceCDR1
130Gly Glu Ile Gly Arg Ile Asn Phe Tyr Arg1 5
1013110PRTArtificial SequenceCDR1 131Gly Glu Thr Phe Lys Val Asn Ile
Trp Gly1 5 1013210PRTArtificial
SequenceCDR1 132Gly Asp Val Tyr Lys Ile Asn Phe Leu Gly1 5
1013310PRTArtificial SequenceCDR1 133Gly Glu Val His Lys
Ile Asn Ile Leu Gly1 5
101349PRTArtificial SequenceCDR2 134Thr Ile Thr Ile Gly Asp Thr Thr Asp1
51359PRTArtificial SequenceCDR2 135Thr Ile Thr Ile Gly Asp
Ala Thr Asp1 51369PRTArtificial SequenceCDR2 136His Ile Thr
Ile Ala Asp Ala Thr Asp1 51379PRTArtificial SequenceCDR2
137Thr Ile Thr Ile Gly Asp Asp Val Asp1 51389PRTArtificial
SequenceCDR2 138His Ile Thr Ile Gly Asp Ala Thr Asp1
51399PRTArtificial SequenceCDR2 139His Ile Thr Ile Gly Asp Gln Ala Asp1
51409PRTArtificial SequenceCDR2 140His Ile Ser Ile Ala Asp
Ala Thr Asp1 51419PRTArtificial SequenceCDR2 141His Ile Thr
Ile Gly Asp Ala Thr Val1 51429PRTArtificial SequenceCDR2
142Ser Leu Thr Ile Gly Gly Ala Thr Asp1 51439PRTArtificial
SequenceCDR2 143His Ile Thr Ile Gly Asp Glu Val Asp1
51449PRTArtificial SequenceCDR2 144His Ile Thr Ile Gly Asp Val Thr Asp1
51459PRTArtificial SequenceCDR2 145Ser Leu Thr Ile Gly Gly
Ala Thr Asn1 51469PRTArtificial SequenceCDR2 146His Ile Thr
Ile Gly Asp Ala Thr Asn1 51479PRTArtificial SequenceCDR2
147His Ile Thr Ile Ala Asp Val Ala Asp1 51489PRTArtificial
SequenceCDR2 148Thr Ile Thr Ile Gly Asp Glu Val Asp1
51499PRTArtificial SequenceCDR2 149His Ile Ser Ile Ser Asp Gln Thr Asp1
51509PRTArtificial SequenceCDR2 150His Ile Thr Ile Gly Asp
Gln Thr Asp1 51519PRTArtificial SequenceCDR2 151His Ile Thr
Ile Gly Asp Thr Thr Asp1 51529PRTArtificial SequenceCDR2
152Arg Ile Ser Ile Ser Asp Gln Thr Asp1 51539PRTArtificial
SequenceCDR2 153His Ile Ser Ile Gly Asp Gln Thr Asp1
51549PRTArtificial SequenceCDR2 154His Ile Thr Ile Ala Asp Ala Ala Asp1
51559PRTArtificial SequenceCDR2 155Thr Ile Thr Ile Gly Asp
Ala Ala Asp1 51569PRTArtificial SequenceCDR2 156His Ile Ala
Ile Ser Asp Gln Thr Asp1 51579PRTArtificial SequenceCDR2
157Thr Ile Thr Ile Ala Asp Lys Thr Asp1 51589PRTArtificial
SequenceCDR2 158Thr Ile Thr Ile Ala Asp Lys Ile Asp1
51599PRTArtificial SequenceCDR2 159His Ile Thr Ile Gly Asp Ala Thr Ser1
51609PRTArtificial SequenceCDR2 160Thr Ile Thr Ile Gly Asp
Glu Val Ala1 51619PRTArtificial SequenceCDR2 161His Ile Thr
Ile Ala Asp Val Thr Asp1 51629PRTArtificial SequenceCDR2
162His Ile Thr Ile Ala Asp Gln Ala Asp1 51639PRTArtificial
SequenceCDR2 163Thr Ile Thr Ile Gly Asp Glu Thr Gln1
51649PRTArtificial SequenceCDR3 164Gly Ser Arg Leu Tyr Pro Tyr Asn Tyr1
51659PRTArtificial SequenceCDR3 165Gly Ser Arg Ile Tyr Pro
Tyr Asp Tyr1 51669PRTArtificial SequenceCDR3 166Tyr Ser Arg
Ile Tyr Pro Tyr Asn Tyr1 51679PRTArtificial SequenceCDR3
167Lys Ser Arg Leu Tyr Pro Tyr Asp Tyr1 51689PRTArtificial
SequenceCDR3 168Lys Ser Arg Ile Tyr Pro Tyr Asp Tyr1
51699PRTArtificial SequenceCDR3 169Gly Ser Arg Ile Trp Pro Tyr Asp Tyr1
51709PRTArtificial SequenceCDR3 170Phe Ser Arg Ile Tyr Pro
Tyr Asp Tyr1 51719PRTArtificial SequenceCDR3 171Gly Ser Arg
Ile Tyr Pro Tyr Asn Tyr1 51729PRTArtificial SequenceCDR3
172Gly Ser Arg Leu Tyr Pro Tyr Asp Tyr1 51739PRTArtificial
SequenceCDR3 173Gly Ser Arg Ile Tyr Pro Tyr Ser Tyr1
51749PRTArtificial SequenceCDR3 174Leu Ser Arg Leu Tyr Pro Tyr Asn Tyr1
517525PRTArtificial SequenceFR1 175Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser 20
2517625PRTArtificial SequenceFR1 176Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Arg1 5
10 15Ser Leu Arg Leu Pro Cys Ala Ala Ser
20 2517725PRTArtificial SequenceFR1 177Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Val Ser
20 2517825PRTArtificial SequenceFR1 178Glu Val Gln
Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Lys Leu Ser Cys Ala Ala Ser
20 2517925PRTArtificial SequenceFR1 179Glu Val
Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Arg Ala
Ser 20 2518025PRTArtificial SequenceFR1
180Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Arg Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys
Ala Ala Ser 20 2518125PRTArtificial
SequenceFR1 181Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro
Gly Gly1 5 10 15Ser Leu
Arg Leu Ser Cys Val Ala Ser 20
2518225PRTArtificial SequenceFR1 182Glu Val Gln Leu Val Glu Ser Gly Gly
Gly Ser Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser 20
2518325PRTArtificial SequenceFR1 183Glu Val Gln Leu Val Glu Ser Gly
Gly Gly Leu Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Pro Ser Cys Ala Ala Ser 20
2518425PRTArtificial SequenceFR1 184Glu Val Gln Leu Val Glu Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Ile Thr Ser 20
2518525PRTArtificial SequenceFR1 185Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val His Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser 20
2518625PRTArtificial SequenceFR1 186Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Ala Arg Leu Ser Cys Val Ala Ser
20 2518725PRTArtificial SequenceFR1 187Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5
10 15Ser Leu Thr Leu Ser Cys Ala Ala Ser
20 2518825PRTArtificial SequenceFR1 188Glu Val Gln
Leu Val Glu Ser Gly Gly Asp Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
20 2518925PRTArtificial SequenceFR1 189Glu Val
Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Glu Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala
Ser 20 2519025PRTArtificial SequenceFR1
190Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Lys Leu Pro Cys
Ala Ala Ser 20 2519125PRTArtificial
SequenceFR1 191Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro
Gly Gly1 5 10 15Ser Leu
Gly Leu Ser Cys Ala Ala Ser 20
2519225PRTArtificial SequenceFR1 192Glu Val Gln Leu Val Glu Ser Gly Gly
Gly Leu Ala Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser 20
2519325PRTArtificial SequenceFR1 193Glu Val Gln Leu Val Glu Ser Gly
Gly Gly Trp Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser 20
2519425PRTArtificial SequenceFR1 194Glu Val Gln Leu Val Glu Ser
Gly Gly Gly Ser Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Pro Ser Cys Ala Ala Ser 20
2519525PRTArtificial SequenceFR1 195Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly Glu1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser 20
2519626PRTArtificial SequenceFR1 196Glu Val Gln Leu Val
Glu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly1 5
10 15Gly Ser Leu Arg Leu Ser Cys Ile Thr Ser
20 2519725PRTArtificial SequenceFR1 197Glu Val Gln
Leu Val Glu Ser Gly Gly Gly Leu Val Arg Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Val Ala Ser
20 2519825PRTArtificial SequenceFR1 198Glu Val
Gln Leu Val Glu Ser Gly Gly Gly Met Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala
Ser 20 2519925PRTArtificial SequenceFR1
199Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys
Leu Thr Ser 20 2520025PRTArtificial
SequenceFR1 200Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro
Gly Gly1 5 10 15Ser Pro
Arg Leu Ser Cys Val Ala Ser 20
2520125PRTArtificial SequenceFR1 201Glu Val Gln Leu Val Glu Ser Gly Gly
Gly Leu Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Pro Ser Cys Val Ala Ser 20
2520225PRTArtificial SequenceFR1 202Glu Val Gln Leu Val Glu Ser Gly
Gly Gly Trp Val Gln Ala Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser 20
2520314PRTArtificial SequenceFR2 203Trp Tyr Arg Gln Ala Pro Gly
Lys Glu Arg Glu Leu Val Ala1 5
1020414PRTArtificial SequenceFR2 204Trp Tyr Arg Gln Ala Pro Gly Lys Glu
Arg Gly Leu Val Ala1 5
1020514PRTArtificial SequenceFR2 205Trp Tyr Arg Gln Ala Pro Gly Lys Glu
Arg Glu Met Val Ala1 5
1020614PRTArtificial SequenceFR2 206Trp Tyr Arg Gln Thr Pro Glu Lys Glu
Arg Glu Met Val Ala1 5
1020714PRTArtificial SequenceFR2 207Trp Tyr Arg Gln Ala Pro Ala Lys Glu
Arg Glu Met Val Ala1 5
1020814PRTArtificial SequenceFR2 208Trp Tyr Arg Gln Ala Pro Gly Lys Glu
Arg Glu Lys Val Ala1 5
1020914PRTArtificial SequenceFR2 209Trp Tyr Arg Gln Cys Pro Gly Lys Glu
Arg Glu Met Val Ala1 5
1021014PRTArtificial SequenceFR2 210Trp Tyr Arg Gln Ala Pro Gly Lys Gln
Arg Glu Leu Val Ala1 5
1021114PRTArtificial SequenceFR2 211Trp His Arg Gln Pro Pro Gly Lys Glu
Arg Glu Lys Val Ala1 5
1021214PRTArtificial SequenceFR2 212Trp Tyr Arg Gln Ala Pro Gly Lys Arg
Arg Glu Leu Val Ala1 5
1021314PRTArtificial SequenceFR2 213Trp His Arg Gln Ala Pro Gly Lys Glu
Arg Glu Lys Val Ala1 5
1021414PRTArtificial SequenceFR2 214Trp Tyr Arg Gln Ala Pro Glu Lys Glu
Arg Glu Met Val Ala1 5
1021514PRTArtificial SequenceFR2 215Trp Tyr Arg Gln Ala Pro Gly Lys Glu
Arg Glu Val Val Ala1 5
1021614PRTArtificial SequenceFR2 216Trp Tyr Arg Gln Ala Pro Gly Lys Glu
Arg Gly Val Val Ala1 5
1021714PRTArtificial SequenceFR2 217Trp Tyr Arg Gln Thr Pro Gly Lys Gln
Arg Glu Leu Val Ala1 5
1021814PRTArtificial SequenceFR2 218Trp Tyr Arg Gln Ala Pro Gly Lys Glu
Arg Glu Met Val Thr1 5
1021914PRTArtificial SequenceFR2 219Trp Tyr Arg Gln Ala Pro Gly His Glu
Arg Glu Leu Val Ala1 5
1022014PRTArtificial SequenceFR2 220Trp Tyr Arg Gln Ala Pro Gly Asn Gln
Arg Glu Val Val Ala1 5
1022114PRTArtificial SequenceFR2 221Trp Tyr Arg Gln Ala Pro Gly Asn Gln
Arg Gly Val Val Ala1 5
1022214PRTArtificial SequenceFR2 222Trp Tyr Arg Gln Ala Pro Ala Lys Glu
Arg Gly Met Val Ala1 5
1022314PRTArtificial SequenceFR2 223Trp Tyr Arg Gln Ala Pro Ala Lys Glu
His Glu Met Val Ala1 5
1022414PRTArtificial SequenceFR2 224Trp Tyr Arg Gln Ala Pro Ala Arg Glu
Arg Glu Met Val Ala1 5
1022514PRTArtificial SequenceFR2 225Trp Tyr Arg Gln Gly Pro Gly Lys Gln
Arg Glu Leu Val Ala1 5
1022614PRTArtificial SequenceFR2 226Trp Tyr Arg Gln Ala Pro Gly Lys Glu
Arg Gly Met Val Ala1 5
1022714PRTArtificial SequenceFR2 227Trp Tyr Arg Gln Ala Pro Ala Lys Glu
Arg Glu Met Ile Ala1 5
1022814PRTArtificial SequenceFR2 228Trp Tyr Arg Gln Ala Pro Ala Lys Gly
Arg Glu Met Val Ala1 5
1022914PRTArtificial SequenceFR2 229Trp Tyr Arg Gln Val Pro Ala Lys Glu
Arg Glu Met Val Ala1 5
1023014PRTArtificial SequenceFR2 230Trp Tyr Arg Gln Cys Pro Gly Lys Glu
Arg Asp Met Val Ala1 5
1023114PRTArtificial SequenceFR2 231Trp Gln Arg Gln Ala Pro Gly Lys Glu
Arg Glu Lys Val Ala1 5
1023214PRTArtificial SequenceFR2 232Trp Tyr Cys Gln Ala Pro Gly Lys Glu
Arg Glu Met Val Ala1 5
1023314PRTArtificial SequenceFR2 233Trp Tyr Arg Gln Ala Pro Gly Lys Glu
Arg Asp Met Val Ala1 5
1023414PRTArtificial SequenceFR2 234Trp His Arg Gln Ala Pro Ala Lys Glu
Arg Glu Met Val Ala1 5
1023539PRTArtificial SequenceFR3 235Tyr Ala Asp Ser Ala Lys Gly Arg Phe
Thr Ile Ser Arg Asp Glu Ala1 5 10
15Lys Asn Met Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu Asp
Thr 20 25 30Ala Val His Phe
Cys Arg Ala 3523639PRTArtificial SequenceFR3 236Tyr Ala Asp Tyr
Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala1 5
10 15Arg Asn Met Val Tyr Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr 20 25
30Ala Val Tyr Phe Cys Arg Ala 3523739PRTArtificial SequenceFR3
237Tyr Ala Asp Ser Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala1
5 10 15Lys Asn Met Val Tyr Leu
Gln Met Asn Ser Leu Lys Pro Glu Asp Thr 20 25
30Ala Val Tyr Phe Cys Arg Ala
3523839PRTArtificial SequenceFR3 238Tyr Ser His Phe Ala Lys Gly Arg Phe
Thr Ile Ser Arg Asp Glu Ala1 5 10
15Lys Asn Met Val Tyr Leu Gln Met Asn Ser Leu Arg Pro Glu Asp
Thr 20 25 30Ala Val Tyr Phe
Cys Arg Ala 3523939PRTArtificial SequenceFR3 239Tyr Ala Asp Ser
Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala1 5
10 15Lys Asn Met Val Tyr Leu Gln Met Thr Ser
Leu Lys Pro Glu Asp Thr 20 25
30Ala Val Tyr Val Cys Arg Ala 3524039PRTArtificial SequenceFR3
240Tyr Ala Glu Ser Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala1
5 10 15Lys Asn Met Val Tyr Leu
Gln Met Asn Ser Leu Lys Pro Glu Asp Thr 20 25
30Ala Val Tyr Phe Cys Arg Ala
3524139PRTArtificial SequenceFR3 241Tyr Ala Asp Ser Ala Lys Gly Arg Phe
Thr Ile Ser Arg Asp Glu Ala1 5 10
15Lys Asn Met Val Tyr Leu Gln Met Asn Ser Leu Ser Pro Glu Asp
Thr 20 25 30Ala Val Tyr Phe
Cys Arg Ala 3524239PRTArtificial SequenceFR3 242Tyr Ala His Phe
Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala1 5
10 15Lys Asn Met Val Tyr Leu Gln Met Asn Ser
Leu Arg Pro Glu Asp Thr 20 25
30Ala Val Tyr Phe Cys Arg Ala 3524339PRTArtificial SequenceFR3
243Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Glu Asp Ser Ala1
5 10 15Lys Asn Thr Val Tyr Leu
Gln Met Asn Ser Leu Lys Ala Glu Asp Thr 20 25
30Ala Val Tyr Phe Cys Asn Ala
3524439PRTArtificial SequenceFR3 244Tyr Ala Asp Ser Ala Lys Gly Arg Phe
Thr Ile Ser Arg Asp Glu Ala1 5 10
15Lys Asn Met Val Tyr Leu Gln Met Thr Ser Leu Thr Pro Glu Asp
Thr 20 25 30Ala Val Tyr Val
Cys Arg Ala 3524539PRTArtificial SequenceFR3 245Tyr Ala Asp Ser
Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala1 5
10 15Lys Asn Met Val Tyr Leu Gln Met Asn Asn
Leu Lys Pro Glu Asp Thr 20 25
30Ala Val Tyr Phe Cys Arg Ala 3524639PRTArtificial SequenceFR3
246Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Glu Asp Ser Ala1
5 10 15Lys Asn Thr Val Tyr Leu
Gln Met Asn Ser Leu Lys Pro Glu Asp Thr 20 25
30Ala Val Tyr Phe Cys Asn Ala
3524739PRTArtificial SequenceFR3 247Tyr Ala Asp Ser Ala Lys Gly Arg Phe
Thr Ile Ser Arg Asp Glu Ala1 5 10
15Lys Asn Met Val His Leu Gln Met Asn Ser Leu Lys Pro Glu Asp
Thr 20 25 30Ala Val Tyr Phe
Cys Arg Ala 3524839PRTArtificial SequenceFR3 248Tyr Ala Asp Ser
Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala1 5
10 15Lys Asn Met Val Phe Leu Gln Met Asn Asn
Leu Lys Pro Glu Asp Thr 20 25
30Ala Val Tyr Phe Cys Arg Ala 3524939PRTArtificial SequenceFR3
249Tyr Ala Gly Ser Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala1
5 10 15Lys Asn Met Val Tyr Leu
Gln Met Asn Ser Leu Lys Pro Glu Asp Thr 20 25
30Ala Val Tyr Phe Cys Arg Ala
3525039PRTArtificial SequenceFR3 250Tyr Ala Asp Phe Ala Lys Gly Arg Phe
Thr Ile Ser Arg Asp Glu Ala1 5 10
15Lys Asn Met Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu Asp
Thr 20 25 30Ala Val Tyr Phe
Cys Arg Ala 3525139PRTArtificial SequenceFR3 251Tyr Ala Asp Ser
Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala1 5
10 15Lys Asn Met Val Tyr Leu Gln Met Thr Ser
Leu Lys Pro Glu Asp Thr 20 25
30Thr Val Tyr Val Cys Arg Ala 3525239PRTArtificial SequenceFR3
252Tyr Ala Glu Ser Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu Ser1
5 10 15Lys Asn Met Val Tyr Leu
Gln Met Asn Ser Leu Lys Pro Glu Asp Thr 20 25
30Ala Val Tyr Leu Cys Arg Ala
3525339PRTArtificial SequenceFR3 253Tyr Ala Asp Ser Ala Lys Gly Arg Phe
Ala Ile Ser Arg Asp Glu Ala1 5 10
15Lys Asn Met Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu Asp
Thr 20 25 30Ala Val Tyr Phe
Cys Arg Ala 3525439PRTArtificial SequenceFR3 254Tyr Ala Asp Phe
Ala Gln Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala1 5
10 15Lys Asn Met Val Tyr Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr 20 25
30Ala Val Tyr Phe Cys Arg Ala 3525539PRTArtificial SequenceFR3
255Tyr Ala Glu Phe Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu Pro1
5 10 15Lys Asn Met Val His Leu
Gln Met Asn Ser Leu Lys Pro Glu Asp Thr 20 25
30Ala Val Tyr Leu Cys Arg Ala
3525639PRTArtificial SequenceFR3 256Tyr Ala Asp Phe Ala Lys Gly Arg Leu
Thr Ile Ser Arg Asp Glu Ala1 5 10
15Lys Asn Met Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu Asp
Thr 20 25 30Ala Val Tyr Phe
Cys Arg Ala 3525739PRTArtificial SequenceFR3 257Tyr Ala Asp Ser
Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu Ser1 5
10 15Lys Asn Met Val Tyr Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr 20 25
30Ala Val Tyr Phe Cys Arg Ala 3525839PRTArtificial SequenceFR3
258Tyr Ala Asp Phe Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Gly Ala1
5 10 15Lys Asn Met Val Tyr Leu
Gln Met Asn Ser Leu Lys Pro Glu Asp Thr 20 25
30Ala Val Tyr Phe Cys Arg Ala
3525939PRTArtificial SequenceFR3 259Tyr Ala Asp Ser Ala Lys Gly Arg Phe
Thr Ile Ser Arg Asp Glu Ala1 5 10
15Arg Asn Met Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu Asp
Thr 20 25 30Ala Leu Tyr Phe
Cys His Ala 3526039PRTArtificial SequenceFR3 260Tyr Ala Asp Ser
Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala1 5
10 15Lys Asn Met Val Tyr Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr 20 25
30Ala Ala Tyr Phe Cys Arg Ala 3526139PRTArtificial SequenceFR3
261Tyr Ala Asp Ser Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu Ser1
5 10 15Arg Asn Met Val Tyr Leu
Gln Met Ser Ser Leu Lys Pro Glu Asp Thr 20 25
30Ala Val Tyr Phe Cys His Ala
3526239PRTArtificial SequenceFR3 262Tyr Ala Asp Ser Ala Lys Gly Arg Phe
Thr Ile Ser Arg Asp Glu Ser1 5 10
15Arg Asn Met Val Tyr Leu Gln Met Gly Ser Leu Lys Pro Glu Asp
Thr 20 25 30Ala Val Tyr Phe
Cys His Ala 3526339PRTArtificial SequenceFR3 263Tyr Ala Asp Ser
Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala1 5
10 15Glu Asn Met Val Tyr Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr 20 25
30Ala Val Tyr Phe Cys Arg Ala 3526439PRTArtificial SequenceFR3
264Tyr Ala Asp Ser Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala1
5 10 15Thr Asn Met Val Tyr Leu
Gln Met Thr Ser Leu Lys Pro Glu Asp Thr 20 25
30Ala Val Tyr Phe Cys Arg Ala
3526539PRTArtificial SequenceFR3 265Tyr Ala Gly Ser Ala Lys Gly Arg Phe
Thr Ile Ser Arg Asp Glu Ala1 5 10
15Lys Asn Met Val Tyr Leu Gln Leu Asn Asn Leu Lys Pro Glu Asp
Thr 20 25 30Ala Val Tyr Phe
Cys Arg Ala 3526639PRTArtificial SequenceFR3 266Tyr Ala Asp Ser
Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala1 5
10 15Lys Asn Met Val Tyr Leu Gln Leu Asn Asn
Leu Lys Pro Glu Asp Thr 20 25
30Ala Val Tyr Phe Cys Arg Ala 3526739PRTArtificial SequenceFR3
267Tyr Ala Glu Phe Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu Pro1
5 10 15Lys Asn Met Val Tyr Leu
Gln Met Asn Ser Leu Lys Pro Glu Asp Thr 20 25
30Ala Val Tyr Leu Cys Arg Ala
3526839PRTArtificial SequenceFR3 268Tyr Ala His Ser Ala Lys Gly Arg Phe
Thr Ile Ser Arg Asp Glu Ala1 5 10
15Lys Asn Met Val Tyr Leu Gln Met Thr Ser Leu Lys Pro Glu Asp
Thr 20 25 30Ala Val Tyr Val
Cys Arg Ala 3526939PRTArtificial SequenceFR3 269Tyr Ala Asp Phe
Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu Val1 5
10 15Lys Asn Met Val Tyr Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr 20 25
30Ala Val Tyr Phe Cys Arg Ala 3527039PRTArtificial SequenceFR3
270Tyr Ala Asp Phe Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala1
5 10 15Lys Asn Met Val Tyr Leu
Gln Met Asn Ser Leu Arg Pro Glu Asp Thr 20 25
30Ala Val Tyr Phe Cys Arg Ala
3527139PRTArtificial SequenceFR3 271Tyr Ser Tyr Phe Ala Lys Gly Arg Phe
Thr Ile Ser Arg Asp Glu Ala1 5 10
15Lys Asn Met Val Tyr Leu Gln Met Asn Ser Leu Arg Pro Glu Asp
Thr 20 25 30Ala Val Tyr Phe
Cys Arg Ala 3527239PRTArtificial SequenceFR3 272Tyr Ala Asp Ser
Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala1 5
10 15Lys Asn Val Val Tyr Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr 20 25
30Ala Val Tyr Phe Cys Arg Ala 3527339PRTArtificial SequenceFR3
273Tyr Glu Asp Ser Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala1
5 10 15Lys Asn Met Val Tyr Leu
Gln Met Thr Gly Leu Lys Pro Glu Asp Thr 20 25
30Ala Val Tyr Val Cys Arg Ala
3527439PRTArtificial SequenceFR3 274Tyr Ala Asp Ser Val Lys Gly Arg Phe
Thr Ile Ser Glu Asp Ser Ala1 5 10
15Lys Asn Thr Val Tyr Leu Gln Met Ser Ser Leu Lys Pro Glu Asp
Thr 20 25 30Ala Val Tyr Phe
Cys Asn Ala 3527539PRTArtificial SequenceFR3 275Tyr Ser His Phe
Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala1 5
10 15Lys Asn Met Val Tyr Leu Gln Met Asn Gly
Leu Arg Pro Glu Asp Thr 20 25
30Ala Val Tyr Phe Cys Arg Ala 3527639PRTArtificial SequenceFR3
276Tyr Ala Asp Ser Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala1
5 10 15Lys Asn Met Val Tyr Leu
Gln Met Asn Ser Leu Lys Pro Glu Asp Thr 20 25
30Ala Val Tyr Leu Cys Arg Ala
3527739PRTArtificial SequenceFR3 277Tyr Ala Glu Phe Ala Lys Gly Arg Phe
Thr Ile Ser Arg Asp Glu Pro1 5 10
15Lys Asn Met Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Val Asp
Thr 20 25 30Ala Val Tyr Leu
Cys Arg Ala 3527839PRTArtificial SequenceFR3 278Tyr Ser His Phe
Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala1 5
10 15Lys Asn Met Val Tyr Leu Gln Met Asn Asn
Leu Arg Pro Glu Asp Thr 20 25
30Ala Val Tyr Phe Cys Arg Ala 3527939PRTArtificial SequenceFR3
279Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Glu Asp Ser Ala1
5 10 15Lys Asp Thr Val Tyr Leu
Gln Met Asn Ser Leu Lys Pro Glu Asp Thr 20 25
30Ala Val Tyr Phe Cys Asn Ala
3528039PRTArtificial SequenceFR3 280Tyr Ala Asp Ser Ala Lys Gly Arg Phe
Thr Ile Ser Arg Asp Glu Ala1 5 10
15Lys Asn Met Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu Asp
Ala 20 25 30Ala Val Tyr Phe
Cys Arg Ala 3528139PRTArtificial SequenceFR3 281Tyr Ala Glu Ser
Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu Ser1 5
10 15Lys Asn Met Val Tyr Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Ala 20 25
30Ala Val Tyr Leu Cys Arg Ala 3528239PRTArtificial SequenceFR3
282Tyr Ala Asp Ser Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu Ser1
5 10 15Arg Asn Met Val Tyr Leu
Gln Met Ser Ser Leu Lys Pro Glu Asn Thr 20 25
30Ala Val Tyr Phe Cys His Ala
3528339PRTArtificial SequenceFR3 283Tyr Ala Asp Ser Ala Lys Gly Arg Phe
Thr Ile Ser Arg Asp Glu Ala1 5 10
15Lys Asn Met Val Tyr Leu Gln Met Asp Ser Leu Lys Pro Glu Asp
Thr 20 25 30Ala Val Tyr Phe
Cys Arg Ala 3528439PRTArtificial SequenceFR3 284Tyr Ala Asp Ser
Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala1 5
10 15Lys Asn Met Val Tyr Leu Gln Met Asn Ser
Leu Lys Pro Gly Asp Thr 20 25
30Ala Val Tyr Phe Cys Arg Ala 3528511PRTArtificial SequenceFR4
285Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser1 5
1028611PRTArtificial SequenceFR4 286Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser1 5 1028711PRTArtificial
SequenceFR4 287Trp Gly Arg Gly Thr Gln Val Thr Val Ser Ser1
5 1028811PRTArtificial SequenceFR4 288Trp Gly His Gly
Thr Leu Val Thr Val Ser Ser1 5
1028911PRTArtificial SequenceFR4 289Trp Gly Arg Gly Thr Leu Val Thr Val
Ser Ser1 5 1029011PRTArtificial
SequenceFR4 290Trp Asp Gln Gly Thr Gln Val Thr Val Ser Ser1
5 10291327PRTArtificial SequenceNanobody sequence
291Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Gly Gly Gly1
5 10 15Ser Leu Ser Leu Ser Cys
Ala Ala Ser Gly Arg Thr Phe Ser Ser Tyr 20 25
30Ala Met Ala Trp Phe Arg Gln Pro Pro Gly Lys Glu Arg
Glu Phe Val 35 40 45Ala Ser Ile
Ser Trp Ser Gly Glu Asn Thr Asn Tyr Arg Asn Ser Val 50
55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
Asn Thr Val Tyr65 70 75
80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Ala Lys Ile Ala Lys
Thr Tyr Pro Asp Asn Trp Tyr Trp Thr Lys 100
105 110Ser Asn Asn Tyr Asn Tyr Trp Gly Gln Gly Thr Leu
Val Thr Val Ser 115 120 125Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser 130
135 140Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
Gly Gly Gly Ser Gly145 150 155
160Gly Gly Gly Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val
165 170 175Gln Gly Gly Gly
Ser Leu Ser Leu Ser Cys Ala Ala Ser Gly Arg Thr 180
185 190Phe Ser Ser Tyr Ala Met Ala Trp Phe Arg Gln
Pro Pro Gly Lys Glu 195 200 205Arg
Glu Phe Val Ala Ser Ile Ser Trp Ser Gly Glu Asn Thr Asn Tyr 210
215 220Arg Asn Ser Val Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ala Lys225 230 235
240Asn Thr Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr
Ala 245 250 255Val Tyr Tyr
Cys Ala Ala Lys Ile Ala Lys Thr Tyr Pro Asp Asn Trp 260
265 270Tyr Trp Thr Lys Ser Asn Asn Tyr Asn Tyr
Trp Gly Gln Gly Thr Leu 275 280
285Val Thr Val Ser Ser Gly Ala Ala Asp Tyr Lys Asp His Asp Gly Asp 290
295 300Tyr Lys Asp His Asp Ile Asp Tyr
Lys Asp Asp Asp Asp Lys Gly Ala305 310
315 320Ala His His His His His His
325292276PRTArtificial SequenceNanobody sequence 292Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Thr Phe Ser Gly Gly
Thr Phe Ser Ser Tyr 20 25
30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Glu Val Arg Trp Gly Gly Val
Thr Thr Tyr Ser Asn Ser Leu Lys 50 55
60Asp Arg Phe Ser Ile Ser Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala 85
90 95Ala Val Arg Gln Met Tyr Met Thr Val Val Pro
Asp Tyr Trp Gly Gln 100 105
110Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Glu Val Gln
115 120 125Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly Ser Leu Arg 130 135
140Leu Ser Cys Ala Ala Ser Gly Ser Val His Lys Ile Asn Phe Leu
Gly145 150 155 160Trp Tyr
Arg Gln Ala Pro Gly Lys Glu Arg Gly Leu Val Ala Thr Ile
165 170 175Thr Ile Gly Asp Thr Thr Asp
Tyr Ala Asp Tyr Ala Lys Gly Arg Phe 180 185
190Thr Ile Ser Arg Asp Glu Ala Arg Asn Met Val Tyr Leu Gln
Met Asn 195 200 205Ser Leu Lys Pro
Glu Asp Thr Ala Val Tyr Phe Cys Arg Ala Gly Ser 210
215 220Arg Leu Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr
Leu Val Thr Val225 230 235
240Ser Ser Gly Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr Lys Asp
245 250 255His Asp Ile Asp Tyr
Lys Asp Asp Asp Asp Lys Gly Ala Ala His His 260
265 270His His His His 275293289PRTArtificial
SequenceNanobody sequence 293Glu Val Gln Leu Gln Ala Ser Gly Gly Gly Ser
Val Gln Ala Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Tyr Thr Ile Gly Pro Tyr
20 25 30Cys Met Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu Arg Glu Gly Val 35 40
45Ala Ala Ile Asn Met Gly Gly Gly Ile Thr Tyr Tyr Ala Asp Ser
Val 50 55 60Lys Gly Arg Phe Thr Ile
Ser Gln Asp Asn Ala Lys Asn Thr Val Tyr65 70
75 80Leu Leu Met Asn Ser Leu Glu Pro Glu Asp Thr
Ala Ile Tyr Tyr Cys 85 90
95Ala Ala Asp Ser Thr Ile Tyr Ala Ser Tyr Tyr Glu Cys Gly His Gly
100 105 110Leu Ser Thr Gly Gly Tyr
Gly Tyr Asp Ser Trp Gly Gln Gly Thr Gln 115 120
125Val Thr Val Ser Ser Gly Gly Gly Gly Ser Glu Val Gln Leu
Val Glu 130 135 140Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys145 150
155 160Ala Ala Ser Gly Ser Val His Lys Ile Asn
Phe Leu Gly Trp Tyr Arg 165 170
175Gln Ala Pro Gly Lys Glu Arg Gly Leu Val Ala Thr Ile Thr Ile Gly
180 185 190Asp Thr Thr Asp Tyr
Ala Asp Tyr Ala Lys Gly Arg Phe Thr Ile Ser 195
200 205Arg Asp Glu Ala Arg Asn Met Val Tyr Leu Gln Met
Asn Ser Leu Lys 210 215 220Pro Glu Asp
Thr Ala Val Tyr Phe Cys Arg Ala Gly Ser Arg Leu Tyr225
230 235 240Pro Tyr Asn Tyr Trp Gly Gln
Gly Thr Leu Val Thr Val Ser Ser Gly 245
250 255Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr Lys
Asp His Asp Ile 260 265 270Asp
Tyr Lys Asp Asp Asp Asp Lys Gly Ala Ala His His His His His 275
280 285His294292PRTArtificial
SequenceNanobody sequence 294Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr
20 25 30Thr Met Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40
45Ala Glu Val Arg Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu
Lys 50 55 60Asp Arg Phe Ser Ile Ser
Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65 70
75 80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala
Val Tyr Tyr Cys Ala 85 90
95Ala Val Arg Gln Met Tyr Met Thr Val Val Pro Asp Tyr Trp Gly Gln
100 105 110Gly Thr Leu Val Thr Val
Ser Ser Gly Gly Gly Gly Ser Asp Val Gln 115 120
125Leu Gln Ala Ser Gly Gly Gly Ser Val Gln Ala Gly Gly Ser
Leu Arg 130 135 140Leu Ser Cys Ala Ala
Ser Gly Tyr Thr Ile Gly Pro Tyr Cys Met Gly145 150
155 160Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg
Glu Gly Val Ala Ala Ile 165 170
175Asn Met Gly Gly Gly Ile Thr Tyr Tyr Ala Asp Ser Val Lys Gly Arg
180 185 190Phe Thr Ile Ser Gln
Asp Asn Ala Lys Asn Thr Val Tyr Leu Leu Met 195
200 205Asn Ser Leu Glu Pro Glu Asp Thr Ala Ile Tyr Tyr
Cys Ala Ala Asp 210 215 220Ser Thr Ile
Tyr Ala Ser Tyr Tyr Glu Cys Gly His Gly Leu Ser Thr225
230 235 240Gly Gly Tyr Gly Tyr Asp Ser
Trp Gly Gln Gly Thr Gln Val Thr Val 245
250 255Ser Ser Gly Ala Ala Asp Tyr Lys Asp His Asp Gly
Asp Tyr Lys Asp 260 265 270His
Asp Ile Asp Tyr Lys Asp Asp Asp Asp Lys Gly Ala Ala His His 275
280 285His His His His
290295276PRTArtificial SequenceNanobody sequence 295Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ser
Val His Lys Ile Asn 20 25
30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Gly Leu Val
35 40 45Ala Thr Ile Thr Ile Gly Asp Thr
Thr Asp Tyr Ala Asp Tyr Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Arg Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val Glu
115 120 125Ser Gly Gly Gly Leu Val Gln
Pro Gly Gly Ser Leu Arg Leu Ser Cys 130 135
140Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr Thr Met Gly Trp Phe
Arg145 150 155 160Gln Ala
Pro Gly Lys Glu Arg Glu Phe Val Ala Glu Val Arg Trp Gly
165 170 175Gly Val Thr Thr Tyr Ser Asn
Ser Leu Lys Asp Arg Phe Ser Ile Ser 180 185
190Glu Asp Ser Val Lys Asn Ala Val Tyr Leu Gln Met Asn Ser
Leu Lys 195 200 205Pro Glu Asp Thr
Ala Val Tyr Tyr Cys Ala Ala Val Arg Gln Met Tyr 210
215 220Met Thr Val Val Pro Asp Tyr Trp Gly Gln Gly Thr
Leu Val Thr Val225 230 235
240Ser Ser Gly Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr Lys Asp
245 250 255His Asp Ile Asp Tyr
Lys Asp Asp Asp Asp Lys Gly Ala Ala His His 260
265 270His His His His 275296280PRTArtificial
SequenceNanobody sequence 296Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr
20 25 30Thr Met Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40
45Ala Glu Val Arg Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu
Lys 50 55 60Asp Arg Phe Ser Ile Ser
Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65 70
75 80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala
Val Tyr Tyr Cys Ala 85 90
95Ala Val Arg Gln Met Tyr Met Thr Val Val Pro Asp Tyr Trp Gly Gln
100 105 110Gly Thr Leu Val Thr Val
Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly 115 120
125Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln
Pro Gly 130 135 140Gly Ser Leu Arg Leu
Ser Cys Ala Ala Ser Gly Ser Val His Lys Ile145 150
155 160Asn Phe Leu Gly Trp Tyr Arg Gln Ala Pro
Gly Lys Glu Arg Gly Leu 165 170
175Val Ala Thr Ile Thr Ile Gly Asp Thr Thr Asp Tyr Ala Asp Tyr Ala
180 185 190Lys Gly Arg Phe Thr
Ile Ser Arg Asp Glu Ala Arg Asn Met Val Tyr 195
200 205Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala
Val Tyr Phe Cys 210 215 220Arg Ala Gly
Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr225
230 235 240Leu Val Thr Val Ser Ser Gly
Ala Ala Asp Tyr Lys Asp His Asp Gly 245
250 255Asp Tyr Lys Asp His Asp Ile Asp Tyr Lys Asp Asp
Asp Asp Lys Gly 260 265 270Ala
Ala His His His His His His 275
280297293PRTArtificial SequenceNanobody sequence 297Glu Val Gln Leu Gln
Ala Ser Gly Gly Gly Ser Val Gln Ala Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Tyr
Thr Ile Gly Pro Tyr 20 25
30Cys Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Gly Val
35 40 45Ala Ala Ile Asn Met Gly Gly Gly
Ile Thr Tyr Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Gln Asp Asn Ala Lys Asn Thr Val Tyr65
70 75 80Leu Leu Met Asn Ser
Leu Glu Pro Glu Asp Thr Ala Ile Tyr Tyr Cys 85
90 95Ala Ala Asp Ser Thr Ile Tyr Ala Ser Tyr Tyr
Glu Cys Gly His Gly 100 105
110Leu Ser Thr Gly Gly Tyr Gly Tyr Asp Ser Trp Gly Gln Gly Thr Gln
115 120 125Val Thr Val Ser Ser Gly Gly
Gly Gly Ser Gly Gly Gly Ser Glu Val 130 135
140Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser
Leu145 150 155 160Arg Leu
Ser Cys Ala Ala Ser Gly Ser Val His Lys Ile Asn Phe Leu
165 170 175Gly Trp Tyr Arg Gln Ala Pro
Gly Lys Glu Arg Gly Leu Val Ala Thr 180 185
190Ile Thr Ile Gly Asp Thr Thr Asp Tyr Ala Asp Tyr Ala Lys
Gly Arg 195 200 205Phe Thr Ile Ser
Arg Asp Glu Ala Arg Asn Met Val Tyr Leu Gln Met 210
215 220Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg Ala Gly225 230 235
240Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu Val Thr
245 250 255Val Ser Ser Gly Ala
Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr Lys 260
265 270Asp His Asp Ile Asp Tyr Lys Asp Asp Asp Asp Lys
Gly Ala Ala His 275 280 285His His
His His His 290298296PRTArtificial SequenceNanobody sequence 298Glu
Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Thr
Phe Ser Gly Gly Thr Phe Ser Ser Tyr 20 25
30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu
Phe Val 35 40 45Ala Glu Val Arg
Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu Lys 50 55
60Asp Arg Phe Ser Ile Ser Glu Asp Ser Val Lys Asn Ala
Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala
85 90 95Ala Val Arg Gln Met Tyr
Met Thr Val Val Pro Asp Tyr Trp Gly Gln 100
105 110Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly
Ser Gly Gly Gly 115 120 125Ser Asp
Val Gln Leu Gln Ala Ser Gly Gly Gly Ser Val Gln Ala Gly 130
135 140Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Tyr Thr Ile Gly Pro145 150 155
160Tyr Cys Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Gly
165 170 175Val Ala Ala Ile
Asn Met Gly Gly Gly Ile Thr Tyr Tyr Ala Asp Ser 180
185 190Val Lys Gly Arg Phe Thr Ile Ser Gln Asp Asn
Ala Lys Asn Thr Val 195 200 205Tyr
Leu Leu Met Asn Ser Leu Glu Pro Glu Asp Thr Ala Ile Tyr Tyr 210
215 220Cys Ala Ala Asp Ser Thr Ile Tyr Ala Ser
Tyr Tyr Glu Cys Gly His225 230 235
240Gly Leu Ser Thr Gly Gly Tyr Gly Tyr Asp Ser Trp Gly Gln Gly
Thr 245 250 255Gln Val Thr
Val Ser Ser Gly Ala Ala Asp Tyr Lys Asp His Asp Gly 260
265 270Asp Tyr Lys Asp His Asp Ile Asp Tyr Lys
Asp Asp Asp Asp Lys Gly 275 280
285Ala Ala His His His His His His 290
295299280PRTArtificial SequenceNanobody sequence 299Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ser
Val His Lys Ile Asn 20 25
30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Gly Leu Val
35 40 45Ala Thr Ile Thr Ile Gly Asp Thr
Thr Asp Tyr Ala Asp Tyr Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Arg Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Ser Glu Val
115 120 125Gln Leu Val Glu Ser Gly Gly
Gly Leu Val Gln Pro Gly Gly Ser Leu 130 135
140Arg Leu Ser Cys Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr Thr
Met145 150 155 160Gly Trp
Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala Glu
165 170 175Val Arg Trp Gly Gly Val Thr
Thr Tyr Ser Asn Ser Leu Lys Asp Arg 180 185
190Phe Ser Ile Ser Glu Asp Ser Val Lys Asn Ala Val Tyr Leu
Gln Met 195 200 205Asn Ser Leu Lys
Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala Ala Val 210
215 220Arg Gln Met Tyr Met Thr Val Val Pro Asp Tyr Trp
Gly Gln Gly Thr225 230 235
240Leu Val Thr Val Ser Ser Gly Ala Ala Asp Tyr Lys Asp His Asp Gly
245 250 255Asp Tyr Lys Asp His
Asp Ile Asp Tyr Lys Asp Asp Asp Asp Lys Gly 260
265 270Ala Ala His His His His His His 275
280300306PRTArtificial SequenceNanobody sequence 300Glu Val Gln
Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Thr Phe Ser
Gly Gly Thr Phe Ser Ser Tyr 20 25
30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Glu Val Arg Trp Gly Gly
Val Thr Thr Tyr Ser Asn Ser Leu Lys 50 55
60Asp Arg Phe Ser Ile Ser Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65
70 75 80Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala 85
90 95Ala Val Arg Gln Met Tyr Met Thr Val Val
Pro Asp Tyr Trp Gly Gln 100 105
110Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly
115 120 125Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly 130 135
140Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu
Val145 150 155 160Glu Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser
165 170 175Cys Ala Ala Ser Gly Ser Val
His Lys Ile Asn Phe Leu Gly Trp Tyr 180 185
190Arg Gln Ala Pro Gly Lys Glu Arg Gly Leu Val Ala Thr Ile
Thr Ile 195 200 205Gly Asp Thr Thr
Asp Tyr Ala Asp Tyr Ala Lys Gly Arg Phe Thr Ile 210
215 220Ser Arg Asp Glu Ala Arg Asn Met Val Tyr Leu Gln
Met Asn Ser Leu225 230 235
240Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg Ala Gly Ser Arg Leu
245 250 255Tyr Pro Tyr Asn Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270Gly Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr
Lys Asp His Asp 275 280 285Ile Asp
Tyr Lys Asp Asp Asp Asp Lys Gly Ala Ala His His His His 290
295 300His His305301319PRTArtificial
SequenceNanobody sequence 301Glu Val Gln Leu Gln Ala Ser Gly Gly Gly Ser
Val Gln Ala Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Tyr Thr Ile Gly Pro Tyr
20 25 30Cys Met Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu Arg Glu Gly Val 35 40
45Ala Ala Ile Asn Met Gly Gly Gly Ile Thr Tyr Tyr Ala Asp Ser
Val 50 55 60Lys Gly Arg Phe Thr Ile
Ser Gln Asp Asn Ala Lys Asn Thr Val Tyr65 70
75 80Leu Leu Met Asn Ser Leu Glu Pro Glu Asp Thr
Ala Ile Tyr Tyr Cys 85 90
95Ala Ala Asp Ser Thr Ile Tyr Ala Ser Tyr Tyr Glu Cys Gly His Gly
100 105 110Leu Ser Thr Gly Gly Tyr
Gly Tyr Asp Ser Trp Gly Gln Gly Thr Gln 115 120
125Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
Ser Gly 130 135 140Gly Gly Gly Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly145 150
155 160Gly Gly Ser Gly Gly Gly Gly Ser Glu Val
Gln Leu Val Glu Ser Gly 165 170
175Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala
180 185 190Ser Gly Ser Val His
Lys Ile Asn Phe Leu Gly Trp Tyr Arg Gln Ala 195
200 205Pro Gly Lys Glu Arg Gly Leu Val Ala Thr Ile Thr
Ile Gly Asp Thr 210 215 220Thr Asp Tyr
Ala Asp Tyr Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp225
230 235 240Glu Ala Arg Asn Met Val Tyr
Leu Gln Met Asn Ser Leu Lys Pro Glu 245
250 255Asp Thr Ala Val Tyr Phe Cys Arg Ala Gly Ser Arg
Leu Tyr Pro Tyr 260 265 270Asn
Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Gly Ala Ala 275
280 285Asp Tyr Lys Asp His Asp Gly Asp Tyr
Lys Asp His Asp Ile Asp Tyr 290 295
300Lys Asp Asp Asp Asp Lys Gly Ala Ala His His His His His His305
310 315302322PRTArtificial SequenceNanobody
sequence 302Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr 20
25 30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly
Lys Glu Arg Glu Phe Val 35 40
45Ala Glu Val Arg Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu Lys 50
55 60Asp Arg Phe Ser Ile Ser Glu Asp Ser
Val Lys Asn Ala Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr
Cys Ala 85 90 95Ala Val
Arg Gln Met Tyr Met Thr Val Val Pro Asp Tyr Trp Gly Gln 100
105 110Gly Thr Leu Val Thr Val Ser Ser Gly
Gly Gly Gly Ser Gly Gly Gly 115 120
125Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
130 135 140Ser Gly Gly Gly Gly Ser Gly
Gly Gly Gly Ser Asp Val Gln Leu Gln145 150
155 160Ala Ser Gly Gly Gly Ser Val Gln Ala Gly Gly Ser
Leu Arg Leu Ser 165 170
175Cys Ala Ala Ser Gly Tyr Thr Ile Gly Pro Tyr Cys Met Gly Trp Phe
180 185 190Arg Gln Ala Pro Gly Lys
Glu Arg Glu Gly Val Ala Ala Ile Asn Met 195 200
205Gly Gly Gly Ile Thr Tyr Tyr Ala Asp Ser Val Lys Gly Arg
Phe Thr 210 215 220Ile Ser Gln Asp Asn
Ala Lys Asn Thr Val Tyr Leu Leu Met Asn Ser225 230
235 240Leu Glu Pro Glu Asp Thr Ala Ile Tyr Tyr
Cys Ala Ala Asp Ser Thr 245 250
255Ile Tyr Ala Ser Tyr Tyr Glu Cys Gly His Gly Leu Ser Thr Gly Gly
260 265 270Tyr Gly Tyr Asp Ser
Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 275
280 285Gly Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr
Lys Asp His Asp 290 295 300Ile Asp Tyr
Lys Asp Asp Asp Asp Lys Gly Ala Ala His His His His305
310 315 320His His303306PRTArtificial
SequenceNanobody sequence 303Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ser Val His Lys Ile Asn
20 25 30Phe Leu Gly Trp Tyr Arg Gln
Ala Pro Gly Lys Glu Arg Gly Leu Val 35 40
45Ala Thr Ile Thr Ile Gly Asp Thr Thr Asp Tyr Ala Asp Tyr Ala
Lys 50 55 60Gly Arg Phe Thr Ile Ser
Arg Asp Glu Ala Arg Asn Met Val Tyr Leu65 70
75 80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala
Val Tyr Phe Cys Arg 85 90
95Ala Gly Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu
100 105 110Val Thr Val Ser Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly 115 120
125Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Gly Gly 130 135 140Gly Gly Ser Gly Gly
Gly Gly Ser Glu Val Gln Leu Val Glu Ser Gly145 150
155 160Gly Gly Leu Val Gln Pro Gly Gly Ser Leu
Arg Leu Ser Cys Thr Phe 165 170
175Ser Gly Gly Thr Phe Ser Ser Tyr Thr Met Gly Trp Phe Arg Gln Ala
180 185 190Pro Gly Lys Glu Arg
Glu Phe Val Ala Glu Val Arg Trp Gly Gly Val 195
200 205Thr Thr Tyr Ser Asn Ser Leu Lys Asp Arg Phe Ser
Ile Ser Glu Asp 210 215 220Ser Val Lys
Asn Ala Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu225
230 235 240Asp Thr Ala Val Tyr Tyr Cys
Ala Ala Val Arg Gln Met Tyr Met Thr 245
250 255Val Val Pro Asp Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 260 265 270Gly
Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr Lys Asp His Asp 275
280 285Ile Asp Tyr Lys Asp Asp Asp Asp Lys
Gly Ala Ala His His His His 290 295
300His His305304322PRTArtificial SequenceNanobody sequence 304Glu Val Gln
Leu Gln Ala Ser Gly Gly Gly Ser Val Gln Ala Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Tyr Thr Ile Gly Pro Tyr 20 25
30Cys Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Gly Val
35 40 45Ala Ala Ile Asn Met Gly Gly
Gly Ile Thr Tyr Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Gln Asp Asn Ala Lys Asn Thr Val Tyr65
70 75 80Leu Leu Met Asn
Ser Leu Glu Pro Glu Asp Thr Ala Ile Tyr Tyr Cys 85
90 95Ala Ala Asp Ser Thr Ile Tyr Ala Ser Tyr
Tyr Glu Cys Gly His Gly 100 105
110Leu Ser Thr Gly Gly Tyr Gly Tyr Asp Ser Trp Gly Gln Gly Thr Gln
115 120 125Val Thr Val Ser Ser Gly Gly
Gly Gly Ser Gly Gly Gly Gly Ser Gly 130 135
140Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
Gly145 150 155 160Gly Gly
Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val Glu Ser Gly
165 170 175Gly Gly Leu Val Gln Pro Gly
Gly Ser Leu Arg Leu Ser Cys Thr Phe 180 185
190Ser Gly Gly Thr Phe Ser Ser Tyr Thr Met Gly Trp Phe Arg
Gln Ala 195 200 205Pro Gly Lys Glu
Arg Glu Phe Val Ala Glu Val Arg Trp Gly Gly Val 210
215 220Thr Thr Tyr Ser Asn Ser Leu Lys Asp Arg Phe Ser
Ile Ser Glu Asp225 230 235
240Ser Val Lys Asn Ala Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu
245 250 255Asp Thr Ala Val Tyr
Tyr Cys Ala Ala Val Arg Gln Met Tyr Met Thr 260
265 270Val Val Pro Asp Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 275 280 285Gly Ala
Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr Lys Asp His Asp 290
295 300Ile Asp Tyr Lys Asp Asp Asp Asp Lys Gly Ala
Ala His His His His305 310 315
320His His305319PRTArtificial SequenceNanobody sequence 305Glu Val
Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala
Ser Gly Ser Val His Lys Ile Asn 20 25
30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Gly Leu
Val 35 40 45Ala Thr Ile Thr Ile
Gly Asp Thr Thr Asp Tyr Ala Asp Tyr Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Arg Asn Met Val
Tyr Leu65 70 75 80Gln
Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg
85 90 95Ala Gly Ser Arg Leu Tyr Pro
Tyr Asn Tyr Trp Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
Ser Gly 115 120 125Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly 130
135 140Gly Gly Ser Gly Gly Gly Gly Ser Asp Val Gln Leu
Gln Ala Ser Gly145 150 155
160Gly Gly Ser Val Gln Ala Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala
165 170 175Ser Gly Tyr Thr Ile
Gly Pro Tyr Cys Met Gly Trp Phe Arg Gln Ala 180
185 190Pro Gly Lys Glu Arg Glu Gly Val Ala Ala Ile Asn
Met Gly Gly Gly 195 200 205Ile Thr
Tyr Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Gln 210
215 220Asp Asn Ala Lys Asn Thr Val Tyr Leu Leu Met
Asn Ser Leu Glu Pro225 230 235
240Glu Asp Thr Ala Ile Tyr Tyr Cys Ala Ala Asp Ser Thr Ile Tyr Ala
245 250 255Ser Tyr Tyr Glu
Cys Gly His Gly Leu Ser Thr Gly Gly Tyr Gly Tyr 260
265 270Asp Ser Trp Gly Gln Gly Thr Gln Val Thr Val
Ser Ser Gly Ala Ala 275 280 285Asp
Tyr Lys Asp His Asp Gly Asp Tyr Lys Asp His Asp Ile Asp Tyr 290
295 300Lys Asp Asp Asp Asp Lys Gly Ala Ala His
His His His His His305 310
315306306PRTArtificial SequenceNanobody sequence 306Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Asp
Val Tyr Lys Ile Asn 20 25
30Phe Leu Gly Trp His Arg Gln Ala Pro Gly Lys Glu Arg Glu Lys Val
35 40 45Ala His Ile Thr Ile Gly Asp Ala
Thr Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
115 120 125Gly Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly 130 135
140Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val Glu Ser
Gly145 150 155 160Gly Gly
Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Thr Phe
165 170 175Ser Gly Gly Thr Phe Ser Ser
Tyr Thr Met Gly Trp Phe Arg Gln Ala 180 185
190Pro Gly Lys Glu Arg Glu Phe Val Ala Glu Val Arg Trp Gly
Gly Val 195 200 205Thr Thr Tyr Ser
Asn Ser Leu Lys Asp Arg Phe Ser Ile Ser Glu Asp 210
215 220Ser Val Lys Asn Ala Val Tyr Leu Gln Met Asn Ser
Leu Lys Pro Glu225 230 235
240Asp Thr Ala Val Tyr Tyr Cys Ala Ala Val Arg Gln Met Tyr Met Thr
245 250 255Val Val Pro Asp Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270Gly Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr
Lys Asp His Asp 275 280 285Ile Asp
Tyr Lys Asp Asp Asp Asp Lys Gly Ala Ala His His His His 290
295 300His His305307306PRTArtificial
SequenceNanobody sequence 307Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10
15Ser Leu Lys Leu Ser Cys Ala Ala Ser Gly Ala Val His Lys Ile Asn
20 25 30Phe Leu Gly Trp Tyr Arg Gln
Thr Pro Glu Lys Glu Arg Glu Met Val 35 40
45Ala Thr Ile Thr Ile Gly Asp Glu Val Asp Tyr Ala Asp Ser Ala
Lys 50 55 60Gly Arg Phe Thr Ile Ser
Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65 70
75 80Gln Met Thr Ser Leu Lys Pro Glu Asp Thr Ala
Val Tyr Val Cys Arg 85 90
95Ala Gly Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu
100 105 110Val Thr Val Ser Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly 115 120
125Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Gly Gly 130 135 140Gly Gly Ser Gly Gly
Gly Gly Ser Glu Val Gln Leu Val Glu Ser Gly145 150
155 160Gly Gly Leu Val Gln Pro Gly Gly Ser Leu
Arg Leu Ser Cys Thr Phe 165 170
175Ser Gly Gly Thr Phe Ser Ser Tyr Thr Met Gly Trp Phe Arg Gln Ala
180 185 190Pro Gly Lys Glu Arg
Glu Phe Val Ala Glu Val Arg Trp Gly Gly Val 195
200 205Thr Thr Tyr Ser Asn Ser Leu Lys Asp Arg Phe Ser
Ile Ser Glu Asp 210 215 220Ser Val Lys
Asn Ala Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu225
230 235 240Asp Thr Ala Val Tyr Tyr Cys
Ala Ala Val Arg Gln Met Tyr Met Thr 245
250 255Val Val Pro Asp Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 260 265 270Gly
Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr Lys Asp His Asp 275
280 285Ile Asp Tyr Lys Asp Asp Asp Asp Lys
Gly Ala Ala His His His His 290 295
300His His305308306PRTArtificial SequenceNanobody sequence 308Glu Val Gln
Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ile Thr Ser
Gly Glu Thr Phe Lys Ile Asn 20 25
30Ile Trp Gly Trp Tyr Arg Gln Ala Pro Gly Lys Gln Arg Glu Leu Val
35 40 45Ala Ser Leu Thr Ile Gly Gly
Ala Thr Asn Tyr Ala Asp Ser Val Lys 50 55
60Gly Arg Phe Thr Ile Ser Glu Asp Ser Ala Lys Asn Thr Val Tyr Leu65
70 75 80Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Asn 85
90 95Ala Lys Ser Arg Leu Tyr Pro Tyr Asp Tyr
Trp Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
115 120 125Gly Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly 130 135
140Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val Glu Ser
Gly145 150 155 160Gly Gly
Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Thr Phe
165 170 175Ser Gly Gly Thr Phe Ser Ser
Tyr Thr Met Gly Trp Phe Arg Gln Ala 180 185
190Pro Gly Lys Glu Arg Glu Phe Val Ala Glu Val Arg Trp Gly
Gly Val 195 200 205Thr Thr Tyr Ser
Asn Ser Leu Lys Asp Arg Phe Ser Ile Ser Glu Asp 210
215 220Ser Val Lys Asn Ala Val Tyr Leu Gln Met Asn Ser
Leu Lys Pro Glu225 230 235
240Asp Thr Ala Val Tyr Tyr Cys Ala Ala Val Arg Gln Met Tyr Met Thr
245 250 255Val Val Pro Asp Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270Gly Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr
Lys Asp His Asp 275 280 285Ile Asp
Tyr Lys Asp Asp Asp Asp Lys Gly Ala Ala His His His His 290
295 300His His305309306PRTArtificial
SequenceNanobody sequence 309Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ser Val His Leu Leu Asn
20 25 30Phe Leu Gly Trp Tyr Arg Gln
Ala Pro Gly Lys Glu Arg Glu Met Val 35 40
45Ala His Ile Thr Ile Ala Asp Ala Thr Asp Tyr Ala His Phe Ala
Lys 50 55 60Gly Arg Phe Thr Ile Ser
Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65 70
75 80Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala
Val Tyr Phe Cys Arg 85 90
95Ala Gly Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu
100 105 110Val Thr Val Ser Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly 115 120
125Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Gly Gly 130 135 140Gly Gly Ser Gly Gly
Gly Gly Ser Glu Val Gln Leu Val Glu Ser Gly145 150
155 160Gly Gly Leu Val Gln Pro Gly Gly Ser Leu
Arg Leu Ser Cys Thr Phe 165 170
175Ser Gly Gly Thr Phe Ser Ser Tyr Thr Met Gly Trp Phe Arg Gln Ala
180 185 190Pro Gly Lys Glu Arg
Glu Phe Val Ala Glu Val Arg Trp Gly Gly Val 195
200 205Thr Thr Tyr Ser Asn Ser Leu Lys Asp Arg Phe Ser
Ile Ser Glu Asp 210 215 220Ser Val Lys
Asn Ala Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu225
230 235 240Asp Thr Ala Val Tyr Tyr Cys
Ala Ala Val Arg Gln Met Tyr Met Thr 245
250 255Val Val Pro Asp Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 260 265 270Gly
Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr Lys Asp His Asp 275
280 285Ile Asp Tyr Lys Asp Asp Asp Asp Lys
Gly Ala Ala His His His His 290 295
300His His305310306PRTArtificial SequenceNanobody sequence 310Glu Val Gln
Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ile Thr Ser
Gly Glu Thr Phe Lys Ile Asn 20 25
30Ile Trp Gly Trp Tyr Arg Gln Ala Pro Gly Lys Gln Arg Glu Leu Val
35 40 45Ala Ser Leu Thr Ile Gly Gly
Ala Thr Asp Tyr Ala Asp Ser Val Lys 50 55
60Gly Arg Phe Thr Ile Ser Glu Asp Ser Ala Lys Asn Thr Val Tyr Leu65
70 75 80Gln Met Asn Ser
Leu Lys Ala Glu Asp Thr Ala Val Tyr Phe Cys Asn 85
90 95Ala Lys Ser Arg Leu Tyr Pro Tyr Asp Tyr
Trp Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
115 120 125Gly Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly 130 135
140Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val Glu Ser
Gly145 150 155 160Gly Gly
Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Thr Phe
165 170 175Ser Gly Gly Thr Phe Ser Ser
Tyr Thr Met Gly Trp Phe Arg Gln Ala 180 185
190Pro Gly Lys Glu Arg Glu Phe Val Ala Glu Val Arg Trp Gly
Gly Val 195 200 205Thr Thr Tyr Ser
Asn Ser Leu Lys Asp Arg Phe Ser Ile Ser Glu Asp 210
215 220Ser Val Lys Asn Ala Val Tyr Leu Gln Met Asn Ser
Leu Lys Pro Glu225 230 235
240Asp Thr Ala Val Tyr Tyr Cys Ala Ala Val Arg Gln Met Tyr Met Thr
245 250 255Val Val Pro Asp Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270Gly Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr
Lys Asp His Asp 275 280 285Ile Asp
Tyr Lys Asp Asp Asp Asp Lys Gly Ala Ala His His His His 290
295 300His His305311306PRTArtificial
SequenceNanobody sequence 311Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Glu Val Tyr Lys Ile Asn
20 25 30Phe Leu Gly Trp Tyr Arg Gln
Ala Pro Gly Lys Glu Arg Glu Lys Val 35 40
45Ala His Ile Thr Ile Ala Asp Ala Ala Asp Tyr Ala Asp Phe Ala
Lys 50 55 60Gly Arg Phe Thr Ile Ser
Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65 70
75 80Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala
Val Tyr Phe Cys Arg 85 90
95Ala Gly Ser Arg Ile Trp Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu
100 105 110Val Thr Val Ser Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly 115 120
125Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Gly Gly 130 135 140Gly Gly Ser Gly Gly
Gly Gly Ser Glu Val Gln Leu Val Glu Ser Gly145 150
155 160Gly Gly Leu Val Gln Pro Gly Gly Ser Leu
Arg Leu Ser Cys Thr Phe 165 170
175Ser Gly Gly Thr Phe Ser Ser Tyr Thr Met Gly Trp Phe Arg Gln Ala
180 185 190Pro Gly Lys Glu Arg
Glu Phe Val Ala Glu Val Arg Trp Gly Gly Val 195
200 205Thr Thr Tyr Ser Asn Ser Leu Lys Asp Arg Phe Ser
Ile Ser Glu Asp 210 215 220Ser Val Lys
Asn Ala Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu225
230 235 240Asp Thr Ala Val Tyr Tyr Cys
Ala Ala Val Arg Gln Met Tyr Met Thr 245
250 255Val Val Pro Asp Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 260 265 270Gly
Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr Lys Asp His Asp 275
280 285Ile Asp Tyr Lys Asp Asp Asp Asp Lys
Gly Ala Ala His His His His 290 295
300His His305312306PRTArtificial SequenceNanobody sequence 312Glu Val Gln
Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Val Ala Ser
Gly Asp Val His Lys Ile Asn 20 25
30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Glu Lys Val
35 40 45Ala His Ile Ser Ile Gly Asp
Gln Thr Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ser Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Phe Ser Arg Ile Tyr Pro Tyr Asp Tyr
Trp Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
115 120 125Gly Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly 130 135
140Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val Glu Ser
Gly145 150 155 160Gly Gly
Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Thr Phe
165 170 175Ser Gly Gly Thr Phe Ser Ser
Tyr Thr Met Gly Trp Phe Arg Gln Ala 180 185
190Pro Gly Lys Glu Arg Glu Phe Val Ala Glu Val Arg Trp Gly
Gly Val 195 200 205Thr Thr Tyr Ser
Asn Ser Leu Lys Asp Arg Phe Ser Ile Ser Glu Asp 210
215 220Ser Val Lys Asn Ala Val Tyr Leu Gln Met Asn Ser
Leu Lys Pro Glu225 230 235
240Asp Thr Ala Val Tyr Tyr Cys Ala Ala Val Arg Gln Met Tyr Met Thr
245 250 255Val Val Pro Asp Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270Gly Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr
Lys Asp His Asp 275 280 285Ile Asp
Tyr Lys Asp Asp Asp Asp Lys Gly Ala Ala His His His His 290
295 300His His305313306PRTArtificial
SequenceNanobody sequence 313Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Glu Ile Gly Arg Ile Asn
20 25 30Phe Tyr Arg Trp Tyr Arg Gln
Ala Pro Gly Asn Gln Arg Glu Val Val 35 40
45Ala Thr Ile Thr Ile Ala Asp Lys Thr Asp Tyr Ala Asp Ser Ala
Lys 50 55 60Gly Arg Phe Thr Ile Ser
Arg Asp Glu Ser Arg Asn Met Val Tyr Leu65 70
75 80Gln Met Ser Ser Leu Lys Pro Glu Asp Thr Ala
Val Tyr Phe Cys His 85 90
95Ala Gly Ser Arg Leu Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu
100 105 110Val Thr Val Ser Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly 115 120
125Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Gly Gly 130 135 140Gly Gly Ser Gly Gly
Gly Gly Ser Glu Val Gln Leu Val Glu Ser Gly145 150
155 160Gly Gly Leu Val Gln Pro Gly Gly Ser Leu
Arg Leu Ser Cys Thr Phe 165 170
175Ser Gly Gly Thr Phe Ser Ser Tyr Thr Met Gly Trp Phe Arg Gln Ala
180 185 190Pro Gly Lys Glu Arg
Glu Phe Val Ala Glu Val Arg Trp Gly Gly Val 195
200 205Thr Thr Tyr Ser Asn Ser Leu Lys Asp Arg Phe Ser
Ile Ser Glu Asp 210 215 220Ser Val Lys
Asn Ala Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu225
230 235 240Asp Thr Ala Val Tyr Tyr Cys
Ala Ala Val Arg Gln Met Tyr Met Thr 245
250 255Val Val Pro Asp Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 260 265 270Gly
Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr Lys Asp His Asp 275
280 285Ile Asp Tyr Lys Asp Asp Asp Asp Lys
Gly Ala Ala His His His His 290 295
300His His305314306PRTArtificial SequenceNanobody sequence 314Glu Val Gln
Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Val Ala Ser
Gly Asp Val His Lys Ile Asn 20 25
30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Glu Lys Val
35 40 45Ala His Ile Thr Ile Gly Asp
Gln Ala Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Ile Tyr Pro Tyr Asp Tyr
Trp Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
115 120 125Gly Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly 130 135
140Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val Glu Ser
Gly145 150 155 160Gly Gly
Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Thr Phe
165 170 175Ser Gly Gly Thr Phe Ser Ser
Tyr Thr Met Gly Trp Phe Arg Gln Ala 180 185
190Pro Gly Lys Glu Arg Glu Phe Val Ala Glu Val Arg Trp Gly
Gly Val 195 200 205Thr Thr Tyr Ser
Asn Ser Leu Lys Asp Arg Phe Ser Ile Ser Glu Asp 210
215 220Ser Val Lys Asn Ala Val Tyr Leu Gln Met Asn Ser
Leu Lys Pro Glu225 230 235
240Asp Thr Ala Val Tyr Tyr Cys Ala Ala Val Arg Gln Met Tyr Met Thr
245 250 255Val Val Pro Asp Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270Gly Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr
Lys Asp His Asp 275 280 285Ile Asp
Tyr Lys Asp Asp Asp Asp Lys Gly Ala Ala His His His His 290
295 300His His305315306PRTArtificial
SequenceNanobody sequence 315Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Asp Val His Lys Ile Asn
20 25 30Ile Leu Gly Trp Tyr Arg Gln
Ala Pro Ala Lys Glu Arg Glu Met Val 35 40
45Ala His Ile Thr Ile Gly Asp Ala Thr Asp Tyr Ala Asp Ser Ala
Lys 50 55 60Gly Arg Phe Thr Ile Ser
Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65 70
75 80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala
Val Tyr Phe Cys Arg 85 90
95Ala Tyr Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu
100 105 110Val Thr Val Ser Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly 115 120
125Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Gly Gly 130 135 140Gly Gly Ser Gly Gly
Gly Gly Ser Glu Val Gln Leu Val Glu Ser Gly145 150
155 160Gly Gly Leu Val Gln Pro Gly Gly Ser Leu
Arg Leu Ser Cys Thr Phe 165 170
175Ser Gly Gly Thr Phe Ser Ser Tyr Thr Met Gly Trp Phe Arg Gln Ala
180 185 190Pro Gly Lys Glu Arg
Glu Phe Val Ala Glu Val Arg Trp Gly Gly Val 195
200 205Thr Thr Tyr Ser Asn Ser Leu Lys Asp Arg Phe Ser
Ile Ser Glu Asp 210 215 220Ser Val Lys
Asn Ala Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu225
230 235 240Asp Thr Ala Val Tyr Tyr Cys
Ala Ala Val Arg Gln Met Tyr Met Thr 245
250 255Val Val Pro Asp Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 260 265 270Gly
Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr Lys Asp His Asp 275
280 285Ile Asp Tyr Lys Asp Asp Asp Asp Lys
Gly Ala Ala His His His His 290 295
300His His305316306PRTArtificial SequenceNanobody sequence 316Glu Val Gln
Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Ser Val His Lys Ile Asn 20 25
30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Glu Leu Val
35 40 45Ala Thr Ile Thr Ile Gly Asp
Thr Thr Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Leu Tyr Pro Tyr Asn Tyr
Trp Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
115 120 125Gly Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly 130 135
140Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val Glu Ser
Gly145 150 155 160Gly Gly
Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Thr Phe
165 170 175Ser Gly Gly Thr Phe Ser Ser
Tyr Thr Met Gly Trp Phe Arg Gln Ala 180 185
190Pro Gly Lys Glu Arg Glu Phe Val Ala Glu Val Arg Trp Gly
Gly Val 195 200 205Thr Thr Tyr Ser
Asn Ser Leu Lys Asp Arg Phe Ser Ile Ser Glu Asp 210
215 220Ser Val Lys Asn Ala Val Tyr Leu Gln Met Asn Ser
Leu Lys Pro Glu225 230 235
240Asp Thr Ala Val Tyr Tyr Cys Ala Ala Val Arg Gln Met Tyr Met Thr
245 250 255Val Val Pro Asp Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270Gly Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr
Lys Asp His Asp 275 280 285Ile Asp
Tyr Lys Asp Asp Asp Asp Lys Gly Ala Ala His His His His 290
295 300His His305317306PRTArtificial
SequenceNanobody sequence 317Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ser Val His Lys Ile Asn
20 25 30Phe Leu Gly Trp Tyr Arg Gln
Ala Pro Gly Lys Glu Arg Gly Leu Val 35 40
45Ala Thr Ile Thr Ile Gly Asp Thr Thr Asp Tyr Ala Asp Tyr Ala
Lys 50 55 60Gly Arg Phe Thr Ile Ser
Arg Asp Glu Ala Arg Asn Met Val Tyr Leu65 70
75 80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala
Val Tyr Phe Cys Arg 85 90
95Ala Gly Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu
100 105 110Val Thr Val Ser Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly 115 120
125Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Gly Gly 130 135 140Gly Gly Ser Gly Gly
Gly Gly Ser Glu Val Gln Leu Val Glu Ser Gly145 150
155 160Gly Gly Leu Val Gln Pro Gly Gly Ser Leu
Arg Leu Ser Cys Thr Phe 165 170
175Ser Gly Gly Thr Phe Ser Ser Tyr Thr Met Gly Trp Phe Arg Gln Ala
180 185 190Pro Gly Lys Glu Arg
Glu Phe Val Ala Glu Val Arg Trp Gly Gly Val 195
200 205Thr Thr Tyr Ser Asn Ser Leu Lys Asp Arg Phe Ser
Ile Ser Glu Asp 210 215 220Ser Val Lys
Asn Ala Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu225
230 235 240Asp Thr Ala Val Tyr Tyr Cys
Ala Ala Val Arg Gln Met Tyr Met Thr 245
250 255Val Val Pro Asp Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 260 265 270Gly
Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr Lys Asp His Asp 275
280 285Ile Asp Tyr Lys Asp Asp Asp Asp Lys
Gly Ala Ala His His His His 290 295
300His His305318306PRTArtificial SequenceNanobody sequence 318Glu Val Gln
Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Asp Val His Lys Ile Asn 20 25
30Ile Leu Gly Trp Tyr Arg Gln Ala Pro Ala Lys Glu Arg Glu Met Val
35 40 45Ala His Ile Thr Ile Gly Asp
Ala Thr Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Leu Cys Arg 85
90 95Ala Tyr Ser Arg Ile Tyr Pro Tyr Asn Tyr
Trp Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
115 120 125Gly Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly 130 135
140Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val Glu Ser
Gly145 150 155 160Gly Gly
Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Thr Phe
165 170 175Ser Gly Gly Thr Phe Ser Ser
Tyr Thr Met Gly Trp Phe Arg Gln Ala 180 185
190Pro Gly Lys Glu Arg Glu Phe Val Ala Glu Val Arg Trp Gly
Gly Val 195 200 205Thr Thr Tyr Ser
Asn Ser Leu Lys Asp Arg Phe Ser Ile Ser Glu Asp 210
215 220Ser Val Lys Asn Ala Val Tyr Leu Gln Met Asn Ser
Leu Lys Pro Glu225 230 235
240Asp Thr Ala Val Tyr Tyr Cys Ala Ala Val Arg Gln Met Tyr Met Thr
245 250 255Val Val Pro Asp Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270Gly Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr
Lys Asp His Asp 275 280 285Ile Asp
Tyr Lys Asp Asp Asp Asp Lys Gly Ala Ala His His His His 290
295 300His His305319306PRTArtificial
SequenceNanobody sequence 319Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr
20 25 30Thr Met Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40
45Ala Glu Val Arg Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu
Lys 50 55 60Asp Arg Phe Ser Ile Ser
Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65 70
75 80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala
Val Tyr Tyr Cys Ala 85 90
95Ala Val Arg Gln Met Tyr Met Thr Val Val Pro Asp Tyr Trp Gly Gln
100 105 110Gly Thr Leu Val Thr Val
Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly 115 120
125Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly 130 135 140Ser Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val145 150
155 160Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly Ser Leu Arg Leu Ser 165 170
175Cys Val Ala Ser Gly Asp Val His Lys Ile Asn Phe Leu Gly Trp Tyr
180 185 190Arg Gln Ala Pro Gly
Lys Glu Arg Glu Lys Val Ala His Ile Ser Ile 195
200 205Gly Asp Gln Thr Asp Tyr Ala Asp Ser Ala Lys Gly
Arg Phe Thr Ile 210 215 220Ser Arg Asp
Glu Ser Lys Asn Met Val Tyr Leu Gln Met Asn Ser Leu225
230 235 240Lys Pro Glu Asp Thr Ala Val
Tyr Phe Cys Arg Ala Phe Ser Arg Ile 245
250 255Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 260 265 270Gly
Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr Lys Asp His Asp 275
280 285Ile Asp Tyr Lys Asp Asp Asp Asp Lys
Gly Ala Ala His His His His 290 295
300His His305320306PRTArtificial SequenceNanobody sequence 320Glu Val Gln
Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Thr Phe Ser
Gly Gly Thr Phe Ser Ser Tyr 20 25
30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Glu Val Arg Trp Gly Gly
Val Thr Thr Tyr Ser Asn Ser Leu Lys 50 55
60Asp Arg Phe Ser Ile Ser Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65
70 75 80Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala 85
90 95Ala Val Arg Gln Met Tyr Met Thr Val Val
Pro Asp Tyr Trp Gly Gln 100 105
110Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly
115 120 125Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly 130 135
140Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu
Val145 150 155 160Glu Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser
165 170 175Cys Ala Ala Ser Gly Glu Ile
Gly Arg Ile Asn Phe Tyr Arg Trp Tyr 180 185
190Arg Gln Ala Pro Gly Asn Gln Arg Glu Val Val Ala Thr Ile
Thr Ile 195 200 205Ala Asp Lys Thr
Asp Tyr Ala Asp Ser Ala Lys Gly Arg Phe Thr Ile 210
215 220Ser Arg Asp Glu Ser Arg Asn Met Val Tyr Leu Gln
Met Ser Ser Leu225 230 235
240Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys His Ala Gly Ser Arg Leu
245 250 255Tyr Pro Tyr Asp Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270Gly Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr
Lys Asp His Asp 275 280 285Ile Asp
Tyr Lys Asp Asp Asp Asp Lys Gly Ala Ala His His His His 290
295 300His His305321306PRTArtificial
SequenceNanobody sequence 321Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr
20 25 30Thr Met Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40
45Ala Glu Val Arg Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu
Lys 50 55 60Asp Arg Phe Ser Ile Ser
Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65 70
75 80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala
Val Tyr Tyr Cys Ala 85 90
95Ala Val Arg Gln Met Tyr Met Thr Val Val Pro Asp Tyr Trp Gly Gln
100 105 110Gly Thr Leu Val Thr Val
Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly 115 120
125Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly 130 135 140Ser Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val145 150
155 160Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly Ser Leu Arg Leu Ser 165 170
175Cys Val Ala Ser Gly Asp Val His Lys Ile Asn Phe Leu Gly Trp Tyr
180 185 190Arg Gln Ala Pro Gly
Lys Glu Arg Glu Lys Val Ala His Ile Thr Ile 195
200 205Gly Asp Gln Ala Asp Tyr Ala Asp Ser Ala Lys Gly
Arg Phe Thr Ile 210 215 220Ser Arg Asp
Glu Ala Lys Asn Met Val Tyr Leu Gln Met Asn Ser Leu225
230 235 240Lys Pro Glu Asp Thr Ala Val
Tyr Phe Cys Arg Ala Gly Ser Arg Ile 245
250 255Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 260 265 270Gly
Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr Lys Asp His Asp 275
280 285Ile Asp Tyr Lys Asp Asp Asp Asp Lys
Gly Ala Ala His His His His 290 295
300His His305322306PRTArtificial SequenceNanobody sequence 322Glu Val Gln
Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Thr Phe Ser
Gly Gly Thr Phe Ser Ser Tyr 20 25
30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Glu Val Arg Trp Gly Gly
Val Thr Thr Tyr Ser Asn Ser Leu Lys 50 55
60Asp Arg Phe Ser Ile Ser Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65
70 75 80Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala 85
90 95Ala Val Arg Gln Met Tyr Met Thr Val Val
Pro Asp Tyr Trp Gly Gln 100 105
110Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly
115 120 125Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly 130 135
140Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu
Val145 150 155 160Glu Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser
165 170 175Cys Ala Ala Ser Gly Asp Val
His Lys Ile Asn Ile Leu Gly Trp Tyr 180 185
190Arg Gln Ala Pro Ala Lys Glu Arg Glu Met Val Ala His Ile
Thr Ile 195 200 205Gly Asp Ala Thr
Asp Tyr Ala Asp Ser Ala Lys Gly Arg Phe Thr Ile 210
215 220Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu Gln
Met Asn Ser Leu225 230 235
240Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg Ala Tyr Ser Arg Ile
245 250 255Tyr Pro Tyr Asn Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270Gly Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr
Lys Asp His Asp 275 280 285Ile Asp
Tyr Lys Asp Asp Asp Asp Lys Gly Ala Ala His His His His 290
295 300His His305323306PRTArtificial
SequenceNanobody sequence 323Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr
20 25 30Thr Met Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40
45Ala Glu Val Arg Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu
Lys 50 55 60Asp Arg Phe Ser Ile Ser
Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65 70
75 80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala
Val Tyr Tyr Cys Ala 85 90
95Ala Val Arg Gln Met Tyr Met Thr Val Val Pro Asp Tyr Trp Gly Gln
100 105 110Gly Thr Leu Val Thr Val
Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly 115 120
125Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly 130 135 140Ser Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val145 150
155 160Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly Ser Leu Arg Leu Ser 165 170
175Cys Ala Ala Ser Gly Ser Val His Lys Ile Asn Phe Leu Gly Trp Tyr
180 185 190Arg Gln Ala Pro Gly
Lys Glu Arg Glu Leu Val Ala Thr Ile Thr Ile 195
200 205Gly Asp Thr Thr Asp Tyr Ala Asp Ser Ala Lys Gly
Arg Phe Thr Ile 210 215 220Ser Arg Asp
Glu Ala Lys Asn Met Val Tyr Leu Gln Met Asn Ser Leu225
230 235 240Lys Pro Glu Asp Thr Ala Val
Tyr Phe Cys Arg Ala Gly Ser Arg Leu 245
250 255Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 260 265 270Gly
Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr Lys Asp His Asp 275
280 285Ile Asp Tyr Lys Asp Asp Asp Asp Lys
Gly Ala Ala His His His His 290 295
300His His305324306PRTArtificial SequenceNanobody sequence 324Glu Val Gln
Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Thr Phe Ser
Gly Gly Thr Phe Ser Ser Tyr 20 25
30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Glu Val Arg Trp Gly Gly
Val Thr Thr Tyr Ser Asn Ser Leu Lys 50 55
60Asp Arg Phe Ser Ile Ser Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65
70 75 80Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala 85
90 95Ala Val Arg Gln Met Tyr Met Thr Val Val
Pro Asp Tyr Trp Gly Gln 100 105
110Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly
115 120 125Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly 130 135
140Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu
Val145 150 155 160Glu Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser
165 170 175Cys Ala Ala Ser Gly Ser Val
His Lys Ile Asn Phe Leu Gly Trp Tyr 180 185
190Arg Gln Ala Pro Gly Lys Glu Arg Gly Leu Val Ala Thr Ile
Thr Ile 195 200 205Gly Asp Thr Thr
Asp Tyr Ala Asp Tyr Ala Lys Gly Arg Phe Thr Ile 210
215 220Ser Arg Asp Glu Ala Arg Asn Met Val Tyr Leu Gln
Met Asn Ser Leu225 230 235
240Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg Ala Gly Ser Arg Leu
245 250 255Tyr Pro Tyr Asn Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270Gly Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr
Lys Asp His Asp 275 280 285Ile Asp
Tyr Lys Asp Asp Asp Asp Lys Gly Ala Ala His His His His 290
295 300His His305325306PRTArtificial
SequenceNanobody sequence 325Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr
20 25 30Thr Met Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40
45Ala Glu Val Arg Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu
Lys 50 55 60Asp Arg Phe Ser Ile Ser
Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65 70
75 80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala
Val Tyr Tyr Cys Ala 85 90
95Ala Val Arg Gln Met Tyr Met Thr Val Val Pro Asp Tyr Trp Gly Gln
100 105 110Gly Thr Leu Val Thr Val
Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly 115 120
125Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly 130 135 140Ser Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val145 150
155 160Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly Ser Leu Arg Leu Ser 165 170
175Cys Ala Ala Ser Gly Asp Val Tyr Lys Ile Asn Phe Leu Gly Trp His
180 185 190Arg Gln Ala Pro Gly
Lys Glu Arg Glu Lys Val Ala His Ile Thr Ile 195
200 205Gly Asp Ala Thr Asp Tyr Ala Asp Ser Ala Lys Gly
Arg Phe Thr Ile 210 215 220Ser Arg Asp
Glu Ala Lys Asn Met Val Tyr Leu Gln Met Asn Ser Leu225
230 235 240Lys Pro Glu Asp Thr Ala Val
Tyr Phe Cys Arg Ala Gly Ser Arg Ile 245
250 255Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 260 265 270Gly
Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr Lys Asp His Asp 275
280 285Ile Asp Tyr Lys Asp Asp Asp Asp Lys
Gly Ala Ala His His His His 290 295
300His His305326306PRTArtificial SequenceNanobody sequence 326Glu Val Gln
Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Thr Phe Ser
Gly Gly Thr Phe Ser Ser Tyr 20 25
30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Glu Val Arg Trp Gly Gly
Val Thr Thr Tyr Ser Asn Ser Leu Lys 50 55
60Asp Arg Phe Ser Ile Ser Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65
70 75 80Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala 85
90 95Ala Val Arg Gln Met Tyr Met Thr Val Val
Pro Asp Tyr Trp Gly Gln 100 105
110Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly
115 120 125Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly 130 135
140Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu
Val145 150 155 160Glu Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser
165 170 175Cys Ala Ala Ser Gly Glu Val
Tyr Lys Ile Asn Phe Leu Gly Trp Tyr 180 185
190Arg Gln Ala Pro Gly Lys Glu Arg Glu Lys Val Ala His Ile
Thr Ile 195 200 205Ala Asp Ala Ala
Asp Tyr Ala Asp Phe Ala Lys Gly Arg Phe Thr Ile 210
215 220Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu Gln
Met Asn Ser Leu225 230 235
240Arg Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg Ala Gly Ser Arg Ile
245 250 255Trp Pro Tyr Asp Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270Gly Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr
Lys Asp His Asp 275 280 285Ile Asp
Tyr Lys Asp Asp Asp Asp Lys Gly Ala Ala His His His His 290
295 300His His305327306PRTArtificial
SequenceNanobody sequence 327Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr
20 25 30Thr Met Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40
45Ala Glu Val Arg Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu
Lys 50 55 60Asp Arg Phe Ser Ile Ser
Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65 70
75 80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala
Val Tyr Tyr Cys Ala 85 90
95Ala Val Arg Gln Met Tyr Met Thr Val Val Pro Asp Tyr Trp Gly Gln
100 105 110Gly Thr Leu Val Thr Val
Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly 115 120
125Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly 130 135 140Ser Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val145 150
155 160Glu Ser Gly Gly Asp Leu Val Gln Pro Gly
Gly Ser Leu Arg Leu Ser 165 170
175Cys Ala Ala Ser Gly Asp Val His Lys Ile Asn Phe Leu Gly Trp Tyr
180 185 190Arg Gln Ala Pro Gly
Lys Glu Arg Glu Met Val Ala His Ile Thr Ile 195
200 205Ala Asp Ala Thr Asp Tyr Ala Glu Phe Ala Lys Gly
Arg Phe Thr Ile 210 215 220Ser Arg Asp
Glu Pro Lys Asn Met Val Tyr Leu Gln Met Asn Ser Leu225
230 235 240Lys Pro Glu Asp Thr Ala Val
Tyr Leu Cys Arg Ala Gly Ser Arg Ile 245
250 255Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 260 265 270Gly
Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr Lys Asp His Asp 275
280 285Ile Asp Tyr Lys Asp Asp Asp Asp Lys
Gly Ala Ala His His His His 290 295
300His His305328306PRTArtificial SequenceNanobody sequence 328Glu Val Gln
Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Thr Phe Ser
Gly Gly Thr Phe Ser Ser Tyr 20 25
30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Glu Val Arg Trp Gly Gly
Val Thr Thr Tyr Ser Asn Ser Leu Lys 50 55
60Asp Arg Phe Ser Ile Ser Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65
70 75 80Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala 85
90 95Ala Val Arg Gln Met Tyr Met Thr Val Val
Pro Asp Tyr Trp Gly Gln 100 105
110Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly
115 120 125Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly 130 135
140Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu
Val145 150 155 160Glu Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser
165 170 175Cys Ile Thr Ser Gly Glu Thr
Phe Lys Ile Asn Ile Trp Gly Trp Tyr 180 185
190Arg Gln Ala Pro Gly Lys Gln Arg Glu Leu Val Ala Ser Leu
Thr Ile 195 200 205Gly Gly Ala Thr
Asn Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile 210
215 220Ser Glu Asp Ser Ala Lys Asn Thr Val Tyr Leu Gln
Met Asn Ser Leu225 230 235
240Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Asn Ala Lys Ser Arg Leu
245 250 255Tyr Pro Tyr Asp Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270Gly Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr
Lys Asp His Asp 275 280 285Ile Asp
Tyr Lys Asp Asp Asp Asp Lys Gly Ala Ala His His His His 290
295 300His His305329306PRTArtificial
SequenceNanobody sequence 329Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr
20 25 30Thr Met Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40
45Ala Glu Val Arg Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu
Lys 50 55 60Asp Arg Phe Ser Ile Ser
Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65 70
75 80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala
Val Tyr Tyr Cys Ala 85 90
95Ala Val Arg Gln Met Tyr Met Thr Val Val Pro Asp Tyr Trp Gly Gln
100 105 110Gly Thr Leu Val Thr Val
Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly 115 120
125Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly 130 135 140Ser Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val145 150
155 160Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly Ser Leu Arg Leu Ser 165 170
175Cys Ala Ala Ser Gly Ser Val His Leu Leu Asn Phe Leu Gly Trp Tyr
180 185 190Arg Gln Ala Pro Gly
Lys Glu Arg Glu Met Val Ala His Ile Thr Ile 195
200 205Ala Asp Ala Thr Asp Tyr Ala His Phe Ala Lys Gly
Arg Phe Thr Ile 210 215 220Ser Arg Asp
Glu Ala Lys Asn Met Val Tyr Leu Gln Met Asn Ser Leu225
230 235 240Arg Pro Glu Asp Thr Ala Val
Tyr Phe Cys Arg Ala Gly Ser Arg Ile 245
250 255Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 260 265 270Gly
Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr Lys Asp His Asp 275
280 285Ile Asp Tyr Lys Asp Asp Asp Asp Lys
Gly Ala Ala His His His His 290 295
300His His305330306PRTArtificial SequenceNanobody sequence 330Glu Val Gln
Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Thr Phe Ser
Gly Gly Thr Phe Ser Ser Tyr 20 25
30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Glu Val Arg Trp Gly Gly
Val Thr Thr Tyr Ser Asn Ser Leu Lys 50 55
60Asp Arg Phe Ser Ile Ser Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65
70 75 80Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala 85
90 95Ala Val Arg Gln Met Tyr Met Thr Val Val
Pro Asp Tyr Trp Gly Gln 100 105
110Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly
115 120 125Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly 130 135
140Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu
Val145 150 155 160Glu Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser
165 170 175Cys Ile Thr Ser Gly Glu Thr
Phe Lys Ile Asn Ile Trp Gly Trp Tyr 180 185
190Arg Gln Ala Pro Gly Lys Gln Arg Glu Leu Val Ala Ser Leu
Thr Ile 195 200 205Gly Gly Ala Thr
Asp Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile 210
215 220Ser Glu Asp Ser Ala Lys Asn Thr Val Tyr Leu Gln
Met Asn Ser Leu225 230 235
240Lys Ala Glu Asp Thr Ala Val Tyr Phe Cys Asn Ala Lys Ser Arg Leu
245 250 255Tyr Pro Tyr Asp Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270Gly Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr
Lys Asp His Asp 275 280 285Ile Asp
Tyr Lys Asp Asp Asp Asp Lys Gly Ala Ala His His His His 290
295 300His His305331306PRTArtificial
SequenceNanobody sequence 331Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Asp Val His Lys Ile Asn
20 25 30Ile Leu Gly Trp Tyr Arg Gln
Ala Pro Ala Lys Glu Arg Glu Met Val 35 40
45Ala His Ile Thr Ile Gly Asp Ala Thr Ser Tyr Ala Asp Ser Ala
Lys 50 55 60Gly Arg Phe Thr Ile Ser
Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65 70
75 80Gln Leu Asn Asn Leu Lys Pro Glu Asp Thr Ala
Val Tyr Phe Cys Arg 85 90
95Ala Tyr Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu
100 105 110Val Thr Val Ser Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly 115 120
125Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Gly Gly 130 135 140Gly Gly Ser Gly Gly
Gly Gly Ser Glu Val Gln Leu Val Glu Ser Gly145 150
155 160Gly Gly Leu Val Gln Pro Gly Gly Ser Leu
Arg Leu Ser Cys Thr Phe 165 170
175Ser Gly Gly Thr Phe Ser Ser Tyr Thr Met Gly Trp Phe Arg Gln Ala
180 185 190Pro Gly Lys Glu Arg
Glu Phe Val Ala Glu Val Arg Trp Gly Gly Val 195
200 205Thr Thr Tyr Ser Asn Ser Leu Lys Asp Arg Phe Ser
Ile Ser Glu Asp 210 215 220Ser Val Lys
Asn Ala Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu225
230 235 240Asp Thr Ala Val Tyr Tyr Cys
Ala Ala Val Arg Gln Met Tyr Met Thr 245
250 255Val Val Pro Asp Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 260 265 270Gly
Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr Lys Asp His Asp 275
280 285Ile Asp Tyr Lys Asp Asp Asp Asp Lys
Gly Ala Ala His His His His 290 295
300His His305332306PRTArtificial SequenceNanobody sequence 332Glu Val Gln
Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Val Ala Ser
Gly Asp Val His Lys Ile Asn 20 25
30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Glu Lys Val
35 40 45Ala His Ile Ser Ile Gly Asp
Gln Thr Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ser Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Phe Ser Arg Ile Tyr Pro Tyr Asp Tyr
Trp Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
115 120 125Gly Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly 130 135
140Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val Glu Ser
Gly145 150 155 160Gly Gly
Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Thr Phe
165 170 175Ser Gly Gly Thr Phe Ser Ser
Tyr Thr Met Gly Trp Phe Arg Gln Ala 180 185
190Pro Gly Lys Glu Arg Glu Phe Val Ala Glu Val Arg Trp Gly
Gly Val 195 200 205Thr Thr Tyr Ser
Asn Ser Leu Lys Asp Arg Phe Ser Ile Ser Glu Asp 210
215 220Ser Val Lys Asn Ala Val Tyr Leu Gln Met Asn Ser
Leu Lys Pro Glu225 230 235
240Asp Thr Ala Val Tyr Tyr Cys Ala Ala Val Arg Gln Met Tyr Met Thr
245 250 255Val Val Pro Asp Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270Gly Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr
Lys Asp His Asp 275 280 285Ile Asp
Tyr Lys Asp Asp Asp Asp Lys Gly Ala Ala His His His His 290
295 300His His305333306PRTArtificial
SequenceNanobody sequence 333Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr
20 25 30Thr Met Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40
45Ala Glu Val Arg Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu
Lys 50 55 60Asp Arg Phe Ser Ile Ser
Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65 70
75 80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala
Val Tyr Tyr Cys Ala 85 90
95Ala Val Arg Gln Met Tyr Met Thr Val Val Pro Asp Tyr Trp Gly Gln
100 105 110Gly Thr Leu Val Thr Val
Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly 115 120
125Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly 130 135 140Ser Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val145 150
155 160Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly Ser Leu Arg Leu Ser 165 170
175Cys Ala Ala Ser Gly Asp Val His Lys Ile Asn Ile Leu Gly Trp Tyr
180 185 190Arg Gln Ala Pro Ala
Lys Glu Arg Glu Met Val Ala His Ile Thr Ile 195
200 205Gly Asp Ala Thr Ser Tyr Ala Asp Ser Ala Lys Gly
Arg Phe Thr Ile 210 215 220Ser Arg Asp
Glu Ala Lys Asn Met Val Tyr Leu Gln Leu Asn Asn Leu225
230 235 240Lys Pro Glu Asp Thr Ala Val
Tyr Phe Cys Arg Ala Tyr Ser Arg Ile 245
250 255Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 260 265 270Gly
Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr Lys Asp His Asp 275
280 285Ile Asp Tyr Lys Asp Asp Asp Asp Lys
Gly Ala Ala His His His His 290 295
300His His305334306PRTArtificial SequenceNanobody sequence 334Glu Val Gln
Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Thr Phe Ser
Gly Gly Thr Phe Ser Ser Tyr 20 25
30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Glu Val Arg Trp Gly Gly
Val Thr Thr Tyr Ser Asn Ser Leu Lys 50 55
60Asp Arg Phe Ser Ile Ser Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65
70 75 80Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala 85
90 95Ala Val Arg Gln Met Tyr Met Thr Val Val
Pro Asp Tyr Trp Gly Gln 100 105
110Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly
115 120 125Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly 130 135
140Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu
Val145 150 155 160Glu Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser
165 170 175Cys Val Ala Ser Gly Asp Val
His Lys Ile Asn Phe Leu Gly Trp Tyr 180 185
190Arg Gln Ala Pro Gly Lys Glu Arg Glu Lys Val Ala His Ile
Ser Ile 195 200 205Gly Asp Gln Thr
Asp Tyr Ala Asp Ser Ala Lys Gly Arg Phe Thr Ile 210
215 220Ser Arg Asp Glu Ser Lys Asn Met Val Tyr Leu Gln
Met Asn Ser Leu225 230 235
240Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg Ala Phe Ser Arg Ile
245 250 255Tyr Pro Tyr Asp Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270Gly Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr
Lys Asp His Asp 275 280 285Ile Asp
Tyr Lys Asp Asp Asp Asp Lys Gly Ala Ala His His His His 290
295 300His His305335306PRTArtificial
SequenceNanobody sequence 335Glu Val Gln Leu Val Glu Ser Gly Gly Asp Leu
Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Asp Val His Lys Ile Asn
20 25 30Phe Leu Gly Trp Tyr Arg Gln
Ala Pro Gly Lys Glu Arg Glu Met Val 35 40
45Ala His Ile Thr Ile Ala Asp Ala Thr Asp Tyr Ala Glu Phe Ala
Lys 50 55 60Gly Arg Phe Thr Ile Ser
Arg Asp Glu Pro Lys Asn Met Val Tyr Leu65 70
75 80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala
Val Tyr Leu Cys Arg 85 90
95Ala Gly Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu
100 105 110Val Thr Val Ser Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly 115 120
125Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Gly Gly 130 135 140Gly Gly Ser Gly Gly
Gly Gly Ser Glu Val Gln Leu Val Glu Ser Gly145 150
155 160Gly Gly Leu Val Gln Pro Gly Gly Ser Leu
Arg Leu Ser Cys Thr Phe 165 170
175Ser Gly Gly Thr Phe Ser Ser Tyr Thr Met Gly Trp Phe Arg Gln Ala
180 185 190Pro Gly Lys Glu Arg
Glu Phe Val Ala Glu Val Arg Trp Gly Gly Val 195
200 205Thr Thr Tyr Ser Asn Ser Leu Lys Asp Arg Phe Ser
Ile Ser Glu Asp 210 215 220Ser Val Lys
Asn Ala Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu225
230 235 240Asp Thr Ala Val Tyr Tyr Cys
Ala Ala Val Arg Gln Met Tyr Met Thr 245
250 255Val Val Pro Asp Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 260 265 270Gly
Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr Lys Asp His Asp 275
280 285Ile Asp Tyr Lys Asp Asp Asp Asp Lys
Gly Ala Ala His His His His 290 295
300His His305336306PRTArtificial SequenceNanobody sequence 336Glu Val Gln
Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Thr Phe Ser
Gly Gly Thr Phe Ser Ser Tyr 20 25
30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Glu Val Arg Trp Gly Gly
Val Thr Thr Tyr Ser Asn Ser Leu Lys 50 55
60Asp Arg Phe Ser Ile Ser Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65
70 75 80Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala 85
90 95Ala Val Arg Gln Met Tyr Met Thr Val Val
Pro Asp Tyr Trp Gly Gln 100 105
110Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly
115 120 125Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly 130 135
140Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu
Val145 150 155 160Glu Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser
165 170 175Cys Ala Ala Ser Gly Asp Val
His Lys Ile Asn Ile Leu Gly Trp Tyr 180 185
190Arg Gln Ala Pro Ala Lys Glu Arg Glu Met Val Ala His Ile
Thr Ile 195 200 205Gly Asp Ala Thr
Asp Tyr Ala Asp Ser Ala Lys Gly Arg Phe Thr Ile 210
215 220Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu Gln
Met Asn Ser Leu225 230 235
240Lys Pro Glu Asp Thr Ala Val Tyr Leu Cys Arg Ala Tyr Ser Arg Ile
245 250 255Tyr Pro Tyr Asn Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270Gly Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr
Lys Asp His Asp 275 280 285Ile Asp
Tyr Lys Asp Asp Asp Asp Lys Gly Ala Ala His His His His 290
295 300His His305337306PRTArtificial
SequenceNanobody sequence 337Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr
20 25 30Thr Met Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40
45Ala Glu Val Arg Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu
Lys 50 55 60Asp Arg Phe Ser Ile Ser
Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65 70
75 80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala
Val Tyr Tyr Cys Ala 85 90
95Ala Val Arg Gln Met Tyr Met Thr Val Val Pro Asp Tyr Trp Gly Gln
100 105 110Gly Thr Leu Val Thr Val
Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly 115 120
125Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly 130 135 140Ser Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val145 150
155 160Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly Ser Leu Lys Leu Ser 165 170
175Cys Ala Ala Ser Gly Ala Val His Lys Ile Asn Phe Leu Gly Trp Tyr
180 185 190Arg Gln Thr Pro Glu
Lys Glu Arg Glu Met Val Ala Thr Ile Thr Ile 195
200 205Gly Asp Glu Val Asp Tyr Ala Asp Ser Ala Lys Gly
Arg Phe Thr Ile 210 215 220Ser Arg Asp
Glu Ala Lys Asn Met Val Tyr Leu Gln Met Thr Ser Leu225
230 235 240Lys Pro Glu Asp Thr Ala Val
Tyr Val Cys Arg Ala Gly Ser Arg Leu 245
250 255Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 260 265 270Gly
Ala Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr Lys Asp His Asp 275
280 285Ile Asp Tyr Lys Asp Asp Asp Asp Lys
Gly Ala Ala His His His His 290 295
300His His305338273PRTArtificial SequenceNanobody sequence 338Asp Val Gln
Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Thr Phe Ser
Gly Gly Thr Phe Ser Ser Tyr 20 25
30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Glu Val Arg Trp Gly Gly
Val Thr Thr Tyr Ser Asn Ser Leu Lys 50 55
60Asp Arg Phe Ser Ile Ser Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65
70 75 80Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala 85
90 95Ala Val Arg Gln Met Tyr Met Thr Val Val
Pro Asp Tyr Trp Gly Gln 100 105
110Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly
115 120 125Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly 130 135
140Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu
Val145 150 155 160Glu Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser
165 170 175Cys Ala Ala Ser Gly Asp Val
His Lys Ile Asn Ile Leu Gly Trp Tyr 180 185
190Arg Gln Ala Pro Ala Lys Glu Arg Glu Met Val Ala His Ile
Thr Ile 195 200 205Gly Asp Ala Thr
Asp Tyr Ala Asp Ser Ala Lys Gly Arg Phe Thr Ile 210
215 220Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu Gln
Met Asn Ser Leu225 230 235
240Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg Ala Tyr Ser Arg Ile
245 250 255Tyr Pro Tyr Asn Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270Ala339280PRTArtificial SequenceNanobody sequence
339Asp Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Asp1
5 10 15Ser Leu Arg Leu Ser Cys
Ala Ala Ser Gly Arg Thr Phe Ser Ser Tyr 20 25
30Ala Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg
Glu Phe Val 35 40 45Ala Ala Ile
Ser Trp Ser Asp Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50
55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
Asn Thr Val Tyr65 70 75
80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Ala Asp Leu Thr Ser
Thr Asn Pro Gly Ser Tyr Ile Tyr Ile Trp 100
105 110Ala Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr
Val Ser Ser Gly 115 120 125Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly 130
135 140Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly145 150 155
160Gly Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro
165 170 175Gly Gly Ser Leu
Arg Leu Ser Cys Ala Ala Ser Gly Asp Val His Lys 180
185 190Ile Asn Ile Leu Gly Trp Tyr Arg Gln Ala Pro
Ala Lys Glu Arg Glu 195 200 205Met
Val Ala His Ile Thr Ile Gly Asp Ala Thr Asp Tyr Ala Asp Ser 210
215 220Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp
Glu Ala Lys Asn Met Val225 230 235
240Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr
Phe 245 250 255Cys Arg Ala
Tyr Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly 260
265 270Thr Leu Val Thr Val Ser Ser Ala
275 280340456PRTArtificial SequenceNanobody sequence
340Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys
Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr 20 25
30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg
Glu Phe Val 35 40 45Ala Glu Val
Arg Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu Lys 50
55 60Asp Arg Phe Ser Ile Ser Glu Asp Ser Val Lys Asn
Ala Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala
85 90 95Ala Val Arg Gln Met Tyr
Met Thr Val Val Pro Asp Tyr Trp Gly Gln 100
105 110Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly
Ser Gly Gly Gly 115 120 125Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly 130
135 140Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Glu Val Gln Leu Val145 150 155
160Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser
165 170 175Cys Val Ala Ser
Gly Asp Val His Lys Ile Asn Phe Leu Gly Trp Tyr 180
185 190Arg Gln Ala Pro Gly Lys Glu Arg Glu Lys Val
Ala His Ile Ser Ile 195 200 205Gly
Asp Gln Thr Asp Tyr Ala Asp Ser Ala Lys Gly Arg Phe Thr Ile 210
215 220Ser Arg Asp Glu Ser Lys Asn Met Val Tyr
Leu Gln Met Asn Ser Leu225 230 235
240Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg Ala Phe Ser Arg
Ile 245 250 255Tyr Pro Tyr
Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly 275 280
285Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly 290
295 300Gly Gly Ser Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln305 310
315 320Pro Gly Asn Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe 325 330
335Ser Ser Phe Gly Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu
340 345 350Glu Trp Val Ser Ser Ile
Ser Gly Ser Gly Ser Asp Thr Leu Tyr Ala 355 360
365Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala
Lys Thr 370 375 380Thr Leu Tyr Leu Gln
Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Val385 390
395 400Tyr Tyr Cys Thr Ile Gly Gly Ser Leu Ser
Arg Ser Ser Gln Gly Thr 405 410
415Leu Val Thr Val Ser Ser Gly Ala Ala Asp Tyr Lys Asp His Asp Gly
420 425 430Asp Tyr Lys Asp His
Asp Ile Asp Tyr Lys Asp Asp Asp Asp Lys Gly 435
440 445Ala Ala His His His His His His 450
455341456PRTArtificial SequenceNanobody sequence 341Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Thr Phe Ser Gly
Gly Thr Phe Ser Ser Tyr 20 25
30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Glu Val Arg Trp Gly Gly Val
Thr Thr Tyr Ser Asn Ser Leu Lys 50 55
60Asp Arg Phe Ser Ile Ser Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala 85
90 95Ala Val Arg Gln Met Tyr Met Thr Val Val Pro
Asp Tyr Trp Gly Gln 100 105
110Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly
115 120 125Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly 130 135
140Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu
Val145 150 155 160Glu Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser
165 170 175Cys Ile Thr Ser Gly Glu Thr
Phe Lys Ile Asn Ile Trp Gly Trp Tyr 180 185
190Arg Gln Ala Pro Gly Lys Gln Arg Glu Leu Val Ala Ser Leu
Thr Ile 195 200 205Gly Gly Ala Thr
Asn Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile 210
215 220Ser Glu Asp Ser Ala Lys Asn Thr Val Tyr Leu Gln
Met Asn Ser Leu225 230 235
240Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Asn Ala Lys Ser Arg Leu
245 250 255Tyr Pro Tyr Asp Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Gly 275 280 285Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly 290
295 300Gly Gly Ser Glu Val Gln Leu Val Glu Ser Gly
Gly Gly Leu Val Gln305 310 315
320Pro Gly Asn Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe
325 330 335Ser Ser Phe Gly
Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 340
345 350Glu Trp Val Ser Ser Ile Ser Gly Ser Gly Ser
Asp Thr Leu Tyr Ala 355 360 365Asp
Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Thr 370
375 380Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg
Pro Glu Asp Thr Ala Val385 390 395
400Tyr Tyr Cys Thr Ile Gly Gly Ser Leu Ser Arg Ser Ser Gln Gly
Thr 405 410 415Leu Val Thr
Val Ser Ser Gly Ala Ala Asp Tyr Lys Asp His Asp Gly 420
425 430Asp Tyr Lys Asp His Asp Ile Asp Tyr Lys
Asp Asp Asp Asp Lys Gly 435 440
445Ala Ala His His His His His His 450
455342304PRTArtificial SequenceNanobody sequence 342Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ile
Thr Phe Ser Ile Asn 20 25
30Thr Met Gly Trp Tyr Arg Gln Ala Pro Gly Lys Gln Arg Glu Leu Val
35 40 45Ala Leu Ile Ser Ser Ile Gly Asp
Thr Tyr Tyr Ala Asp Ser Val Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Lys 85
90 95Arg Phe Arg Thr Ala Ala Gln Gly Thr Asp Tyr
Trp Gly Gln Gly Thr 100 105
110Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
115 120 125Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Gly Gly Gly Gly Ser Gly 130 135
140Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val Glu
Ser145 150 155 160Gly Gly
Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Val
165 170 175Ala Ser Gly Asp Val His Lys
Ile Asn Phe Leu Gly Trp Tyr Arg Gln 180 185
190Ala Pro Gly Lys Glu Arg Glu Lys Val Ala His Ile Ser Ile
Gly Asp 195 200 205Gln Thr Asp Tyr
Ala Asp Ser Ala Lys Gly Arg Phe Thr Ile Ser Arg 210
215 220Asp Glu Ser Lys Asn Met Val Tyr Leu Gln Met Asn
Ser Leu Lys Pro225 230 235
240Glu Asp Thr Ala Val Tyr Phe Cys Arg Ala Phe Ser Arg Ile Tyr Pro
245 250 255Tyr Asp Tyr Trp Gly
Gln Gly Thr Leu Val Thr Val Ser Ser Gly Ala 260
265 270Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr Lys Asp
His Asp Ile Asp 275 280 285Tyr Lys
Asp Asp Asp Asp Lys Gly Ala Ala His His His His His His 290
295 300343304PRTArtificial SequenceNanobody sequence
343Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys
Val Ala Ser Gly Asp Val His Lys Ile Asn 20 25
30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg
Glu Lys Val 35 40 45Ala His Ile
Ser Ile Gly Asp Gln Thr Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ser Lys Asn
Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg
85 90 95Ala Phe Ser Arg Ile Tyr
Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Gly 115 120 125Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly 130
135 140Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln
Leu Val Glu Ser Gly145 150 155
160Gly Gly Leu Val Gln Ala Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala
165 170 175Ser Gly Ile Thr
Phe Ser Ile Asn Thr Met Gly Trp Tyr Arg Gln Ala 180
185 190Pro Gly Lys Gln Arg Glu Leu Val Ala Leu Ile
Ser Ser Ile Gly Asp 195 200 205Thr
Tyr Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp 210
215 220Asn Ala Lys Asn Thr Val Tyr Leu Gln Met
Asn Ser Leu Lys Pro Glu225 230 235
240Asp Thr Ala Val Tyr Tyr Cys Lys Arg Phe Arg Thr Ala Ala Gln
Gly 245 250 255Thr Asp Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Gly Ala 260
265 270Ala Asp Tyr Lys Asp His Asp Gly Asp Tyr
Lys Asp His Asp Ile Asp 275 280
285Tyr Lys Asp Asp Asp Asp Lys Gly Ala Ala His His His His His His 290
295 300344171PRTHomo sapiens 344Met Glu
His Ser Thr Phe Leu Ser Gly Leu Val Leu Ala Thr Leu Leu1 5
10 15Ser Gln Val Ser Pro Phe Lys Ile
Pro Ile Glu Glu Leu Glu Asp Arg 20 25
30Val Phe Val Asn Cys Asn Thr Ser Ile Thr Trp Val Glu Gly Thr
Val 35 40 45Gly Thr Leu Leu Ser
Asp Ile Thr Arg Leu Asp Leu Gly Lys Arg Ile 50 55
60Leu Asp Pro Arg Gly Ile Tyr Arg Cys Asn Gly Thr Asp Ile
Tyr Lys65 70 75 80Asp
Lys Glu Ser Thr Val Gln Val His Tyr Arg Met Cys Gln Ser Cys
85 90 95Val Glu Leu Asp Pro Ala Thr
Val Ala Gly Ile Ile Val Thr Asp Val 100 105
110Ile Ala Thr Leu Leu Leu Ala Leu Gly Val Phe Cys Phe Ala
Gly His 115 120 125Glu Thr Gly Arg
Leu Ser Gly Ala Ala Asp Thr Gln Ala Leu Leu Arg 130
135 140Asn Asp Gln Val Tyr Gln Pro Leu Arg Asp Arg Asp
Asp Ala Gln Tyr145 150 155
160Ser His Leu Gly Gly Asn Trp Ala Arg Asn Lys 165
170345182PRTHomo sapiens 345Met Glu Gln Gly Lys Gly Leu Ala Val
Leu Ile Leu Ala Ile Ile Leu1 5 10
15Leu Gln Gly Thr Leu Ala Gln Ser Ile Lys Gly Asn His Leu Val
Lys 20 25 30Val Tyr Asp Tyr
Gln Glu Asp Gly Ser Val Leu Leu Thr Cys Asp Ala 35
40 45Glu Ala Lys Asn Ile Thr Trp Phe Lys Asp Gly Lys
Met Ile Gly Phe 50 55 60Leu Thr Glu
Asp Lys Lys Lys Trp Asn Leu Gly Ser Asn Ala Lys Asp65 70
75 80Pro Arg Gly Met Tyr Gln Cys Lys
Gly Ser Gln Asn Lys Ser Lys Pro 85 90
95Leu Gln Val Tyr Tyr Arg Met Cys Gln Asn Cys Ile Glu Leu
Asn Ala 100 105 110Ala Thr Ile
Ser Gly Phe Leu Phe Ala Glu Ile Val Ser Ile Phe Val 115
120 125Leu Ala Val Gly Val Tyr Phe Ile Ala Gly Gln
Asp Gly Val Arg Gln 130 135 140Ser Arg
Ala Ser Asp Lys Gln Thr Leu Leu Pro Asn Asp Gln Leu Tyr145
150 155 160Gln Pro Leu Lys Asp Arg Glu
Asp Asp Gln Tyr Ser His Leu Gln Gly 165
170 175Asn Gln Leu Arg Arg Asn
180346207PRTHomo sapiens 346Met Gln Ser Gly Thr His Trp Arg Val Leu Gly
Leu Cys Leu Leu Ser1 5 10
15Val Gly Val Trp Gly Gln Asp Gly Asn Glu Glu Met Gly Gly Ile Thr
20 25 30Gln Thr Pro Tyr Lys Val Ser
Ile Ser Gly Thr Thr Val Ile Leu Thr 35 40
45Cys Pro Gln Tyr Pro Gly Ser Glu Ile Leu Trp Gln His Asn Asp
Lys 50 55 60Asn Ile Gly Gly Asp Glu
Asp Asp Lys Asn Ile Gly Ser Asp Glu Asp65 70
75 80His Leu Ser Leu Lys Glu Phe Ser Glu Leu Glu
Gln Ser Gly Tyr Tyr 85 90
95Val Cys Tyr Pro Arg Gly Ser Lys Pro Glu Asp Ala Asn Phe Tyr Leu
100 105 110Tyr Leu Arg Ala Arg Val
Cys Glu Asn Cys Met Glu Met Asp Val Met 115 120
125Ser Val Ala Thr Ile Val Ile Val Asp Ile Cys Ile Thr Gly
Gly Leu 130 135 140Leu Leu Leu Val Tyr
Tyr Trp Ser Lys Asn Arg Lys Ala Lys Ala Lys145 150
155 160Pro Val Thr Arg Gly Ala Gly Ala Gly Gly
Arg Gln Arg Gly Gln Asn 165 170
175Lys Glu Arg Pro Pro Pro Val Pro Asn Pro Asp Tyr Glu Pro Ile Arg
180 185 190Lys Gly Gln Arg Asp
Leu Tyr Ser Gly Leu Asn Gln Arg Arg Ile 195 200
205347164PRTHomo sapiens 347Met Lys Trp Lys Ala Leu Phe Thr
Ala Ala Ile Leu Gln Ala Gln Leu1 5 10
15Pro Ile Thr Glu Ala Gln Ser Phe Gly Leu Leu Asp Pro Lys
Leu Cys 20 25 30Tyr Leu Leu
Asp Gly Ile Leu Phe Ile Tyr Gly Val Ile Leu Thr Ala 35
40 45Leu Phe Leu Arg Val Lys Phe Ser Arg Ser Ala
Asp Ala Pro Ala Tyr 50 55 60Gln Gln
Gly Gln Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg65
70 75 80Glu Glu Tyr Asp Val Leu Asp
Lys Arg Arg Gly Arg Asp Pro Glu Met 85 90
95Gly Gly Lys Pro Gln Arg Arg Lys Asn Pro Gln Glu Gly
Leu Tyr Asn 100 105 110Glu Leu
Gln Lys Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly Met 115
120 125Lys Gly Glu Arg Arg Arg Gly Lys Gly His
Asp Gly Leu Tyr Gln Gly 130 135 140Leu
Ser Thr Ala Thr Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala145
150 155 160Leu Pro Pro
Arg348142PRTHomo sapiens 348Pro Asn Ile Gln Asn Pro Asp Pro Ala Val Tyr
Gln Leu Arg Asp Ser1 5 10
15Lys Ser Ser Asp Lys Ser Val Cys Leu Phe Thr Asp Phe Asp Ser Gln
20 25 30Thr Asn Val Ser Gln Ser Lys
Asp Ser Asp Val Tyr Ile Thr Asp Lys 35 40
45Thr Val Leu Asp Met Arg Ser Met Asp Phe Lys Ser Asn Ser Ala
Val 50 55 60Ala Trp Ser Asn Lys Ser
Asp Phe Ala Cys Ala Asn Ala Phe Asn Asn65 70
75 80Ser Ile Ile Pro Glu Asp Thr Phe Phe Pro Ser
Pro Glu Ser Ser Cys 85 90
95Asp Val Lys Leu Val Glu Lys Ser Phe Glu Thr Asp Thr Asn Phe Arg
100 105 110Ile Leu Leu Leu Lys Val
Ala Gly Phe Asn Leu Leu Met Thr Leu Arg 115 120
125Leu Trp Ser Ser Leu Asn Phe Gln Asn Leu Ser Val Ile Gly
130 135 140349177PRTHomo sapiens 349Glu
Asp Leu Asn Lys Val Phe Pro Pro Glu Val Ala Val Phe Glu Pro1
5 10 15Ser Glu Ala Glu Ile Ser His
Thr Gln Lys Ala Thr Leu Val Cys Leu 20 25
30Ala Thr Gly Phe Phe Pro Asp His Val Glu Leu Ser Trp Trp
Val Asn 35 40 45Gly Lys Glu Val
His Ser Gly Val Ser Thr Asp Pro Gln Pro Leu Lys 50 55
60Glu Gln Pro Ala Leu Asn Asp Ser Arg Tyr Cys Leu Ser
Ser Arg Leu65 70 75
80Arg Val Ser Ala Thr Phe Trp Gln Asn Pro Arg Asn His Phe Arg Cys
85 90 95Gln Val Gln Phe Tyr Gly
Leu Ser Glu Asn Asp Glu Trp Thr Val Ser 100
105 110Ala Glu Ala Trp Gly Arg Ala Asp Cys Gly Phe Thr
Ser Val Ser Tyr 115 120 125Gln Gln
Gly Val Leu Ser Ala Thr Ile Leu Tyr Glu Ile Leu Leu Gly 130
135 140Lys Ala Thr Leu Tyr Ala Val Leu Val Ser Ala
Leu Val Leu Met Ala145 150 155
160Met Val Lys Arg Lys Asp Phe Gln Asp Arg Ala Lys Pro Val Thr Gln
165 170
175Ile350118PRTArtificial SequenceNanobody sequence 350Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Ile Thr Phe Ser Ile Asn 20 25
30Thr Met Gly Trp Tyr Arg Gln Ala Pro Gly Lys Gln Arg Glu Leu Val
35 40 45Ala Leu Ile Ser Ser Ile Gly Asp
Thr Tyr Tyr Ala Asp Ser Val Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Lys 85
90 95Arg Phe Arg Thr Ala Ala Gln Gly Thr Asp Tyr
Trp Gly Gln Gly Thr 100 105
110Leu Val Thr Val Ser Ser 115351119PRTArtificial SequenceNanobody
sequence 351Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Ser Ile Phe Gly Phe Asn 20
25 30Asp Met Ala Trp Tyr Arg Gln Ala Pro Gly
Lys Gln Arg Glu Leu Val 35 40
45Ala Leu Ile Ser Arg Val Gly Val Thr Ser Ser Ala Asp Ser Val Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Val Asn
Ala Lys Asp Thr Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr
Cys Tyr 85 90 95Met Asp
Gln Arg Leu Asp Gly Ser Thr Leu Ala Tyr Trp Gly Gln Gly 100
105 110Thr Gln Val Thr Val Ser Ser
115352127PRTArtificial SequenceNanobody sequence 352Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg
Thr Phe Ser Ser Tyr 20 25
30Ala Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Val Ala Ile Asn Trp Ser Ser Gly
Ser Thr Tyr Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Met Tyr65
70 75 80Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85
90 95Ala Ala Gly Tyr Gln Ile Asn Ser Gly Asn Tyr
Asn Phe Lys Asp Tyr 100 105
110Glu Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115
120 125353123PRTArtificial
SequenceNanobody sequence 353Glu Val Gln Leu Val Glu Ser Gly Gly Gly Ser
Val Gln Ala Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Asp Thr Tyr Gly Ser Tyr
20 25 30Trp Met Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu Arg Glu Gly Val 35 40
45Ala Ala Ile Asn Arg Gly Gly Gly Tyr Thr Val Tyr Ala Asp Ser
Val 50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Thr Ala Lys Asn Thr Val Tyr65 70
75 80Leu Gln Met Asn Ser Leu Arg Pro Asp Asp Thr
Ala Asp Tyr Tyr Cys 85 90
95Ala Ala Ser Gly Val Leu Gly Gly Leu His Glu Asp Trp Phe Asn Tyr
100 105 110Trp Gly Gln Gly Thr Leu
Val Thr Val Ser Ser 115 120354123PRTArtificial
SequenceNanobody sequence 354Glu Val Gln Leu Val Glu Ser Gly Gly Gly Ser
Val Gln Ala Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Asp Thr Tyr Gly Ser Tyr
20 25 30Trp Met Gly Trp Phe Arg Gln
Ala Pro Gly Gln Glu Arg Glu Ala Val 35 40
45Ala Ala Ile Asn Arg Gly Gly Gly Tyr Thr Val Tyr Ala Asp Ser
Val 50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ala Lys Asn Thr Leu Tyr65 70
75 80Leu Gln Met Asn Ser Leu Arg Pro Asp Asp Thr
Ala Asp Tyr Tyr Cys 85 90
95Ala Ala Ser Gly Val Leu Gly Gly Leu His Glu Asp Trp Phe Asn Tyr
100 105 110Trp Gly Gln Gly Thr Leu
Val Thr Val Ser Ser 115 120355124PRTArtificial
SequenceNanobody sequence 355Glu Val Gln Leu Val Glu Ser Gly Gly Gly Ser
Val Gln Thr Gly Gly1 5 10
15Ser Leu Arg Leu Thr Cys Ala Ala Ser Gly Arg Thr Ser Arg Ser Tyr
20 25 30Gly Met Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40
45Ser Gly Ile Ser Trp Arg Gly Asp Ser Thr Gly Tyr Ala Asp Ser
Val 50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ala Lys Asn Thr Val Asp65 70
75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr
Ala Ile Tyr Tyr Cys 85 90
95Ala Ala Ala Ala Gly Ser Ala Trp Tyr Gly Thr Leu Tyr Glu Tyr Asp
100 105 110Tyr Trp Gly Gln Gly Thr
Leu Val Thr Val Ser Ser 115 120356124PRTArtificial
SequenceNanobody sequence 356Glu Val Gln Leu Val Glu Ser Gly Gly Gly Ser
Val Gln Ala Gly Gly1 5 10
15Ser Leu Arg Leu Thr Cys Ala Ala Ser Gly Ser Thr Ser Arg Ser Tyr
20 25 30Gly Met Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40
45Ser Gly Ile Ser Trp Arg Gly Asp Ser Thr Gly Tyr Ala Asp Ser
Val 50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ala Lys Asn Thr Val Asp65 70
75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr
Ala Ile Tyr Tyr Cys 85 90
95Ala Ala Ala Ala Gly Ser Thr Trp Tyr Gly Thr Leu Tyr Glu Tyr Asp
100 105 110Tyr Trp Gly Gln Gly Thr
Leu Val Thr Val Ser Ser 115 120357120PRTArtificial
SequenceNanobody sequence 357Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr
20 25 30Thr Met Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40
45Ala Glu Val Arg Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu
Lys 50 55 60Asp Arg Phe Ser Ile Ser
Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65 70
75 80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala
Val Tyr Tyr Cys Ala 85 90
95Ala Val Arg Gln Met Tyr Met Thr Val Val Pro Asp Tyr Trp Gly Gln
100 105 110Gly Thr Leu Val Thr Val
Ser Ser 115 120358129PRTArtificial
SequenceNanobody sequence 358Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Ala Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Thr Phe Ser Ser Tyr
20 25 30Val Met Gly Trp Phe Arg Gln
Ala Thr Gly Lys Glu Arg Glu Phe Val 35 40
45Ala Thr Ile Ala Trp Asp Ser Gly Ser Thr Tyr Tyr Ala Asp Ser
Val 50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ala Lys Asn Thr Val His65 70
75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr
Ala Val Tyr Tyr Cys 85 90
95Ala Ala Ser Tyr Asn Val Tyr Tyr Asn Asn Tyr Tyr Tyr Pro Ile Ser
100 105 110Arg Asp Glu Tyr Asp Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser 115 120
125Ser359133PRTArtificial SequenceNanobody sequence 359Asp
Val Gln Leu Gln Ala Ser Gly Gly Gly Ser Val Gln Ala Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Ala
Ala Ser Gly Tyr Thr Ile Gly Pro Tyr 20 25
30Cys Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu
Gly Val 35 40 45Ala Ala Ile Asn
Met Gly Gly Gly Ile Thr Tyr Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Gln Asp Asn Ala Lys Asn
Thr Val Tyr65 70 75
80Leu Leu Met Asn Ser Leu Glu Pro Glu Asp Thr Ala Ile Tyr Tyr Cys
85 90 95Ala Ala Asp Ser Thr Ile
Tyr Ala Ser Tyr Tyr Glu Cys Gly His Gly 100
105 110Leu Ser Thr Gly Gly Tyr Gly Tyr Asp Ser Trp Gly
Gln Gly Thr Gln 115 120 125Val Thr
Val Ser Ser 130360127PRTArtificial SequenceNanobody sequence 360Glu
Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Asp1
5 10 15Ser Leu Arg Leu Ser Cys Ala
Ala Ser Gly Arg Thr Phe Ser Ser Tyr 20 25
30Ala Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu
Phe Val 35 40 45Ala Ala Ile Ser
Trp Ser Asp Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn
Thr Val Tyr65 70 75
80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Ala Asp Leu Thr Ser
Thr Asn Pro Gly Ser Tyr Ile Tyr Ile Trp 100
105 110Ala Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr
Val Ser Ser 115 120
12536110PRTArtificial SequenceCDR1 361Gly Asp Thr Tyr Gly Ser Tyr Trp Met
Gly1 5 1036210PRTArtificial SequenceCDR1
362Gly Gly Thr Phe Ser Ser Tyr Thr Met Gly1 5
1036310PRTArtificial SequenceCDR2 363Ala Ile Asn Arg Gly Gly Gly Tyr
Thr Val1 5 103649PRTArtificial
SequenceCDR2 364Glu Val Arg Trp Gly Gly Val Thr Thr1
536514PRTArtificial SequenceCDR3 365Ser Gly Val Leu Gly Gly Leu His Glu
Asp Trp Phe Asn Tyr1 5
1036612PRTArtificial SequenceCDR3 366Val Arg Gln Met Tyr Met Thr Val Val
Pro Asp Tyr1 5 1036725PRTArtificial
SequenceFR1 367Glu Val Gln Leu Val Glu Ser Gly Gly Gly Ser Val Gln Ala
Gly Gly1 5 10 15Ser Leu
Arg Leu Ser Cys Ala Ala Ser 20
2536825PRTArtificial SequenceFR1 368Glu Val Gln Leu Val Glu Ser Gly Gly
Gly Leu Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Thr Phe Ser 20
2536914PRTArtificial SequenceFR2 369Trp Phe Arg Gln Ala Pro Gly Lys
Glu Arg Glu Gly Val Ala1 5
1037014PRTArtificial SequenceFR2 370Trp Phe Arg Gln Ala Pro Gly Gln Glu
Arg Glu Ala Val Ala1 5
1037114PRTArtificial SequenceFR2 371Trp Phe Arg Gln Ala Pro Gly Lys Glu
Arg Glu Phe Val Ala1 5
1037239PRTArtificial SequenceFR3 372Tyr Ala Asp Ser Val Lys Gly Arg Phe
Thr Ile Ser Arg Asp Thr Ala1 5 10
15Lys Asn Thr Val Tyr Leu Gln Met Asn Ser Leu Arg Pro Asp Asp
Thr 20 25 30Ala Asp Tyr Tyr
Cys Ala Ala 3537339PRTArtificial SequenceFR3 373Tyr Ala Asp Ser
Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala1 5
10 15Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser
Leu Arg Pro Asp Asp Thr 20 25
30Ala Asp Tyr Tyr Cys Ala Ala 3537439PRTArtificial SequenceFR3
374Tyr Ser Asn Ser Leu Lys Asp Arg Phe Ser Ile Ser Glu Asp Ser Val1
5 10 15Lys Asn Ala Val Tyr Leu
Gln Met Asn Ser Leu Lys Pro Glu Asp Thr 20 25
30Ala Val Tyr Tyr Cys Ala Ala
3537511PRTArtificial SequenceFR4 375Trp Gly Gln Gly Thr Leu Val Thr Val
Ser Ser1 5 103765PRTArtificial
SequenceLinker 376Gly Gly Gly Gly Ser1 53777PRTArtificial
SequenceLinker 377Ser Gly Gly Ser Gly Gly Ser1
53789PRTArtificial SequenceLinker 378Gly Gly Gly Gly Ser Gly Gly Gly Ser1
537910PRTArtificial SequenceLinker 379Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser1 5
1038015PRTArtificial SequenceLinker 380Gly Gly Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser1 5 10
1538118PRTArtificial SequenceLinker 381Gly Gly Gly Gly Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Gly Gly1 5
10 15Gly Ser38220PRTArtificial SequenceLinker 382Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly1
5 10 15Gly Gly Gly Ser
2038325PRTArtificial SequenceLinker 383Gly Gly Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly1 5 10
15Gly Gly Gly Ser Gly Gly Gly Gly Ser 20
2538430PRTArtificial SequenceLinker 384Gly Gly Gly Gly Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly1 5
10 15Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly
Gly Ser 20 25
3038535PRTArtificial SequenceLinker 385Gly Gly Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly1 5 10
15Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Gly Gly 20 25 30Gly Gly Ser
353863PRTArtificial SequenceLinker 386Ala Ala
Ala1387423PRTArtificial SequenceNanobody sequence 387Asp Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Thr Phe Ser Gly Gly
Thr Phe Ser Ser Tyr 20 25
30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Glu Val Arg Trp Gly Gly Val
Thr Thr Tyr Ser Asn Ser Leu Lys 50 55
60Asp Arg Phe Ser Ile Ser Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala 85
90 95Ala Val Arg Gln Met Tyr Met Thr Val Val Pro
Asp Tyr Trp Gly Gln 100 105
110Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly
115 120 125Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly 130 135
140Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu
Val145 150 155 160Glu Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser
165 170 175Cys Ala Ala Ser Gly Asp Val
His Lys Ile Asn Ile Leu Gly Trp Tyr 180 185
190Arg Gln Ala Pro Ala Lys Glu Arg Glu Met Val Ala His Ile
Thr Ile 195 200 205Gly Asp Ala Thr
Asp Tyr Ala Asp Ser Ala Lys Gly Arg Phe Thr Ile 210
215 220Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu Gln
Met Asn Ser Leu225 230 235
240Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg Ala Tyr Ser Arg Ile
245 250 255Tyr Pro Tyr Asn Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Gly 275 280 285Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly 290
295 300Gly Gly Ser Glu Val Gln Leu Val Glu Ser Gly
Gly Gly Leu Val Gln305 310 315
320Pro Gly Asn Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe
325 330 335Ser Ser Phe Gly
Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 340
345 350Glu Trp Val Ser Ser Ile Ser Gly Ser Gly Ser
Asp Thr Leu Tyr Ala 355 360 365Asp
Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Thr 370
375 380Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg
Pro Glu Asp Thr Ala Val385 390 395
400Tyr Tyr Cys Thr Ile Gly Gly Ser Leu Ser Arg Ser Ser Gln Gly
Thr 405 410 415Leu Val Thr
Val Ser Ser Ala 420388273PRTArtificial SequenceNanobody
sequence 388Asp Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr 20
25 30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly
Lys Glu Arg Glu Phe Val 35 40
45Ala Glu Val Arg Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu Lys 50
55 60Asp Arg Phe Ser Ile Ser Glu Asp Ser
Val Lys Asn Ala Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr
Cys Ala 85 90 95Ala Val
Arg Gln Met Tyr Met Thr Val Val Pro Asp Tyr Trp Gly Gln 100
105 110Gly Thr Leu Val Thr Val Ser Ser Gly
Gly Gly Gly Ser Gly Gly Gly 115 120
125Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
130 135 140Ser Gly Gly Gly Gly Ser Gly
Gly Gly Gly Ser Glu Val Gln Leu Val145 150
155 160Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser
Leu Arg Leu Ser 165 170
175Cys Val Ala Ser Gly Asp Val His Lys Ile Asn Phe Leu Gly Trp Tyr
180 185 190Arg Gln Ala Pro Gly Lys
Glu Arg Glu Lys Val Ala His Ile Ser Ile 195 200
205Gly Asp Gln Thr Asp Tyr Ala Asp Ser Ala Lys Gly Arg Phe
Thr Ile 210 215 220Ser Arg Asp Glu Ser
Lys Asn Met Val Tyr Leu Gln Met Asn Ser Leu225 230
235 240Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys
Arg Ala Phe Ser Arg Ile 245 250
255Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser
260 265
270Ala389430PRTArtificial SequenceNanobody sequence 389Asp Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Asp1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Arg Thr Phe Ser Ser Tyr 20 25
30Ala Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Ala Ile Ser Trp Ser Asp Gly
Ser Thr Tyr Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr65
70 75 80Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85
90 95Ala Ala Asp Leu Thr Ser Thr Asn Pro Gly Ser
Tyr Ile Tyr Ile Trp 100 105
110Ala Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser Gly
115 120 125Gly Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly 130 135
140Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly145 150 155 160Gly Ser
Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro
165 170 175Gly Gly Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly Asp Val His Lys 180 185
190Ile Asn Ile Leu Gly Trp Tyr Arg Gln Ala Pro Ala Lys Glu
Arg Glu 195 200 205Met Val Ala His
Ile Thr Ile Gly Asp Ala Thr Asp Tyr Ala Asp Ser 210
215 220Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala
Lys Asn Met Val225 230 235
240Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
245 250 255Cys Arg Ala Tyr Ser
Arg Ile Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly 260
265 270Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly 275 280 285Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser 290
295 300Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu
Val Gln Leu Val Glu305 310 315
320Ser Gly Gly Gly Leu Val Gln Pro Gly Asn Ser Leu Arg Leu Ser Cys
325 330 335Ala Ala Ser Gly
Phe Thr Phe Ser Ser Phe Gly Met Ser Trp Val Arg 340
345 350Gln Ala Pro Gly Lys Gly Leu Glu Trp Val Ser
Ser Ile Ser Gly Ser 355 360 365Gly
Ser Asp Thr Leu Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile 370
375 380Ser Arg Asp Asn Ala Lys Thr Thr Leu Tyr
Leu Gln Met Asn Ser Leu385 390 395
400Arg Pro Glu Asp Thr Ala Val Tyr Tyr Cys Thr Ile Gly Gly Ser
Leu 405 410 415Ser Arg Ser
Ser Gln Gly Thr Leu Val Thr Val Ser Ser Ala 420
425 430390473PRTArtificial SequenceNanobody sequence
390Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys
Ala Ala Ser Gly Arg Thr Phe Ser Ser Tyr 20 25
30Val Met Gly Trp Phe Arg Gln Ala Thr Gly Lys Glu Arg
Glu Phe Val 35 40 45Ala Thr Ile
Ala Trp Asp Ser Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50
55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
Asn Thr Val His65 70 75
80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Ala Ser Tyr Asn Val
Tyr Tyr Asn Asn Tyr Tyr Tyr Pro Ile Ser 100
105 110Arg Asp Glu Tyr Asp Tyr Trp Gly Gln Gly Thr Leu
Val Thr Val Ser 115 120 125Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser 130
135 140Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
Gly Gly Gly Ser Gly145 150 155
160Gly Gly Gly Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly Ser Val
165 170 175Gln Ala Gly Gly
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Asp Thr 180
185 190Tyr Gly Ser Tyr Trp Met Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu 195 200 205Arg
Glu Gly Val Ala Ala Ile Asn Arg Gly Gly Gly Tyr Thr Val Tyr 210
215 220Ala Asp Ser Val Lys Gly Arg Phe Thr Ile
Ser Arg Asp Thr Ala Lys225 230 235
240Asn Thr Val Tyr Leu Gln Met Asn Ser Leu Arg Pro Asp Asp Thr
Ala 245 250 255Asp Tyr Tyr
Cys Ala Ala Ser Gly Val Leu Gly Gly Leu His Glu Asp 260
265 270Trp Phe Asn Tyr Trp Gly Gln Gly Thr Leu
Val Thr Val Ser Ser Gly 275 280
285Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly 290
295 300Gly Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly305 310
315 320Gly Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro 325 330
335Gly Gly Ser Leu Arg Leu Ser Cys Val Ala Ser Gly Asp Val His Lys
340 345 350Ile Asn Phe Leu Gly Trp
Tyr Arg Gln Ala Pro Gly Lys Glu Arg Glu 355 360
365Lys Val Ala His Ile Ser Ile Gly Asp Gln Thr Asp Tyr Ala
Asp Ser 370 375 380Ala Lys Gly Arg Phe
Thr Ile Ser Arg Asp Glu Ser Lys Asn Met Val385 390
395 400Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu
Asp Thr Ala Val Tyr Phe 405 410
415Cys Arg Ala Phe Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly
420 425 430Thr Leu Val Thr Val
Ser Ser Gly Ala Ala Asp Tyr Lys Asp His Asp 435
440 445Gly Asp Tyr Lys Asp His Asp Ile Asp Tyr Lys Asp
Asp Asp Asp Lys 450 455 460Gly Ala Ala
His His His His His His465 470391477PRTArtificial
SequenceNanobody sequence 391Glu Val Gln Leu Val Glu Ser Gly Gly Gly Ser
Val Gln Ala Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Tyr Thr Ile Gly Pro Tyr
20 25 30Cys Met Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu Arg Glu Gly Val 35 40
45Ala Ala Ile Asn Met Gly Gly Gly Ile Thr Tyr Tyr Ala Asp Ser
Val 50 55 60Lys Gly Arg Phe Thr Ile
Ser Gln Asp Asn Ala Lys Asn Thr Val Tyr65 70
75 80Leu Leu Met Asn Ser Leu Glu Pro Glu Asp Thr
Ala Ile Tyr Tyr Cys 85 90
95Ala Ala Asp Ser Thr Ile Tyr Ala Ser Tyr Tyr Glu Cys Gly His Gly
100 105 110Leu Ser Thr Gly Gly Tyr
Gly Tyr Asp Ser Trp Gly Gln Gly Thr Leu 115 120
125Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
Ser Gly 130 135 140Gly Gly Gly Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly145 150
155 160Gly Gly Ser Gly Gly Gly Gly Ser Glu Val
Gln Leu Val Glu Ser Gly 165 170
175Gly Gly Ser Val Gln Ala Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala
180 185 190Ser Gly Asp Thr Tyr
Gly Ser Tyr Trp Met Gly Trp Phe Arg Gln Ala 195
200 205Pro Gly Lys Glu Arg Glu Gly Val Ala Ala Ile Asn
Arg Gly Gly Gly 210 215 220Tyr Thr Val
Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg225
230 235 240Asp Thr Ala Lys Asn Thr Val
Tyr Leu Gln Met Asn Ser Leu Arg Pro 245
250 255Asp Asp Thr Ala Asp Tyr Tyr Cys Ala Ala Ser Gly
Val Leu Gly Gly 260 265 270Leu
His Glu Asp Trp Phe Asn Tyr Trp Gly Gln Gly Thr Leu Val Thr 275
280 285Val Ser Ser Gly Gly Gly Gly Ser Gly
Gly Gly Gly Ser Gly Gly Gly 290 295
300Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly305
310 315 320Ser Gly Gly Gly
Gly Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly 325
330 335Leu Val Gln Pro Gly Gly Ser Leu Arg Leu
Ser Cys Val Ala Ser Gly 340 345
350Asp Val His Lys Ile Asn Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly
355 360 365Lys Glu Arg Glu Lys Val Ala
His Ile Ser Ile Gly Asp Gln Thr Asp 370 375
380Tyr Ala Asp Ser Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ser385 390 395 400Lys Asn
Met Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr
405 410 415Ala Val Tyr Phe Cys Arg Ala
Phe Ser Arg Ile Tyr Pro Tyr Asp Tyr 420 425
430Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Gly Ala Ala
Asp Tyr 435 440 445Lys Asp His Asp
Gly Asp Tyr Lys Asp His Asp Ile Asp Tyr Lys Asp 450
455 460Asp Asp Asp Lys Gly Ala Ala His His His His His
His465 470 475392483PRTArtificial
SequenceNanobody sequence 392Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Ala Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Thr Phe Ser Ser Tyr
20 25 30Val Met Gly Trp Phe Arg Gln
Ala Thr Gly Lys Glu Arg Glu Phe Val 35 40
45Ala Thr Ile Ala Trp Asp Ser Gly Ser Thr Tyr Tyr Ala Asp Ser
Val 50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ala Lys Asn Thr Val His65 70
75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr
Ala Val Tyr Tyr Cys 85 90
95Ala Ala Ser Tyr Asn Val Tyr Tyr Asn Asn Tyr Tyr Tyr Pro Ile Ser
100 105 110Arg Asp Glu Tyr Asp Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser 115 120
125Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly
Gly Ser 130 135 140Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly145 150
155 160Gly Gly Gly Ser Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Ser Val 165 170
175Gln Ala Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Tyr Thr
180 185 190Ile Gly Pro Tyr Cys
Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu 195
200 205Arg Glu Gly Val Ala Ala Ile Asn Met Gly Gly Gly
Ile Thr Tyr Tyr 210 215 220Ala Asp Ser
Val Lys Gly Arg Phe Thr Ile Ser Gln Asp Asn Ala Lys225
230 235 240Asn Thr Val Tyr Leu Leu Met
Asn Ser Leu Glu Pro Glu Asp Thr Ala 245
250 255Ile Tyr Tyr Cys Ala Ala Asp Ser Thr Ile Tyr Ala
Ser Tyr Tyr Glu 260 265 270Cys
Gly His Gly Leu Ser Thr Gly Gly Tyr Gly Tyr Asp Ser Trp Gly 275
280 285Gln Gly Thr Leu Val Thr Val Ser Ser
Gly Gly Gly Gly Ser Gly Gly 290 295
300Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly305
310 315 320Gly Ser Gly Gly
Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu 325
330 335Val Glu Ser Gly Gly Gly Leu Val Gln Pro
Gly Gly Ser Leu Arg Leu 340 345
350Ser Cys Val Ala Ser Gly Asp Val His Lys Ile Asn Phe Leu Gly Trp
355 360 365Tyr Arg Gln Ala Pro Gly Lys
Glu Arg Glu Lys Val Ala His Ile Ser 370 375
380Ile Gly Asp Gln Thr Asp Tyr Ala Asp Ser Ala Lys Gly Arg Phe
Thr385 390 395 400Ile Ser
Arg Asp Glu Ser Lys Asn Met Val Tyr Leu Gln Met Asn Ser
405 410 415Leu Lys Pro Glu Asp Thr Ala
Val Tyr Phe Cys Arg Ala Phe Ser Arg 420 425
430Ile Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr
Val Ser 435 440 445Ser Gly Ala Ala
Asp Tyr Lys Asp His Asp Gly Asp Tyr Lys Asp His 450
455 460Asp Ile Asp Tyr Lys Asp Asp Asp Asp Lys Gly Ala
Ala His His His465 470 475
480His His His393107PRTHomo sapiens 393Ile Gln Val Glu Gln Ser Pro Pro
Asp Leu Ile Leu Gln Glu Gly Ala1 5 10
15Asn Ser Thr Leu Arg Cys Asn Phe Ser Asp Ser Val Asn Asn
Leu Gln 20 25 30Trp Phe His
Gln Asn Pro Trp Gly Gln Leu Ile Asn Leu Phe Tyr Ile 35
40 45Pro Ser Gly Thr Lys Gln Asn Gly Arg Leu Ser
Ala Thr Thr Val Ala 50 55 60Thr Glu
Arg Tyr Ser Leu Leu Tyr Ile Ser Ser Ser Gln Thr Thr Asp65
70 75 80Ser Gly Val Tyr Phe Cys Ala
Ala Leu Ile Gln Gly Ala Gln Lys Leu 85 90
95Val Phe Gly Gln Gly Thr Arg Leu Thr Ile Asn
100 105394108PRTHomo sapiens 394Gln Leu Leu Glu Gln Ser
Pro Gln Phe Leu Ser Ile Gln Glu Gly Glu1 5
10 15Asn Leu Thr Val Tyr Cys Asn Ser Ser Ser Val Phe
Ser Ser Leu Gln 20 25 30Trp
Tyr Arg Gln Glu Pro Gly Glu Gly Pro Val Leu Leu Val Thr Val 35
40 45Val Thr Gly Gly Glu Val Lys Lys Leu
Lys Arg Leu Thr Phe Gln Phe 50 55
60Gly Asp Ala Arg Lys Asp Ser Ser Leu His Ile Thr Ala Ala Gln Pro65
70 75 80Gly Asp Thr Gly Leu
Tyr Leu Cys Ala Gly Ala Gly Ser Gln Gly Asn 85
90 95Leu Ile Phe Gly Lys Gly Thr Lys Leu Ser Val
Lys 100 105395110PRTHomo sapiens 395Gly Asp
Ala Lys Thr Thr Gln Pro Asn Ser Met Glu Ser Asn Glu Glu1 5
10 15Glu Pro Val His Leu Pro Cys Asn
His Ser Thr Ile Ser Gly Thr Asp 20 25
30Tyr Ile His Trp Tyr Arg Gln Leu Pro Ser Gln Gly Pro Glu Tyr
Val 35 40 45Ile His Gly Leu Thr
Ser Asn Val Asn Asn Arg Met Ala Ser Leu Ala 50 55
60Ile Ala Glu Asp Arg Lys Ser Ser Thr Leu Ile Leu His Arg
Ala Thr65 70 75 80Leu
Arg Asp Ala Ala Val Tyr Tyr Cys Thr Val Tyr Gly Gly Ala Thr
85 90 95Asn Lys Leu Ile Phe Gly Thr
Gly Thr Leu Leu Ala Val Gln 100 105
11039696PRTMacaca fascicularis 396Pro Tyr Ile Gln Asn Pro Asp Pro
Ala Val Tyr Gln Leu Arg Gly Ser1 5 10
15Lys Ser Asn Asp Thr Ser Val Cys Leu Phe Thr Asp Phe Asp
Ser Val 20 25 30Met Asn Val
Ser Gln Ser Lys Asp Ser Asp Val His Ile Thr Asp Lys 35
40 45Thr Val Leu Asp Met Arg Ser Met Asp Phe Lys
Ser Asn Gly Ala Val 50 55 60Ala Trp
Ser Asn Lys Ser Asp Phe Ala Cys Thr Ser Ala Phe Lys Asp65
70 75 80Ser Val Ile Pro Ala Asp Thr
Phe Phe Pro Ser Pro Glu Ser Ser Cys 85 90
95397131PRTMacaca mulatta 397Glu Asp Leu Lys Lys Val Phe
Pro Pro Lys Val Ala Val Phe Glu Pro1 5 10
15Ser Glu Ala Glu Ile Ser His Thr Gln Lys Ala Thr Leu
Val Cys Leu 20 25 30Ala Thr
Gly Phe Tyr Pro Asp His Val Glu Leu Ser Trp Trp Val Asn 35
40 45Gly Lys Glu Val His Ser Gly Val Ser Thr
Asp Pro Gln Pro Leu Lys 50 55 60Glu
Gln Pro Ala Leu Glu Asp Ser Arg Tyr Ser Leu Ser Ser Arg Leu65
70 75 80Arg Val Ser Ala Thr Phe
Trp His Asn Pro Arg Asn His Phe Arg Cys 85
90 95Gln Val Gln Phe Tyr Gly Leu Ser Glu Asp Asp Glu
Trp Thr Glu Asp 100 105 110Arg
Asp Lys Pro Ile Thr Gln Lys Ile Ser Ala Glu Ala Trp Gly Arg 115
120 125Ala Asp Cys 130398107PRTMacaca
mulatta 398Gln Gln Ile Met Gln Ile Pro Gln Tyr Gln His Val Gln Glu Gly
Glu1 5 10 15Asp Phe Thr
Thr Tyr Cys Asn Ser Ser Thr Thr Leu Ser Asn Ile Gln 20
25 30Trp Tyr Lys Gln Arg Pro Gly Gly His Pro
Val Phe Leu Ile Met Leu 35 40
45Val Lys Ser Gly Glu Val Lys Lys Gln Lys Arg Leu Ile Phe Gln Phe 50
55 60Gly Glu Ala Lys Lys Asn Ser Ser Leu
His Ile Thr Ala Thr Gln Thr65 70 75
80Thr Asp Val Gly Thr Tyr Phe Cys Ala Thr Thr Gly Val Asn
Asn Leu 85 90 95Phe Phe
Gly Thr Gly Thr Arg Leu Thr Val Leu 100
105399118PRTMacaca mulatta 399Ala Gly Pro Val Asn Ala Gly Val Thr Gln Thr
Pro Lys Phe Gln Val1 5 10
15Leu Lys Thr Gly Gln Ser Met Thr Leu Gln Cys Ala Gln Asp Met Asn
20 25 30His Asp Tyr Met Tyr Trp Tyr
Arg Gln Asp Pro Gly Met Gly Leu Arg 35 40
45Leu Ile His Tyr Ser Val Gly Glu Gly Ser Thr Glu Lys Gly Glu
Val 50 55 60Pro Asp Gly Tyr Asn Val
Thr Arg Ser Asn Thr Glu Asp Phe Pro Leu65 70
75 80Arg Leu Glu Ser Ala Ala Pro Ser Gln Thr Ser
Val Tyr Phe Cys Ala 85 90
95Ser Ser Tyr Trp Thr Gly Arg Ser Tyr Glu Gln Tyr Phe Gly Pro Gly
100 105 110Thr Arg Leu Thr Val Ile
115400115PRTArtificial SequenceNanobody sequence 400Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Asn1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Phe Thr Phe Ser Ser Phe 20 25
30Gly Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45Ser Ser Ile Ser Gly Ser Gly Ser
Asp Thr Leu Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Thr Thr Leu Tyr65
70 75 80Leu Gln Met Asn Ser
Leu Arg Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85
90 95Thr Ile Gly Gly Ser Leu Ser Arg Ser Ser Gln
Gly Thr Leu Val Thr 100 105
110Val Ser Ser 115401115PRTArtificial SequenceNanobody sequence
401Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys
Ala Ala Ser Gly Phe Thr Phe Arg Ser Phe 20 25
30Gly Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Pro
Glu Trp Val 35 40 45Ser Ser Ile
Ser Gly Ser Gly Ser Asp Thr Leu Tyr Ala Asp Ser Val 50
55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys
Asn Thr Leu Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Thr Ile Gly Gly Ser Leu
Ser Arg Ser Ser Gln Gly Thr Leu Val Thr 100
105 110Val Ser Ser 115402116PRTArtificial
SequenceNanobody sequence 402Glu Val Gln Leu Val Glu Ser Gly Gly Gly Val
Val Gln Pro Gly Asn1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Phe
20 25 30Gly Met Ser Trp Val Arg Gln
Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40
45Ser Ser Ile Ser Gly Ser Gly Ser Asp Thr Leu Tyr Ala Asp Ser
Val 50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ala Lys Thr Thr Leu Tyr65 70
75 80Leu Gln Met Asn Ser Leu Arg Pro Glu Asp Thr
Ala Thr Tyr Tyr Cys 85 90
95Thr Ile Gly Gly Ser Leu Ser Arg Ser Ser Gln Gly Thr Leu Val Thr
100 105 110Val Ser Ser Ala
115403116PRTArtificial SequenceNanobody sequence 403Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Val Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe
Thr Phe Arg Ser Phe 20 25
30Gly Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Pro Glu Trp Val
35 40 45Ser Ser Ile Ser Gly Ser Gly Ser
Asp Thr Leu Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65
70 75 80Leu Gln Met Asn Ser
Leu Arg Pro Glu Asp Thr Ala Thr Tyr Tyr Cys 85
90 95Thr Ile Gly Gly Ser Leu Ser Arg Ser Ser Gln
Gly Thr Leu Val Thr 100 105
110Val Ser Ser Ala 115404115PRTArtificial SequenceNanobody
sequence 404Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Asn1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Phe 20
25 30Gly Met Ser Trp Val Arg Gln Ala Pro Gly
Lys Gly Leu Glu Trp Val 35 40
45Ser Ser Ile Ser Gly Ser Gly Ser Asp Thr Leu Tyr Ala Asp Ser Val 50
55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp
Asn Ala Lys Thr Thr Leu Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr
Tyr Cys 85 90 95Thr Ile
Gly Gly Ser Leu Ser Arg Ser Ser Gln Gly Thr Leu Val Thr 100
105 110Val Ser Ser
115405116PRTArtificial SequenceNanobody sequence 405Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Asn1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe
Thr Phe Ser Ser Phe 20 25
30Gly Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45Ser Ser Ile Ser Gly Ser Gly Ser
Asp Thr Leu Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Thr Thr Leu Tyr65
70 75 80Leu Gln Met Asn Ser
Leu Arg Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85
90 95Thr Ile Gly Gly Ser Leu Ser Arg Ser Ser Gln
Gly Thr Leu Val Lys 100 105
110Val Ser Ser Ala 115406115PRTArtificial SequenceNanobody
sequence 406Glu Val Gln Leu Val Glu Ser Gly Gly Gly Val Val Gln Pro Gly
Asn1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Phe 20
25 30Gly Met Ser Trp Val Arg Gln Ala Pro Gly
Lys Gly Leu Glu Trp Val 35 40
45Ser Ser Ile Ser Gly Ser Gly Ser Asp Thr Leu Tyr Ala Asp Ser Val 50
55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp
Asn Ala Lys Thr Thr Leu Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Leu Tyr
Tyr Cys 85 90 95Thr Ile
Gly Gly Ser Leu Ser Arg Ser Ser Gln Gly Thr Leu Val Thr 100
105 110Val Ser Ser
115407116PRTArtificial SequenceNanobody sequence 407Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Val Val Gln Pro Gly Asn1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe
Thr Phe Ser Ser Phe 20 25
30Gly Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45Ser Ser Ile Ser Gly Ser Gly Ser
Asp Thr Leu Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Thr Thr Leu Tyr65
70 75 80Leu Gln Met Asn Ser
Leu Arg Pro Glu Asp Thr Ala Leu Tyr Tyr Cys 85
90 95Thr Ile Gly Gly Ser Leu Ser Arg Ser Ser Gln
Gly Thr Leu Val Thr 100 105
110Val Ser Ser Ala 115408117PRTArtificial SequenceNanobody
sequence 408Glu Val Gln Leu Val Glu Ser Gly Gly Gly Val Val Gln Pro Gly
Asn1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Phe 20
25 30Gly Met Ser Trp Val Arg Gln Ala Pro Gly
Lys Gly Leu Glu Trp Val 35 40
45Ser Ser Ile Ser Gly Ser Gly Ser Asp Thr Leu Tyr Ala Asp Ser Val 50
55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp
Asn Ala Lys Thr Thr Leu Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Leu Tyr
Tyr Cys 85 90 95Thr Ile
Gly Gly Ser Leu Ser Arg Ser Ser Gln Gly Thr Leu Val Thr 100
105 110Val Ser Ser Ala Ala
115409118PRTArtificial SequenceNanobody sequence 409Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Val Val Gln Pro Gly Asn1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe
Thr Phe Ser Ser Phe 20 25
30Gly Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45Ser Ser Ile Ser Gly Ser Gly Ser
Asp Thr Leu Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Thr Thr Leu Tyr65
70 75 80Leu Gln Met Asn Ser
Leu Arg Pro Glu Asp Thr Ala Leu Tyr Tyr Cys 85
90 95Thr Ile Gly Gly Ser Leu Ser Arg Ser Ser Gln
Gly Thr Leu Val Thr 100 105
110Val Ser Ser Ala Ala Ala 115410116PRTArtificial SequenceNanobody
sequence 410Glu Val Gln Leu Val Glu Ser Gly Gly Gly Val Val Gln Pro Gly
Asn1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Phe 20
25 30Gly Met Ser Trp Val Arg Gln Ala Pro Gly
Lys Gly Leu Glu Trp Val 35 40
45Ser Ser Ile Ser Gly Ser Gly Ser Asp Thr Leu Tyr Ala Asp Ser Val 50
55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp
Asn Ala Lys Thr Thr Leu Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Leu Tyr
Tyr Cys 85 90 95Thr Ile
Gly Gly Ser Leu Ser Arg Ser Ser Gln Gly Thr Leu Val Thr 100
105 110Val Ser Ser Gly
115411117PRTArtificial SequenceNanobody sequence 411Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Val Val Gln Pro Gly Asn1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe
Thr Phe Ser Ser Phe 20 25
30Gly Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45Ser Ser Ile Ser Gly Ser Gly Ser
Asp Thr Leu Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Thr Thr Leu Tyr65
70 75 80Leu Gln Met Asn Ser
Leu Arg Pro Glu Asp Thr Ala Leu Tyr Tyr Cys 85
90 95Thr Ile Gly Gly Ser Leu Ser Arg Ser Ser Gln
Gly Thr Leu Val Thr 100 105
110Val Ser Ser Gly Gly 115412118PRTArtificial SequenceNanobody
sequence 412Glu Val Gln Leu Val Glu Ser Gly Gly Gly Val Val Gln Pro Gly
Asn1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Phe 20
25 30Gly Met Ser Trp Val Arg Gln Ala Pro Gly
Lys Gly Leu Glu Trp Val 35 40
45Ser Ser Ile Ser Gly Ser Gly Ser Asp Thr Leu Tyr Ala Asp Ser Val 50
55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp
Asn Ala Lys Thr Thr Leu Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Leu Tyr
Tyr Cys 85 90 95Thr Ile
Gly Gly Ser Leu Ser Arg Ser Ser Gln Gly Thr Leu Val Thr 100
105 110Val Ser Ser Gly Gly Gly
115413293PRTArtificial SequenceNanobody sequence 413Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Gly Gly Gly1 5
10 15Ser Leu Ser Leu Ser Cys Ala Ala Ser Gly Arg
Thr Phe Ser Ser Tyr 20 25
30Ala Met Ala Trp Phe Arg Gln Pro Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Ser Ile Ser Trp Ser Gly Glu
Asn Thr Asn Tyr Arg Asn Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr65
70 75 80Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85
90 95Ala Ala Lys Ile Ala Lys Thr Tyr Pro Asp Asn
Trp Tyr Trp Thr Lys 100 105
110Ser Asn Asn Tyr Asn Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser
115 120 125Ser Gly Gly Gly Gly Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser 130 135
140Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Gly145 150 155 160Gly Gly
Gly Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val
165 170 175Gln Gly Gly Gly Ser Leu Ser
Leu Ser Cys Ala Ala Ser Gly Arg Thr 180 185
190Phe Ser Ser Tyr Ala Met Ala Trp Phe Arg Gln Pro Pro Gly
Lys Glu 195 200 205Arg Glu Phe Val
Ala Ser Ile Ser Trp Ser Gly Glu Asn Thr Asn Tyr 210
215 220Arg Asn Ser Val Lys Gly Arg Phe Thr Ile Ser Arg
Asp Asn Ala Lys225 230 235
240Asn Thr Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala
245 250 255Val Tyr Tyr Cys Ala
Ala Lys Ile Ala Lys Thr Tyr Pro Asp Asn Trp 260
265 270Tyr Trp Thr Lys Ser Asn Asn Tyr Asn Tyr Trp Gly
Gln Gly Thr Leu 275 280 285Val Thr
Val Ser Ser 290414242PRTArtificial SequenceNanobody sequence 414Glu
Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Thr
Phe Ser Gly Gly Thr Phe Ser Ser Tyr 20 25
30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu
Phe Val 35 40 45Ala Glu Val Arg
Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu Lys 50 55
60Asp Arg Phe Ser Ile Ser Glu Asp Ser Val Lys Asn Ala
Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala
85 90 95Ala Val Arg Gln Met Tyr
Met Thr Val Val Pro Asp Tyr Trp Gly Gln 100
105 110Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly
Ser Glu Val Gln 115 120 125Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg 130
135 140Leu Ser Cys Ala Ala Ser Gly Ser Val His Lys
Ile Asn Phe Leu Gly145 150 155
160Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Gly Leu Val Ala Thr Ile
165 170 175Thr Ile Gly Asp
Thr Thr Asp Tyr Ala Asp Tyr Ala Lys Gly Arg Phe 180
185 190Thr Ile Ser Arg Asp Glu Ala Arg Asn Met Val
Tyr Leu Gln Met Asn 195 200 205Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg Ala Gly Ser 210
215 220Arg Leu Tyr Pro Tyr Asn Tyr Trp Gly Gln
Gly Thr Leu Val Thr Val225 230 235
240Ser Ser415255PRTArtificial SequenceNanobody sequence 415Glu
Val Gln Leu Gln Ala Ser Gly Gly Gly Ser Val Gln Ala Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Ala
Ala Ser Gly Tyr Thr Ile Gly Pro Tyr 20 25
30Cys Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu
Gly Val 35 40 45Ala Ala Ile Asn
Met Gly Gly Gly Ile Thr Tyr Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Gln Asp Asn Ala Lys Asn
Thr Val Tyr65 70 75
80Leu Leu Met Asn Ser Leu Glu Pro Glu Asp Thr Ala Ile Tyr Tyr Cys
85 90 95Ala Ala Asp Ser Thr Ile
Tyr Ala Ser Tyr Tyr Glu Cys Gly His Gly 100
105 110Leu Ser Thr Gly Gly Tyr Gly Tyr Asp Ser Trp Gly
Gln Gly Thr Gln 115 120 125Val Thr
Val Ser Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val Glu 130
135 140Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser
Leu Arg Leu Ser Cys145 150 155
160Ala Ala Ser Gly Ser Val His Lys Ile Asn Phe Leu Gly Trp Tyr Arg
165 170 175Gln Ala Pro Gly
Lys Glu Arg Gly Leu Val Ala Thr Ile Thr Ile Gly 180
185 190Asp Thr Thr Asp Tyr Ala Asp Tyr Ala Lys Gly
Arg Phe Thr Ile Ser 195 200 205Arg
Asp Glu Ala Arg Asn Met Val Tyr Leu Gln Met Asn Ser Leu Lys 210
215 220Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg
Ala Gly Ser Arg Leu Tyr225 230 235
240Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser
245 250
255416258PRTArtificial SequenceNanobody sequence 416Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Thr Phe Ser Gly Gly
Thr Phe Ser Ser Tyr 20 25
30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Glu Val Arg Trp Gly Gly Val
Thr Thr Tyr Ser Asn Ser Leu Lys 50 55
60Asp Arg Phe Ser Ile Ser Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala 85
90 95Ala Val Arg Gln Met Tyr Met Thr Val Val Pro
Asp Tyr Trp Gly Gln 100 105
110Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Asp Val Gln
115 120 125Leu Gln Ala Ser Gly Gly Gly
Ser Val Gln Ala Gly Gly Ser Leu Arg 130 135
140Leu Ser Cys Ala Ala Ser Gly Tyr Thr Ile Gly Pro Tyr Cys Met
Gly145 150 155 160Trp Phe
Arg Gln Ala Pro Gly Lys Glu Arg Glu Gly Val Ala Ala Ile
165 170 175Asn Met Gly Gly Gly Ile Thr
Tyr Tyr Ala Asp Ser Val Lys Gly Arg 180 185
190Phe Thr Ile Ser Gln Asp Asn Ala Lys Asn Thr Val Tyr Leu
Leu Met 195 200 205Asn Ser Leu Glu
Pro Glu Asp Thr Ala Ile Tyr Tyr Cys Ala Ala Asp 210
215 220Ser Thr Ile Tyr Ala Ser Tyr Tyr Glu Cys Gly His
Gly Leu Ser Thr225 230 235
240Gly Gly Tyr Gly Tyr Asp Ser Trp Gly Gln Gly Thr Gln Val Thr Val
245 250 255Ser
Ser417242PRTArtificial SequenceNanobody sequence 417Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ser
Val His Lys Ile Asn 20 25
30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Gly Leu Val
35 40 45Ala Thr Ile Thr Ile Gly Asp Thr
Thr Asp Tyr Ala Asp Tyr Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Arg Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val Glu
115 120 125Ser Gly Gly Gly Leu Val Gln
Pro Gly Gly Ser Leu Arg Leu Ser Cys 130 135
140Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr Thr Met Gly Trp Phe
Arg145 150 155 160Gln Ala
Pro Gly Lys Glu Arg Glu Phe Val Ala Glu Val Arg Trp Gly
165 170 175Gly Val Thr Thr Tyr Ser Asn
Ser Leu Lys Asp Arg Phe Ser Ile Ser 180 185
190Glu Asp Ser Val Lys Asn Ala Val Tyr Leu Gln Met Asn Ser
Leu Lys 195 200 205Pro Glu Asp Thr
Ala Val Tyr Tyr Cys Ala Ala Val Arg Gln Met Tyr 210
215 220Met Thr Val Val Pro Asp Tyr Trp Gly Gln Gly Thr
Leu Val Thr Val225 230 235
240Ser Ser418246PRTArtificial SequenceNanobody sequence 418Glu Val Gln
Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Thr Phe Ser
Gly Gly Thr Phe Ser Ser Tyr 20 25
30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Glu Val Arg Trp Gly Gly
Val Thr Thr Tyr Ser Asn Ser Leu Lys 50 55
60Asp Arg Phe Ser Ile Ser Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65
70 75 80Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala 85
90 95Ala Val Arg Gln Met Tyr Met Thr Val Val
Pro Asp Tyr Trp Gly Gln 100 105
110Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly
115 120 125Ser Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Leu Val Gln Pro Gly 130 135
140Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ser Val His Lys
Ile145 150 155 160Asn Phe
Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Gly Leu
165 170 175Val Ala Thr Ile Thr Ile Gly
Asp Thr Thr Asp Tyr Ala Asp Tyr Ala 180 185
190Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Arg Asn Met
Val Tyr 195 200 205Leu Gln Met Asn
Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys 210
215 220Arg Ala Gly Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr225 230 235
240Leu Val Thr Val Ser Ser 245419259PRTArtificial
SequenceNanobody sequence 419Glu Val Gln Leu Gln Ala Ser Gly Gly Gly Ser
Val Gln Ala Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Tyr Thr Ile Gly Pro Tyr
20 25 30Cys Met Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu Arg Glu Gly Val 35 40
45Ala Ala Ile Asn Met Gly Gly Gly Ile Thr Tyr Tyr Ala Asp Ser
Val 50 55 60Lys Gly Arg Phe Thr Ile
Ser Gln Asp Asn Ala Lys Asn Thr Val Tyr65 70
75 80Leu Leu Met Asn Ser Leu Glu Pro Glu Asp Thr
Ala Ile Tyr Tyr Cys 85 90
95Ala Ala Asp Ser Thr Ile Tyr Ala Ser Tyr Tyr Glu Cys Gly His Gly
100 105 110Leu Ser Thr Gly Gly Tyr
Gly Tyr Asp Ser Trp Gly Gln Gly Thr Gln 115 120
125Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Ser
Glu Val 130 135 140Gln Leu Val Glu Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu145 150
155 160Arg Leu Ser Cys Ala Ala Ser Gly Ser Val
His Lys Ile Asn Phe Leu 165 170
175Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Gly Leu Val Ala Thr
180 185 190Ile Thr Ile Gly Asp
Thr Thr Asp Tyr Ala Asp Tyr Ala Lys Gly Arg 195
200 205Phe Thr Ile Ser Arg Asp Glu Ala Arg Asn Met Val
Tyr Leu Gln Met 210 215 220Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg Ala Gly225
230 235 240Ser Arg Leu Tyr Pro Tyr Asn
Tyr Trp Gly Gln Gly Thr Leu Val Thr 245
250 255Val Ser Ser420262PRTArtificial SequenceNanobody
sequence 420Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr 20
25 30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly
Lys Glu Arg Glu Phe Val 35 40
45Ala Glu Val Arg Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu Lys 50
55 60Asp Arg Phe Ser Ile Ser Glu Asp Ser
Val Lys Asn Ala Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr
Cys Ala 85 90 95Ala Val
Arg Gln Met Tyr Met Thr Val Val Pro Asp Tyr Trp Gly Gln 100
105 110Gly Thr Leu Val Thr Val Ser Ser Gly
Gly Gly Gly Ser Gly Gly Gly 115 120
125Ser Asp Val Gln Leu Gln Ala Ser Gly Gly Gly Ser Val Gln Ala Gly
130 135 140Gly Ser Leu Arg Leu Ser Cys
Ala Ala Ser Gly Tyr Thr Ile Gly Pro145 150
155 160Tyr Cys Met Gly Trp Phe Arg Gln Ala Pro Gly Lys
Glu Arg Glu Gly 165 170
175Val Ala Ala Ile Asn Met Gly Gly Gly Ile Thr Tyr Tyr Ala Asp Ser
180 185 190Val Lys Gly Arg Phe Thr
Ile Ser Gln Asp Asn Ala Lys Asn Thr Val 195 200
205Tyr Leu Leu Met Asn Ser Leu Glu Pro Glu Asp Thr Ala Ile
Tyr Tyr 210 215 220Cys Ala Ala Asp Ser
Thr Ile Tyr Ala Ser Tyr Tyr Glu Cys Gly His225 230
235 240Gly Leu Ser Thr Gly Gly Tyr Gly Tyr Asp
Ser Trp Gly Gln Gly Thr 245 250
255Gln Val Thr Val Ser Ser 260421246PRTArtificial
SequenceNanobody sequence 421Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ser Val His Lys Ile Asn
20 25 30Phe Leu Gly Trp Tyr Arg Gln
Ala Pro Gly Lys Glu Arg Gly Leu Val 35 40
45Ala Thr Ile Thr Ile Gly Asp Thr Thr Asp Tyr Ala Asp Tyr Ala
Lys 50 55 60Gly Arg Phe Thr Ile Ser
Arg Asp Glu Ala Arg Asn Met Val Tyr Leu65 70
75 80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala
Val Tyr Phe Cys Arg 85 90
95Ala Gly Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu
100 105 110Val Thr Val Ser Ser Gly
Gly Gly Gly Ser Gly Gly Gly Ser Glu Val 115 120
125Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
Ser Leu 130 135 140Arg Leu Ser Cys Thr
Phe Ser Gly Gly Thr Phe Ser Ser Tyr Thr Met145 150
155 160Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu
Arg Glu Phe Val Ala Glu 165 170
175Val Arg Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu Lys Asp Arg
180 185 190Phe Ser Ile Ser Glu
Asp Ser Val Lys Asn Ala Val Tyr Leu Gln Met 195
200 205Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr
Cys Ala Ala Val 210 215 220Arg Gln Met
Tyr Met Thr Val Val Pro Asp Tyr Trp Gly Gln Gly Thr225
230 235 240Leu Val Thr Val Ser Ser
245422272PRTArtificial SequenceNanobody sequence 422Glu Val Gln
Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Thr Phe Ser
Gly Gly Thr Phe Ser Ser Tyr 20 25
30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Glu Val Arg Trp Gly Gly
Val Thr Thr Tyr Ser Asn Ser Leu Lys 50 55
60Asp Arg Phe Ser Ile Ser Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65
70 75 80Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala 85
90 95Ala Val Arg Gln Met Tyr Met Thr Val Val
Pro Asp Tyr Trp Gly Gln 100 105
110Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly
115 120 125Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly 130 135
140Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu
Val145 150 155 160Glu Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser
165 170 175Cys Ala Ala Ser Gly Ser Val
His Lys Ile Asn Phe Leu Gly Trp Tyr 180 185
190Arg Gln Ala Pro Gly Lys Glu Arg Gly Leu Val Ala Thr Ile
Thr Ile 195 200 205Gly Asp Thr Thr
Asp Tyr Ala Asp Tyr Ala Lys Gly Arg Phe Thr Ile 210
215 220Ser Arg Asp Glu Ala Arg Asn Met Val Tyr Leu Gln
Met Asn Ser Leu225 230 235
240Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg Ala Gly Ser Arg Leu
245 250 255Tyr Pro Tyr Asn Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270423285PRTArtificial SequenceNanobody sequence
423Glu Val Gln Leu Gln Ala Ser Gly Gly Gly Ser Val Gln Ala Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys
Ala Ala Ser Gly Tyr Thr Ile Gly Pro Tyr 20 25
30Cys Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg
Glu Gly Val 35 40 45Ala Ala Ile
Asn Met Gly Gly Gly Ile Thr Tyr Tyr Ala Asp Ser Val 50
55 60Lys Gly Arg Phe Thr Ile Ser Gln Asp Asn Ala Lys
Asn Thr Val Tyr65 70 75
80Leu Leu Met Asn Ser Leu Glu Pro Glu Asp Thr Ala Ile Tyr Tyr Cys
85 90 95Ala Ala Asp Ser Thr Ile
Tyr Ala Ser Tyr Tyr Glu Cys Gly His Gly 100
105 110Leu Ser Thr Gly Gly Tyr Gly Tyr Asp Ser Trp Gly
Gln Gly Thr Gln 115 120 125Val Thr
Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly 130
135 140Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Gly Gly145 150 155
160Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val Glu Ser Gly
165 170 175Gly Gly Leu Val
Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala 180
185 190Ser Gly Ser Val His Lys Ile Asn Phe Leu Gly
Trp Tyr Arg Gln Ala 195 200 205Pro
Gly Lys Glu Arg Gly Leu Val Ala Thr Ile Thr Ile Gly Asp Thr 210
215 220Thr Asp Tyr Ala Asp Tyr Ala Lys Gly Arg
Phe Thr Ile Ser Arg Asp225 230 235
240Glu Ala Arg Asn Met Val Tyr Leu Gln Met Asn Ser Leu Lys Pro
Glu 245 250 255Asp Thr Ala
Val Tyr Phe Cys Arg Ala Gly Ser Arg Leu Tyr Pro Tyr 260
265 270Asn Tyr Trp Gly Gln Gly Thr Leu Val Thr
Val Ser Ser 275 280
285424288PRTArtificial SequenceNanobody sequence 424Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Thr Phe Ser Gly Gly
Thr Phe Ser Ser Tyr 20 25
30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Glu Val Arg Trp Gly Gly Val
Thr Thr Tyr Ser Asn Ser Leu Lys 50 55
60Asp Arg Phe Ser Ile Ser Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala 85
90 95Ala Val Arg Gln Met Tyr Met Thr Val Val Pro
Asp Tyr Trp Gly Gln 100 105
110Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly
115 120 125Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly 130 135
140Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Asp Val Gln Leu
Gln145 150 155 160Ala Ser
Gly Gly Gly Ser Val Gln Ala Gly Gly Ser Leu Arg Leu Ser
165 170 175Cys Ala Ala Ser Gly Tyr Thr
Ile Gly Pro Tyr Cys Met Gly Trp Phe 180 185
190Arg Gln Ala Pro Gly Lys Glu Arg Glu Gly Val Ala Ala Ile
Asn Met 195 200 205Gly Gly Gly Ile
Thr Tyr Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr 210
215 220Ile Ser Gln Asp Asn Ala Lys Asn Thr Val Tyr Leu
Leu Met Asn Ser225 230 235
240Leu Glu Pro Glu Asp Thr Ala Ile Tyr Tyr Cys Ala Ala Asp Ser Thr
245 250 255Ile Tyr Ala Ser Tyr
Tyr Glu Cys Gly His Gly Leu Ser Thr Gly Gly 260
265 270Tyr Gly Tyr Asp Ser Trp Gly Gln Gly Thr Gln Val
Thr Val Ser Ser 275 280
285425272PRTArtificial SequenceNanobody sequence 425Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ser
Val His Lys Ile Asn 20 25
30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Gly Leu Val
35 40 45Ala Thr Ile Thr Ile Gly Asp Thr
Thr Asp Tyr Ala Asp Tyr Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Arg Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
115 120 125Gly Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly 130 135
140Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val Glu Ser
Gly145 150 155 160Gly Gly
Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Thr Phe
165 170 175Ser Gly Gly Thr Phe Ser Ser
Tyr Thr Met Gly Trp Phe Arg Gln Ala 180 185
190Pro Gly Lys Glu Arg Glu Phe Val Ala Glu Val Arg Trp Gly
Gly Val 195 200 205Thr Thr Tyr Ser
Asn Ser Leu Lys Asp Arg Phe Ser Ile Ser Glu Asp 210
215 220Ser Val Lys Asn Ala Val Tyr Leu Gln Met Asn Ser
Leu Lys Pro Glu225 230 235
240Asp Thr Ala Val Tyr Tyr Cys Ala Ala Val Arg Gln Met Tyr Met Thr
245 250 255Val Val Pro Asp Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270426288PRTArtificial SequenceNanobody sequence
426Glu Val Gln Leu Gln Ala Ser Gly Gly Gly Ser Val Gln Ala Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys
Ala Ala Ser Gly Tyr Thr Ile Gly Pro Tyr 20 25
30Cys Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg
Glu Gly Val 35 40 45Ala Ala Ile
Asn Met Gly Gly Gly Ile Thr Tyr Tyr Ala Asp Ser Val 50
55 60Lys Gly Arg Phe Thr Ile Ser Gln Asp Asn Ala Lys
Asn Thr Val Tyr65 70 75
80Leu Leu Met Asn Ser Leu Glu Pro Glu Asp Thr Ala Ile Tyr Tyr Cys
85 90 95Ala Ala Asp Ser Thr Ile
Tyr Ala Ser Tyr Tyr Glu Cys Gly His Gly 100
105 110Leu Ser Thr Gly Gly Tyr Gly Tyr Asp Ser Trp Gly
Gln Gly Thr Gln 115 120 125Val Thr
Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly 130
135 140Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Gly Gly145 150 155
160Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val Glu Ser Gly
165 170 175Gly Gly Leu Val
Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Thr Phe 180
185 190Ser Gly Gly Thr Phe Ser Ser Tyr Thr Met Gly
Trp Phe Arg Gln Ala 195 200 205Pro
Gly Lys Glu Arg Glu Phe Val Ala Glu Val Arg Trp Gly Gly Val 210
215 220Thr Thr Tyr Ser Asn Ser Leu Lys Asp Arg
Phe Ser Ile Ser Glu Asp225 230 235
240Ser Val Lys Asn Ala Val Tyr Leu Gln Met Asn Ser Leu Lys Pro
Glu 245 250 255Asp Thr Ala
Val Tyr Tyr Cys Ala Ala Val Arg Gln Met Tyr Met Thr 260
265 270Val Val Pro Asp Tyr Trp Gly Gln Gly Thr
Leu Val Thr Val Ser Ser 275 280
285427285PRTArtificial SequenceNanobody sequence 427Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ser
Val His Lys Ile Asn 20 25
30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Gly Leu Val
35 40 45Ala Thr Ile Thr Ile Gly Asp Thr
Thr Asp Tyr Ala Asp Tyr Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Arg Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
115 120 125Gly Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly 130 135
140Gly Gly Ser Gly Gly Gly Gly Ser Asp Val Gln Leu Gln Ala Ser
Gly145 150 155 160Gly Gly
Ser Val Gln Ala Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala
165 170 175Ser Gly Tyr Thr Ile Gly Pro
Tyr Cys Met Gly Trp Phe Arg Gln Ala 180 185
190Pro Gly Lys Glu Arg Glu Gly Val Ala Ala Ile Asn Met Gly
Gly Gly 195 200 205Ile Thr Tyr Tyr
Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Gln 210
215 220Asp Asn Ala Lys Asn Thr Val Tyr Leu Leu Met Asn
Ser Leu Glu Pro225 230 235
240Glu Asp Thr Ala Ile Tyr Tyr Cys Ala Ala Asp Ser Thr Ile Tyr Ala
245 250 255Ser Tyr Tyr Glu Cys
Gly His Gly Leu Ser Thr Gly Gly Tyr Gly Tyr 260
265 270Asp Ser Trp Gly Gln Gly Thr Gln Val Thr Val Ser
Ser 275 280 285428272PRTArtificial
SequenceNanobody sequence 428Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Asp Val Tyr Lys Ile Asn
20 25 30Phe Leu Gly Trp His Arg Gln
Ala Pro Gly Lys Glu Arg Glu Lys Val 35 40
45Ala His Ile Thr Ile Gly Asp Ala Thr Asp Tyr Ala Asp Ser Ala
Lys 50 55 60Gly Arg Phe Thr Ile Ser
Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65 70
75 80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala
Val Tyr Phe Cys Arg 85 90
95Ala Gly Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu
100 105 110Val Thr Val Ser Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly 115 120
125Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Gly Gly 130 135 140Gly Gly Ser Gly Gly
Gly Gly Ser Glu Val Gln Leu Val Glu Ser Gly145 150
155 160Gly Gly Leu Val Gln Pro Gly Gly Ser Leu
Arg Leu Ser Cys Thr Phe 165 170
175Ser Gly Gly Thr Phe Ser Ser Tyr Thr Met Gly Trp Phe Arg Gln Ala
180 185 190Pro Gly Lys Glu Arg
Glu Phe Val Ala Glu Val Arg Trp Gly Gly Val 195
200 205Thr Thr Tyr Ser Asn Ser Leu Lys Asp Arg Phe Ser
Ile Ser Glu Asp 210 215 220Ser Val Lys
Asn Ala Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu225
230 235 240Asp Thr Ala Val Tyr Tyr Cys
Ala Ala Val Arg Gln Met Tyr Met Thr 245
250 255Val Val Pro Asp Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 260 265
270429272PRTArtificial SequenceNanobody sequence 429Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Lys Leu Ser Cys Ala Ala Ser Gly Ala
Val His Lys Ile Asn 20 25
30Phe Leu Gly Trp Tyr Arg Gln Thr Pro Glu Lys Glu Arg Glu Met Val
35 40 45Ala Thr Ile Thr Ile Gly Asp Glu
Val Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Thr Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Val Cys Arg 85
90 95Ala Gly Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
115 120 125Gly Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly 130 135
140Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val Glu Ser
Gly145 150 155 160Gly Gly
Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Thr Phe
165 170 175Ser Gly Gly Thr Phe Ser Ser
Tyr Thr Met Gly Trp Phe Arg Gln Ala 180 185
190Pro Gly Lys Glu Arg Glu Phe Val Ala Glu Val Arg Trp Gly
Gly Val 195 200 205Thr Thr Tyr Ser
Asn Ser Leu Lys Asp Arg Phe Ser Ile Ser Glu Asp 210
215 220Ser Val Lys Asn Ala Val Tyr Leu Gln Met Asn Ser
Leu Lys Pro Glu225 230 235
240Asp Thr Ala Val Tyr Tyr Cys Ala Ala Val Arg Gln Met Tyr Met Thr
245 250 255Val Val Pro Asp Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270430272PRTArtificial SequenceNanobody sequence
430Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys
Ile Thr Ser Gly Glu Thr Phe Lys Ile Asn 20 25
30Ile Trp Gly Trp Tyr Arg Gln Ala Pro Gly Lys Gln Arg
Glu Leu Val 35 40 45Ala Ser Leu
Thr Ile Gly Gly Ala Thr Asn Tyr Ala Asp Ser Val Lys 50
55 60Gly Arg Phe Thr Ile Ser Glu Asp Ser Ala Lys Asn
Thr Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Asn
85 90 95Ala Lys Ser Arg Leu Tyr
Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Gly 115 120 125Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly 130
135 140Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln
Leu Val Glu Ser Gly145 150 155
160Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Thr Phe
165 170 175Ser Gly Gly Thr
Phe Ser Ser Tyr Thr Met Gly Trp Phe Arg Gln Ala 180
185 190Pro Gly Lys Glu Arg Glu Phe Val Ala Glu Val
Arg Trp Gly Gly Val 195 200 205Thr
Thr Tyr Ser Asn Ser Leu Lys Asp Arg Phe Ser Ile Ser Glu Asp 210
215 220Ser Val Lys Asn Ala Val Tyr Leu Gln Met
Asn Ser Leu Lys Pro Glu225 230 235
240Asp Thr Ala Val Tyr Tyr Cys Ala Ala Val Arg Gln Met Tyr Met
Thr 245 250 255Val Val Pro
Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270431272PRTArtificial SequenceNanobody
sequence 431Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Ser Val His Leu Leu Asn 20
25 30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly
Lys Glu Arg Glu Met Val 35 40
45Ala His Ile Thr Ile Ala Asp Ala Thr Asp Tyr Ala His Phe Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Lys Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Gly
Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Gly 115 120
125Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
130 135 140Gly Gly Ser Gly Gly Gly Gly
Ser Glu Val Gln Leu Val Glu Ser Gly145 150
155 160Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu
Ser Cys Thr Phe 165 170
175Ser Gly Gly Thr Phe Ser Ser Tyr Thr Met Gly Trp Phe Arg Gln Ala
180 185 190Pro Gly Lys Glu Arg Glu
Phe Val Ala Glu Val Arg Trp Gly Gly Val 195 200
205Thr Thr Tyr Ser Asn Ser Leu Lys Asp Arg Phe Ser Ile Ser
Glu Asp 210 215 220Ser Val Lys Asn Ala
Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu225 230
235 240Asp Thr Ala Val Tyr Tyr Cys Ala Ala Val
Arg Gln Met Tyr Met Thr 245 250
255Val Val Pro Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser
260 265 270432272PRTArtificial
SequenceNanobody sequence 432Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Ile Thr Ser Gly Glu Thr Phe Lys Ile Asn
20 25 30Ile Trp Gly Trp Tyr Arg Gln
Ala Pro Gly Lys Gln Arg Glu Leu Val 35 40
45Ala Ser Leu Thr Ile Gly Gly Ala Thr Asp Tyr Ala Asp Ser Val
Lys 50 55 60Gly Arg Phe Thr Ile Ser
Glu Asp Ser Ala Lys Asn Thr Val Tyr Leu65 70
75 80Gln Met Asn Ser Leu Lys Ala Glu Asp Thr Ala
Val Tyr Phe Cys Asn 85 90
95Ala Lys Ser Arg Leu Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu
100 105 110Val Thr Val Ser Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly 115 120
125Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Gly Gly 130 135 140Gly Gly Ser Gly Gly
Gly Gly Ser Glu Val Gln Leu Val Glu Ser Gly145 150
155 160Gly Gly Leu Val Gln Pro Gly Gly Ser Leu
Arg Leu Ser Cys Thr Phe 165 170
175Ser Gly Gly Thr Phe Ser Ser Tyr Thr Met Gly Trp Phe Arg Gln Ala
180 185 190Pro Gly Lys Glu Arg
Glu Phe Val Ala Glu Val Arg Trp Gly Gly Val 195
200 205Thr Thr Tyr Ser Asn Ser Leu Lys Asp Arg Phe Ser
Ile Ser Glu Asp 210 215 220Ser Val Lys
Asn Ala Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu225
230 235 240Asp Thr Ala Val Tyr Tyr Cys
Ala Ala Val Arg Gln Met Tyr Met Thr 245
250 255Val Val Pro Asp Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 260 265
270433272PRTArtificial SequenceNanobody sequence 433Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Glu
Val Tyr Lys Ile Asn 20 25
30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Glu Lys Val
35 40 45Ala His Ile Thr Ile Ala Asp Ala
Ala Asp Tyr Ala Asp Phe Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Arg Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Gly Ser Arg Ile Trp Pro Tyr Asp Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
115 120 125Gly Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly 130 135
140Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val Glu Ser
Gly145 150 155 160Gly Gly
Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Thr Phe
165 170 175Ser Gly Gly Thr Phe Ser Ser
Tyr Thr Met Gly Trp Phe Arg Gln Ala 180 185
190Pro Gly Lys Glu Arg Glu Phe Val Ala Glu Val Arg Trp Gly
Gly Val 195 200 205Thr Thr Tyr Ser
Asn Ser Leu Lys Asp Arg Phe Ser Ile Ser Glu Asp 210
215 220Ser Val Lys Asn Ala Val Tyr Leu Gln Met Asn Ser
Leu Lys Pro Glu225 230 235
240Asp Thr Ala Val Tyr Tyr Cys Ala Ala Val Arg Gln Met Tyr Met Thr
245 250 255Val Val Pro Asp Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270434272PRTArtificial SequenceNanobody sequence
434Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys
Val Ala Ser Gly Asp Val His Lys Ile Asn 20 25
30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg
Glu Lys Val 35 40 45Ala His Ile
Ser Ile Gly Asp Gln Thr Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ser Lys Asn
Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg
85 90 95Ala Phe Ser Arg Ile Tyr
Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Gly 115 120 125Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly 130
135 140Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln
Leu Val Glu Ser Gly145 150 155
160Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Thr Phe
165 170 175Ser Gly Gly Thr
Phe Ser Ser Tyr Thr Met Gly Trp Phe Arg Gln Ala 180
185 190Pro Gly Lys Glu Arg Glu Phe Val Ala Glu Val
Arg Trp Gly Gly Val 195 200 205Thr
Thr Tyr Ser Asn Ser Leu Lys Asp Arg Phe Ser Ile Ser Glu Asp 210
215 220Ser Val Lys Asn Ala Val Tyr Leu Gln Met
Asn Ser Leu Lys Pro Glu225 230 235
240Asp Thr Ala Val Tyr Tyr Cys Ala Ala Val Arg Gln Met Tyr Met
Thr 245 250 255Val Val Pro
Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270435272PRTArtificial SequenceNanobody
sequence 435Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Glu Ile Gly Arg Ile Asn 20
25 30Phe Tyr Arg Trp Tyr Arg Gln Ala Pro Gly
Asn Gln Arg Glu Val Val 35 40
45Ala Thr Ile Thr Ile Ala Asp Lys Thr Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ser Arg Asn Met Val Tyr Leu65 70 75
80Gln Met Ser Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys His 85 90 95Ala Gly
Ser Arg Leu Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Gly 115 120
125Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
130 135 140Gly Gly Ser Gly Gly Gly Gly
Ser Glu Val Gln Leu Val Glu Ser Gly145 150
155 160Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu
Ser Cys Thr Phe 165 170
175Ser Gly Gly Thr Phe Ser Ser Tyr Thr Met Gly Trp Phe Arg Gln Ala
180 185 190Pro Gly Lys Glu Arg Glu
Phe Val Ala Glu Val Arg Trp Gly Gly Val 195 200
205Thr Thr Tyr Ser Asn Ser Leu Lys Asp Arg Phe Ser Ile Ser
Glu Asp 210 215 220Ser Val Lys Asn Ala
Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu225 230
235 240Asp Thr Ala Val Tyr Tyr Cys Ala Ala Val
Arg Gln Met Tyr Met Thr 245 250
255Val Val Pro Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser
260 265 270436272PRTArtificial
SequenceNanobody sequence 436Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Val Ala Ser Gly Asp Val His Lys Ile Asn
20 25 30Phe Leu Gly Trp Tyr Arg Gln
Ala Pro Gly Lys Glu Arg Glu Lys Val 35 40
45Ala His Ile Thr Ile Gly Asp Gln Ala Asp Tyr Ala Asp Ser Ala
Lys 50 55 60Gly Arg Phe Thr Ile Ser
Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65 70
75 80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala
Val Tyr Phe Cys Arg 85 90
95Ala Gly Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu
100 105 110Val Thr Val Ser Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly 115 120
125Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Gly Gly 130 135 140Gly Gly Ser Gly Gly
Gly Gly Ser Glu Val Gln Leu Val Glu Ser Gly145 150
155 160Gly Gly Leu Val Gln Pro Gly Gly Ser Leu
Arg Leu Ser Cys Thr Phe 165 170
175Ser Gly Gly Thr Phe Ser Ser Tyr Thr Met Gly Trp Phe Arg Gln Ala
180 185 190Pro Gly Lys Glu Arg
Glu Phe Val Ala Glu Val Arg Trp Gly Gly Val 195
200 205Thr Thr Tyr Ser Asn Ser Leu Lys Asp Arg Phe Ser
Ile Ser Glu Asp 210 215 220Ser Val Lys
Asn Ala Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu225
230 235 240Asp Thr Ala Val Tyr Tyr Cys
Ala Ala Val Arg Gln Met Tyr Met Thr 245
250 255Val Val Pro Asp Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 260 265
270437272PRTArtificial SequenceNanobody sequence 437Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Asp
Val His Lys Ile Asn 20 25
30Ile Leu Gly Trp Tyr Arg Gln Ala Pro Ala Lys Glu Arg Glu Met Val
35 40 45Ala His Ile Thr Ile Gly Asp Ala
Thr Asp Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Tyr Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
115 120 125Gly Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly 130 135
140Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val Glu Ser
Gly145 150 155 160Gly Gly
Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Thr Phe
165 170 175Ser Gly Gly Thr Phe Ser Ser
Tyr Thr Met Gly Trp Phe Arg Gln Ala 180 185
190Pro Gly Lys Glu Arg Glu Phe Val Ala Glu Val Arg Trp Gly
Gly Val 195 200 205Thr Thr Tyr Ser
Asn Ser Leu Lys Asp Arg Phe Ser Ile Ser Glu Asp 210
215 220Ser Val Lys Asn Ala Val Tyr Leu Gln Met Asn Ser
Leu Lys Pro Glu225 230 235
240Asp Thr Ala Val Tyr Tyr Cys Ala Ala Val Arg Gln Met Tyr Met Thr
245 250 255Val Val Pro Asp Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270438272PRTArtificial SequenceNanobody sequence
438Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys
Ala Ala Ser Gly Ser Val His Lys Ile Asn 20 25
30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg
Glu Leu Val 35 40 45Ala Thr Ile
Thr Ile Gly Asp Thr Thr Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn
Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg
85 90 95Ala Gly Ser Arg Leu Tyr
Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Gly 115 120 125Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly 130
135 140Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln
Leu Val Glu Ser Gly145 150 155
160Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Thr Phe
165 170 175Ser Gly Gly Thr
Phe Ser Ser Tyr Thr Met Gly Trp Phe Arg Gln Ala 180
185 190Pro Gly Lys Glu Arg Glu Phe Val Ala Glu Val
Arg Trp Gly Gly Val 195 200 205Thr
Thr Tyr Ser Asn Ser Leu Lys Asp Arg Phe Ser Ile Ser Glu Asp 210
215 220Ser Val Lys Asn Ala Val Tyr Leu Gln Met
Asn Ser Leu Lys Pro Glu225 230 235
240Asp Thr Ala Val Tyr Tyr Cys Ala Ala Val Arg Gln Met Tyr Met
Thr 245 250 255Val Val Pro
Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270439272PRTArtificial SequenceNanobody
sequence 439Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Ser Val His Lys Ile Asn 20
25 30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly
Lys Glu Arg Gly Leu Val 35 40
45Ala Thr Ile Thr Ile Gly Asp Thr Thr Asp Tyr Ala Asp Tyr Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu
Ala Arg Asn Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
Cys Arg 85 90 95Ala Gly
Ser Arg Leu Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Gly 115 120
125Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
130 135 140Gly Gly Ser Gly Gly Gly Gly
Ser Glu Val Gln Leu Val Glu Ser Gly145 150
155 160Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu
Ser Cys Thr Phe 165 170
175Ser Gly Gly Thr Phe Ser Ser Tyr Thr Met Gly Trp Phe Arg Gln Ala
180 185 190Pro Gly Lys Glu Arg Glu
Phe Val Ala Glu Val Arg Trp Gly Gly Val 195 200
205Thr Thr Tyr Ser Asn Ser Leu Lys Asp Arg Phe Ser Ile Ser
Glu Asp 210 215 220Ser Val Lys Asn Ala
Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu225 230
235 240Asp Thr Ala Val Tyr Tyr Cys Ala Ala Val
Arg Gln Met Tyr Met Thr 245 250
255Val Val Pro Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser
260 265 270440272PRTArtificial
SequenceNanobody sequence 440Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Asp Val His Lys Ile Asn
20 25 30Ile Leu Gly Trp Tyr Arg Gln
Ala Pro Ala Lys Glu Arg Glu Met Val 35 40
45Ala His Ile Thr Ile Gly Asp Ala Thr Asp Tyr Ala Asp Ser Ala
Lys 50 55 60Gly Arg Phe Thr Ile Ser
Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65 70
75 80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala
Val Tyr Leu Cys Arg 85 90
95Ala Tyr Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu
100 105 110Val Thr Val Ser Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly 115 120
125Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Gly Gly 130 135 140Gly Gly Ser Gly Gly
Gly Gly Ser Glu Val Gln Leu Val Glu Ser Gly145 150
155 160Gly Gly Leu Val Gln Pro Gly Gly Ser Leu
Arg Leu Ser Cys Thr Phe 165 170
175Ser Gly Gly Thr Phe Ser Ser Tyr Thr Met Gly Trp Phe Arg Gln Ala
180 185 190Pro Gly Lys Glu Arg
Glu Phe Val Ala Glu Val Arg Trp Gly Gly Val 195
200 205Thr Thr Tyr Ser Asn Ser Leu Lys Asp Arg Phe Ser
Ile Ser Glu Asp 210 215 220Ser Val Lys
Asn Ala Val Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu225
230 235 240Asp Thr Ala Val Tyr Tyr Cys
Ala Ala Val Arg Gln Met Tyr Met Thr 245
250 255Val Val Pro Asp Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 260 265
270441272PRTArtificial SequenceNanobody sequence 441Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Thr Phe Ser Gly Gly
Thr Phe Ser Ser Tyr 20 25
30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Glu Val Arg Trp Gly Gly Val
Thr Thr Tyr Ser Asn Ser Leu Lys 50 55
60Asp Arg Phe Ser Ile Ser Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala 85
90 95Ala Val Arg Gln Met Tyr Met Thr Val Val Pro
Asp Tyr Trp Gly Gln 100 105
110Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly
115 120 125Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly 130 135
140Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu
Val145 150 155 160Glu Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser
165 170 175Cys Val Ala Ser Gly Asp Val
His Lys Ile Asn Phe Leu Gly Trp Tyr 180 185
190Arg Gln Ala Pro Gly Lys Glu Arg Glu Lys Val Ala His Ile
Ser Ile 195 200 205Gly Asp Gln Thr
Asp Tyr Ala Asp Ser Ala Lys Gly Arg Phe Thr Ile 210
215 220Ser Arg Asp Glu Ser Lys Asn Met Val Tyr Leu Gln
Met Asn Ser Leu225 230 235
240Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg Ala Phe Ser Arg Ile
245 250 255Tyr Pro Tyr Asp Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270442272PRTArtificial SequenceNanobody sequence
442Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys
Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr 20 25
30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg
Glu Phe Val 35 40 45Ala Glu Val
Arg Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu Lys 50
55 60Asp Arg Phe Ser Ile Ser Glu Asp Ser Val Lys Asn
Ala Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala
85 90 95Ala Val Arg Gln Met Tyr
Met Thr Val Val Pro Asp Tyr Trp Gly Gln 100
105 110Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly
Ser Gly Gly Gly 115 120 125Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly 130
135 140Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Glu Val Gln Leu Val145 150 155
160Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser
165 170 175Cys Ala Ala Ser
Gly Glu Ile Gly Arg Ile Asn Phe Tyr Arg Trp Tyr 180
185 190Arg Gln Ala Pro Gly Asn Gln Arg Glu Val Val
Ala Thr Ile Thr Ile 195 200 205Ala
Asp Lys Thr Asp Tyr Ala Asp Ser Ala Lys Gly Arg Phe Thr Ile 210
215 220Ser Arg Asp Glu Ser Arg Asn Met Val Tyr
Leu Gln Met Ser Ser Leu225 230 235
240Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys His Ala Gly Ser Arg
Leu 245 250 255Tyr Pro Tyr
Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270443272PRTArtificial SequenceNanobody
sequence 443Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr 20
25 30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly
Lys Glu Arg Glu Phe Val 35 40
45Ala Glu Val Arg Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu Lys 50
55 60Asp Arg Phe Ser Ile Ser Glu Asp Ser
Val Lys Asn Ala Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr
Cys Ala 85 90 95Ala Val
Arg Gln Met Tyr Met Thr Val Val Pro Asp Tyr Trp Gly Gln 100
105 110Gly Thr Leu Val Thr Val Ser Ser Gly
Gly Gly Gly Ser Gly Gly Gly 115 120
125Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
130 135 140Ser Gly Gly Gly Gly Ser Gly
Gly Gly Gly Ser Glu Val Gln Leu Val145 150
155 160Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser
Leu Arg Leu Ser 165 170
175Cys Val Ala Ser Gly Asp Val His Lys Ile Asn Phe Leu Gly Trp Tyr
180 185 190Arg Gln Ala Pro Gly Lys
Glu Arg Glu Lys Val Ala His Ile Thr Ile 195 200
205Gly Asp Gln Ala Asp Tyr Ala Asp Ser Ala Lys Gly Arg Phe
Thr Ile 210 215 220Ser Arg Asp Glu Ala
Lys Asn Met Val Tyr Leu Gln Met Asn Ser Leu225 230
235 240Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys
Arg Ala Gly Ser Arg Ile 245 250
255Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser
260 265 270444272PRTArtificial
SequenceNanobody sequence 444Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr
20 25 30Thr Met Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40
45Ala Glu Val Arg Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu
Lys 50 55 60Asp Arg Phe Ser Ile Ser
Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65 70
75 80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala
Val Tyr Tyr Cys Ala 85 90
95Ala Val Arg Gln Met Tyr Met Thr Val Val Pro Asp Tyr Trp Gly Gln
100 105 110Gly Thr Leu Val Thr Val
Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly 115 120
125Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly 130 135 140Ser Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val145 150
155 160Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly Ser Leu Arg Leu Ser 165 170
175Cys Ala Ala Ser Gly Asp Val His Lys Ile Asn Ile Leu Gly Trp Tyr
180 185 190Arg Gln Ala Pro Ala
Lys Glu Arg Glu Met Val Ala His Ile Thr Ile 195
200 205Gly Asp Ala Thr Asp Tyr Ala Asp Ser Ala Lys Gly
Arg Phe Thr Ile 210 215 220Ser Arg Asp
Glu Ala Lys Asn Met Val Tyr Leu Gln Met Asn Ser Leu225
230 235 240Lys Pro Glu Asp Thr Ala Val
Tyr Phe Cys Arg Ala Tyr Ser Arg Ile 245
250 255Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 260 265
270445272PRTArtificial SequenceNanobody sequence 445Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Thr Phe Ser Gly Gly
Thr Phe Ser Ser Tyr 20 25
30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Glu Val Arg Trp Gly Gly Val
Thr Thr Tyr Ser Asn Ser Leu Lys 50 55
60Asp Arg Phe Ser Ile Ser Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala 85
90 95Ala Val Arg Gln Met Tyr Met Thr Val Val Pro
Asp Tyr Trp Gly Gln 100 105
110Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly
115 120 125Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly 130 135
140Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu
Val145 150 155 160Glu Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser
165 170 175Cys Ala Ala Ser Gly Ser Val
His Lys Ile Asn Phe Leu Gly Trp Tyr 180 185
190Arg Gln Ala Pro Gly Lys Glu Arg Glu Leu Val Ala Thr Ile
Thr Ile 195 200 205Gly Asp Thr Thr
Asp Tyr Ala Asp Ser Ala Lys Gly Arg Phe Thr Ile 210
215 220Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu Gln
Met Asn Ser Leu225 230 235
240Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg Ala Gly Ser Arg Leu
245 250 255Tyr Pro Tyr Asn Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270446272PRTArtificial SequenceNanobody sequence
446Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys
Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr 20 25
30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg
Glu Phe Val 35 40 45Ala Glu Val
Arg Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu Lys 50
55 60Asp Arg Phe Ser Ile Ser Glu Asp Ser Val Lys Asn
Ala Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala
85 90 95Ala Val Arg Gln Met Tyr
Met Thr Val Val Pro Asp Tyr Trp Gly Gln 100
105 110Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly
Ser Gly Gly Gly 115 120 125Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly 130
135 140Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Glu Val Gln Leu Val145 150 155
160Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser
165 170 175Cys Ala Ala Ser
Gly Ser Val His Lys Ile Asn Phe Leu Gly Trp Tyr 180
185 190Arg Gln Ala Pro Gly Lys Glu Arg Gly Leu Val
Ala Thr Ile Thr Ile 195 200 205Gly
Asp Thr Thr Asp Tyr Ala Asp Tyr Ala Lys Gly Arg Phe Thr Ile 210
215 220Ser Arg Asp Glu Ala Arg Asn Met Val Tyr
Leu Gln Met Asn Ser Leu225 230 235
240Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg Ala Gly Ser Arg
Leu 245 250 255Tyr Pro Tyr
Asn Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270447272PRTArtificial SequenceNanobody
sequence 447Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr 20
25 30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly
Lys Glu Arg Glu Phe Val 35 40
45Ala Glu Val Arg Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu Lys 50
55 60Asp Arg Phe Ser Ile Ser Glu Asp Ser
Val Lys Asn Ala Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr
Cys Ala 85 90 95Ala Val
Arg Gln Met Tyr Met Thr Val Val Pro Asp Tyr Trp Gly Gln 100
105 110Gly Thr Leu Val Thr Val Ser Ser Gly
Gly Gly Gly Ser Gly Gly Gly 115 120
125Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
130 135 140Ser Gly Gly Gly Gly Ser Gly
Gly Gly Gly Ser Glu Val Gln Leu Val145 150
155 160Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser
Leu Arg Leu Ser 165 170
175Cys Ala Ala Ser Gly Asp Val Tyr Lys Ile Asn Phe Leu Gly Trp His
180 185 190Arg Gln Ala Pro Gly Lys
Glu Arg Glu Lys Val Ala His Ile Thr Ile 195 200
205Gly Asp Ala Thr Asp Tyr Ala Asp Ser Ala Lys Gly Arg Phe
Thr Ile 210 215 220Ser Arg Asp Glu Ala
Lys Asn Met Val Tyr Leu Gln Met Asn Ser Leu225 230
235 240Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys
Arg Ala Gly Ser Arg Ile 245 250
255Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser
260 265 270448272PRTArtificial
SequenceNanobody sequence 448Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr
20 25 30Thr Met Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40
45Ala Glu Val Arg Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu
Lys 50 55 60Asp Arg Phe Ser Ile Ser
Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65 70
75 80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala
Val Tyr Tyr Cys Ala 85 90
95Ala Val Arg Gln Met Tyr Met Thr Val Val Pro Asp Tyr Trp Gly Gln
100 105 110Gly Thr Leu Val Thr Val
Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly 115 120
125Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly 130 135 140Ser Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val145 150
155 160Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly Ser Leu Arg Leu Ser 165 170
175Cys Ala Ala Ser Gly Glu Val Tyr Lys Ile Asn Phe Leu Gly Trp Tyr
180 185 190Arg Gln Ala Pro Gly
Lys Glu Arg Glu Lys Val Ala His Ile Thr Ile 195
200 205Ala Asp Ala Ala Asp Tyr Ala Asp Phe Ala Lys Gly
Arg Phe Thr Ile 210 215 220Ser Arg Asp
Glu Ala Lys Asn Met Val Tyr Leu Gln Met Asn Ser Leu225
230 235 240Arg Pro Glu Asp Thr Ala Val
Tyr Phe Cys Arg Ala Gly Ser Arg Ile 245
250 255Trp Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 260 265
270449272PRTArtificial SequenceNanobody sequence 449Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Thr Phe Ser Gly Gly
Thr Phe Ser Ser Tyr 20 25
30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Glu Val Arg Trp Gly Gly Val
Thr Thr Tyr Ser Asn Ser Leu Lys 50 55
60Asp Arg Phe Ser Ile Ser Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala 85
90 95Ala Val Arg Gln Met Tyr Met Thr Val Val Pro
Asp Tyr Trp Gly Gln 100 105
110Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly
115 120 125Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly 130 135
140Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu
Val145 150 155 160Glu Ser
Gly Gly Asp Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser
165 170 175Cys Ala Ala Ser Gly Asp Val
His Lys Ile Asn Phe Leu Gly Trp Tyr 180 185
190Arg Gln Ala Pro Gly Lys Glu Arg Glu Met Val Ala His Ile
Thr Ile 195 200 205Ala Asp Ala Thr
Asp Tyr Ala Glu Phe Ala Lys Gly Arg Phe Thr Ile 210
215 220Ser Arg Asp Glu Pro Lys Asn Met Val Tyr Leu Gln
Met Asn Ser Leu225 230 235
240Lys Pro Glu Asp Thr Ala Val Tyr Leu Cys Arg Ala Gly Ser Arg Ile
245 250 255Tyr Pro Tyr Asn Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270450272PRTArtificial SequenceNanobody sequence
450Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys
Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr 20 25
30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg
Glu Phe Val 35 40 45Ala Glu Val
Arg Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu Lys 50
55 60Asp Arg Phe Ser Ile Ser Glu Asp Ser Val Lys Asn
Ala Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala
85 90 95Ala Val Arg Gln Met Tyr
Met Thr Val Val Pro Asp Tyr Trp Gly Gln 100
105 110Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly
Ser Gly Gly Gly 115 120 125Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly 130
135 140Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Glu Val Gln Leu Val145 150 155
160Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser
165 170 175Cys Ile Thr Ser
Gly Glu Thr Phe Lys Ile Asn Ile Trp Gly Trp Tyr 180
185 190Arg Gln Ala Pro Gly Lys Gln Arg Glu Leu Val
Ala Ser Leu Thr Ile 195 200 205Gly
Gly Ala Thr Asn Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile 210
215 220Ser Glu Asp Ser Ala Lys Asn Thr Val Tyr
Leu Gln Met Asn Ser Leu225 230 235
240Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Asn Ala Lys Ser Arg
Leu 245 250 255Tyr Pro Tyr
Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270451272PRTArtificial SequenceNanobody
sequence 451Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr 20
25 30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly
Lys Glu Arg Glu Phe Val 35 40
45Ala Glu Val Arg Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu Lys 50
55 60Asp Arg Phe Ser Ile Ser Glu Asp Ser
Val Lys Asn Ala Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr
Cys Ala 85 90 95Ala Val
Arg Gln Met Tyr Met Thr Val Val Pro Asp Tyr Trp Gly Gln 100
105 110Gly Thr Leu Val Thr Val Ser Ser Gly
Gly Gly Gly Ser Gly Gly Gly 115 120
125Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
130 135 140Ser Gly Gly Gly Gly Ser Gly
Gly Gly Gly Ser Glu Val Gln Leu Val145 150
155 160Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser
Leu Arg Leu Ser 165 170
175Cys Ala Ala Ser Gly Ser Val His Leu Leu Asn Phe Leu Gly Trp Tyr
180 185 190Arg Gln Ala Pro Gly Lys
Glu Arg Glu Met Val Ala His Ile Thr Ile 195 200
205Ala Asp Ala Thr Asp Tyr Ala His Phe Ala Lys Gly Arg Phe
Thr Ile 210 215 220Ser Arg Asp Glu Ala
Lys Asn Met Val Tyr Leu Gln Met Asn Ser Leu225 230
235 240Arg Pro Glu Asp Thr Ala Val Tyr Phe Cys
Arg Ala Gly Ser Arg Ile 245 250
255Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser
260 265 270452272PRTArtificial
SequenceNanobody sequence 452Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr
20 25 30Thr Met Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40
45Ala Glu Val Arg Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu
Lys 50 55 60Asp Arg Phe Ser Ile Ser
Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65 70
75 80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala
Val Tyr Tyr Cys Ala 85 90
95Ala Val Arg Gln Met Tyr Met Thr Val Val Pro Asp Tyr Trp Gly Gln
100 105 110Gly Thr Leu Val Thr Val
Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly 115 120
125Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly 130 135 140Ser Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val145 150
155 160Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly Ser Leu Arg Leu Ser 165 170
175Cys Ile Thr Ser Gly Glu Thr Phe Lys Ile Asn Ile Trp Gly Trp Tyr
180 185 190Arg Gln Ala Pro Gly
Lys Gln Arg Glu Leu Val Ala Ser Leu Thr Ile 195
200 205Gly Gly Ala Thr Asp Tyr Ala Asp Ser Val Lys Gly
Arg Phe Thr Ile 210 215 220Ser Glu Asp
Ser Ala Lys Asn Thr Val Tyr Leu Gln Met Asn Ser Leu225
230 235 240Lys Ala Glu Asp Thr Ala Val
Tyr Phe Cys Asn Ala Lys Ser Arg Leu 245
250 255Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 260 265
270453272PRTArtificial SequenceNanobody sequence 453Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Asp
Val His Lys Ile Asn 20 25
30Ile Leu Gly Trp Tyr Arg Gln Ala Pro Ala Lys Glu Arg Glu Met Val
35 40 45Ala His Ile Thr Ile Gly Asp Ala
Thr Ser Tyr Ala Asp Ser Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu65
70 75 80Gln Leu Asn Asn Leu
Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg 85
90 95Ala Tyr Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
115 120 125Gly Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly 130 135
140Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val Glu Ser
Gly145 150 155 160Gly Gly
Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Thr Phe
165 170 175Ser Gly Gly Thr Phe Ser Ser
Tyr Thr Met Gly Trp Phe Arg Gln Ala 180 185
190Pro Gly Lys Glu Arg Glu Phe Val Ala Glu Val Arg Trp Gly
Gly Val 195 200 205Thr Thr Tyr Ser
Asn Ser Leu Lys Asp Arg Phe Ser Ile Ser Glu Asp 210
215 220Ser Val Lys Asn Ala Val Tyr Leu Gln Met Asn Ser
Leu Lys Pro Glu225 230 235
240Asp Thr Ala Val Tyr Tyr Cys Ala Ala Val Arg Gln Met Tyr Met Thr
245 250 255Val Val Pro Asp Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270454272PRTArtificial SequenceNanobody sequence
454Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys
Val Ala Ser Gly Asp Val His Lys Ile Asn 20 25
30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg
Glu Lys Val 35 40 45Ala His Ile
Ser Ile Gly Asp Gln Thr Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ser Lys Asn
Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg
85 90 95Ala Phe Ser Arg Ile Tyr
Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Gly 115 120 125Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly 130
135 140Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln
Leu Val Glu Ser Gly145 150 155
160Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Thr Phe
165 170 175Ser Gly Gly Thr
Phe Ser Ser Tyr Thr Met Gly Trp Phe Arg Gln Ala 180
185 190Pro Gly Lys Glu Arg Glu Phe Val Ala Glu Val
Arg Trp Gly Gly Val 195 200 205Thr
Thr Tyr Ser Asn Ser Leu Lys Asp Arg Phe Ser Ile Ser Glu Asp 210
215 220Ser Val Lys Asn Ala Val Tyr Leu Gln Met
Asn Ser Leu Lys Pro Glu225 230 235
240Asp Thr Ala Val Tyr Tyr Cys Ala Ala Val Arg Gln Met Tyr Met
Thr 245 250 255Val Val Pro
Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270455272PRTArtificial SequenceNanobody
sequence 455Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr 20
25 30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly
Lys Glu Arg Glu Phe Val 35 40
45Ala Glu Val Arg Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu Lys 50
55 60Asp Arg Phe Ser Ile Ser Glu Asp Ser
Val Lys Asn Ala Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr
Cys Ala 85 90 95Ala Val
Arg Gln Met Tyr Met Thr Val Val Pro Asp Tyr Trp Gly Gln 100
105 110Gly Thr Leu Val Thr Val Ser Ser Gly
Gly Gly Gly Ser Gly Gly Gly 115 120
125Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
130 135 140Ser Gly Gly Gly Gly Ser Gly
Gly Gly Gly Ser Glu Val Gln Leu Val145 150
155 160Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser
Leu Arg Leu Ser 165 170
175Cys Ala Ala Ser Gly Asp Val His Lys Ile Asn Ile Leu Gly Trp Tyr
180 185 190Arg Gln Ala Pro Ala Lys
Glu Arg Glu Met Val Ala His Ile Thr Ile 195 200
205Gly Asp Ala Thr Ser Tyr Ala Asp Ser Ala Lys Gly Arg Phe
Thr Ile 210 215 220Ser Arg Asp Glu Ala
Lys Asn Met Val Tyr Leu Gln Leu Asn Asn Leu225 230
235 240Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys
Arg Ala Tyr Ser Arg Ile 245 250
255Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser
260 265 270456272PRTArtificial
SequenceNanobody sequence 456Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr
20 25 30Thr Met Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40
45Ala Glu Val Arg Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu
Lys 50 55 60Asp Arg Phe Ser Ile Ser
Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65 70
75 80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala
Val Tyr Tyr Cys Ala 85 90
95Ala Val Arg Gln Met Tyr Met Thr Val Val Pro Asp Tyr Trp Gly Gln
100 105 110Gly Thr Leu Val Thr Val
Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly 115 120
125Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly 130 135 140Ser Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val145 150
155 160Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly Ser Leu Arg Leu Ser 165 170
175Cys Val Ala Ser Gly Asp Val His Lys Ile Asn Phe Leu Gly Trp Tyr
180 185 190Arg Gln Ala Pro Gly
Lys Glu Arg Glu Lys Val Ala His Ile Ser Ile 195
200 205Gly Asp Gln Thr Asp Tyr Ala Asp Ser Ala Lys Gly
Arg Phe Thr Ile 210 215 220Ser Arg Asp
Glu Ser Lys Asn Met Val Tyr Leu Gln Met Asn Ser Leu225
230 235 240Lys Pro Glu Asp Thr Ala Val
Tyr Phe Cys Arg Ala Phe Ser Arg Ile 245
250 255Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 260 265
270457272PRTArtificial SequenceNanobody sequence 457Glu Val Gln Leu Val
Glu Ser Gly Gly Asp Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Asp
Val His Lys Ile Asn 20 25
30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg Glu Met Val
35 40 45Ala His Ile Thr Ile Ala Asp Ala
Thr Asp Tyr Ala Glu Phe Ala Lys 50 55
60Gly Arg Phe Thr Ile Ser Arg Asp Glu Pro Lys Asn Met Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Leu Cys Arg 85
90 95Ala Gly Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp
Gly Gln Gly Thr Leu 100 105
110Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
115 120 125Gly Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly 130 135
140Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val Glu Ser
Gly145 150 155 160Gly Gly
Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Thr Phe
165 170 175Ser Gly Gly Thr Phe Ser Ser
Tyr Thr Met Gly Trp Phe Arg Gln Ala 180 185
190Pro Gly Lys Glu Arg Glu Phe Val Ala Glu Val Arg Trp Gly
Gly Val 195 200 205Thr Thr Tyr Ser
Asn Ser Leu Lys Asp Arg Phe Ser Ile Ser Glu Asp 210
215 220Ser Val Lys Asn Ala Val Tyr Leu Gln Met Asn Ser
Leu Lys Pro Glu225 230 235
240Asp Thr Ala Val Tyr Tyr Cys Ala Ala Val Arg Gln Met Tyr Met Thr
245 250 255Val Val Pro Asp Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270458272PRTArtificial SequenceNanobody sequence
458Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys
Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr 20 25
30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg
Glu Phe Val 35 40 45Ala Glu Val
Arg Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu Lys 50
55 60Asp Arg Phe Ser Ile Ser Glu Asp Ser Val Lys Asn
Ala Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala
85 90 95Ala Val Arg Gln Met Tyr
Met Thr Val Val Pro Asp Tyr Trp Gly Gln 100
105 110Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly
Ser Gly Gly Gly 115 120 125Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly 130
135 140Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Glu Val Gln Leu Val145 150 155
160Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser
165 170 175Cys Ala Ala Ser
Gly Asp Val His Lys Ile Asn Ile Leu Gly Trp Tyr 180
185 190Arg Gln Ala Pro Ala Lys Glu Arg Glu Met Val
Ala His Ile Thr Ile 195 200 205Gly
Asp Ala Thr Asp Tyr Ala Asp Ser Ala Lys Gly Arg Phe Thr Ile 210
215 220Ser Arg Asp Glu Ala Lys Asn Met Val Tyr
Leu Gln Met Asn Ser Leu225 230 235
240Lys Pro Glu Asp Thr Ala Val Tyr Leu Cys Arg Ala Tyr Ser Arg
Ile 245 250 255Tyr Pro Tyr
Asn Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270459272PRTArtificial SequenceNanobody
sequence 459Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr 20
25 30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly
Lys Glu Arg Glu Phe Val 35 40
45Ala Glu Val Arg Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu Lys 50
55 60Asp Arg Phe Ser Ile Ser Glu Asp Ser
Val Lys Asn Ala Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr
Cys Ala 85 90 95Ala Val
Arg Gln Met Tyr Met Thr Val Val Pro Asp Tyr Trp Gly Gln 100
105 110Gly Thr Leu Val Thr Val Ser Ser Gly
Gly Gly Gly Ser Gly Gly Gly 115 120
125Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
130 135 140Ser Gly Gly Gly Gly Ser Gly
Gly Gly Gly Ser Glu Val Gln Leu Val145 150
155 160Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser
Leu Lys Leu Ser 165 170
175Cys Ala Ala Ser Gly Ala Val His Lys Ile Asn Phe Leu Gly Trp Tyr
180 185 190Arg Gln Thr Pro Glu Lys
Glu Arg Glu Met Val Ala Thr Ile Thr Ile 195 200
205Gly Asp Glu Val Asp Tyr Ala Asp Ser Ala Lys Gly Arg Phe
Thr Ile 210 215 220Ser Arg Asp Glu Ala
Lys Asn Met Val Tyr Leu Gln Met Thr Ser Leu225 230
235 240Lys Pro Glu Asp Thr Ala Val Tyr Val Cys
Arg Ala Gly Ser Arg Leu 245 250
255Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser
260 265 270460422PRTArtificial
SequenceNanobody sequence 460Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr
20 25 30Thr Met Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40
45Ala Glu Val Arg Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu
Lys 50 55 60Asp Arg Phe Ser Ile Ser
Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65 70
75 80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala
Val Tyr Tyr Cys Ala 85 90
95Ala Val Arg Gln Met Tyr Met Thr Val Val Pro Asp Tyr Trp Gly Gln
100 105 110Gly Thr Leu Val Thr Val
Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly 115 120
125Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly 130 135 140Ser Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val145 150
155 160Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly Ser Leu Arg Leu Ser 165 170
175Cys Val Ala Ser Gly Asp Val His Lys Ile Asn Phe Leu Gly Trp Tyr
180 185 190Arg Gln Ala Pro Gly
Lys Glu Arg Glu Lys Val Ala His Ile Ser Ile 195
200 205Gly Asp Gln Thr Asp Tyr Ala Asp Ser Ala Lys Gly
Arg Phe Thr Ile 210 215 220Ser Arg Asp
Glu Ser Lys Asn Met Val Tyr Leu Gln Met Asn Ser Leu225
230 235 240Lys Pro Glu Asp Thr Ala Val
Tyr Phe Cys Arg Ala Phe Ser Arg Ile 245
250 255Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 260 265 270Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly 275
280 285Gly Gly Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly 290 295
300Gly Gly Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln305
310 315 320Pro Gly Asn Ser
Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe 325
330 335Ser Ser Phe Gly Met Ser Trp Val Arg Gln
Ala Pro Gly Lys Gly Leu 340 345
350Glu Trp Val Ser Ser Ile Ser Gly Ser Gly Ser Asp Thr Leu Tyr Ala
355 360 365Asp Ser Val Lys Gly Arg Phe
Thr Ile Ser Arg Asp Asn Ala Lys Thr 370 375
380Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala
Val385 390 395 400Tyr Tyr
Cys Thr Ile Gly Gly Ser Leu Ser Arg Ser Ser Gln Gly Thr
405 410 415Leu Val Thr Val Ser Ser
420461422PRTArtificial SequenceNanobody sequence 461Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Thr Phe Ser Gly
Gly Thr Phe Ser Ser Tyr 20 25
30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Glu Val Arg Trp Gly Gly Val
Thr Thr Tyr Ser Asn Ser Leu Lys 50 55
60Asp Arg Phe Ser Ile Ser Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala 85
90 95Ala Val Arg Gln Met Tyr Met Thr Val Val Pro
Asp Tyr Trp Gly Gln 100 105
110Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly
115 120 125Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly 130 135
140Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu
Val145 150 155 160Glu Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser
165 170 175Cys Ile Thr Ser Gly Glu Thr
Phe Lys Ile Asn Ile Trp Gly Trp Tyr 180 185
190Arg Gln Ala Pro Gly Lys Gln Arg Glu Leu Val Ala Ser Leu
Thr Ile 195 200 205Gly Gly Ala Thr
Asn Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile 210
215 220Ser Glu Asp Ser Ala Lys Asn Thr Val Tyr Leu Gln
Met Asn Ser Leu225 230 235
240Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Asn Ala Lys Ser Arg Leu
245 250 255Tyr Pro Tyr Asp Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Gly 275 280 285Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly 290
295 300Gly Gly Ser Glu Val Gln Leu Val Glu Ser Gly
Gly Gly Leu Val Gln305 310 315
320Pro Gly Asn Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe
325 330 335Ser Ser Phe Gly
Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 340
345 350Glu Trp Val Ser Ser Ile Ser Gly Ser Gly Ser
Asp Thr Leu Tyr Ala 355 360 365Asp
Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Thr 370
375 380Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg
Pro Glu Asp Thr Ala Val385 390 395
400Tyr Tyr Cys Thr Ile Gly Gly Ser Leu Ser Arg Ser Ser Gln Gly
Thr 405 410 415Leu Val Thr
Val Ser Ser 420462270PRTArtificial SequenceNanobody sequence
462Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys
Ala Ala Ser Gly Ile Thr Phe Ser Ile Asn 20 25
30Thr Met Gly Trp Tyr Arg Gln Ala Pro Gly Lys Gln Arg
Glu Leu Val 35 40 45Ala Leu Ile
Ser Ser Ile Gly Asp Thr Tyr Tyr Ala Asp Ser Val Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn
Thr Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Lys
85 90 95Arg Phe Arg Thr Ala Ala
Gln Gly Thr Asp Tyr Trp Gly Gln Gly Thr 100
105 110Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly
Gly Gly Gly Ser 115 120 125Gly Gly
Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly 130
135 140Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val
Gln Leu Val Glu Ser145 150 155
160Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Val
165 170 175Ala Ser Gly Asp
Val His Lys Ile Asn Phe Leu Gly Trp Tyr Arg Gln 180
185 190Ala Pro Gly Lys Glu Arg Glu Lys Val Ala His
Ile Ser Ile Gly Asp 195 200 205Gln
Thr Asp Tyr Ala Asp Ser Ala Lys Gly Arg Phe Thr Ile Ser Arg 210
215 220Asp Glu Ser Lys Asn Met Val Tyr Leu Gln
Met Asn Ser Leu Lys Pro225 230 235
240Glu Asp Thr Ala Val Tyr Phe Cys Arg Ala Phe Ser Arg Ile Tyr
Pro 245 250 255Tyr Asp Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270463270PRTArtificial SequenceNanobody sequence
463Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys
Val Ala Ser Gly Asp Val His Lys Ile Asn 20 25
30Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly Lys Glu Arg
Glu Lys Val 35 40 45Ala His Ile
Ser Ile Gly Asp Gln Thr Asp Tyr Ala Asp Ser Ala Lys 50
55 60Gly Arg Phe Thr Ile Ser Arg Asp Glu Ser Lys Asn
Met Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg
85 90 95Ala Phe Ser Arg Ile Tyr
Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu 100
105 110Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Gly 115 120 125Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly 130
135 140Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln
Leu Val Glu Ser Gly145 150 155
160Gly Gly Leu Val Gln Ala Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala
165 170 175Ser Gly Ile Thr
Phe Ser Ile Asn Thr Met Gly Trp Tyr Arg Gln Ala 180
185 190Pro Gly Lys Gln Arg Glu Leu Val Ala Leu Ile
Ser Ser Ile Gly Asp 195 200 205Thr
Tyr Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp 210
215 220Asn Ala Lys Asn Thr Val Tyr Leu Gln Met
Asn Ser Leu Lys Pro Glu225 230 235
240Asp Thr Ala Val Tyr Tyr Cys Lys Arg Phe Arg Thr Ala Ala Gln
Gly 245 250 255Thr Asp Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270464439PRTArtificial SequenceNanobody sequence
464Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys
Ala Ala Ser Gly Arg Thr Phe Ser Ser Tyr 20 25
30Val Met Gly Trp Phe Arg Gln Ala Thr Gly Lys Glu Arg
Glu Phe Val 35 40 45Ala Thr Ile
Ala Trp Asp Ser Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50
55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys
Asn Thr Val His65 70 75
80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Ala Ser Tyr Asn Val
Tyr Tyr Asn Asn Tyr Tyr Tyr Pro Ile Ser 100
105 110Arg Asp Glu Tyr Asp Tyr Trp Gly Gln Gly Thr Leu
Val Thr Val Ser 115 120 125Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser 130
135 140Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
Gly Gly Gly Ser Gly145 150 155
160Gly Gly Gly Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly Ser Val
165 170 175Gln Ala Gly Gly
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Asp Thr 180
185 190Tyr Gly Ser Tyr Trp Met Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu 195 200 205Arg
Glu Gly Val Ala Ala Ile Asn Arg Gly Gly Gly Tyr Thr Val Tyr 210
215 220Ala Asp Ser Val Lys Gly Arg Phe Thr Ile
Ser Arg Asp Thr Ala Lys225 230 235
240Asn Thr Val Tyr Leu Gln Met Asn Ser Leu Arg Pro Asp Asp Thr
Ala 245 250 255Asp Tyr Tyr
Cys Ala Ala Ser Gly Val Leu Gly Gly Leu His Glu Asp 260
265 270Trp Phe Asn Tyr Trp Gly Gln Gly Thr Leu
Val Thr Val Ser Ser Gly 275 280
285Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly 290
295 300Gly Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly305 310
315 320Gly Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro 325 330
335Gly Gly Ser Leu Arg Leu Ser Cys Val Ala Ser Gly Asp Val His Lys
340 345 350Ile Asn Phe Leu Gly Trp
Tyr Arg Gln Ala Pro Gly Lys Glu Arg Glu 355 360
365Lys Val Ala His Ile Ser Ile Gly Asp Gln Thr Asp Tyr Ala
Asp Ser 370 375 380Ala Lys Gly Arg Phe
Thr Ile Ser Arg Asp Glu Ser Lys Asn Met Val385 390
395 400Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu
Asp Thr Ala Val Tyr Phe 405 410
415Cys Arg Ala Phe Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly
420 425 430Thr Leu Val Thr Val
Ser Ser 435465443PRTArtificial SequenceNanobody sequence 465Glu
Val Gln Leu Val Glu Ser Gly Gly Gly Ser Val Gln Ala Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys Ala
Ala Ser Gly Tyr Thr Ile Gly Pro Tyr 20 25
30Cys Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu
Gly Val 35 40 45Ala Ala Ile Asn
Met Gly Gly Gly Ile Thr Tyr Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Gln Asp Asn Ala Lys Asn
Thr Val Tyr65 70 75
80Leu Leu Met Asn Ser Leu Glu Pro Glu Asp Thr Ala Ile Tyr Tyr Cys
85 90 95Ala Ala Asp Ser Thr Ile
Tyr Ala Ser Tyr Tyr Glu Cys Gly His Gly 100
105 110Leu Ser Thr Gly Gly Tyr Gly Tyr Asp Ser Trp Gly
Gln Gly Thr Leu 115 120 125Val Thr
Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly 130
135 140Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Gly Gly145 150 155
160Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val Glu Ser Gly
165 170 175Gly Gly Ser Val
Gln Ala Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala 180
185 190Ser Gly Asp Thr Tyr Gly Ser Tyr Trp Met Gly
Trp Phe Arg Gln Ala 195 200 205Pro
Gly Lys Glu Arg Glu Gly Val Ala Ala Ile Asn Arg Gly Gly Gly 210
215 220Tyr Thr Val Tyr Ala Asp Ser Val Lys Gly
Arg Phe Thr Ile Ser Arg225 230 235
240Asp Thr Ala Lys Asn Thr Val Tyr Leu Gln Met Asn Ser Leu Arg
Pro 245 250 255Asp Asp Thr
Ala Asp Tyr Tyr Cys Ala Ala Ser Gly Val Leu Gly Gly 260
265 270Leu His Glu Asp Trp Phe Asn Tyr Trp Gly
Gln Gly Thr Leu Val Thr 275 280
285Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly 290
295 300Gly Ser Gly Gly Gly Gly Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly305 310
315 320Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val Glu
Ser Gly Gly Gly 325 330
335Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Val Ala Ser Gly
340 345 350Asp Val His Lys Ile Asn
Phe Leu Gly Trp Tyr Arg Gln Ala Pro Gly 355 360
365Lys Glu Arg Glu Lys Val Ala His Ile Ser Ile Gly Asp Gln
Thr Asp 370 375 380Tyr Ala Asp Ser Ala
Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu Ser385 390
395 400Lys Asn Met Val Tyr Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr 405 410
415Ala Val Tyr Phe Cys Arg Ala Phe Ser Arg Ile Tyr Pro Tyr Asp Tyr
420 425 430Trp Gly Gln Gly Thr
Leu Val Thr Val Ser Ser 435 440466449PRTArtificial
SequenceNanobody sequence 466Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Ala Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Thr Phe Ser Ser Tyr
20 25 30Val Met Gly Trp Phe Arg Gln
Ala Thr Gly Lys Glu Arg Glu Phe Val 35 40
45Ala Thr Ile Ala Trp Asp Ser Gly Ser Thr Tyr Tyr Ala Asp Ser
Val 50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ala Lys Asn Thr Val His65 70
75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr
Ala Val Tyr Tyr Cys 85 90
95Ala Ala Ser Tyr Asn Val Tyr Tyr Asn Asn Tyr Tyr Tyr Pro Ile Ser
100 105 110Arg Asp Glu Tyr Asp Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser 115 120
125Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly
Gly Ser 130 135 140Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly145 150
155 160Gly Gly Gly Ser Glu Val Gln Leu Val Glu
Ser Gly Gly Gly Ser Val 165 170
175Gln Ala Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Tyr Thr
180 185 190Ile Gly Pro Tyr Cys
Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu 195
200 205Arg Glu Gly Val Ala Ala Ile Asn Met Gly Gly Gly
Ile Thr Tyr Tyr 210 215 220Ala Asp Ser
Val Lys Gly Arg Phe Thr Ile Ser Gln Asp Asn Ala Lys225
230 235 240Asn Thr Val Tyr Leu Leu Met
Asn Ser Leu Glu Pro Glu Asp Thr Ala 245
250 255Ile Tyr Tyr Cys Ala Ala Asp Ser Thr Ile Tyr Ala
Ser Tyr Tyr Glu 260 265 270Cys
Gly His Gly Leu Ser Thr Gly Gly Tyr Gly Tyr Asp Ser Trp Gly 275
280 285Gln Gly Thr Leu Val Thr Val Ser Ser
Gly Gly Gly Gly Ser Gly Gly 290 295
300Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly305
310 315 320Gly Ser Gly Gly
Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu 325
330 335Val Glu Ser Gly Gly Gly Leu Val Gln Pro
Gly Gly Ser Leu Arg Leu 340 345
350Ser Cys Val Ala Ser Gly Asp Val His Lys Ile Asn Phe Leu Gly Trp
355 360 365Tyr Arg Gln Ala Pro Gly Lys
Glu Arg Glu Lys Val Ala His Ile Ser 370 375
380Ile Gly Asp Gln Thr Asp Tyr Ala Asp Ser Ala Lys Gly Arg Phe
Thr385 390 395 400Ile Ser
Arg Asp Glu Ser Lys Asn Met Val Tyr Leu Gln Met Asn Ser
405 410 415Leu Lys Pro Glu Asp Thr Ala
Val Tyr Phe Cys Arg Ala Phe Ser Arg 420 425
430Ile Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr
Val Ser 435 440
445Ser467422PRTArtificial SequenceNanobody sequence 467Asp Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Thr Phe Ser Gly
Gly Thr Phe Ser Ser Tyr 20 25
30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Glu Val Arg Trp Gly Gly Val
Thr Thr Tyr Ser Asn Ser Leu Lys 50 55
60Asp Arg Phe Ser Ile Ser Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65
70 75 80Gln Met Asn Ser Leu
Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala 85
90 95Ala Val Arg Gln Met Tyr Met Thr Val Val Pro
Asp Tyr Trp Gly Gln 100 105
110Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly
115 120 125Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly 130 135
140Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu
Val145 150 155 160Glu Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser
165 170 175Cys Ala Ala Ser Gly Asp Val
His Lys Ile Asn Ile Leu Gly Trp Tyr 180 185
190Arg Gln Ala Pro Ala Lys Glu Arg Glu Met Val Ala His Ile
Thr Ile 195 200 205Gly Asp Ala Thr
Asp Tyr Ala Asp Ser Ala Lys Gly Arg Phe Thr Ile 210
215 220Ser Arg Asp Glu Ala Lys Asn Met Val Tyr Leu Gln
Met Asn Ser Leu225 230 235
240Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg Ala Tyr Ser Arg Ile
245 250 255Tyr Pro Tyr Asn Tyr
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Gly 275 280 285Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly 290
295 300Gly Gly Ser Glu Val Gln Leu Val Glu Ser Gly
Gly Gly Leu Val Gln305 310 315
320Pro Gly Asn Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe
325 330 335Ser Ser Phe Gly
Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 340
345 350Glu Trp Val Ser Ser Ile Ser Gly Ser Gly Ser
Asp Thr Leu Tyr Ala 355 360 365Asp
Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Thr 370
375 380Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg
Pro Glu Asp Thr Ala Val385 390 395
400Tyr Tyr Cys Thr Ile Gly Gly Ser Leu Ser Arg Ser Ser Gln Gly
Thr 405 410 415Leu Val Thr
Val Ser Ser 420468272PRTArtificial SequenceNanobody sequence
468Asp Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys
Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr 20 25
30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg
Glu Phe Val 35 40 45Ala Glu Val
Arg Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu Lys 50
55 60Asp Arg Phe Ser Ile Ser Glu Asp Ser Val Lys Asn
Ala Val Tyr Leu65 70 75
80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Ala
85 90 95Ala Val Arg Gln Met Tyr
Met Thr Val Val Pro Asp Tyr Trp Gly Gln 100
105 110Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly
Ser Gly Gly Gly 115 120 125Gly Ser
Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly 130
135 140Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Glu Val Gln Leu Val145 150 155
160Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser
165 170 175Cys Val Ala Ser
Gly Asp Val His Lys Ile Asn Phe Leu Gly Trp Tyr 180
185 190Arg Gln Ala Pro Gly Lys Glu Arg Glu Lys Val
Ala His Ile Ser Ile 195 200 205Gly
Asp Gln Thr Asp Tyr Ala Asp Ser Ala Lys Gly Arg Phe Thr Ile 210
215 220Ser Arg Asp Glu Ser Lys Asn Met Val Tyr
Leu Gln Met Asn Ser Leu225 230 235
240Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys Arg Ala Phe Ser Arg
Ile 245 250 255Tyr Pro Tyr
Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 260
265 270469429PRTArtificial SequenceNanobody
sequence 469Asp Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly
Asp1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Arg Thr Phe Ser Ser Tyr 20
25 30Ala Met Gly Trp Phe Arg Gln Ala Pro Gly
Lys Glu Arg Glu Phe Val 35 40
45Ala Ala Ile Ser Trp Ser Asp Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50
55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp
Asn Ala Lys Asn Thr Val Tyr65 70 75
80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr
Tyr Cys 85 90 95Ala Ala
Asp Leu Thr Ser Thr Asn Pro Gly Ser Tyr Ile Tyr Ile Trp 100
105 110Ala Tyr Asp Tyr Trp Gly Gln Gly Thr
Gln Val Thr Val Ser Ser Gly 115 120
125Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
130 135 140Gly Gly Ser Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Gly Gly Gly145 150
155 160Gly Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro 165 170
175Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Asp Val His Lys
180 185 190Ile Asn Ile Leu Gly Trp
Tyr Arg Gln Ala Pro Ala Lys Glu Arg Glu 195 200
205Met Val Ala His Ile Thr Ile Gly Asp Ala Thr Asp Tyr Ala
Asp Ser 210 215 220Ala Lys Gly Arg Phe
Thr Ile Ser Arg Asp Glu Ala Lys Asn Met Val225 230
235 240Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu
Asp Thr Ala Val Tyr Phe 245 250
255Cys Arg Ala Tyr Ser Arg Ile Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly
260 265 270Thr Leu Val Thr Val
Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly 275
280 285Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
Gly Gly Gly Ser 290 295 300Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val Glu305
310 315 320Ser Gly Gly Gly Leu Val Gln
Pro Gly Asn Ser Leu Arg Leu Ser Cys 325
330 335Ala Ala Ser Gly Phe Thr Phe Ser Ser Phe Gly Met
Ser Trp Val Arg 340 345 350Gln
Ala Pro Gly Lys Gly Leu Glu Trp Val Ser Ser Ile Ser Gly Ser 355
360 365Gly Ser Asp Thr Leu Tyr Ala Asp Ser
Val Lys Gly Arg Phe Thr Ile 370 375
380Ser Arg Asp Asn Ala Lys Thr Thr Leu Tyr Leu Gln Met Asn Ser Leu385
390 395 400Arg Pro Glu Asp
Thr Ala Val Tyr Tyr Cys Thr Ile Gly Gly Ser Leu 405
410 415Ser Arg Ser Ser Gln Gly Thr Leu Val Thr
Val Ser Ser 420 425470272PRTArtificial
SequenceNanobody sequence 470Asp Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Thr Phe Ser Gly Gly Thr Phe Ser Ser Tyr
20 25 30Thr Met Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40
45Ala Glu Val Arg Trp Gly Gly Val Thr Thr Tyr Ser Asn Ser Leu
Lys 50 55 60Asp Arg Phe Ser Ile Ser
Glu Asp Ser Val Lys Asn Ala Val Tyr Leu65 70
75 80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala
Val Tyr Tyr Cys Ala 85 90
95Ala Val Arg Gln Met Tyr Met Thr Val Val Pro Asp Tyr Trp Gly Gln
100 105 110Gly Thr Leu Val Thr Val
Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly 115 120
125Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly 130 135 140Ser Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Glu Val Gln Leu Val145 150
155 160Glu Ser Gly Gly Gly Leu Val Gln Pro Gly
Gly Ser Leu Arg Leu Ser 165 170
175Cys Ala Ala Ser Gly Asp Val His Lys Ile Asn Ile Leu Gly Trp Tyr
180 185 190Arg Gln Ala Pro Ala
Lys Glu Arg Glu Met Val Ala His Ile Thr Ile 195
200 205Gly Asp Ala Thr Asp Tyr Ala Asp Ser Ala Lys Gly
Arg Phe Thr Ile 210 215 220Ser Arg Asp
Glu Ala Lys Asn Met Val Tyr Leu Gln Met Asn Ser Leu225
230 235 240Lys Pro Glu Asp Thr Ala Val
Tyr Phe Cys Arg Ala Tyr Ser Arg Ile 245
250 255Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly Thr Leu Val
Thr Val Ser Ser 260 265
270471279PRTArtificial SequenceNanobody sequence 471Asp Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Asp1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg
Thr Phe Ser Ser Tyr 20 25
30Ala Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Ala Ile Ser Trp Ser Asp Gly
Ser Thr Tyr Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr65
70 75 80Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85
90 95Ala Ala Asp Leu Thr Ser Thr Asn Pro Gly Ser
Tyr Ile Tyr Ile Trp 100 105
110Ala Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser Gly
115 120 125Gly Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly 130 135
140Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly145 150 155 160Gly Ser
Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro
165 170 175Gly Gly Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly Asp Val His Lys 180 185
190Ile Asn Ile Leu Gly Trp Tyr Arg Gln Ala Pro Ala Lys Glu
Arg Glu 195 200 205Met Val Ala His
Ile Thr Ile Gly Asp Ala Thr Asp Tyr Ala Asp Ser 210
215 220Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp Glu Ala
Lys Asn Met Val225 230 235
240Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe
245 250 255Cys Arg Ala Tyr Ser
Arg Ile Tyr Pro Tyr Asn Tyr Trp Gly Gln Gly 260
265 270Thr Leu Val Thr Val Ser Ser
27547210PRTArtificial SequenceCDR1 472Gly Phe Thr Phe Ser Ser Phe Gly Met
Ser1 5 1047310PRTArtificial SequenceCDR1
473Gly Phe Thr Phe Arg Ser Phe Gly Met Ser1 5
1047410PRTArtificial SequenceCDR2 474Ser Ile Ser Gly Ser Gly Ser Asp
Thr Leu1 5 104756PRTArtificial
SequenceCDR3 475Gly Gly Ser Leu Ser Arg1 5476110PRTHomo
sapiens 476Asn Ala Gly Val Thr Gln Thr Pro Lys Phe Arg Ile Leu Lys Ile
Gly1 5 10 15Gln Ser Met
Thr Leu Gln Cys Thr Gln Asp Met Asn His Asn Tyr Met 20
25 30Tyr Trp Tyr Arg Gln Asp Pro Gly Met Gly
Leu Lys Leu Ile Tyr Tyr 35 40
45Ser Val Gly Ala Gly Ile Thr Asp Lys Gly Glu Val Pro Asn Gly Tyr 50
55 60Asn Val Ser Arg Ser Thr Thr Glu Asp
Phe Pro Leu Arg Leu Glu Leu65 70 75
80Ala Ala Pro Ser Gln Thr Ser Val Tyr Phe Cys Ala Ser Thr
Tyr His 85 90 95Gly Thr
Gly Tyr Phe Gly Glu Gly Ser Trp Leu Thr Val Val 100
105 110477112PRTHomo sapiens 477Asp Gly Gly Ile Thr
Gln Ser Pro Lys Tyr Leu Phe Arg Lys Glu Gly1 5
10 15Gln Asn Val Thr Leu Ser Cys Glu Gln Asn Leu
Asn His Asp Ala Met 20 25
30Tyr Trp Tyr Arg Gln Asp Pro Gly Gln Gly Leu Arg Leu Ile Tyr Tyr
35 40 45Ser Gln Ile Val Asn Asp Phe Gln
Lys Gly Asp Ile Ala Glu Gly Tyr 50 55
60Ser Val Ser Arg Glu Lys Lys Glu Ser Phe Pro Leu Thr Val Thr Ser65
70 75 80Ala Gln Lys Asn Pro
Thr Ala Phe Tyr Leu Cys Ala Ser Ser Ser Arg 85
90 95Ser Ser Tyr Glu Gln Tyr Phe Gly Pro Gly Thr
Arg Leu Thr Val Thr 100 105
110478114PRTHomo sapiens 478Val Val Ser Gln His Pro Ser Trp Val Ile Ala
Lys Ser Gly Thr Ser1 5 10
15Val Lys Ile Glu Cys Arg Ser Leu Asp Phe Gln Ala Thr Thr Met Phe
20 25 30Trp Tyr Arg Gln Phe Pro Lys
Gln Ser Leu Met Leu Met Ala Thr Ser 35 40
45Asn Glu Gly Ser Lys Ala Thr Tyr Glu Gln Gly Val Glu Lys Asp
Lys 50 55 60Phe Leu Ile Asn His Ala
Ser Leu Thr Leu Ser Thr Leu Thr Val Thr65 70
75 80Ser Ala His Pro Glu Asp Ser Ser Phe Tyr Ile
Cys Ser Ala Arg Gly 85 90
95Gly Ser Tyr Asn Ser Pro Leu His Phe Gly Asn Gly Thr Arg Leu Thr
100 105 110Val Thr47996PRTHomo
sapiens 479Pro Asn Ile Gln Asn Pro Asp Pro Ala Val Tyr Gln Leu Arg Asp
Ser1 5 10 15Lys Ser Ser
Asp Lys Ser Val Cys Leu Phe Thr Asp Phe Asp Ser Gln 20
25 30Thr Asn Val Ser Gln Ser Lys Asp Ser Asp
Val Tyr Ile Thr Asp Lys 35 40
45Thr Val Leu Asp Met Arg Ser Met Asp Phe Lys Ser Asn Ser Ala Val 50
55 60Ala Trp Ser Asn Lys Ser Asp Phe Ala
Cys Ala Asn Ala Phe Asn Asn65 70 75
80Ser Ile Ile Pro Glu Asp Thr Phe Phe Pro Ser Pro Glu Ser
Ser Cys 85 90
95480131PRTHomo sapiens 480Glu Asp Leu Asn Lys Val Phe Pro Pro Glu Val
Ala Val Phe Glu Pro1 5 10
15Ser Glu Ala Glu Ile Ser His Thr Gln Lys Ala Thr Leu Val Cys Leu
20 25 30Ala Thr Gly Phe Phe Pro Asp
His Val Glu Leu Ser Trp Trp Val Asn 35 40
45Gly Lys Glu Val His Ser Gly Val Ser Thr Asp Pro Gln Pro Leu
Lys 50 55 60Glu Gln Pro Ala Leu Asn
Asp Ser Arg Tyr Cys Leu Ser Ser Arg Leu65 70
75 80Arg Val Ser Ala Thr Phe Trp Gln Asn Pro Arg
Asn His Phe Arg Cys 85 90
95Gln Val Gln Phe Tyr Gly Leu Ser Glu Asn Asp Glu Trp Thr Gln Asp
100 105 110Arg Ala Lys Pro Val Thr
Gln Ile Val Ser Ala Glu Ala Trp Gly Arg 115 120
125Ala Asp Cys 1304815PRTArtificial SequenceCDR1 481Ser
Phe Gly Met Ser1 548217PRTArtificial SequenceCDR2 482Ser
Ile Ser Gly Ser Gly Ser Asp Thr Leu Tyr Ala Asp Ser Val Lys1
5 10 15Gly48398PRTArtificial
SequenceNanobody sequence 483Gln Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10
15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Leu Asp Tyr Tyr
20 25 30Ala Ile Gly Trp Phe Arg Gln
Ala Pro Gly Lys Glu Arg Glu Gly Val 35 40
45Ser Cys Ile Ser Ser Ser Asp Gly Ser Thr Tyr Tyr Ala Asp Ser
Val 50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr65 70
75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr
Ala Val Tyr Tyr Cys 85 90
95Ala Ala484142PRTHomo sapiens 484Pro Asn Ile Gln Asn Pro Asp Pro Ala
Val Tyr Gln Leu Arg Asp Ser1 5 10
15Lys Ser Ser Asp Lys Ser Val Cys Leu Phe Thr Asp Phe Asp Ser
Gln 20 25 30Thr Asn Val Ser
Gln Ser Lys Asp Ser Asp Val Tyr Ile Thr Asp Lys 35
40 45Thr Val Leu Asp Met Arg Ser Met Asp Phe Lys Ser
Asn Ser Ala Val 50 55 60Ala Trp Ser
Asn Lys Ser Asp Phe Ala Cys Ala Asn Ala Phe Asn Asn65 70
75 80Ser Ile Ile Pro Glu Asp Thr Phe
Phe Pro Ser Pro Glu Ser Ser Cys 85 90
95Asp Val Lys Leu Val Glu Lys Ser Phe Glu Thr Asp Thr Asn
Leu Asn 100 105 110Phe Gln Asn
Leu Ser Val Ile Gly Phe Arg Ile Leu Leu Leu Lys Val 115
120 125Ala Gly Phe Asn Leu Leu Met Thr Leu Arg Leu
Trp Ser Ser 130 135 140485177PRTHomo
sapiens 485Glu Asp Leu Asn Lys Val Phe Pro Pro Glu Val Ala Val Phe Glu
Pro1 5 10 15Ser Glu Ala
Glu Ile Ser His Thr Gln Lys Ala Thr Leu Val Cys Leu 20
25 30Ala Thr Gly Phe Phe Pro Asp His Val Glu
Leu Ser Trp Trp Val Asn 35 40
45Gly Lys Glu Val His Ser Gly Val Ser Thr Asp Pro Gln Pro Leu Lys 50
55 60Glu Gln Pro Ala Leu Asn Asp Ser Arg
Tyr Cys Leu Ser Ser Arg Leu65 70 75
80Arg Val Ser Ala Thr Phe Trp Gln Asn Pro Arg Asn His Phe
Arg Cys 85 90 95Gln Val
Gln Phe Tyr Gly Leu Ser Glu Asn Asp Glu Trp Thr Gln Asp 100
105 110Arg Ala Lys Pro Val Thr Gln Ile Val
Ser Ala Glu Ala Trp Gly Arg 115 120
125Ala Asp Cys Gly Phe Thr Ser Val Ser Tyr Gln Gln Gly Val Leu Ser
130 135 140Ala Thr Ile Leu Tyr Glu Ile
Leu Leu Gly Lys Ala Thr Leu Tyr Ala145 150
155 160Val Leu Val Ser Ala Leu Val Leu Met Ala Met Val
Lys Arg Lys Asp 165 170
175Phe486623PRTArtificial SequenceNanobody sequence 486Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Arg Thr Phe Ser Ser Tyr 20 25
30Val Met Gly Trp Phe Arg Gln Ala Thr Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Thr Ile Ala Trp Asp Ser Gly
Ser Thr Tyr Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val His65
70 75 80Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85
90 95Ala Ala Ser Tyr Asn Val Tyr Tyr Asn Asn Tyr
Tyr Tyr Pro Ile Ser 100 105
110Arg Asp Glu Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser
115 120 125Ser Gly Gly Gly Gly Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser 130 135
140Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Gly145 150 155 160Gly Gly
Gly Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly Ser Val
165 170 175Gln Ala Gly Gly Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Asp Thr 180 185
190Tyr Gly Ser Tyr Trp Met Gly Trp Phe Arg Gln Ala Pro Gly
Lys Glu 195 200 205Arg Glu Gly Val
Ala Ala Ile Asn Arg Gly Gly Gly Tyr Thr Val Tyr 210
215 220Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg
Asp Thr Ala Lys225 230 235
240Asn Thr Val Tyr Leu Gln Met Asn Ser Leu Arg Pro Asp Asp Thr Ala
245 250 255Asp Tyr Tyr Cys Ala
Ala Ser Gly Val Leu Gly Gly Leu His Glu Asp 260
265 270Trp Phe Asn Tyr Trp Gly Gln Gly Thr Leu Val Thr
Val Ser Ser Gly 275 280 285Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly 290
295 300Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly305 310 315
320Gly Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro
325 330 335Gly Gly Ser Leu
Arg Leu Ser Cys Val Ala Ser Gly Asp Val His Lys 340
345 350Ile Asn Phe Leu Gly Trp Tyr Arg Gln Ala Pro
Gly Lys Glu Arg Glu 355 360 365Lys
Val Ala His Ile Ser Ile Gly Asp Gln Thr Asp Tyr Ala Asp Ser 370
375 380Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp
Glu Ser Lys Asn Met Val385 390 395
400Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr
Phe 405 410 415Cys Arg Ala
Phe Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly 420
425 430Thr Leu Val Thr Val Ser Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly 435 440
445Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser 450
455 460Gly Gly Gly Gly Ser Gly Gly Gly
Gly Ser Glu Val Gln Leu Val Glu465 470
475 480Ser Gly Gly Gly Leu Val Gln Pro Gly Asn Ser Leu
Arg Leu Ser Cys 485 490
495Ala Ala Ser Gly Phe Thr Phe Ser Ser Phe Gly Met Ser Trp Val Arg
500 505 510Gln Ala Pro Gly Lys Gly
Leu Glu Trp Val Ser Ser Ile Ser Gly Ser 515 520
525Gly Ser Asp Thr Leu Tyr Ala Asp Ser Val Lys Gly Arg Phe
Thr Ile 530 535 540Ser Arg Asp Asn Ala
Lys Thr Thr Leu Tyr Leu Gln Met Asn Ser Leu545 550
555 560Arg Pro Glu Asp Thr Ala Val Tyr Tyr Cys
Thr Ile Gly Gly Ser Leu 565 570
575Ser Arg Ser Ser Gln Gly Thr Leu Val Thr Val Ser Ser Gly Ala Ala
580 585 590Asp Tyr Lys Asp His
Asp Gly Asp Tyr Lys Asp His Asp Ile Asp Tyr 595
600 605Lys Asp Asp Asp Asp Lys Gly Ala Ala His His His
His His His 610 615
620487589PRTArtificial SequenceNanobody sequence 487Glu Val Gln Leu Val
Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg
Thr Phe Ser Ser Tyr 20 25
30Val Met Gly Trp Phe Arg Gln Ala Thr Gly Lys Glu Arg Glu Phe Val
35 40 45Ala Thr Ile Ala Trp Asp Ser Gly
Ser Thr Tyr Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val His65
70 75 80Leu Gln Met Asn Ser
Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85
90 95Ala Ala Ser Tyr Asn Val Tyr Tyr Asn Asn Tyr
Tyr Tyr Pro Ile Ser 100 105
110Arg Asp Glu Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser
115 120 125Ser Gly Gly Gly Gly Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser 130 135
140Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Gly145 150 155 160Gly Gly
Gly Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly Ser Val
165 170 175Gln Ala Gly Gly Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Asp Thr 180 185
190Tyr Gly Ser Tyr Trp Met Gly Trp Phe Arg Gln Ala Pro Gly
Lys Glu 195 200 205Arg Glu Gly Val
Ala Ala Ile Asn Arg Gly Gly Gly Tyr Thr Val Tyr 210
215 220Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg
Asp Thr Ala Lys225 230 235
240Asn Thr Val Tyr Leu Gln Met Asn Ser Leu Arg Pro Asp Asp Thr Ala
245 250 255Asp Tyr Tyr Cys Ala
Ala Ser Gly Val Leu Gly Gly Leu His Glu Asp 260
265 270Trp Phe Asn Tyr Trp Gly Gln Gly Thr Leu Val Thr
Val Ser Ser Gly 275 280 285Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly 290
295 300Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly305 310 315
320Gly Ser Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro
325 330 335Gly Gly Ser Leu
Arg Leu Ser Cys Val Ala Ser Gly Asp Val His Lys 340
345 350Ile Asn Phe Leu Gly Trp Tyr Arg Gln Ala Pro
Gly Lys Glu Arg Glu 355 360 365Lys
Val Ala His Ile Ser Ile Gly Asp Gln Thr Asp Tyr Ala Asp Ser 370
375 380Ala Lys Gly Arg Phe Thr Ile Ser Arg Asp
Glu Ser Lys Asn Met Val385 390 395
400Tyr Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr
Phe 405 410 415Cys Arg Ala
Phe Ser Arg Ile Tyr Pro Tyr Asp Tyr Trp Gly Gln Gly 420
425 430Thr Leu Val Thr Val Ser Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly 435 440
445Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser 450
455 460Gly Gly Gly Gly Ser Gly Gly Gly
Gly Ser Glu Val Gln Leu Val Glu465 470
475 480Ser Gly Gly Gly Leu Val Gln Pro Gly Asn Ser Leu
Arg Leu Ser Cys 485 490
495Ala Ala Ser Gly Phe Thr Phe Ser Ser Phe Gly Met Ser Trp Val Arg
500 505 510Gln Ala Pro Gly Lys Gly
Leu Glu Trp Val Ser Ser Ile Ser Gly Ser 515 520
525Gly Ser Asp Thr Leu Tyr Ala Asp Ser Val Lys Gly Arg Phe
Thr Ile 530 535 540Ser Arg Asp Asn Ala
Lys Thr Thr Leu Tyr Leu Gln Met Asn Ser Leu545 550
555 560Arg Pro Glu Asp Thr Ala Val Tyr Tyr Cys
Thr Ile Gly Gly Ser Leu 565 570
575Ser Arg Ser Ser Gln Gly Thr Leu Val Thr Val Ser Ser
580 585
User Contributions:
Comment about this patent or add new information about this topic: