Patents - stay tuned to the technology

Inventors list

Assignees list

Classification tree browser

Top 100 Inventors

Top 100 Assignees

Patent application title: METHODS AND ORGANISM WITH INCREASED XYLOSE UPTAKE

Inventors:
IPC8 Class: AC12P718FI
USPC Class: 1 1
Class name:
Publication date: 2021-07-22
Patent application number: 20210222210



Abstract:

Provided herein are novel xylose transporters and their variants, as well as nucleic acid encoding the novel xylose transporters and their variants. Provided herein are also non-naturally occurring microbial organisms having increased xylose uptake and increased production of bioderived compounds using xylose as a substrate, as well as methods to make and use these microbial organisms.

Claims:

1. A non-naturally occurring microbial organism comprising at least one exogenous nucleic acid encoding a xylose transporter, wherein said xylose transporter has an amino acid sequence that is at least 89% identical to a Metschnikowia xylose transporter.

2. The non-naturally occurring microbial organism of claim 1, comprising exogenous nucleic acids encoding at least two, at least three, at least four, at least five, at least six, or at least seven xylose transporters.

3. The non-naturally occurring microbial organism of claim 1, wherein said xylose transporter has an amino acid sequence that is at least 90%, at least 95%, at least 98%, or at least 99%, identical to said Metschnikowia xylose transporter.

4. The non-naturally occurring microbial organism of claim 1, wherein said xylose transporter is a Metschnikowia xylose transporter.

5. The non-naturally occurring microbial organism of claim 1, wherein said Metschnikowia xylose transporter is selected from the group consisting of Xyt1p, Gxf1p, .DELTA.Gxf1p, Gxf2p/Gal2p, Gxs1p/Hgt12p, .DELTA.Gxs1p/.DELTA.Hgt12p, Hxt5p, Hxt2.6p, Qup2p, and Aps1p/Hgt19p.

6. The non-naturally occurring microbial organism of claim 1, wherein said Metschnikowia xylose transporter is from a H0 Metschnikowia sp.

7. The non-naturally occurring microbial organism of claim 1, wherein said Metschnikowia xylose transporter has an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-5 and 7-12.

8. The non-naturally occurring microbial organism of claim 1, wherein said microbial organism comprising an exogenous nucleic acid is selected from the group consisting of SEQ ID NOs: 13-17 and 19-27.

9. The non-naturally occurring microbial organism of claim 7, wherein said microbial organism has at least one exogenous nucleic acid encoding: (a) SEQ ID NO:1; or (b) SEQ ID NO: 12.

10. (canceled)

11. The non-naturally occurring microbial organism of claim 1, wherein said xylose transporter is ubiquitin-deficient.

12-13. (canceled)

14. The non-naturally occurring microbial organism of claim 1, wherein said exogenous nucleic acid is codon-optimized to produce said xylose transporter in said microbial organism.

15. A non-naturally occurring microbial organism comprising at least one exogenous nucleic acid encoding a xylose transporter, wherein said xylose transporter has an amino acid sequence that is: (a) at least 74% identical to Xyt1p of a Metschnikowia species; (b) at least 85% identical to Gxf1p of a Metschnikowia species; (c) at least 89% identical to a .DELTA.Gxf1p of a Metschnikowia species; (d) at least 71% identical to a Gxf2p/Gal2p of a Metschnikowia species; (e) at least 71% identical to a Gxs1p/Hgt12p of a Metschnikowia species; (f) at least 60% identical to a Hxt5p of a Metschnikowia species; (g) at least 84% identical to a Hxt2.6p of a Metschnikowia species; (h) at least 50% identical to a Qup2p of a Metschnikowia species; or (i) at least 74% identical to a Aps1p/Hgt19p of a Metschnikowia species.

16-24. (canceled)

25. The non-naturally occurring microbial organism of claim 1, wherein said at least one exogenous nucleic acid is a heterologous nucleic acid.

26. The non-naturally occurring microbial organism of claim 1, wherein said microbial organism is in an aerobic culture medium.

27. The non-naturally occurring microbial organism of claim 1, wherein said microbial organism is in a substantially anaerobic culture medium.

28. The non-naturally occurring microbial organism of claim 1, wherein the microbial organism is a species of bacteria or yeast.

29-30. (canceled)

31. The non-naturally occurring Saccharomyces cerevisiae of claim 30 having at least one exogenous nucleic acid encoding (a) SEQ ID NO:1; (b) SEQ ID NO: 12; (c) SEQ ID NO:21; or (d) SEQ ID NO:27.

32-35. (canceled)

36. The non-naturally occurring microbial organism of claim 1, wherein said microbial organism further comprises a metabolic pathway capable of producing a bioderived compound from xylose, wherein said bioderived compound is selected from the group consisting of xylitol, ethanol, n-butanol, isobutanol, isopropanol, arabitol, ethyl acetate, phenyl-ethyl alcohol, 2-methyl-butanol, and 3-methyl-butanol.

37. (canceled)

38. A method of producing a bioderived compound comprising: culturing the non-naturally occurring microbial organism of claim 36 under conditions and for a sufficient period of time to produce said bioderived compound, and wherein said microbial organism comprises a pathway capable of producing the bioderived compound from xylose.

39. The method of claim 38, wherein the conditions comprise culturing the microbial organism in medium comprising xylose and a co-substrate selected from the group consisting of cellobiose, hemicellulose, glycerol, galactose, and glucose, or a combination thereof.

40-48. (canceled)

Description:

CROSS-REFERENCE TO RELATED APPLICATION

[0001] This application is a continuation application of U.S. application Ser. No. 15/849,191, filed Dec. 20, 2017, which claims the benefit of priority of U.S. Provisional Application No. 62/437,600, filed on Dec. 21, 2016, the content of which are herein incorporated by reference in their entireties.

FIELD

[0002] The present invention relates to the field of molecular biology and microbiology. Provided herein are non-naturally occurring microbial organisms having increased xylose uptake and increased production of bioderived compounds using xylose as a substrate, as well as methods to make and use these microbial organisms.

REFERENCE TO SEQUENCE LISTING

[0003] The instant application contains a Sequence Listing which has been submitted in ASCII format via EFS-Web and is hereby incorporated by reference in its entirety. Said ASCII copy, created on Oct. 14, 2020, is named 14305-015-999_Sequence_Listing.txt and is 146,873 bytes in size.

BACKGROUND

[0004] Xylose is an abundant sugar present in lignocellulosic biomass, a renewable feedstock for producing bioderived chemicals. However, the use of lignocellulosic biomass and the production of bioderived chemicals are limited by the naturally low xylose uptake in microbial organisms. Therefore, methods to increase xylose uptake in microbial organisms to increase the production of bioderived compounds from xylose represent unmet needs. The non-naturally occurring microbial organisms and methods provided herein meet these needs and provide other related advantages.

SUMMARY OF THE INVENTION

[0005] Provided herein are non-naturally occurring microbial organism having at least one exogenous nucleic acid encoding a xylose transporter, wherein the xylose transporter has an amino acid sequence that is at least 89% identical to a Metschnikowia xylose transporter.

[0006] In some embodiments, the non-naturally occurring microbial organism provided herein can have exogenous nucleic acids encoding at least two, at least three, at least four, at least five, at least six, or at least seven xylose transporters. In some embodiments, the xylose transporter can have an amino acid sequence that is at least 90%, at least 95%, at least 98%, or at least 99%, identical to the Metschnikowia xylose transporter. In some embodiments, the xylose transporter is a Metschnikowia xylose transporter. In some embodiments, the Metschnikowia xylose transporter can be, for example, Xyt1p, Gxf1p, .DELTA.Gxf1p, Gxf2p/Gal2p, Gxs1p/Hgt12p, .DELTA.Gxs1p/.DELTA.Hgt12p, Hxt5p, Hxt2.6p, Qup2p, or Aps1p/Hgt19p.

[0007] In some embodiments, the Metschnikowia xylose transporter is from the H0 Metschnikowia sp. Accordingly, also provided herein is a non-naturally occurring microbial organism having at least one exogenous nucleic acid encoding a xylose transporter, wherein the xylose transporter has an amino acid sequence that is at least 89% identical to a xylose transporter form the H0 Metschnikowia sp. In some embodiments, the xylose transporter has an amino acid sequence that is at least 89% identical to SEQ ID NO: 1, 2, 3, 4, 5, 7, 8, 9, 10, 11, or 12. In some embodiments, the non-naturally occurring microbial organism provided herein can have the exogenous nucleic acid SEQ ID NOs: 13, 14, 15, 16, 17, 19, 20, 21, 22, 23, 24 25, 26, or 27.

[0008] In some embodiments, the xylose transporter can be ubiquitin-deficient. In some embodiments, the xylose transporter has an amino acid sequence of SEQ ID NO: 44 or SEQ ID NO: 45. In some embodiments, the non-naturally occurring microbial organism provided herein has the exogenous nucleic acid SEQ ID NO: 49 or SEQ ID NO: 45.

[0009] In some embodiments, the exogenous nucleic acid can be codon-optimized for expression in the host microbial organism.

[0010] In some embodiments, provided herein is a non-naturally occurring microbial organism having at least one exogenous nucleic acid encoding a xylose transporter, wherein the xylose transporter has an amino acid sequence that is at least 74% identical to Xyt1p of a Metschnikowia species. In some embodiments, the Metschnikowia species is the H0 Metschnikowia sp. In some embodiments, the xylose transporter has an amino acid sequence that is at least 74% identical to SEQ ID NO: 1. In some embodiments, the exogenous nucleic acid has the sequence of SEQ ID NO: 13 or SEQ ID NO: 21.

[0011] In some embodiments, provided herein is a non-naturally occurring microbial organism having at least one exogenous nucleic acid encoding a xylose transporter, wherein the xylose transporter has an amino acid sequence that is at least 85% identical to Gxf1p of a Metschnikowia species. In some embodiments, the Metschnikowia species is the H0 Metschnikowia sp. In some embodiments, the xylose transporter has an amino acid sequence that is at least 74% identical to SEQ ID NO: 2. In some embodiments, the exogenous nucleic acid has the sequence of SEQ ID NO: 14.

[0012] In some embodiments, provided herein is a non-naturally occurring microbial organism having at least one exogenous nucleic acid encoding a xylose transporter, wherein the xylose transporter has an amino acid sequence that is at least 89% identical to a .DELTA.Gxf1p of a Metschnikowia species. In some embodiments, the Metschnikowia species is the H0 Metschnikowia sp. In some embodiments, the xylose transporter has an amino acid sequence that is at least 89% identical to SEQ ID NO: 3. In some embodiments, the exogenous nucleic acid has the sequence of SEQ ID NO: 15.

[0013] In some embodiments, provided herein is a non-naturally occurring microbial organism comprising at least one exogenous nucleic acid encoding a xylose transporter, wherein the xylose transporter has an amino acid sequence that is at least 71% identical to a Gxf2p/Gal2p of a Metschnikowia species. In some embodiments, the Metschnikowia species is the H0 Metschnikowia sp. In some embodiments, the xylose transporter has an amino acid sequence that is at least 71% identical to SEQ ID NO: 4. In some embodiments, the exogenous nucleic acid has the sequence of SEQ ID NO: 16.

[0014] In some embodiments, provided herein is a non-naturally occurring microbial organism comprising at least one exogenous nucleic acid encoding a xylose transporter, wherein the xylose transporter has an amino acid sequence that is at least 71% identical to a Gxs1p/Hgt12p of a Metschnikowia species. In some embodiments, the Metschnikowia species is the H0 Metschnikowia sp. In some embodiments, the xylose transporter has an amino acid sequence that is at least 71% identical to SEQ ID NO: 7. In some embodiments, the exogenous nucleic acid has the sequence of SEQ ID NO: 19.

[0015] In some embodiments, provided herein is a non-naturally occurring microbial organism comprising at least one exogenous nucleic acid encoding a xylose transporter, wherein the xylose transporter has an amino acid sequence that is at least 60% identical to a Hxt5p of a Metschnikowia species. In some embodiments, the Metschnikowia species is the H0 Metschnikowia sp. In some embodiments, the xylose transporter has an amino acid sequence that is at least 60% identical to SEQ ID NO: 8. In some embodiments, the exogenous nucleic acid has the sequence of SEQ ID NO: 20.

[0016] In some embodiments, provided herein is a non-naturally occurring microbial organism comprising at least one exogenous nucleic acid encoding a xylose transporter, wherein the xylose transporter has an amino acid sequence that is at least 84% identical to a Hxt2.6p of a Metschnikowia species. In some embodiments, the Metschnikowia species is the H0 Metschnikowia sp. In some embodiments, the xylose transporter has an amino acid sequence that is at least 84% identical to SEQ ID NO: 10. In some embodiments, the exogenous nucleic acid has the sequence of SEQ ID NO: 22 or SEQ ID NO: 23.

[0017] In some embodiments, provided herein is a non-naturally occurring microbial organism comprising at least one exogenous nucleic acid encoding a xylose transporter, wherein the xylose transporter has an amino acid sequence that is at least 50% identical to a Qup2p of a Metschnikowia species. In some embodiments, the Metschnikowia species is the H0 Metschnikowia sp. In some embodiments, the xylose transporter has an amino acid sequence that is at least 50% identical to SEQ ID NO: 11. In some embodiments, the exogenous nucleic acid has the sequence of SEQ ID NO: 24 or SEQ ID NO: 25.

[0018] In some embodiments, provided herein is a non-naturally occurring microbial organism comprising at least one exogenous nucleic acid encoding a xylose transporter, wherein the xylose transporter has an amino acid sequence that is at least 74% identical to a Aps1p/Hgt19p of a Metschnikowia species. In some embodiments, the Metschnikowia species is the H0 Metschnikowia sp. In some embodiments, the xylose transporter has an amino acid sequence that is at least 74% identical to SEQ ID NO: 12. In some embodiments, the exogenous nucleic acid has the sequence of SEQ ID NO: 26 or SEQ ID NO: 27.

[0019] Provided herein are non-naturally occurring microbial organism having at least one exogenous nucleic acid encoding a xylose transporter having an amino acid sequence that is at least 89% identical to a Metschnikowia xylose transporter. The exogenous nucleic acid can be a heterologous nucleic acid. The microbial organism can be in an aerobic culture medium or a substantially anaerobic culture medium. The microbial organism can be a species of bacteria or yeast.

[0020] In some embodiments, the microbial organism is a species of a yeast, such as Saccharomyces cerevisiae, Schizosaccharomyces pombe, Candida albicans, Candida tropicalis, Debaryomyces hansenii, Kluyveromyces lactis, Kluyveromyces marxianus, Aspergillus terreus, Aspergillus niger, Chlamydomonas reinhardtii, Pichia pastoris, Rhizopus arrhizus, Rhizopus oryzae, Trichoderma reesei, or Yarrowia lipolytica.

[0021] In some embodiments, the microbial organism is a species of a bacteria, such as Escherichia coli, Klebsiella oxytoca, Anaerobiospirillum succiniciproducens, Actinobacillus succinogenes, Mannheimia succiniciproducens, Rhizobium etli, Bacillus subtilis, Corynebacterium glutamicum, Gluconobacter oxydans, Zymomonas mobilis, Lactococcus lactis, Lactobacillus plantarum, Streptomyces coelicolor, Clostridium acetobutylicum, Pseudomonas fluorescens, or Pseudomonas putida.

[0022] The non-naturally occurring microbial organism provided herein can further include a metabolic pathway capable of producing a bioderived compound from xylose, such as xylitol, ethanol, n-butanol, isobutanol, isopropanol, arabitol, ethyl acetate, phenyl-ethyl alcohol, 2-methyl-butanol, or 3-methyl-butanol.

[0023] Provided herein is also a method of producing a bioderived compound, including culturing the non-naturally occurring microbial organism provided herein under conditions and for a sufficient period of time to produce said bioderived compound, wherein the microbial organism has a pathway capable of producing the bioderived compound from xylose. The microbial organism can be cultured in medium having xylose and a co-substrate, such as cellobiose, hemicellulose, glycerol, galactose, and glucose, or a combination thereof. The microbial organism can be cultured in batch cultivation, fed-batch cultivation or continuous cultivation.

[0024] In some embodiments, the method can further includes separating the bioderived compound from other components in the culture. The separation method can include, for example, extraction, continuous liquid-liquid extraction, pervaporation, membrane filtration, membrane separation, reverse osmosis, electrodialysis, distillation, crystallization, centrifugation, extractive filtration, ion exchange chromatography, absorption chromatography, or ultrafiltration.

[0025] Also provided herein is a bioderived compound produced by the method described herein. The bioderived compound can include, for example, glycerol, acetaldehyde, acetate, glyceraldehyde, or a combination thereof as impurities. Also provided herein is a composition having one or more of the bioderived compound described herein. In some embodiments, the composition can have the bioderived xylitol. In some embodiments, the composition can be culture medium. The composition can be culture medium with the microbial organism removed.

BRIEF DESCRIPTION OF THE DRAWINGS

[0026] FIG. 1 shows the efficient xylose uptake by the wild type H0 Metschnikowia sp. measured by the amount of xylose transported (%), which was further enhanced (from about 55% to about 65%) when XYT1, a xylose transporter of the H0 Metschnikowia sp., was overexpressed.

[0027] FIG. 2 shows the efficient xylose uptake by the wild type H0 Metschnikowia sp. measured by xylose transported (%) per unit OD.sub.600, which was further enhanced (from about 1.3 to 2.2) when the XYT1 was overexpressed.

[0028] FIG. 3 shows that the expression of H0 XYT1 in Saccharomyces increased the xylose transport from about 10% to about 74% (48 hours) in Saccharomyces.

[0029] FIGS. 4A-4C show the xylose uptake by host strain BY4742 (Saccharomyces cerevisiae), and BY4742 strains expressing xylose transports H0 Metschnikowia sp. Gxf2p/Gal2p ("Gal2p"), H0 Metschnikowia sp. Gxf1p ("Gxf1p"), H0 Metschnikowia sp. Xyt1p ("Xyt1p"), H0 Metschnikowia sp. Hxt5p ("Hxt5p"), H0 Metschnikowia sp. Aps1p/Hgt19p ("Hgt19p"), Candida intermedia Gxf1p ("CiGxf1p-65d"), Pichia stipis Sut1p ("PsSut1p"), ubiquitin-deficient H0 Metschnikowia sp. Aps1p/Hgt19p (".DELTA.ubq-Hgt19p"), or ubiquitin-deficient H0 Metschnikowia sp. Hxt5p (".DELTA.ubq-Hxt5p"), at 18h (FIG. 4A), 64h (FIG. 4B), and 88h (FIG. 4C)

DETAILED DESCRIPTION

[0030] The compositions and methods provided herein are based, in part, on the discovery, cloning and characterization of novel xylose transporters from the Metschnikowia genus. Expression of one or more of these xylose transporters or variants thereof in host microbial organisms was found to increase xylose uptake, as well as production of bioderived compounds by these microbial organisms using xylose as a substrate. Provided herein are also nucleic acids that encode these xylose transporters, non-naturally microbial organisms having enhanced xylose uptake by expressing these xylose transporters, as well as bioderived compounds produced by these microbial organisms.

[0031] As used herein, the term "non-naturally occurring," when used in reference to a microbial organism or microorganism described herein is intended to mean that the microbial organism has at least one genetic alteration not normally found in a naturally occurring strain of the referenced species, including wild-type strains of the referenced species. Genetic alterations include, for example, modifications introducing expressible nucleic acids encoding metabolic polypeptides, other nucleic acid additions, nucleic acid deletions and/or other functional disruption of the microbial organism's genetic material. Such modifications include, for example, coding regions and functional fragments thereof, for heterologous, homologous or both heterologous and homologous polypeptides for the referenced species. Additional modifications include, for example, non-coding regulatory regions in which the modifications alter expression of a gene or operon. Exemplary metabolic polypeptides include, but are not limited to, enzymes or proteins within a xylitol biosynthetic pathway.

[0032] As used herein, the terms "microbial," "microbial organism" or "microorganism" are intended to mean any organism that exists as a microscopic cell that is included within the domains of archaea, bacteria or eukarya. Therefore, the term is intended to encompass prokaryotic or eukaryotic cells or organisms having a microscopic size and includes bacteria, archaea and eubacteria of all species as well as eukaryotic microorganisms such as yeast and fungi. The term also includes cell cultures of any species that can be cultured for the production of a biochemical.

[0033] As used herein, the term "isolated" when used in reference to a microbial organism is intended to mean an organism that is substantially free of at least one component as the referenced microbial organism is found in nature. The term includes a microbial organism that is removed from some or all components as it is found in its natural environment. The term also includes a microbial organism that is removed from some or all components as the microbial organism is found in non-naturally occurring environments. Therefore, an isolated microbial organism is partly or completely separated from other substances as it is found in nature or as it is grown, stored or subsisted in non-naturally occurring environments. Specific examples of isolated microbial organisms include partially pure microbes, substantially pure microbes and microbes cultured in a medium that is non-naturally occurring.

[0034] As used herein, the terms "exogenous" is intended to mean that the referenced molecule or the referenced activity is introduced into the host microbial organism. The molecule can be introduced, for example, by introduction of an encoding nucleic acid into the host genetic material such as by integration into a host chromosome or as non-chromosomal genetic material such as a plasmid. Therefore, the term as it is used in reference to expression of an encoding nucleic acid refers to introduction of the encoding nucleic acid in an expressible form into the microbial organism. When used in reference to a biosynthetic activity, the term refers to an activity that is introduced into the host reference organism. The source can be, for example, a homologous or heterologous encoding nucleic acid that expresses the referenced activity following introduction into the host microbial organism. Therefore, the term "endogenous" refers to a referenced molecule or activity that is present in the host. Similarly, the term when used in reference to expression of an encoding nucleic acid refers to expression of an encoding nucleic acid contained within the microbial organism. The term "heterologous" refers to a molecule or activity derived from a source other than the referenced species whereas "homologous" refers to a molecule or activity derived from the host microbial organism. Accordingly, exogenous expression of an encoding nucleic acid of the invention can utilize either or both a heterologous or homologous encoding nucleic acid.

[0035] It is understood that when more than one exogenous nucleic acid is included in a microbial organism that the more than one exogenous nucleic acids refers to the referenced encoding nucleic acid or biosynthetic activity, as discussed above. It is also understood that a microbial organism can have one or multiple copies of the same exogenous nucleic acid. It is further understood, as disclosed herein, that such more than one exogenous nucleic acids can be introduced into the host microbial organism on separate nucleic acid molecules, on polycistronic nucleic acid molecules, or a combination thereof, and still be considered as more than one exogenous nucleic acid. For example, as disclosed herein a microbial organism can be engineered to express two or more exogenous nucleic acids encoding a desired pathway enzyme or protein. In the case where two exogenous nucleic acids encoding a desired activity are introduced into a host microbial organism, it is understood that the two exogenous nucleic acids can be introduced as a single nucleic acid, for example, on a single plasmid, on separate plasmids, can be integrated into the host chromosome at a single site or multiple sites, and still be considered as two exogenous nucleic acids. Similarly, it is understood that more than two exogenous nucleic acids can be introduced into a host organism in any desired combination, for example, on a single plasmid, on separate plasmids, can be integrated into the host chromosome at a single site or multiple sites, and still be considered as two or more exogenous nucleic acids, for example three exogenous nucleic acids. Thus, the number of referenced exogenous nucleic acids or biosynthetic activities refers to the number of encoding nucleic acids or the number of biosynthetic activities, not the number of separate nucleic acids introduced into the host organism.

[0036] As used herein, the term "xylose" refers to a five carbon monosaccharide with a formyl functional group having the chemical formula of C.sub.5H.sub.10O.sub.5, a Molar mass of 150.13 g/mol, and one IUPAC name of (3R,4S,5R)-oxane-2,3,4,5-tetrol. Xylose is also known in the art as D-xylose, D-xylopyranose, xyloside, d-(+)-xylose, xylopyranose, wood sugar, xylomed and D-xylopentose.

[0037] As used herein, the term "xylose transporter" refers to membrane protein that facilitates the movement of xylose across a cell membrane. The term "Metschnikowia xylose transporter" refers to a xylose transporter from a Metschnikowia species. As used herein, the term "Metschnikowia species" refers to any species of yeast that falls within the Metschnikowia genus. Exemplary Metschnikowia species include, but are not limited to, Metschnikowia pulcherrima, Metschnikowia fructicola, Metschnikowia chrysoperlae, Metschnikowia andauensis, Metschnikowia shanxiensis, Metschnikowia sinensis, Metschnikowia zizyphicola, Metschnikowia reukaufri, Metschnikowia bicuspidata, Metschnikowia lunata, Metschnikowia zobellii, Metschnikowia australis, Metschnikowia agaveae, Metschnikowia gruessii, Metschnikowia hawaiiensis, Metschnikowia krissii, Metschnikowia sp. strain NS-O-85, Metschnikowia sp. strain NS-O-89, Metschnikowia sp. strain 4MS-2013 and the unique Metschnikowia species described herein, Metschnikowia sp. H0, alternatively known as the "H0 Metschnikowia sp." The Metschnikowia species described herein, i.e., the H0 Metschnikowia sp., is a newly discovered species, which is identified by the designated Accession No. 081116-01, and deposited at International Depositary Authority of Canada ("IDAC"), an International Depositary Authority, at the address of 1015 Arlington Street, Winnipeg, Manitoba, Canada R3E 3R2, on Nov. 8, 2016, under the terms of the Budapest Treaty.

[0038] As used herein, the term "ubiquitin-deficient" when used in connection with a protein refers to an altered form of the protein that is resistant to ubiquitination at one or more ubiquitination sites and proteasome-mediated degradation. The resistance to ubiquitination can range from a decreased frequency of ubiquitination to complete inhibition of ubiquitination. Ubiquitination is an enzymatic post-translational modification by which a ubiquitin protein is attached to a lysine residue of the substrate protein. A chain of multiple ubiquitin proteins can form on a single lysine residue on the substrate protein, and target the substrate protein for proteasome-mediated degradation. Accordingly, a ubiquitin-deficient protein is partially or totally resistant to ubiquitination and proteasome-mediated degradation. In some embodiments, a ubiquitin-deficient protein has an amino acid mutation at or near a lysine residue that can be ubiquitinated. The proximity of the mutation near a lysine residue that can be ubiquitinated can be close within the primary sequence or close within the 3D structure so long as the mutation yields resistance to ubiquitination. Such mutation can be amino acid substitution, deletion, or addition. In some embodiment, the lysine residue that can be ubiquitinated itself is substituted to another amino acid. In some embodiment, the lysine residue is deleted. In some embodiments, one or more amino acid residues near the lysine residue that can be ubiquitinated are mutated such that the lysine residue is not accessible to the ubiquitination machinery. In some embodiments, a ubiquitin-deficient protein has amino acid mutations at or near at least two lysine residues that can be ubiquitinated. In some embodiments, a ubiquitin-deficient protein has amino acid mutations at or near at least three lysine residues that can be ubiquitinated. In some embodiments, a ubiquitin-deficient protein has amino acid mutations at or near at least four lysine residues that can be ubiquitinated. In some embodiments, a ubiquitin-deficient protein has amino acid substitutions at or near all lysine residues that can be ubiquitinated. In some embodiments, a ubiquitin-deficient protein has amino acid substitutions at least all lysine residues that can be ubiquitinated, and is completely resistant to ubiquitination and proteasome-mediated degradation.

[0039] As used herein, the term "medium," "culture medium," "growth medium" or grammatical equivalents thereof refers to a liquid or solid (e.g., gelatinous) substance containing nutrients that supports the growth of a cell, including any microbial organism species described herein. Nutrients that support growth include: a substrate that supplies carbon, such as, but are not limited to, xylose, cellobiose, hemicelluloses, glycerol, galactose and glucose; salts that provide essential elements including magnesium, nitrogen, phosphorus, and sulfur; a source for amino acids, such as peptone or tryptone; and a source for vitamin content, such as yeast extract. Specific examples of medium useful in the methods and in characterizing the Metschnikowia species described herein include yeast extract peptone (YEP) medium and yeast nitrogen base (YNB) medium having a carbon source such as, but not limited to xylose, glucose, cellobiose, galactose, or glycerol, or a combination thereof. The formulations of YEP and YNB medium are well known in the art. For example, YEP medium having 4% xylose includes, but is not limited to, yeast extract 1.0 g, peptone 2.0 g, xylose 4.0 g, and 100 ml water. As another example, YNB medium having 2% glucose and 2% xylose includes, but is not limited to, biotin 2 g, calcium pantothenate 400 .mu.g, folic acid 2 .mu.g, inositol 2000 .mu.g, niacin 400 .mu.g, aminobenzoic acid 200 .mu.g, pyridoxine hydrochloride 400 .mu.g, riboflavin 200 .mu.g, thiamine hydrochloride 400 .mu.g, boric acid 500 .mu.g, copper sulfate 40 .mu.g, potassium iodide 100 .mu.g, ferric chloride 200 .mu.g, manganese sulfate 400 .mu.g, sodium molybdate 200 .mu.g, zinc sulfate 400 .mu.g, potassium phosphate monobasic 1 g, magnesium sulfate 500 mg, sodium chloride 100 mg, calcium chloride 100 mg, 20 g glucose, 20 g, xylose and 1 L water. The amount of the carbon source in the medium can be readily determined by a person skilled in the art. When more than one substrate that supplies carbon is present in the medium, these are referred to as "co-substrates." Medium can also include substances other than nutrients needed for growth, such as a substance that only allows select cells to grow (e.g., antibiotic or antifungal), which are generally found in selective medium, or a substance that allows for differentiation of one microbial organism over another when grown on the same medium, which are generally found in differential or indicator medium. Such substances are well known to a person skilled in the art.

[0040] As used herein, the term "aerobic" when used in reference to a culture or growth condition is intended to mean that the free oxygen (O.sub.2) is available in the culture or growth condition. The term "anaerobic" when used in reference to a culture or growth condition is intended to mean that the culture or growth condition lacks free oxygen (O.sub.2). The term "substantially anaerobic" when used in reference to a culture or growth condition is intended to mean that the amount of dissolved oxygen in a liquid medium is less than about 10% of saturation. The term also is intended to include sealed chambers maintained with an atmosphere of less than about 1% oxygen that include liquid or solid medium.

[0041] As used herein, the term "bioderived" means derived from or synthesized by a biological organism and can be considered a renewable resource since it can be generated by a biological organism. Such a biological organism, in particular the microbial organism disclosed herein, can utilize feedstock or biomass, such as, sugars (e.g., xylose, glucose, fructose, galactose, sucrose, and arabinose), carbohydrates obtained from an agricultural, plant, bacterial, or animal source, and glycerol.

[0042] As used herein, the term "biobased" means a product is composed, in whole or in part, of a bioderived compound. A biobased or bioderived product is in contrast to a petroleum derived product, wherein such a product is derived from or synthesized from petroleum or a petrochemical feedstock.

[0043] Provided herein are novel Metschnikowia xylose transporters. Expression of these transporters or their variants in microbial organisms (e.g. Saccharomyces cerevisiae) can enhance xylose uptake and increase the production of bioderived products from xylose by these microbial organisms. Thus, provided herein is an isolated polypeptide that is a Metschnikowia xylose transporter or a variant thereof; an isolated nucleic acid that encodes a Metschnikowia xylose transporter or a variant thereof, a vector that has an isolated nucleic acid that encodes a Metschnikowia xylose transporter or a variant thereof, as well as a non-naturally occurring microbial organism having enhanced xylose uptake and at least one exogenous nucleic acid encoding a Metschnikowia xylose transporter or a variant thereof.

[0044] Provided herein are non-naturally occurring microbial organisms having enhanced xylose uptake, which have at least one exogenous nucleic acid encoding a xylose transporter, wherein the xylose transporter has an amino acid sequence that is at least 30% identical to a Metschnikowia xylose transporter. The microbial organisms can have one or more copies of the exogenous nucleic acid. In some embodiments, the microbial organisms can have two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen, sixteen, seventeen, eighteen, nineteen, twenty, or more copies of the exogenous nucleic acid.

[0045] Provided herein are also isolated polypeptides that are at least 30% identical to a Metschnikowia xylose transporter. Provided herein are also isolated nucleic acids that encode polypeptides that are at least 30% identical to a Metschnikowia xylose transporter. The Metschnikowia xylose transporters include, for example, transporters such as Xyt1p, Gxf1p, .DELTA.Gxf1p, Gxf2p/Gal2p, Gxs1p/Hgt12p, .DELTA.Gxs1p/.DELTA.Hgt12p, Hxt5p, Hxt2.6p, Qup2p, or Aps1p/Hgt19p from a Metschnikowia species. The Metschnikowia species include, for example, the Metschnikowia sp. H0, Metschnikowia pulcherrima, Metschnikowia fructicola, Metschnikowia chrysoperlae, Metschnikowia andauensis, Metschnikowia shanxiensis, Metschnikowia sinensis, Metschnikowia zizyphicola, Metschnikowia reukaufii, Metschnikowia bicuspidata, Metschnikowia lunata, Metschnikowia zobellii, Metschnikowia australis, Metschnikowia agaveae, Metschnikowia gruessii, Metschnikowia hawaiiensis, Metschnikowia krissii, Metschnikowia sp. strain NS-O-85, Metschnikowia sp. strain NS-O-89, and Metschnikowia sp. strain 4MS-2013. The Metschnikowia xylose transporter can be axylose transporter from the H0 Metschnikowia sp. In some embodiments, the xylose transporter can include, for example, Xyt1p, Gxf1p, .DELTA.Gxf1p, Gxf2p/Gal2p, Gxs1p/Hgt12p, .DELTA.Gxs1p/.DELTA.Hgt12p, Hxt5p, Hxt2.6p, Qup2p, or Aps1p/Hgt19p from the H0 Metschnikowia sp. Exemplary sequences are provided below.

TABLE-US-00001 SEQ ID NO: Description SEQUENCES 1 Amino acid MGYEEKLVAPALKFKNFLDKTPNIHNVYVIAAISCTSGMMFGFDISSMSVF sequence of H0 VDQQPYLKMFDNPSSVIQGFITASMSLGSFFGSLTSTFISEPFGRRASLFICGI Metschnikowia LWVIGAAVQSSSQNRAQLICGRIIAGWGIGFGSSVAPVYGSEMAPRKIRGTI species Xyt1p GGIFQFSVTVGIFIMFLIGYGCSFIQGKASFRIPWGVQMVPGLILLIGLFFIPES PRWLAKQGYWEDAEIIVANVQAKGNRNDANVQIEMSEIKDQLMLDEHLK EFTYADLFTKKYRQRTITAIFAQIWQQLTGMNVMMYYIVYIFQMAGYSGN TNLVPSLIQYIINMAVTVPALFCLDLLGRRTILLAGAAFMMAWQFGVAGIL ATYSEPAYISDTVRITIPDDHKSAAKGVIACCYLFVCSFAFSWGVGIWVYCS EVWGDSQSRQRGAALATSANWIFNFAIAMFTPSSFKNITWKTYIIYATFCAC MFIHVFFFFPETKGKRLEEIGQLWDEGVPAWRSAKWQPTVPLASDAELAH KMDVAHAEHADLLATHSPSSDEKTGTV 2 Amino acid MSQDELHTKSGVETPINDSLLEEKHDVTPLAALPEKSFKDYISISIFCLFVAF sequence of H0 GGFVFGFDTGTISGFVNMSDFKTRFGEMNAQGEYYLSNVRTGLMVSIFNV Metschnikowia GCAVGGIFLCKIADVYGRRIGLMFSMVVYVVGIIIQIASTTKWYQYFIGRLI species Gxf1p AGLAVGTVSVISPLFISEVAPKQLRGTLVCCFQLCITLGIFLGYCTTYGTKTY TDSRQWRIPLGICFAWALFLVAGMLNMPESPRYLVEKSRIDDARKSIARSN KVSEEDPAVYTEVQLIQAGIDREALAGSATWMELVTGKPKIFRRVIMGVM LQSLQQLTGDNYFFYYGTTIFKAVGLQDSFQTSIILGIVNFASTFVGIYAIER MGRRLCLLTGSACMFVCFIIYSLIGTQHLYKNGFSNEPSNTYKPSGNAMIFIT CLYIFFFASTWAGGVYCIVSESYPLRIRSKAMSVATAANWMWGFLISFFTPF ITSAIHFYYGFVFTGCLAFSFFYVYFFVVETKGLSLEEVDILYASGTLPWKSS GWVP 3 Amino acid MSDFKTRFGEMNAQGEYYLSNVRTGLMVSIFNVGCAVGGIFLCKIADVYG sequence of H0 RRIGLMFSMVVYVVGIIIQIASTTKWYQYFIGRLIAGLAVGTVSVISPLFISEV Metschnikowia APKQLRGTLVCCFQLCITLGIFLGYCTTYGTKTYTDSRQWRIPLGICFAWAL species .DELTA.Gxf1p FLVAGMLNMPESPRYLVEKSRIDDARKSIARSNKVSEEDPAVYTEVQLIQA (variant of Gxf1p GIDREALAGSATWMELVTGKPKIFRRVIMGVMLQSLQQLTGDNYFFYYGT with shorter N- TIFKAVGLQDSFQTSIILGIVNFASTFVGIYAIERMGRRLCLLTGSACMFVCFI terminus) IYSLIGTQHLYKNGFSNEPSNTYKPSGNAMIFITCLYIFFFASTWAGGVYCIV SESYPLRIRSKAMSVATAANWMWGFLISFFTPFITSAIHFYYGFVFTGCLAFS FFYVYFFVVETKGLSLEEVDILYASGTLPWKSSGWVP 4 Amino acid MSAEQEQQVSGTSATIDGLASLKQEKTAEEEDAFKPKPATAYFFISFLCGLV sequence of H0 AFGGYVFGFDTGTISGFVNMDDYLMRFGQQHADGTYYLSNVRTGLIVSIFN Metschnikowia IGCAVGGLALSKVGDIWGRRIGIMVAMIIYMVGIIIQIASQDKWYQYFIGRLI species TGLGVGTTSVLSPLFISESAPKHLRGTLVCCFQLMVTLGIFLGYCTTYGTKN Gxf2p/Gal2p YTDSRQWRIPLGLCFAWALLLISGMVFMPESPRFLIERQRFDEAKASVAKS NQVSTEDPAVYTEVELIQAGIDREALAGSAGWKELITGKPKMLQRVILGM MLQSIQQLTGNNYFFYYGTTIFKAVGMSDSFQTSIVLGIVNFASTFVGIWAI ERMGRRSCLLVGSACMSVCFLIYSILGSVNLYIDGYENTPSNTRKPTGNAMI FITCLFIFFFASTWAGGVYSIVSETYPLRIRSKGMAVATAANWMWGFLISFF TPFITSAIHFYYGFVFTGCLIFSFFYVFFFVRETKGLSLEEVDELYATDLPPW KTAGWTPPSAEDMAHTTGFAEAAKPTNKHV 5 Amino acid MGIFVGVFAALGGVLFGYDTGTISGVMAMPWVKEHFPKDRVAFSASESSLI sequence of H0 VSILSAGTFFGAILAPLLTDTLGRRWCIIISSLVVFNLGAALQTAATDIPLLIV Metschnikowia GRVIAGLGVGLISSTIPLYQSEALPKWIRGAVVSCYQWAITIGIFLAAVINQG species THKINSPASYRIPLGIQMAWGLILGVGMFFLPETPRFYISKGQNAKAAVSLA .DELTA.Gxs1p/.DELTA.Hgt12p RLRKLPQDHPELLEELEDIQAAYEFETVHGKSSWSQVFTNKNKQLKKLATG (variant of VCLQAFQQLTGVNFIFYFGTTFFNSVGLDGFTTSLATNIVNVGSTIPGILGVE Gxs1p/Hgt12p IFGRRKVLLTGAAGMCLSQFIVAIVGVATDSKAANQVLIAFCCIFIAFFAAT with shorter N- WGPTAWVVCGEIFPLRTRAKSIAMCAASNWLLNWAIAYATPYLVDSDKG terminus) NLGTNVFFIWGSCNFFCLVFAYFMIYETKGLSLEQVDELYEKVASARKSPG FVPSEHAFREHADVETAMPDNFNLKAEAISVEDASV 6 NOT USED 7 Amino acid MGLESNKLIRKYINVGEKRAGSSGMGIFVGVFAALGGVLFGYDTGTISGVM sequence of H0 AMPWVKEHFPKDRVAFSASESSLIVSILSAGTFFGAILAPLLTDTLGRRWCII Metschnikowia ISSLVVFNLGAALQTAATDIPLLIVGRVIAGLGVGLISSTIPLYQSEALPKWIR species GAVVSCYQWAITIGIFLAAVINQGTHKINSPASYRIPLGIQMAWGLILGVGM Gxs1p/Hgt12 FFLPETPRFYISKGQNAKAAVSLARLRKLPQDHPELLEELEDIQAAYEFETV HGKSSWSQVFTNKNKQLKKLATGVCLQAFQQLTGVNFIFYFGTTFFNSVG LDGFTTSLATNIVNVGSTIPGILGVEIFGRRKVLLTGAAGMCLSQFIVAIVGV ATDSKAANQVLIAFCCIFIAFFAATWGPTAWVVCGEIFPLRTRAKSIAMCAA SNWLLNWAIAYATPYLVDSDKGNLGTNVFFIWGSCNFFCLVFAYFMIYET KGLSLEQVDELYEKVASARKSPGFVPSEHAFREHADVETAMPDNFNLKAE AISVEDASV 8 Amino acid MSIFEGKDGKGVSSTESLSNDVRYDNMEKVDQDVLRHNFNFDKEFEELEIE sequence of H0 AAQVNDKPSFVDRILSLEYKLHFENKNHMVWLLGAFAAAAGLLSGLDQSII Metschnikowia SGASIGMNKALNLTEREASLVSSLMPLGAMAGSMIMTPLNEWFGRKSSLIIS species Hxt5p CIWYTIGSALCAGARDHHMMYAGRFILGVGVGIEGGCVGIYISESVPANVR GSIVSMYQFNIALGEVLGYAVAAIFYTVHGGWRFMVGSSLVFSTILFAGLFF LPESPRWLVHKGRNGMAYDVWKRLRDINDESAKLEFLEMRQAAYQERER RSQESLFSSWGELFTIARNRRALTYSVIMITLGQLTGVNAVMYYMSTLMGA IGFNEKDSVFMSLVGGGSLLIGTIPAILWMDRFGRRVWGYNLVGFFVGLVL VGVGYRFNPVTQKAASEGVYLTGLIVYFLFFGSYSTLTWVIPSESFDLRTRS LGMTICSTFLYLWSFTVTYNFTKMSAAFTYTGLTLGFYGGIAFLGLIYQVCF MPETKDKTLEEIDDIFNRSAFSIARENISNLKKGIW 9 Amino acid MGYEEKLVAPALKFKNFLDKTPNIHNVYVIAAISCTSGMMFGFDISSMSVF sequence of H0 VDQQPYLKMFDNPSSVIQGFITALMSLGSFFGSLTSTFISEPFGRRASLFICGI Metschnikowia LWVIGAAVQSSSQNRAQLICGRIIAGWGIGFGSSVAPVYGSEMAPRKIRGTI species Xyt1p GGIFQFSVTVGIFIMFLIGYGCSFIQGKASFRIPWGVQMVPGLILLIGLFFIPES with S75L PRWLAKQGYWEDAEIIVANVQAKGNRNDANVQIEMSEIKDQLMLDEHLK mutation. EFTYADLFTKKYRQRTITAIFAQIWQQLTGMNVMMYYIVYIFQMAGYSGN TNLVPSLIQYIINMAVTVPALFCLDLLGRRTILLAGAAFMMAWQFGVAGIL ATYSEPAYISDTVRITIPDDHKSAAKGVIACCYLFVCSFAFSWGVGIWVYCS EVWGDSQSRQRGAALATSANWIFNFAIAMFTPSSFKNITWKTYIIYATFCAC MFIHVFFFFPETKGKRLEEIGQLWDEGVPAWRSAKWQPTVPLASDAELAH KMDVAHAEHADLLATHSPSSDEKTGTV 10 Amino acid MSSTTDTLEKRDIEPFTSDAPVTVHDYIAEERPWWKVPHLRVLTWSVFVIT sequence of H0 LTSTNNGYDGSMLNGLQSLDIWQEDLGHPAGQKLGALANGVLFGNLAAV Metschnikowia PFASYFCDRFGRRPVICFGQILTIVGAVLQGLSNSYGFFLGSRIVLGFGAMIA species Hxt2.6p TIPSPTLISEIAYPTHRETSTFAYNVCWYLGAIIASWVTYGTRDLQSKACWSI PSYLQAALPFFQVCMIWFVPESPRFLVAKGKIDQARAVLSKYHTGDSTDPR DVALVDFELHEIESALEQEKLNTRSSYFDFFKKRNFRKRGFLCVMVGVAM QLSGNGLVSYYLSKVLDSIGITETKRQLEINGCLMIYNFVICVSLMSVCRMF KRRVLFLTCFSGMTVCYTIWTILSALNEQRHFEDKGLANGVLAMIFFYYFF YNVGINGLPFLYITEILPYSHRAKGLNLFQFSQFLTQIYNGYVNPIAMDAISW KYYIVYCCILFVELVIVFFTFPETSGYTLEEVAQVFGDEAPGLHNRQLDVAK ESLEHVEHV 11 Amino acid MGFRNLKRRLSNVGDSMSVHSVKEEEDFSRVEIPDEIYNYKIVLVALTAAS sequence of H0 AAIIIGYDAGFIGGTVSLTAFKSEFGLDKMSATAASAIEANVVSVFQAGAYF Metschnikowia GCLFFYPIGEIWGRKIGLLLSGFLLTFGAAISLISNSSRGLGAIYAGRVLTGLG species Qup2p IGGCSSLAPIYVSEIAPAAIRGKLVGCWEVSWQVGGIVGYWINYGVLQTLPI SSQQWIIPFAVQLIPSGLFWGLCLLIPESPRFLVSKGKIDKARKNLAYLRGLS EDHPYSVFELENISKAIEENFEQTGRGFFDPLKALFFSKKMLYRLLLSTSMF MMQNGYGINAVTYYSPTIFKSLGVQGSNAGLLSTGIFGLLKGAASVFWVFF LVDTFGRRFCLCYLSLPCSICMWYIGAYIKIANPSAKLAAGDTATTPAGTAA KAMLYIWTIFYGITWNGTTWVICAEIFPQSVRTAAQAVNASSNWFWAFMI GHFTGQALENIGYGYYFLFAACSAIFPVVVWFVYPETKGVPLEAVEYLFEV RPWKAHSYALEKYQIEYNEGEFHQHKPEVLLQGSENSD 12 Amino acid MGYEEKLVAPALKFKNFLDKTPNIHNVYVIAAISCTSGMMFGFDISSMSVF sequence of H0 VDQQPYLKMFDNPSSVIQGFITASMSLGSFFGSLTSTFISEPFGRRASLFICGI Metschnikowia LWVIGAAVQSSSQNRAQLICGRIIAGWGIGFGSSVAPVYGSEMAPRKIRGTI species GGIFQFSVTVGIFIMFLIGYGCSFIQGKASFRIPWGVQMVPGLILLIGLFFIPES Aps1p/Hgt19p PRWLAKQGYWEDAEIIVANVQAKGNRNDANVQIEMSEIKDQLMLDEHLK EFTYADLFTKKYRQRTITAIFAQIWQQLTGMNVMMYYIVYIFQMAGYSGN TNLVPSLIQYIINMAVTVPALFCLDLLGRRTILLAGAAFMMAWQFGVAGIL ATYSEPAYISDTVRITIPDDHKSAAKGVIACCYLFVCSFAFSWGVGIWVYCS EVWGDSQSRQRGAALATSANWIFNFAIAMFTPSSFKNITWKTYIIYATFCAC MFIHVFFFFPETKGKRLEEIGQLWDEGVPAWRSAKWQPTVPLASDAELAH KMDVAHAEHADLLATHSPSSDEKTGTV 13 Nucleic acid ATGGGTTACGAGGAAAAGCTTGTAGCGCCCGCGTTGAAATTCAAAAAC sequence of H0 TTTCTTGACAAAACCCCCAATATTCACAATGTCTATGTCATTGCCGCCAT Metschnikowia CTCCTGTACATCAGGTATGATGTTTGGATTTGATATCTCGTCGATGTCTG species XYT1 TCTTTGTCGACCAGCAGCCATACTTGAAGATGTTTGACAACCCTAGTTC CGTGATTCAAGGTTTCATTACCGCGCTGATGAGTTTGGGCTCGTTTTTCG GCTCGCTCACATCCACGTTCATCTCTGAGCCTTTTGGTCGTCGTGCATCG TTGTTCATTTGTGGTATTCTTTGGGTAATTGGAGCAGCGGTTCAAAGTTC GTCGCAGAACAGGGCCCAATTGATTTGTGGGCGTATCATTGCAGGATGG GGCATTGGCTTTGGGTCATCGGTGGCTCCTGTTTACGGGTCCGAGATGG CTCCGAGAAAGATCAGAGGCACGATTGGTGGAATCTTCCAGTTCTCCGT CACCGTGGGTATCTTTATCATGTTCTTGATTGGGTACGGATGCTCTTTCA TTCAAGGAAAGGCCTCTTTCCGGATCCCCTGGGGTGTGCAAATGGTTCC CGGCCTTATCCTCTTGATTGGACTTTTCTTTATTCCTGAATCTCCCCGTTG GTTGGCCAAACAGGGCTACTGGGAAGACGCCGAAATCATTGTGGCCAA TGTGCAGGCCAAGGGTAACCGTAACGACGCCAACGTGCAGATTGAAAT GTCGGAGATTAAGGATCAATTGATGCTTGACGAGCACTTGAAGGAGTTT ACGTACGCTGACCTTTTCACGAAGAAGTACCGCCAGCGCACGATCACGG CGATCTTTGCCCAGATCTGGCAACAGTTGACCGGTATGAATGTGATGAT GTACTACATTGTGTACATTTTCCAGATGGCAGGCTACAGCGGCAACACG AACTTGGTGCCCAGTTTGATCCAGTACATCATCAACATGGCGGTCACGG TGCCGGCGCTTTTCTGCTTGGATCTCTTGGGCCGTCGTACCATTTTGCTC GCGGGTGCCGCGTTCATGATGGCGTGGCAATTCGGCGTGGCGGGCATTT TGGCCACTTACTCAGAACCGGCATATATCTCTGACACTGTGCGTATCAC GATCCCCGACGACCACAAGTCTGCTGCAAAAGGTGTGATTGCATGCTGC TATTTGTTTGTGTGCTCGTTTGCATTCTCGTGGGGTGTCGGTATTTGGGT GTACTGTTCCGAGGTTTGGGGTGACTCCCAGTCGAGACAAAGAGGCGCC GCTCTTGCGACGTCGGCCAACTGGATCTTCAACTTCGCCATTGCCATGTT CACGCCGTCCTCATTCAAGAATATCACGTGGAAGACGTATATCATCTAC GCCACGTTCTGTGCGTGCATGTTCATACACGTGTTTTTCTTTTTCCCAGA AACAAAGGGCAAGCGTTTGGAGGAGATAGGCCAGCTTTGGGACGAAGG AGTCCCAGCATGGAGGTCAGCCAAGTGGCAGCCAACAGTGCCGCTCGC GTCCGACGCAGAGCTTGCACACAAGATGGATGTTGCGCACGCGGAGCA CGCGGACTTATTGGCCACGCACTCGCCATCTTCAGACGAGAAGACGGGC ACGGTCTAA 14 Nucleic acid ATGTCTCAAGACGAACTTCATACAAAGTCTGGTGTTGAAACACCAATCA sequence of H0 ACGATTCGCTTCTCGAGGAGAAGCACGATGTCACCCCACTCGCGGCATT Metschnikowia GCCCGAGAAGTCCTTCAAGGACTACATTTCCATTTCCATTTTCTGTTTGT species GXF1 TTGTGGCATTTGGTGGTTTTGTTTTCGGTTTCGACACCGGTACGATTTCC GGTTTCGTCAACATGTCCGACTTCAAGACCAGATTTGGTGAGATGAATG CCCAGGGCGAATACTACTTGTCCAATGTTAGAACTGGTTTGATGGTTTC TATTTTCAACGTCGGTTGCGCCGTTGGTGGTATCTTCCTTTGTAAGATTG CCGATGTTTATGGCAGAAGAATTGGTCTTATGTTTTCCATGGTGGTTTAT GTCGTTGGTATCATTATTCAGATTGCCTCCACCACCAAATGGTACCAAT ACTTCATTGGCCGTCTTATTGCTGGCTTGGCTGTGGGTACTGTTTCCGTC ATCTCGCCACTTTTCATTTCCGAGGTTGCTCCTAAACAGCTCAGAGGTAC GCTTGTGTGCTGCTTCCAGTTGTGTATCACCTTGGGTATCTTTTTGGGTT ACTGCACGACCTACGGTACAAAGACTTACACTGACTCCAGACAGTGGA GAATCCCATTGGGTATCTGTTTCGCGTGGGCTTTGTTTTTGGTGGCCGGT ATGTTGAACATGCCCGAGTCTCCTAGATACTTGGTTGAGAAATCGAGAA TCGACGATGCCAGAAAGTCCATTGCCAGATCCAACAAGGTTTCCGAGG AAGACCCCGCCGTGTACACCGAGGTGCAGCTTATCCAGGCTGGTATTGA CAGAGAGGCCCTTGCCGGCAGCGCCACATGGATGGAGCTTGTGACTGG TAAGCCCAAAATCTTCAGAAGAGTCATCATGGGTGTCATGCTTCAGTCC TTGCAACAATTGACTGGTGACAACTACTTTTTCTACTACGGAACCACGA TTTTCAAGGCTGTTGGCTTGCAGGACTCTTTCCAGACGTCGATTATCTTG GGTATTGTCAACTTTGCCTCGACTTTTGTCGGTATTTACGCCATTGAGAG AATGGGCAGAAGATTGTGTTTGTTGACCGGATCTGCGTGCATGTTTGTG TGTTTCATCATCTACTCGCTCATTGGTACGCAGCACTTGTACAAGAACG GCTTCTCTAACGAACCTTCCAACACATACAAGCCTTCCGGTAACGCCAT GATCTTCATCACGTGTCTTTACATTTTCTTCTTTGCCTCGACCTGGGCCG GTGGTGTTTACTGTATCGTGTCCGAGTCTTACCCATTGAGAATCAGATCC AAGGCCATGTCTGTCGCCACCGCCGCCAACTGGATGTGGGGTTTCTTGA TCTCGTTCTTCACGCCTTTCATCACCTCCGCCATCCACTTTTACTACGGTT TTGTTTTCACTGGCTGCTTGGCGTTCTCCTTCTTCTACGTCTACTTCTTTG TCGTGGAGACCAAGGGTCTTTCCTTGGAGGAGGTTGACATTTTGTACGC TTCCGGTACGCTTCCATGGAAGTCCTCTGGCTGGGTGCCTCCTACCGCG GACGAAATGGCCCACAACGCCTTCGACAACAAGCCAACTGACGAACAA GTCTAA 15 Nucleic acid ATGTCCGACTTCAAGACCAGATTTGGTGAGATGAATGCCCAGGGCGAAT sequence of H0 ACTACTTGTCCAATGTTAGAACTGGTTTGATGGTTTCTATTTTCAACGTC Metschnikowia GGTTGCGCCGTTGGTGGTATCTTCCTTTGTAAGATTGCCGATGTTTATGG species .DELTA.GXF1 CAGAAGAATTGGTCTTATGTTTTCCATGGTGGTTTATGTCGTTGGTATCA (variant of GXF1 TTATTCAGATTGCCTCCACCACCAAATGGTACCAATACTTCATTGGCCGT with shorter N- CTTATTGCTGGCTTGGCTGTGGGTACTGTTTCCGTCATCTCGCCACTTTT terminus) CATTTCCGAGGTTGCTCCTAAACAGCTCAGAGGTACGCTTGTGTGCTGC TTCCAGTTGTGTATCACCTTGGGTATCTTTTTGGGTTACTGCACGACCTA CGGTACAAAGACTTACACTGACTCCAGACAGTGGAGAATCCCATTGGGT ATCTGTTTCGCGTGGGCTTTGTTTTTGGTGGCCGGTATGTTGAACATGCC CGAGTCTCCTAGATACTTGGTTGAGAAATCGAGAATCGACGATGCCAGA AAGTCCATTGCCAGATCCAACAAGGTTTCCGAGGAAGACCCCGCCGTGT ACACCGAGGTGCAGCTTATCCAGGCTGGTATTGACAGAGAGGCCCTTGC CGGCAGCGCCACATGGATGGAGCTTGTGACTGGTAAGCCCAAAATCTTC AGAAGAGTCATCATGGGTGTCATGCTTCAGTCCTTGCAACAATTGACTG GTGACAACTACTTTTTCTACTACGGAACCACGATTTTCAAGGCTGTTGG CTTGCAGGACTCTTTCCAGACGTCGATTATCTTGGGTATTGTCAACTTTG CCTCGACTTTTGTCGGTATTTACGCCATTGAGAGAATGGGCAGAAGATT GTGTTTGTTGACCGGATCTGCGTGCATGTTTGTGTGTTTCATCATCTACT CGCTCATTGGTACGCAGCACTTGTACAAGAACGGCTTCTCTAACGAACC TTCCAACACATACAAGCCTTCCGGTAACGCCATGATCTTCATCACGTGT CTTTACATTTTCTTCTTTGCCTCGACCTGGGCCGGTGGTGTTTACTGTAT CGTGTCCGAGTCTTACCCATTGAGAATCAGATCCAAGGCCATGTCTGTC GCCACCGCCGCCAACTGGATGTGGGGTTTCTTGATCTCGTTCTTCACGCC TTTCATCACCTCCGCCATCCACTTTTACTACGGTTTTGTTTTCACTGGCTG CTTGGCGTTCTCCTTCTTCTACGTCTACTTCTTTGTCGTGGAGACCAAGG GTCTTTCCTTGGAGGAGGTTGACATTTTGTACGCTTCCGGTACGCTTCCA TGGAAGTCCTCTGGCTGGGTGCCTCCTACCGCGGACGAAATGGCCCACA ACGCCTTCGACAACAAGCCAACTGACGAACAAGTCTAA 16 Nucleic acid ATGAGTGCCGAACAGGAACAACAAGTATCGGGCACATCTGCCACGATA sequence of H0 GATGGGCTGGCGTCCTTGAAGCAAGAAAAAACCGCCGAGGAGGAAGAC Metschnikowia GCCTTCAAGCCTAAGCCCGCCACGGCGTACTTTTTCATTTCGTTCCTCTG species TGGCTTGGTCGCCTTTGGCGGCTACGTTTTCGGTTTCGATACCGGTACGA GXF2/GAL2 TTTCCGGGTTTGTTAACATGGACGACTATTTGATGAGATTCGGCCAGCA GCACGCTGATGGCACGTATTACCTTTCCAACGTGAGAACCGGTTTGATC GTGTCGATCTTCAACATTGGCTGTGCCGTTGGTGGTCTTGCGCTTTCGAA AGTCGGTGACATTTGGGGCAGAAGAATTGGTATTATGGTTGCTATGATC ATCTACATGGTGGGAATCATCATCCAGATCGCTTCACAGGATAAATGGT ACCAGTACTTCATTGGCCGTTTGATCACCGGATTGGGTGTCGGCACCAC GTCCGTGCTTAGTCCTCTTTTCATCTCCGAGTCGGCTCCGAAGCATTTGA GAGGCACCCTTGTGTGTTGTTTCCAGCTCATGGTCACCTTGGGTATCTTT TTGGGCTACTGCACGACCTACGGTACCAAGAACTACACTGACTCGCGCC AGTGGCGGATTCCCTTGGGTCTTTGCTTCGCATGGGCTCTTTTGTTGATC

TCGGGAATGGTTTTCATGCCTGAATCCCCACGTTTCTTGATTGAGCGCCA GAGATTCGACGAGGCCAAGGCTTCCGTGGCCAAATCGAACCAGGTTTC GACCGAGGACCCCGCCGTGTACACTGAAGTCGAGTTGATCCAGGCCGG TATTGACCGTGAGGCATTGGCCGGATCCGCTGGCTGGAAAGAGCTTATC ACGGGTAAGCCCAAGATGTTGCAGCGTGTGATTTTGGGAATGATGCTCC AGTCGATCCAGCAGCTTACCGGTAACAACTACTTTTTCTACTATGGTAC CACGATCTTCAAGGCCGTGGGCATGTCGGACTCGTTCCAGACCTCGATT GTTTTGGGTATTGTCAACTTCGCCTCCACTTTTGTCGGAATCTGGGCCAT CGAACGCATGGGCCGCAGATCTTGTTTGCTTGTTGGTTCCGCGTGCATG AGTGTGTGTTTCTTGATCTACTCCATCTTGGGTTCCGTCAACCTTTACAT CGACGGCTACGAGAACACGCCTTCCAACACGCGTAAGCCTACCGGTAA CGCCATGATTTTCATCACGTGTTTGTTCATCTTCTTCTTCGCCTCCACCTG GGCCGGTGGTGTGTACAGTATTGTGTCTGAAACATACCCATTGAGAATC CGCTCTAAAGGTATGGCCGTGGCCACCGCTGCCAACTGGATGTGGGGTT TCTTGATTTCGTTCTTCACGCCTTTCATCACCTCGGCCATCCACTTCTACT ACGGGTTTGTGTTCACAGGGTGTCTTATTTTCTCCTTCTTCTACGTGTTCT TCTTTGTTAGGGAAACCAAGGGTCTCTCGTTGGAAGAGGTGGATGAGTT ATATGCCACTGACCTCCCACCATGGAAGACCGCGGGCTGGACGCCTCCT TCTGCTGAGGATATGGCCCACACCACCGGGTTTGCCGAGGCCGCAAAGC CTACGAACAAACACGTTTAA 17 Nucleic acid ATGGGCATTTTCGTTGGCGTTTTCGCCGCGCTTGGCGGTGTTCTCTTTGG sequence of H0 CTACGATACCGGTACCATCTCTGGTGTGATGGCCATGCCTTGGGTCAAG Metschnikowia GAACATTTCCCAAAAGACCGTGTTGCATTTAGTGCTTCCGAGTCGTCGT species .DELTA.GXS1/ TGATTGTGTCTATTTTATCTGCAGGAACTTTCTTTGGAGCCATTCTTGCT .DELTA.HGT12 (variant CCGCTCTTGACCGATACATTGGGTAGACGCTGGTGTATTATCATCTCTTC of GXS1/HGT12 GCTCGTTGTGTTCAATTTGGGTGCTGCTTTGCAGACGGCTGCCACGGAT with shorter N- ATCCCGCTCTTGATTGTTGGTCGTGTCATTGCCGGTTTAGGGGTTGGTTT terminus) GATTTCGCTGACGATTCCATTGTACCAGTCCGAAGCGCTTCCCAAATGG ATTAGAGGTGCTGTTGTCTCGTGCTACCAATGGGCCATTACTATTGGTAT CTTTTTGGCTGCCGTGATCAACCAGGGCACTCACAAGATCAACAGCCCT GCGTCGTACAGAATTCCATTGGGTATTCAGATGGCATGGGGTCTTATCT TGGGTGTCGGCATGTTCTTCTTGCCCGAGACGCCTCGTTTCTACATTTCC AAGGGCCAGAATGCGAAGGCTGCTGTTTCATTGGCGCGTTTGAGAAAG CTTCCGCAAGATCACCCGGAGTTGTTGGAGGAATTGGAAGATATCCAGG CGGCATACGAGTTTGAGACTGTCCATGGCAAGTCTTCATGGCTGCAGGT TTTCACCAACAAGAACAAACAATTGAAGAAGTTGGCCACGGGCGTGTG CTTGCAGGCGTTCCAACAATTGACTGGTGTGAACTTCATTTTCTACTTTG GCACGACTTTCTTCAACAGTGTTGGGCTTGACGGATTCACCACCTCCTTG GCCACCAACATTGTCAATGTTGGCTCGACGATCCCTGGTATTTTGGGTG TTGAGATTTTCGGCAGAAGAAAAGTGTTGTTGACCGGCGCTGCTGGTAT GTGTCTTTCGCAATTCATTGTTGCCATTGTTGGTGTAGCCACCGACTCCA AGGCTGCGAACCAAGTTCTTATTGCCTTCTGCTGCATTTTCATTGCGTTC TTTGCAGCCACCTGGGGCCCCACCGCATGGGTTGTTTGTGGCGAGATTT TCCCCTTGAGAACCAGAGCCAAGTCGATTGCCATGTGCGCTGCTTCGAA CTGGTTGTTGAACTGGGCAATTGCATACGCCACGCCATACTTGGTTGAC TCCGATAAGGGTAACTTGGGCACCAATGTGTTTTTCATTTGGGGAAGCT GTAACTTCTTCTGCCTTGTGTTTGCCTACTTCATGATTTACGAGACCAAG GGTCTTTCCTTGGAGCAGGTTGATGAGCTTTACGAGAAGGTTGCCAGCG CCAGAAAGTCGCCTGGCTTCGTGCCAAGCGAGCACGCTTTCAGAGAGC ACGCCGATGTGGAGACCGCCATGCCAGACAACTTCAACTTGAAGGCGG AGGCGATTTCTGTCGAGGATGCCTCTGTTTAA 18 NOT USED 19 Nucleic acid ATGAGCATCTTTGAAGGCAAAGACGGGAAGGGGGTATCCTCCACCGAG sequence of H0 TCGCTTTCCAATGACGTCAGATATGACAACATGGAGAAAGTTGATCAGG Metschnikowia ATGTTCTTAGACACAACTTCAACTTTGACAAAGAATTCGAGGAGCTCGA species AATCGAGGCGGCGCAAGTCAACGACAAACCTTCTTTTGTCGACAGGATT GXS1/HGT12 TTATCCCTCGAATACAAGCTTCATTTCGAAAACAAGAACCACATGGTGT GGCTCTTGGGCGCTTTCGCAGCCGCCGCAGGCTTATTGTCTGGCTTGGA TCAGTCCATTATTTCTGGTGCATCCATTGGAATGAACAAAGCATTGAAC TTGACTGAACGTGAAGCCTCATTGGTGTCTTCGCTTATGCCTTTAGGCGC CATGGCAGGCTCCATGATTATGACACCTCTTAATGAGTGGTTCGGAAGA AAATCATCGTTGATTATTTCTTGTATTTGGTATACCATCGGATCCGCTTT GTGCGCTGGCGCCAGAGATCACCACATGATGTACGCTGGCAGATTTATT CTTGGTGTCGGTGTGGGTATAGAAGGTGGGTGTGTGGGCATTTACATTT CCGAGTCTGTCCCAGCCAATGTGCGTGGTAGTATCGTGTCGATGTACCA GTTCAATATTGCTTTGGGTGAAGTTCTAGGGTATGCTGTTGCTGCCATTT TCTACACTGTTCATGGTGGATGGAGGTTCATGGTGGGGTCTTCTTTAGTA TTCTCTACTATATTGTTTGCCGGATTGTTTTTCTTGCCCGAGTCACCTCGT TGGTTGGTGCACAAAGGCAGAAACGGAATGGCATACGATGTGTGGAAG AGATTGAGAGACATAAACGATGAAAGCGCAAAGTTGGAATTTTTGGAG ATGAGACAGGCTGCTTATCAAGAGAGAGAAAGACGCTCGCAAGAGTCT TTGTTCTCCAGCTGGGGCGAATTATTCACCATCGCTAGAAACAGAAGAG CACTTACTTACTCTGTCATAATGATCACTTTGGGTCAATTGACTGGTGTC AATGCCGTCATGTACTACATGTCGACTTTGATGGGTGCAATTGGTTTCA ACGAGAAAGACTCTGTGTTCATGTCCCTTGTGGGAGGCGGTTCTTTGCT TATAGGTACCATTCCTGCCATTTTGTGGATGGACCGTTTCGGCAGAAGA GTTTGGGGTTATAATCTTGTTGGTTTCTTCGTTGGTTTGGTGCTCGTTGG TGTTGGCTACCGTTTCAATCCCGTCACTCAAAAGGCGGCTTCAGAAGGT GTGTACTTGACGGGTCTCATTGTCTATTTCTTGTTCTTTGGTTCCTACTCG ACCTTAACTTGGGTCATTCCATCCGAGTCTTTTGATTTGAGAACAAGATC TTTGGGTATGACAATCTGTTCCACTTTCCTTTACTTGTGGTCTTTCACCGT CACCTACAACTTCACCAAGATGTCCGCCGCCTTCACATACACTGGGTTG ACACTTGGTTTCTACGGTGGCATTGCGTTCCTTGGTTTGATTTACCAGGT CTGCTTCATGCCCGAGACGAAGGACAAGACTTTGGAAGAAATTGACGA TATCTTCAATCGTTCTGCGTTCTCTATCGCGCGCGAGAACATCTCCAACT TGAAGAAGGGTATTTGGTAA 20 Nucleic acid ATGAGCATCTTTGAAGGCAAAGACGGGAAGGGGGTATCCTCCACCGAG sequence of H0 TCGCTTTCCAATGACGTCAGATATGACAACATGGAGAAAGTTGATCAGG Metschnikowia ATGTTCTTAGACACAACTTCAACTTTGACAAAGAATTCGAGGAGCTCGA species HXT5 AATCGAGGCGGCGCAAGTCAACGACAAACCTTCTTTTGTCGACAGGATT TTATCCCTCGAATACAAGCTTCATTTCGAAAACAAGAACCACATGGTGT GGCTCTTGGGCGCTTTCGCAGCCGCCGCAGGCTTATTGTCTGGCTTGGA TCAGTCCATTATTTCTGGTGCATCCATTGGAATGAACAAAGCATTGAAC TTGACTGAACGTGAAGCCTCATTGGTGTCTTCGCTTATGCCTTTAGGCGC CATGGCAGGCTCCATGATTATGACACCTCTTAATGAGTGGTTCGGAAGA AAATCATCGTTGATTATTTCTTGTATTTGGTATACCATCGGATCCGCTTT GTGCGCTGGCGCCAGAGATCACCACATGATGTACGCTGGCAGATTTATT CTTGGTGTCGGTGTGGGTATAGAAGGTGGGTGTGTGGGCATTTACATTT CCGAGTCTGTCCCAGCCAATGTGCGTGGTAGTATCGTGTCGATGTACCA GTTCAATATTGCTTTGGGTGAAGTTCTAGGGTATGCTGTTGCTGCCATTT TCTACACTGTTCATGGTGGATGGAGGTTCATGGTGGGGTCTTCTTTAGTA TTCTCTACTATATTGTTTGCCGGATTGTTTTTCTTGCCCGAGTCACCTCGT TGGTTGGTGCACAAAGGCAGAAACGGAATGGCATACGATGTGTGGAAG AGATTGAGAGACATAAACGATGAAAGCGCAAAGTTGGAATTTTTGGAG ATGAGACAGGCTGCTTATCAAGAGAGAGAAAGACGCTCGCAAGAGTCT TTGTTCTCCAGCTGGGGCGAATTATTCACCATCGCTAGAAACAGAAGAG CACTTACTTACTCTGTCATAATGATCACTTTGGGTCAATTGACTGGTGTC AATGCCGTCATGTACTACATGTCGACTTTGATGGGTGCAATTGGTTTCA ACGAGAAAGACTCTGTGTTCATGTCCCTTGTGGGAGGCGGTTCTTTGCT TATAGGTACCATTCCTGCCATTTTGTGGATGGACCGTTTCGGCAGAAGA GTTTGGGGTTATAATCTTGTTGGTTTCTTCGTTGGTTTGGTGCTCGTTGG TGTTGGCTACCGTTTCAATCCCGTCACTCAAAAGGCGGCTTCAGAAGGT GTGTACTTGACGGGTCTCATTGTCTATTTCTTGTTCTTTGGTTCCTACTCG ACCTTAACTTGGGTCATTCCATCCGAGTCTTTTGATTTGAGAACAAGATC TTTGGGTATGACAATCTGTTCCACTTTCCTTTACTTGTGGTCTTTCACCGT CACCTACAACTTCACCAAGATGTCCGCCGCCTTCACATACACTGGGTTG ACACTTGGTTTCTACGGTGGCATTGCGTTCCTTGGTTTGATTTACCAGGT CTGCTTCATGCCCGAGACGAAGGACAAGACTTTGGAAGAAATTGACGA TATCTTCAATCGTTCTGCGTTCTCTATCGCGCGCGAGAACATCTCCAACT TGAAGAAGGGTATTTGGTAA 21 Nucleic acid ATGGGATACGAAGAGAAATTAGTGGCCCCCGCTTTGAAATTTAAGAACT sequence of H0 TTTTGGATAAGACCCCAAATATACATAACGTTTACGTAATTGCGGCGAT Metschnikowia CTCGTGTACCTCAGGTATGATGTTCGGTTTCGATATATCGTCGATGTCCG species XYT1 TGTTCGTGGACCAACAGCCGTATTTAAAAATGTTTGATAACCCTAGCAG codon optimized CGTGATACAAGGGTTTATAACTGCGTTGATGTCTTTGGGGAGCTTTTTCG for expression in GATCGCTAACGTCCACTTTTATTTCAGAACCTTTTGGTAGACGTGCCTCT S. cerevisiae TTGTTCATATGCGGGATCCTTTGGGTAATTGGGGCGGCAGTTCAAAGTT CTTCTCAGAACCGTGCGCAGCTTATTTGTGGCCGAATTATTGCAGGGTG GGGCATCGGATTCGGTTCTAGCGTTGCGCCGGTATACGGTTCAGAAATG GCCCCACGCAAAATTAGAGGAACAATCGGAGGTATTTTTCAATTTTCTG TCACGGTCGGAATATTCATAATGTTCCTGATTGGCTACGGCTGCTCATTT ATACAAGGCAAGGCCAGTTTTAGAATTCCGTGGGGAGTTCAAATGGTAC CAGGTCTCATTCTGTTGATCGGACTATTCTTCATTCCTGAATCCCCAAGA TGGTTAGCCAAACAAGGCTACTGGGAAGACGCTGAGATCATCGTAGCA AACGTTCAAGCTAAGGGTAACAGGAACGATGCTAATGTGCAAATTGAA ATGTCCGAGATAAAAGATCAGTTAATGCTTGACGAGCATTTAAAGGAGT TTACTTATGCCGATTTGTTTACCAAAAAATACCGGCAAAGGACGATAAC AGCTATATTTGCCCAAATATGGCAACAGCTGACAGGTATGAATGTCATG ATGTACTACATCGTATATATATTTCAAATGGCAGGTTATTCAGGTAATA CTAATTTAGTTCCTTCACTCATTCAGTATATTATAAATATGGCTGTTACG GTCCCCGCATTGTTCTGTCTTGATCTGCTTGGCAGGAGGACAATTTTATT AGCTGGCGCCGCTTTTATGATGGCCTGGCAATTTGGTGTTGCTGGCATTT TAGCTACTTATTCAGAGCCAGCCTATATTTCAGATACCGTGAGAATTAC AATTCCAGATGACCATAAAAGTGCCGCTAAGGGTGTCATCGCTTGCTGC TATTTGTTTGTTTGTTCCTTCGCCTTTTCCTGGGGTGTAGGTATCTGGGTT TATTGTTCAGAAGTGTGGGGTGATAGTCAATCCAGACAAAGAGGTGCTG CATTGGCAACTTCTGCTAATTGGATCTTCAATTTCGCAATTGCAATGTTT ACACCTTCTTCTTTCAAAAATATCACTTGGAAGACTTATATCATTTATGC TACATTTTGTGCTTGTATGTTCATTCATGTTTTTTTTTTTTTCCCTGAAAC AAAGGGTAAGAGACTAGAAGAAATTGGACAGCTATGGGATGAAGGTGT CCCAGCATGGAGATCTGCAAAATGGCAACCCACTGTCCCACTAGCAAGT GACGCTGAATTAGCTCACAAAATGGATGTTGCACACGCTGAACACGCA GACTTATTGGCAACCCATTCTCCAAGTAGTGACGAAAAAACTGGTACCG TTTAA 22 Nucleic acid ATGCTGAGCACTACCGATACCCTCGAAAAAAGGGACACCGAGCCTTTC sequence of H0 ACTTCAGATGCTCCTGTCACAGTCCATGACTATATCGCAGAGGAGCGTC Metschnikowia CGTGGTGGAAAGTGCCGCATTTGCGTGTATTGACTTGGTCTGTTTTCGTG species HXT2.6 ATCACCCTCACCTCCACCAACAACGGGTATGATGGCCTGATGTTGAATG GATTGCAATCCTTGGACATTTGGCAGGAGGATTTGGGTCACCCTGCGGG CCAGAAATTGGGTGCCTTGGCCAACGGTGTTTTGTTTGGTAACCTTGCT GCTGTGCCTTTTGCTTCGTATTTCTGCGATCGTTTTGGTAGAAGGCCGGT CATTTGTTTCGGACAGATCTTGACAATTGTTGGTGCTGTATTACAAGGTT TGTCCAACAGCTATGGATTTTTTTTGGGTTCGAGAATTGTGTTGGGTTTT GGTGCTATGATAGCCACTATTCCGCTGCCAACATTGATTTCCGAAATCG CCTACCCTACGCATAGAGAAACTTCCACTTTCGCCTACAACGTGTGCTG GTATTTGGGAGCCATTATCGCCTCCTGGGTCACATACGGCACCAGAGAT TTACAGAGCAAGGCTTGCTGGTCAATTCCTTCTTATCTCCAGGCCGCCTT ACCTTTCTTTCAAGTGTGCATGATTTGGTTTGTGCCAGAGTCTCCCAGAT TCCTCGTTGCCAAGGGCAAGATCGACCAAGCAAGGGCTGTTTTGTCTAA ATACCATACAGGAGACTCGACTGACCCCAGAGACGTTGCGTTGGTTGAC TTTGAGCTCCATGAGATTGAGAGTGCATTGGAGCAGGAAAAATTGAAC ACTCGCTCGTCATACTTTGACTTTTTCAAGAAGAGAAACTTTAGAAAGA GAGGCTTCTTGTGTGTCATGGTCGGTGTTGCAATGCAGCTTTCTGGAAA CGGCTTAGTGTCCTATTACTTGTCGAAAGTGCTAGACTCGATTGGAATC ACTGAAACCAAGAGACAGCTCGAGATCAATGGCTGCTTGATGATCTATA ACTTTGTCATCTGCGTCTCGTTGATGAGTGTTTGCCGTATGTTCAAAAGA AGAGTATTATTTCTCACGTGTTTCTCAGGAATGACGGTTTGCTACACGAT ATGGACGATTTTGTCAGCGCTTAATGAACAGAGACACTTTGAGGATAAA GGCTTGGCCAATGGCGTGTTGGCAATGATCTTCTTCTACTATTTTTTCTA CAACGTTGGCATCAATGGATTGCCATTCCTATACATCACCGAGATCTTG CCTTACTCACACAGAGCAAAAGGCTTGAATTTATTCCAATTCTCGCAAT TTCTCACGCAAATCTACAATGGCTATGTGAACCCAATCGCCATGGACGC AATCAGCTGGAAGTATTACATTGTGTACTGCTGTATTCTCTTCGTGGAGT TGGTGATTGTGTTTTTCACGTTCCCAGAAACTTCGGGATACACTTTGGAG GAGGTCGCCCAGGTATTTGGTGATGAGGCTCCCGGGCTCCACAACAGAC AATTGGATGTTGCGAAAGAATCACTCGAGCATGTTGAGCATGTTTGA 23 Nucleic acid ATGAGCCAGTCTAAAGAAAAGTCCAACGTTATTACCACCGTCTTGTCTG sequence of H0 AAGAATTGCCAGTTAAGTACTCCGAAGAAATCTCCGATTACGTTTACCA Metschnikowia TGATCAACATTGGTGGAAGTACAACCACTTCAGAAAATTGCATTGGTAC species HXT2.6 ATCTTCGTTCTGACTTTGACTTCTACCAACAATGGTTACGATGGCTCTAT codon optimized GTTGAACGGTCTACAATCTTTGTCTACTTGGAAAGATGCTATGGGTAAT for expression in CCTGAAGGTTACATTTTGGGTGCTTTGGCTAATGGTACTATTTTCGGTGG S. cerevisiae TGTTTTGGCTGTTGCTTTTGCTTCTTGGGCTTGTGATAGATTTGGTAGAA AGTTGACTACCTGCTTCGGTTCTATCGTTACTGTTATTGGTGCTATATTG CAAGGTGCCTCTACTAATTACGCATTCTTTTTCGTTTCCCGTATGGTTAT TGGTTTTGGTTTCGGTCTAGCTTCTGTTGCTTCTCCAACTTTGATTGCTGA ATTGTCTTTCCCAACTTACAGACCAACTTGTACTGCCTTGTACAATGTTT TTTGGTACTTGGGTGCTGTTATTGCTGCATGGGTTACTTATGGTACTAGA ACTATCGTTTCTGCCTACTCTTGGAGAATTCCATCTTACTTGCAAGGTTT GTTGCCATTGGTTCAAGTTTGTTTGGTTTGGTGGGTTCCAGAATCTCCAA GATTCTTGGTTTCTAAGGGTAAGATTGAAAAGGCCAGGGAATTCTTGAT TAAGTTCCATACTGGTAACGACACCCAAGAACAAGCTACTAGATTGGTC GAATTTGAGTTGAAAGAAATTGAAGCCGCCTTGGAGATGGAAAAGATT AACTCTAATTCTAAGTACACCGACTTCATCACCATCAAGACTTTCAGAA AGAGAATCTTCTTGGTTGCTTTCACTGCTTGTATGACTCAATTGTCTGGT AACGGTTTGGTGTCTTACTACTTGTCCAAGGTTTTGATCTCCATTGGTAT TACCGGTGAGAAAGAACAATTGCAAATCAACGGTTGCCTGATGATCTAC AACTTGGTTTTGTCTTTAGCTGTTGCCTTCACCTGTTACTTGTTTAGAAG AAAGGCCCTGTTCATCTTCTCTTGCTCATTCATGTTGTTGTCCTACGTTA TTTGGACCATTCTGTCCGCTATCAATCAACAGAGAAACTTCGAACAAAA AGGTCTAGGTCAAGGTGTCTTGGCTATGATTTTTATCTACTACTTGGCCT ACAACATCGGTTTGAATGGTTTGCCATACTTGTACGTTACCGAAATCTT GCCATATACTCATAGAGCTAAGGGCATCAACTTGTATTCCTTGGTTATT AACATCACCCTGATCTATAACGGTTTCGTTAACGCTATTGCTATGGATG CTATTTCCTGGAAGTACTACATCGTTTACTGCTGCATTATTGCCGTTGAA TTGGTTGTTGTTATCTTCACCTACGTTGAAACTTTCGGTTACACCTTGGA AGAAGTTGCTAGAGTTTTTGAAGGTACTGATTCTTTGGCCATGGACATT AACTTGAACGGTACAGTTTCCAACGAAAAGATCGATATCGTTCACTCTG AAAGAGGTTCCTCTGCTTAA 24 Nucleic acid ATGGGCTTTCGCAACTTAAAGCGCAGGCTCTCAAATGTTGGCGACTCCA sequence of H0 TGTCAGTGCACTCTGTGAAAGAGGAGGAAGACTTCTCCCGCGTGGAAAT Metschnikowia CCCGGATGAAATCTACAACTATAAGATCGTCCTTGTGGCTTTAACAGCG species QUP2 GCGTCGGCTGCCATCATCATCGGCTACGATGCAGGCTTCATTGGTGGCA CGGTTTCGTTGACGGCGTTCAAACTGGAATTTGGCTTGGACAAAATGTC TGCGACGGCGGCTTCTGCTATCGAAGCCAACGTTGTTTCCGTGTTCCAG GCCGGCGCCTACTTTGGGTGTCTTTTCTTCTATCCGATTGGCGAGATTTG GGGCCGTAAAATCGGTCTTCTTCTTTCCGGCTTTCTTTTGACGTTTGGTG CTGCTATTTCTTTGATTTCGAACTCGTCTCGTGGCCTTGGTGCCATATAT GCTGGAAGAGTACTAACAGGTTTGGGGATTGGCGGATGTCTGAGTTTGG CCCCAATCTACGTTTCTGAAATCGCGCCTGCAGCAATCAGAGGCAAGCT TGTGGGCTGCTGGGAAGTGTCATGGCAGGTGGGCGGCATTGTTGGCTAC TGGATCAATTACGGAGTCTTGCAGACTCTTCCGATTAGCTCACAACAAT GGATCATCCCGTTTGCTGTACAATTGATCCCATCGGGGCTTTTCTGGGGC CTTTGTCTTTTGATTCCAGAGCTGCCACGTTTTCTTGTATCGAAGGGAAA GATCGATAAGGCGCGCAAAAACTTAGCGTACTTGCGTGGACTTAGCGA GGACCACCCCTATTCTGTTTTTGAGTTGGAGAACATTAGTAAGGCCATT GAAGAGAACTTCGAGCAAACAGGAAGGGGTTTTTTCGACCCATTGAAA GCTTTGTTTTTCAGCAAAAAAATGCTTTACCGCCTTCTCTTGTCCACGTC AATGTTCATGATGCAGAATGGCTATGGAATCAATGCTGTGACATACTAC TCGCCCACGATCTTCAAATCCTTAGGCGTTCAGGGCTCAAACGCCGGTT TGCTCTCAACAGGAATTTTCGGTCTTCTTAAAGGTGCCGCTTCGGTGTTC TGGGTCTTTTTCTTGGTTGACACATTCGGCCGCCGGTTTTGTCTTTGCTA CCTCTCTCTCCCCTGCTCGATCTGCATGTGGTATATTGGCGCATACATCA

AGATTGCCAACCCTTCAGCGAAGCTTGCTGCAGGAGACACAGCCACCA CCCCAGCAGGAACTGCAGCGAAAGCGATGCTTTACATATGGACGATTTT CTACGGCATTACGTGGAATGGTACGACCTGGGTGATCTGCGCGGAGATT TTCCCCCAGTCGGTGAGAACAGCCGCGCAGGCCGTCAACGCTTCTTCTA ATTGGTTCTGGGCTTTCATGATCGGCCACTTCACTGGCCAGGCGCTCGA GAATATTGGGTACGGATACTACTTCTTGTTTGCGGCGTGCTCTGCAATCT TCCCTGTGGTAGTCTGGTTTGTGTACCCCGAAACAAAGGGTGTGCCTTT GGAGGCCGTGGAGTATTTGTTCGAGGTGCGTCCTTGGAAAGCGCACTCA TATGCTTTGGAGAAGTACCAGATTGAGTACAACGAGGGTGAATTCCACC AACATAAGCCCGAAGTACTCTTACAAGGGTCTGAAAACTCGGACACGA GCGAGAAAAGCCTCGCCTGA 25 Nucleic acid ATGGGTTTCAGAAACTTGAAGAGAAGATTGTCTAACGTTGGTGACTCCA sequence of H0 TGTCTGTTCACTCTGTTAAGGAAGAAGAAGACTTCTCCAGAGTTGAAAT Metschnikowia CCCAGATGAAATCTACAACTACAAGATCGTCTTGGTTGCTTTGACTGCT species QUP2 GCTTCTGCTGCTATCATCATCGGTTACGATGCTGGTTTCATTGGTGGTAC codon optimized TGTTTCTTTGACTGCTTTCAAGTCTGAATTCGGTTTGGACAAGATGTCTG for expression in CTACTGCTGCTTCTGCTATCGAAATGGGTTTCAGAAACTTGAAGAGGCG S. cerevisiae TTTGTCTAATGTTGGTGATTCCATGTCTGTTCACTCCGTCAAAGAAGAAG AGGATTTCTCCAGAGTTGAAATCCCAGACGAAATCTACAACTACAAGAT CGTTTTGGTTGCTTTGACTGCTGCTTCTGCTGCTATTATCATTGGTTATG ATGCTGGTTTCATCGGTGGTACTGTTTCTTTGACAGCTTTCAAGTCTGAA TTCGGTTTGGATAAGATGTCTGCTACAGCTGCTTCAGCTATTGAAGCTA ATGTTGTCTCTGTTTTTCAAGCTGGTGCTTACTTTGGTTGCCTGTTTTTTT ACCCAATTGGTGAAATTTGGGGTCGTAAGATTGGTTTGTTGTTGTCTGGT TTCTTGTTGACTTTTGGTGCTGCCATTTCCTTGATCTCTAATTCTTCTAGA GGTTTGGGTGCTATCTATGCTGGTAGAGTTTTGACTGGTTTAGGTATTGG TGGTTGTTCTTCTTTAGCTCCCATCTACGTTAGTGAAATTGCTCCAGCTG CAATTAGAGGTAAGTTAGTTGGTTGTTGGGAAGTTTCTTGGCAAGTTGG TGGTATCGTTGGTTATTGGATTAACTATGGTGTCTTGCAAACCCTGCCAA TCTCTTCTCAACAATGGATTATTCCATTCGCCGTTCAATTGATTCCATCT GGTTTGTTTTGGGGTTTGTGCTTGTTGATTCCAGAATCTCCAAGATTCTT GGTGTCCAAAGGTAAGATTGATAAGGCCAGAAAGAACTTGGCTTACTT GAGAGGTTTGTCTGAAGATCATCCATACTCCGTTTTTGAGTTGGAGAAC ATTTCCAAGGCCATCGAAGAAAACTTTGAACAAACAGGTAGAGGTTTCT TCGACCCATTGAAGGCTTTGTTTTTCAGCAAGAAAATGCTGTACAGGCT GCTGTTGTCTACTTCTATGTTTATGATGCAAAACGGCTACGGTATTAACG CTGTTACTTATTACTCTCCCACCATCTTTAAGTCCTTGGGTGTTCAAGGT TCTAATGCCGGTTTGTTATCTACTGGTATTTTCGGTTTGTTGAAAGGTGC CGCTTCTGTTTTTTGGGTTTTCTTCTTGGTTGATACCTTCGGTAGAAGATT CTGTTTGTGCTATTTGTCTTTGCCATGCTCTATCTGCATGTGGTATATTG GTGCCTACATTAAGATTGCTAACCCATCTGCTAAATTGGCTGCTGGTGA TACTGCTACTACTCCAGCTGGTACTGCTGCTAAAGCTATGTTGTATATTT GGACCATCTTCTACGGTATCACTTGGAATGGTACTACCTGGGTTATTTGC GCTGAAATTTTTCCACAATCTGTTAGAACAGCTGCTCAAGCTGTTAATG CTTCTTCTAATTGGTTTTGGGCCTTCATGATTGGTCATTTTACTGGTCAA GCTTTGGAAAACATTGGTTACGGTTACTACTTTTTGTTCGCTGCTTGTTC CGCTATTTTCCCAGTTGTAGTTTGGTTCGTTTACCCAGAAACAAAAGGT GTTCCATTGGAAGCTGTTGAATACTTGTTTGAAGTTAGACCATGGAAGG CTCATTCTTACGCTTTAGAAAAGTACCAGATCGAGTACAACGAAGGTGA ATTCCATCAACATAAGCCAGAAGTTTTGTTGCAGGGTTCTGAAAACTCT GATACCTCTGAAAAGTCTTTGGCCTGAAACGAAGGTGAATTCCACCAAC ATAAGCCAGAAGTTTTGTTGCAAGGTTCTGAAAACTCTGACACTTCTGA AAAGTCTTTGGCTTAA 26 Nucleic acid ATGTCAGAAAAGCCTGTTGTGTCGCACAGCATCGACACGACGCTGTCTA sequence of H0 CGTCATCGAAACAAGTCTATGACGGTAACTCGCTTCTTAAGACCCTGAA Metschnikowia TGAGCGCGATGGCGAACGCGGCAATATCTTGTCGCAGTACACTGAGGA species ACAGGCCATGCAAATGGGCCGCAACTATGCGTTGAAGCACAATTTAGA APS1/HGT19 TGCGACACTCTTTGGAAAGGCGGCCGCGGTCGCAAGAAACCCATACGA GTTCAATTCGATGAGTTTTTTGACCGAAGAGGAAAAAGTCGCGCTTAAC ACGGAGCAGACCAAGAAATGGCACATCCCAAGAAAGTTGGTGGAGGTG ATTGCATTGGGGTCCATGGCCGCTGCGGTGCAGGGTATGGATGAGTCGG TGGTGAATGGTGCAACGCTTTTCTACCCCACGGCAATGGGTATCACAGA TATCAAGAATGCCGATTTGATTGAAGGTTTGATCAACGGTGCGCCCTAT CTTTGCTGCGCCATCATGTGCTGGACATCTGATTACTGGAACAGGAAGT TGGGCCGTAAGTGGACCATTTTCTGGACATGTGCCATTTCTGCAATCAC ATGTATCTGGCAAGGTCTCGTCAATTTGAAATGGTACCATTTGTTCATTG CGCGTTTCTGCTTGGGTTTCGGTATCGGTGTCAAGTCTGCCACCGTGCCT GCGTATGCTGCCGAAACCACCCCGGCCAAAATCAGAGGCTCGTTGGTCA TGCTTTGGCAGTTCTTCACCGCTGTCGGAATCATGCTTGGTTACGTGGCG TCTTTGGCATTCTATTACATTGGTGACAATGGCATTTCTGGCGGCTTGAA CTGGAGATTGATGCTAGGATCTGCATGTCTTCCAGCTATCGTTGTGTTAG TCCAAGTTCCGTTTGTTCCAGAATCCCCTCGTTGGCTCATGGGTAAGGA AAGACACGCTGAAGCATATGATTCGCTCCGGCAATTGCGGTTCAGTGAA ATCGAGGCGGCCCGTGACTGTTTCTACCAGTACGTGTTGTTGAAAGAGG AGGGCTCTTATGGAACGCAGCCATTCTTCAGCAGAATCAAGGAGATGTT CACCGTGAGAAGAAACAGAAATGGTGCATTGGGCGCGTGGATCGTCAT GTTCATGCAGCAGTTCTGTGGAATCAACGTCATTGCTTACTACTCGTCGT CGATCTTCGTGGAGTCGAATCTTTCTGAGATCAAGGCCATGTTGGCGTC TTGGGGGTTCGGTATGATCAATTTCTTGTTTGCAATTCCAGCGTTCTACA CCATTGACACGTTTGGCCGACGCAACTTGTTGCTCACTACTTTCCCTCTT ATGGCGGTATTCTTACTCATGGCCGGATTCGGGTTCTGGATCCCGTTCG AGACAAACCCACACGGCCGTTTGGCGGTGATCACTATTGGTATCTATTT GTTTGCATGTGTCTACTCTGCGGGCGAGGGACCAGTTCCCTTCACATAC TCTGCCGAAGCATTCCCGTTGTATATCCGTGACTTGGGTATGGGCTTTGC CACGGCCACGTGTTGGTTCTTCAACTTCATTTTGGCATTTTCCTGGCCTA GAATGAAGAATGCATTCAAGCCTCAAGGTGCCTTTGGCTGGTATGCCGC CTGGAACATTGTTGGCTTCTTCTTAGTGTTATGGTTCTTGCCCGAGACAA AGGGCTTGACGTTGGAGGAATTGGACGAAGTGTTTGATGTGCCTTTGAG AAAACACGCGCACTACCGTACCAAAGAATTAGTATACAACTTGCGCAA ATACTTCTTGAGGCAGAACCCTAAGCCATTGCCGCCACTTTATGCACAC CAAAGAATGGCTGTTACCAACCCAGAATGGTTGGAAAAGACCGAGGTC ACGCACGAGGAGAATATCTAG 27 Nucleic acid ATGTCTGAAAAGCCAGTTGTTTCTCACTCTATCGACACCACCTCTTCTAC sequence of H0 CTCTTCTAAGCAAGTCTACGACGGTAACTCTTTGTTGAAGACCTCTAAC Metschnikowia GAAAGAGACGGTGAAAGAGGTAACATCTTGTCTCAATACACTGAAGAA species CAAGCAATGCAAATGGGTAGAAACTACGCTTTGAAGCACAACTTGGAC APS1/HGT19 GCTACCTTGTTCGGTAAGGCTGCTGCTGTCGCTAGAAACCCATACGAGT codon optimized TCAACTCTATGTCTTTCTTGACCGAAGAAGAAAAGGTCGCTTTGAACAC for expression in CGAACAAACCAAGAAGTGGCACATCCCAAGAAAGTTGGTTGAAGTTAT S. cerevisiae TGCTTTGGGTTCTATGGCTGCTGCTGTTCAAGGTATGGACGAATCTGTTG TTAACGGTGCTACCTTGTTCTACCCAACCGCTATGGGTATCACCGACAT CAAGAACGCTGACTTGATTGAAGGTTTGATTAACGGTGCCCCATACTTG TGTTGTGCTATTATGTGTTGGACCTCTGACTACTGGAACAGAAAGTTGG GTAGAAAGTGGACCATTTTCTGGACCTGTGCTATTTCTGCTATCACCTGT ATCTGGCAAGGTTTGGTCAACTTGAAGTGGTATCACTTGTTCATTGCTA GATTCTGTTTGGGTTTCGGTATCGGTGTCAAGTCTGCTACCGTTCCAGCC TACGCTGCTGAAACCACCCCAGCCAAGATTAGAGGTTCTTTGGTTATGT TGTGGCAATTCTTCACCGCTGTCGGTATTATGTTGGGTTACGTTGCTTCT TTGGCTTTCTACTACATTGGTGACAACGGTATTTCTGGTGGTTTGAACTG GAGATTGATGTTGGGTTCTGCTTGTTTGCCAGCCATCGTTGTTTTGGTCC AAGTTCCATTCGTTCCAGAATCTCCAAGATGGTTGATGGGTAAGGAAAG ACACGCTGAAGCCTACGACTCTTTGAGACAATTGAGATTCTCTGAAATC GAAGCCGCTAGAGACTGTTTCTACCAATACGTTTTGTTGAAGGAAGAAG GTTCTTACGGTACTCAACCATTCTTCTCTAGAATCAAGGAAATGTTCACC GTTAGAAGAAACAGAAACGGTGCTTTGGGTGCTTGGATTGTTATGTTTA TGCAACAATTCTGTGGTATCAACGTCATTGCTTACTACTCTTCTTCTATC TTCGTTGAATCTAACTTGTCTGAAATCAAGGCTATGTTGGCTTCTTGGGG TTTCGGTATGATTAACTTCTTGTTCGCTATTCCAGCCTTCTACACCATTG ACACCTTCGGTAGAAGAAACTTGTTGTTGACTACTTTCCCATTGATGGCT GTTTTCTTGTTGATGGCTGGTTTCGGTTTCTGGATTCCATTCGAAACCAA CCCACACGGTAGATTGGCTGTTATCACTATTGGTATCTACTTGTTCGCTT GTGTCTACTCTGCTGGTGAAGGTCCAGTTCCATTCACCTACTCTGCTGAA GCCTTCCCATTGTACATCAGAGACTTGGGTATGGGTTTCGCTACCGCTA CCTGTTGGTTCTTCAACTTCATTTTGGCTTTCTCTTGGCCAAGAATGAAG AACGCTTTCAAGCCTCAAGGTGCTTTCGGTTGGTACGCTGCTTGGAACA TTGTTGGTTTCTTCTTGGTTTTGTGGTTCTTGCCAGAAACTAAGGGTTTG ACTTTGGAAGAATTGGACGAAGTTTTCGACGTTCCATTGAGAAAGCACG CTCACTACAGAACTAAGGAATTGGTTTACAACTTGAGAAAGTACTTCTT GAGACAAAACCCAAAGCCATTGCCACCATTGTACGCTCACCAAAGAAT GGCTGTTACCAACCCAGAATGGTTGGAAAAGACCGAAGTCACCCACGA AGAAAACATCTAA 44 Amino Acid MSERPVVSHSIDTTSSTSSRQVYDGNSLLRTSNERDGERGNILSQYTEEQAM sequence of QMGRNYALKHNLDATLFGKAAAVARNPYEFNSMSFLTEEERVALNTEQT ubiquitin-deficient KKWHIPRKLVEVIALGSMAAAVQGMDESVVNGATLFYPTAMGITDIKNAD H0 LIEGLINGAPYLCCAIMCWTSDYWNRKLGRKWTIFWTCAISAITCIWQGLV Metschnikowia NLKWYHLFIARFCLGFGIGVKSATVPAYAAETTPAKIRGSLVMLWQFFTAV species GIMLGYVASLAFYYIGDNGISGGLNWRLMLGSACLPAIVVLVQVPFVPESP Aps1p/Hgt19 RWLMGKERHAEAYDSLRQLRFSEIEAARDCFYQYVLLKEEGSYGTQPFFSR codon optimized IKEMFTVRRNRNGALGAWIVMFMQQFCGINVIAYYSSSIFVESNLSEIKAML for expression in ASWGFGMINFLFAIPAFYTIDTFGRRNLLLTTFPLMAVFLLMAGFGFWIPFE S. cerevisiae TNPHGRLAVITIGIYLFACVYSAGEGPVPFTYSAEAFPLYIRDLGMGFATAT (with K4R; K20R; CWFFNFILAFSWPRMKNAFKPQGAFGWYAAWNIVGFFLVLWFLPETKGLT K30R and K93R LEELDEVFDVPLRKHAHYRTKELVYNLRKYFLRQNPKPLPPLYAHQRMAV mutations) TNPEWLEKTEVTHEENI 45 Amino Acid MSIFEGRDGRGVSSTESLSNDVRYDNMERVDQDVLRHNFNFDREFEELEIE sequence of AAQVNDRPSFVDRILSLEYKLHFENKNHMVWLLGAFAAAAGLLSGLDQSII ubiquitin-deficient SGASIGMNKALNLTEREASLVSSLMPLGAMAGSMIMTPLNEWFGRKSSLIIS H0 CIWYTIGSALCAGARDHHMMYAGRFILGVGVGIEGGCVGIYISESVPANVR Metschnikowia GSIVSMYQFNIALGEVLGYAVAAIFYTVHGGWRFMVGSSLVFSTILFAGLFF species Hxt5p LPESPRWLVHKGRNGMAYDVWKRLRDINDESAKLEFLEMRQAAYQERER (with K7R; K10R, RSQESLFSSWGELFTIARNRRALTYSVIMITLGQLTGVNAVMYYMSTLMGA K29R; K43R and IGFNEKDSVFMSLVGGGSLLIGTIPAILWMDRFGRRVWGYNLVGFFVGLVL K58R mutations) VGVGYRFNPVTQKAASEGVYLTGLIVYFLFFGSYSTLTWVIPSESFDLRTRS LGMTICSTFLYLWSFTVTYNFTKMSAAFTYTGLTLGFYGGIAFLGLIYQVCF MPETKDKTLEEIDDIFNRSAFSIARENISNLKKGIW 46 Amino Acid MSAEQEQQVSGTSATIDGLASLRQERTAEEEDAFRPKPATAYFFISFLCGLV sequence of AFGGYVFGFDTGTISGFVNMDDYLMRFGQQHADGTYYLSNVRTGLIVSIFN ubiquitin-deficient IGCAVGGLALSKVGDIWGRRIGIMVAMIIYMVGIIIQIASQDKWYQYFIGRLI H0 TGLGVGTTSVLSPLFISESAPKHLRGTLVCCFQLMVTLGIFLGYCTTYGTKN Metschnikowia YTDSRQWRIPLGLCFAWALLLISGMVFMPESPRFLIERQRFDEAKASVAKS species NQVSTEDPAVYTEVELIQAGIDREALAGSAGWKELITGKPKMLQRVILGM Gxf2p/Gal2p MLQSIQQLTGNNYFFYYGTTIFKAVGMSDSFQTSIVLGIVNFASTFVGIWAI (with K23R, ERMGRRSCLLVGSACMSVCFLIYSILGSVNLYIDGYENTPSNTRKPTGNAMI K26R, K35R, FITCLFIFFFASTWAGGVYSIVSETYPLRIRSKGMAVATAANWMWGFLISFF K542R and TPFITSAIHFYYGFVFTGCLIFSFFYVFFFVRETKGLSLEEVDELYATDLPPW K546R mutations) KTAGWTPPSAEDMAHTTGFAEAARPTNRHV 47 Amino Acid MSQDELHTRSGVETPINDSLLEERHDVTPLAALPEKSFKDYISISIFCLFVAF sequence of GGFVFGFDTGTISGFVNMSDFKTRFGEMNAQGEYYLSNVRTGLMVSIFNV ubiquitin-deficient GCAVGGIFLCKIADVYGRRIGLMFSMVVYVVGIIIQIASTTKWYQYFIGRLI H0 AGLAVGTVSVISPLFISEVAPKQLRGTLVCCFQLCITLGIFLGYCTTYGTKTY Metschnikowia TDSRQWRIPLGICFAWALFLVAGMLNMPESPRYLVEKSRIDDARKSIARSN species Gxf1p KVSEEDPAVYTEVQLIQAGIDREALAGSATWMELVTGKPKIFRRVIMGVM (with K9R and LQSLQQLTGDNYFFYYGTTIFKAVGLQDSFQTSIILGIVNFASTFVGIYAIER K24R mutations) MGRRLCLLTGSACMFVCFIIYSLIGTQHLYKNGFSNEPSNTYKPSGNAMIFIT CLYIFFFASTWAGGVYCIVSESYPLRIRSKAMSVATAANWMWGFLISFFTPF ITSAIHFYYGFVFTGCLAFSFFYVYFFVVETKGLSLEEVDILYASGTLPWKSS GWVPPTADEMAHNAFDNKPTDEQV 48 Amino Acid MGYEERLVAPALKFKNFLDKTPNIHNVYVIAAISCTSGMMFGFDISSMSVF sequence of VDQQPYLKMFDNPSSVIQGFITALMSLGSFFGSLTSTFISEPFGRRASLFICGI ubiquitin-deficient LWVIGAAVQSSSQNRAQLICGRIIAGWGIGFGSSVAPVYGSEMAPRKIRGTI H0 GGIFQFSVTVGIFIMFLIGYGCSFIQGKASFRIPWGVQMVPGLILLIGLFFIPES Metschnikowia PRWLAKQGYWEDAEIIVANVQAKGNRNDANVQIEMSEIKDQLMLDEHLK species Xyt1p EFTYADLFTKKYRQRTITAIFAQIWQQLTGMNVMMYYIVYIFQMAGYSGN (with K6R and TNLVPSLIQYIINMAVTVPALFCLDLLGRRTILLAGAAFMMAWQFGVAGIL S75L mutations) ATYSEPAYISDTVRITIPDDHKSAAKGVIACCYLFVCSFAFSWGVGIWVYCS EVWGDSQSRQRGAALATSANWIFNFAIAMFTPSSFKNITWKTYIIYATFCAC MFIHVFFFFPETKGKRLEEIGQLWDEGVPAWRSAKWQPTVPLASDAELAH KMDVAHAEHADLLATHSPSSDEKTGTV 49 Nucleic acid ATGTCTGAAAGACCAGTTGTTTCTCACTCTATCGACACCACCTCTTCTAC sequence of CTCTTCTAGACAAGTCTACGACGGTAACTCTTTGTTGAGGACCTCTAAC ubiquitin-deficient GAAAGAGACGGTGAAAGAGGTAACATCTTGTCTCAATACACTGAAGAA H0 CAAGCAATGCAAATGGGTAGAAACTACGCTTTGAAGCACAACTTGGAC Metschnikowia GCTACCTTGTTCGGTAAGGCTGCTGCTGTCGCTAGAAACCCATACGAGT species TCAACTCTATGTCTTTCTTGACCGAAGAAGAAAGAGTCGCTTTGAACAC APS1/HGT19 CGAACAAACCAAGAAGTGGCACATCCCAAGAAAGTTGGTTGAAGTTAT (with K4R; K20R; TGCTTTGGGTTCTATGGCTGCTGCTGTTCAAGGTATGGACGAATCTGTTG K30R and K93R TTAACGGTGCTACCTTGTTCTACCCAACCGCTATGGGTATCACCGACAT mutations) CAAGAACGCTGACTTGATTGAAGGTTTGATTAACGGTGCCCCATACTTG TGTTGTGCTATTATGTGTTGGACCTCTGACTACTGGAACAGAAAGTTGG GTAGAAAGTGGACCATTTTCTGGACCTGTGCTATTTCTGCTATCACCTGT ATCTGGCAAGGTTTGGTCAACTTGAAGTGGTATCACTTGTTCATTGCTA GATTCTGTTTGGGTTTCGGTATCGGTGTCAAGTCTGCTACCGTTCCAGCC TACGCTGCTGAAACCACCCCAGCCAAGATTAGAGGTTCTTTGGTTATGT TGTGGCAATTCTTCACCGCTGTCGGTATTATGTTGGGTTACGTTGCTTCT TTGGCTTTCTACTACATTGGTGACAACGGTATTTCTGGTGGTTTGAACTG GAGATTGATGTTGGGTTCTGCTTGTTTGCCAGCCATCGTTGTTTTGGTCC AAGTTCCATTCGTTCCAGAATCTCCAAGATGGTTGATGGGTAAGGAAAG ACACGCTGAAGCCTACGACTCTTTGAGACAATTGAGATTCTCTGAAATC GAAGCCGCTAGAGACTGTTTCTACCAATACGTTTTGTTGAAGGAAGAAG GTTCTTACGGTACTCAACCATTCTTCTCTAGAATCAAGGAAATGTTCACC GTTAGAAGAAACAGAAACGGTGCTTTGGGTGCTTGGATTGTTATGTTTA TGCAACAATTCTGTGGTATCAACGTCATTGCTTACTACTCTTCTTCTATC TTCGTTGAATCTAACTTGTCTGAAATCAAGGCTATGTTGGCTTCTTGGGG TTTCGGTATGATTAACTTCTTGTTCGCTATTCCAGCCTTCTACACCATTG ACACCTTCGGTAGAAGAAACTTGTTGTTGACTACTTTCCCATTGATGGCT GTTTTCTTGTTGATGGCTGGTTTCGGTTTCTGGATTCCATTCGAAACCAA CCCACACGGTAGATTGGCTGTTATCACTATTGGTATCTACTTGTTCGCTT GTGTCTACTCTGCTGGTGAAGGTCCAGTTCCATTCACCTACTCTGCTGAA GCCTTCCCATTGTACATCAGAGACTTGGGTATGGGTTTCGCTACCGCTA CCTGTTGGTTCTTCAACTTCATTTTGGCTTTCTCTTGGCCAAGAATGAAG AACGCTTTCAAGCCTCAAGGTGCTTTCGGTTGGTACGCTGCTTGGAACA TTGTTGGTTTCTTCTTGGTTTTGTGGTTCTTGCCAGAAACTAAGGGTTTG ACTTTGGAAGAATTGGACGAAGTTTTCGACGTTCCATTGAGAAAGCACG CTCACTACAGAACTAAGGAATTGGTTTACAACTTGAGAAAGTACTTCTT GAGACAAAACCCAAAGCCATTGCCACCATTGTACGCTCACCAAAGAAT GGCTGTTACCAACCCAGAATGGTTGGAAAAGACCGAAGTCACCCACGA AGAAAACATCTAA 50 Nucleic acid ATGTCCATTTTCGAAGGTAGGGATGGTAGAGGTGTTTCCTCTACTGAAT sequence of CCTTGTCTAACGATGTTAGATACGACAACATGGAAAGAGTTGACCAAG ubiquitin-deficient ATGTTTTGAGGCACAATTTCAACTTCGACAGAGAGTTCGAAGAATTGGA H0 AATTGAAGCTGCCCAAGTTAACGATAGACCATCTTTCGTTGATAGGATC Metschnikowia TTGTCTTTGGAGTACAAGTTGCACTTCGAAAACAAGAATCACATGGTTT species HXT5 GGTTGTTGGGTGCTTTTGCTGCTGCTGCAGGTTTGTTGTCTGGTTTGGAT (with K7R; K10R, CAATCTATTATTTCCGGTGCCTCTATCGGTATGAACAAGGCTTTGAATTT K29R; K43R and GACCGAAAGAGAAGCCTCTTTGGTCAGTTCTTTGATGCCATTGGGTGCT K58R mutations) ATGGCTGGTTCTATGATTATGACTCCATTGAATGAATGGTTCGGCCGTA AATCCTCCTTGATTATTTCTTGTATTTGGTACACCATCGGTTCTGCTTTGT GTGCTGGTGCTAGAGATCATCACATGATGTATGCTGGTAGATTCATCTT AGGTGTTGGTGTTGGTATTGAAGGTGGTTGCGTTGGTATCTACATTTCTG AATCTGTTCCAGCCAATGTCAGAGGTTCTATCGTTTCTATGTACCAGTTC

AACATTGCCTTGGGTGAAGTTTTGGGTTATGCTGTTGCTGCTATTTTCTA CACTGTTCATGGTGGTTGGAGGTTTATGGTTGGTTCTTCTTTGGTTTTCT CCACCATTTTGTTTGCCGGCTTGTTTTTTTTGCCAGAATCTCCAAGATGG TTGGTCCATAAGGGTAGAAATGGTATGGCTTACGATGTTTGGAAGAGAT TGAGAGATATCAACGATGAATCCGCCAAGTTGGAATTCTTGGAAATGA GACAAGCTGCCTACCAAGAAAGAGAAAGAAGATCTCAAGAGTCCTTGT TTTCTTCATGGGGTGAGTTGTTTACCATTGCTAGAAATAGAAGGGCTTT GACCTACTCCGTTATTATGATTACTTTGGGTCAGTTGACTGGTGTTAACG CTGTTATGTATTACATGTCTACTTTGATGGGTGCCATCGGTTTTAACGAA AAGGATTCTGTTTTCATGTCCTTGGTTGGTGGTGGTTCTTTGTTGATTGG TACTATTCCAGCTATCTTGTGGATGGATAGATTCGGTAGAAGAGTTTGG GGTTACAATTTGGTTGGTTTTTTCGTCGGTTTGGTATTGGTCGGTGTTGG TTATAGATTCAACCCAGTTACTCAAAAGGCTGCTTCTGAAGGTGTTTATT TGACTGGTTTGATCGTCTACTTCTTGTTCTTCGGTTCTTACTCTACATTGA CCTGGGTTATTCCATCCGAATCTTTCGATTTGAGAACCAGATCTTTGGGT ATGACCATTTGCTCTACTTTCTTGTACTTGTGGTCTTTCACTGTCACTTAC AACTTCACTAAGATGTCTGCTGCTTTCACTTACACAGGTTTGACTTTGGG TTTTTACGGTGGTATTGCTTTCTTGGGTTTGATCTACCAAGTTTGCTTTAT GCCAGAAACTAAGGACAAGACCTTGGAAGAAATCGATGACATCTTTAA CAGATCCGCTTTCTCTATTGCCAGGGAAAACATTAGCAACTTGAAGAAA GGTATCTGGTAA 51 Nucleic acid ATGTCCGCTGAACAAGAACAACAAGTTTCTGGTACTTCTGCCACTATTG sequence of ATGGTTTGGCTTCTTTGAGGCAAGAAAGGACTGCTGAAGAAGAAGATG ubiquitin-deficient CTTTTAGGCCAAAACCAGCTACTGCCTACTTCTTCATTTCTTTCTTGTGT H0 GGTTTGGTTGCTTTCGGTGGTTACGTTTTTGGTTTTGATACCGGTACTAT Metschnikowia CTCCGGTTTCGTTAACATGGATGATTACTTGATGAGATTCGGTCAACAA species CATGCTGATGGTACTTACTACTTGTCCAATGTTAGAACCGGTTTGATCGT GXF2/GAL2 CAGTATTTTCAACATTGGTTGTGCTGTTGGTGGTTTGGCATTGTCTAAAG (with K23R, TTGGTGATATTTGGGGTAGAAGAATCGGTATTATGGTTGCCATGATCAT K26R, K35R, CTACATGGTTGGTATCATTATTCAAATCGCCTCCCAAGACAAGTGGTAT K542R and CAATACTTTATTGGTAGATTGATCACCGGTTTGGGTGTTGGTACTACTTC K546R mutations) TGTTTTGTCTCCTTTGTTCATTTCCGAATCCGCTCCAAAACATTTGAGAG GTACTTTGGTTTGCTGCTTCCAATTGATGGTAACCTTGGGTATTTTCTTG GGTTACTGTACTACTTACGGTACTAAGAACTACACCGATTCTAGACAAT GGAGAATTCCATTGGGTTTGTGTTTTGCTTGGGCCTTGTTGTTGATTTCT GGTATGGTTTTTATGCCAGAATCCCCAAGATTCTTGATCGAAAGACAAA GATTCGATGAAGCTAAGGCTTCTGTTGCCAAGTCTAATCAAGTTTCTAC TGAAGATCCAGCCGTTTACACTGAAGTTGAATTGATTCAAGCCGGTATT GATAGAGAAGCTTTGGCTGGTTCTGCTGGTTGGAAAGAATTGATTACTG GTAAGCCAAAGATGTTGCAAAGAGTCATTTTGGGTATGATGTTACAATC CATCCAACAATTGACCGGTAACAATTACTTCTTCTACTACGGTACAACC ATCTTCAAAGCTGTTGGTATGTCCGATTCTTTTCAAACCTCTATAGTCTT GGGTATCGTTAACTTCGCTTCTACCTTTGTTGGTATTTGGGCCATTGAAA GAATGGGTAGAAGATCTTGTTTGTTGGTTGGTTCAGCTTGTATGTCTGTT TGCTTCTTGATCTACTCTATCTTGGGTTCAGTCAACTTGTACATCGATGG TTACGAAAACACTCCATCTAACACTAGAAAGCCAACTGGTAACGCCATG ATTTTCATTACCTGTTTGTTCATCTTTTTCTTCGCCTCTACTTGGGCTGGT GGTGTTTATTCTATAGTTTCTGAAACCTACCCATTGAGAATCAGATCTAA AGGTATGGCTGTTGCTACTGCTGCTAATTGGATGTGGGGTTTTTTGATCT CTTTCTTTACCCCATTCATCACCTCCGCTATTCATTTTTACTACGGTTTTG TTTTCACCGGTTGCTTGATCTTCTCATTCTTTTACGTATTCTTTTTCGTCC GTGAAACTAAGGGTTTGTCCTTGGAAGAAGTTGACGAATTATACGCTAC TGATTTGCCACCATGGAAAACTGCAGGTTGGACTCCACCATCAGCTGAA GATATGGCTCATACAACTGGTTTTGCTGAAGCTGCTAGGCCTACAAACA GACACGTTTGA 52 Nucleic acid ATGTCTCAAGATGAATTGCACACCAGATCTGGTGTTGAAACTCCAATCA sequence of ACGACTCCTTGTTGGAAGAAAGACATGATGTTACTCCATTGGCTGCTTT ubiquitin-deficient GCCAGAAAAATCTTTCAAGGACTACATCTCCATCTCCATTTTCTGTTTGT H0 TTGTTGCTTTCGGTGGTTTCGTTTTCGGTTTTGATACTGGTACTATTTCCG Metschnikowia GTTTCGTTAACATGTCTGATTTCAAGACTAGGTTCGGTGAAATGAATGC species GXF1 TCAGGGTGAATATTACTTGTCCAACGTTAGAACTGGCCTGATGGTTTCT (with K9R and ATTTTCAATGTTGGTTGTGCTGTCGGTGGTATTTTCTTGTGTAAAATTGC K24R mutations) TGATGTCTACGGTAGAAGGATCGGTTTGATGTTTTCTATGGTTGTCTACG TTGTCGGTATCATTATTCAAATTGCTTCTACCACCAAGTGGTATCAGTAC TTCATTGGTAGATTGATTGCTGGTTTGGCTGTTGGTACTGTTTCTGTTAT TTCCCCTTTGTTCATTTCCGAAGTTGCTCCAAAACAATTGAGAGGTACTT TGGTTTGCTGTTTCCAATTGTGTATTACCTTGGGTATCTTCTTGGGTTACT GTACTACTTACGGTACTAAGACTTACACCGATTCTAGACAATGGCGTAT TCCATTGGGTATTTGTTTTGCTTGGGCTTTGTTTTTGGTTGCCGGTATGTT GAATATGCCAGAATCTCCAAGATACTTGGTCGAAAAGTCCAGAATTGAT GATGCCAGAAAGTCCATTGCTAGGTCTAACAAAGTTTCCGAAGAAGATC CAGCTGTTTACACCGAAGTTCAATTGATTCAAGCCGGTATTGATAGAGA AGCTTTGGCTGGTTCTGCTACTTGGATGGAATTGGTTACTGGTAAGCCT AAGATCTTTAGAAGAGTTATCATGGGTGTCATGTTGCAATCCTTGCAAC AATTGACTGGTGACAACTACTTTTTCTACTACGGTACAACCATTTTCAAG GCTGTCGGTTTACAAGATTCTTTCCAAACCTCCATCATTTTGGGTATCGT TAACTTCGCTTCTACCTTCGTTGGTATCTACGCTATTGAAAGAATGGGTA GAAGATTGTGTTTGTTGACAGGTTCTGCTTGTATGTTCGTTTGCTTCATC ATCTACTCATTGATCGGTACTCAGCACTTGTACAAAAACGGTTTTTCTAA CGAACCCTCCAACACTTACAAACCATCTGGTAATGCCATGATCTTCATT ACCTGCCTGTACATTTTCTTTTTCGCTTCAACTTGGGCTGGTGGTGTTTA CTGTATAGTTTCTGAATCTTACCCACTGAGGATCAGATCTAAAGCTATG TCTGTTGCTACTGCTGCAAATTGGATGTGGGGTTTTTTGATTTCTTTCTTT ACCCCATTCATCACCTCCGCTATCCATTTTTACTATGGTTTTGTTTTCACC GGTTGCTTGGCTTTCTCTTTCTTTTACGTTTACTTCTTCGTCGTCGAGACT AAGGGTTTGTCTTTGGAAGAGGTTGATATCTTGTATGCCTCTGGTACTTT GCCATGGAAATCTTCAGGTTGGGTTCCACCAACTGCTGACGAAATGGCT CATAATGCTTTTGATAACAAACCAACCGATGAACAGGTTTAA 53 Nucleic acid ATGGGATACGAAGAGAGATTAGTGGCCCCCGCTTTGAAATTTAAGAACT sequence of TTTTGGATAAGACCCCAAATATACATAACGTTTACGTAATTGCGGCGAT ubiquitin-deficient CTCGTGTACCTCAGGTATGATGTTCGGTTTCGATATATCGTCGATGTCCG H0 TGTTCGTGGACCAACAGCCGTATTTAAAAATGTTTGATAACCCTAGCAG Metschnikowia CGTGATACAAGGGTTTATAACTGCGTTGATGTCTTTGGGGAGCTTTTTCG species XYT1 GATCGCTAACGTCCACTTTTATTTCAGAACCTTTTGGTAGACGTGCCTCT (with K6R and TTGTTCATATGCGGGATCCTTTGGGTAATTGGGGCGGCAGTTCAAAGTT S75L mutations) CTTCTCAGAACCGTGCGCAGCTTATTTGTGGCCGAATTATTGCAGGGTG GGGCATCGGATTCGGTTCTAGCGTTGCGCCGGTATACGGTTCAGAAATG GCCCCACGCAAAATTAGAGGAACAATCGGAGGTATTTTTCAATTTTCTG TCACGGTCGGAATATTCATAATGTTCCTGATTGGCTACGGCTGCTCATTT ATACAAGGCAAGGCCAGTTTTAGAATTCCGTGGGGAGTTCAAATGGTAC CAGGTCTCATTCTGTTGATCGGACTATTCTTCATTCCTGAATCCCCAAGA TGGTTAGCCAAACAAGGCTACTGGGAAGACGCTGAGATCATCGTAGCA AACGTTCAAGCTAAGGGTAACAGGAACGATGCTAATGTGCAAATTGAA ATGTCCGAGATAAAAGATCAGTTAATGCTTGACGAGCATTTAAAGGAGT TTACTTATGCCGATTTGTTTACCAAAAAATACCGGCAAAGGACGATAAC AGCTATATTTGCCCAAATATGGCAACAGCTGACAGGTATGAATGTCATG ATGTACTACATCGTATATATATTTCAAATGGCAGGTTATTCAGGTAATA CTAATTTAGTTCCTTCACTCATTCAGTATATTATAAATATGGCTGTTACG GTCCCCGCATTGTTCTGTCTTGATCTGCTTGGCAGGAGGACAATTTTATT AGCTGGCGCCGCTTTTATGATGGCCTGGCAATTTGGTGTTGCTGGCATTT TAGCTACTTATTCAGAGCCAGCCTATATTTCAGATACCGTGAGAATTAC AATTCCAGATGACCATAAAAGTGCCGCTAAGGGTGTCATCGCTTGCTGC TATTTGTTTGTTTGTTCCTTCGCCTTTTCCTGGGGTGTAGGTATCTGGGTT TATTGTTCAGAAGTGTGGGGTGATAGTCAATCCAGACAAAGAGGTGCTG CATTGGCAACTTCTGCTAATTGGATCTTCAATTTCGCAATTGCAATGTTT ACACCTTCTTCTTTCAAAAATATCACTTGGAAGACTTATATCATTTATGC TACATTTTGTGCTTGTATGTTCATTCATGTTTTTTTTTTTTTCCCTGAAAC AAAGGGTAAGAGACTAGAAGAAATTGGACAGCTATGGGATGAAGGTGT CCCAGCATGGAGATCTGCAAAATGGCAACCCACTGTCCCACTAGCAAGT GACGCTGAATTAGCTCACAAAATGGATGTTGCACACGCTGAACACGCA GACTTATTGGCAACCCATTCTCCAAGTAGTGACGAAAAAACTGGTACCG TTTAA 54 Amino Acid MSQDELHTRSGVETPINDSLLEERHDVTPLAALPEKSFKDYISISIFCLFVAF sequence of GGFVFGFDTGTISGFVNMSDFKTRFGEMNAQGEYYLSNVRTGLMVSIFNV ubiquitin-deficient GCAVGGIFLCKIADVYGRRIGLMFSMVVYVVGIIIQIASTTKWYQYFIGRLI H0 AGLAVGTVSVISPLFISEVAPKQLRGTLVCCFQLCITLGIFLGYCTTYGTKTY Metschnikowia TDSRQWRIPLGICFAWALFLVAGMLNMPESPRYLVEKSRIDDARKSIARSN species Gxf1p KVSEEDPAVYTEVQLIQAGIDREALAGSATWMELVTGKPKIFRRVIMGVM (with K9R; K24R, LQSLQQLTGDNYFFYYGTTIFKAVGLQDSFQTSIILGIVNFASTFVGIYAIER K538R mutations) MGRRLCLLTGSACMFVCFIIYSLIGTQHLYKNGFSNEPSNTYKPSGNAMIFIT CLYIFFFASTWAGGVYCIVSESYPLRIRSKAMSVATAANWMWGFLISFFTPF ITSAIHFYYGFVFTGCLAFSFFYVYFFVVETKGLSLEEVDILYASGTLPWKSS GWVPPTADEMAHNAFDNRPTDEQV 55 Amino Acid MGYEERLVAPALKFKNFLDKTPNIHNVYVIAAISCTSGMMFGFDISSMSVF sequence of VDQQPYLKMFDNPSSVIQGFITALMSLGSFFGSLTSTFISEPFGRRASLFICGI ubiquitin-deficient LWVIGAAVQSSSQNRAQLICGRIIAGWGIGFGSSVAPVYGSEMAPRKIRGTI H0 GGIFQFSVTVGIFIMFLIGYGCSFIQGKASFRIPWGVQMVPGLILLIGLFFIPES Metschnikowia PRWLAKQGYWEDAEIIVANVQAKGNRNDANVQIEMSEIKDQLMLDEHLK species Xyt1p EFTYADLFTKKYRQRTITAIFAQIWQQLTGMNVMMYYIVYIFQMAGYSGN (with K6R, S75L, TNLVPSLIQYIINMAVTVPALFCLDLLGRRTILLAGAAFMMAWQFGVAGIL K517R, K539R ATYSEPAYISDTVRITIPDDHKSAAKGVIACCYLFVCSFAFSWGVGIWVYCS mutations) EVWGDSQSRQRGAALATSANWIFNFAIAMFTPSSFKNITWKTYIIYATFCAC MFIHVFFFFPETKGKRLEEIGQLWDEGVPAWRSAKWQPTVPLASDAELAH RMDVAHAEHADLLATHSPSSDERTGTV 56 Nucleic acid ATGTCTCAAGATGAATTGCACACCAGATCTGGTGTTGAAACTCCAATCA sequence of ACGACTCCTTGTTGGAAGAAAGACATGATGTTACTCCATTGGCTGCTTT ubiquitin-deficient GCCAGAAAAATCTTTCAAGGACTACATCTCCATCTCCATTTTCTGTTTGT H0 TTGTTGCTTTCGGTGGTTTCGTTTTCGGTTTTGATACTGGTACTATTTCCG Metschnikowia GTTTCGTTAACATGTCTGATTTCAAGACTAGGTTCGGTGAAATGAATGC species GXF1 TCAGGGTGAATATTACTTGTCCAACGTTAGAACTGGCCTGATGGTTTCT (with K9R; K24R, ATTTTCAATGTTGGTTGTGCTGTCGGTGGTATTTTCTTGTGTAAAATTGC K538R mutations) TGATGTCTACGGTAGAAGGATCGGTTTGATGTTTTCTATGGTTGTCTACG TTGTCGGTATCATTATTCAAATTGCTTCTACCACCAAGTGGTATCAGTAC TTCATTGGTAGATTGATTGCTGGTTTGGCTGTTGGTACTGTTTCTGTTAT TTCCCCTTTGTTCATTTCCGAAGTTGCTCCAAAACAATTGAGAGGTACTT TGGTTTGCTGTTTCCAATTGTGTATTACCTTGGGTATCTTCTTGGGTTACT GTACTACTTACGGTACTAAGACTTACACCGATTCTAGACAATGGCGTAT TCCATTGGGTATTTGTTTTGCTTGGGCTTTGTTTTTGGTTGCCGGTATGTT GAATATGCCAGAATCTCCAAGATACTTGGTCGAAAAGTCCAGAATTGAT GATGCCAGAAAGTCCATTGCTAGGTCTAACAAAGTTTCCGAAGAAGATC CAGCTGTTTACACCGAAGTTCAATTGATTCAAGCCGGTATTGATAGAGA AGCTTTGGCTGGTTCTGCTACTTGGATGGAATTGGTTACTGGTAAGCCT AAGATCTTTAGAAGAGTTATCATGGGTGTCATGTTGCAATCCTTGCAAC AATTGACTGGTGACAACTACTTTTTCTACTACGGTACAACCATTTTCAAG GCTGTCGGTTTACAAGATTCTTTCCAAACCTCCATCATTTTGGGTATCGT TAACTTCGCTTCTACCTTCGTTGGTATCTACGCTATTGAAAGAATGGGTA GAAGATTGTGTTTGTTGACAGGTTCTGCTTGTATGTTCGTTTGCTTCATC ATCTACTCATTGATCGGTACTCAGCACTTGTACAAAAACGGTTTTTCTAA CGAACCCTCCAACACTTACAAACCATCTGGTAATGCCATGATCTTCATT ACCTGCCTGTACATTTTCTTTTTCGCTTCAACTTGGGCTGGTGGTGTTTA CTGTATAGTTTCTGAATCTTACCCACTGAGGATCAGATCTAAAGCTATG TCTGTTGCTACTGCTGCAAATTGGATGTGGGGTTTTTTGATTTCTTTCTTT ACCCCATTCATCACCTCCGCTATCCATTTTTACTATGGTTTTGTTTTCACC GGTTGCTTGGCTTTCTCTTTCTTTTACGTTTACTTCTTCGTCGTCGAGACT AAGGGTTTGTCTTTGGAAGAGGTTGATATCTTGTATGCCTCTGGTACTTT GCCATGGAAATCTTCAGGTTGGGTTCCACCAACTGCTGACGAAATGGCT CATAATGCTTTTGATAACAGACCAACCGATGAACAGGTTTAA 57 Nucleic acid ATGGGATACGAAGAGAGATTAGTGGCCCCCGCTTTGAAATTTAAGAACT sequence of TTTTGGATAAGACCCCAAATATACATAACGTTTACGTAATTGCGGCGAT ubiquitin-deficient CTCGTGTACCTCAGGTATGATGTTCGGTTTCGATATATCGTCGATGTCCG H0 TGTTCGTGGACCAACAGCCGTATTTAAAAATGTTTGATAACCCTAGCAG Metschnikowia CGTGATACAAGGGTTTATAACTGCGTTGATGTCTTTGGGGAGCTTTTTCG species XYT1 GATCGCTAACGTCCACTTTTATTTCAGAACCTTTTGGTAGACGTGCCTCT (with K6R, S75L, TTGTTCATATGCGGGATCCTTTGGGTAATTGGGGCGGCAGTTCAAAGTT K517R, K539R CTTCTCAGAACCGTGCGCAGCTTATTTGTGGCCGAATTATTGCAGGGTG mutations) GGGCATCGGATTCGGTTCTAGCGTTGCGCCGGTATACGGTTCAGAAATG GCCCCACGCAAAATTAGAGGAACAATCGGAGGTATTTTTCAATTTTCTG TCACGGTCGGAATATTCATAATGTTCCTGATTGGCTACGGCTGCTCATTT ATACAAGGCAAGGCCAGTTTTAGAATTCCGTGGGGAGTTCAAATGGTAC CAGGTCTCATTCTGTTGATCGGACTATTCTTCATTCCTGAATCCCCAAGA TGGTTAGCCAAACAAGGCTACTGGGAAGACGCTGAGATCATCGTAGCA AACGTTCAAGCTAAGGGTAACAGGAACGATGCTAATGTGCAAATTGAA ATGTCCGAGATAAAAGATCAGTTAATGCTTGACGAGCATTTAAAGGAGT TTACTTATGCCGATTTGTTTACCAAAAAATACCGGCAAAGGACGATAAC AGCTATATTTGCCCAAATATGGCAACAGCTGACAGGTATGAATGTCATG ATGTACTACATCGTATATATATTTCAAATGGCAGGTTATTCAGGTAATA CTAATTTAGTTCCTTCACTCATTCAGTATATTATAAATATGGCTGTTACG GTCCCCGCATTGTTCTGTCTTGATCTGCTTGGCAGGAGGACAATTTTATT AGCTGGCGCCGCTTTTATGATGGCCTGGCAATTTGGTGTTGCTGGCATTT TAGCTACTTATTCAGAGCCAGCCTATATTTCAGATACCGTGAGAATTAC AATTCCAGATGACCATAAAAGTGCCGCTAAGGGTGTCATCGCTTGCTGC TATTTGTTTGTTTGTTCCTTCGCCTTTTCCTGGGGTGTAGGTATCTGGGTT TATTGTTCAGAAGTGTGGGGTGATAGTCAATCCAGACAAAGAGGTGCTG CATTGGCAACTTCTGCTAATTGGATCTTCAATTTCGCAATTGCAATGTTT ACACCTTCTTCTTTCAAAAATATCACTTGGAAGACTTATATCATTTATGC TACATTTTGTGCTTGTATGTTCATTCATGTTTTTTTTTTTTTCCCTGAAAC AAAGGGTAAGAGACTAGAAGAAATTGGACAGCTATGGGATGAAGGTGT CCCAGCATGGAGATCTGCAAAATGGCAACCCACTGTCCCACTAGCAAGT GACGCTGAATTAGCTCACAGAATGGATGTTGCACACGCTGAACACGCA GACTTATTGGCAACCCATTCTCCAAGTAGTGACGAAAGAACTGGTACCG TTTAA 58 Amino Acid MSAEQEQQVSGTSATIDGLASLRQERTAEEEDAFRPKPATAYFFISFLCGLV sequence of AFGGYVFGFDTGTISGFVNMDDYLMRFGQQHADGTYYLSNVRTGLIVSIFN ubiquitin-deficient IGCAVGGLALSKVGDIWGRRIGIMVAMIIYMVGIIIQIASQDKWYQYFIGRLI H0 TGLGVGTTSVLSPLFISESAPKHLRGTLVCCFQLMVTLGIFLGYCTTYGTKN Metschnikowia YTDSRQWRIPLGLCFAWALLLISGMVFMPESPRFLIERQRFDEAKASVAKS species NQVSTEDPAVYTEVELIQAGIDREALAGSAGWKELITGKPKMLQRVILGM Gxf2p/Gal2p MLQSIQQLTGNNYFFYYGTTIFKAVGMSDSFQTSIVLGIVNFASTFVGIWAI (with K23R, ERMGRRSCLLVGSACMSVCFLIYSILGSVNLYIDGYENTPSNTRKPTGNAMI K26R, and K35R, FITCLFIFFFASTWAGGVYSIVSETYPLRIRSKGMAVATAANWMWGFLISFF mutations) TPFITSAIHFYYGFVFTGCLIFSFFYVFFFVRETKGLSLEEVDELYATDLPPW KTAGWTPPSAEDMAHTTGFAEAAKPTNKHV 59 Nucleic Acid ATGTCCGCTGAACAAGAACAACAAGTTTCTGGTACTTCTGCCACTATTG sequence of ATGGTTTGGCTTCTTTGAGGCAAGAAAGGACTGCTGAAGAAGAAGATG ubiquitin-deficient CTTTTAGGCCAAAACCAGCTACTGCCTACTTCTTCATTTCTTTCTTGTGT H0 GGTTTGGTTGCTTTCGGTGGTTACGTTTTTGGTTTTGATACCGGTACTAT Metschnikowia CTCCGGTTTCGTTAACATGGATGATTACTTGATGAGATTCGGTCAACAA species CATGCTGATGGTACTTACTACTTGTCCAATGTTAGAACCGGTTTGATCGT Gxf2p/Gal2p CAGTATTTTCAACATTGGTTGTGCTGTTGGTGGTTTGGCATTGTCTAAAG (with K23R, TTGGTGATATTTGGGGTAGAAGAATCGGTATTATGGTTGCCATGATCAT K26R, and K35R, CTACATGGTTGGTATCATTATTCAAATCGCCTCCCAAGACAAGTGGTAT mutations) CAATACTTTATTGGTAGATTGATCACCGGTTTGGGTGTTGGTACTACTTC TGTTTTGTCTCCTTTGTTCATTTCCGAATCCGCTCCAAAACATTTGAGAG GTACTTTGGTTTGCTGCTTCCAATTGATGGTAACCTTGGGTATTTTCTTG GGTTACTGTACTACTTACGGTACTAAGAACTACACCGATTCTAGACAAT GGAGAATTCCATTGGGTTTGTGTTTTGCTTGGGCCTTGTTGTTGATTTCT GGTATGGTTTTTATGCCAGAATCCCCAAGATTCTTGATCGAAAGACAAA GATTCGATGAAGCTAAGGCTTCTGTTGCCAAGTCTAATCAAGTTTCTAC TGAAGATCCAGCCGTTTACACTGAAGTTGAATTGATTCAAGCCGGTATT GATAGAGAAGCTTTGGCTGGTTCTGCTGGTTGGAAAGAATTGATTACTG GTAAGCCAAAGATGTTGCAAAGAGTCATTTTGGGTATGATGTTACAATC

CATCCAACAATTGACCGGTAACAATTACTTCTTCTACTACGGTACAACC ATCTTCAAAGCTGTTGGTATGTCCGATTCTTTTCAAACCTCTATAGTCTT GGGTATCGTTAACTTCGCTTCTACCTTTGTTGGTATTTGGGCCATTGAAA GAATGGGTAGAAGATCTTGTTTGTTGGTTGGTTCAGCTTGTATGTCTGTT TGCTTCTTGATCTACTCTATCTTGGGTTCAGTCAACTTGTACATCGATGG TTACGAAAACACTCCATCTAACACTAGAAAGCCAACTGGTAACGCCATG ATTTTCATTACCTGTTTGTTCATCTTTTTCTTCGCCTCTACTTGGGCTGGT GGTGTTTATTCTATAGTTTCTGAAACCTACCCATTGAGAATCAGATCTAA AGGTATGGCTGTTGCTACTGCTGCTAATTGGATGTGGGGTTTTTTGATCT CTTTCTTTACCCCATTCATCACCTCCGCTATTCATTTTTACTACGGTTTTG TTTTCACCGGTTGCTTGATCTTCTCATTCTTTTACGTATTCTTTTTCGTCC GTGAAACTAAGGGTTTGTCCTTGGAAGAAGTTGACGAATTATACGCTAC TGATTTGCCACCATGGAAAACTGCAGGTTGGACTCCACCATCAGCTGAA GATATGGCTCATACAACTGGTTTTGCTGAAGCTGCTAAGCCTACAAACA AACACGTTTGA

[0046] Expression of more than one xylose transporters can further improve xylose uptake. As such, the non-naturally occurring microbial organisms can have at least one exogenous nucleic acid, or at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or at least eleven nucleic acids each encoding a xylose transporter. In some embodiments, the microbial organisms have at least two exogenous nucleic acids each encoding a xylose transporter. In some embodiments, the microbial organisms have at least three exogenous nucleic acids each encoding a xylose transporter. In some embodiments, the microbial organisms have at least four exogenous nucleic acids each encoding a xylose transporter. In some embodiments, the microbial organisms have at least five exogenous nucleic acids each encoding a xylose transporter. In some embodiments, the microbial organisms have at least six exogenous nucleic acids each encoding a xylose transporter. In some embodiments, the microbial organisms have at least seven exogenous nucleic acids each encoding a xylose transporter. In some embodiments, the microbial organisms have at least eight exogenous nucleic acids each encoding a xylose transporter. In some embodiments, the microbial organisms have at least nine exogenous nucleic acids each encoding a xylose transporter. In some embodiments, the microbial organisms have at least ten exogenous nucleic acids each encoding a xylose transporter. In some embodiments, the microbial organisms have at least eleven exogenous nucleic acids each encoding a xylose transporter.

[0047] The xylose transporters provided herein can be a Metschnikowia xylose transporter, including such as those from H0 Metschnikowia sp. having amino acid sequences as shown in sequence listing, as well as their variants that retain their transporter function. For example, provided herein is Xyt1p from H0 Metschnikowia sp. that has an amino acid sequence of SEQ ID NO:1, as well as variants thereof that retain the transporter function of Xyt1p. The transporter function of Xyt1p includes, but is not limited to, transport of xylose across cell wall and/or cell membrane, which can be determined, for example, by subjecting the variant to a transporter assay as described herein or otherwise known in the art. The xylose transporter function can be determined, for example, by expressing the transporter in a microbial organism and measuring the increase in xylose uptake by the microbial organism. In an exemplary assay, a non-xylose utilizing microbial organism expressing an exogenous transporter can be cultured in a xylose-containing medium and the decrease of xylose in the culture medium can be measured by high performance liquid chromatography (HPLC) using Rezex RPM-monosaccharide Pb+2 column (Phenomenex), refractive index detector and water as a mobile phase at 0.6 ml/min. In another exemplary assay, starter cultures for wild type and transgenic microbial organisms expressing various transporters can be grown in YP base medium with controlled amounts of glucose and xylose (%; w/v). Uninoculated medium is used a reference for a given sampling time; the medium indicates 100% of the starting xylose or xylose at time 0 h. At 24 h intervals, samples at volumes of 300-1000 .mu.L can be removed from the culture aseptically and filtered through a 0.2 m syringe filter, physically separating medium and yeast. The medium can be transferred to glass vials and the xylose content can be examined by HPLC. The amount of xylose remaining in the sampled medium can be determined by comparison with a pre-defined calibration curve, and the remaining sample is normalized to the xylose content in the uninoculated medium, which is counted as containing 100% of the xylose at the initiation of the culture. The non-naturally occurring microbial organisms expressing an exogenous xylose transporter can consume xylose at a higher rate than their wild type counterparts, and the differences in the decrease rate of xylose in the culture medium between wild type and non-naturally occurring microbial organisms expressing an exogenous xylose transporter can indicate the transporter function of the exogenous xylose transporter.

[0048] In some embodiments, provided herein are also isolated polypeptides that are variants of a Metschnikowia xylose transporter that retains its transporter function. Provided herein are also isolated nucleic acids that encode polypeptides that are variants to a Metschnikowia xylose transporter that retains its transporter function. In some embodiments, the variant of a Metschnikowia xylose transporter is ubiquitin-deficient. In some embodiments, the ubiquitin-deficient Metschnikowia xylose transporter has amino acid mutation at or near at least one lysine residue that can be ubiquitinated. In some embodiments, the ubiquitin-deficient Metschnikowia xylose transporter has amino acid mutations at or near at least two lysine residue that can be ubiquitinated. In some embodiments, the ubiquitin-deficient Metschnikowia xylose transporter has amino acid mutations at or near at least three lysine residue that can be ubiquitinated. In some embodiments, the ubiquitin-deficient Metschnikowia xylose transporter has amino acid mutations at or near all lysine residue that can be ubiquitinated. In some embodiment, the amino acid mutation is substitution of the lysine residue. In some embodiment, the amino acid mutation is deletion of the lysine residue. In some embodiment, the ubiquitin-deficient Metschnikowia xylose transporter has amino acid mutation near the lysine residue that can be ubiquitinated such that the lysine residue is not accessible to the ubiquitination machinery. In some embodiments, provided herein are non-naturally occurring microbial organisms having an exogenous nucleic acid encoding a xylose transporter, wherein the xylose transporter is a variant of a Metschnikowia xylose transporter that retains its transporter function. In some embodiments, the xylose transporter is a variant of the xylose transporters from the H0 Metschnikowia sp. as described herein that retains its transporter function. In some embodiments, the variant of a H0 Metschnikowia sp. xylose transporter is ubiquitin-deficient.

[0049] In some embodiments, provided herein are also isolated polypeptides that are variants of Xyt1p, Gxf1p, .DELTA.Gxf1p, Gxf2p/Gal2p, Gxs1p/Hgt12p, .DELTA.Gxs1p/.DELTA.Hgt12p, Hxt5p, Hxt2.6p, Qup2p, or Aps1p/Hgt19p from a Metschnikowia species that retain the transporter function. Provided herein are also isolated polypeptides that are variants of Xyt1p, Gxf1p, .DELTA.Gxf1p, Gxf2p/Gal2p, Gxs1p/Hgt12p, .DELTA.Gxs1p/.DELTA.Hgt12p, Hxt5p, Hxt2.6p, Qup2p, or Aps1p/Hgt19p from the H0 Metschnikowia sp. that retain the transporter function. In some embodiments, the variant is ubiquitin-deficient. In some embodiments, provided herein are also isolated nucleic acids that encode polypeptides that are variants of Xyt1p, Gxf1p, .DELTA.Gxf1p, Gxf2p/Gal2p, Gxs1p/Hgt12p, .DELTA.Gxs1p/.DELTA.Hgt12p, Hxt5p, Hxt2.6p, Qup2p, or Aps1p/Hgt19p from a Metschnikowia species that retain the transporter function. In some embodiments, provided herein are also isolated nucleic acids that encode polypeptides that are variants of Xyt1p, Gxf1p, .DELTA.Gxf1p, Gxf2p/Gal2p, Gxs1p/Hgt12p, .DELTA.Gxs1p/.DELTA.Hgt12p, Hxt5p, Hxt2.6p, Qup2p, or Aps1p/Hgt19p from the H0 Metschnikowia sp. that retain the transporter function.

[0050] In some embodiments, provided herein are non-naturally occurring microbial organisms having an exogenous nucleic acid encoding a xylose transporter, wherein the xylose transporter is a variant of Xyt1p, Gxf1p, .DELTA.Gxf1p, Gxf2p/Gal2p, Gxs1p/Hgt12p, .DELTA.Gxs1p/.DELTA.Hgt12p, Hxt5p, Hxt2.6p, Qup2p, or Aps1p/Hgt19p from a Metschnikowia species that retains the transporter function. In some embodiments, provided herein are non-naturally occurring microbial organisms having an exogenous nucleic acid encoding a xylose transporter, wherein the xylose transporter is a variant of Xyt1p, Gxf1p, .DELTA.Gxf1p, Gxf2p/Gal2p, Gxs1p/Hgt12p, .DELTA.Gxs1p/.DELTA.Hgt12p, Hxt5p, Hxt2.6p, Qup2p, or Aps1p/Hgt19p from H0 Metschnikowia sp. that retains the transporter function. In some embodiments, the variant is ubiquitin-deficient.

[0051] The xylose transporters described herein can have amino acid sequence of at least 30% identity, at least 35% identity, at least 40% identity, at least 45% identity, at least 50% identity, at least 55% identity, at least 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity, or is identical, to the amino acid sequences disclosed herein by SEQ ID NO, GenBank and/or GI number. In some embodiments, the xylose transporters described herein can have amino acid sequence of 35%, 40%, 45%, 50%, 55%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity, or be identical, to amino acids described herein by SEQ ID NO, GenBank and/or GI number. In some embodiments, the xylose transporters described herein can have amino acid sequence of 35%, 40%, 45%, 50%, 55%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity, or be identical, to any one of SEQ ID NOs: 1-5 and 7-12.

[0052] In some embodiments, provided herein is an isolated polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Metschnikowia xylose transporter such as Metschnikowia Xyt1p, Gxf1p, .DELTA.Gxf1p, Gxf2p/Gal2p, Gxs1p/Hgt12p, .DELTA.Gxs1p/.DELTA.Hgt12p, Hxt5p, Hxt2.6p, Qup2p, or Aps1p/Hgt19p. In some embodiments, provided herein is an isolated nucleic acid that encodes a polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Metschnikowia xylose transporter such as Metschnikowia Xyt1p, Gxf1p, .DELTA.Gxf1p, Gxf2p/Gal2p, Gxs1p/Hgt12p, .DELTA.Gxs1p/.DELTA.Hgt12p, Hxt5p, Hxt2.6p, Qup2p, or Aps1p/Hgt19p.

[0053] In some embodiments, provided herein are non-naturally occurring microbial organisms having at least one exogenous nucleic acid encoding a xylose transporter, wherein the xylose transporter has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Metschnikowia xylose transporter such as Metschnikowia Xyt1p, Gxf1p, .DELTA.Gxf1p, Gxf2p/Gal2p, Gxs1p/Hgt12p, .DELTA.Gxs1p/.DELTA.Hgt12p, Hxt5p, Hxt2.6p, Qup2p, or Aps1p/Hgt19p. In some embodiments, the exogenous nucleic acid encodes a Metschnikowia xylose transporter such as Metschnikowia Xyt1p, Gxf1p, .DELTA.Gxf1p, Gxf2p/Gal2p, Gxs1p/Hgt12p, .DELTA.Gxs1p/.DELTA.Hgt12p, Hxt5p, Hxt2.6p, Qup2p, or Aps1p/Hgt19p.

[0054] Sequence identity (also known as homology or similarity) refers to sequence similarity between two nucleic acid molecules or between two polypeptides. Identity can be determined by comparing a position in each sequence, which may be aligned for purposes of comparison. When a position in the compared sequence is occupied by the same base or amino acid, then the molecules are identical at that position. A degree of identity between sequences is a function of the number of matching or homologous positions shared by the sequences. The alignment of two sequences to determine their percent sequence identity can be done using software programs known in the art, such as, for example, those described in Ausubel et al., Current Protocols in Molecular Biology, John Wiley and Sons, Baltimore, Md. (1999). Preferably, default parameters are used for the alignment. One alignment program well known in the art that can be used is BLAST set to default parameters. In particular, programs are BLASTN and BLASTP, using the following default parameters: Genetic code=standard; filter=none; strand=both; cutoff=60; expect=10; Matrix=BLOSUM62; Descriptions=50 sequences; sort by=HIGH SCORE; Databases=non-redundant, GenBank+EMBL+DDBJ+PDB+GenBank CDS translations+SwissProtein+SPupdate+PIR. Details of these programs can be found at the National Center for Biotechnology Information.

[0055] Variants of a specific xylose transporter can also include, for example, amino acid substitutions, deletions, fusions, or truncations when compared to the reference xylose transporter. Variants of the Metschnikowia xylose transporters described herein can also contain conservatively amino acids substitution, meaning that one or more amino acid can be replaced by an amino acid that does not alter the secondary and/or tertiary stricture of the xylose transporter. Such substitutions can include the replacement of an amino acid, by a residue having similar physicochemical properties, such as substituting one aliphatic residue (Ile, Val, Leu, or Ala) for another, or substitutions between basic residues Lys and Arg, acidic residues Glu and Asp, amide residues Gln and Asn, hydroxyl residues Ser and Tyr, or aromatic residues Phe and Tyr. Phenotypically silent amino acid exchanges are described more fully in Bowie et al., Science 247:1306-10(1990). In addition, variants of Metschnikowia xylose transporters include those having amino acid substitutions, deletions, or additions to the amino acid sequence outside functional regions of the protein so long as the substitution, deletion, or addition does not affect xylose transport function of the resulting polypeptide. In some embodiments, the variant is ubiquitin-deficient. Techniques for making these substitutions and deletions are well known in the art and include, for example, site-directed mutagenesis.

[0056] In some embodiments, provided herein are non-naturally occurring microbial organisms having an exogenous nucleic acid encoding a xylose transporter, wherein the xylose transporter has 1 to 50, 1 to 45, 1 to 40, 1 to 35, 1 to 30, 1 to 25, 1 to 20, 1 to 15, 1 to 10, or 1 to 5, amino acid substitutions, deletions or insertions of Xyt1p, Gxf1p, .DELTA.Gxf1p, Gxf2p/Gal2p, Gxs1p/Hgt12p, .DELTA.Gxs1p/.DELTA.Hgt12p, Hxt5p, Hxt2.6p, Qup2p, or Aps1p/Hgt19p from a Metschnikowia species and retains the transporter function. The Metschnikowia species can be the H0 Metschnikowia sp. In some embodiments, the xylose transporter has 1 to 10 amino acid substitutions, deletions or insertions of Xyt1p, Gxf1p, .DELTA.Gxf1p, Gxf2p/Gal2p, Gxs1p/Hgt12p, .DELTA.Gxs1p/.DELTA.Hgt12p, Hxt5p, Hxt2.6p, Qup2p, or Aps1p/Hgt19p from a Metschnikowia species and retains the transporter function. The Metschnikowia species can be the H0 Metschnikowia sp. In some embodiments, the xylose transporter has 1 to 5 amino acid substitutions, deletions or insertions of Xyt1p, Gxf1p, .DELTA.Gxf1p, Gxf2p/Gal2p, Gxs1p/Hgt12p, .DELTA.Gxs1p/.DELTA.Hgt12p, Hxt5p, Hxt2.6p, Qup2p, or Aps1p/Hgt19p from a Metschnikowia species and retains the transporter function. The Metschnikowia species can be the H0 Metschnikowia sp. In some embodiment, the xylose transporter is a ubiquitin-deficient Xyt1p, Gxf1p, .DELTA.Gxf1p, Gxf2p/Gal2p, Gxs1p/Hgt12p, .DELTA.Gxs1p/.DELTA.Hgt12p, Hxt5p, Hxt2.6p, Qup2p, or Aps1p/Hgt19p from a Metschnikowia species and retains the transporter function. The Metschnikowia species can be the H0 Metschnikowia sp.

[0057] The xylose transporters provided herein also include functional fragments of specific Metschnikowia xylose transporters that retain their transporter function. In some embodiments, provided herein is an isolated polypeptide that is a functional fragment of a specific Metschnikowia xylose transporter. In some embodiments, provided herein is an isolated nucleic acid that encodes a polypeptide that is functional fragment of a specific Metschnikowia xylose transporter. In some embodiments, the xylose transporter can be fragments of a xylose transporter such as Metschnikowia Xyt1p, Gxf1p, .DELTA.Gxf1p, Gxf2p/Gal2p, Gxs1p/Hgt12p, .DELTA.Gxs1p/.DELTA.Hgt12p, Hxt5p, Hxt2.6p, Qup2p, or Aps1p/Hgt19p retains the transporter function. In some embodiments, the xylose transporter can be fragments of a xylose transporter such as Xyt1p, Gxf1p, .DELTA.Gxf1p, Gxf2p/Gal2p, Gxs1p/Hgt12p, .DELTA.Gxs1p/.DELTA.Hgt12p, Hxt5p, Hxt2.6p, Qup2p, or Aps1p/Hgt19p from the H0 Metschnikowia sp. retains the transporter function.

[0058] In some embodiments, provided herein is an isolated polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a function fragment of a Metschnikowia xylose transporter including such as Metschnikowia Xyt1p, Gxf1p, .DELTA.Gxf1p, Gxf2p/Gal2p, Gxs1p/Hgt12p, .DELTA.Gxs1p/.DELTA.Hgt12p, Hxt5p, Hxt2.6p, Qup2p, or Aps1p/Hgt19p. In some embodiments, provided herein is an isolated nucleic acid that encodes a polypeptide that has an amino acid sequence that is at least 30%, at at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a function fragment of a Metschnikowia xylose transporter including such as Metschnikowia Xyt1p, Gxf1p, .DELTA.Gxf1p, Gxf2p/Gal2p, Gxs1p/Hgt12p, .DELTA.Gxs1p/.DELTA.Hgt12p, Hxt5p, Hxt2.6p, Qup2p, or Aps1p/Hgt19p.

[0059] In some embodiments, provided herein is an isolated polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% identical to a function fragment of a xylose transporter of H0 Metschnikowia sp. including such as Metschnikowia Xyt1p, Gxf1p, .DELTA.Gxf1p, Gxf2p/Gal2p, Gxs1p/Hgt12p, .DELTA.Gxs1p/.DELTA.Hgt12p, Hxt5p, Hxt2.6p, Qup2p, or Aps1p/Hgt19p. In some embodiments, provided herein is an isolated nucleic acid that encodes a polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a function fragment of a xylose transporter of H0 Metschnikowia sp. including such as Metschnikowia Xyt1p, Gxf1p, .DELTA.Gxf1p, Gxf2p/Gal2p, Gxs1p/Hgt12p, .DELTA.Gxs1p/.DELTA.Hgt12p, Hxt5p, Hxt2.6p, Qup2p, or Aps1p/Hgt19p.

[0060] In some embodiments, provided herein are non-naturally occurring microbial organisms having an exogenous nucleic acid encoding a functional fragment of a Metschnikowia xylose transporter that retains its transporter function. In some embodiments, the non-naturally occurring microbial organisms provided herein have at least one exogenous nucleic acid encoding a xylose transporter that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a function fragment of a Metschnikowia xylose transporter including such as Metschnikowia Xyt1p, Gxf1p, .DELTA.Gxf1p, Gxf2p/Gal2p, Gxs1p/Hgt12p, .DELTA.Gxs1p/.DELTA.Hgt12p, Hxt5p, Hxt2.6p, Qup2p, or Aps1p/Hgt19p. In some embodiments, the non-naturally occurring microbial organisms provided herein have at least one exogenous nucleic acid encoding a xylose transporter that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a function fragment of a xylose transporter of H0 Metschnikowia sp. such as Xyt1p, Gxf1p, .DELTA.Gxf1p, Gxf2p/Gal2p, Gxs1p/Hgt12p, .DELTA.Gxs1p/.DELTA.Hgt12p, Hxt5p, Hxt2.6p, Qup2p, or Aps1p/Hgt19p.

[0061] In some embodiments, variants of Metschnikowia xylose transporters described herein include covalent modification or aggregative conjugation with other chemical moieties, such as glycosyl groups, polyethylene glycol (PEG) groups, lipids, phosphate, acetyl groups, and the like. In some embodiments, variants of the Metschnikowia xylose transporters described herein further include, for example, fusion proteins formed of xylose transporter polypeptide and another polypeptide. The added polypeptides for constructing the fusion protein include those that facilitate purification or oligomerization of xylose transporters, or those that enhance stability and/or transport capacity or transport rate of xylose transporters. In some embodiments, the added polypeptides gain enhanced transport capability when fused with the xylose transporters described herein.

[0062] The Metschnikowia xylose transporters described herein can be fused to heterologous polypeptides to facilitate purification. Many available heterologous peptides (peptide tags) allow selective binding of the fusion protein to a binding partner. Non-limiting examples of peptide tags include 6-His, thioredoxin, hemaglutinin, GST, and the OmpA signal sequence tag. A binding partner that recognizes and binds to the heterologous peptide tags can be any molecule or compound, including metal ions (for example, metal affinity columns), antibodies, antibody fragments, or any protein or peptide that selectively or specifically binds the heterologous peptide to permit purification of the fusion protein.

[0063] The Metschnikowia xylose transporters can also be modified to facilitate formation of oligomers. For example, the Xyt1p polypeptides can be fused to peptide moieties that promote oligomerization, such as leucine zippers and certain antibody fragment polypeptides, such as Fc polypeptides. Techniques for preparing these fusion proteins are known, and are described, for example, in WO 99/31241 and in Cosman et al., Immunity 14:123-133 (2001). Fusion to an Fc polypeptide offers the additional benefit of facilitating purification by affinity chromatography over Protein A or Protein G columns. Fusion to a leucine-zipper (LZ), for example, a repetitive heptad repeat, often with four or five leucine residues interspersed with other amino acids, is described in Landschulz et al., Science 240:1759-64 (1988).

[0064] The xylose transporters described herein can be provided in an isolated form, or in a substantially purified form. The polypeptides can be recovered and purified from recombinant cell cultures by known methods, including, for example, ammonium sulfate or ethanol precipitation, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography, and lectin chromatography. In some embodiments, protein chromatography is employed for purification.

[0065] The Metschnikowia xylose transporters described herein can be recombinantly expressed by suitable hosts. When heterologous expression of the Metschnikowia xylose transporters is desired, the coding sequences of specific Metschnikowia xylose transporters can be modified in accordance with the codon usage of the host. The standard genetic code is well known in the art, as reviewed in, for example, Osawa et al., Microbiol Rev. 56(1):229-64 (1992). Yeast species, including but not limited to Saccharomyces cerevisiae, Candida azyma, Candida diversa, Candida magnoliae, Candida rugopelliculosa, Yarrowia lipolytica, and Zygoascus hellenicus, use the standard code. Certain yeast species use alternative codes. For example, "CUG," standard codon for "Leu," encodes "Ser" in species such as Candida albicans, Candida cylindracea, Candida melibiosica, Candida parapsilosis, Candida rugose, Pichia stipitis, and Metschnikowia species. The codon table for the H0 Metschnikowia sp. is provided below. The DNA codon CTG in a foreign gene from a non "CUG" clade species need to be changed to TTG, CTT, CTC, TTA, or CTA for a functional expression of a protein in the Metschnikowia species. Other codon optimization can result in increase of protein expression of a foreign gene in the Metschnikowia species. Codon optimization can result in increase protein expression of a foreign gene in the host. Methods of Codon optimization are well known in the art (e.g. Chung et al., BMC SystBiol. 6:134 (2012); Chin et al., Bioinformatics 30(15):2210-12 (2014)), and various tools are available (e.g. DNA2.0 at https://www.dna20.com/services/genegps; and OPTIMIZER at http://genomes.urv.es/OPTIMIZER).

TABLE-US-00002 TABLE Codons for H0 Metschnikowia sp. Amino Acid SLC DNA codons Isoleucine I ATT ATC ATA Leucine L CTT CTC CTA TTA TTG Valine V GTT GTC GTA GTG Phenylalanine F TTT TTC Methionine M ATG Cysteine C TGT TGC Alanine A GCT GCC GCA GCG Glycine G GGT GGC GGA GGG Proline P CCT CCC CCA CCG Threonine T ACT ACC ACA ACG Serine S TCT TCC TCA TCG AGT AGC CTG Tyrosine Y TAT TAC Tryptophan W TGG Glutamine Q CAA CAG Asparagine N AAT AAC Histidine H CAT CAC Glutamic acid E GAA GAG Aspartic acid D GAT GAC Lysine K AAA AAG Arginine R CGT CGC CGA CGG AGA AGG Stop codons Stop TAA TAG TGA

[0066] Furthermore, the hosts can simultaneously produce other transporters such that multiple transporters are expressed in the same cell, wherein the different transporters can form oligomers to transport the same sugar. Alternatively, the different transporters can function independently to transport different sugars.

[0067] Variants of Metschnikowia xylose transporters can be generated by conventional methods known in the art, such as by introducing mutations at particular locations by oligonucleotide-directed site-directed mutagenesis. Site-directed-mutagenesis is considered an informational approach to protein engineering and can rely on high-resolution crystallographic structures of target proteins for specific amino acid changes (Van Den Burg et al., PNAS 95:2056-60 (1998)). Computational methods for identifying site-specific changes for a variety of protein engineering objectives are also known in the art (Hellinga, Nature Structural Biology 5:525-27 (1998)).

[0068] Other techniques known in the art include, but are not limited to, non-informational mutagenesis techniques (referred to generically as "directed evolution"). Directed evolution, in conjunction with high-throughput screening, allows testing of statistically meaningful variations in protein conformation (Arnold, 1998). Directed evolution technology can include diversification methods similar to that described by Crameri et al., Nature 391:288-91 (1998), site-saturation mutagenesis, staggered extension process (StEP) (Zhao et al., Nature Biotechnology 16:258-61 (1998)), and DNA synthesis/reassembly (U.S. Pat. No. 5,965,408).

[0069] As disclosed herein, a nucleic acid encoding xylose transporter can be introduced into a host organism. In some cases, it can also be desirable to modify an activity of a biosynthesis pathway enzyme or protein to increase production of a desired product. For example, known mutations that increase the activity of a protein or enzyme can be introduced into an encoding nucleic acid molecule. Additionally, optimization methods can be applied to increase the activity of an enzyme or protein and/or decrease an inhibitory activity, for example, decrease the activity of a negative regulator.

[0070] One such optimization method is directed evolution. Directed evolution is a powerful approach that involves the introduction of mutations targeted to a specific gene in order to improve and/or alter the properties of an enzyme. Improved and/or altered enzymes can be identified through the development and implementation of sensitive high-throughput screening assays that allow the automated screening of many enzyme variants (for example, >10.sup.4). Iterative rounds of mutagenesis and screening typically are performed to afford an enzyme with optimized properties. Computational algorithms that can help to identify areas of the gene for mutagenesis also have been developed and can significantly reduce the number of enzyme variants that need to be generated and screened. Numerous directed evolution technologies have been developed (for reviews, see Hibbert et al., Biomol. Eng 22:11-19 (2005); Huisman and Lalonde, In Biocatalysis in the pharmaceutical and biotechnology industries pgs. 717-742 (2007), Patel (ed.), CRC Press; Otten and Quax. Biomol. Eng 22:1-9 (2005); and Sen et al., Appl Biochem. Biotechnol 143:212-223 (2007)) to be effective at creating diverse variant libraries, and these methods have been successfully applied to the improvement of a wide range of properties across many enzyme classes. Enzyme characteristics that have been improved and/or altered by directed evolution technologies include, for example: selectivity/specificity, for conversion of non-natural substrates; temperature stability, for robust high temperature processing; pH stability, for bioprocessing under lower or higher pH conditions; substrate or product tolerance, so that high product titers can be achieved; binding (K.sub.m), including broadening substrate binding to include non-natural substrates; inhibition (K.sub.i), to remove inhibition by products, substrates, or key intermediates; activity (kcat), to increases enzymatic reaction rates to achieve desired flux; expression levels, to increase protein yields and overall pathway flux; oxygen stability, for operation of air sensitive enzymes under aerobic conditions; and anaerobic activity, for operation of an aerobic enzyme in the absence of oxygen.

[0071] A number of exemplary methods have been developed for the mutagenesis and diversification of genes to target desired properties of specific enzymes. Such methods are well known to those skilled in the art. Any of these can be used to alter and/or optimize the activity of a xylose transporter or a biosynthesis pathway enzyme or protein. Such methods include, but are not limited to EpPCR, which introduces random point mutations by reducing the fidelity of DNA polymerase in PCR reactions (Pritchard et al., J Theor. Biol. 234:497-509 (2005)); Error-prone Rolling Circle Amplification (epRCA), which is similar to epPCR except a whole circular plasmid is used as the template and random 6-mers with exonuclease resistant thiophosphate linkages on the last 2 nucleotides are used to amplify the plasmid followed by transformation into cells in which the plasmid is re-circularized at tandem repeats (Fujii et al., Nucleic Acids Res. 32:e145 (2004); and Fujii et al., Nat. Protoc. 1:2493-2497 (2006)); DNA or Family Shuffling, which typically involves digestion of two or more variant genes with nucleases such as Dnase I or EndoV to generate a pool of random fragments that are reassembled by cycles of annealing and extension in the presence of DNA polymerase to create a library of chimeric genes (Stemmer, Proc Natl Acad Sci USA 91:10747-10751 (1994); and Stemmer, Nature 370:389-391 (1994)); Staggered Extension (StEP), which entails template priming followed by repeated cycles of 2 step PCR with denaturation and very short duration of annealing/extension (as short as 5 sec) (Zhao et al., Nat. Biotechnol. 16:258-261 (1998)); Random Priming Recombination (RPR), in which random sequence primers are used to generate many short DNA fragments complementary to different segments of the template (Shao et al., Nucleic Acids Res 26:681-683 (1998)).

[0072] Additional methods include Heteroduplex Recombination, in which linearized plasmid DNA is used to form heteroduplexes that are repaired by mismatch repair (Volkov et al, Nucleic Acids Res. 27:e18 (1999); and Volkov et al., Methods Enzymol. 328:456-463 (2000)); Random Chimeragenesis on Transient Templates (RACHITT), which employs Dnase I fragmentation and size fractionation of single stranded DNA (ssDNA) (Coco et al., Nat. Biotechnol. 19:354-359 (2001)); Recombined Extension on Truncated templates (RETT), which entails template switching of unidirectionally growing strands from primers in the presence of unidirectional ssDNA fragments used as a pool of templates (Lee et al., J. Molec. Catalysis 26:119-129 (2003)); Degenerate Oligonucleotide Gene Shuffling (DOGS), in which degenerate primers are used to control recombination between molecules; (Bergquist and Gibbs, Methods Mol. Biol 352:191-204 (2007); Bergquist et al., Biomol. Eng 22:63-72 (2005); Gibbs et al., Gene 271:13-20 (2001)); Incremental Truncation for the Creation of Hybrid Enzymes (ITCHY), which creates a combinatorial library with 1 base pair deletions of a gene or gene fragment of interest (Ostermeier et al., Proc. Nat. Acad. Sci. USA 96:3562-3567 (1999); and Ostermeier et al., Nat. Biotechnol. 17:1205-1209 (1999)); Thio-Incremental Truncation for the Creation of Hybrid Enzymes (THIO-ITCHY), which is similar to ITCHY except that phosphothioate dNTPs are used to generate truncations (Lutz et al., Nucleic Acids Res 29:E16 (2001)); SCRATCHY, which combines two methods for recombining genes, ITCHY and DNA shuffling (Lutz et al., Proc. Natl. Acad. Sci. USA 98:11248-11253 (2001)); Random Drift Mutagenesis (RNDM), in which mutations made via epPCR are followed by screening/selection for those retaining usable activity (Bergquist et al., Biomol. Eng. 22:63-72 (2005)); Sequence Saturation Mutagenesis (SeSaM), a random mutagenesis method that generates a pool of random length fragments using random incorporation of a phosphothioate nucleotide and cleavage, which is used as a template to extend in the presence of "universal" bases such as inosine, and replication of an inosine-containing complement gives random base incorporation and, consequently, mutagenesis (Wong et al., Biotechnol. J. 3:74-82 (2008); Wong et al., Nucleic Acids Res. 32:e26 (2004); and Wong et al., Anal. Biochem. 341:187-189 (2005)); Synthetic Shuffling, which uses overlapping oligonucleotides designed to encode "all genetic diversity in targets" and allows a very high diversity for the shuffled progeny (Ness et al., Nat. Biotechnol. 20:1251-1255 (2002)); Nucleotide Exchange and Excision Technology NexT, which exploits a combination of dUTP incorporation followed by treatment with uracil DNA glycosylase and then piperidine to perform endpoint DNA fragmentation (Muller et al., Nucleic Acids Res. 33:e117 (2005)).

[0073] Further methods include Sequence Homology-Independent Protein Recombination (SHIPREC), in which a linker is used to facilitate fusion between two distantly related or unrelated genes, and a range of chimeras is generated between the two genes, resulting in libraries of single-crossover hybrids (Sieber et al., Nat. Biotechnol. 19:456-460 (2001)); Gene Site Saturation Mutagenesis.TM. (GSSM.TM.), in which the starting materials include a supercoiled double stranded DNA (dsDNA) plasmid containing an insert and two primers which are degenerate at the desired site of mutations (Kretz et al., Methods Enzymol. 388:3-11 (2004)); Combinatorial Cassette Mutagenesis (CCM), which involves the use of short oligonucleotide cassettes to replace limited regions with a large number of possible amino acid sequence alterations (Reidhaar-Olson et al. Methods Enzymol. 208:564-586 (1991); and Reidhaar-Olson et al. Science 241:53-57 (1988)); Combinatorial Multiple Cassette Mutagenesis (CMCM), which is essentially similar to CCM and uses epPCR at high mutation rate to identify hot spots and hot regions and then extension by CMCM to cover a defined region of protein sequence space (Reetz et al., Angew. Chem. Int. EdEngl. 40:3589-3591 (2001)); the Mutator Strains technique, in which conditional ts mutator plasmids, utilizing the mutD5 gene, which encodes a mutant subunit of DNA polymerase III, to allow increases of 20 to 4000-.times. in random and natural mutation frequency during selection and block accumulation of deleterious mutations when selection is not required (Selifonova et al., Appl. Environ. Microbiol. 67:3645-3649 (2001)); Low et al., J. Mol. Biol. 260:359-3680 (1996)).

[0074] Additional exemplary methods include Look-Through Mutagenesis (LTM), which is a multidimensional mutagenesis method that assesses and optimizes combinatorial mutations of selected amino acids (Rajpal et al., Proc. Nat. Acad. Sci. USA 102:8466-8471 (2005)); Gene Reassembly, which is a DNA shuffling method that can be applied to multiple genes at one time or to create a large library of chimeras (multiple mutations) of a single gene (Tunable GeneReassembly.TM. (TGR.TM.) Technology supplied by Verenium Corporation), in Silico Protein Design Automation (PDA), which is an optimization algorithm that anchors the structurally defined protein backbone possessing a particular fold, and searches sequence space for amino acid substitutions that can stabilize the fold and overall protein energetics, and generally works most effectively on proteins with known three-dimensional structures (Hayes et al., Proc. Natl. Acad. Sci. USA 99:15926-15931 (2002)); and Iterative Saturation Mutagenesis (ISM), which involves using knowledge of structure/function to choose a likely site for enzyme improvement, performing saturation mutagenesis at chosen site using a mutagenesis method such as Stratagene QuikChange (Stratagene; San Diego Calif.), screening/selecting for desired properties, and, using improved clone(s), starting over at another site and continue repeating until a desired activity is achieved (Reetz et al., Nat. Protoc. 2:891-903 (2007); and Reetz et al., Angew. Chem. Int. Ed Engl. 45:7745-7751 (2006)).

[0075] Any of the aforementioned methods for mutagenesis can be used alone or in any combination. Additionally, any one or combination of the directed evolution methods can be used in conjunction with adaptive evolution techniques, as described herein or otherwise known in the art.

[0076] Provided herein are also isolated nucleic acids encoding the Metschnikowia xylose transporters described herein. Nucleic acids provided herein include those having the nucleic acid sequence provided in the sequence listing; those that hybridize to the nucleic acid sequences provided in the sequence listing, under high stringency hybridization conditions (for example, 42.degree., 2.5 hr., 6.times.SCC, 0.1% SDS); and those having substantial nucleic acid sequence identity with the nucleic acid sequence provided in the sequence listing. The nucleic acids provided herein also encompass equivalent substitutions of codons that can be translated to produce the same amino acid sequences. Provided herein are also vectors including the nucleic acids described herein. The vector can be an expression vector suitable for expression in a host microbial organism. The vector can be a 2 vector. The vector can be an ARS vector.

[0077] The nucleic acids provided herein include those encoding xylose transporters having an amino acid sequence as described herein, as well as their variants that retain transporter activity. The nucleic acids provided herein can be cDNA, chemically synthesized DNA, DNA amplified by PCR, RNA, or combinations thereof. Due to the degeneracy of the genetic code, two DNA sequences can differ and yet encode identical amino acid sequences.

[0078] Provided herein are also useful fragments of nucleic acids encoding the Metschnikowia xylose transporters described herein, include probes and primers. Such probes and primers can be used, for example, in PCR methods to amplify or detect the presence of nucleic acids encoding the Metschnikowia xylose transporters in vitro, as well as in Southern and Northern blots for analysis. Cells expressing the Metschnikowia xylose transporters can also be identified by the use of such probes. Methods for the production and use of such primers and probes are known.

[0079] Provided herein are also fragments of nucleic acids encoding the Metschnikowia xylose transporters that are antisense or sense oligonucleotides having a single-stranded nucleic acid capable of binding to a target mRNA or DNA sequence of a Metschnikowia xylose transporter.

[0080] A nucleic acid encoding a xylose transporter described herein can include nucleic acids that hybridize to a nucleic acid disclosed herein by SEQ ID NO, GenBank and/or GI number or a nucleic acid molecule that hybridizes to a nucleic acid molecule that encodes an amino acid sequence disclosed herein by SEQ ID NO, GenBank and/or GI number. Hybridization conditions can include highly stringent, moderately stringent, or low stringency hybridization conditions that are well known to one of skill in the art such as those described herein.

[0081] Stringent hybridization refers to conditions under which hybridized polynucleotides are stable. As known to those of skill in the art, the stability of hybridized polynucleotides is reflected in the melting temperature (T.sub.m) of the hybrids. In general, the stability of hybridized polynucleotides is a function of the salt concentration, for example, the sodium ion concentration and temperature. A hybridization reaction can be performed under conditions of lower stringency, followed by washes of varying, but higher, stringency. Reference to hybridization stringency relates to such washing conditions. Highly stringent hybridization includes conditions that permit hybridization of only those nucleic acid sequences that form stable hybridized polynucleotides in 0.018M NaCl at 65.degree. C., for example, if a hybrid is not stable in 0.018M NaCl at 65.degree. C., it will not be stable under high stringency conditions, as contemplated herein. High stringency conditions can be provided, for example, by hybridization in 50% formamide, 5.times.Denhart's solution, 5.times.SSPE, 0.2% SDS at 42.degree. C., followed by washing in 0.1.times.SSPE, and 0.1% SDS at 65.degree. C. Hybridization conditions other than highly stringent hybridization conditions can also be used to describe the nucleic acid sequences disclosed herein. For example, the phrase moderately stringent hybridization refers to conditions equivalent to hybridization in 50% formamide, 5.times.Denhart's solution, 5.times.SSPE, 0.2% SDS at 42.degree. C., followed by washing in 0.2.times.SSPE, 0.2% SDS, at 42.degree. C. The phrase low stringency hybridization refers to conditions equivalent to hybridization in 10% formamide, 5.times.Denhart's solution, 6.times.SSPE, 0.2% SDS at 22.degree. C., followed by washing in 1.times.SSPE, 0.2% SDS, at 37.degree. C. Denhart's solution contains 1% Ficoll, 1% polyvinylpyrolidone, and 1% bovine serum albumin (BSA). 20.times.SSPE (sodium chloride, sodium phosphate, ethylene diamide tetraacetic acid (EDTA)) contains 3M sodium chloride, 0.2M sodium phosphate, and 0.025 M (EDTA). Other suitable low, moderate and high stringency hybridization buffers and conditions are well known to those of skill in the art and are described, for example, in Sambrook et al., Molecular Cloning: A Laboratory Manual, Third Ed., Cold Spring Harbor Laboratory, New York (2001); and Ausubel et al., Current Protocols in Molecular Biology, John Wiley and Sons, Baltimore, Md. (1999).

[0082] Nucleic acids encoding a xylose transporter provided herein include those having a certain percent sequence identity to a nucleic acid disclosed herein by SEQ ID NO, GenBank and/or GI number. For example, the nucleic acids encoding a xylose transporter can have at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% sequence identity, or be identical, to a nucleic acid described herein by SEQ ID NO, GenBank and/or GI number. In some embodiments, the nucleic acid molecule can have 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity, or be identical, to a sequence selected from SEQ ID NOs: 10-16 and 19-27.

[0083] In some embodiments, provided herein is an isolated polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Metschnikowia Xyt1p. In some embodiments, provided herein is an isolated nucleic acid that encodes a polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Metschnikowia Xyt1p. In some embodiments, provided herein are non-naturally occurring microbial organisms having at least one exogenous nucleic acid encoding a xylose transporter, wherein the xylose transporter has an amino acid sequence that is at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Metschnikowia Xyt1p. In some embodiments, the xylose transporter can be a Metschnikowia Xyt1p. In some embodiments, the xylose transporter can be a variant of a Metschnikowia Xyt1p that retains its transporter function. The xylose transporter can be a functional fragment of a Metschnikowia Xyt1p. In some embodiments, the xylose transporter can have 1 to 50, 1 to 45, 1 to 40, 1 to 35, 1 to 30, 1 to 25, 1 to 20, 1 to 15, 1 to 10, or 1 to 5, amino acid substitutions, deletions or insertions of Xyt1p from a Metschnikowia species. In some embodiments, the xylose transporter has 1 to 10 amino acid substitutions, deletions or insertions of Xyt1p from a Metschnikowia species. In some embodiments, the xylose transporter has 1 to 5 amino acid substitutions, deletions or insertions of Xyt1p from a Metschnikowia species.

[0084] In some embodiment, the xylose transporter is an ubiquitin-deficient Xyt1p from a Metschnikowia species. In some embodiments, the ubiquitin-deficient Xyt1p has amino acid mutation at or near at least one lysine residue that can be ubiquitinated. In some embodiments, the ubiquitin-deficient Xyt1p has amino acid mutations at or near at least two lysine residues that can be ubiquitinated. In some embodiments, the ubiquitin-deficient Xyt1p has amino acid mutations at or near at least three lysine residues that can be ubiquitinated. In some embodiments, the ubiquitin-deficient Xyt1p has amino acid mutations at or near all lysine residue that can be ubiquitinated. In some embodiment, the amino acid mutation is substitution of the lysine residue. In some embodiment, the amino acid mutation is deletion of the lysine residue. In some embodiment, the ubiquitin-deficient Xyt1p has amino acid mutation near the lysine residue that can be ubiquitinated such that the lysine residue is not accessible to the ubiquitination machinery. In some embodiments, the lysine residues that can be ubiquitinated include K6, K517 and K539 of Xyt1p. In some embodiments, the ubiquitin-deficient Xyt1p has amino acid substitutions at one of K6, K517 and K539. In some embodiments, the ubiquitin-deficient Xyt1p has amino acid substitution at K6. In some embodiments, the ubiquitin-deficient Xyt1p has amino acid substitution at K517. In some embodiments, the ubiquitin-deficient Xyt1p has amino acid substitution at K539. In some embodiments, the ubiquitin-deficient Xyt1p has amino acid substitutions at two of K6, K517 and K539. In some embodiments, the ubiquitin-deficient Xyt1p has amino acid substitutions at K517 and K539. In some embodiments, the ubiquitin-deficient Xyt1p has amino acid substitutions at K539 and K6. In some embodiments, the ubiquitin-deficient Xyt1p has amino acid substitutions at K6 and K517. In some embodiments, the ubiquitin-deficient Xyt1p has amino acid substitutions at three of K6, K517 and K539.

[0085] The Metschnikowia species can be the H0 Metschnikowia sp. In some embodiments, provided herein is an isolated polypeptide that has an amino acid sequence that is at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to Xyt1p of H0 Metschnikowia sp. In some embodiments, provided herein is an isolated nucleic acid that encodes a polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Xyt1p of H0 Metschnikowia sp. In some embodiments, the non-naturally occurring microbial organisms have at least one exogenous nucleic acid encoding a xylose transporter that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to Xyt1p of H0 Metschnikowia sp. In some embodiments, the xylose transporter is Xyt1p of H0 Metschnikowia sp. In some embodiments, the xylose transporter can be a variant of Xyt1p of H0 Metschnikowia sp. that retains its transporter function. In some embodiment, the xylose transporter is a ubiquitin-deficient Xyt1p from H0 Metschnikowia sp. In some embodiments, the xylose transporter is a functional fragment of Xyt1p of H0 Metschnikowia sp. In some embodiments, the xylose transporter can have 1 to 50, 1 to 45, 1 to 40, 1 to 35, 1 to 30, 1 to 25, 1 to 20, 15, to 10, or 1 to 5, amino acid substitutions, deletions or insertions of Xyt1p from H0 Metschnikowia sp. In some embodiments, the xylose transporter has 1 to 10 amino acid substitutions, deletions or insertions of Xyt1p from H0 Metschnikowia sp. In some embodiments, the xylose transporter has 1 to 5 amino acid substitutions, deletions or insertions of Xyt1p from H0 Metschnikowia sp. In some embodiments, the xylose transporter has the amino acid sequence of SEQ ID NO: 1. In some embodiments, the amino acid sequence of the xylose transporter is SEQ ID NO: 1. In some embodiments, the nucleic acid has the sequence of SEQ ID NO: 13. In some embodiments, the sequence of the nucleic acid is SEQ ID NO: 13. In some embodiments, the ubiquitin-deficient Xyt1p has the amino acid sequence of SEQ ID NO: 48. In some embodiments, the nucleic acid has the sequence of SEQ ID NO: 53. The nucleic acid encoding Xyt1p from a Metschnikowia species can be codon optimized for heterologous expression. In some embodiments, the nucleic acid encoding Metschnikowia Xyt1p is codon optimized for expression in a yeast host strain. The yeast host strain can be any yeast host strain described herein, such as Saccharomyces cerevisiae. In some embodiments, the nucleic acid encoding Metschnikowia Xyt1p is codon optimized for expression in a bacterial host strain. The bacterial host strain can be any bacterial host strain described herein, such as E. coli. In some embodiments, the nucleic acid encoding Xyt1p from H0 Metschnikowia sp. is codon optimized for expression in Saccharomyces cerevisiae. For example, in some embodiments, the nucleic acid encoding Xyt1p of H0 Metschnikowia sp. is codon optimized for expression in Saccharomyces cerevisiae. The nucleic acid can have the sequence of SEQ ID NO: 21.

[0086] In some embodiments, provided herein is an isolated polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Metschnikowia Gxf1p. In some embodiments, provided herein is an isolated nucleic acid that encodes a polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Metschnikowia Gxf1p. In some embodiments, provided herein are non-naturally occurring microbial organisms having at least one exogenous nucleic acid encoding a xylose transporter, wherein the xylose transporter has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Metschnikowia Gxf1p. In some embodiments, the xylose transporter is a Metschnikowia Gxf1p. In some embodiments, the xylose transporter is a variant of a Metschnikowia Gxf1p that retains its transporter function. The xylose transporter can be a functional fragment of a Metschnikowia Gxf1p. In some embodiments, the nucleic acid encodes a xylose transporter having 1 to 50, 1 to 45, 1 to 40, 1 to 35, 1 to 30, 1 to 25, 1 to 20, 1 to 15, 1 to 10, or 1 to 5, amino acid substitutions, deletions or insertions of Gxf1p from a Metschnikowia species. In some embodiments, the xylose transporter has 1 to 10 amino acid substitutions, deletions or insertions of Gxf1p from a Metschnikowia species. In some embodiments, the xylose transporter has 1 to 5 amino acid substitutions, deletions or insertions of Gxf1p from a Metschnikowia species.

[0087] In some embodiment, the xylose transporter is a ubiquitin-deficient Gxf1p from a Metschnikowia species. In some embodiments, the ubiquitin-deficient Gxf1p has amino acid mutation at or near at least one lysine residue that can be ubiquitinated. In some embodiments, the ubiquitin-deficient Gxf1p has amino acid mutations at or near at least two lysine residue that can be ubiquitinated. In some embodiments, the ubiquitin-deficient Gxf1p has amino acid mutations at or near at least three lysine residue that can be ubiquitinated. In some embodiments, the ubiquitin-deficient Gxf1p has amino acid mutations at or near all lysine residue that can be ubiquitinated. In some embodiment, the amino acid mutation is substitution of the lysine residue. In some embodiment, the amino acid mutation is deletion of the lysine residue. In some embodiment, the ubiquitin-deficient Gxf1p has amino acid mutation near the lysine residue that can be ubiquitinated such that the lysine residue is not accessible to the ubiquitination machinery. In some embodiments, the lysine residues that can be ubiquitinated include K9, K24, and K538 of Gxf1p. In some embodiments, the ubiquitin-deficient Gxf1p has amino acid substitutions at one of K9, K24, and K538. In some embodiments, the ubiquitin-deficient Gxf1p has amino acid substitution at K9. In some embodiments, the ubiquitin-deficient Gxf1p has amino acid substitution at K24. In some embodiments, the ubiquitin-deficient Gxf1p has amino acid substitution at K538. In some embodiments, the ubiquitin-deficient Gxf1p has amino acid substitutions at two of K9, K24, and K538. In some embodiments, the ubiquitin-deficient Gxf1p has amino acid substitutions at K9 and K24. In some embodiments, the ubiquitin-deficient Gxf1p has amino acid substitutions at K538 and K9. In some embodiments, the ubiquitin-deficient Gxf1p has amino acid substitutions at K24 and K538. In some embodiments, the ubiquitin-deficient Gxf1p has amino acid substitutions at three of K9, K24, and K538. In some embodiments, the ubiquitin-deficient Gxf1p has amino acid substitutions at K9, K24, K538. In some embodiments, the ubiquitin-deficient Gxf1p has amino acid substitutions at K9, K24, and K538.

[0088] The Metschnikowia species can be the H0 Metschnikowia sp. In some embodiments, provided herein is an isolated polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to Gxf1p of H0 Metschnikowia sp. In some embodiments, provided herein is an isolated nucleic acid that encodes a polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Gxf1p of H0 Metschnikowia sp. In some embodiments, the non-naturally occurring microbial organisms have at least one exogenous nucleic acid encoding a xylose transporter that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to Gxf1p of H0 Metschnikowia sp. In some embodiments, the xylose transporter is Gxf1p of H0 Metschnikowia sp. In some embodiments, the xylose transporter can be a variant of Gxf1p of H0 Metschnikowia sp. that retains its transporter function. In some embodiment, the xylose transporter is a ubiquitin-deficient Gxf1p from H0 Metschnikowia sp. In some embodiments, the xylose transporter is a functional fragment of Gxf1p of H0 Metschnikowia sp. In some embodiments, the xylose transporter can have 1 to 50, 1 to 45, 1 to 40, 1 to 35, 1 to 30, 1 to 25, 1 to 20, 1 to 15, 1 to 10, or 1 to 5, amino acid substitutions, deletions or insertions of Gxf1p from H0 Metschnikowia sp. In some embodiments, the xylose transporter has 1 to 10 amino acid substitutions, deletions or insertions of Gxf1p from H0 Metschnikowia sp. In some embodiments, the xylose transporter has 1 to 5 amino acid substitutions, deletions or insertions of Gxf1p from H0 Metschnikowia sp. In some embodiments, the xylose transporter has the amino acid sequence of SEQ ID NO: 2. In some embodiments, the amino acid sequence of the xylose transporter is SEQ ID NO: 2. In some embodiments, the nucleic acid has the sequence of SEQ ID NO: 14. In some embodiments, the sequence of the nucleic acid is SEQ ID NO: 14. In some embodiments, the ubiquitin-deficient Gxf1p has the amino acid sequence of SEQ ID NO: 47. In some embodiments, the nucleic acid has the sequence of SEQ ID NO: 52. In some embodiments, the nucleic acid encodes a functional fragment of Gxf1p of H0 Metschnikowia sp. For example, the fragment of Gxf1p can be a variant of Gxf1p that has a shorter N-terminus, and referred to as .DELTA.Gxf1p. In some embodiments, the amino acid sequence of the xylose transporter is SEQ ID NO: 3. In some embodiments, the nucleic acid has the sequence of SEQ ID NO: 15. The nucleic acid encoding Gxf1p from a Metschnikowia species can be codon optimized for heterologous expression. In some embodiments, the nucleic acid encoding Metschnikowia Gxf1p is codon optimized for expression in a yeast host strain. The yeast host strain can be any yeast host strain described herein, such as Saccharomyces cerevisiae. In some embodiments, the nucleic acid encoding Metschnikowia Gxf1p is codon optimized for expression in a bacterial host strain. The bacterial host strain can be any bacterial host strain described herein, such as E. coli. In some embodiments, the nucleic acid encoding Gxf1p from H0 Metschnikowia sp. is codon optimized for expression in Saccharomyces cerevisiae.

[0089] In some embodiments, provided herein is an isolated polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Metschnikowia Gxf2p/Gal2p. In some embodiments, provided herein is an isolated nucleic acid that encodes a polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Metschnikowia Gxf2p/Gal2p. In some embodiments, provided herein are non-naturally occurring microbial organisms having at least one exogenous nucleic acid encoding a xylose transporter, wherein the xylose transporter has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Metschnikowia Gxf2p/Gal2p. In some embodiments, the xylose transporter is a Metschnikowia Gxf2p/Gal2p. In some embodiments, the xylose transporter is a variant of a Metschnikowia Gxf2p/Gal2p that retains its transporter function. The xylose transporter can be a functional fragment of a Metschnikowia Gxf2p/Gal2p. In some embodiments, the xylose transporter can have 1 to 50, 1 to 45, 1 to 40, 1 to 35, 1 to 30, 1 to 25, 1 to 20, 1 to 15, 1 to 10, or 1 to 5, amino acid substitutions, deletions or insertions of Gxf2p/Gal2p from a Metschnikowia species. In some embodiments, the xylose transporter has 1 to 10 amino acid substitutions, deletions or insertions of Gxf2p/Gal2p from a Metschnikowia species. In some embodiments, the xylose transporter has 1 to 5 amino acid substitutions, deletions or insertions of Gxf2p/Gal2p from a Metschnikowia species.

[0090] In some embodiment, the xylose transporter is a ubiquitin-deficient Gxf2p/Gal2p from a Metschnikowia species. In some embodiments, the ubiquitin-deficient Gxf2p/Gal2p has amino acid mutation at or near at least one lysine residue that can be ubiquitinated. In some embodiments, the ubiquitin-deficient Gxf2p/Gal2p has amino acid mutations at or near at least two lysine residue that can be ubiquitinated. In some embodiments, the ubiquitin-deficient Gxf2p/Gal2p has amino acid mutations at or near at least three lysine residue that can be ubiquitinated. In some embodiments, the ubiquitin-deficient Gxf2p/Gal2p has amino acid mutations at or near at least four lysine residue that can be ubiquitinated. In some embodiments, the ubiquitin-deficient Gxf2p/Gal2p has amino acid mutations at or near all lysine residue that can be ubiquitinated. In some embodiment, the amino acid mutation is substitution of the lysine residue. In some embodiment, the amino acid mutation is deletion of the lysine residue. In some embodiment, the ubiquitin-deficient Gxf2p/Gal2p has amino acid mutation near the lysine residue that can be ubiquitinated such that the lysine residue is not accessible to the ubiquitination machinery. In some embodiments, the lysine residues that can be ubiquitinated include K23, K26, K35, K542 and K546 of Gxf2p/Gal2p. In some embodiments, the ubiquitin-deficient Xyt1p has amino acid substitutions at one of K23, K26, K35, K542 and K546. In some embodiments, the ubiquitin-deficient Gxf2p/Gal2p has amino acid substitution at K23. In some embodiments, the ubiquitin-deficient Gxf2p/Gal2p has amino acid substitution at K26. In some embodiments, the ubiquitin-deficient Gxf2p/Gal2p has amino acid substitution at K35. In some embodiments, the ubiquitin-deficient Gxf2p/Gal2p has amino acid substitution at K542. In some embodiments, the ubiquitin-deficient Gxf2p/Gal2p has amino acid substitution at K546. In some embodiments, the ubiquitin-deficient Gxf2p/Gal2p has amino acid substitutions at two of K23, K26, K35, K542 and K546. In some embodiments, the ubiquitin-deficient Gxf2p/Gal2p has amino acid substitutions at three of K23, K26, K35, K542 and K546. In some embodiments, the ubiquitin-deficient Gxf2p/Gal2p has amino acid substitutions at four of K23, K26, K35, K542 and K546. In some embodiments, the ubiquitin-deficient Gxf2p/Gal2p has amino acid substitutions at K23, K26, K35, K542 and K546.

[0091] The Metschnikowia species can be the H0 Metschnikowia sp. In some embodiments, provided herein is an isolated polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to Gxf2p/Gal2p of H0 Metschnikowia sp. In some embodiments, provided herein is an isolated nucleic acid that encodes a polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Gxf2p/Gal2p of H0 Metschnikowia sp. In some embodiments, the non-naturally occurring microbial organisms have at least one exogenous nucleic acid encoding a xylose transporter that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% identical to Gxf2p/Gal2p of H0 Metschnikowia sp. In some embodiments, the xylose transporter is Gxf2p/Gal2p of H0 Metschnikowia sp. In some embodiments, the xylose transporter can be a variant of Gxf2p/Gal2p of H0 Metschnikowia sp. that retains its transporter function. In some embodiment, the xylose transporter is a ubiquitin-deficient Gxf2p/Gal2p from H0 Metschnikowia sp. In some embodiments, the xylose transporter is a functional fragment of Gxf2p/Gal2p of H0 Metschnikowia sp. In some embodiments, the xylose transporter can have 1 to 50, 1 to 45, 1 to 40, 1 to 35, 1 to 30, 1 to 25, 1 to 20, 1 to 15, 1 to 10, or 1 to 5, amino acid substitutions, deletions or insertions of Gxf2p/Gal2p from H0 Metschnikowia sp. In some embodiments, the xylose transporter has 1 to 10 amino acid substitutions, deletions or insertions of Gxf2p/Gal2p from H0 Metschnikowia sp. In some embodiments, the xylose transporter has 1 to 5 amino acid substitutions, deletions or insertions of Gxf2p/Gal2p from H0 Metschnikowia sp. In some embodiments, the xylose transporter has the amino acid sequence of SEQ ID NO: 4. In some embodiments, the amino acid sequence of the xylose transporter is SEQ ID NO: 4. In some embodiments, the nucleic acid has the sequence of SEQ ID NO: 16. In some embodiments, the sequence of the nucleic acid is SEQ ID NO: 16. In some embodiments, the ubiquitin-deficient Gxf2p/Gal2p has the amino acid sequence of SEQ ID NO: 46. In some embodiments, the nucleic acid has the sequence of SEQ ID NO: 51. The nucleic acid encoding Gxf2p/Gal2p from a Metschnikowia species can be codon optimized for heterologous expression. In some embodiments, the nucleic acid encoding Metschnikowia Gxf2p/Gal2p is codon optimized for expression in a yeast host strain. The yeast host strain can be any yeast host strain described herein, such as Saccharomyces cerevisiae. In some embodiments, the nucleic acid encoding Metschnikowia Gxf2p/Gal2p is codon optimized for expression in a bacterial host strain. The bacterial host strain can be any bacterial host strain described herein, such as E. coli. In some embodiments, the nucleic acid encoding Gxf2p/Gal2p from H0 Metschnikowia sp. is codon optimized for expression in Saccharomyces cerevisiae.

[0092] In some embodiments, provided herein is an isolated polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Metschnikowia Gxs1p/Hgt12p. In some embodiments, provided herein is an isolated nucleic acid that encodes a polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Metschnikowia Gxs1p/Hgt12p. In some embodiments, provided herein are non-naturally occurring microbial organisms having at least one exogenous nucleic acid encoding a xylose transporter, wherein the xylose transporter has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Metschnikowia Gxs1p/Hgt12p. In some embodiments, the xylose transporter is a Metschnikowia Gxs1p/Hgt12p. In some embodiments, the xylose transporter is a variant of a Metschnikowia Gxs1p/Hgt12p that retains its transporter function. The xylose transporter can be a functional fragment of a Metschnikowia Gxs1p/Hgt12p. In some embodiments, the xylose transporter can have 1 to 50, 1 to 45, 1 to 40, 1 to 35, 1 to 30, 1 to 25, 1 to 20, 1 to 15, 1 to 10, or 1 to 5, amino acid substitutions, deletions or insertions of Gxs1p/Hgt12p from a Metschnikowia species. In some embodiments, the xylose transporter has 1 to 10 amino acid substitutions, deletions or insertions of Gxs1p/Hgt12p from a Metschnikowia species. In some embodiments, the xylose transporter has 1 to 5 amino acid substitutions, deletions or insertions of Gxs1p/Hgt12p from a Metschnikowia species.

[0093] The Metschnikowia species can be the H0 Metschnikowia sp. In some embodiments, provided herein is an isolated polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to Gxs1p/Hgt12p of H0 Metschnikowia sp. In some embodiments, provided herein is an isolated nucleic acid that encodes a polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Gxs1p/Hgt12p of H0 Metschnikowia sp. In some embodiments, the non-naturally occurring microbial organisms have at least one exogenous nucleic acid encoding a xylose transporter that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% identical to Gxs1p/Hgt12p of H0 Metschnikowia sp. In some embodiments, the xylose transporter is Gxs1p/Hgt12p of H0 Metschnikowia sp. In some embodiments, the xylose transporter can be a variant of Gxs1p/Hgt12p of H0 Metschnikowia sp. that retains its transporter function. In some embodiments, the xylose transporter is a functional fragment of Gxs1p/Hgt12p of H0 Metschnikowia sp. In some embodiments, the xylose transporter can have 1 to 50, 1 to 45, 1 to 40, 1 to 35, 1 to 30, 1 to 25, 1 to 20, 1 to 15, 1 to 10, or 1 to 5, amino acid substitutions, deletions or insertions of Gxs1p/Hgt12p from H0 Metschnikowia sp. In some embodiments, the xylose transporter has 1 to 10 amino acid substitutions, deletions or insertions of Gxs1p/Hgt12p from H0 Metschnikowia sp. In some embodiments, the xylose transporter has 1 to 5 amino acid substitutions, deletions or insertions of Gxs1p/Hgt12p from H0 Metschnikowia sp. In some embodiments, the xylose transporter has the amino acid sequence of SEQ ID NO: 7. In some embodiments, the amino acid sequence of the xylose transporter is SEQ ID NO: 7. In some embodiments, the nucleic acid has the sequence of SEQ ID NO: 19. In some embodiments, the sequence of the nucleic acid is SEQ ID NO: 19. In some embodiments, the nucleic acid encodes a functional fragment of Gxs1p/Hgt12p of H0 Metschnikowia sp. For example, the fragment of Gxs1p/Hgt12p can be a variant of Gxs1p/Hgt12p that has a shorter N-terminus, and referred to as .DELTA.Gxs1p/.DELTA.Hgt12p. In some embodiments, the amino acid sequence of the xylose transporter is SEQ ID NO: 5. In some embodiments, the nucleic acid has the sequence of SEQ ID NO: 17. The nucleic acid encoding Gxs1p/Hgt12p from a Metschnikowia species can be codon optimized for heterologous expression. In some embodiments, the nucleic acid encoding Metschnikowia Gxs1p/Hgt12p is codon optimized for expression in a yeast host strain. The yeast host strain can be any yeast host strain described herein, such as Saccharomyces cerevisiae. In some embodiments, the nucleic acid encoding Metschnikowia Gxs1p/Hgt12p is codon optimized for expression in a bacterial host strain. The bacterial host strain can be any bacterial host strain described herein, such as E. coli. In some embodiments, the nucleic acid encoding Gxs1p/Hgt12p from H0 Metschnikowia sp. is codon optimized for expression in Saccharomyces cerevisiae.

[0094] In some embodiments, provided herein is an isolated polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Metschnikowia Hxt5p. In some embodiments, provided herein is an isolated nucleic acid that encodes a polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Metschnikowia Hxt5p. In some embodiments, provided herein are non-naturally occurring microbial organisms having at least one exogenous nucleic acid encoding a xylose transporter, wherein the xylose transporter has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Metschnikowia Hxt5p. In some embodiments, the xylose transporter is a Metschnikowia Hxt5p. In some embodiments, the xylose transporter is a variant of a Metschnikowia Hxt5p that retains its transporter function. The xylose transporter can be a functional fragment of a Metschnikowia Hxt5p. In some embodiments, the xylose transporter can have 1 to 50, 1 to 45, 1 to 40, 1 to 35, 1 to 30, 1 to 25, 1 to 20, 1 to 15, 1 to 10, or 1 to 5, amino acid substitutions, deletions or insertions of Hxt5p from a Metschnikowia species. In some embodiments, the xylose transporter has 1 to 10 amino acid substitutions, deletions or insertions of Hxt5p from a Metschnikowia species. In some embodiments, the xylose transporter has 1 to 5 amino acid substitutions, deletions or insertions of Hxt5p from a Metschnikowia species.

[0095] In some embodiment, the xylose transporter is a ubiquitin-deficient Hxt5p from a Metschnikowia species. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid mutation at or near at least one lysine residue that can be ubiquitinated. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid mutations at or near at least two lysine residue that can be ubiquitinated. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid mutations at or near at least three lysine residue that can be ubiquitinated. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid mutations at or near all lysine residue that can be ubiquitinated. In some embodiment, the amino acid mutation is substitution of the lysine residue. In some embodiment, the amino acid mutation is deletion of the lysine residue. In some embodiment, the ubiquitin-deficient Hxt5p has amino acid mutation near the lysine residue that can be ubiquitinated such that the lysine residue is not accessible to the ubiquitination machinery. In some embodiments, the lysine residues that can be ubiquitinated include K7, K10, K29, K43 and K58 of Hxt5p. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid substitutions at one of K7, K10, K29, K43 and K58. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid substitution at K7. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid substitution at K10. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid substitution at K29. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid substitution at K43. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid substitution at K58. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid substitutions at two of K7, K10, K29, K43, and K58. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid substitutions at K7 and K10. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid substitutions at K7 and K29. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid substitutions at K7 and K58. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid substitutions at K10 and K29. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid substitutions at K10 and K58. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid substitutions at K10 and K43. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid substitutions at K29 and K43. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid substitutions at K43 and K7. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid substitutions at K29 and K58. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid substitutions at K43 and K58. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid substitutions at three of K7, K10, K29, K43 and K58. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid substitutions at K7, K10, and K29. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid substitutions at K7, K10, and K43. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid substitutions at K7, K10, and K58. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid substitutions at K10, K29 and K43. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid substitutions at K10, K29 and K58. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid substitutions at K29, K43 and K58. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid substitutions at four of K7, K10, K29, K43 and K58. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid substitutions at K7, K10, K29 and K43. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid substitutions at K7, K10, K29 and K58. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid substitutions at K7, K10, K43 and K58. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid substitutions at K7, K29, K43 and K58. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid substitutions at K10, K29, K43, and K58. In some embodiments, the ubiquitin-deficient Hxt5p has amino acid substitutions at K7, K10, K29, K43 and K58.

[0096] The Metschnikowia species can be the H0 Metschnikowia sp. In some embodiments, provided herein is an isolated polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to Hxt5p of H0 Metschnikowia sp. In some embodiments, provided herein is an isolated nucleic acid that encodes a polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Hxt5p of H0 Metschnikowia sp. In some embodiments, the non-naturally occurring microbial organisms have at least one exogenous nucleic acid encoding a xylose transporter that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% identical to Hxt5p of H0 Metschnikowia sp. In some embodiments, the xylose transporter is Hxt5p of H0 Metschnikowia sp. In some embodiments, the xylose transporter can be a variant of Hxt5p of H0 Metschnikowia sp. that retains its transporter function. In some embodiment, the xylose transporter is a ubiquitin-deficient Hxt5p from H0 Metschnikowia sp. In some embodiments, the xylose transporter is a functional fragment of Hxt5p of H0 Metschnikowia sp. In some embodiments, the xylose transporter can have 1 to 50, 1 to 45, 1 to 40, 1 to 35, 1 to 30, 1 to 25, 1 to 20, 1 to 15, 1 to 10, or 1 to 5, amino acid substitutions, deletions or insertions of Hxt5p from H0 Metschnikowia sp. In some embodiments, the xylose transporter has 1 to 10 amino acid substitutions, deletions or insertions of Hxt5p from H0 Metschnikowia sp. In some embodiments, the xylose transporter has 1 to 5 amino acid substitutions, deletions or insertions of Hxt5p from H0 Metschnikowia sp. In some embodiments, the xylose transporter has the amino acid sequence of SEQ ID NO: 8. In some embodiments, the amino acid sequence of the xylose transporter is SEQ ID NO: 8. In some embodiments, the nucleic acid has the sequence of SEQ ID NO: 20. In some embodiments, the sequence of the nucleic acid is SEQ ID NO: 20. In some embodiments, the ubiquitin-deficient Hxt5p has the amino acid sequence of SEQ ID NO: 45. In some embodiments, the nucleic acid has the sequence of SEQ ID NO: 50. The nucleic acid encoding Hxt5p from a Metschnikowia species can be codon optimized for heterologous expression. In some embodiments, the nucleic acid encoding Metschnikowia Hxt5p is codon optimized for expression in a yeast host strain. The yeast host strain can be any yeast host strain described herein, such as Saccharomyces cerevisiae. In some embodiments, the nucleic acid encoding Metschnikowia Hxt5p is codon optimized for expression in a bacterial host strain. The bacterial host strain can be any bacterial host strain described herein, such as E. coli. In some embodiments, the nucleic acid encoding Hxt5p from H0 Metschnikowia sp. is codon optimized for expression in Saccharomyces cerevisiae.

[0097] In some embodiments, provided herein is an isolated polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Metschnikowia Hxt2.6p. In some embodiments, provided herein is an isolated nucleic acid that encodes a polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Metschnikowia Hxt2.6p. In some embodiments, provided herein are non-naturally occurring microbial organisms having at least one exogenous nucleic acid encoding a xylose transporter, wherein the xylose transporter has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Metschnikowia Hxt2.6p. In some embodiments, the xylose transporter is a Metschnikowia Hxt2.6p. In some embodiments, the xylose transporter is a variant of a Metschnikowia Hxt2.6p that retains its transporter function. The xylose transporter can be a functional fragment of a Metschnikowia Hxt2.6p. In some embodiments, the xylose transporter can have 1 to 50, 1 to 45, 1 to 40, 1 to 35, 1 to 30, 1 to 25, 1 to 20, 1 to 15, 1 to 10, or 1 to 5, amino acid substitutions, deletions or insertions of Hxt2.6p from a Metschnikowia species. In some embodiments, the xylose transporter has 1 to 10 amino acid substitutions, deletions or insertions of Hxt2.6p from a Metschnikowia species. In some embodiments, the xylose transporter has 1 to 5 amino acid substitutions, deletions or insertions of Hxt2.6p from a Metschnikowia species. In some embodiment, the xylose transporter is a ubiquitin-deficient Hxt2.6p from a Metschnikowia species. In some embodiments, the ubiquitin-deficient Hxt2.6p has amino acid mutation at or near at least one lysine residue that can be ubiquitinated. In some embodiments, the ubiquitin-deficient Hxt2.6p has amino acid mutations at or near at least two lysine residue that can be ubiquitinated. In some embodiments, the ubiquitin-deficient Hxt2.6p has amino acid mutations at or near at least three lysine residue that can be ubiquitinated. In some embodiments, the ubiquitin-deficient Hxt2.6p has amino acid mutations at or near all lysine residue that can be ubiquitinated. In some embodiment, the amino acid mutation is substitution of the lysine residue. In some embodiment, the amino acid mutation is deletion of the lysine residue. In some embodiment, the ubiquitin-deficient Hxt2.6p has amino acid mutation near the lysine residue that can be ubiquitinated such that the lysine residue is not accessible to the ubiquitination machinery.

[0098] The Metschnikowia species can be the H0 Metschnikowia sp. In some embodiments, provided herein is an isolated polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% identical to Hxt2.6p of H0 Metschnikowia sp. In some embodiments, provided herein is an isolated nucleic acid that encodes a polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Hxt2.6p of H0 Metschnikowia sp. In some embodiments, the non-naturally occurring microbial organisms have at least one exogenous nucleic acid encoding a xylose transporter that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% identical to Hxt2.6p of H0 Metschnikowia sp. In some embodiments, the xylose transporter is Hxt2.6p of H0 Metschnikowia sp. In some embodiments, the xylose transporter can be a variant of Hxt2.6p of H0 Metschnikowia sp. that retains its transporter function. In some embodiments, the xylose transporter is a functional fragment of Hxt2.6p of H0 Metschnikowia sp. In some embodiments, the xylose transporter can have 1 to 50, 1 to 45, 1 to 40, 1 to 35, 1 to 30, 1 to 25, 1 to 20, 1 to 15, 1 to 10, or 1 to 5, amino acid substitutions, deletions or insertions of Hxt2.6p from H0 Metschnikowia sp. In some embodiments, the xylose transporter has 1 to 10 amino acid substitutions, deletions or insertions of Hxt2.6p from H0 Metschnikowia sp. In some embodiments, the xylose transporter has 1 to 5 amino acid substitutions, deletions or insertions of Hxt2.6p from H0 Metschnikowia sp. In some embodiments, the xylose transporter has the amino acid sequence of SEQ ID NO: 10. In some embodiments, the amino acid sequence of the xylose transporter is SEQ ID NO: 10. In some embodiments, the nucleic acid has the sequence of SEQ ID NO: 22. In some embodiments, the sequence of the nucleic acid is SEQ ID NO: 22. The Hxt2.6p from a Metschnikowia species can be codon optimized for heterologous expression. In some embodiments, the nucleic acid encoding Metschnikowia Hxt2.6p is codon optimized for expression in a yeast host strain. The yeast host strain can be any yeast host strain described herein, such as Saccharomyces cerevisiae. In some embodiments, the nucleic acid encoding Metschnikowia Hxt2.6p is codon optimized for expression in a bacterial host strain. The bacterial host strain can be any bacterial host strain described herein, such as E. coli. In some embodiments, the nucleic acid encoding Hxt2.6p from H0 Metschnikowia sp. is codon optimized for expression in Saccharomyces cerevisiae. For example, in some embodiments, the nucleic acid encodes Hxt2.6p of H0 Metschnikowia sp. that is codon optimized for expression in Saccharomyces cerevisiae. The nucleic acid can have the sequence of SEQ ID NO: 23.

[0099] In some embodiments, provided herein is an isolated polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Metschnikowia Qup2p. In some embodiments, provided herein is an isolated nucleic acid that encodes a polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Metschnikowia Qup2p. In some embodiments, provided herein are non-naturally occurring microbial organisms having at least one exogenous nucleic acid encoding a xylose transporter, wherein the xylose transporter has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Metschnikowia Qup2p. In some embodiments, the xylose transporter is a Metschnikowia Qup2p. In some embodiments, the xylose transporter is a variant of a Metschnikowia Qup2p that retains its transporter function. The xylose transporter can be a functional fragment of a Metschnikowia Qup2p. In some embodiments, the xylose transporter can have 1 to 50, 1 to 45, 1 to 40, 1 to 35, 1 to 30, 1 to 25, 1 to 20, 1 to 15, 1 to 10, or 1 to 5, amino acid substitutions, deletions or insertions of Qup2p from a Metschnikowia species. In some embodiments, the xylose transporter has 1 to 10 amino acid substitutions, deletions or insertions of Qup2p from a Metschnikowia species. In some embodiments, the xylose transporter has 1 to 5 amino acid substitutions, deletions or insertions of Qup2p from a Metschnikowia species. In some embodiment, the xylose transporter is a ubiquitin-deficient Qup2p from a Metschnikowia species. In some embodiments, the ubiquitin-deficient Qup2p has amino acid mutation at or near at least one lysine residue that can be ubiquitinated. In some embodiments, the ubiquitin-deficient Qup2p has amino acid mutations at or near at least two lysine residue that can be ubiquitinated. In some embodiments, the ubiquitin-deficient Qup2p has amino acid mutations at or near at least three lysine residue that can be ubiquitinated. In some embodiments, the ubiquitin-deficient Qup2p has amino acid mutations at or near all lysine residue that can be ubiquitinated. In some embodiment, the amino acid mutation is substitution of the lysine residue. In some embodiment, the amino acid mutation is deletion of the lysine residue. In some embodiment, the ubiquitin-deficient Qup2p has amino acid mutation near the lysine residue that can be ubiquitinated such that the lysine residue is not accessible to the ubiquitination machinery.

[0100] The Metschnikowia species can be the H0 Metschnikowia sp. In some embodiments, provided herein is an isolated polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to Qup2p of H0 Metschnikowia sp. In some embodiments, provided herein is an isolated nucleic acid that encodes a polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Qup2p of H0 Metschnikowia sp. In some embodiments, the non-naturally occurring microbial organisms have at least one exogenous nucleic acid encoding a xylose transporter that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or 100% identical to Qup2p of H0 Metschnikowia sp. In some embodiments, the xylose transporter can be Qup2p of H0 Metschnikowia sp. In some embodiments, the xylose transporter can be a variant of Qup2p of H0 Metschnikowia sp. that retains its transporter function. In some embodiments, the xylose transporter can be a functional fragment of Qup2p of H0 Metschnikowia sp. In some embodiments, the xylose transporter can have 1 to 50, 1 to 45, 1 to 40, 1 to 35, 1 to 30, 1 to 25, 1 to 20, 1 to 15, 1 to 10, or 1 to 5, amino acid substitutions, deletions or insertions of Qup2p from H0 Metschnikowia sp. In some embodiments, the xylose transporter has 1 to 10 amino acid substitutions, deletions or insertions of Qup2p from H0 Metschnikowia sp. In some embodiments, the xylose transporter has 1 to 5 amino acid substitutions, deletions or insertions of Qup2p from H0 Metschnikowia sp. In some embodiments, the xylose transporter has the amino acid sequence of SEQ ID NO: 11. In some embodiments, the amino acid sequence of the xylose transporter is SEQ ID NO: 11. In some embodiments, the nucleic acid has the sequence of SEQ ID NO: 24. In some embodiments, the sequence of the nucleic acid is SEQ ID NO: 24. The Qup2p from a Metschnikowia species can be codon optimized for heterologous expression. In some embodiments, the nucleic acid encoding Metschnikowia Qup2p is codon optimized for expression in a yeast host strain. The yeast host strain can be any yeast host strain described herein, such as Saccharomyces cerevisiae. In some embodiments, the nucleic acid encoding Metschnikowia Qup2p is codon optimized for expression in a bacterial host strain. The bacterial host strain can be any bacterial host strain described herein, such as E. coli. In some embodiments, the nucleic acid encoding Qup2p from H0 Metschnikowia sp. is codon optimized for expression in Saccharomyces cerevisiae. For example, in some embodiments, the nucleic acid encodes Qup2p of H0 Metschnikowia sp. that is codon optimized for expression in Saccharomyces cerevisiae. The nucleic acid can have the sequence of SEQ ID NO: 25.

[0101] In some embodiments, provided herein is an isolated polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Metschnikowia Aps1p/Hgt19p. In some embodiments, provided herein is an isolated nucleic acid that encodes a polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Metschnikowia Aps1p/Hgt19p. In some embodiments, provided herein are non-naturally occurring microbial organisms having at least one exogenous nucleic acid encoding a xylose transporter, wherein the xylose transporter has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Metschnikowia Aps1p/Hgt19p. In some embodiments, the xylose transporter is a Metschnikowia Aps1p/Hgt19p. In some embodiments, the xylose transporter is a variant of a Metschnikowia Aps1p/Hgt19p that retains its transporter function. The xylose transporter can be a functional fragment of a Metschnikowia Aps1p/Hgt19p. In some embodiments, the xylose transporter can have 1 to 50, 1 to 45, 1 to 40, 1 to 35, 1 to 30, 1 to 25, 1 to 20, 1 to 15, 1 to 10, or 1 to 5, amino acid substitutions, deletions or insertions of Aps1p/Hgt19p from a Metschnikowia species. In some embodiments, the xylose transporter has 1 to 10 amino acid substitutions, deletions or insertions of Aps1p/Hgt19p from a Metschnikowia species. In some embodiments, the xylose transporter has 1 to 5 amino acid substitutions, deletions or insertions of Aps1p/Hgt19p from a Metschnikowia species.

[0102] In some embodiment, the xylose transporter is a ubiquitin-deficient Aps1p/Hgt19p from a Metschnikowia species. In some embodiments, the ubiquitin-deficient Aps1p/Hgt19p has amino acid mutation at or near at least one lysine residue that can be ubiquitinated. In some embodiments, the ubiquitin-deficient Aps1p/Hgt19p has amino acid mutations at or near at least two lysine residue that can be ubiquitinated. In some embodiments, the ubiquitin-deficient Aps1p/Hgt19p has amino acid mutations at or near at least three lysine residue that can be ubiquitinated. In some embodiments, the ubiquitin-deficient Aps1p/Hgt19p has amino acid mutations at or near all lysine residue that can be ubiquitinated. In some embodiment, the amino acid mutation is substitution of the lysine residue. In some embodiment, the amino acid mutation is deletion of the lysine residue. In some embodiment, the ubiquitin-deficient Aps1p/Hgt19p has amino acid mutation near the lysine residue that can be ubiquitinated such that the lysine residue is not accessible to the ubiquitination machinery. In some embodiments, the lysine residues that can be ubiquitinated include K4, K20, K30 and K93 of Aps1p/Hgt19p. In some embodiments, the ubiquitin-deficient Aps1p/Hgt19p has amino acid substitutions at one of K4, K20, K30 and K93. In some embodiments, the ubiquitin-deficient Aps1p/Hgt19p has amino acid substitution at K4. In some embodiments, the ubiquitin-deficient Aps1p/Hgt19p has amino acid substitution at K20. In some embodiments, the ubiquitin-deficient Aps1p/Hgt19p has amino acid substitution at K30. In some embodiments, the ubiquitin-deficient Aps1p/Hgt19p has amino acid substitution at K93. In some embodiments, the ubiquitin-deficient Aps1p/Hgt19p has amino acid substitutions at two of K4, K20, K30 and K93. In some embodiments, the ubiquitin-deficient Aps1p/Hgt19p has amino acid substitutions at K4 and K20. In some embodiments, the ubiquitin-deficient Aps1p/Hgt19p has amino acid substitutions at K20 and K30. In some embodiments, the ubiquitin-deficient Aps1p/Hgt19p has amino acid substitutions at K30 and K93. In some embodiments, the ubiquitin-deficient Aps1p/Hgt19p has amino acid substitutions at K93 and K4. In some embodiments, the ubiquitin-deficient Aps1p/Hgt19p has amino acid substitutions at K4 and K30. In some embodiments, the ubiquitin-deficient Aps1p/Hgt19p has amino acid substitutions at K20 and K93. In some embodiments, the ubiquitin-deficient Aps1p/Hgt19p has amino acid substitutions at three of K4, K20, K30 and K93. In some embodiments, the ubiquitin-deficient Aps1p/Hgt19p has amino acid substitutions at K4, K20, and K30. In some embodiments, the ubiquitin-deficient Aps1p/Hgt19p has amino acid substitutions at K20, K30 and K93. In some embodiments, the ubiquitin-deficient Aps1p/Hgt19p has amino acid substitutions at K30, K93 and K4. In some embodiments, the ubiquitin-deficient Aps1p/Hgt19p has amino acid substitutions at K4, K20, and K93. In some embodiments, the ubiquitin-deficient Aps1p/Hgt19p has amino acid substitutions at K4, K20, K30 and K93.

[0103] The Metschnikowia species can be the Metschnikowia H0 Metschnikowia sp. In some embodiments, provided herein is an isolated polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to Aps1p/Hgt19p of H0 Metschnikowia sp. In some embodiments, provided herein is an isolated nucleic acid that encodes a polypeptide that has an amino acid sequence that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a Aps1p/Hgt19p of H0 Metschnikowia sp. In some embodiments, the non-naturally occurring microbial organisms have at least one exogenous nucleic acid encoding a xylose transporter that is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to Aps1p/Hgt19p of H0 Metschnikowia sp. In some embodiments, the xylose transporter is Aps1p/Hgt19p of H0 Metschnikowia sp. In some embodiments, the xylose transporter can be a variant of Aps1p/Hgt19p of H0 Metschnikowia sp. that retains its transporter function. In some embodiment, the xylose transporter is a ubiquitin-deficient Aps1p/Hgt19p from H0 Metschnikowia sp. In some embodiments, the xylose transporter is a functional fragment of Aps1p/Hgt19p of H0 Metschnikowia sp. In some embodiments, the xylose transporter can have 1 to 50, 1 to 45, 1 to 40, 1 to 35, 1 to 30, 1 to 25, 1 to 20, 15, to 10, or 1 to 5, amino acid substitutions, deletions or insertions of Aps1p/Hgt19p from H0 Metschnikowia sp. In some embodiments, the xylose transporter has 1 to 10 amino acid substitutions, deletions or insertions of Aps1p/Hgt19p from H0 Metschnikowia sp. In some embodiments, the xylose transporter has 1 to 5 amino acid substitutions, deletions or insertions of Aps1p/Hgt19p from H0 Metschnikowia sp. In some embodiments, the xylose transporter has the amino acid sequence of SEQ ID NO: 12. In some embodiments, the amino acid sequence of the xylose transporter is SEQ ID NO: 12. In some embodiments, the nucleic acid has the sequence of SEQ ID NO: 26. In some embodiments, the sequence of the nucleic acid is SEQ ID NO: 26. In some embodiments, the ubiquitin-deficient Aps1p/Hgt19p has the amino acid sequence of SEQ ID NO: 44. In some embodiments, the nucleic acid has the sequence of SEQ ID NO: 49. The Aps1p/Hgt19p from a Metschnikowia species can be codon optimized for heterologous expression. In some embodiments, the nucleic acid encoding Metschnikowia Aps1p/Hgt19p is codon optimized for expression in a yeast host strain. The yeast host strain can be any yeast host strain described herein, such as Saccharomyces cerevisiae. In some embodiments, the nucleic acid encoding Metschnikowia Aps1p/Hgt19p is codon optimized for expression in a bacterial host strain. The bacterial host strain can be any bacterial host strain described herein, such as E. coli. In some embodiments, the nucleic acid encoding Aps1p/Hgt19p from H0 Metschnikowia sp. is codon optimized for expression in Saccharomyces cerevisiae. For example, in some embodiments, the nucleic acid encodes Aps1p/Hgt19p of H0 Metschnikowia sp. that is codon optimized for expression in Saccharomyces cerevisiae. The nucleic acid can have the sequence of SEQ ID NO: 27.

[0104] As provided above, the non-naturally occurring microbial organisms can have at least one exogenous nucleic acid, or at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, or at least nine nucleic acids encoding a combination of xylose transporters described herein. In some embodiments, the non-naturally occurring microbial organisms express two xylose transporters described herein. In some embodiments, the non-naturally occurring microbial organisms express three xylose transporters described herein. In some embodiments, the non-naturally occurring microbial organisms express four xylose transporters described herein. In some embodiments, the non-naturally occurring microbial organisms express five xylose transporters described herein. In some embodiments, the non-naturally occurring microbial organisms express six xylose transporters described herein. In some embodiments, the non-naturally occurring microbial organisms express seven xylose transporters described herein. In some embodiments, the non-naturally occurring microbial organisms express eight xylose transporters described herein. In some embodiments, the non-naturally occurring microbial organisms express nine xylose transporters described herein. In some embodiments, the non-naturally occurring microbial organisms express ten xylose transporters described herein. In some embodiments, the non-naturally occurring microbial organisms express eleven xylose transporters described herein. In some embodiments, the combination of xylose transporters include two, three, four, five, six, seven, eight, nine, or ten xylose transporters of Xyt1p, Gxf1p, .DELTA.Gxf1p, Gxf2p/Gal2p, Gxs1p/Hgt12p, .DELTA.Gxs1p/.DELTA.Hgt12p, Hxt5p, Hxt2.6p, Qup2p, and Aps1p/Hgt19p from a Metschnikowia species as well as variants thereof. In some embodiments, the combination of xylose transporters include two, three, four, five, six, seven, eight, nine, or ten xylose transporters of Xyt1p, Gxf1p, .DELTA.Gxf1p, Gxf2p/Gal2p, Gxs1p/Hgt12p, .DELTA.Gxs1p/.DELTA.Hgt12p, Hxt5p, Hxt2.6p, Qup2p, and Aps1p/Hgt19p from H0 Metschnikowia sp. as well as variants thereof.

[0105] The xylose transporter provided herein can be isolated by a variety of methods well-known in the art, for example, recombinant expression systems, precipitation, gel filtration, ion-exchange, reverse-phase and affinity chromatography, and the like. Other well-known methods are described in Deutscher et al., Guide to Protein Purification: Methods in Enzymology, Vol. 182 (Academic Press, (1990)). Alternatively, the isolated xylose transporter provided herein can be obtained using well-known recombinant methods (see, for example, Sambrook et al., supra, 1989; Ausubel et al., supra, 1999). The methods and conditions for biochemical purification of the isolated xylose transporter provided herein can be chosen by those skilled in the art, and purification monitored, for example, by a functional assay.

[0106] One non-limiting example of a method for preparing the xylose transporter is to express nucleic acids encoding the xylose transporter in a suitable host cell, such as a bacterial cell, a yeast cell, or other suitable cell, using methods well known in the art, and recovering the expressed xylose transporter, again using well-known purification methods, as described herein. The xylose transporter provided herein can be isolated directly from cells that have been transformed with expression vectors as described herein. Recombinantly expressed xylose transporters can also be expressed as fusion proteins with appropriate affinity tags, such as glutathione S transferase (GST), poly His, streptavidin, and the like, and affinity purified, if desired. The polypeptide of the xylose transporters described herein can retain the affinity tag, if desired, or optionally the affinity tag can be removed from the polypeptide using well known methods to remove an affinity tag, for example, using appropriate enzymatic or chemical cleavage. Thus, provided herein are polypeptide of xylose transporters without or optionally with an affinity tag. Accordingly, in some embodiments, provided herein is a host cell expressing a polypeptide of the xylose transporters herein. A polypeptide of the xylose transporters described herein can also be produced by chemical synthesis using a method of polypeptide synthesis well know to one of skill in the art.

[0107] In some embodiments, provided herein are methods of constructing a host strain that can include, among other steps, introducing a vector disclosed herein into a host cell that is capable of fermentation. Vectors of the invention can be introduced stably or transiently into a host cell using techniques well known in the art including, but not limited to, conjugation, electroporation, chemical transformation, transduction, transfection, and ultrasound transformation. Additional methods are disclosed herein, any one of which can be used in the method of the invention.

[0108] Provided herein are also vectors containing the polynucleotide molecules encoding xylose transporters, as well as host cells transformed with such vectors. Any of the polynucleotide molecules of the disclosure can be contained in a vector, which generally includes a selectable marker and an origin of replication, for propagation in a host. The vectors can further include suitable transcriptional or translational regulatory sequences, such as those derived from a mammalian, fungal, bacterial, viral, or insect genes, operably linked to the polynucleotide molecule that encode xylose transporter. Examples of such regulatory sequences include transcriptional promoters, operators, or enhancers, mRNA ribosomal binding sites, and appropriate sequences which control transcription and translation. Nucleotide sequences are operably linked when the regulatory sequence functionally relates to the DNA encoding the target protein. Thus, a promoter nucleotide sequence is operably linked to a xylose transporter if the promoter nucleotide sequence directs the transcription of the xylose transporter sequence.

[0109] Selection of suitable vectors for the cloning of nucleic acid molecules encoding the xylose transporter of this disclosure depends upon the host cell in which the vector will be transformed, and, where applicable, the host cell from which the xylose transporter is to be expressed. Suitable host cells for expression of xylose transporter include prokaryotes and yeasts, which are discussed below. Selection of suitable combinations of vectors and host organisms is a routine matter from a perspective of skill.

[0110] The xylose transporter to be expressed in such host cells can also be fusion proteins that include sequences from other proteins. As discussed above, such regions can be included to allow, for example, enhanced functionality, improved stability, or facilitated purification of the xylose transporter. For example, a nucleic acid sequence encoding a peptide that binds strongly to xylose can be fused in-frame to the transmembrane sequence of a xylose transporter so that the resulting fusion protein binds xylose and transports the sugar across the cell membrane at a higher rate than the wild type transporter.

[0111] The non-naturally occurring microbial organisms provided herein can be produced by introducing expressible nucleic acids encoding one or more of the xylose transporters. In some embodiments, the host microbial organisms have one or more biosynthetic pathways for producing products such as xylitol, ethanol, n-butanol, isobutanol, isopropanol, arabitol, ethyl acetate, phenyl-ethyl alcohol, 2-methyl-butanol, and 3-methyl-butanol from xylose. The expression of xylose transporters described herein can enhance xylose uptake and increase the production of these bioderived products of these microbial organisms.

[0112] Host microbial organisms can be selected from, and the non-naturally occurring microbial organisms generated in, for example, bacteria, yeast, fungus or any of a variety of other microorganisms applicable or suitable to fermentation processes. Similarly, exemplary species of yeast or fungi species include any species selected from the order Saccharomycetales, family Saccaromycetaceae, including the genera Saccharomyces, Debaryomyces, Candida, Kluyveromyces and Pichia; the order Saccharomycetales, family Dipodascaceae, including the genus Yarrowia; the order Schizosaccharomycetales, family Schizosaccaromycetaceae, including the genus Schizosaccharomyces; the order Eurotiales, family Trichocomaceae, including the genus Aspergillus; and the order Mucorales, family Mucoraceae, including the genus Rhizopus. Non-limiting species of host yeast or fungi include Saccharomyces cerevisiae, Schizosaccharomyces pombe, Candida albicans, Candida tropicalis, Debaryomyces hansenii, Kluyveromyces lactis, Kluyveromyces marxianus, Aspergillus terreus, Aspergillus niger, Chlamydomonas reinhardtii, Pichia pastoris, Rhizopus arrhizus, Rhizopus oryzae, Trichoderma reesei, Yarrowia lipolytica, and the like.

[0113] The xylose transporters described herein can also be expressed in yeast host cells from genera including Saccharomyces, Pichia, and Kluveromyces. In one embodiment, the yeast host is S. cerevisiae. Yeast vectors can contain an origin of replication sequence from a 2 yeast plasmid for high copy vectors and a CEN sequence for a low copy number vector. Other sequences on a yeast vector can include an autonomously replicating sequence (ARS), a promoter region, sequences for polyadenylation, sequences for transcription termination, and a selectable marker gene. In some embodiments, vectors are replicable in both yeast and bacteria such as E. coli (termed shuttle vectors). In addition to the above-mentioned features of yeast vectors, a shuttle vector also includes sequences for replication and selection in bacteria such as E. coli.

[0114] Exemplary bacteria include, for example, any species selected from the order Enterobacteriales, family Enterobacteriaceae, including the genera Escherichia and Klebsiella; the order Aeromonadales, family Succinivibrionaceae, including the genus Anaerobiospirillum; the order Pasteurellales, family Pasteurellaceae, including the genera Actinobacillus and Mannheimia; the order Rhizobiales, family Bradyrhizobiaceae, including the genus Rhizobium; the order Bacillales, family Bacillaceae, including the genus Bacillus; the order Actinomycetales, families Corynebacteriaceae and Streptomycetaceae, including the genus Corynebacterium and the genus Streptomyces, respectively; order Rhodospirillales, family Acetobacteraceae, including the genus Gluconobacter; the order Sphingomonadales, family Sphingomonadaceae, including the genus Zymomonas; the order Lactobacillales, families Lactobacillaceae and Streptococcaceae, including the genus Lactobacillus and the genus Lactococcus, respectively; the order Clostridiales, family Clostridiaceae, genus Clostridium; and the order Pseudomonadales, family Pseudomonadaceae, including the genus Pseudomonas. Non-limiting species of host bacteria include, for example, Escherichia coli, Klebsiella oxytoca, Anaerobiospirillum succiniciproducens, Actinobacillus succinogenes, Mannheimia succiniciproducens, Rhizobium etli, Bacillus subtilis, Corynebacterium glutamicum, Gluconobacter oxydans, Zymomonas mobilis, Lactococcus lactis, Lactobacillus plantarum, Streptomyces coelicolor, Clostridium acetobutylicum, Pseudomonas fluorescens, and Pseudomonas putida.

[0115] Expression vectors for use in prokaryotic hosts generally comprise one or more phenotypic selectable marker genes. Such genes encode, for example, a protein that confers antibiotic resistance or that supplies an auxotrophic requirement. A wide variety of such vectors are readily available from commercial sources. Examples include, for example, pSPORT vectors, pGEM vectors (Promega, Madison, Wis.), pPROEX vectors (LTI, Bethesda, Md.), Bluescript vectors (Stratagene), and pQE vectors (Qiagen).

[0116] Insect host cell culture systems can also be used for the expression of the xylose transporters described herein. The target xylose transporters can be expressed using a baculovirus expression system, as described, for example, in the review by Luckow and Summers, 1988.

[0117] Saccharomyces cerevisiae is a particularly useful host organism since it is a well characterized microbial organism suitable for genetic engineering. Other particularly useful host organisms include bacteria such as E. coli. It is understood that any suitable microbial host organism can be used to express xylose transporters described herein to enhance xylose uptake. The microbial host organism can also be modified to introduce metabolic and/or genetic modifications to produce a desired product or to further enhance the production of a desired product, such as xylitol, ethanol, n-butanol, isobutanol, isopropanol, arabitol, ethyl acetate, phenyl-ethyl alcohol, 2-methyl-butanol, and 3-methyl-butanol from xylose.

[0118] The choice of a suitable expression vector for expression of xylose transporters described herein depend upon the host cell to be used. Examples of suitable expression vectors for E. coli include pET, pUC, and similar vectors as is known in the art. In some embodiments, the vectors for expression of the xylose transporters include the shuttle plasmid pIJ702 for Streptomyces lividans, pGAPZalpha-A, B, C and pPICZalpha-A, B, C (Invitrogen) for Pichia pastoris, and pFE-1 and pFE-2 for filamentous fungi and similar vectors as is known in the art.

[0119] Modification of nucleic acids encoding xylose transporters described herein to facilitate insertion into a particular vector (for example, by modifying restriction sites), ease of use in a particular expression system or host (for example, using preferred host codons), and the like, are known and are contemplated for use. Genetic engineering methods for the production of xylose transporters include the expression of the polynucleotide molecules in cell free expression systems, in host cells, in tissues, and in animal models, according to known methods.

[0120] Methods for constructing and testing the expression levels of xylose transporter in a non-naturally occurring host can be performed, for example, by recombinant and detection methods well known in the art. Such methods can be found described in, for example, Sambrook et al., Molecular Cloning: A Laboratory Manual, Third Ed., Cold Spring Harbor Laboratory, New York (2001); and Ausubel et al., Current Protocols in Molecular Biology, John Wiley and Sons, Baltimore, Md. (1999).

[0121] Exogenous nucleic acid sequences involved in a pathway for production of a bioderived product can be introduced stably or transiently into a host cell using techniques well known in the art including, but not limited to, conjugation, electroporation, chemical transformation, transduction, transfection, and ultrasound transformation. For exogenous expression in E. coli or other prokaryotic cells, some nucleic acid sequences in the genes or cDNAs of eukaryotic nucleic acids can encode targeting signals such as an N-terminal mitochondrial or other targeting signal, which can be removed before transformation into prokaryotic host cells, if desired. For example, removal of a mitochondrial leader sequence led to increased expression in E. coli (Hoffmeister et al., J. Biol. Chem. 280:4329-4338 (2005)). For exogenous expression in yeast or other eukaryotic cells, genes can be expressed in the cytosol without the addition of leader sequence, or can be targeted to mitochondrion or other organelles, or targeted for secretion, by the addition of a suitable targeting sequence such as a mitochondrial targeting or secretion signal suitable for the host cells. Thus, it is understood that appropriate modifications to a nucleic acid sequence to remove or include a targeting sequence can be incorporated into an exogenous nucleic acid sequence to impart desirable properties. Furthermore, genes can be subjected to codon optimization with techniques well known in the art to achieve optimized expression of the proteins. Available tools for codon optimization include "UpGene," described in Gao et al., Biotechnology progress 20.2 (2004): 443-448; "Codon optimizer," described in Fuglsang, Protein expression and purification 31.2 (2003): 247-249. As a person of ordinary skill would understand, it would have been a routine practice to use these or any other available tools in the art to codon optimize the specific nucleic acid sequences described herein to express the corresponding gene in a specific host strain.

[0122] An expression vector or vectors can be constructed to include one or more nucleic acids encoding xylose transporters and/or other enzymes of a biosynthesis pathway operably linked to expression control sequences functional in the host organism. Expression vectors applicable for use in the microbial host organisms of the invention include, for example, plasmids, phage vectors, viral vectors, episomes and artificial chromosomes, including vectors and selection sequences or markers operable for stable integration into a host chromosome. Additionally, the expression vectors can include one or more selectable marker genes and appropriate expression control sequences. Selectable marker genes also can be included that, for example, provide resistance to antibiotics or toxins, complement auxotrophic deficiencies, or supply critical nutrients not in the culture media. Expression control sequences can include constitutive and inducible promoters, transcription enhancers, transcription terminators, and the like which are well known in the art. When two or more exogenous encoding nucleic acids are to be co-expressed, both nucleic acids can be inserted, for example, into a single expression vector or in separate expression vectors. For single vector expression, the encoding nucleic acids can be operationally linked to one common expression control sequence or linked to different expression control sequences, such as one inducible promoter and one constitutive promoter. The transformation of exogenous nucleic acid sequences involved in a metabolic or synthetic pathway can be confirmed using methods well known in the art. Such methods include, for example, nucleic acid analysis such as Northern blots or polymerase chain reaction (PCR) amplification of mRNA, or immunoblotting for expression of gene products, or other suitable analytical methods to test the expression of an introduced nucleic acid sequence or its corresponding gene product. It is understood by those skilled in the art that the exogenous nucleic acid is expressed in a sufficient amount to produce the desired product, and it is further understood that expression levels can be optimized to obtain sufficient expression using methods well known in the art and as disclosed herein.

[0123] Provided herein are also reagents, compositions, and methods that are useful for analysis of xylose transporter activity and for assessing the amount and rate of xylose transport.

[0124] The polypeptide of xylose transporters of the present disclosure, in whole or in part, can be used to raise polyclonal and monoclonal antibodies that are useful in purifying the xylose transporters, or detecting their expression, as well as a reagent tool for characterizing the molecular actions of the xylose transporters. Preferably, a peptide containing a unique epitope of the xylose transporters is used in preparation of antibodies, using conventional techniques. Methods for the selection of peptide epitopes and production of antibodies are known. See, for example, Antibodies: A Laboratory Manual, Harlow and Land (eds.), 1988 Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Monoclonal Antibodies, Hybridomas: A New Dimension in Biological Analyses, Kennet et al. (eds.), 1980 Plenum Press, New York.

[0125] The non-naturally occurring microbial organisms provided herein have enhanced xylose uptake by expressing xylose transporter described herein. In some embodiments, the microbial organisms provided herein can have one or more biosynthetic pathways to produce compounds such as xylitol, ethanol, n-butanol, isobutanol, isopropanol, arabitol, ethyl acetate, phenyl-ethyl alcohol, 2-methyl-butanol, or 3-methyl-butanol from xylose, and the enhanced xylose uptake increases production of such compound. The biosynthetic pathway can be an endogenous pathway or an exogenous pathway. The microbial organisms provided herein can further have expressible nucleic acids encoding one or more of the enzymes or proteins participating in one or more biosynthetic pathways for products such as xylitol, ethanol, n-butanol, isobutanol, isopropanol, arabitol, ethyl acetate, phenyl-ethyl alcohol, 2-methyl-butanol, and 3-methyl-butanol. Depending on the host microbial organism chosen for biosynthesis, nucleic acids for some or all of a particular biosynthetic pathway can be expressed. In some embodiments, the host microbial organism can have endogenous expression of all enzymes of a biosynthetic pathway to produce a compound from xylose and naturally produces the compound, which can be improved by further expressing a xylose transporter described herein. In some embodiments, the host microbial organism can be deficient in one or more enzymes or proteins for a desired biosynthetic pathway, then expressible nucleic acids for the deficient enzyme(s) or protein(s) are introduced into the host for subsequent exogenous expression. Alternatively, if the chosen host exhibits endogenous expression of some pathway genes, but is deficient in others, then an encoding nucleic acid is needed for the deficient enzyme(s) or protein(s) to achieve biosynthesis of the desired compound. Thus, a non-naturally occurring microbial organism can further include exogenous enzyme or protein activities to obtain a desired biosynthetic pathway or a desired biosynthetic pathway can be obtained by introducing one or more exogenous enzyme or protein activities that, together with one or more endogenous enzymes or proteins, produces a desired product such as xylitol, ethanol, n-butanol, isobutanol, isopropanol, arabitol, ethyl acetate, phenyl-ethyl alcohol, 2-methyl-butanol, or 3-methyl-butanol from xylose.

[0126] Microbial organisms having a biosynthesis pathway to produce xylitol from xylose are known in the art. In some embodiments, provided herein are non-naturally occurring microbial organisms having at least one exogenous nucleic acid encoding a xylose transporter as described herein, as well as a biosynthesis pathway for producing xylitol from xylose. With enhanced xylose uptake the microbial organism can also have improved production of xylitol from xylose. Provided herein are also methods of producing a bioderived xylitol by culturing the non-naturally occurring microbial organism provided herein having a xylitol biosynthesis pathway under conditions and for a sufficient period of time to produce xylitol.

[0127] Xylitol is a five-carbon sugar alcohol widely used as a low-calorie, low-carbohydrate alternative to sugar; xylitol does not affect insulin levels of people with diabetes and individuals with hyperglycemia (Drucker et al., Arch of Oral Biol. 24:965-970 (1979)). Xylitol is approximately as sweet as sucrose but has 33% fewer calories. The consumption of xylitol is also beneficial for dental health as it reduces caries by 33%; xylitol has also been reported to inhibit demineralization of healthy tooth enamel and to re-mineralize damaged tooth enamel (Steinberg et al., Clinical Preventive Dentistry 14:31-34 (1992); Maguire et al., British Dental J. 194:429-436 (2003); Grillaud et al., Arch of Pediatrics and Adolescent Medicine 12:1180-1186 (2005)). In addition, xylitol in chewing gum inhibits growth of Streptococcus mutans (Haresaku et al., Caries Res. 41:198-203 (2007)), and it reduces the incidence of acute middle ear infection (Azarpazhooh et al., Cochrane Database of Systematic Reviews 11:CD007095 (2011)).

[0128] Microbial production of xylitol offers cost effective downstream processing that can reduce manufacturing cost (Rivas et al., Biotechnol. Prog. 19:706-713 (2003)). Such process would reduce the need for purified xylose, producing highly pure, easy to separate product, and be adaptable to wide variety of raw material source from different geographical locations (Ur-Rehman et al., Critical Reviews in Food Science and Nutrition 55:1514-1528 (2013)).

[0129] Many yeast species (Candida spp., Debaryomyces hansenii, Pichia anomala, Kluyveromyces spp, Pachysolen tannophilus, Saccharomyces spp. and Schizosaccharomyces pombe) have been identified with the ability to convert xylose to xylitol (Sirisansaneeyakul et al., J. Ferment. Bioeng. 80:565-570 (1995); Onishi et al., Agric. Biol. Chem. 30:1139-1144 (1966); Barbosa et al., J Ind. Microbiol. 3:241-251 (1988); Gong et al., Biotechnol. Lett. 3:125-130 (1981); Vandeska et al., World J. Microbiol. Biotechnol. 11:213-218 (1995); Dahiya et al., Cabdirect.org 292-303 (1990); Gong et al., Biotechnol. Bioeng. 25:85-102 (1983)). The ability to produce xylitol from xylulose has also been discovered in various yeast (Saccharomyces spp., D. hansenii, P. farinose, Hansenula spp., Endomycopsis chodatii, Candida spp. and Cryptococcus neoformans) (Onishi et al., Appl. Microbiol. 18:1031-1035 (1969)). The majority of research into the biological production of xylitol is with yeast, and novel yeast species capable of converting xylose to xylitol continue to be discovered (Kamat et al., J. App. Microbiol. 115: 1357-1367 (2013); Bura et al., J. Ind. Microbiol. Biotechnol. 39:1003-1011 (2012); Junyapate et al., Antonie Van Leeuwenhoek 105:471-480 (2014); Guaman-Burneo et al., Antonie Van Leeuwenhoek 108: 919-931 (2015); Cadete et al., Int. J. Syst. Evolv. Microbiol. 65:2968-2974 (2015)).

[0130] S. cerevisiae is a yeast organism that is used in many food processes, but does not naturally utilize xylose efficiently. It has been engineered to produce xylitol from xylose by expressing xylose reductases from other yeast species such as S. stipitis (P. stipitis) and C. shehatae (Hallborn et al., Bio/Technology 9:1090-1095; Hallborn et al., Appl. Microbiol. Biotechol. 42:326-333 (1994); Lee et al., Process Biochem. 35:1199-1203 (2000); Giovinden et al., Appl. Microbiol. Biotechnol. 55:76-80 (2001); Chung et al., Enzyme Microb. Technol. 30:809-816 (2002)).

[0131] Alternate pathways for xylitol production in S. cerevisiae have been explored. Expression of S. stipitis xylitol dehydrogenase and deletion of the xylulokinase gene in a transketolase-deficient strain of S. cerevisiae allowed conversion of glucose to xylitol through a multistep pathway (Toivari et al., Appl. Enviorn. Microbiol. 73:5471-5476 (2007)).

[0132] Expression of Neurospora crassa cellodextrin transporter and intracellular .beta.-glucosidase allowed it to simultaneously utilize cellobiose and xylose during xylitol production (Oh et al., Metab. Eng. 15:226-234 (2013); Zha et al., PLoS One 8:e68317 (2013)). Furthermore, the overexpression of S. cerevisae ALD5, IDP2 or S. stipitis ZWF1 lead to increased NADPH levels, resulting in higher xylitol productivity (Oh et al., Metab. Eng. 15:226-234 (2013)).

[0133] Xylitol production can be improved by the use of both NADPH-preferring and NADH-preferring xylose reductases to decrease the limitation of NAD(P)H cofactors. This strategy was used in S. cerevisiae with the expression of wild-type NADPH-preferring and mutant NADH-preferring S. stipitis xylose reductase and S. cerevisiae ZWF1 and ACS1 (Jo et al., Biotechnol. J 10:1935-1943 (2015)).

[0134] In order to decrease processing costs of xylitol production, S. stipitis xylose reductase, Aspergillus aculeatus .beta.-glucosidase, A. oryzae .beta.-xylosidase, and Trichoderma reesei endoxylanase were expressed in S. cerevisiae (Guirimand et al., Appl. Microbiol. Biotechnol. 100:3477-3487 (2016)). Expression of these fungal enzymes allowed direct degradation of hemicellulose without the addition of exogenous enzymes.

[0135] C. tropicalis is pathogenic, but is also one of the natural producers of xylitol. Several patents and literature have described the application of yeast from genus Candida as the host strain for xylitol production from xylose; i.e. C. tropicalis ATCC 13803 (PCT/IN2009/000027 & KR100259470), C. tropicalis ATCC 9968 (PCT/FI1990/000015), C. tropicalis KFCC 10960 (KR100199819), C. tropicalis (NRRL 12968) (PCT/IN2013/000523), C. tropicalis ATCC 750 (West et al., World J. Mircrobiol. Biotechnol. 25:913-916 (2009)) and C. tropicalis ATCC 7349 (SAROTE et al., J. Ferment. andBioeng. 80:565-570 (1995)). One strategy used to improve xylitol production in C. tropicalis was the expression of an NADH-preferring xylose reductase from C. parapsilosis, which allowed reduction of xylose with both NADPH and NADH (Lee et al., Appl. Enviorn. Microbiol. 69:6179-6188 (2003)). Deletion of xylitol dehydrogenase increases xylitol production by blocking xylitol catabolism, but a co-substate such as glucose or glycerol is needed to regenerate NADPH for xylose reductase activity (Ko et al., Appl. Environ. Microbiol. 72:4207-4213 (2006); Ko et al., Biotechnol. Lett. 28:1159-1162 (2006)). Further improvements for xylitol production were made by combining deletion of the xylitol dehydrogenase gene with expression of N. crassa xylose reductase (Jeon et al., Bioprocess Biosyst. Eng. 35:191-198 (2012)). The xylose uptake and xylitol productivity of this strain was again further improved by expressing a xylose transporter from Arabidopsis thaliana (Jeon et al., Bioprocess Biosyst. Eng. 36:809-817 (2013)).

[0136] If glycerol is provided as a co-substrate, NADPH regeneration can be enhanced by expressing glucose-6-phosphate dehydrogenase and 6-phosphogluconate dehydrogenase in C. tropicalis (Ahmad et al., Bioprocess Biosyst. Eng. 35:199-204 (2012)). Xylitol production can also be enhanced by deleting glycerol kinase and expressing three NADPH-regenerating glycerol dehydrogenases from S. stipitis (Ahmad et al., Bioprocess Biosyst. Eng. 36:1279-1284 (2013)). One of the problems with producing xylitol from mixed sugar substrates is that the xylose reductase from C. tropicalis can convert arabinose to arabitol, a contaminant in xylitol production. To prevent this, the endogenous xylose reductase was deleted and a mutant xylose-specific xylose reductase from N. crassa was expressed along with bacterial arabinose assimilation enzymes (Yoon et al., Biotechnol. Lett. 33:747-753 (2011); Nair et al., ChemBioChem 9:1213-1215 (2008)). This minimized arabitol formation while allowing arabinose assimilation for cell growth.

[0137] K. marxianus is a thermotolerant yeast often found in dairy products. It can be used for xylitol production due to its high growth rate, tolerance to temperatures up to 52.degree. C., and ability to utilize various sugars. Expression of the N. crassa xylose reductase alone or in conjunction with deletion of the xylitol dehydrogenase gene in K. marxianus led to xylitol production optimally at 42.degree. C. (Zhang et al., Bioresour. Technol. 152:192-201 (2014)). Further improvements to xylitol production were made by testing the expression of various xylose transporters: K. marxianus aquaglyceroporin, C. intermedia glucose/xylose facilitator, or C. intermedia glucose/xylose symporter (Zhang et al., Bioresour. Technol. 175:642-645 (2015)). The expression of the C. intermedia glucose/xylose facilitator was found to be effective at increasing xylitol yield and productivity, and notably, produced the highest reported final xylitol concentration. K. marxianus was also used in an evolutionary adaptation experiment that resulted in a strain with improved xylose utilization and xylitol production capabilities (Sharma et al., Bioprocess Biosyst. Eng. 39:835-843 (2016)).

[0138] Two other yeast species have been genetically engineered to explore xylitol production. D. hansenii is another natural producer of xylitol that is osmotolerant and non-pathogenic. Xylitol production was enhanced in this species by deletion of the xylitol dehydrogenase gene (Pal et al., Bioresour. Technol. 147:449-455 (2013)). P. pastoris is a yeast commonly used for protein expression. It has been engineered to produce xylitol directly from glucose through the glucose-arabitol-xylulose-xylitol pathway (Cheng et al., Appl. Microbiol. Biotechnol. 98:3539-3552 (2014)). This was achieved by expressing xylitol dehydrogenase from Gluconobacter oxydans and the xylulose-forming arabitol dehydrogenase from Klebsiella pneumoniae.

[0139] In addition to filamentous fungi and yeast, a limited number of bacterial species (Corynebacterium sp. and Enterobacter liquefaciens) have been observed to produce xylitol from xylose (Yoshitake et al., Agric. Biol. Chem. 35:905-911 (1971); Yoshitake et al., Agric. Biol. Chem. 37:2261-2267 (1973); Yoshitake et al., Agric. Biol. Chem. 40:1493-1503 (1976); Rangaswamy et al., Appl. Microbiol. Biotechnol. 60:88-93 (2002)). Mycobacterium smegmatis has also been reported to be able to produce xylitol from xylulose (Izumori et al., J. Ferment. Technol. 66:33-36 (1988)). A subsequent screen of bacteria discovered that Gluconobacter spp. and Acetobacter xylinum are capable of converting arabitol to xylitol through the sequential conversion of arabitol to xylulose and xylulose to xylitol (Suzuki et al., Biosci. Biotechnol. Biochem. 66:2614-2620 (2002)).

[0140] Microalgae are an attractive platform for the production of renewable resources. Xylitol production in microalgae has been reported once, where expression of the xylose reductase from Neurospora crassa in Chlamydomonas reinhardtii allowed it to convert a small amount of xylose to xylitol (Pourmir et al., J. Biotechnol. 165:178-183 (2013)).

[0141] The extracts of various filamentous fungi (Penicillium spp., Aspergillus spp., Rhizopus nigricans, Gliocladium roseum, Byssochlamys fulva, Myrothecium verrucaria, Neurospora crassa, Rhodotorula glutinis and Torulopsis utilis) have been observed to contain an enzyme capable of converting xylose to xylitol (Chiang et al., Nature 188:79-81 (1960); Chiang et al., Biochem. Biophys. Res. Commun. 3:554-559 (1960); Chiang et al., Biochem. Biophys. Acta. 29:664-5 (1958)). Subsequent studies identified additional filamentous fungi (Petromyces albertensis, Penicillium spp. and A. niger) capable of converting xylose to xylitol with varying degrees of efficiency (Dahiya et al., Can. J. Microbiol. 37:14-18 (1991); Sampaio et al., Brazilian J. Microbiol. 34:325-328 (2003)).

[0142] Trichoderma reesei, a filamentous fungus that secretes celluloytic enzymes, produced more xylitol when the genes for xylitol dehydrogenase and L-arabinitol-4-dehydrogenase were deleted in order to block xylitol metabolism (Dashtban et al., Appl. Biochem. Biotecnol. 169:554-569(2013)). Xylitol production also increased in T reesei when xylose reductase was overexpressed and xylulokinase was inhibited (Hong et al., BiomedRes. Int. 2014:169705 (2014)). Phanerochaete sordida, a white-rot fungus with ligninolytic activity, produced more xylitol when it expressed the xylose reductase gene from P. chrysosporium (Hirabayashi et al., J. Biosci. Bioeng. 120:6-8 (2015)).

[0143] Bacteria metabolize xylose with xylose isomerases instead of with the xylose reductase-xylitol dehydrogenase pathway. Therefore, the use of bacterial hosts for xylitol production typically involves recombinant expression of xylose reductases. Xylose reductase from C. tropicalis was expressed in E. coli and was found to be functional for xylitol production from xylose (Suzuki et al., J. Biosci. Bioeng. 87:280-284 (1999)). A subsequent study expressed xylose reductases from C. boidinii, C. tenuis and S. stipitis in conjunction with a deletion of the endogenous xylulokinase gene (Cirino et al., Biotechnol. Bioeng. 95:1167-1176 (2006)). In order to improve xylitol production from mixtures of glucose and xylose, the cyclic AMP receptor protein was replaced with a mutant that circumvents glucose repression of xylose metabolism. Expressing the xylose transporters, XylE or XylFGH, has similar effects to replacing the cyclic AMP receptor protein with a mutant form (Khankal et al., J. Biotechnol. 134:246-252 (2008)).

[0144] Cofactor regeneration is also important for improving xylitol production in bacteria, which has been explored in E. coli through a large number of gene deletions and expression of cofactor regenerating pathways (Chin et al., Biotechnol. Bioeng. 102:209-220 (2009); Chin et al., Biotechnol. Prog. 27:333-341 (2011); Iverson et al., World J. Microbiol. Biotechnol. 29:1225-1232 (2013); Iverson et al., BMC Syst. Biol. 10:31 (2016)). Another study aimed at improving xylitol production from mixtures of glucose and xylose disrupted the phosphoenolpyruvate-dependent glucose phosphotransferase system to eliminate catabolite repression (Su et al., Metab. Eng. 31:112-122 (2015)). Endogenous xylose metabolism was blocked in this strain by disrupting xylose isomerase, xylulose kinase, and the phosphoenolpyruvate-dependent fructose phosphotransferase system, and the N. crassa xylose reductase was expressed to optimize xylitol production.

[0145] L. lactis is a well-characterized bacterium commonly used for dairy processes such as cheese production, and could be adopted for other food-related processes. L. lactis was able to produce xylitol from xylose when it expressed the S. stipitis xylose reductase and the L. brevis xylose transporter (Nyyossola et al., J. Biotechnol. 118:55-56 (2005)).

[0146] C. glutamicum is a bacterium with many industrial uses such as the production of MSG. It has been engineered to co-utilize xylose and glucose, which is an important trait for xylitol productivity (Sasaki et al., Appl. Microbiol. Biotechnol. 85:105-115 (2009)). To optimize xylitol production in C. glutamicum, it has been engineered to express a pentose transporter and a mutant xylose reductase from C. tenuis in conjunction with disruptions of its lactate dehydrogenase, xylulokinase, and phosphoenolpyruvate-dependent fructose phosphotransferase genes (Sasaki et al., Appl. Microbiol. Biotechnol. 86:1057-1066 (2010)). Xylitol production in C. glutamicum was also achieved by expressing S. stipitis xylose reductase (Kim et al., Enzyme Microb. Technol. 46:366-371 (2010)). Expression of Rhodotorula mucilaginosa xylose reductase, E. coli1-arabinose isomerase, Agrobacterium tumefaciens d-psicose-3-epimerase, Mycobacterium smegmatis 1-xylulose reductase, and a fusion pentose transporter allowed the production of xylitol from mixtures of xylose and arabinose without the formation of arabitol (Dhar et al., J. Biotechnol. 230:63-71 (2016)).

[0147] It is understood that microbial organisms provided herein or otherwise known in the art with either natural or engineered biosynthesis pathways to produce xylitol from xylose can be used as the host strain, which can have enhanced xylose uptake and improved production of xylitol from xylose when expressing an exogenous nucleic acid encoding a xylose transporter as described herein. Further metabolic engineering can be adopted to further increase xylitol production in these host strains.

[0148] Microbial organisms having a biosynthesis pathway to produce ethanol from xylose are known in the art. In some embodiments, provided herein are non-naturally occurring microbial organisms having at least one exogenous nucleic acid encoding a xylose transporter as described herein, as well as a biosynthesis pathway for producing ethanol from xylose. With enhanced xylose uptake the microbial organism can also have improved production of ethanol from xylose. Provided herein are also methods of producing a bioderived ethanol by culturing the non-naturally occurring microbial organism provided herein having an ethanol biosynthesis pathway under conditions and for a sufficient period of time to produce ethanol.

[0149] Ethanol has a number of uses and is most commonly used as a fuel additive. As a fuel additive, ethanol is a low value product with much of the cost of its production attributed to the cost of raw materials. It would be desirable, therefore, to develop ethanologens and fermentation processes for the production of ethanol from readily available, inexpensive starting materials, such as lignocellulose. Fermentation of both glucose and xylose is currently regarded as a high priority for economical conversion of biomass into ethanol. Most microorganisms are able to ferment glucose but few have been reported to utilize xylose efficiently and even fewer ferment this pentose to ethanol.

[0150] A relatively small number of wild type microorganisms can ferment D-xylose. These microorganisms are generally not suitable for large-scale fermentation. This unfavorability may arise, for example, as a result of unfamiliarity with the microorganisms, difficulty obtaining the microorganisms, poor productivity and/or growth on pretreated lignocellulosics or unsatisfactory yield when grown on mixed sugars derived from biomass. (C. Abbas, "Lignocellulosics to ethanol: meeting ethanol demand in the future," The Alcohol Textbook, 4.sup.th Edition. (K. A. Jacques, T. P. Lyons and D. R. Kelsall, eds). Nottingham University Press, Nottingham, U K, 2003, pp. 41-57.; C. Abbas, "Emerging biorefineries and biotechnological applications of nonconventional yeast: now and in the future," The Alcohol Textbook, 4.sup.th Edition. (K. A. Jacques, T. P. Lyons and D. R. Kelsall, eds). Nottingham University Press, Nottingham, United Kingdom, 2003, pp. 171-191).

[0151] Yeasts are considered promising microorganisms for alcoholic fermentation of xylose (see Ryabova, supra). They have larger cells than bacteria, are resistant to viral infection, and tend to be more resistant to negative feedback from ethanol. Furthermore, yeast growth and metabolism have been extensively studied for a number of species.

[0152] A number of yeasts are known to naturally ferment D-xylose. These include, for example, P. stipitis, C. shehatae, and P. tannophilus (see Ryabova, supra; Cite 2, C. Abbas 2003). The common brewer's yeast S. cerevisiae is not known to ferment D-xylose naturally, but a number of strains of metabolically engineered S. cerevisiae that do ferment D-xylose have been reported.

[0153] Numerous studies have described the metabolism of D-xylose by recombinant S. cerevisiae (see, e.g., Matsushika et al., Applied Microbiology and Biotechnology 84, no. 1 (2009): 37-53; U.S. Pat. Pub. No. 2005/0153411A1 (Jul. 14, 2005); U.S. Pat. Pub. No. 2004/0231661A1 (Nov. 25, 2004); U.S. Pat. No. 4,368,268 (Jan. 11, 1983); U.S. Pat. No. 6,582,944 (Jun. 24, 2003); U.S. Pat. No. 7,226,735 (Jun. 5, 2007); U.S. Pat. Pub. No. 2004/0142456A1 (Jul. 22, 2004); Jeffries, T. W. & Jin, Y-S., Appl. Microbiol. Biotechnol. 63: 495-509 (2004); Jin, Y-S., Met. Eng. 6: 229-238 (2004); Pitkanen, J-Y., Helsinki Univ. of Tech., Dept. of Chem. Tech., Technical Biochemistry Report (January 2005); Porro, D. et al., App. & Env. Microbiol. 65(9): 4211-4215 (1999); Jin, Y-S., et al., App. & Env. Microbiol. 70(11): 6816-6825 (2004); Sybirna, K, et al., Curr. Genetics 47(3): 172-181 (2005); Toivari, M. H., et al., Metabolic Eng. 3:236-249 (2001).

[0154] D-Xylose metabolism in yeast proceeds along a pathway similar to that of glucose via pentose phosphate pathway. Carbon from D-xylose is processed to ethanol via the glycolytic cycle or to CO2 via respiratory TCA cycle. Fermentation to ethanol relies in part on the metabolism of pyruvate, which is a metabolite that may be used in either respiration or fermentation (see van Hoek, P., et al., Appl. & Enviro. Microbiol. 64(6); 2133-2140 (1998)). Pyruvate enters fermentation following decarboxylation of pyruvate to acetaldehyde by the enzyme pyruvate decarboxylase (E.C. 4.1.1.1). Pyruvate decarboxylase is a member of the family of biotin-dependent carboxylases. It catalyzes the decarboxylation of pyruvate to form oxaloacetate with ATP cleavage. The oxaloacetate can be used for synthesis of fat, glucose, and some amino acids or other derivatives. The enzyme is highly conserved and found in a variety of prokaryotes and eukaryotes.

[0155] Other microbial organisms capable of ethanol production from xylose are also known in the art. The thermotolerant methylotrophic yeast Hansenula polymorpha (also known as P. angusta) was reported to have optimum and maximum growth temperatures of 37.degree. C. and 48.degree. C., respectively, and can naturally ferment D-xylose under certain conditions. (U.S. Pat. No. 8,071,298; Voronovsky et al., FEMS Yeast Res. 5(11): 1055-62 (2005)). Additionally, three strains of P. stipitis and three of C. shehatae were reported to ferment xylose when subjected to both aerobic and microaerophilic conditions. Of the strains considered, P. stipitis NRRL Y-7124 was able to utilize all but 7 g/L of 150 g/L xylose supplied aerobically to produce 52 g/L ethanol at a yield of 0.39 g per gram xylose (76% of theoretical yield) and at a rate comparable to the fastest shown by C. shehatae NRRL Y-12878. For all strains tested, fermentation results from aerobic cultures were more favorable than those from microaerophilic cultures. Slininger, P. J. et al., Biotechnol Lett (1985) 7: 431.

[0156] For example, Zymomonas mobilis, a bacterial ethanologen that grows on glucose, fructose, and sucrose, metabolizing these sugars to CO2 and ethanol via the Entner-Douderoff pathway. Though wild type strains cannot use xylose as a carbon source, recombinant strains of Z. mobilis that are able to grow on this sugar have been engineered (U.S. patent publication No. 20080187973, U.S. Pat. Nos. 5,514,583, 5,712,133, WO 95/28476, Feldmann et al. (1992) Appl Microbiol Biotechnol 38: 354-361, Zhang et al. (1995) Science 267:240-243).

[0157] The conversion of xylose to ethanol by recombinant E. coli has been reported. The addition of small amounts of calcium, magnesium, and ferrous ions stimulated fermentation. Beall et al., Biotechnology and Bioengineering 38, no. 3 (1991): 296-303.

[0158] It is understood that microbial organisms provided herein or otherwise known in the art with either natural or engineered biosynthesis pathways to produce ethanol from xylose can be used as the host strain, which can have enhanced xylose uptake and improved production of ethanol from xylose when expressing an exogenous nucleic acid encoding a xylose transporter as described herein. Further metabolic engineering can be adopted to further increase ethanol production in these host strains.

[0159] Microbial organisms having a biosynthesis pathway to produce n-butanol from xylose are known in the art. See e.g. Kudahettige-Nilsson R L, et al., Bioresour Technol. 176:71-9 (2015); Xin F, et al., Appl Environ Microbiol., 80(15):4771-8 (2014); Xiao H, et al., Metab Eng. 14(5):569-78 (2012); Zhang J, et al., Biotechnol Lett. 38(4):611-7 (2016); Yu L, et al. Biotechnol Bioeng. 112(10):2134-41 (2015); Steen, et al, Microb Cell Fact. 7:36 (2008); Pdsztor A, et al., Biotechnol Bioeng., 112(1):120-8 (2015); Shi S, et al., Sci Rep. 6:25675(2016); Dellomonaco C, et al., Nature, 10:476(7360):355-9 (2011). In some embodiments, provided herein are non-naturally occurring microbial organisms having at least one exogenous nucleic acid encoding a xylose transporter as described herein, as well as a biosynthesis pathway for producing n-butanol from xylose. With enhanced xylose uptake the microbial organism can also have improved production of n-butanol from xylose. Provided herein are also methods of producing a bioderived n-butanol by culturing the non-naturally occurring microbial organism provided herein having a n-butanol biosynthesis pathway under conditions and for a sufficient period of time to produce n-butanol.

[0160] Butanol offers a number of benefits as a fuel. Butanol is a four-carbon alcohol, a clear neutral liquid miscible with most solvents (alcohols, ether, aldehydes, ketones and hydrocarbons) and is sparingly soluble in water (water solubility 6.3% as compared to ethanol which is totally miscible). It has an octane rating comparable to gasoline, making it a valuable fuel for any internal combustion engine made for burning gasoline. Fuel testing also has proven that butanol does not phase separate in the presence of water, and has no negative impact on elastomer swelling. Butanol not only has a higher energy content that is closer to that of gasoline than ethanol, so it is less of a compromise on fuel economy, but it also can be easily added to conventional gasoline due to its low vapor pressure.

[0161] Butanol biosynthesis can be achieved through the acetone, butanol, and ethanol fermentation pathway (the "ABE pathway"). The products of this butanol fermentative production pathway using a solvent-producing species of the bacterium Clostridium acetobutylicnm are six parts butanol, three parts acetone, and one part ethanol. Butanol-production pathway has been introduced to various host organisms. For instance, the pathway was expressed in Escherichia coli (Atsumi et al., Nature 451:86-89 (2008)) and S. cerevisiae (Steen et al., Microb. Cell Fact 7:36 (2008)) for their high growth rates and the efficiency of genetic tools. P. putida, L. brevis and B. subtilis were used for their potentially higher solvent tolerance (Nielsen et al., Metab. Eng. 11:262-273 (2009); Berezina et al., Appl. Microbiol. Bot. 87:635-646 (2010)).

[0162] An alternative to the use of food crops as starting material for butanol production is biomass, specifically lignocellulosic biomass. Clostridium spp. strains have been engineered to produce butanol for xylose, such as C. saccharoperbutylacetonicum (e.g., C. saccharoperbutylacetonicum strain ATCC 27021 or C. saccharoperbutylacetonicum strain ATCC 27022). See e.g. U.S. Pat. No. 8,900,841. C. cellulolyticum was engineered to divert its native valine synthesis pathway for isobutanol production from crystalline cellulose (Higashide et al., Appl. Environ. Microb. 77:2727-2733 (2011)). C. cellulovorans, which natively produces butyric acid as the main metabolic product, was introduced with an aldehyde/alcohol dehydrogenase (AdhE2) to convert precursor butyryl-CoA to 1-butanol from cellulose (Yang et al., Metab. Eng. 32:39-48 (2015)). 1-Butanol production from xylose was also demonstrated using Thermoanaerobacterium saccharolyticum (Bhandiwad et al., Metab. Eng. 21:17-25 (2014)).

[0163] To increase the cellulose decomposition rate and to reduce chance of contamination, thermophilic organisms were used. The first example of isobutanol production in thermophiles was demonstrated in Geobacillus thermoglucosidasius using cellobiose as substrate (Lin et al., Metab. Eng. 24:1-8 (2014)). In this work, thermostabilities of enzymes involved in isobutanol synthesis were investigated. The result of this study was applied to the direct conversion of cellulose to isobutanol in C. thermocellum by expressing and optimizing the isobutanol biosynthesis pathway (Lin et al., Metab. Eng. 31:44-52 (2015)).

[0164] S. cerevisiae has several benefits such as high ethanol production from hexoses and high tolerance to ethanol and other inhibitory compounds in the acid hydrolysates of lignocellulose biomass. Although standard strains of this yeast cannot utilize pentoses, such as xylose, a recombinant yeast strain can be provided that can ferment xylose and cellooligosaccharides by integrating genes for the intercellular expression of xylose assimilation pathways, such as xylose reductase and xylitol dehydrogenase from P. stipitis and a gene for displaying .beta.-glucosidase from A. acleatus. See e.g. U.S. Patent Publication No. 20100129885; U.S. Patent Publication No. 20100261241.

[0165] It is understood that microbial organisms provided herein or otherwise known in the art with either natural or engineered biosynthesis pathways to produce n-butanol from xylose can be used as the host strain. These microbial organisms can have enhanced xylose uptake and improved production of n-butanol from xylose when expressing an exogenous nucleic acid encoding a xylose transporter as described herein. Further metabolic engineering can be adopted to further increase n-butanol production in these host strains.

[0166] Microbial organisms having a biosynthesis pathway to produce isobutanol from xylose are known in the art. See e.g. Felpeto-Santero C, et al., AMB Express 5(1):119 (2015). In some embodiments, provided herein are non-naturally occurring microbial organisms having at least one exogenous nucleic acid encoding a xylose transporter as described herein, as well as a biosynthesis pathway for producing isobutanol from xylose. With enhanced xylose uptake the microbial organism can also have improved production of isobutanol from xylose. Provided herein are also methods of producing a bioderived isobutanol by culturing the non-naturally occurring microbial organism provided herein having a isobutanol biosynthesis pathway under conditions and for a sufficient period of time to produce isobutanol.

[0167] Isobutanol, also a biofuel candidate, has been produced in recombinant microorganisms expressing a heterologous, five-step metabolic pathway (See, e.g., WO/2007/050671, WO/2008/098227, and WO/2009/103533). Other pathways for isobutanol production are also known in the art. See e.g., U.S. Pat. No. 8,530,226 B2; U.S. Pat. No. 8,114,641B2; U.S. Pat. No. 8,975,049 B2. The recombinant microorganism including a pathway for the production of isobutanol from five-carbon (pentose) sugars including xylose is also known in the art. (See e.g., WO 2012173659; WO 2011153144). The recombinant microorganism can be engineered to express a functional exogenous xylose isomerase. Exogenous xylose isomerases functional in yeast are known in the art. See, e.g., US2006/0234364. The exogenous xylose isomerase gene can be operatively linked to promoter and terminator sequences that are functional in the yeast cell. Various methods of genetic engineering to improve isobutanol production are also known in the art. (See e.g., Avalos et al., Nature Biotechnology 31, 335-41 (2013).)

[0168] For example, recombinant S. cerevisiae was known to produce isobutanol from xylose. See e.g. US20130035515, Brat et al., FEMSyeast research 13.2 (2013): 241-244; Lee, Won-Heong et al. Bioprocess and biosystems engineering 35.9 (2012): 1467-1475; Simultaneous overexpression of an optimized, cytosolically localized valine biosynthesis pathway together with overexpression of xylose isomerase XylA from C. phytofermentans, transaldolase Tall and xylulokinase Xks1 enabled recombinant S. cerevisiae cells to complement the valine auxotrophy of ilv2,3,5 triple deletion mutants for growth on D-xylose as the sole carbon source. Moreover, after additional overexpression of ketoacid decarboxylase Arol0 and alcohol dehydrogenase Adh2, the cells were able to ferment D-xylose directly to isobutanol.

[0169] It is understood that microbial organisms provided herein or otherwise known in the art with either natural or engineered biosynthesis pathways to produce isobutanol from xylose can be used as the host strain, which can have enhanced xylose uptake and improved production of isobutanol from xylose when expressing an exogenous nucleic acid encoding a xylose transporter as described herein. Further metabolic engineering can be adopted to further increase isobutanol production in these host strains.

[0170] Microbial organisms having a biosynthesis pathway to produce isopropanol are known in the art. Hanai T, et al., Appl Environ Microbiol., 73(24):7814-8 (2007). In some embodiments, provided herein are non-naturally occurring microbial organisms having at least one exogenous nucleic acid encoding a xylose transporter as described herein, as well as a biosynthesis pathway for producing isopropanol from xylose. With enhanced xylose uptake the microbial organism can also have improved production of isopropanol from xylose. Provided herein are also methods of producing a bioderived isopropanol by culturing the non-naturally occurring microbial organism provided herein having an isopropanol biosynthesis pathway under conditions and for a sufficient period of time to produce isopropanol.

[0171] Polymerization of ethylene provides polyethylene, a type of plastic with a wide range of useful applications. Ethylene is traditionally produced by refined non-renewable fossil fuels, but dehydration of biologically-derived ethanol to ethylene offers an alternative route to ethylene from renewable carbon sources, i.e., ethanol from fermentation of fermentable sugars. Similarly, isopropanol and n-propanol can be dehydrated to propylene, which in turn can be polymerized to polypropylene. As with polyethylene, using biologically-derived propanol starting material (i.e., isopropanol or n-propanol) would result in "Green Polypropylene." See e.g. WO 2009/049274, WO 2009/103026, WO 2009/131286, WO 2010/071697, WO 2011/031897, WO 2011/029166, WO 2011/022651, WO 2012/058603.

[0172] Production of isopropanol has been observed in recombinant Lactobacillus host cells (e.g., Lactobacillus reuteri) engineered to have an isopropanol pathway and produce increased amounts of isopropanol. See e.g. WO2013178699 A1. Direct isopropanol production from cellobiose by engineered Escherichia coli using a synthetic pathway was also observed. See e.g. Soma et al., Journal of bioscience and bioengineering 114.1: 80-85 (2012).

[0173] It is understood that microbial organisms provided herein or otherwise known in the art with either natural or engineered biosynthesis pathways to produce isopropanol from xylose can be used as the host strain, which can have enhanced xylose uptake and improved production of isopropanol from xylose when expressing an exogenous nucleic acid encoding a xylose transporter as described herein. Further metabolic engineering can be adopted to further increase isopropanol production in these host strains.

[0174] Arabitol belongs to the pentitol family and is used in the food industry as a sweetener and in the production of human therapeutics as an anticariogenic agent and an adipose tissue reducer. It can also be utilized as a substrate for chemical products such as arabinoic and xylonic acids, propylene, ethylene glycol, xylitol and others. It is included on the list of 12 building block C3-C6 compounds, designated for further biotechnological research. This polyol can be produced by yeasts in the processes of bioconversion or biotransformation of waste materials from agriculture, the forest industry (L-arabinose, glucose) and the biodiesel industry (glycerol). There are native yeasts from the genera Candida, Pichia, Debaryomyces and Zygosaccharomyces as well as genetically modified strains of Saccharomyces cerevisiae that are able to utilize biomass hydrolysates to effectively produce L- or D-arabitol. Kordowska-Wiater, Journal of Applied Microbiology 119, 303-314 (2015).

[0175] Microbial organisms having a biosynthesis pathway to produce arabitol are known in the art. (See e.g. Kordowska-Wiater, Journal of Applied Microbiology 119, 303-314 (2015); Nozaki et al., Biosci. Biotechnol. Biochem., 67(9): 1923-29 (2003).) For example, the recently identified Zygocaccharomyces rouxxii NRRL 27,624 strain is known to produce D-arabitol as the main metabolic product from glucose (Saha et al., J Ind Microbiol Biotechnol 34:519-523 (2007)). However, it also was identified as producing D-arabitol and xylitol from xylose and from a mixture of xylose and xylulose (Saha et al., 2007). Based on these results, the pathway for production of D-arabitol from xylose included a xylose reductase, a xylitol dehydrogenase and an arabitol dehydrogenase (Saha et al., 2007). Additionally, Candida maltosa has been shown to produce D-arabitol from D-xylulose by a xylulose reductase (Cheng et al., Microbial. Cell Factories, 10:5 (2011)). Production of arabitol was also found to be improved by the addition of xylose with glycerol in the yeast species within the genus of Debaryomyces, Geotrichum and Metschnikowia (International Application Publication WO 2012/011962 (2012)).

[0176] In some embodiments, provided herein are non-naturally occurring microbial organisms having at least one exogenous nucleic acid encoding a xylose transporter as described herein, as well as a biosynthesis pathway for producing arabitol from xylose. With enhanced xylose uptake the microbial organism can also have improved production of arabitol from xylose. Provided herein are also methods of producing a bioderived arabitol by culturing the non-naturally occurring microbial organism provided herein having an arabitol biosynthesis pathway under conditions and for a sufficient period of time to produce arabitol.

[0177] It is understood that microbial organisms provided herein or otherwise known in the art with either natural or engineered biosynthesis pathways to produce arabitol from xylose can be used as the host strain, which can have enhanced xylose uptake and improved production of arabitol from xylose when expressing an exogenous nucleic acid encoding a xylose transporter as described herein. Further metabolic engineering can be adopted to further increase arabitol production in these host strains.

[0178] Microbial organisms having a biosynthesis pathway to produce ethyl acetate from xylose are known in the art. Morrissey J P, et al., Yeast, 32(1):3-16 (2015). In some embodiments, provided herein are non-naturally occurring microbial organisms having at least one exogenous nucleic acid encoding a xylose transporter as described herein, as well as a biosynthesis pathway for producing ethyl acetate from xylose. With enhanced xylose uptake the microbial organism can also have improved production of ethyl acetate from xylose. Provided herein are also methods of producing a bioderived ethyl acetate by culturing the non-naturally occurring microbial organism provided herein having an ethyl acetate biosynthesis pathway under conditions and for a sufficient period of time to produce ethyl acetate.

[0179] Ethyl acetate is an environmentally friendly solvent with many industrial applications. Microbial synthesis of ethyl acetate is desirable. The ability of yeasts for producing larger amounts of this ester is known for a long time and can be applied to large-scale ester production from renewable raw materials. P. anomala, C. utilis, and K. marxianus are yeasts which convert sugar into ethyl acetate with a high yield. Loser et al., Appl Microbiol Biotechnol (2014) 98:5397-5415.

[0180] Synthesis of much ethyl acetate requires oxygen which is usually supplied by aeration. Ethyl acetate is highly volatile so that aeration results in its phase transfer and stripping. This stripping process cannot be avoided but requires adequate handling during experimentation and offers a chance for a cost-efficient process-integrated recovery of the synthesized ester.

[0181] It is understood that microbial organisms provided herein or otherwise known in the art with either natural or engineered biosynthesis pathways to produce ethyl acetate from xylose can be used as the host strain, which can have enhanced xylose uptake and improved production of ethyl acetate from xylose when expressing an exogenous nucleic acid encoding a xylose transporter as described herein. Further metabolic engineering can be adopted to further increase ethyl acetate production in these host strains.

[0182] Microbial organisms having a biosynthesis pathway to produce phenyl-ethyl alcohol are known in the art. See e.g. Kim B, et al., Biotechnol Bioeng. 111(1):115-24 (2014). In some embodiments, provided herein are non-naturally occurring microbial organisms having at least one exogenous nucleic acid encoding a xylose transporter as described herein, as well as a biosynthesis pathway for producing phenyl-ethyl alcohol from xylose. With enhanced xylose uptake the microbial organism can also have improved production of phenyl-ethyl alcohol from xylose. Provided herein are also methods of producing a bioderived phenyl-ethyl alcohol by culturing the non-naturally occurring microbial organism provided herein having an phenyl-ethyl alcohol biosynthesis pathway under conditions and for a sufficient period of time to produce phenyl-ethyl alcohol.

[0183] Phenyl-ethyl alcohol a colorless, transparent, slightly viscous liquid that can be produced by microbial organisms. Phenyl-ethyl alcohol has been found in a number of natural essential oils, in food, spices and tobacco, and in undistilled alcoholic beverages, beers and wines. It prevents or retards bacterial growth, and thus protects cosmetics and personal care products from spoilage. Phenyl-ethyl alcohol also imparts a fragrance to a product.

[0184] It is understood that microbial organisms provided herein or otherwise known in the art with either natural or engineered biosynthesis pathways to produce phenyl-ethyl alcohol from xylose can be used as the host strain, which can have enhanced xylose uptake and improved production of phenyl-ethyl alcohol from xylose when expressing an exogenous nucleic acid encoding a xylose transporter as described herein. Further metabolic engineering can be adopted to further increase phenyl-ethyl alcohol production in these host strains.

[0185] Microbial organisms having a biosynthesis pathway to produce 2-methyl-butanol are known in the art. See e.g. U.S. Pat. No. 8,114,641B2; U.S. Pat. No. 8,975,049 B2. In some embodiments, provided herein are non-naturally occurring microbial organisms having at least one exogenous nucleic acid encoding a xylose transporter as described herein, as well as a biosynthesis pathway for producing 2-methyl-butanol from xylose. With enhanced xylose uptake the microbial organism can also have improved production of 2-methyl-butanol from xylose. Provided herein are also methods of producing a bioderived 2-methyl-butanol by culturing the non-naturally occurring microbial organism provided herein having a 2-methyl-butanol biosynthesis pathway under conditions and for a sufficient period of time to produce 2-methyl-butanol.

[0186] 2-methyl-butanol can be used as a solvent and an intermediate in the manufacture of other chemicals. 2-methyl-butanol also has applications in fuel and lubricating oil additives, flotation aids, manufacture of corrosion inhibitors, pharmaceuticals, paint solvent, and extraction agent.

[0187] It is understood that microbial organisms provided herein or otherwise known in the art with either natural or engineered biosynthesis pathways to produce 2-methyl-butanol from xylose can be used as the host strain, which can have enhanced xylose uptake and improved production of 2-methyl-butanol from xylose when expressing an exogenous nucleic acid encoding a xylose transporter as described herein. Further metabolic engineering can be adopted to further increase 2-methyl-butanol production in these host strains.

[0188] Microbial organisms having a biosynthesis pathway to produce 3-methyl-butanol are known in the art. See e.g. U.S. Pat. No. 8,114,641B2; U.S. Pat. No. 8,975,049 B2; U.S. Pat. No. 7,985,567 B2. In some embodiments, provided herein are non-naturally occurring microbial organisms having at least one exogenous nucleic acid encoding a xylose transporter as described herein, as well as a biosynthesis pathway for producing 3-methyl-butanol from xylose. With enhanced xylose uptake the microbial organism also has improved production of 3-methyl-butanol from xylose. Provided herein are also methods of producing a bioderived 3-methyl-butanol by culturing the non-naturally occurring microbial organism provided herein having a 3-methyl-butanol biosynthesis pathway under conditions and for a sufficient period of time to produce 3-methyl-butanol.

[0189] 3-methyl-butanol (also known as isoamyl alcohol or isopentyl alcohol) is a clear, colorless alcohol. 3-methyl-butanol is a main ingredient in the production of banana oil, an ester found in nature and also produced as a flavouring in industry. It is also the main ingredient of Kovac's reagent, used for the bacterial diagnostic indole test. 3-methyl-butanol is also used as an antifoaming agent in the chloroform:isomyl alcohol reagent.

[0190] It is understood that microbial organisms provided herein or otherwise known in the art with either natural or engineered biosynthesis pathways to produce 3-methyl-butanol from xylose can be used as the host strain, which can have enhanced xylose uptake and improved production of 3-methyl-butanol from xylose when expressing an exogenous nucleic acid encoding a xylose transporter as described herein. Further metabolic engineering can be adopted to further increase 3-methyl-butanol production in these host strains.

[0191] Depending on the biosynthetic pathway constituents of a selected host microbial organism for a particular compound, the non-naturally occurring microbial organisms provided herein can include at least one exogenously expressed biosynthetic pathway-encoding nucleic acid and up to all encoding nucleic acids for one or more biosynthetic pathways of the compound. The compound can be, for example, xylitol, ethanol, n-butanol, isobutanol, isopropanol, arabitol, ethyl acetate, phenyl-ethyl alcohol, 2-methyl-butanol, or 3-methyl-butanol. For example, ethanol biosynthesis can be established in a host deficient in a pathway enzyme or protein that is required to produce ethanol from xylose through exogenous expression of the corresponding encoding nucleic acid. In other words, in a host deficient in all enzymes or proteins of an ethanol pathway, exogenous expression of all enzyme or proteins in the pathway can be included, although it is understood that all enzymes or proteins of a pathway can be expressed even if the host contains at least one of the pathway enzymes or proteins. For example, exogenous expression of all enzymes or proteins in a pathway for production of ethanol can be included in S. cerevisiae to enhance the production of ethanol from xylose, although S. cerevisiae has endogenous expression for all enzymes of the ethanol biosynthesis pathway from xylose except a xylose transporter.

[0192] Given the teachings and guidance provided herein, those skilled in the art will understand that the number of encoding nucleic acids to introduce in an expressible form will, at least, parallel the pathway deficiencies of the selected host microbial organism. Therefore, a non-naturally occurring microbial organism of the invention can have one, two, three, four, five, six, seven or eight up to all nucleic acids encoding the enzymes or proteins constituting a biosynthetic pathway. In some embodiments, the non-naturally occurring microbial organisms also can include other genetic modifications that facilitate or optimize biosynthesis of a particular compound or that confer other useful functions onto the host microbial organism. One such other functionality can include, for example, augmentation of the synthesis of one or more of the pathway precursors for a particular compound.

[0193] Generally, a host microbial organism is selected such that it produces the desired product or the precursor of a desired product, either as a naturally produced molecule or as an engineered product that either provides de novo production of a desired precursor or increased production of a precursor naturally produced by the host microbial organism. For example, ethanol is produced naturally in a host organism such as E. coli. A host organism can be engineered to increase production of a precursor, as disclosed herein. In addition, a microbial organism that has been engineered to produce a desired precursor can be used as a host organism and further engineered to express enzymes or proteins of a particular biosynthesis pathway.

[0194] In some embodiments, a non-naturally occurring microbial organism provided herein is generated from a host that contains the enzymatic capability to synthesize compounds such as xylitol, ethanol, n-butanol, isobutanol, isopropanol, arabitol, ethyl acetate, phenyl-ethyl alcohol, 2-methyl-butanol, or 3-methyl-butanol from xylose. In this specific embodiment it can be useful to increase the synthesis or accumulation of the desired product to, for example, drive the biosynthesis pathway reactions toward the production of the desired product. Increased synthesis or accumulation can be accomplished by, for example, overexpression of nucleic acids encoding one or more of the biosynthesis pathway enzymes or proteins for producing compounds such as xylitol, ethanol, n-butanol, isobutanol, isopropanol, arabitol, ethyl acetate, phenyl-ethyl alcohol, 2-methyl-butanol, or 3-methyl-butanol from xylose. Overexpression of the enzyme or enzymes and/or protein or proteins of the biosynthesis pathways of desired pathway can occur, for example, through exogenous expression of the endogenous gene or genes, or through exogenous expression of the heterologous gene or genes. Therefore, the microbial organisms with enhanced xylose uptake as provided herein can be readily modified for producing a desired compound, for example, through overexpression of one, two, three, four, five, and up to all nucleic acids encoding the biosynthetic pathway enzymes or proteins for the desired product. In addition, a non-naturally occurring organism can be generated by mutagenesis of an endogenous gene that results in an increase in activity of an enzyme in the biosynthetic pathway.

[0195] In particularly useful embodiments, exogenous expression of the encoding nucleic acids is employed. Exogenous expression confers the ability to custom tailor the expression and/or regulatory elements to the host and application to achieve a desired expression level that is controlled by the user. However, endogenous expression also can be utilized in other embodiments such as by removing a negative regulatory effector or induction of the gene's promoter when linked to an inducible promoter or other regulatory element. Thus, an endogenous gene having a naturally occurring inducible promoter can be up-regulated by providing the appropriate inducing agent, or the regulatory region of an endogenous gene can be engineered to incorporate an inducible regulatory element, thereby allowing the regulation of increased expression of an endogenous gene at a desired time. Similarly, an inducible promoter can be included as a regulatory element for an exogenous gene introduced into a non-naturally occurring microbial organism.

[0196] It is understood that any of the one or more exogenous nucleic acids can be introduced into a microbial organism to produce a non-naturally occurring microbial organism with increased production of a desired product, such as xylitol, ethanol, n-butanol, isobutanol, isopropanol, arabitol, ethyl acetate, phenyl-ethyl alcohol, 2-methyl-butanol, or 3-methyl-butanol. The nucleic acids can be introduced so as to confer, for example, a biosynthetic pathway to produce ethanol from xylose onto the microbial organism. Alternatively, encoding nucleic acids can be introduced to produce an intermediate microbial organism having the biosynthetic capability to catalyze some of the required reactions to confer biosynthetic capability. For example, a non-naturally occurring microbial organism having a biosynthetic pathway can comprise at least two exogenous nucleic acids encoding desired enzymes or proteins. Thus, it is understood that any combination of two or more enzymes or proteins of a biosynthetic pathway can be included in a non-naturally occurring microbial organism of the invention. Similarly, it is understood that any combination of three or more enzymes or proteins of a biosynthetic pathway can be included in a non-naturally occurring microbial organism of the invention so long as the combination of enzymes and/or proteins of the desired biosynthetic pathway results in production of the corresponding desired product. Similarly, any combination of four or more enzymes or proteins of a biosynthetic pathway as disclosed herein can be included in a non-naturally occurring microbial organism of the invention, as desired, so long as the combination of enzymes and/or proteins of the desired biosynthetic pathway results in production of the corresponding desired product.

[0197] In addition to the biosynthesis of a desired product as described herein, the non-naturally occurring microbial organisms and methods provided herein also can be utilized in various combinations with each other and/or with other microbial organisms and methods well known in the art to achieve product biosynthesis by other routes. For example, one alternative to produce ethanol other than use of the ethanol producers is through addition of another microbial organism capable of converting an ethanol pathway intermediate to ethanol. One such procedure includes, for example, the fermentation of a microbial organism that produces an ethanol pathway intermediate. The ethanol pathway intermediate can then be used as a substrate for a second microbial organism that converts the ethanol pathway intermediate to ethanol. The ethanol pathway intermediate can be added directly to another culture of the second organism or the original culture of the ethanol pathway intermediate producers can be depleted of these microbial organisms by, for example, cell separation, and then subsequent addition of the second organism to the fermentation broth can be utilized to produce the final product without intermediate purification steps. Although ethanol is used as an example here, the same approach can be used for production of other desired products such as xylitol, ethanol, n-butanol, isobutanol, isopropanol, arabitol, ethyl acetate, phenyl-ethyl alcohol, 2-methyl-butanol, or 3-methyl-butanol.

[0198] In other embodiments, the non-naturally occurring microbial organisms and methods provided herein can be assembled in a wide variety of subpathways to achieve biosynthesis of a desired product. In these embodiments, biosynthetic pathways for a desired product of the invention can be segregated into different microbial organisms, and the different microbial organisms can be co-cultured to produce the final product. In such a biosynthetic scheme, the product of one microbial organism is the substrate for a second microbial organism until the final product is synthesized. For example, the biosynthesis of a desired product can be accomplished by constructing a microbial organism that contains biosynthetic pathways for conversion of one pathway intermediate to another pathway intermediate or the product. Alternatively, a desired product also can be biosynthetically produced from microbial organisms through co-culture or co-fermentation using two organisms in the same vessel, where the first microbial organism produces an intermediate for the desired product and the second microbial organism converts the intermediate to the desired product. The desired product can be xylitol, ethanol, n-butanol, isobutanol, isopropanol, arabitol, ethyl acetate, phenyl-ethyl alcohol, 2-methyl-butanol, or 3-methyl-butanol.

[0199] Given the teachings and guidance provided herein, those skilled in the art will understand that a wide variety of combinations and permutations exist for the non-naturally occurring microbial organisms and methods provided herein, together with other microbial organisms, with the co-culture of other non-naturally occurring microbial organisms having subpathways and with combinations of other chemical and/or biochemical procedures well known in the art to produce a desired product.

[0200] In some embodiments, the methods provided herein to produce a bioderived compound further include separated from other components in the culture using a variety of methods well known in the art. The bioderived compound can be xylitol, ethanol, n-butanol, isobutanol, isopropanol, arabitol, ethyl acetate, phenyl-ethyl alcohol, 2-methyl-butanol, or 3-methyl-butanol. Such separation methods include, for example, extraction procedures as well as methods that include continuous liquid-liquid extraction, pervaporation, membrane filtration, membrane separation, reverse osmosis, electrodialysis, distillation, crystallization, centrifugation, extractive filtration, ion exchange chromatography, size exclusion chromatography, adsorption chromatography, ultrafiltration, activated charcoal adsorption, pH adjustment and precipitation, or a combination of one or more methods enumerated above. All of the above methods are well known in the art.

[0201] Any of the non-naturally occurring microbial organisms described herein can be cultured to produce and/or secrete the desired bioderived compound including such as xylitol, ethanol, n-butanol, isobutanol, isopropanol, arabitol, ethyl acetate, phenyl-ethyl alcohol, 2-methyl-butanol, or 3-methyl-butanol. For example, the microbial organisms provided herein can be cultured for the biosynthetic production of a desired compound. Accordingly, in some embodiments, provided herein are culture media containing a desired bioderived compound described herein or intermediate thereof. In some aspects, the culture medium can also be separated from the non-naturally occurring microbial organisms that produced the a desired bioderived compound or intermediate thereof. Methods for separating a microbial organism from culture medium are well known in the art. Exemplary methods include filtration, flocculation, precipitation, centrifugation, sedimentation, and the like.

[0202] For the production of the desired bioderived compound including such as xylitol, ethanol, n-butanol, isobutanol, isopropanol, arabitol, ethyl acetate, phenyl-ethyl alcohol, 2-methyl-butanol, or 3-methyl-butanol, the microbial organisms provided herein are cultured in a medium with carbon source and other essential nutrients. In some embodiments, the microbial organisms provided herein are cultured in an aerobic culture medium. In some embodiments, the microbial organisms provided herein are cultured in a substantially anaerobic culture medium. As described herein, one exemplary growth condition for achieving biosynthesis of a desired product such as xylitol, ethanol, n-butanol, isobutanol, isopropanol, arabitol, ethyl acetate, phenyl-ethyl alcohol, 2-methyl-butanol, or 3-methyl-butanol includes anaerobic culture or fermentation conditions. In certain embodiments, the non-naturally occurring microbial organisms provided herein can be sustained, cultured or fermented under anaerobic or substantially anaerobic conditions. Briefly, an anaerobic condition refers to an environment devoid of oxygen. Substantially anaerobic conditions include, for example, a culture, batch fermentation or continuous fermentation such that the dissolved oxygen concentration in the medium remains between 0 and 10% of saturation. Substantially anaerobic conditions also includes growing or resting cells in liquid medium or on solid agar inside a sealed chamber maintained with an atmosphere of less than 1% oxygen. The percent of oxygen can be maintained by, for example, sparging the culture with an N.sub.2/CO.sub.2 mixture or other suitable non-oxygen gas or gases.

[0203] It is sometimes desirable and can be highly desirable to maintain anaerobic conditions in the fermenter to reduce the cost of the overall process. Such conditions can be obtained, for example, by first sparging the medium with nitrogen and then sealing the flasks with a septum and crimp-cap. For strains where growth is not observed anaerobically, microaerobic or substantially anaerobic conditions can be applied by perforating the septum with a small hole for limited aeration. Exemplary anaerobic conditions have been described previously and are well-known in the art. Exemplary aerobic and anaerobic conditions are described, for example, in United States publication 2009/0047719, filed Aug. 10, 2007. Fermentations can be performed in a batch, fed-batch or continuous manner, as disclosed herein. Fermentations can also be conducted in two phases, if desired. The first phase can be aerobic to allow for high growth and therefore high productivity, followed by an anaerobic phase of high yields.

[0204] If desired, the pH of the medium can be maintained at a desired pH, in particular neutral pH, such as a pH of around 7 by addition of a base, such as NaOH or other bases, or acid, as needed to maintain the culture medium at a desirable pH. The growth rate can be determined by measuring optical density using a spectrophotometer (600 nm), and the glucose uptake rate by monitoring carbon source depletion over time.

[0205] The culture medium for the microbial organisms provided herein can include xylose, either as the sole source of carbon or in combination with one or more co-substrates described herein or known in the art. The culture medium can further include other supplements, such as yeast extract, and/or peptone. The culture medium can further include, for example, any other carbohydrate source which can supply a source of carbon to the non-naturally occurring microorganism. Such sources include, for example: other sugars such as cellobiose, hemicelluloses, glucose, arabinose, galactose, mannose, fructose, sucrose and starch; or glycerol. The source can be biomass hydrolysate. Thus, the culture medium can include xylose and the co-substrate glucose. The culture medium can include xylose and the co-substrate cellobiose. The culture medium can include xylose and the co-substrate hemicellulose. The culture medium can include xylose and the co-substrate galactose. The culture medium can include xylose and the co-substrate glycerol.

[0206] The culture medium can have 1%, 2%, 3%, 4%, 5%, 6%, 7% 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, or higher amount of sugar (w/v). In some embodiments, the culture medium can have 2% sugar. In some embodiments, the culture medium can have 4% sugar. In some embodiments, the culture medium can have 10% sugar. In some embodiments, the culture medium can have 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, or higher amount of xylose (w/v). The culture medium can have 1% xylose. The culture medium can have 2% xylose. The culture medium can have 3% xylose. The culture medium can have 4% xylose. The culture medium can have 5% xylose. The culture medium can have 6% xylose. The culture medium can have 7% xylose. The culture medium can have 8% xylose. The culture medium can have 9% xylose. The culture medium can have 10% xylose. The culture medium can have 11% xylose. The culture medium can have 12% xylose. The culture medium can have 12% xylose. The culture medium can have 13% xylose. The culture medium can have 14% xylose. The culture medium can have 15% xylose. The culture medium can have 16% xylose. The culture medium can have 17% xylose. The culture medium can have 18% xylose. The culture medium can have 19% xylose. The culture medium can have 20% xylose.

[0207] The culture medium can be a C5-rich medium, with a five carbon sugar (such as xylose) as the primary carbon source. The culture medium can also have a C6 sugar (six-carbon sugar). In some embodiments, the culture medium can have a C6 sugar as the primary carbon source. In some embodiments, the C6 sugar is glucose. The culture can have both a C6 sugar and a C5 sugar as the carbon source can have the C6 sugar and the C5 sugar present at different ratios. In some embodiment, the ratio of the amount of C6 sugar to that of the C5 sugar (the C6:C5 ratio) in the culture medium is between about 10:1 and about 1:10. For example, the C6:C5 ratio in the culture medium can be about 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 3:1, 2:1, 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9 or 1:10. In some embodiments, the C6:C5 ratio in the culture medium is about 3:1. In some embodiments, the C6:C5 ratio in the culture medium is about 1:1. In some embodiments, the C6:C5 ratio in the culture medium is about 1:5. In some embodiments, the C6:C5 ratio in the culture medium is about 1:10. The C5 sugar can be xylose, and the C6 sugar can be glucose. In some embodiment, the ratio of the amount of glucose to that of xylose (the glucose:xylose ratio) in the culture medium is between about 10:1 and about 1:10. For example, the glucose:xylose ratio in the culture medium can be about 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 3:1, 2:1, 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9 or 1:10. In some embodiments, the glucose:xylose ratio in the culture medium is about 3:1. In some embodiments, the glucose:xylose ratio in the culture medium is about 1:1. In some embodiments, the glucose:xylose ratio in the culture medium is about 1:5. In some embodiments, the glucose:xylose ratio in the culture medium is about 1:10.

[0208] Other sources of carbohydrate include, for example, renewable feedstocks and biomass. Exemplary types of biomasses that can be used as feedstocks in the methods of the invention include cellulosic biomass, hemicellulosic biomass and lignin feedstocks or portions of feedstocks. Such biomass feedstocks contain, for example, carbohydrate substrates useful as carbon sources such as xylose, glucose, arabinose, galactose, mannose, fructose and starch. Given the teachings and guidance provided herein, those skilled in the art will understand that renewable feedstocks and biomass other than those exemplified above also can be used for culturing the microbial organisms of the invention for the production of the desired bioderived compound including such as xylitol, ethanol, n-butanol, isobutanol, isopropanol, arabitol, ethyl acetate, phenyl-ethyl alcohol, 2-methyl-butanol, or 3-methyl-butanol.

[0209] Accordingly, given the teachings and guidance provided herein, those skilled in the art will understand that a non-naturally occurring microbial organism can be produced that secretes the biosynthesized compounds described herein when grown on xylose as a carbon source. Such compounds include, for example, xylitol, ethanol, n-butanol, isobutanol, isopropanol, arabitol, ethyl acetate, phenyl-ethyl alcohol, 2-methyl-butanol, or 3-methyl-butanol and any of the intermediate metabolites thereof. All that is required is to engineer in one or more of the required enzyme or protein activities to achieve biosynthesis of the desired compound or intermediate including, for example, inclusion of some or all of the biosynthetic pathways for producing the desired product. Accordingly, provided herein is a non-naturally occurring microbial organism that produces and/or secretes a desired product such as xylitol, ethanol, n-butanol, isobutanol, isopropanol, arabitol, ethyl acetate, phenyl-ethyl alcohol, 2-methyl-butanol, or 3-methyl-butanol when grown on a carbohydrate or other carbon source and produces and/or secretes an intermediate metabolites shown in the biosynthesis pathway of the desired compound when grown on xylose and optionally other carbohydrate or carbon source.

[0210] The non-naturally occurring microbial organisms provided herein are constructed using methods well known in the art as exemplified herein to exogenously express at least one nucleic acid encoding a xylose transporter in sufficient amounts to enhance xylose uptake and increase the production of a desired product from xylose. It is understood that the microbial organisms provided herein are cultured under conditions sufficient to produce a desired product such as xylitol, ethanol, n-butanol, isobutanol, isopropanol, arabitol, ethyl acetate, phenyl-ethyl alcohol, 2-methyl-butanol, or 3-methyl-butanol. Following the teachings and guidance provided herein, the non-naturally occurring microbial organisms provided herein can achieve biosynthesis of the desired product resulting in intracellular concentrations between about 0.1-200 mM or more. Generally, the intracellular concentration of the desired product between about 3-150 mM, particularly between about 5-125 mM and more particularly between about 8-100 mM, including about 10 mM, 20 mM, 50 mM, 80 mM, or more. Intracellular concentrations between and above each of these exemplary ranges also can be achieved from the non-naturally occurring microbial organisms provided herein.

[0211] In some embodiments, culture conditions include anaerobic or substantially anaerobic growth or maintenance conditions. Exemplary anaerobic conditions have been described previously and are well known in the art. Exemplary anaerobic conditions for fermentation processes are described herein and are described, for example, in U.S. publication 2009/0047719. Any of these conditions can be employed with the non-naturally occurring microbial organisms as well as other anaerobic conditions well known in the art. Under such anaerobic or substantially anaerobic conditions, the producer strains can synthesize the desired product at intracellular concentrations of 5-10 mM or more as well as all other concentrations exemplified herein. It is understood that, even though the above description refers to intracellular concentrations, the producing microbial organisms can produce the desired product intracellularly and/or secrete the product into the culture medium.

[0212] Exemplary fermentation processes include, but are not limited to, fed-batch fermentation and batch separation; fed-batch fermentation and continuous separation; and continuous fermentation and continuous separation. In an exemplary fed-batch fermentation protocol, the production organism is grown in a suitably sized bioreactor sparged with an appropriate gas. Under anaerobic conditions, the culture is sparged with an inert gas or combination of gases, for example, nitrogen, N.sub.2/CO.sub.2 mixture, argon, helium, and the like. As the cells grow and utilize the carbon source, additional carbon source(s) and/or other nutrients are fed into the bioreactor at a rate approximately balancing consumption of the carbon source and/or nutrients. The temperature of the bioreactor is maintained at a desired temperature, generally in the range of 22-37 degrees C., but the temperature can be maintained at a higher or lower temperature depending on the the growth characteristics of the production organism and/or desired conditions for the fermentation process. Growth continues for a desired period of time to achieve desired characteristics of the culture in the fermenter, for example, cell density, product concentration, and the like. In a fed-batch fermentation process, the time period for the fermentation is generally in the range of several hours to several days, for example, 8 to 24 hours, or 1, 2, 3, 4 or 5 days, or up to two weeks, depending on the desired culture conditions. The pH can be controlled or not, as desired, in which case a culture in which pH is not controlled will typically decrease to pH 3-6 by the end of the run. In some embodiment, the initial pH can first decrease and then increase during the cultivation period. In one embodiment, the initial pH of the medium is around 6, and during the cultivation period, the pH decreased first to 5.5 and later increased to around 6.5. Upon completion of the cultivation period, the fermenter contents can be passed through a cell separation unit, for example, a centrifuge, filtration unit, and the like, to remove cells and cell debris. In the case where the desired product is expressed intracellularly, the cells can be lysed or disrupted enzymatically or chemically prior to or after separation of cells from the fermentation broth, as desired, in order to release additional product. The fermentation broth can be transferred to a product separations unit. Isolation of product occurs by standard separations procedures employed in the art to separate a desired product from dilute aqueous solutions. Such methods include, but are not limited to, liquid-liquid extraction using a water immiscible organic solvent (e.g., toluene or other suitable solvents, including but not limited to diethyl ether, ethyl acetate, tetrahydrofuran (THF), methylene chloride, chloroform, benzene, pentane, hexane, heptane, petroleum ether, methyl tertiary butyl ether (MTBE), dioxane, dimethylformamide (DMF), dimethyl sulfoxide (DMSO), and the like) to provide an organic solution of the product, if appropriate, standard distillation methods, and the like, depending on the chemical characteristics of the product of the fermentation process.

[0213] In an exemplary fully continuous fermentation protocol, the production organism is generally first grown up in batch mode in order to achieve a desired cell density. When the carbon source and/or other nutrients are exhausted, feed medium of the same composition is supplied continuously at a desired rate, usually with relatively high sugar concentration, and fermentation liquid is withdrawn at the same rate. Under such conditions, the product concentration in the bioreactor generally remains constant, as well as the cell density. The temperature of the fermenter is maintained at a desired temperature, as discussed above. During the continuous fermentation phase, it is generally desirable to maintain a suitable pH range for optimized production. The pH can be monitored and maintained using routine methods, including the addition of suitable acids or bases to maintain a desired pH range. The bioreactor is operated continuously for extended periods of time, generally at least one week to several weeks and up to one month, or longer, as appropriate and desired. The fermentation liquid and/or culture is monitored periodically, including sampling up to every day, as desired, to assure consistency of product concentration and/or cell density. In continuous mode, fermenter contents are constantly removed as new feed medium is supplied. The exit stream, containing cells, medium, and product, are generally subjected to a continuous product separations procedure, with or without removing cells and cell debris, as desired. Continuous separations methods employed in the art can be used to separate the product from dilute aqueous solutions, including but not limited to continuous liquid-liquid extraction using a water immiscible organic solvent (e.g., toluene or other suitable solvents, including but not limited to diethyl ether, ethyl acetate, tetrahydrofuran (THF), methylene chloride, chloroform, benzene, pentane, hexane, heptane, petroleum ether, methyl tertiary butyl ether (MTBE), dioxane, dimethylformamide (DMF), dimethyl sulfoxide (DMSO), and the like), standard continuous distillation methods, and the like, or other methods well known in the art.

[0214] In addition to the culturing and fermentation conditions disclosed herein, growth condition for achieving biosynthesis of the desired product can include the addition of an osmoprotectant to the culturing conditions. In certain embodiments, the non-naturally occurring microbial organisms provided herein can be sustained, cultured or fermented as described herein in the presence of an osmoprotectant. Briefly, an osmoprotectant refers to a compound that acts as an osmolyte and helps a microbial organism as described herein survive osmotic stress. Osmoprotectants include, but are not limited to, betaines, amino acids, and the sugar trehalose. Non-limiting examples of such are glycine betaine, praline betaine, dimethylthetin, dimethylsulfonioproprionate, 3-dimethylsulfonio-2-methylproprionate, pipecolic acid, dimethylsulfonioacetate, choline, L-carnitine and ectoine. In one aspect, the osmoprotectant is glycine betaine. It is understood to one of ordinary skill in the art that the amount and type of osmoprotectant suitable for protecting a microbial organism described herein from osmotic stress will depend on the microbial organism used. The amount of osmoprotectant in the culturing conditions can be, for example, no more than about 0.1 mM, no more than about 0.5 mM, no more than about 1.0 mM, no more than about 1.5 mM, no more than about 2.0 mM, no more than about 2.5 mM, no more than about 3.0 mM, no more than about 5.0 mM, no more than about 7.0 mM, no more than about 10 mM, no more than about 50 mM, no more than about 100 mM or no more than about 500 mM.

[0215] The culture conditions can include, for example, liquid culture procedures as well as fermentation and other large scale culture procedures. As described herein, particularly useful yields of the biosynthetic products can be obtained under anaerobic or substantially anaerobic culture conditions.

[0216] The culture conditions described herein can be scaled up and grown continuously for manufacturing of a desired product. Exemplary growth procedures include, for example, fed-batch fermentation and batch separation; fed-batch fermentation and continuous separation, or continuous fermentation and continuous separation. All of these processes are well known in the art. Fermentation procedures are particularly useful for the biosynthetic production of commercial quantities of a desired product. Generally, and as with non-continuous culture procedures, the continuous and/or near-continuous production includes culturing the microbial organisms provided herein in sufficient nutrients and medium to sustain and/or nearly sustain growth in an exponential phase. Continuous culture under such conditions can include, for example, growth or culturing for 1 day, 2, 3, 4, 5, 6 or 7 days or more. Additionally, continuous culture can include longer time periods of 1 week, 2, 3, 4 or 5 or more weeks and up to several months. Alternatively, organisms of the invention can be cultured for hours, if suitable for a particular application. It is to be understood that the continuous and/or near-continuous culture conditions also can include all time intervals in between these exemplary periods. It is further understood that the time of culturing the microbial organism provided herein is for a sufficient period of time to produce a sufficient amount of product for a desired purpose.

[0217] Fermentation procedures are well known in the art. Briefly, fermentation for the biosynthetic production of a desired product can be utilized in, for example, fed-batch fermentation and batch separation; fed-batch fermentation and continuous separation, or continuous fermentation and continuous separation. Examples of batch and continuous fermentation procedures are well known in the art.

[0218] In addition to the above fermentation procedures using producer strains provided herein using continuous production of substantial quantities of a desire product, the bioderived product also can be, for example, simultaneously subjected to chemical synthesis and/or enzymatic procedures to convert the product to other compounds, or the bioderived product can be separated from the fermentation culture and sequentially subjected to chemical and/or enzymatic conversion to convert the product to other compounds, if desired.

[0219] To generate better producers, metabolic modeling can be utilized to optimize growth conditions. Modeling can also be used to design gene knockouts that additionally optimize utilization of the pathway (see, for example, U.S. patent publications US 2002/0012939, US 2003/0224363, US 2004/0029149, US 2004/0072723, US 2003/0059792, US 2002/0168654 and US 2004/0009466, and U.S. Pat. No. 7,127,379). Modeling analysis allows reliable predictions of the effects on cell growth of shifting the metabolism towards more efficient production of a desired product.

[0220] Provided herein are also compositions having a bioderived compound produced by the microbial organisms described herein, and an additional component. The component other than the bioderived product can be a cellular portion, for example, a trace amount of a cellular portion of the culture medium, or can be fermentation broth or culture medium or a purified or partially purified fraction thereof produced in the presence of, a non-naturally occurring microbial organism provided herein having a xylose transporter. The composition can have, for example, a reduced level of a byproduct when produced by the microbial organism disclosed herein. The composition can have, for example, one or more bioderived compound such as xylitol, ethanol, n-butanol, isobutanol, isopropanol, arabitol, ethyl acetate, phenyl-ethyl alcohol, 2-methyl-butanol, or 3-methyl-butanol, and a cell lysate or culture supernatant of a microbial organism provided herein. The additional component can be a byproduct, or an impurity, such as glycerol, acetaldehyde, acetate, glyceraldehyde, or a combination thereof. The byproduct can be glycerol. The byproduct can be acetaldehyde. The byproduct can be glyceraldehyde. The byproduct can be acetate. The impurity can be glycerol. The impurity can be acetaldehyde. The impurity can be glyceraldehyde. The impurity can be acetate.

[0221] In some embodiments, the carbon feedstock and other cellular uptake sources such as phosphate, ammonia, sulfate, chloride and other halogens can be chosen to alter the isotopic distribution of the atoms present in the bioderived compound produced by microbial organisms provided herein. The various carbon feedstock and other uptake sources enumerated above will be referred to herein, collectively, as "uptake sources." Uptake sources can provide isotopic enrichment for any atom present in the bioderived compound produced by microbial organisms provided herein, or in the byproducts or impurities. Isotopic enrichment can be achieved for any target atom including, for example, carbon, hydrogen, oxygen, nitrogen, sulfur, phosphorus, chloride or other halogens.

[0222] In some embodiments, the uptake sources can be selected to alter the carbon-12, carbon-13, and carbon-14 ratios. In some embodiments, the uptake sources can be selected to alter the oxygen-16, oxygen-17, and oxygen-18 ratios. In some embodiments, the uptake sources can be selected to alter the hydrogen, deuterium, and tritium ratios. In some embodiments, the uptake sources can be selected to alter the nitrogen-14 and nitrogen-15 ratios. In some embodiments, the uptake sources can be selected to alter the sulfur-32, sulfur-33, sulfur-34, and sulfur-35 ratios. In some embodiments, the uptake sources can be selected to alter the phosphorus-31, phosphorus-32, and phosphorus-33 ratios. In some embodiments, the uptake sources can be selected to alter the chlorine-35, chlorine-36, and chlorine-37 ratios.

[0223] In some embodiments, the isotopic ratio of a target atom can be varied to a desired ratio by selecting one or more uptake sources. An uptake source can be derived from a natural source, as found in nature, or from a man-made source, and one skilled in the art can select a natural source, a man-made source, or a combination thereof, to achieve a desired isotopic ratio of a target atom. An example of a man-made uptake source includes, for example, an uptake source that is at least partially derived from a chemical synthetic reaction. Such isotopically enriched uptake sources can be purchased commercially or prepared in the laboratory and/or optionally mixed with a natural source of the uptake source to achieve a desired isotopic ratio. In some embodiments, a target atom isotopic ratio of an uptake source can be achieved by selecting a desired origin of the uptake source as found in nature. For example, as discussed herein, a natural source can be a biobased derived from or synthesized by a biological organism or a source such as petroleum-based products or the atmosphere. In some such embodiments, a source of carbon, for example, can be selected from a fossil fuel-derived carbon source, which can be relatively depleted of carbon-14, or an environmental or atmospheric carbon source, such as CO2, which can possess a larger amount of carbon-14 than its petroleum-derived counterpart.

[0224] The unstable carbon isotope carbon-14 or radiocarbon makes up for roughly 1 in 10.sup.12 carbon atoms in the earth's atmosphere and has a half-life of about 5700 years. The stock of carbon is replenished in the upper atmosphere by a nuclear reaction involving cosmic rays and ordinary nitrogen (14N). Fossil fuels contain no carbon-14, as it decayed long ago. Burning of fossil fuels lowers the atmospheric carbon-14 fraction, the so-called "Suess effect".

[0225] Methods of determining the isotopic ratios of atoms in a compound are well known to those skilled in the art. Isotopic enrichment is readily assessed by mass spectrometry using techniques known in the art such as accelerated mass spectrometry (AMS), Stable Isotope Ratio Mass Spectrometry (SIRMS) and Site-Specific Natural Isotopic Fractionation by Nuclear Magnetic Resonance (SNIF-NMR). Such mass spectral techniques can be integrated with separation techniques such as liquid chromatography (LC), high performance liquid chromatography (HPLC) and/or gas chromatography, and the like.

[0226] In the case of carbon, ASTM D6866 was developed in the United States as a standardized analytical method for determining the biobased content of solid, liquid, and gaseous samples using radiocarbon dating by the American Society for Testing and Materials (ASTM) International. The standard is based on the use of radiocarbon dating for the determination of a product's biobased content. ASTM D6866 was first published in 2004, and the current active version of the standard is ASTM D6866-11 (effective Apr. 1, 2011). Radiocarbon dating techniques are well known to those skilled in the art, including those described herein.

[0227] The biobased content of a compound is estimated by the ratio of carbon-14 (.sup.14C) to carbon-12 (.sup.12C). Specifically, the Fraction Modern (Fm) is computed from the expression: Fm=(S-B)/(M-B), where B, S and M represent the .sup.14C/.sup.12C ratios of the blank, the sample and the modern reference, respectively. Fraction Modern is a measurement of the deviation of the .sup.14C/C.sup.12 ratio of a sample from "Modern." Modern is defined as 95% of the radiocarbon concentration (in AD 1950) of National Bureau of Standards (NBS) Oxalic Acid I (i.e., standard reference materials (SRM) 4990b) normalized to .delta..sup.13C.sub.VPDB=-19 per mil (Olsson, The use of Oxalic acid as a Standard. in, Radiocarbon Variations and Absolute Chronology, Nobel Symposium, 12th Proc., John Wiley & Sons, New York (1970)). Mass spectrometry results, for example, measured by ASM, are calculated using the internationally agreed upon definition of 0.95 times the specific activity of NBS Oxalic Acid I (SRM 4990b) normalized to .delta..sup.13C.sub.VPDB=-19 per mil. This is equivalent to an absolute (AD 1950).sup.14C/.sup.12C ratio of 1.176.+-.0.010.times.10.sup.-12 (Karlen et al., Arkiv Geofysik, 4:465-471 (1968)). The standard calculations take into account the differential uptake of one isotope with respect to another, for example, the preferential uptake in biological systems of .sup.12C over .sup.13C over .sup.14C, and these corrections are reflected as a Fm corrected for .delta..sup.13.

[0228] An oxalic acid standard (SRM 4990b or HOx 1) was made from a crop of 1955 sugar beet. Although there were 1000 lbs made, this oxalic acid standard is no longer commercially available. The Oxalic Acid II standard (HOx 2; N.I.S.T designation SRM 4990 C) was made from a crop of 1977 French beet molasses. In the early 1980's, a group of 12 laboratories measured the ratios of the two standards. The ratio of the activity of Oxalic acid II to 1 is 1.2933.+-.0.001 (the weighted mean). The isotopic ratio of HOx II is -17.8 per mil. ASTM D6866-11 suggests use of the available Oxalic Acid II standard SRM 4990 C (Hox2) for the modern standard (see discussion of original vs. currently available oxalic acid standards in Mann, Radiocarbon, 25(2):519-527 (1983)). A Fm=0% represents the entire lack of carbon-14 atoms in a material, thus indicating a fossil (for example, petroleum based) carbon source. A Fm=100%, after correction for the post-1950 injection of carbon-14 into the atmosphere from nuclear bomb testing, indicates an entirely modern carbon source. As described herein, such a "modern" source includes biobased sources.

[0229] As described in ASTM D6866, the percent modern carbon (pMC) can be greater than 100% because of the continuing but diminishing effects of the 1950s nuclear testing programs, which resulted in a considerable enrichment of carbon-14 in the atmosphere as described in ASTM D6866-11. Because all sample carbon-14 activities are referenced to a "pre-bomb" standard, and because nearly all new biobased products are produced in a post-bomb environment, all pMC values (after correction for isotopic fraction) must be multiplied by 0.95 (as of 2010) to better reflect the true biobased content of the sample. A biobased content that is greater than 103% suggests that either an analytical error has occurred, or that the source of biobased carbon is more than several years old.

[0230] ASTM D6866 quantifies the biobased content relative to the material's total organic content and does not consider the inorganic carbon and other non-carbon containing substances present. For example, a product that is 50% starch-based material and 50% water would be considered to have a Biobased Content=100% (50% organic content that is 100% biobased) based on ASTM D6866. In another example, a product that is 50% starch-based material, 25% petroleum-based, and 25% water would have a Biobased Content=66.7% (75% organic content but only 50% of the product is biobased). In another example, a product that is 50% organic carbon and is a petroleum-based product would be considered to have a Biobased Content=0% (50% organic carbon but from fossil sources). Thus, based on the well known methods and known standards for determining the biobased content of a compound or material, one skilled in the art can readily determine the biobased content and/or prepared downstream products that utilize of the invention having a desired biobased content.

[0231] Applications of carbon-14 dating techniques to quantify bio-based content of materials are known in the art (Currie et al., Nuclear Instruments andMethods in Physics Research B, 172:281-287 (2000)). For example, carbon-14 dating has been used to quantify bio-based content in terephthalate-containing materials (Colonna et al., Green Chemistry, 13:2543-2548 (2011)). Notably, polypropylene terephthalate (PPT) polymers derived from renewable 1,3-propanediol and petroleum-derived terephthalic acid resulted in Fm values near 30% (i.e., since 3/11 of the polymeric carbon derives from renewable 1,3-propanediol and 8/11 from the fossil end member terephthalic acid) (Currie et al., supra, 2000). In contrast, polybutylene terephthalate polymer derived from both renewable 1,4-butanediol and renewable terephthalic acid resulted in bio-based content exceeding 90% (Colonna et al., supra, 2011).

[0232] Accordingly, in some embodiments, provided herein are bioderived compounds that have a carbon-12, carbon-13, and carbon-14 ratio that reflects an atmospheric carbon, also referred to as environmental carbon, uptake source. The bioderived compounds include such as xylitol, ethanol, n-butanol, isobutanol, isopropanol, arabitol, ethyl acetate, phenyl-ethyl alcohol, 2-methyl-butanol, or 3-methyl-butanol. For example, in some aspects the bioderived compound can have an Fm value of at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98% or as much as 100%. In some such embodiments, the uptake source is CO2. In some embodiments, provided herein are bioderived compounds that have a carbon-12, carbon-13, and carbon-14 ratio that reflects petroleum-based carbon uptake source. In this aspect, the bioderived compounds provided herein can have an Fm value of less than 95%, less than 90%, less than 85%, less than 80%, less than 75%, less than 70%, less than 65%, less than 60%, less than 55%, less than 50%, less than 45%, less than 40%, less than 35%, less than 30%, less than 25%, less than 20%, less than 15%, less than 10%, less than 5%, less than 2% or less than 1%. In some embodiments, bioderived compounds provided herein can have a carbon-12, carbon-13, and carbon-14 ratio that is obtained by a combination of an atmospheric carbon uptake source with a petroleum-based uptake source. Using such a combination of uptake sources is one way by which the carbon-12, carbon-13, and carbon-14 ratio can be varied, and the respective ratios would reflect the proportions of the uptake sources.

[0233] Further, provided herein are also the products derived the bioderived compounds including such as xylitol, ethanol, n-butanol, isobutanol, isopropanol, arabitol, ethyl acetate, phenyl-ethyl alcohol, 2-methyl-butanol, or 3-methyl-butanol, wherein the bioderived compounds has a carbon-12, carbon-13, and carbon-14 isotope ratio of about the same value as the CO2 that occurs in the environment. For example, in some aspects, provided herein are bioderived compounds having a carbon-12 versus carbon-13 versus carbon-14 isotope ratio of about the same value as the CO2 that occurs in the environment, or any of the other ratios disclosed herein. It is understood, as disclosed herein, that a product can have a carbon-12 versus carbon-13 versus carbon-14 isotope ratio of about the same value as the CO.sub.2 that occurs in the environment, or any of the ratios disclosed herein, wherein the product is generated from bioderived compounds as disclosed herein, wherein the bioderived product is chemically modified to generate a final product. Methods of chemically modifying a bioderived product to generate a desired product are well known to those skilled in the art, as described herein.

[0234] Provided herein are also compositions having a bioderived compound produced by the microbial organisms described herein, and an additional component. The component other than the bioderived product can be a cellular portion, for example, a trace amount of a cellular portion of the culture medium, or can be fermentation broth or culture medium or a purified or partially purified fraction thereof produced in the presence of, a non-naturally occurring microbial organism provided herein having a xylose transporter. The composition can have, for example, a reduced level of a byproduct when produced by the microbial organism disclosed herein. The composition can have, for example, one or more bioderived compound such as xylitol, ethanol, n-butanol, isobutanol, isopropanol, arabitol, ethyl acetate, phenyl-ethyl alcohol, 2-methyl-butanol, or 3-methyl-butanol, and a cell lysate or culture supernatant of a microbial organism provided herein. The additional component can be a byproduct, or an impurity, such as glycerol, acetaldehyde, acetate, glyceraldehyde, or a combination thereof. The byproduct can be glycerol. The byproduct can be acetaldehyde. The byproduct can be glyceraldehyde. The byproduct can be acetate. The impurity can be glycerol. The impurity can be acetaldehyde. The impurity can be glyceraldehyde. The impurity can be acetate.

[0235] In some embodiments, the compositions provided herein can have a bioderived xylitol and an additional component. The additional component can be fermentation broth or culture medium. The additional component can be the supernatant of fermentation broth or culture medium. The additional component can be a cellular portion of fermentation broth or culture medium. The additional component can be the microbial organisms having an exogenous nucleic acid encoding a xylose transporter as described herein used to produce the bioderived xylitol. The additional component can be the cell lysate of the microbial organism provided herein. The additional component can be a byproduct, such as glycerol, acetaldehyde, acetate, glyceraldehyde, or a combination thereof.

[0236] In some embodiments, the compositions provided herein can have a bioderived ethanol and an additional component. The additional component can be fermentation broth or culture medium. The additional component can be the supernatant of fermentation broth or culture medium. The additional component can be a cellular portion of fermentation broth or culture medium. The additional component can be the microbial organisms having an exogenous nucleic acid encoding a xylose transporter as described herein used to produce the bioderived ethanol. The additional component can be the cell lysate of the microbial organism provided herein. The additional component can be a byproduct, such as glycerol, acetaldehyde, acetate, glyceraldehyde, or a combination thereof.

[0237] In some embodiments, the compositions provided herein can have a bioderived n-butanol and an additional component. The additional component can be fermentation broth or culture medium. The additional component can be the supernatant of fermentation broth or culture medium. The additional component can be a cellular portion of fermentation broth or culture medium. The additional component can be the microbial organisms having an exogenous nucleic acid encoding a xylose transporter as described herein used to produce the bioderived n-butanol. The additional component can be the cell lysate of the microbial organism provided herein. The additional component can be a byproduct, such as glycerol, acetaldehyde, acetate, glyceraldehyde, or a combination thereof.

[0238] In some embodiments, the compositions provided herein can have a bioderived isobutanol and an additional component. The additional component can be fermentation broth or culture medium. The additional component can be the supernatant of fermentation broth or culture medium. The additional component can be a cellular portion of fermentation broth or culture medium. The additional component can be the microbial organisms having an exogenous nucleic acid encoding a xylose transporter as described herein used to produce the bioderived isobutanol. The additional component can be the cell lysate of the microbial organism provided herein. The additional component can be a byproduct, such as glycerol, acetaldehyde, acetate, glyceraldehyde, or a combination thereof.

[0239] In some embodiments, the compositions provided herein can have a bioderived isopropanol and an additional component. The additional component can be fermentation broth or culture medium. The additional component can be the supernatant of fermentation broth or culture medium. The additional component can be a cellular portion of fermentation broth or culture medium. The additional component can be the microbial organisms having an exogenous nucleic acid encoding a xylose transporter as described herein used to produce the bioderived isopropanol. The additional component can be the cell lysate of the microbial organism provided herein. The additional component can be a byproduct, such as glycerol, acetaldehyde, acetate, glyceraldehyde, or a combination thereof.

[0240] In some embodiments, the compositions provided herein can have a bioderived arabitol and an additional component. The additional component can be fermentation broth or culture medium. The additional component can be the supernatant of fermentation broth or culture medium. The additional component can be a cellular portion of fermentation broth or culture medium. The additional component can be the microbial organisms having an exogenous nucleic acid encoding a xylose transporter as described herein used to produce the bioderived arabitol. The additional component can be the cell lysate of the microbial organism provided herein. The additional component can be a byproduct, such as glycerol, acetaldehyde, acetate, glyceraldehyde, or a combination thereof.

[0241] In some embodiments, the compositions provided herein can have a bioderived ethyl acetate and an additional component. The additional component can be fermentation broth or culture medium. The additional component can be the supernatant of fermentation broth or culture medium. The additional component can be a cellular portion of fermentation broth or culture medium. The additional component can be the microbial organisms having an exogenous nucleic acid encoding a xylose transporter as described herein used to produce the bioderived ethyl acetate. The additional component can be the cell lysate of the microbial organism provided herein. The additional component can be a byproduct, such as glycerol, acetaldehyde, acetate, glyceraldehyde, or a combination thereof.

[0242] In some embodiments, the compositions provided herein can have a bioderived phenyl-ethyl alcohol and an additional component. The additional component can be fermentation broth or culture medium. The additional component can be the supernatant of fermentation broth or culture medium. The additional component can be a cellular portion of fermentation broth or culture medium. The additional component can be the microbial organisms having an exogenous nucleic acid encoding a xylose transporter as described herein used to produce the bioderived phenyl-ethyl alcohol. The additional component can be the cell lysate of the microbial organism provided herein. The additional component can be a byproduct, such as glycerol, acetaldehyde, acetate, glyceraldehyde, or a combination thereof.

[0243] In some embodiments, the compositions provided herein can have a bioderived 2-methyl-butanol and an additional component. The additional component can be fermentation broth or culture medium. The additional component can be the supernatant of fermentation broth or culture medium. The additional component can be a cellular portion of fermentation broth or culture medium. The additional component can be the microbial organisms having an exogenous nucleic acid encoding a xylose transporter as described herein used to produce the bioderived 2-methyl-butanol. The additional component can be the cell lysate of the microbial organism provided herein. The additional component can be a byproduct, such as glycerol, acetaldehyde, acetate, glyceraldehyde, or a combination thereof.

[0244] In some embodiments, the compositions provided herein can have a bioderived 3-methyl-butanol and an additional component. The additional component can be fermentation broth or culture medium. The additional component can be the supernatant of fermentation broth or culture medium. The additional component can be a cellular portion of fermentation broth or culture medium. The additional component can be the microbial organisms having an exogenous nucleic acid encoding a xylose transporter as described herein used to produce the bioderived 3-methyl-butanol. The additional component can be the cell lysate of the microbial organism provided herein. The additional component can be a byproduct, such as glycerol, acetaldehyde, acetate, glyceraldehyde, or a combination thereof.

[0245] Provided herein are also biobased products having one or more bioderived compound produced by a non-naturally occurring microorganism described herein or produced using a method described herein. In some embodiments, provided herein are biobased products produced using a bioderived compound described herein, such as xylitol, ethanol, n-butanol, isobutanol, isopropanol, arabitol, ethyl acetate, phenyl-ethyl alcohol, 2-methyl-butanol, or 3-methyl-butanol. Such manufacturing can include chemically reacting the bioderived compound (e.g. chemical conversion, chemical functionalization, chemical coupling, oxidation, reduction, polymerization, copolymerization and the like) into the final product. In some embodiments, provided herein are biobased products having a bioderived compound described herein, such as xylitol, ethanol, n-butanol, isobutanol, isopropanol, arabitol, ethyl acetate, phenyl-ethyl alcohol, 2-methyl-butanol, or 3-methyl-butanol. In some embodiments, provided herein are biobased products having at least 2%, at least 3%, at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98% or 100% bioderived compound as disclosed herein.

[0246] It is understood that modifications which do not substantially affect the activity of the various embodiments of this invention are also provided within the definition of the invention provided herein. Accordingly, the following examples are intended to illustrate but not limit the present invention. Throughout this application various publications have been referenced. The disclosures of these publications in their entireties, including GenBank and GI number publications, are hereby incorporated by reference in this application in order to more fully describe the state of the art to which this invention pertains.

Example I

Expression of Xylose Transporters in H0 Metschnikowia sp

[0247] The yeast of H0 Metschnikowia sp. was grown in various culture media, and the expression of various xylose transporters was measured by transcriptome analysis. As referred to in the Table below, "FPKM" refers to "Fragments Per Kilobase of transcript per Million mapped reads"; all media included the standard formulation of 2% peptone and 1% yeast extract; final sugar concentrations were 2% total in all culture media; "High" and "Low" refer to the maximum and minimum FPKM values found in the three biological replicates tested.

TABLE-US-00003 TABLE Transcriptome Analysis of Xylose Transporters in H0 Metschnikowia sp. Glucose_FPKM Gene Average Low High GXF1 3137.35 2408.44 3866.25 XYT1 31.9043 21.8232 41.9855 HXT5 3.52499 0 8.25012 GXS1/HGT12 1.78735 0 5.2273 HGT19/APS1 22.3382 13.4993 31.1771 QUP2 25.0151 15.6231 34.4071 GXF2/GAL2 302.552 232.996 372.107 Xylose_FPKM Gene Average Low High GXF1 860.96 671.36 1050.56 XYT1 1758.64 1354.27 2163.01 HXT5 322.102 247.985 396.218 GXS1/HGT12 42.4692 28.2335 56.705 HGT19/APS1 2254.54 1738.24 2770.83 QUP2 46.223 32.1743 60.2716 GXF2/GAL2 69.8126 50.0024 89.6228 Galactose_FPKM Gene Average Low High GXF1 1865.95 1442.41 2289.49 XYT1 1309.91 1016.34 1603.48 HXT5 386.68 298.795 474.564 GXS1/HGT12 150.957 112.586 189.328 HGT19/APS1 2915.42 2230.39 3600.46 QUP2 43.0144 29.7968 56.2321 GXF2/GAL2 89.9721 65.6522 114.292 Cellobiose_FPKM Gene Average Low High GXF1 321.954 248.525 395.383 XYT1 900.511 701.542 1099.48 HXT5 614.885 477.428 752.342 GXS1/HGT12 119.261 88.3474 150.175 HGT19/APS1 3723.89 2821.8 4625.99 QUP2 51.0531 36.0561 66.0501 GXF2/GAL2 31.5998 19.9003 43.2992 FP_media_FPKM Gene Average Low High GXF1 2238.27 1726.85 2749.7 XYT1 461.868 359.76 563.975 HXT5 61.3177 42.1094 80.5259 GXS1/HGT12 5.15064 0 10.7361 HGT19/APS1 830.711 644.877 1016.54 QUP2 39.3644 26.9207 51.8081 GXF2/GAL2 40.5208 26.9909 54.0507

Example II

Engineering Enhanced Xylose Uptake in H0 Metschnikowia sp

[0248] H0 Metschnikowia sp. was confirmed to have a robust xylose uptake and metabolism machinery, with the ability to consume and metabolize xylose as its sole carbon source. Xylose uptake is measured by growing H0 in known quantities of xylose and measuring the xylose remaining in the medium by high performance liquid chromatography. The quantity of xylose remaining is compared with a standard curve and the amount of said sugar in the inoculation medium. As shown in FIG. 1 and FIG. 2, efficient xylose transport was observed in wild type H0 Metschnikowia sp. The xylose uptake by the H0 Metschnikowia sp. was measured to be between 24 to 48 grams in 48 hours and 90 grams in 6 days (initial OD.sub.600=0.2), which is significantly higher than the xylose uptake rate by yeasts known in the art. See Hector, et al., Applied microbiology and biotechnology 80(4): 675-684 (2008) (reporting xylose uptake rate of 10-15 grams in 48 h by S. cerevisiae with initial OD.sub.600=1.0 at aerobic conditions); Runquist, et al., Appl Microbiol Biotechnol 82:123 (2009) (reporting xylose uptake rate of 4 grams in 48 h by yeast (TMB34XX) at anaerobic conditions); Apel et al., Scientific reports 6 (2016)(reporting xylose uptake rate of 9 grams in 48 h by yeast at aerobic conditions). The xylose transport was further enhanced in H0 Metschnikowia sp. overexpressing Xyt1p, as also shown in FIG. 1 and FIG. 2. To overexpress Xyt1p, the H0 XYT1 cassette was used which is comprised of H0 TPI1 promoter driving XYT1 and blasticidin expressed from the H0 PGK1 promoter. The primers Y33 and Y33R amplified XYT1 OFR from H0 genomic DNA with homology 30 and 31 bp of homology with the H0 TPI1 promoter and H0 RPL15A terminator in vector DeBONO_E28.7. The XYT1 amplicon was Gibson assembled into the EcoRI and SalI sites of DeBONO_E28.7. The resulting Xyt1p vector was linearized with NdeI. Primers Y41 and Y41R were used to amplify H0 PGK1 pro-Blasticidin-H0PGK1 terminator was amplified from DeBONO_E29. The resulting amplicon was recombined into the NdeI site of the digested H0TPI1pro-XYL1-RPL15A terminator. The vector was electroporated into H0 at 1.5 kv and 25 uF and 200 ohm in a 0.1 cm cuvette. Electroporated cells were recovered in liquid YPD for 4 hours. Finally, cells were diluted to 30% with liquid YPD and 100 uL of cell mixture was plated on YPD agar containing 350 ug/mL of blasticidin. Individual colonies were picked after 48 h and restreaked onto YPD agar blasticidin medium. The blasticidin concentration required to select transgenic H0 was determined empirically.

Example III

Engineering S. cerevisiae with Enhanced Xylose Uptake

[0249] S. cerevisiae does not have the functional machinery to efficiently utilize xylose as the carbon source. S. cerevisiae has a fully annotated genome, complete transcriptomic data and hundreds of tools developed for genetic and biochemical manipulation. The xylose transporters from the H0 Metschnikowia sp. were introduced into S. cerevisiae to increase xylose uptake and to synthesize bioderived product from renewable biomass. S. cerevisiae BY4742 was used as the genetic platform to heterologously over-express xylose transporter from the H0 Metschnikowia sp.

[0250] Genes encoding the following xylose transporters from the H0 Metschnikowia sp. were cloned Xyt1p, Gxf1p, .DELTA.Gxf1p (variant of Gxf1p with shorter N-terminus), Gxs1p/Hgt12p, and Hxt5p, and codon optimized for expression in BY4742. As shown in FIG. 3, the expression of Xyt1p, the xylose transferred in 48 hours from the medium increased from about 10% in BY4742 to about 74% in BY4742 expressing Xyt1p.

[0251] Genes encoding Gxf1p, .DELTA.Gxf1p, Gxs1p/Hgt12p, and Hxt5p from H0 Metschnikowia sp. were synthesized and transformed into BY4742 for xylose transport testing by HPLC. Following the design for Xyt1p, genes encoding each of Gxf1p, .DELTA.Gxf1p, Gxs1p/Hgt12p, and Hxt5p was expressed from the TEF promoter and terminator derived from the plasmid pUG6. All open reading frames (ORFs) were selected for with nourseothricin.

[0252] Due to H0 CTG codon usage, all ORFs corresponding to H0 transporters were synthesized by ThermoFisher as double stranded "gene strings." H0 transporter ORFs were translated with the codon translation table provided above. The resulting amino acid sequence was converted back to DNA. The resulting DNA was entered into the ThermoFisher genestrings web interface. The web interface modified the nucleotide sequence such that the amino acid remained as desired but the nucleotides would be altered such to achieve nearly balanced ratio of adenine-thymidine to guanine-cytosine. The synthetic XYT1 ORF was flanked by approximately 25 bp of homology with the TEF promoter at the 5' terminus and TEF terminator at the 3' terminus on pUG6 in order to facilitate Gibson assembly, respectively. The ORF was Gibson assembled into the pUG6, linearized with Y10, Y10R primers, deleting the G418 resistance ORF. Using primers Y15 and Y15R, H0 ADH1 promoter-NAT-H0 PGK1 terminator was amplified from pZL29 and assembled into the TEF promoter-XYT1-TEF terminator plasmid. The complete plasmid containing XYT is designated DeBONO_E35.3. E35.3 was used as base vector clone all of GXF1, .DELTA.GXF1, GXS1/HGT12, HXT5, HGT19. The DeBONO_E35.3 vector was amplified with Y53 and Y53R primers to linearize the vector and simultaneously, omitting XYL1, creating fragment Y53 (fY53). Each of the synthesized, codon optimized transporters were cloned into fY53 by Gibson assembly. The cassettes expressing transporters and NAT resistance were linearized by PCR with primers Y16, Y16R or Y96i and Y95Ri for integration into dubious ORFs at loci YIL100W and YLR123C. The linearized transporters were integrated into said dubious loci using standard Saccharomyces electroporation or chemical transformation methods.

[0253] Transgenic yeasts were recovered with 100 ug/mL NAT in solid YPD medium. GXF2/GAL2 was synthesized as described above. GXF2/GAL2 was cloned into a G418 resistance vector with general structure: CCW12 promoter--GXF2/GAL2-H0 DIT1 terminator. The promoter-terminator sequences were amplified from vector DeBONO_E54. This vector was linearized with primers Y83 and Y83R to yield fY83. The GXF2/GAL2 genestring was Gibson assembled into fY83. The transporter cassette was linearized by PCR with primers Y91i+Y93Ri for integration into the dubious ORF at locus YLR122C. The linearized cassette was transformed as described above and GXF2/GAL2 transgenics were selected with 200 ug/mL of G418.

[0254] Relevant primer sequences used in this example are provided below.

TABLE-US-00004 SEQ ID NO: Primer Sequences 28 Primer GAAAAAACTGGTACCGTTTAATCAGTACTGACA Y10 ATAAAAAGATTCTTGT 29 Primer TAATTTCTCTTCGTATCCCATGGTTGTTTATGT Y10R TCGGATGTGATGTGAG 30 Primer ACGCCGCCATCCAGTGTCGAAAACGAGCTTTGT Y15 CTTGTAAAGAGTCTTCGGTCATTTTTA 31 Primer GCGGCCGCATAGGCCACTAGTGGATCTGATCAA Y15R TACATACAAGCATCTCACAATCACAAG 32 Primer TTTTTCACCCACAACAAATAATATCAAAAGATG Y33 GGTTACGAGGAAAAGCTTGTAGCGCCC 33 Primer ACGAGAACACCCAGCTAAACGCGGTGCGCGTTA Y33R GACCGTGCCCGTCTTCTCGTCTGAAGA 34 Primer CAGAGCAGATTGTACTGAGAGTGCACCAGGCGC Y41 GCCCCATCCAGTGTCGAACCATCATTAAAAGAT 35 Primer CTCCTTACGCATCTGTGCGGTATTTCACACCGC Y41R ACTAGACAATACATACAAGCATCTCACAATCAC AA 36 Primer TCAGTACTGACAATAAAAAGATTCTTGTTTTCA Y53 AGAAC 37 Primer CTCACATCACATCCGAACATAAACAACC Y53R 38 Primer TATCCCGTCACTTCCACATTCG Y83 39 Primer TATTGATATAGTGTTTAAGCGAATGACAGAAG Y83R 40 Primer ATAGAAAGCAAATAGTTATATAATTTTTCATGG Y96i ACGTAGGTCTAGAGATCTGTTTAGCTTGC 41 Primer AATGCAAAAGCGGCTCCTAAACAGAAATTCTTC Y95Ri AGTCAATACATACAAGCATCTCACAATCACAAG 42 Primer TCGTCTATATCAAAACTGCATGTTTCTCTACGT Y93Ri CTAATTAAGGGTTCTCGAGAGCTCG 43 Primer ACTTCAATAGACTTCAATAGAAAGCAAATAGTT Y91i ATATGCCCTGAGGATGTATCTGG

Example IV

Xylose Uptake by Wildtype and Ubiquitin-Deficient Xylose Transporters

[0255] The primary sequences of the H0 Metschnikowia sp. transporters described herein were examined for ubiquitination sites/residues with predictive tool `UbiPred` (Tung and Ho, (2008), BMC Bioinformatics, 9, 310). Ubiquitin-deficient mutants of Hxt5p, Hgt19p, Xyt1p, Gxf1p and Gal2p, were engineered to replace all their cytoplasmic facing lysine ("K") residues that were identified as ubiquitination sites to Arginine ("R").

TABLE-US-00005 TABLE Cytoplasmic facing lysine ("K") residues (ATG/M is Residue No. 1)) Residue Residue Residue. Transporter No. Transporter No. Transporter No Hgt19p 4 Xyt1p 6 Gal2p 23 (SEQ ID 20 (SEQ ID 517 (SEQ ID 26 NO: 44) 30 NO: 55) 539 NO: 46) 35 93 542 Hxt5p 7 Gxf1p 9 546 (SEQ ID 10 (SEQ ID 24 NO: 45) 29 NO: 54) 538 43 58

[0256] As shown in the xylose update assay, replacing K with R doubled and quadrupled xylose uptake for each of .DELTA.ubq-Hxt5p and .DELTA.ubq-HGT19p compared with the native transporters at 18 h and 64 h (FIGS. 4A and 4B). When all ubiquitination sites were removed from H0 Metschnikowia sp. Xyt1p and H0 Metschnikowia sp. Gal2p and expressed in host strain BY4742, the transporters were no longer functional. The recovered transgenic yeasts, producing ubiquitin free transporters were slow growing, requiring doubled growing time compared to yeasts expressing unmodified H0 Metschnikowia sp. Xyt1p and Gal2p. Ubiquitin free Gxf1p producing cells could not be recovered. These results indicate that ubiquitination sites, although inhibitory in Hxt5p and Hgt19p, are required in Xyt1p, Gxf1p and Gal2p for xylose transport and/or protein stability.

Sequence CWU 1 SEQUENCE LISTING <160> NUMBER OF SEQ ID NOS: 59 <210> SEQ ID NO 1 <211> LENGTH: 543 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species Xyt1p <400> SEQUENCE: 1 Met Gly Tyr Glu Glu Lys Leu Val Ala Pro Ala Leu Lys Phe Lys Asn 1 5 10 15 Phe Leu Asp Lys Thr Pro Asn Ile His Asn Val Tyr Val Ile Ala Ala 20 25 30 Ile Ser Cys Thr Ser Gly Met Met Phe Gly Phe Asp Ile Ser Ser Met 35 40 45 Ser Val Phe Val Asp Gln Gln Pro Tyr Leu Lys Met Phe Asp Asn Pro 50 55 60 Ser Ser Val Ile Gln Gly Phe Ile Thr Ala Ser Met Ser Leu Gly Ser 65 70 75 80 Phe Phe Gly Ser Leu Thr Ser Thr Phe Ile Ser Glu Pro Phe Gly Arg 85 90 95 Arg Ala Ser Leu Phe Ile Cys Gly Ile Leu Trp Val Ile Gly Ala Ala 100 105 110 Val Gln Ser Ser Ser Gln Asn Arg Ala Gln Leu Ile Cys Gly Arg Ile 115 120 125 Ile Ala Gly Trp Gly Ile Gly Phe Gly Ser Ser Val Ala Pro Val Tyr 130 135 140 Gly Ser Glu Met Ala Pro Arg Lys Ile Arg Gly Thr Ile Gly Gly Ile 145 150 155 160 Phe Gln Phe Ser Val Thr Val Gly Ile Phe Ile Met Phe Leu Ile Gly 165 170 175 Tyr Gly Cys Ser Phe Ile Gln Gly Lys Ala Ser Phe Arg Ile Pro Trp 180 185 190 Gly Val Gln Met Val Pro Gly Leu Ile Leu Leu Ile Gly Leu Phe Phe 195 200 205 Ile Pro Glu Ser Pro Arg Trp Leu Ala Lys Gln Gly Tyr Trp Glu Asp 210 215 220 Ala Glu Ile Ile Val Ala Asn Val Gln Ala Lys Gly Asn Arg Asn Asp 225 230 235 240 Ala Asn Val Gln Ile Glu Met Ser Glu Ile Lys Asp Gln Leu Met Leu 245 250 255 Asp Glu His Leu Lys Glu Phe Thr Tyr Ala Asp Leu Phe Thr Lys Lys 260 265 270 Tyr Arg Gln Arg Thr Ile Thr Ala Ile Phe Ala Gln Ile Trp Gln Gln 275 280 285 Leu Thr Gly Met Asn Val Met Met Tyr Tyr Ile Val Tyr Ile Phe Gln 290 295 300 Met Ala Gly Tyr Ser Gly Asn Thr Asn Leu Val Pro Ser Leu Ile Gln 305 310 315 320 Tyr Ile Ile Asn Met Ala Val Thr Val Pro Ala Leu Phe Cys Leu Asp 325 330 335 Leu Leu Gly Arg Arg Thr Ile Leu Leu Ala Gly Ala Ala Phe Met Met 340 345 350 Ala Trp Gln Phe Gly Val Ala Gly Ile Leu Ala Thr Tyr Ser Glu Pro 355 360 365 Ala Tyr Ile Ser Asp Thr Val Arg Ile Thr Ile Pro Asp Asp His Lys 370 375 380 Ser Ala Ala Lys Gly Val Ile Ala Cys Cys Tyr Leu Phe Val Cys Ser 385 390 395 400 Phe Ala Phe Ser Trp Gly Val Gly Ile Trp Val Tyr Cys Ser Glu Val 405 410 415 Trp Gly Asp Ser Gln Ser Arg Gln Arg Gly Ala Ala Leu Ala Thr Ser 420 425 430 Ala Asn Trp Ile Phe Asn Phe Ala Ile Ala Met Phe Thr Pro Ser Ser 435 440 445 Phe Lys Asn Ile Thr Trp Lys Thr Tyr Ile Ile Tyr Ala Thr Phe Cys 450 455 460 Ala Cys Met Phe Ile His Val Phe Phe Phe Phe Pro Glu Thr Lys Gly 465 470 475 480 Lys Arg Leu Glu Glu Ile Gly Gln Leu Trp Asp Glu Gly Val Pro Ala 485 490 495 Trp Arg Ser Ala Lys Trp Gln Pro Thr Val Pro Leu Ala Ser Asp Ala 500 505 510 Glu Leu Ala His Lys Met Asp Val Ala His Ala Glu His Ala Asp Leu 515 520 525 Leu Ala Thr His Ser Pro Ser Ser Asp Glu Lys Thr Gly Thr Val 530 535 540 <210> SEQ ID NO 2 <211> LENGTH: 524 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species Gxf1p <400> SEQUENCE: 2 Met Ser Gln Asp Glu Leu His Thr Lys Ser Gly Val Glu Thr Pro Ile 1 5 10 15 Asn Asp Ser Leu Leu Glu Glu Lys His Asp Val Thr Pro Leu Ala Ala 20 25 30 Leu Pro Glu Lys Ser Phe Lys Asp Tyr Ile Ser Ile Ser Ile Phe Cys 35 40 45 Leu Phe Val Ala Phe Gly Gly Phe Val Phe Gly Phe Asp Thr Gly Thr 50 55 60 Ile Ser Gly Phe Val Asn Met Ser Asp Phe Lys Thr Arg Phe Gly Glu 65 70 75 80 Met Asn Ala Gln Gly Glu Tyr Tyr Leu Ser Asn Val Arg Thr Gly Leu 85 90 95 Met Val Ser Ile Phe Asn Val Gly Cys Ala Val Gly Gly Ile Phe Leu 100 105 110 Cys Lys Ile Ala Asp Val Tyr Gly Arg Arg Ile Gly Leu Met Phe Ser 115 120 125 Met Val Val Tyr Val Val Gly Ile Ile Ile Gln Ile Ala Ser Thr Thr 130 135 140 Lys Trp Tyr Gln Tyr Phe Ile Gly Arg Leu Ile Ala Gly Leu Ala Val 145 150 155 160 Gly Thr Val Ser Val Ile Ser Pro Leu Phe Ile Ser Glu Val Ala Pro 165 170 175 Lys Gln Leu Arg Gly Thr Leu Val Cys Cys Phe Gln Leu Cys Ile Thr 180 185 190 Leu Gly Ile Phe Leu Gly Tyr Cys Thr Thr Tyr Gly Thr Lys Thr Tyr 195 200 205 Thr Asp Ser Arg Gln Trp Arg Ile Pro Leu Gly Ile Cys Phe Ala Trp 210 215 220 Ala Leu Phe Leu Val Ala Gly Met Leu Asn Met Pro Glu Ser Pro Arg 225 230 235 240 Tyr Leu Val Glu Lys Ser Arg Ile Asp Asp Ala Arg Lys Ser Ile Ala 245 250 255 Arg Ser Asn Lys Val Ser Glu Glu Asp Pro Ala Val Tyr Thr Glu Val 260 265 270 Gln Leu Ile Gln Ala Gly Ile Asp Arg Glu Ala Leu Ala Gly Ser Ala 275 280 285 Thr Trp Met Glu Leu Val Thr Gly Lys Pro Lys Ile Phe Arg Arg Val 290 295 300 Ile Met Gly Val Met Leu Gln Ser Leu Gln Gln Leu Thr Gly Asp Asn 305 310 315 320 Tyr Phe Phe Tyr Tyr Gly Thr Thr Ile Phe Lys Ala Val Gly Leu Gln 325 330 335 Asp Ser Phe Gln Thr Ser Ile Ile Leu Gly Ile Val Asn Phe Ala Ser 340 345 350 Thr Phe Val Gly Ile Tyr Ala Ile Glu Arg Met Gly Arg Arg Leu Cys 355 360 365 Leu Leu Thr Gly Ser Ala Cys Met Phe Val Cys Phe Ile Ile Tyr Ser 370 375 380 Leu Ile Gly Thr Gln His Leu Tyr Lys Asn Gly Phe Ser Asn Glu Pro 385 390 395 400 Ser Asn Thr Tyr Lys Pro Ser Gly Asn Ala Met Ile Phe Ile Thr Cys 405 410 415 Leu Tyr Ile Phe Phe Phe Ala Ser Thr Trp Ala Gly Gly Val Tyr Cys 420 425 430 Ile Val Ser Glu Ser Tyr Pro Leu Arg Ile Arg Ser Lys Ala Met Ser 435 440 445 Val Ala Thr Ala Ala Asn Trp Met Trp Gly Phe Leu Ile Ser Phe Phe 450 455 460 Thr Pro Phe Ile Thr Ser Ala Ile His Phe Tyr Tyr Gly Phe Val Phe 465 470 475 480 Thr Gly Cys Leu Ala Phe Ser Phe Phe Tyr Val Tyr Phe Phe Val Val 485 490 495 Glu Thr Lys Gly Leu Ser Leu Glu Glu Val Asp Ile Leu Tyr Ala Ser 500 505 510 Gly Thr Leu Pro Trp Lys Ser Ser Gly Trp Val Pro 515 520 <210> SEQ ID NO 3 <211> LENGTH: 454 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species ?Gxf1p (variant of Gxf1p with shorter N-terminus) <400> SEQUENCE: 3 Met Ser Asp Phe Lys Thr Arg Phe Gly Glu Met Asn Ala Gln Gly Glu 1 5 10 15 Tyr Tyr Leu Ser Asn Val Arg Thr Gly Leu Met Val Ser Ile Phe Asn 20 25 30 Val Gly Cys Ala Val Gly Gly Ile Phe Leu Cys Lys Ile Ala Asp Val 35 40 45 Tyr Gly Arg Arg Ile Gly Leu Met Phe Ser Met Val Val Tyr Val Val 50 55 60 Gly Ile Ile Ile Gln Ile Ala Ser Thr Thr Lys Trp Tyr Gln Tyr Phe 65 70 75 80 Ile Gly Arg Leu Ile Ala Gly Leu Ala Val Gly Thr Val Ser Val Ile 85 90 95 Ser Pro Leu Phe Ile Ser Glu Val Ala Pro Lys Gln Leu Arg Gly Thr 100 105 110 Leu Val Cys Cys Phe Gln Leu Cys Ile Thr Leu Gly Ile Phe Leu Gly 115 120 125 Tyr Cys Thr Thr Tyr Gly Thr Lys Thr Tyr Thr Asp Ser Arg Gln Trp 130 135 140 Arg Ile Pro Leu Gly Ile Cys Phe Ala Trp Ala Leu Phe Leu Val Ala 145 150 155 160 Gly Met Leu Asn Met Pro Glu Ser Pro Arg Tyr Leu Val Glu Lys Ser 165 170 175 Arg Ile Asp Asp Ala Arg Lys Ser Ile Ala Arg Ser Asn Lys Val Ser 180 185 190 Glu Glu Asp Pro Ala Val Tyr Thr Glu Val Gln Leu Ile Gln Ala Gly 195 200 205 Ile Asp Arg Glu Ala Leu Ala Gly Ser Ala Thr Trp Met Glu Leu Val 210 215 220 Thr Gly Lys Pro Lys Ile Phe Arg Arg Val Ile Met Gly Val Met Leu 225 230 235 240 Gln Ser Leu Gln Gln Leu Thr Gly Asp Asn Tyr Phe Phe Tyr Tyr Gly 245 250 255 Thr Thr Ile Phe Lys Ala Val Gly Leu Gln Asp Ser Phe Gln Thr Ser 260 265 270 Ile Ile Leu Gly Ile Val Asn Phe Ala Ser Thr Phe Val Gly Ile Tyr 275 280 285 Ala Ile Glu Arg Met Gly Arg Arg Leu Cys Leu Leu Thr Gly Ser Ala 290 295 300 Cys Met Phe Val Cys Phe Ile Ile Tyr Ser Leu Ile Gly Thr Gln His 305 310 315 320 Leu Tyr Lys Asn Gly Phe Ser Asn Glu Pro Ser Asn Thr Tyr Lys Pro 325 330 335 Ser Gly Asn Ala Met Ile Phe Ile Thr Cys Leu Tyr Ile Phe Phe Phe 340 345 350 Ala Ser Thr Trp Ala Gly Gly Val Tyr Cys Ile Val Ser Glu Ser Tyr 355 360 365 Pro Leu Arg Ile Arg Ser Lys Ala Met Ser Val Ala Thr Ala Ala Asn 370 375 380 Trp Met Trp Gly Phe Leu Ile Ser Phe Phe Thr Pro Phe Ile Thr Ser 385 390 395 400 Ala Ile His Phe Tyr Tyr Gly Phe Val Phe Thr Gly Cys Leu Ala Phe 405 410 415 Ser Phe Phe Tyr Val Tyr Phe Phe Val Val Glu Thr Lys Gly Leu Ser 420 425 430 Leu Glu Glu Val Asp Ile Leu Tyr Ala Ser Gly Thr Leu Pro Trp Lys 435 440 445 Ser Ser Gly Trp Val Pro 450 <210> SEQ ID NO 4 <211> LENGTH: 548 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species Gxf2p/Gal2p <400> SEQUENCE: 4 Met Ser Ala Glu Gln Glu Gln Gln Val Ser Gly Thr Ser Ala Thr Ile 1 5 10 15 Asp Gly Leu Ala Ser Leu Lys Gln Glu Lys Thr Ala Glu Glu Glu Asp 20 25 30 Ala Phe Lys Pro Lys Pro Ala Thr Ala Tyr Phe Phe Ile Ser Phe Leu 35 40 45 Cys Gly Leu Val Ala Phe Gly Gly Tyr Val Phe Gly Phe Asp Thr Gly 50 55 60 Thr Ile Ser Gly Phe Val Asn Met Asp Asp Tyr Leu Met Arg Phe Gly 65 70 75 80 Gln Gln His Ala Asp Gly Thr Tyr Tyr Leu Ser Asn Val Arg Thr Gly 85 90 95 Leu Ile Val Ser Ile Phe Asn Ile Gly Cys Ala Val Gly Gly Leu Ala 100 105 110 Leu Ser Lys Val Gly Asp Ile Trp Gly Arg Arg Ile Gly Ile Met Val 115 120 125 Ala Met Ile Ile Tyr Met Val Gly Ile Ile Ile Gln Ile Ala Ser Gln 130 135 140 Asp Lys Trp Tyr Gln Tyr Phe Ile Gly Arg Leu Ile Thr Gly Leu Gly 145 150 155 160 Val Gly Thr Thr Ser Val Leu Ser Pro Leu Phe Ile Ser Glu Ser Ala 165 170 175 Pro Lys His Leu Arg Gly Thr Leu Val Cys Cys Phe Gln Leu Met Val 180 185 190 Thr Leu Gly Ile Phe Leu Gly Tyr Cys Thr Thr Tyr Gly Thr Lys Asn 195 200 205 Tyr Thr Asp Ser Arg Gln Trp Arg Ile Pro Leu Gly Leu Cys Phe Ala 210 215 220 Trp Ala Leu Leu Leu Ile Ser Gly Met Val Phe Met Pro Glu Ser Pro 225 230 235 240 Arg Phe Leu Ile Glu Arg Gln Arg Phe Asp Glu Ala Lys Ala Ser Val 245 250 255 Ala Lys Ser Asn Gln Val Ser Thr Glu Asp Pro Ala Val Tyr Thr Glu 260 265 270 Val Glu Leu Ile Gln Ala Gly Ile Asp Arg Glu Ala Leu Ala Gly Ser 275 280 285 Ala Gly Trp Lys Glu Leu Ile Thr Gly Lys Pro Lys Met Leu Gln Arg 290 295 300 Val Ile Leu Gly Met Met Leu Gln Ser Ile Gln Gln Leu Thr Gly Asn 305 310 315 320 Asn Tyr Phe Phe Tyr Tyr Gly Thr Thr Ile Phe Lys Ala Val Gly Met 325 330 335 Ser Asp Ser Phe Gln Thr Ser Ile Val Leu Gly Ile Val Asn Phe Ala 340 345 350 Ser Thr Phe Val Gly Ile Trp Ala Ile Glu Arg Met Gly Arg Arg Ser 355 360 365 Cys Leu Leu Val Gly Ser Ala Cys Met Ser Val Cys Phe Leu Ile Tyr 370 375 380 Ser Ile Leu Gly Ser Val Asn Leu Tyr Ile Asp Gly Tyr Glu Asn Thr 385 390 395 400 Pro Ser Asn Thr Arg Lys Pro Thr Gly Asn Ala Met Ile Phe Ile Thr 405 410 415 Cys Leu Phe Ile Phe Phe Phe Ala Ser Thr Trp Ala Gly Gly Val Tyr 420 425 430 Ser Ile Val Ser Glu Thr Tyr Pro Leu Arg Ile Arg Ser Lys Gly Met 435 440 445 Ala Val Ala Thr Ala Ala Asn Trp Met Trp Gly Phe Leu Ile Ser Phe 450 455 460 Phe Thr Pro Phe Ile Thr Ser Ala Ile His Phe Tyr Tyr Gly Phe Val 465 470 475 480 Phe Thr Gly Cys Leu Ile Phe Ser Phe Phe Tyr Val Phe Phe Phe Val 485 490 495 Arg Glu Thr Lys Gly Leu Ser Leu Glu Glu Val Asp Glu Leu Tyr Ala 500 505 510 Thr Asp Leu Pro Pro Trp Lys Thr Ala Gly Trp Thr Pro Pro Ser Ala 515 520 525 Glu Asp Met Ala His Thr Thr Gly Phe Ala Glu Ala Ala Lys Pro Thr 530 535 540 Asn Lys His Val 545 <210> SEQ ID NO 5 <211> LENGTH: 502 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species delta-Gxs1p/Delta-Hgt12p (variant of Gxs1p/Hgt12p with shorter N-terminus) <400> SEQUENCE: 5 Met Gly Ile Phe Val Gly Val Phe Ala Ala Leu Gly Gly Val Leu Phe 1 5 10 15 Gly Tyr Asp Thr Gly Thr Ile Ser Gly Val Met Ala Met Pro Trp Val 20 25 30 Lys Glu His Phe Pro Lys Asp Arg Val Ala Phe Ser Ala Ser Glu Ser 35 40 45 Ser Leu Ile Val Ser Ile Leu Ser Ala Gly Thr Phe Phe Gly Ala Ile 50 55 60 Leu Ala Pro Leu Leu Thr Asp Thr Leu Gly Arg Arg Trp Cys Ile Ile 65 70 75 80 Ile Ser Ser Leu Val Val Phe Asn Leu Gly Ala Ala Leu Gln Thr Ala 85 90 95 Ala Thr Asp Ile Pro Leu Leu Ile Val Gly Arg Val Ile Ala Gly Leu 100 105 110 Gly Val Gly Leu Ile Ser Ser Thr Ile Pro Leu Tyr Gln Ser Glu Ala 115 120 125 Leu Pro Lys Trp Ile Arg Gly Ala Val Val Ser Cys Tyr Gln Trp Ala 130 135 140 Ile Thr Ile Gly Ile Phe Leu Ala Ala Val Ile Asn Gln Gly Thr His 145 150 155 160 Lys Ile Asn Ser Pro Ala Ser Tyr Arg Ile Pro Leu Gly Ile Gln Met 165 170 175 Ala Trp Gly Leu Ile Leu Gly Val Gly Met Phe Phe Leu Pro Glu Thr 180 185 190 Pro Arg Phe Tyr Ile Ser Lys Gly Gln Asn Ala Lys Ala Ala Val Ser 195 200 205 Leu Ala Arg Leu Arg Lys Leu Pro Gln Asp His Pro Glu Leu Leu Glu 210 215 220 Glu Leu Glu Asp Ile Gln Ala Ala Tyr Glu Phe Glu Thr Val His Gly 225 230 235 240 Lys Ser Ser Trp Ser Gln Val Phe Thr Asn Lys Asn Lys Gln Leu Lys 245 250 255 Lys Leu Ala Thr Gly Val Cys Leu Gln Ala Phe Gln Gln Leu Thr Gly 260 265 270 Val Asn Phe Ile Phe Tyr Phe Gly Thr Thr Phe Phe Asn Ser Val Gly 275 280 285 Leu Asp Gly Phe Thr Thr Ser Leu Ala Thr Asn Ile Val Asn Val Gly 290 295 300 Ser Thr Ile Pro Gly Ile Leu Gly Val Glu Ile Phe Gly Arg Arg Lys 305 310 315 320 Val Leu Leu Thr Gly Ala Ala Gly Met Cys Leu Ser Gln Phe Ile Val 325 330 335 Ala Ile Val Gly Val Ala Thr Asp Ser Lys Ala Ala Asn Gln Val Leu 340 345 350 Ile Ala Phe Cys Cys Ile Phe Ile Ala Phe Phe Ala Ala Thr Trp Gly 355 360 365 Pro Thr Ala Trp Val Val Cys Gly Glu Ile Phe Pro Leu Arg Thr Arg 370 375 380 Ala Lys Ser Ile Ala Met Cys Ala Ala Ser Asn Trp Leu Leu Asn Trp 385 390 395 400 Ala Ile Ala Tyr Ala Thr Pro Tyr Leu Val Asp Ser Asp Lys Gly Asn 405 410 415 Leu Gly Thr Asn Val Phe Phe Ile Trp Gly Ser Cys Asn Phe Phe Cys 420 425 430 Leu Val Phe Ala Tyr Phe Met Ile Tyr Glu Thr Lys Gly Leu Ser Leu 435 440 445 Glu Gln Val Asp Glu Leu Tyr Glu Lys Val Ala Ser Ala Arg Lys Ser 450 455 460 Pro Gly Phe Val Pro Ser Glu His Ala Phe Arg Glu His Ala Asp Val 465 470 475 480 Glu Thr Ala Met Pro Asp Asn Phe Asn Leu Lys Ala Glu Ala Ile Ser 485 490 495 Val Glu Asp Ala Ser Val 500 <210> SEQ ID NO 6 <400> SEQUENCE: 6 000 <210> SEQ ID NO 7 <211> LENGTH: 526 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species Gxs1p/Hgt12 <400> SEQUENCE: 7 Met Gly Leu Glu Ser Asn Lys Leu Ile Arg Lys Tyr Ile Asn Val Gly 1 5 10 15 Glu Lys Arg Ala Gly Ser Ser Gly Met Gly Ile Phe Val Gly Val Phe 20 25 30 Ala Ala Leu Gly Gly Val Leu Phe Gly Tyr Asp Thr Gly Thr Ile Ser 35 40 45 Gly Val Met Ala Met Pro Trp Val Lys Glu His Phe Pro Lys Asp Arg 50 55 60 Val Ala Phe Ser Ala Ser Glu Ser Ser Leu Ile Val Ser Ile Leu Ser 65 70 75 80 Ala Gly Thr Phe Phe Gly Ala Ile Leu Ala Pro Leu Leu Thr Asp Thr 85 90 95 Leu Gly Arg Arg Trp Cys Ile Ile Ile Ser Ser Leu Val Val Phe Asn 100 105 110 Leu Gly Ala Ala Leu Gln Thr Ala Ala Thr Asp Ile Pro Leu Leu Ile 115 120 125 Val Gly Arg Val Ile Ala Gly Leu Gly Val Gly Leu Ile Ser Ser Thr 130 135 140 Ile Pro Leu Tyr Gln Ser Glu Ala Leu Pro Lys Trp Ile Arg Gly Ala 145 150 155 160 Val Val Ser Cys Tyr Gln Trp Ala Ile Thr Ile Gly Ile Phe Leu Ala 165 170 175 Ala Val Ile Asn Gln Gly Thr His Lys Ile Asn Ser Pro Ala Ser Tyr 180 185 190 Arg Ile Pro Leu Gly Ile Gln Met Ala Trp Gly Leu Ile Leu Gly Val 195 200 205 Gly Met Phe Phe Leu Pro Glu Thr Pro Arg Phe Tyr Ile Ser Lys Gly 210 215 220 Gln Asn Ala Lys Ala Ala Val Ser Leu Ala Arg Leu Arg Lys Leu Pro 225 230 235 240 Gln Asp His Pro Glu Leu Leu Glu Glu Leu Glu Asp Ile Gln Ala Ala 245 250 255 Tyr Glu Phe Glu Thr Val His Gly Lys Ser Ser Trp Ser Gln Val Phe 260 265 270 Thr Asn Lys Asn Lys Gln Leu Lys Lys Leu Ala Thr Gly Val Cys Leu 275 280 285 Gln Ala Phe Gln Gln Leu Thr Gly Val Asn Phe Ile Phe Tyr Phe Gly 290 295 300 Thr Thr Phe Phe Asn Ser Val Gly Leu Asp Gly Phe Thr Thr Ser Leu 305 310 315 320 Ala Thr Asn Ile Val Asn Val Gly Ser Thr Ile Pro Gly Ile Leu Gly 325 330 335 Val Glu Ile Phe Gly Arg Arg Lys Val Leu Leu Thr Gly Ala Ala Gly 340 345 350 Met Cys Leu Ser Gln Phe Ile Val Ala Ile Val Gly Val Ala Thr Asp 355 360 365 Ser Lys Ala Ala Asn Gln Val Leu Ile Ala Phe Cys Cys Ile Phe Ile 370 375 380 Ala Phe Phe Ala Ala Thr Trp Gly Pro Thr Ala Trp Val Val Cys Gly 385 390 395 400 Glu Ile Phe Pro Leu Arg Thr Arg Ala Lys Ser Ile Ala Met Cys Ala 405 410 415 Ala Ser Asn Trp Leu Leu Asn Trp Ala Ile Ala Tyr Ala Thr Pro Tyr 420 425 430 Leu Val Asp Ser Asp Lys Gly Asn Leu Gly Thr Asn Val Phe Phe Ile 435 440 445 Trp Gly Ser Cys Asn Phe Phe Cys Leu Val Phe Ala Tyr Phe Met Ile 450 455 460 Tyr Glu Thr Lys Gly Leu Ser Leu Glu Gln Val Asp Glu Leu Tyr Glu 465 470 475 480 Lys Val Ala Ser Ala Arg Lys Ser Pro Gly Phe Val Pro Ser Glu His 485 490 495 Ala Phe Arg Glu His Ala Asp Val Glu Thr Ala Met Pro Asp Asn Phe 500 505 510 Asn Leu Lys Ala Glu Ala Ile Ser Val Glu Asp Ala Ser Val 515 520 525 <210> SEQ ID NO 8 <211> LENGTH: 548 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species Hxt5p <400> SEQUENCE: 8 Met Ser Ile Phe Glu Gly Lys Asp Gly Lys Gly Val Ser Ser Thr Glu 1 5 10 15 Ser Leu Ser Asn Asp Val Arg Tyr Asp Asn Met Glu Lys Val Asp Gln 20 25 30 Asp Val Leu Arg His Asn Phe Asn Phe Asp Lys Glu Phe Glu Glu Leu 35 40 45 Glu Ile Glu Ala Ala Gln Val Asn Asp Lys Pro Ser Phe Val Asp Arg 50 55 60 Ile Leu Ser Leu Glu Tyr Lys Leu His Phe Glu Asn Lys Asn His Met 65 70 75 80 Val Trp Leu Leu Gly Ala Phe Ala Ala Ala Ala Gly Leu Leu Ser Gly 85 90 95 Leu Asp Gln Ser Ile Ile Ser Gly Ala Ser Ile Gly Met Asn Lys Ala 100 105 110 Leu Asn Leu Thr Glu Arg Glu Ala Ser Leu Val Ser Ser Leu Met Pro 115 120 125 Leu Gly Ala Met Ala Gly Ser Met Ile Met Thr Pro Leu Asn Glu Trp 130 135 140 Phe Gly Arg Lys Ser Ser Leu Ile Ile Ser Cys Ile Trp Tyr Thr Ile 145 150 155 160 Gly Ser Ala Leu Cys Ala Gly Ala Arg Asp His His Met Met Tyr Ala 165 170 175 Gly Arg Phe Ile Leu Gly Val Gly Val Gly Ile Glu Gly Gly Cys Val 180 185 190 Gly Ile Tyr Ile Ser Glu Ser Val Pro Ala Asn Val Arg Gly Ser Ile 195 200 205 Val Ser Met Tyr Gln Phe Asn Ile Ala Leu Gly Glu Val Leu Gly Tyr 210 215 220 Ala Val Ala Ala Ile Phe Tyr Thr Val His Gly Gly Trp Arg Phe Met 225 230 235 240 Val Gly Ser Ser Leu Val Phe Ser Thr Ile Leu Phe Ala Gly Leu Phe 245 250 255 Phe Leu Pro Glu Ser Pro Arg Trp Leu Val His Lys Gly Arg Asn Gly 260 265 270 Met Ala Tyr Asp Val Trp Lys Arg Leu Arg Asp Ile Asn Asp Glu Ser 275 280 285 Ala Lys Leu Glu Phe Leu Glu Met Arg Gln Ala Ala Tyr Gln Glu Arg 290 295 300 Glu Arg Arg Ser Gln Glu Ser Leu Phe Ser Ser Trp Gly Glu Leu Phe 305 310 315 320 Thr Ile Ala Arg Asn Arg Arg Ala Leu Thr Tyr Ser Val Ile Met Ile 325 330 335 Thr Leu Gly Gln Leu Thr Gly Val Asn Ala Val Met Tyr Tyr Met Ser 340 345 350 Thr Leu Met Gly Ala Ile Gly Phe Asn Glu Lys Asp Ser Val Phe Met 355 360 365 Ser Leu Val Gly Gly Gly Ser Leu Leu Ile Gly Thr Ile Pro Ala Ile 370 375 380 Leu Trp Met Asp Arg Phe Gly Arg Arg Val Trp Gly Tyr Asn Leu Val 385 390 395 400 Gly Phe Phe Val Gly Leu Val Leu Val Gly Val Gly Tyr Arg Phe Asn 405 410 415 Pro Val Thr Gln Lys Ala Ala Ser Glu Gly Val Tyr Leu Thr Gly Leu 420 425 430 Ile Val Tyr Phe Leu Phe Phe Gly Ser Tyr Ser Thr Leu Thr Trp Val 435 440 445 Ile Pro Ser Glu Ser Phe Asp Leu Arg Thr Arg Ser Leu Gly Met Thr 450 455 460 Ile Cys Ser Thr Phe Leu Tyr Leu Trp Ser Phe Thr Val Thr Tyr Asn 465 470 475 480 Phe Thr Lys Met Ser Ala Ala Phe Thr Tyr Thr Gly Leu Thr Leu Gly 485 490 495 Phe Tyr Gly Gly Ile Ala Phe Leu Gly Leu Ile Tyr Gln Val Cys Phe 500 505 510 Met Pro Glu Thr Lys Asp Lys Thr Leu Glu Glu Ile Asp Asp Ile Phe 515 520 525 Asn Arg Ser Ala Phe Ser Ile Ala Arg Glu Asn Ile Ser Asn Leu Lys 530 535 540 Lys Gly Ile Trp 545 <210> SEQ ID NO 9 <211> LENGTH: 543 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species Xyt1p with S75L mutation <400> SEQUENCE: 9 Met Gly Tyr Glu Glu Lys Leu Val Ala Pro Ala Leu Lys Phe Lys Asn 1 5 10 15 Phe Leu Asp Lys Thr Pro Asn Ile His Asn Val Tyr Val Ile Ala Ala 20 25 30 Ile Ser Cys Thr Ser Gly Met Met Phe Gly Phe Asp Ile Ser Ser Met 35 40 45 Ser Val Phe Val Asp Gln Gln Pro Tyr Leu Lys Met Phe Asp Asn Pro 50 55 60 Ser Ser Val Ile Gln Gly Phe Ile Thr Ala Leu Met Ser Leu Gly Ser 65 70 75 80 Phe Phe Gly Ser Leu Thr Ser Thr Phe Ile Ser Glu Pro Phe Gly Arg 85 90 95 Arg Ala Ser Leu Phe Ile Cys Gly Ile Leu Trp Val Ile Gly Ala Ala 100 105 110 Val Gln Ser Ser Ser Gln Asn Arg Ala Gln Leu Ile Cys Gly Arg Ile 115 120 125 Ile Ala Gly Trp Gly Ile Gly Phe Gly Ser Ser Val Ala Pro Val Tyr 130 135 140 Gly Ser Glu Met Ala Pro Arg Lys Ile Arg Gly Thr Ile Gly Gly Ile 145 150 155 160 Phe Gln Phe Ser Val Thr Val Gly Ile Phe Ile Met Phe Leu Ile Gly 165 170 175 Tyr Gly Cys Ser Phe Ile Gln Gly Lys Ala Ser Phe Arg Ile Pro Trp 180 185 190 Gly Val Gln Met Val Pro Gly Leu Ile Leu Leu Ile Gly Leu Phe Phe 195 200 205 Ile Pro Glu Ser Pro Arg Trp Leu Ala Lys Gln Gly Tyr Trp Glu Asp 210 215 220 Ala Glu Ile Ile Val Ala Asn Val Gln Ala Lys Gly Asn Arg Asn Asp 225 230 235 240 Ala Asn Val Gln Ile Glu Met Ser Glu Ile Lys Asp Gln Leu Met Leu 245 250 255 Asp Glu His Leu Lys Glu Phe Thr Tyr Ala Asp Leu Phe Thr Lys Lys 260 265 270 Tyr Arg Gln Arg Thr Ile Thr Ala Ile Phe Ala Gln Ile Trp Gln Gln 275 280 285 Leu Thr Gly Met Asn Val Met Met Tyr Tyr Ile Val Tyr Ile Phe Gln 290 295 300 Met Ala Gly Tyr Ser Gly Asn Thr Asn Leu Val Pro Ser Leu Ile Gln 305 310 315 320 Tyr Ile Ile Asn Met Ala Val Thr Val Pro Ala Leu Phe Cys Leu Asp 325 330 335 Leu Leu Gly Arg Arg Thr Ile Leu Leu Ala Gly Ala Ala Phe Met Met 340 345 350 Ala Trp Gln Phe Gly Val Ala Gly Ile Leu Ala Thr Tyr Ser Glu Pro 355 360 365 Ala Tyr Ile Ser Asp Thr Val Arg Ile Thr Ile Pro Asp Asp His Lys 370 375 380 Ser Ala Ala Lys Gly Val Ile Ala Cys Cys Tyr Leu Phe Val Cys Ser 385 390 395 400 Phe Ala Phe Ser Trp Gly Val Gly Ile Trp Val Tyr Cys Ser Glu Val 405 410 415 Trp Gly Asp Ser Gln Ser Arg Gln Arg Gly Ala Ala Leu Ala Thr Ser 420 425 430 Ala Asn Trp Ile Phe Asn Phe Ala Ile Ala Met Phe Thr Pro Ser Ser 435 440 445 Phe Lys Asn Ile Thr Trp Lys Thr Tyr Ile Ile Tyr Ala Thr Phe Cys 450 455 460 Ala Cys Met Phe Ile His Val Phe Phe Phe Phe Pro Glu Thr Lys Gly 465 470 475 480 Lys Arg Leu Glu Glu Ile Gly Gln Leu Trp Asp Glu Gly Val Pro Ala 485 490 495 Trp Arg Ser Ala Lys Trp Gln Pro Thr Val Pro Leu Ala Ser Asp Ala 500 505 510 Glu Leu Ala His Lys Met Asp Val Ala His Ala Glu His Ala Asp Leu 515 520 525 Leu Ala Thr His Ser Pro Ser Ser Asp Glu Lys Thr Gly Thr Val 530 535 540 <210> SEQ ID NO 10 <211> LENGTH: 524 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species Hxt2.6p <400> SEQUENCE: 10 Met Ser Ser Thr Thr Asp Thr Leu Glu Lys Arg Asp Thr Glu Pro Phe 1 5 10 15 Thr Ser Asp Ala Pro Val Thr Val His Asp Tyr Ile Ala Glu Glu Arg 20 25 30 Pro Trp Trp Lys Val Pro His Leu Arg Val Leu Thr Trp Ser Val Phe 35 40 45 Val Ile Thr Leu Thr Ser Thr Asn Asn Gly Tyr Asp Gly Ser Met Leu 50 55 60 Asn Gly Leu Gln Ser Leu Asp Ile Trp Gln Glu Asp Leu Gly His Pro 65 70 75 80 Ala Gly Gln Lys Leu Gly Ala Leu Ala Asn Gly Val Leu Phe Gly Asn 85 90 95 Leu Ala Ala Val Pro Phe Ala Ser Tyr Phe Cys Asp Arg Phe Gly Arg 100 105 110 Arg Pro Val Ile Cys Phe Gly Gln Ile Leu Thr Ile Val Gly Ala Val 115 120 125 Leu Gln Gly Leu Ser Asn Ser Tyr Gly Phe Phe Leu Gly Ser Arg Ile 130 135 140 Val Leu Gly Phe Gly Ala Met Ile Ala Thr Ile Pro Ser Pro Thr Leu 145 150 155 160 Ile Ser Glu Ile Ala Tyr Pro Thr His Arg Glu Thr Ser Thr Phe Ala 165 170 175 Tyr Asn Val Cys Trp Tyr Leu Gly Ala Ile Ile Ala Ser Trp Val Thr 180 185 190 Tyr Gly Thr Arg Asp Leu Gln Ser Lys Ala Cys Trp Ser Ile Pro Ser 195 200 205 Tyr Leu Gln Ala Ala Leu Pro Phe Phe Gln Val Cys Met Ile Trp Phe 210 215 220 Val Pro Glu Ser Pro Arg Phe Leu Val Ala Lys Gly Lys Ile Asp Gln 225 230 235 240 Ala Arg Ala Val Leu Ser Lys Tyr His Thr Gly Asp Ser Thr Asp Pro 245 250 255 Arg Asp Val Ala Leu Val Asp Phe Glu Leu His Glu Ile Glu Ser Ala 260 265 270 Leu Glu Gln Glu Lys Leu Asn Thr Arg Ser Ser Tyr Phe Asp Phe Phe 275 280 285 Lys Lys Arg Asn Phe Arg Lys Arg Gly Phe Leu Cys Val Met Val Gly 290 295 300 Val Ala Met Gln Leu Ser Gly Asn Gly Leu Val Ser Tyr Tyr Leu Ser 305 310 315 320 Lys Val Leu Asp Ser Ile Gly Ile Thr Glu Thr Lys Arg Gln Leu Glu 325 330 335 Ile Asn Gly Cys Leu Met Ile Tyr Asn Phe Val Ile Cys Val Ser Leu 340 345 350 Met Ser Val Cys Arg Met Phe Lys Arg Arg Val Leu Phe Leu Thr Cys 355 360 365 Phe Ser Gly Met Thr Val Cys Tyr Thr Ile Trp Thr Ile Leu Ser Ala 370 375 380 Leu Asn Glu Gln Arg His Phe Glu Asp Lys Gly Leu Ala Asn Gly Val 385 390 395 400 Leu Ala Met Ile Phe Phe Tyr Tyr Phe Phe Tyr Asn Val Gly Ile Asn 405 410 415 Gly Leu Pro Phe Leu Tyr Ile Thr Glu Ile Leu Pro Tyr Ser His Arg 420 425 430 Ala Lys Gly Leu Asn Leu Phe Gln Phe Ser Gln Phe Leu Thr Gln Ile 435 440 445 Tyr Asn Gly Tyr Val Asn Pro Ile Ala Met Asp Ala Ile Ser Trp Lys 450 455 460 Tyr Tyr Ile Val Tyr Cys Cys Ile Leu Phe Val Glu Leu Val Ile Val 465 470 475 480 Phe Phe Thr Phe Pro Glu Thr Ser Gly Tyr Thr Leu Glu Glu Val Ala 485 490 495 Gln Val Phe Gly Asp Glu Ala Pro Gly Leu His Asn Arg Gln Leu Asp 500 505 510 Val Ala Lys Glu Ser Leu Glu His Val Glu His Val 515 520 <210> SEQ ID NO 11 <211> LENGTH: 556 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species Qup2p <400> SEQUENCE: 11 Met Gly Phe Arg Asn Leu Lys Arg Arg Leu Ser Asn Val Gly Asp Ser 1 5 10 15 Met Ser Val His Ser Val Lys Glu Glu Glu Asp Phe Ser Arg Val Glu 20 25 30 Ile Pro Asp Glu Ile Tyr Asn Tyr Lys Ile Val Leu Val Ala Leu Thr 35 40 45 Ala Ala Ser Ala Ala Ile Ile Ile Gly Tyr Asp Ala Gly Phe Ile Gly 50 55 60 Gly Thr Val Ser Leu Thr Ala Phe Lys Ser Glu Phe Gly Leu Asp Lys 65 70 75 80 Met Ser Ala Thr Ala Ala Ser Ala Ile Glu Ala Asn Val Val Ser Val 85 90 95 Phe Gln Ala Gly Ala Tyr Phe Gly Cys Leu Phe Phe Tyr Pro Ile Gly 100 105 110 Glu Ile Trp Gly Arg Lys Ile Gly Leu Leu Leu Ser Gly Phe Leu Leu 115 120 125 Thr Phe Gly Ala Ala Ile Ser Leu Ile Ser Asn Ser Ser Arg Gly Leu 130 135 140 Gly Ala Ile Tyr Ala Gly Arg Val Leu Thr Gly Leu Gly Ile Gly Gly 145 150 155 160 Cys Ser Ser Leu Ala Pro Ile Tyr Val Ser Glu Ile Ala Pro Ala Ala 165 170 175 Ile Arg Gly Lys Leu Val Gly Cys Trp Glu Val Ser Trp Gln Val Gly 180 185 190 Gly Ile Val Gly Tyr Trp Ile Asn Tyr Gly Val Leu Gln Thr Leu Pro 195 200 205 Ile Ser Ser Gln Gln Trp Ile Ile Pro Phe Ala Val Gln Leu Ile Pro 210 215 220 Ser Gly Leu Phe Trp Gly Leu Cys Leu Leu Ile Pro Glu Ser Pro Arg 225 230 235 240 Phe Leu Val Ser Lys Gly Lys Ile Asp Lys Ala Arg Lys Asn Leu Ala 245 250 255 Tyr Leu Arg Gly Leu Ser Glu Asp His Pro Tyr Ser Val Phe Glu Leu 260 265 270 Glu Asn Ile Ser Lys Ala Ile Glu Glu Asn Phe Glu Gln Thr Gly Arg 275 280 285 Gly Phe Phe Asp Pro Leu Lys Ala Leu Phe Phe Ser Lys Lys Met Leu 290 295 300 Tyr Arg Leu Leu Leu Ser Thr Ser Met Phe Met Met Gln Asn Gly Tyr 305 310 315 320 Gly Ile Asn Ala Val Thr Tyr Tyr Ser Pro Thr Ile Phe Lys Ser Leu 325 330 335 Gly Val Gln Gly Ser Asn Ala Gly Leu Leu Ser Thr Gly Ile Phe Gly 340 345 350 Leu Leu Lys Gly Ala Ala Ser Val Phe Trp Val Phe Phe Leu Val Asp 355 360 365 Thr Phe Gly Arg Arg Phe Cys Leu Cys Tyr Leu Ser Leu Pro Cys Ser 370 375 380 Ile Cys Met Trp Tyr Ile Gly Ala Tyr Ile Lys Ile Ala Asn Pro Ser 385 390 395 400 Ala Lys Leu Ala Ala Gly Asp Thr Ala Thr Thr Pro Ala Gly Thr Ala 405 410 415 Ala Lys Ala Met Leu Tyr Ile Trp Thr Ile Phe Tyr Gly Ile Thr Trp 420 425 430 Asn Gly Thr Thr Trp Val Ile Cys Ala Glu Ile Phe Pro Gln Ser Val 435 440 445 Arg Thr Ala Ala Gln Ala Val Asn Ala Ser Ser Asn Trp Phe Trp Ala 450 455 460 Phe Met Ile Gly His Phe Thr Gly Gln Ala Leu Glu Asn Ile Gly Tyr 465 470 475 480 Gly Tyr Tyr Phe Leu Phe Ala Ala Cys Ser Ala Ile Phe Pro Val Val 485 490 495 Val Trp Phe Val Tyr Pro Glu Thr Lys Gly Val Pro Leu Glu Ala Val 500 505 510 Glu Tyr Leu Phe Glu Val Arg Pro Trp Lys Ala His Ser Tyr Ala Leu 515 520 525 Glu Lys Tyr Gln Ile Glu Tyr Asn Glu Gly Glu Phe His Gln His Lys 530 535 540 Pro Glu Val Leu Leu Gln Gly Ser Glu Asn Ser Asp 545 550 555 <210> SEQ ID NO 12 <211> LENGTH: 543 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species Aps1p/Hgt19p <400> SEQUENCE: 12 Met Gly Tyr Glu Glu Lys Leu Val Ala Pro Ala Leu Lys Phe Lys Asn 1 5 10 15 Phe Leu Asp Lys Thr Pro Asn Ile His Asn Val Tyr Val Ile Ala Ala 20 25 30 Ile Ser Cys Thr Ser Gly Met Met Phe Gly Phe Asp Ile Ser Ser Met 35 40 45 Ser Val Phe Val Asp Gln Gln Pro Tyr Leu Lys Met Phe Asp Asn Pro 50 55 60 Ser Ser Val Ile Gln Gly Phe Ile Thr Ala Ser Met Ser Leu Gly Ser 65 70 75 80 Phe Phe Gly Ser Leu Thr Ser Thr Phe Ile Ser Glu Pro Phe Gly Arg 85 90 95 Arg Ala Ser Leu Phe Ile Cys Gly Ile Leu Trp Val Ile Gly Ala Ala 100 105 110 Val Gln Ser Ser Ser Gln Asn Arg Ala Gln Leu Ile Cys Gly Arg Ile 115 120 125 Ile Ala Gly Trp Gly Ile Gly Phe Gly Ser Ser Val Ala Pro Val Tyr 130 135 140 Gly Ser Glu Met Ala Pro Arg Lys Ile Arg Gly Thr Ile Gly Gly Ile 145 150 155 160 Phe Gln Phe Ser Val Thr Val Gly Ile Phe Ile Met Phe Leu Ile Gly 165 170 175 Tyr Gly Cys Ser Phe Ile Gln Gly Lys Ala Ser Phe Arg Ile Pro Trp 180 185 190 Gly Val Gln Met Val Pro Gly Leu Ile Leu Leu Ile Gly Leu Phe Phe 195 200 205 Ile Pro Glu Ser Pro Arg Trp Leu Ala Lys Gln Gly Tyr Trp Glu Asp 210 215 220 Ala Glu Ile Ile Val Ala Asn Val Gln Ala Lys Gly Asn Arg Asn Asp 225 230 235 240 Ala Asn Val Gln Ile Glu Met Ser Glu Ile Lys Asp Gln Leu Met Leu 245 250 255 Asp Glu His Leu Lys Glu Phe Thr Tyr Ala Asp Leu Phe Thr Lys Lys 260 265 270 Tyr Arg Gln Arg Thr Ile Thr Ala Ile Phe Ala Gln Ile Trp Gln Gln 275 280 285 Leu Thr Gly Met Asn Val Met Met Tyr Tyr Ile Val Tyr Ile Phe Gln 290 295 300 Met Ala Gly Tyr Ser Gly Asn Thr Asn Leu Val Pro Ser Leu Ile Gln 305 310 315 320 Tyr Ile Ile Asn Met Ala Val Thr Val Pro Ala Leu Phe Cys Leu Asp 325 330 335 Leu Leu Gly Arg Arg Thr Ile Leu Leu Ala Gly Ala Ala Phe Met Met 340 345 350 Ala Trp Gln Phe Gly Val Ala Gly Ile Leu Ala Thr Tyr Ser Glu Pro 355 360 365 Ala Tyr Ile Ser Asp Thr Val Arg Ile Thr Ile Pro Asp Asp His Lys 370 375 380 Ser Ala Ala Lys Gly Val Ile Ala Cys Cys Tyr Leu Phe Val Cys Ser 385 390 395 400 Phe Ala Phe Ser Trp Gly Val Gly Ile Trp Val Tyr Cys Ser Glu Val 405 410 415 Trp Gly Asp Ser Gln Ser Arg Gln Arg Gly Ala Ala Leu Ala Thr Ser 420 425 430 Ala Asn Trp Ile Phe Asn Phe Ala Ile Ala Met Phe Thr Pro Ser Ser 435 440 445 Phe Lys Asn Ile Thr Trp Lys Thr Tyr Ile Ile Tyr Ala Thr Phe Cys 450 455 460 Ala Cys Met Phe Ile His Val Phe Phe Phe Phe Pro Glu Thr Lys Gly 465 470 475 480 Lys Arg Leu Glu Glu Ile Gly Gln Leu Trp Asp Glu Gly Val Pro Ala 485 490 495 Trp Arg Ser Ala Lys Trp Gln Pro Thr Val Pro Leu Ala Ser Asp Ala 500 505 510 Glu Leu Ala His Lys Met Asp Val Ala His Ala Glu His Ala Asp Leu 515 520 525 Leu Ala Thr His Ser Pro Ser Ser Asp Glu Lys Thr Gly Thr Val 530 535 540 <210> SEQ ID NO 13 <211> LENGTH: 1632 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species XYT1 <400> SEQUENCE: 13 atgggttacg aggaaaagct tgtagcgccc gcgttgaaat tcaaaaactt tcttgacaaa 60 acccccaata ttcacaatgt ctatgtcatt gccgccatct cctgtacatc aggtatgatg 120 tttggatttg atatctcgtc gatgtctgtc tttgtcgacc agcagccata cttgaagatg 180 tttgacaacc ctagttccgt gattcaaggt ttcattaccg cgctgatgag tttgggctcg 240 tttttcggct cgctcacatc cacgttcatc tctgagcctt ttggtcgtcg tgcatcgttg 300 ttcatttgtg gtattctttg ggtaattgga gcagcggttc aaagttcgtc gcagaacagg 360 gcccaattga tttgtgggcg tatcattgca ggatggggca ttggctttgg gtcatcggtg 420 gctcctgttt acgggtccga gatggctccg agaaagatca gaggcacgat tggtggaatc 480 ttccagttct ccgtcaccgt gggtatcttt atcatgttct tgattgggta cggatgctct 540 ttcattcaag gaaaggcctc tttccggatc ccctggggtg tgcaaatggt tcccggcctt 600 atcctcttga ttggactttt ctttattcct gaatctcccc gttggttggc caaacagggc 660 tactgggaag acgccgaaat cattgtggcc aatgtgcagg ccaagggtaa ccgtaacgac 720 gccaacgtgc agattgaaat gtcggagatt aaggatcaat tgatgcttga cgagcacttg 780 aaggagttta cgtacgctga ccttttcacg aagaagtacc gccagcgcac gatcacggcg 840 atctttgccc agatctggca acagttgacc ggtatgaatg tgatgatgta ctacattgtg 900 tacattttcc agatggcagg ctacagcggc aacacgaact tggtgcccag tttgatccag 960 tacatcatca acatggcggt cacggtgccg gcgcttttct gcttggatct cttgggccgt 1020 cgtaccattt tgctcgcggg tgccgcgttc atgatggcgt ggcaattcgg cgtggcgggc 1080 attttggcca cttactcaga accggcatat atctctgaca ctgtgcgtat cacgatcccc 1140 gacgaccaca agtctgctgc aaaaggtgtg attgcatgct gctatttgtt tgtgtgctcg 1200 tttgcattct cgtggggtgt cggtatttgg gtgtactgtt ccgaggtttg gggtgactcc 1260 cagtcgagac aaagaggcgc cgctcttgcg acgtcggcca actggatctt caacttcgcc 1320 attgccatgt tcacgccgtc ctcattcaag aatatcacgt ggaagacgta tatcatctac 1380 gccacgttct gtgcgtgcat gttcatacac gtgtttttct ttttcccaga aacaaagggc 1440 aagcgtttgg aggagatagg ccagctttgg gacgaaggag tcccagcatg gaggtcagcc 1500 aagtggcagc caacagtgcc gctcgcgtcc gacgcagagc ttgcacacaa gatggatgtt 1560 gcgcacgcgg agcacgcgga cttattggcc acgcactcgc catcttcaga cgagaagacg 1620 ggcacggtct aa 1632 <210> SEQ ID NO 14 <211> LENGTH: 1635 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species GXF1 <400> SEQUENCE: 14 atgtctcaag acgaacttca tacaaagtct ggtgttgaaa caccaatcaa cgattcgctt 60 ctcgaggaga agcacgatgt caccccactc gcggcattgc ccgagaagtc cttcaaggac 120 tacatttcca tttccatttt ctgtttgttt gtggcatttg gtggttttgt tttcggtttc 180 gacaccggta cgatttccgg tttcgtcaac atgtccgact tcaagaccag atttggtgag 240 atgaatgccc agggcgaata ctacttgtcc aatgttagaa ctggtttgat ggtttctatt 300 ttcaacgtcg gttgcgccgt tggtggtatc ttcctttgta agattgccga tgtttatggc 360 agaagaattg gtcttatgtt ttccatggtg gtttatgtcg ttggtatcat tattcagatt 420 gcctccacca ccaaatggta ccaatacttc attggccgtc ttattgctgg cttggctgtg 480 ggtactgttt ccgtcatctc gccacttttc atttccgagg ttgctcctaa acagctcaga 540 ggtacgcttg tgtgctgctt ccagttgtgt atcaccttgg gtatcttttt gggttactgc 600 acgacctacg gtacaaagac ttacactgac tccagacagt ggagaatccc attgggtatc 660 tgtttcgcgt gggctttgtt tttggtggcc ggtatgttga acatgcccga gtctcctaga 720 tacttggttg agaaatcgag aatcgacgat gccagaaagt ccattgccag atccaacaag 780 gtttccgagg aagaccccgc cgtgtacacc gaggtgcagc ttatccaggc tggtattgac 840 agagaggccc ttgccggcag cgccacatgg atggagcttg tgactggtaa gcccaaaatc 900 ttcagaagag tcatcatggg tgtcatgctt cagtccttgc aacaattgac tggtgacaac 960 tactttttct actacggaac cacgattttc aaggctgttg gcttgcagga ctctttccag 1020 acgtcgatta tcttgggtat tgtcaacttt gcctcgactt ttgtcggtat ttacgccatt 1080 gagagaatgg gcagaagatt gtgtttgttg accggatctg cgtgcatgtt tgtgtgtttc 1140 atcatctact cgctcattgg tacgcagcac ttgtacaaga acggcttctc taacgaacct 1200 tccaacacat acaagccttc cggtaacgcc atgatcttca tcacgtgtct ttacattttc 1260 ttctttgcct cgacctgggc cggtggtgtt tactgtatcg tgtccgagtc ttacccattg 1320 agaatcagat ccaaggccat gtctgtcgcc accgccgcca actggatgtg gggtttcttg 1380 atctcgttct tcacgccttt catcacctcc gccatccact tttactacgg ttttgttttc 1440 actggctgct tggcgttctc cttcttctac gtctacttct ttgtcgtgga gaccaagggt 1500 ctttccttgg aggaggttga cattttgtac gcttccggta cgcttccatg gaagtcctct 1560 ggctgggtgc ctcctaccgc ggacgaaatg gcccacaacg ccttcgacaa caagccaact 1620 gacgaacaag tctaa 1635 <210> SEQ ID NO 15 <211> LENGTH: 1425 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species delta-GXF1 (variant of GXF1 with shorter N-terminus) <400> SEQUENCE: 15 atgtccgact tcaagaccag atttggtgag atgaatgccc agggcgaata ctacttgtcc 60 aatgttagaa ctggtttgat ggtttctatt ttcaacgtcg gttgcgccgt tggtggtatc 120 ttcctttgta agattgccga tgtttatggc agaagaattg gtcttatgtt ttccatggtg 180 gtttatgtcg ttggtatcat tattcagatt gcctccacca ccaaatggta ccaatacttc 240 attggccgtc ttattgctgg cttggctgtg ggtactgttt ccgtcatctc gccacttttc 300 atttccgagg ttgctcctaa acagctcaga ggtacgcttg tgtgctgctt ccagttgtgt 360 atcaccttgg gtatcttttt gggttactgc acgacctacg gtacaaagac ttacactgac 420 tccagacagt ggagaatccc attgggtatc tgtttcgcgt gggctttgtt tttggtggcc 480 ggtatgttga acatgcccga gtctcctaga tacttggttg agaaatcgag aatcgacgat 540 gccagaaagt ccattgccag atccaacaag gtttccgagg aagaccccgc cgtgtacacc 600 gaggtgcagc ttatccaggc tggtattgac agagaggccc ttgccggcag cgccacatgg 660 atggagcttg tgactggtaa gcccaaaatc ttcagaagag tcatcatggg tgtcatgctt 720 cagtccttgc aacaattgac tggtgacaac tactttttct actacggaac cacgattttc 780 aaggctgttg gcttgcagga ctctttccag acgtcgatta tcttgggtat tgtcaacttt 840 gcctcgactt ttgtcggtat ttacgccatt gagagaatgg gcagaagatt gtgtttgttg 900 accggatctg cgtgcatgtt tgtgtgtttc atcatctact cgctcattgg tacgcagcac 960 ttgtacaaga acggcttctc taacgaacct tccaacacat acaagccttc cggtaacgcc 1020 atgatcttca tcacgtgtct ttacattttc ttctttgcct cgacctgggc cggtggtgtt 1080 tactgtatcg tgtccgagtc ttacccattg agaatcagat ccaaggccat gtctgtcgcc 1140 accgccgcca actggatgtg gggtttcttg atctcgttct tcacgccttt catcacctcc 1200 gccatccact tttactacgg ttttgttttc actggctgct tggcgttctc cttcttctac 1260 gtctacttct ttgtcgtgga gaccaagggt ctttccttgg aggaggttga cattttgtac 1320 gcttccggta cgcttccatg gaagtcctct ggctgggtgc ctcctaccgc ggacgaaatg 1380 gcccacaacg ccttcgacaa caagccaact gacgaacaag tctaa 1425 <210> SEQ ID NO 16 <211> LENGTH: 1647 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species GXF2/GAL2 <400> SEQUENCE: 16 atgagtgccg aacaggaaca acaagtatcg ggcacatctg ccacgataga tgggctggcg 60 tccttgaagc aagaaaaaac cgccgaggag gaagacgcct tcaagcctaa gcccgccacg 120 gcgtactttt tcatttcgtt cctctgtggc ttggtcgcct ttggcggcta cgttttcggt 180 ttcgataccg gtacgatttc cgggtttgtt aacatggacg actatttgat gagattcggc 240 cagcagcacg ctgatggcac gtattacctt tccaacgtga gaaccggttt gatcgtgtcg 300 atcttcaaca ttggctgtgc cgttggtggt cttgcgcttt cgaaagtcgg tgacatttgg 360 ggcagaagaa ttggtattat ggttgctatg atcatctaca tggtgggaat catcatccag 420 atcgcttcac aggataaatg gtaccagtac ttcattggcc gtttgatcac cggattgggt 480 gtcggcacca cgtccgtgct tagtcctctt ttcatctccg agtcggctcc gaagcatttg 540 agaggcaccc ttgtgtgttg tttccagctc atggtcacct tgggtatctt tttgggctac 600 tgcacgacct acggtaccaa gaactacact gactcgcgcc agtggcggat tcccttgggt 660 ctttgcttcg catgggctct tttgttgatc tcgggaatgg ttttcatgcc tgaatcccca 720 cgtttcttga ttgagcgcca gagattcgac gaggccaagg cttccgtggc caaatcgaac 780 caggtttcga ccgaggaccc cgccgtgtac actgaagtcg agttgatcca ggccggtatt 840 gaccgtgagg cattggccgg atccgctggc tggaaagagc ttatcacggg taagcccaag 900 atgttgcagc gtgtgatttt gggaatgatg ctccagtcga tccagcagct taccggtaac 960 aactactttt tctactatgg taccacgatc ttcaaggccg tgggcatgtc ggactcgttc 1020 cagacctcga ttgttttggg tattgtcaac ttcgcctcca cttttgtcgg aatctgggcc 1080 atcgaacgca tgggccgcag atcttgtttg cttgttggtt ccgcgtgcat gagtgtgtgt 1140 ttcttgatct actccatctt gggttccgtc aacctttaca tcgacggcta cgagaacacg 1200 ccttccaaca cgcgtaagcc taccggtaac gccatgattt tcatcacgtg tttgttcatc 1260 ttcttcttcg cctccacctg ggccggtggt gtgtacagta ttgtgtctga aacataccca 1320 ttgagaatcc gctctaaagg tatggccgtg gccaccgctg ccaactggat gtggggtttc 1380 ttgatttcgt tcttcacgcc tttcatcacc tcggccatcc acttctacta cgggtttgtg 1440 ttcacagggt gtcttatttt ctccttcttc tacgtgttct tctttgttag ggaaaccaag 1500 ggtctctcgt tggaagaggt ggatgagtta tatgccactg acctcccacc atggaagacc 1560 gcgggctgga cgcctccttc tgctgaggat atggcccaca ccaccgggtt tgccgaggcc 1620 gcaaagccta cgaacaaaca cgtttaa 1647 <210> SEQ ID NO 17 <211> LENGTH: 1509 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species delta-GXS1/delta-HGT12 (variant of GXS1 /HGT12 with shorter N-terminus) <400> SEQUENCE: 17 atgggcattt tcgttggcgt tttcgccgcg cttggcggtg ttctctttgg ctacgatacc 60 ggtaccatct ctggtgtgat ggccatgcct tgggtcaagg aacatttccc aaaagaccgt 120 gttgcattta gtgcttccga gtcgtcgttg attgtgtcta ttttatctgc aggaactttc 180 tttggagcca ttcttgctcc gctcttgacc gatacattgg gtagacgctg gtgtattatc 240 atctcttcgc tcgttgtgtt caatttgggt gctgctttgc agacggctgc cacggatatc 300 ccgctcttga ttgttggtcg tgtcattgcc ggtttagggg ttggtttgat ttcgctgacg 360 attccattgt accagtccga agcgcttccc aaatggatta gaggtgctgt tgtctcgtgc 420 taccaatggg ccattactat tggtatcttt ttggctgccg tgatcaacca gggcactcac 480 aagatcaaca gccctgcgtc gtacagaatt ccattgggta ttcagatggc atggggtctt 540 atcttgggtg tcggcatgtt cttcttgccc gagacgcctc gtttctacat ttccaagggc 600 cagaatgcga aggctgctgt ttcattggcg cgtttgagaa agcttccgca agatcacccg 660 gagttgttgg aggaattgga agatatccag gcggcatacg agtttgagac tgtccatggc 720 aagtcttcat ggctgcaggt tttcaccaac aagaacaaac aattgaagaa gttggccacg 780 ggcgtgtgct tgcaggcgtt ccaacaattg actggtgtga acttcatttt ctactttggc 840 acgactttct tcaacagtgt tgggcttgac ggattcacca cctccttggc caccaacatt 900 gtcaatgttg gctcgacgat ccctggtatt ttgggtgttg agattttcgg cagaagaaaa 960 gtgttgttga ccggcgctgc tggtatgtgt ctttcgcaat tcattgttgc cattgttggt 1020 gtagccaccg actccaaggc tgcgaaccaa gttcttattg ccttctgctg cattttcatt 1080 gcgttctttg cagccacctg gggccccacc gcatgggttg tttgtggcga gattttcccc 1140 ttgagaacca gagccaagtc gattgccatg tgcgctgctt cgaactggtt gttgaactgg 1200 gcaattgcat acgccacgcc atacttggtt gactccgata agggtaactt gggcaccaat 1260 gtgtttttca tttggggaag ctgtaacttc ttctgccttg tgtttgccta cttcatgatt 1320 tacgagacca agggtctttc cttggagcag gttgatgagc tttacgagaa ggttgccagc 1380 gccagaaagt cgcctggctt cgtgccaagc gagcacgctt tcagagagca cgccgatgtg 1440 gagaccgcca tgccagacaa cttcaacttg aaggcggagg cgatttctgt cgaggatgcc 1500 tctgtttaa 1509 <210> SEQ ID NO 18 <400> SEQUENCE: 18 000 <210> SEQ ID NO 19 <211> LENGTH: 1647 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species GXS1/HGT12 <400> SEQUENCE: 19 atgagcatct ttgaaggcaa agacgggaag ggggtatcct ccaccgagtc gctttccaat 60 gacgtcagat atgacaacat ggagaaagtt gatcaggatg ttcttagaca caacttcaac 120 tttgacaaag aattcgagga gctcgaaatc gaggcggcgc aagtcaacga caaaccttct 180 tttgtcgaca ggattttatc cctcgaatac aagcttcatt tcgaaaacaa gaaccacatg 240 gtgtggctct tgggcgcttt cgcagccgcc gcaggcttat tgtctggctt ggatcagtcc 300 attatttctg gtgcatccat tggaatgaac aaagcattga acttgactga acgtgaagcc 360 tcattggtgt cttcgcttat gcctttaggc gccatggcag gctccatgat tatgacacct 420 cttaatgagt ggttcggaag aaaatcatcg ttgattattt cttgtatttg gtataccatc 480 ggatccgctt tgtgcgctgg cgccagagat caccacatga tgtacgctgg cagatttatt 540 cttggtgtcg gtgtgggtat agaaggtggg tgtgtgggca tttacatttc cgagtctgtc 600 ccagccaatg tgcgtggtag tatcgtgtcg atgtaccagt tcaatattgc tttgggtgaa 660 gttctagggt atgctgttgc tgccattttc tacactgttc atggtggatg gaggttcatg 720 gtggggtctt ctttagtatt ctctactata ttgtttgccg gattgttttt cttgcccgag 780 tcacctcgtt ggttggtgca caaaggcaga aacggaatgg catacgatgt gtggaagaga 840 ttgagagaca taaacgatga aagcgcaaag ttggaatttt tggagatgag acaggctgct 900 tatcaagaga gagaaagacg ctcgcaagag tctttgttct ccagctgggg cgaattattc 960 accatcgcta gaaacagaag agcacttact tactctgtca taatgatcac tttgggtcaa 1020 ttgactggtg tcaatgccgt catgtactac atgtcgactt tgatgggtgc aattggtttc 1080 aacgagaaag actctgtgtt catgtccctt gtgggaggcg gttctttgct tataggtacc 1140 attcctgcca ttttgtggat ggaccgtttc ggcagaagag tttggggtta taatcttgtt 1200 ggtttcttcg ttggtttggt gctcgttggt gttggctacc gtttcaatcc cgtcactcaa 1260 aaggcggctt cagaaggtgt gtacttgacg ggtctcattg tctatttctt gttctttggt 1320 tcctactcga ccttaacttg ggtcattcca tccgagtctt ttgatttgag aacaagatct 1380 ttgggtatga caatctgttc cactttcctt tacttgtggt ctttcaccgt cacctacaac 1440 ttcaccaaga tgtccgccgc cttcacatac actgggttga cacttggttt ctacggtggc 1500 attgcgttcc ttggtttgat ttaccaggtc tgcttcatgc ccgagacgaa ggacaagact 1560 ttggaagaaa ttgacgatat cttcaatcgt tctgcgttct ctatcgcgcg cgagaacatc 1620 tccaacttga agaagggtat ttggtaa 1647 <210> SEQ ID NO 20 <211> LENGTH: 1647 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species HXT5 <400> SEQUENCE: 20 atgagcatct ttgaaggcaa agacgggaag ggggtatcct ccaccgagtc gctttccaat 60 gacgtcagat atgacaacat ggagaaagtt gatcaggatg ttcttagaca caacttcaac 120 tttgacaaag aattcgagga gctcgaaatc gaggcggcgc aagtcaacga caaaccttct 180 tttgtcgaca ggattttatc cctcgaatac aagcttcatt tcgaaaacaa gaaccacatg 240 gtgtggctct tgggcgcttt cgcagccgcc gcaggcttat tgtctggctt ggatcagtcc 300 attatttctg gtgcatccat tggaatgaac aaagcattga acttgactga acgtgaagcc 360 tcattggtgt cttcgcttat gcctttaggc gccatggcag gctccatgat tatgacacct 420 cttaatgagt ggttcggaag aaaatcatcg ttgattattt cttgtatttg gtataccatc 480 ggatccgctt tgtgcgctgg cgccagagat caccacatga tgtacgctgg cagatttatt 540 cttggtgtcg gtgtgggtat agaaggtggg tgtgtgggca tttacatttc cgagtctgtc 600 ccagccaatg tgcgtggtag tatcgtgtcg atgtaccagt tcaatattgc tttgggtgaa 660 gttctagggt atgctgttgc tgccattttc tacactgttc atggtggatg gaggttcatg 720 gtggggtctt ctttagtatt ctctactata ttgtttgccg gattgttttt cttgcccgag 780 tcacctcgtt ggttggtgca caaaggcaga aacggaatgg catacgatgt gtggaagaga 840 ttgagagaca taaacgatga aagcgcaaag ttggaatttt tggagatgag acaggctgct 900 tatcaagaga gagaaagacg ctcgcaagag tctttgttct ccagctgggg cgaattattc 960 accatcgcta gaaacagaag agcacttact tactctgtca taatgatcac tttgggtcaa 1020 ttgactggtg tcaatgccgt catgtactac atgtcgactt tgatgggtgc aattggtttc 1080 aacgagaaag actctgtgtt catgtccctt gtgggaggcg gttctttgct tataggtacc 1140 attcctgcca ttttgtggat ggaccgtttc ggcagaagag tttggggtta taatcttgtt 1200 ggtttcttcg ttggtttggt gctcgttggt gttggctacc gtttcaatcc cgtcactcaa 1260 aaggcggctt cagaaggtgt gtacttgacg ggtctcattg tctatttctt gttctttggt 1320 tcctactcga ccttaacttg ggtcattcca tccgagtctt ttgatttgag aacaagatct 1380 ttgggtatga caatctgttc cactttcctt tacttgtggt ctttcaccgt cacctacaac 1440 ttcaccaaga tgtccgccgc cttcacatac actgggttga cacttggttt ctacggtggc 1500 attgcgttcc ttggtttgat ttaccaggtc tgcttcatgc ccgagacgaa ggacaagact 1560 ttggaagaaa ttgacgatat cttcaatcgt tctgcgttct ctatcgcgcg cgagaacatc 1620 tccaacttga agaagggtat ttggtaa 1647 <210> SEQ ID NO 21 <211> LENGTH: 1632 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species XYT1 codon optimized for expression in S. cerevisiae <400> SEQUENCE: 21 atgggatacg aagagaaatt agtggccccc gctttgaaat ttaagaactt tttggataag 60 accccaaata tacataacgt ttacgtaatt gcggcgatct cgtgtacctc aggtatgatg 120 ttcggtttcg atatatcgtc gatgtccgtg ttcgtggacc aacagccgta tttaaaaatg 180 tttgataacc ctagcagcgt gatacaaggg tttataactg cgttgatgtc tttggggagc 240 tttttcggat cgctaacgtc cacttttatt tcagaacctt ttggtagacg tgcctctttg 300 ttcatatgcg ggatcctttg ggtaattggg gcggcagttc aaagttcttc tcagaaccgt 360 gcgcagctta tttgtggccg aattattgca gggtggggca tcggattcgg ttctagcgtt 420 gcgccggtat acggttcaga aatggcccca cgcaaaatta gaggaacaat cggaggtatt 480 tttcaatttt ctgtcacggt cggaatattc ataatgttcc tgattggcta cggctgctca 540 tttatacaag gcaaggccag ttttagaatt ccgtggggag ttcaaatggt accaggtctc 600 attctgttga tcggactatt cttcattcct gaatccccaa gatggttagc caaacaaggc 660 tactgggaag acgctgagat catcgtagca aacgttcaag ctaagggtaa caggaacgat 720 gctaatgtgc aaattgaaat gtccgagata aaagatcagt taatgcttga cgagcattta 780 aaggagttta cttatgccga tttgtttacc aaaaaatacc ggcaaaggac gataacagct 840 atatttgccc aaatatggca acagctgaca ggtatgaatg tcatgatgta ctacatcgta 900 tatatatttc aaatggcagg ttattcaggt aatactaatt tagttccttc actcattcag 960 tatattataa atatggctgt tacggtcccc gcattgttct gtcttgatct gcttggcagg 1020 aggacaattt tattagctgg cgccgctttt atgatggcct ggcaatttgg tgttgctggc 1080 attttagcta cttattcaga gccagcctat atttcagata ccgtgagaat tacaattcca 1140 gatgaccata aaagtgccgc taagggtgtc atcgcttgct gctatttgtt tgtttgttcc 1200 ttcgcctttt cctggggtgt aggtatctgg gtttattgtt cagaagtgtg gggtgatagt 1260 caatccagac aaagaggtgc tgcattggca acttctgcta attggatctt caatttcgca 1320 attgcaatgt ttacaccttc ttctttcaaa aatatcactt ggaagactta tatcatttat 1380 gctacatttt gtgcttgtat gttcattcat gttttttttt ttttccctga aacaaagggt 1440 aagagactag aagaaattgg acagctatgg gatgaaggtg tcccagcatg gagatctgca 1500 aaatggcaac ccactgtccc actagcaagt gacgctgaat tagctcacaa aatggatgtt 1560 gcacacgctg aacacgcaga cttattggca acccattctc caagtagtga cgaaaaaact 1620 ggtaccgttt aa 1632 <210> SEQ ID NO 22 <211> LENGTH: 1575 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species HXT2.6 <400> SEQUENCE: 22 atgctgagca ctaccgatac cctcgaaaaa agggacaccg agcctttcac ttcagatgct 60 cctgtcacag tccatgacta tatcgcagag gagcgtccgt ggtggaaagt gccgcatttg 120 cgtgtattga cttggtctgt tttcgtgatc accctcacct ccaccaacaa cgggtatgat 180 ggcctgatgt tgaatggatt gcaatccttg gacatttggc aggaggattt gggtcaccct 240 gcgggccaga aattgggtgc cttggccaac ggtgttttgt ttggtaacct tgctgctgtg 300 ccttttgctt cgtatttctg cgatcgtttt ggtagaaggc cggtcatttg tttcggacag 360 atcttgacaa ttgttggtgc tgtattacaa ggtttgtcca acagctatgg attttttttg 420 ggttcgagaa ttgtgttggg ttttggtgct atgatagcca ctattccgct gccaacattg 480 atttccgaaa tcgcctaccc tacgcataga gaaacttcca ctttcgccta caacgtgtgc 540 tggtatttgg gagccattat cgcctcctgg gtcacatacg gcaccagaga tttacagagc 600 aaggcttgct ggtcaattcc ttcttatctc caggccgcct tacctttctt tcaagtgtgc 660 atgatttggt ttgtgccaga gtctcccaga ttcctcgttg ccaagggcaa gatcgaccaa 720 gcaagggctg ttttgtctaa ataccataca ggagactcga ctgaccccag agacgttgcg 780 ttggttgact ttgagctcca tgagattgag agtgcattgg agcaggaaaa attgaacact 840 cgctcgtcat actttgactt tttcaagaag agaaacttta gaaagagagg cttcttgtgt 900 gtcatggtcg gtgttgcaat gcagctttct ggaaacggct tagtgtccta ttacttgtcg 960 aaagtgctag actcgattgg aatcactgaa accaagagac agctcgagat caatggctgc 1020 ttgatgatct ataactttgt catctgcgtc tcgttgatga gtgtttgccg tatgttcaaa 1080 agaagagtat tatttctcac gtgtttctca ggaatgacgg tttgctacac gatatggacg 1140 attttgtcag cgcttaatga acagagacac tttgaggata aaggcttggc caatggcgtg 1200 ttggcaatga tcttcttcta ctattttttc tacaacgttg gcatcaatgg attgccattc 1260 ctatacatca ccgagatctt gccttactca cacagagcaa aaggcttgaa tttattccaa 1320 ttctcgcaat ttctcacgca aatctacaat ggctatgtga acccaatcgc catggacgca 1380 atcagctgga agtattacat tgtgtactgc tgtattctct tcgtggagtt ggtgattgtg 1440 tttttcacgt tcccagaaac ttcgggatac actttggagg aggtcgccca ggtatttggt 1500 gatgaggctc ccgggctcca caacagacaa ttggatgttg cgaaagaatc actcgagcat 1560 gttgagcatg tttga 1575 <210> SEQ ID NO 23 <211> LENGTH: 1605 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species HXT2.6 codon optimized for expression in S. cerevisiae <400> SEQUENCE: 23 atgagccagt ctaaagaaaa gtccaacgtt attaccaccg tcttgtctga agaattgcca 60 gttaagtact ccgaagaaat ctccgattac gtttaccatg atcaacattg gtggaagtac 120 aaccacttca gaaaattgca ttggtacatc ttcgttctga ctttgacttc taccaacaat 180 ggttacgatg gctctatgtt gaacggtcta caatctttgt ctacttggaa agatgctatg 240 ggtaatcctg aaggttacat tttgggtgct ttggctaatg gtactatttt cggtggtgtt 300 ttggctgttg cttttgcttc ttgggcttgt gatagatttg gtagaaagtt gactacctgc 360 ttcggttcta tcgttactgt tattggtgct atattgcaag gtgcctctac taattacgca 420 ttctttttcg tttcccgtat ggttattggt tttggtttcg gtctagcttc tgttgcttct 480 ccaactttga ttgctgaatt gtctttccca acttacagac caacttgtac tgccttgtac 540 aatgtttttt ggtacttggg tgctgttatt gctgcatggg ttacttatgg tactagaact 600 atcgtttctg cctactcttg gagaattcca tcttacttgc aaggtttgtt gccattggtt 660 caagtttgtt tggtttggtg ggttccagaa tctccaagat tcttggtttc taagggtaag 720 attgaaaagg ccagggaatt cttgattaag ttccatactg gtaacgacac ccaagaacaa 780 gctactagat tggtcgaatt tgagttgaaa gaaattgaag ccgccttgga gatggaaaag 840 attaactcta attctaagta caccgacttc atcaccatca agactttcag aaagagaatc 900 ttcttggttg ctttcactgc ttgtatgact caattgtctg gtaacggttt ggtgtcttac 960 tacttgtcca aggttttgat ctccattggt attaccggtg agaaagaaca attgcaaatc 1020 aacggttgcc tgatgatcta caacttggtt ttgtctttag ctgttgcctt cacctgttac 1080 ttgtttagaa gaaaggccct gttcatcttc tcttgctcat tcatgttgtt gtcctacgtt 1140 atttggacca ttctgtccgc tatcaatcaa cagagaaact tcgaacaaaa aggtctaggt 1200 caaggtgtct tggctatgat ttttatctac tacttggcct acaacatcgg tttgaatggt 1260 ttgccatact tgtacgttac cgaaatcttg ccatatactc atagagctaa gggcatcaac 1320 ttgtattcct tggttattaa catcaccctg atctataacg gtttcgttaa cgctattgct 1380 atggatgcta tttcctggaa gtactacatc gtttactgct gcattattgc cgttgaattg 1440 gttgttgtta tcttcaccta cgttgaaact ttcggttaca ccttggaaga agttgctaga 1500 gtttttgaag gtactgattc tttggccatg gacattaact tgaacggtac agtttccaac 1560 gaaaagatcg atatcgttca ctctgaaaga ggttcctctg cttaa 1605 <210> SEQ ID NO 24 <211> LENGTH: 1692 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species QUP2 <400> SEQUENCE: 24 atgggctttc gcaacttaaa gcgcaggctc tcaaatgttg gcgactccat gtcagtgcac 60 tctgtgaaag aggaggaaga cttctcccgc gtggaaatcc cggatgaaat ctacaactat 120 aagatcgtcc ttgtggcttt aacagcggcg tcggctgcca tcatcatcgg ctacgatgca 180 ggcttcattg gtggcacggt ttcgttgacg gcgttcaaac tggaatttgg cttggacaaa 240 atgtctgcga cggcggcttc tgctatcgaa gccaacgttg tttccgtgtt ccaggccggc 300 gcctactttg ggtgtctttt cttctatccg attggcgaga tttggggccg taaaatcggt 360 cttcttcttt ccggctttct tttgacgttt ggtgctgcta tttctttgat ttcgaactcg 420 tctcgtggcc ttggtgccat atatgctgga agagtactaa caggtttggg gattggcgga 480 tgtctgagtt tggccccaat ctacgtttct gaaatcgcgc ctgcagcaat cagaggcaag 540 cttgtgggct gctgggaagt gtcatggcag gtgggcggca ttgttggcta ctggatcaat 600 tacggagtct tgcagactct tccgattagc tcacaacaat ggatcatccc gtttgctgta 660 caattgatcc catcggggct tttctggggc ctttgtcttt tgattccaga gctgccacgt 720 tttcttgtat cgaagggaaa gatcgataag gcgcgcaaaa acttagcgta cttgcgtgga 780 cttagcgagg accaccccta ttctgttttt gagttggaga acattagtaa ggccattgaa 840 gagaacttcg agcaaacagg aaggggtttt ttcgacccat tgaaagcttt gtttttcagc 900 aaaaaaatgc tttaccgcct tctcttgtcc acgtcaatgt tcatgatgca gaatggctat 960 ggaatcaatg ctgtgacata ctactcgccc acgatcttca aatccttagg cgttcagggc 1020 tcaaacgccg gtttgctctc aacaggaatt ttcggtcttc ttaaaggtgc cgcttcggtg 1080 ttctgggtct ttttcttggt tgacacattc ggccgccggt tttgtctttg ctacctctct 1140 ctcccctgct cgatctgcat gtggtatatt ggcgcataca tcaagattgc caacccttca 1200 gcgaagcttg ctgcaggaga cacagccacc accccagcag gaactgcagc gaaagcgatg 1260 ctttacatat ggacgatttt ctacggcatt acgtggaatg gtacgacctg ggtgatctgc 1320 gcggagattt tcccccagtc ggtgagaaca gccgcgcagg ccgtcaacgc ttcttctaat 1380 tggttctggg ctttcatgat cggccacttc actggccagg cgctcgagaa tattgggtac 1440 ggatactact tcttgtttgc ggcgtgctct gcaatcttcc ctgtggtagt ctggtttgtg 1500 taccccgaaa caaagggtgt gcctttggag gccgtggagt atttgttcga ggtgcgtcct 1560 tggaaagcgc actcatatgc tttggagaag taccagattg agtacaacga gggtgaattc 1620 caccaacata agcccgaagt actcttacaa gggtctgaaa actcggacac gagcgagaaa 1680 agcctcgcct ga 1692 <210> SEQ ID NO 25 <211> LENGTH: 2049 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species QUP2 codon optimized for expression in S. cerevisiae <400> SEQUENCE: 25 atgggtttca gaaacttgaa gagaagattg tctaacgttg gtgactccat gtctgttcac 60 tctgttaagg aagaagaaga cttctccaga gttgaaatcc cagatgaaat ctacaactac 120 aagatcgtct tggttgcttt gactgctgct tctgctgcta tcatcatcgg ttacgatgct 180 ggtttcattg gtggtactgt ttctttgact gctttcaagt ctgaattcgg tttggacaag 240 atgtctgcta ctgctgcttc tgctatcgaa atgggtttca gaaacttgaa gaggcgtttg 300 tctaatgttg gtgattccat gtctgttcac tccgtcaaag aagaagagga tttctccaga 360 gttgaaatcc cagacgaaat ctacaactac aagatcgttt tggttgcttt gactgctgct 420 tctgctgcta ttatcattgg ttatgatgct ggtttcatcg gtggtactgt ttctttgaca 480 gctttcaagt ctgaattcgg tttggataag atgtctgcta cagctgcttc agctattgaa 540 gctaatgttg tctctgtttt tcaagctggt gcttactttg gttgcctgtt tttttaccca 600 attggtgaaa tttggggtcg taagattggt ttgttgttgt ctggtttctt gttgactttt 660 ggtgctgcca tttccttgat ctctaattct tctagaggtt tgggtgctat ctatgctggt 720 agagttttga ctggtttagg tattggtggt tgttcttctt tagctcccat ctacgttagt 780 gaaattgctc cagctgcaat tagaggtaag ttagttggtt gttgggaagt ttcttggcaa 840 gttggtggta tcgttggtta ttggattaac tatggtgtct tgcaaaccct gccaatctct 900 tctcaacaat ggattattcc attcgccgtt caattgattc catctggttt gttttggggt 960 ttgtgcttgt tgattccaga atctccaaga ttcttggtgt ccaaaggtaa gattgataag 1020 gccagaaaga acttggctta cttgagaggt ttgtctgaag atcatccata ctccgttttt 1080 gagttggaga acatttccaa ggccatcgaa gaaaactttg aacaaacagg tagaggtttc 1140 ttcgacccat tgaaggcttt gtttttcagc aagaaaatgc tgtacaggct gctgttgtct 1200 acttctatgt ttatgatgca aaacggctac ggtattaacg ctgttactta ttactctccc 1260 accatcttta agtccttggg tgttcaaggt tctaatgccg gtttgttatc tactggtatt 1320 ttcggtttgt tgaaaggtgc cgcttctgtt ttttgggttt tcttcttggt tgataccttc 1380 ggtagaagat tctgtttgtg ctatttgtct ttgccatgct ctatctgcat gtggtatatt 1440 ggtgcctaca ttaagattgc taacccatct gctaaattgg ctgctggtga tactgctact 1500 actccagctg gtactgctgc taaagctatg ttgtatattt ggaccatctt ctacggtatc 1560 acttggaatg gtactacctg ggttatttgc gctgaaattt ttccacaatc tgttagaaca 1620 gctgctcaag ctgttaatgc ttcttctaat tggttttggg ccttcatgat tggtcatttt 1680 actggtcaag ctttggaaaa cattggttac ggttactact ttttgttcgc tgcttgttcc 1740 gctattttcc cagttgtagt ttggttcgtt tacccagaaa caaaaggtgt tccattggaa 1800 gctgttgaat acttgtttga agttagacca tggaaggctc attcttacgc tttagaaaag 1860 taccagatcg agtacaacga aggtgaattc catcaacata agccagaagt tttgttgcag 1920 ggttctgaaa actctgatac ctctgaaaag tctttggcct gaaacgaagg tgaattccac 1980 caacataagc cagaagtttt gttgcaaggt tctgaaaact ctgacacttc tgaaaagtct 2040 ttggcttaa 2049 <210> SEQ ID NO 26 <211> LENGTH: 1887 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species APS1/HGT19 <400> SEQUENCE: 26 atgtcagaaa agcctgttgt gtcgcacagc atcgacacga cgctgtctac gtcatcgaaa 60 caagtctatg acggtaactc gcttcttaag accctgaatg agcgcgatgg cgaacgcggc 120 aatatcttgt cgcagtacac tgaggaacag gccatgcaaa tgggccgcaa ctatgcgttg 180 aagcacaatt tagatgcgac actctttgga aaggcggccg cggtcgcaag aaacccatac 240 gagttcaatt cgatgagttt tttgaccgaa gaggaaaaag tcgcgcttaa cacggagcag 300 accaagaaat ggcacatccc aagaaagttg gtggaggtga ttgcattggg gtccatggcc 360 gctgcggtgc agggtatgga tgagtcggtg gtgaatggtg caacgctttt ctaccccacg 420 gcaatgggta tcacagatat caagaatgcc gatttgattg aaggtttgat caacggtgcg 480 ccctatcttt gctgcgccat catgtgctgg acatctgatt actggaacag gaagttgggc 540 cgtaagtgga ccattttctg gacatgtgcc atttctgcaa tcacatgtat ctggcaaggt 600 ctcgtcaatt tgaaatggta ccatttgttc attgcgcgtt tctgcttggg tttcggtatc 660 ggtgtcaagt ctgccaccgt gcctgcgtat gctgccgaaa ccaccccggc caaaatcaga 720 ggctcgttgg tcatgctttg gcagttcttc accgctgtcg gaatcatgct tggttacgtg 780 gcgtctttgg cattctatta cattggtgac aatggcattt ctggcggctt gaactggaga 840 ttgatgctag gatctgcatg tcttccagct atcgttgtgt tagtccaagt tccgtttgtt 900 ccagaatccc ctcgttggct catgggtaag gaaagacacg ctgaagcata tgattcgctc 960 cggcaattgc ggttcagtga aatcgaggcg gcccgtgact gtttctacca gtacgtgttg 1020 ttgaaagagg agggctctta tggaacgcag ccattcttca gcagaatcaa ggagatgttc 1080 accgtgagaa gaaacagaaa tggtgcattg ggcgcgtgga tcgtcatgtt catgcagcag 1140 ttctgtggaa tcaacgtcat tgcttactac tcgtcgtcga tcttcgtgga gtcgaatctt 1200 tctgagatca aggccatgtt ggcgtcttgg gggttcggta tgatcaattt cttgtttgca 1260 attccagcgt tctacaccat tgacacgttt ggccgacgca acttgttgct cactactttc 1320 cctcttatgg cggtattctt actcatggcc ggattcgggt tctggatccc gttcgagaca 1380 aacccacacg gccgtttggc ggtgatcact attggtatct atttgtttgc atgtgtctac 1440 tctgcgggcg agggaccagt tcccttcaca tactctgccg aagcattccc gttgtatatc 1500 cgtgacttgg gtatgggctt tgccacggcc acgtgttggt tcttcaactt cattttggca 1560 ttttcctggc ctagaatgaa gaatgcattc aagcctcaag gtgcctttgg ctggtatgcc 1620 gcctggaaca ttgttggctt cttcttagtg ttatggttct tgcccgagac aaagggcttg 1680 acgttggagg aattggacga agtgtttgat gtgcctttga gaaaacacgc gcactaccgt 1740 accaaagaat tagtatacaa cttgcgcaaa tacttcttga ggcagaaccc taagccattg 1800 ccgccacttt atgcacacca aagaatggct gttaccaacc cagaatggtt ggaaaagacc 1860 gaggtcacgc acgaggagaa tatctag 1887 <210> SEQ ID NO 27 <211> LENGTH: 1887 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species APS1/HGT19 codon optimized for expression in S. cerevisiae <400> SEQUENCE: 27 atgtctgaaa agccagttgt ttctcactct atcgacacca cctcttctac ctcttctaag 60 caagtctacg acggtaactc tttgttgaag acctctaacg aaagagacgg tgaaagaggt 120 aacatcttgt ctcaatacac tgaagaacaa gcaatgcaaa tgggtagaaa ctacgctttg 180 aagcacaact tggacgctac cttgttcggt aaggctgctg ctgtcgctag aaacccatac 240 gagttcaact ctatgtcttt cttgaccgaa gaagaaaagg tcgctttgaa caccgaacaa 300 accaagaagt ggcacatccc aagaaagttg gttgaagtta ttgctttggg ttctatggct 360 gctgctgttc aaggtatgga cgaatctgtt gttaacggtg ctaccttgtt ctacccaacc 420 gctatgggta tcaccgacat caagaacgct gacttgattg aaggtttgat taacggtgcc 480 ccatacttgt gttgtgctat tatgtgttgg acctctgact actggaacag aaagttgggt 540 agaaagtgga ccattttctg gacctgtgct atttctgcta tcacctgtat ctggcaaggt 600 ttggtcaact tgaagtggta tcacttgttc attgctagat tctgtttggg tttcggtatc 660 ggtgtcaagt ctgctaccgt tccagcctac gctgctgaaa ccaccccagc caagattaga 720 ggttctttgg ttatgttgtg gcaattcttc accgctgtcg gtattatgtt gggttacgtt 780 gcttctttgg ctttctacta cattggtgac aacggtattt ctggtggttt gaactggaga 840 ttgatgttgg gttctgcttg tttgccagcc atcgttgttt tggtccaagt tccattcgtt 900 ccagaatctc caagatggtt gatgggtaag gaaagacacg ctgaagccta cgactctttg 960 agacaattga gattctctga aatcgaagcc gctagagact gtttctacca atacgttttg 1020 ttgaaggaag aaggttctta cggtactcaa ccattcttct ctagaatcaa ggaaatgttc 1080 accgttagaa gaaacagaaa cggtgctttg ggtgcttgga ttgttatgtt tatgcaacaa 1140 ttctgtggta tcaacgtcat tgcttactac tcttcttcta tcttcgttga atctaacttg 1200 tctgaaatca aggctatgtt ggcttcttgg ggtttcggta tgattaactt cttgttcgct 1260 attccagcct tctacaccat tgacaccttc ggtagaagaa acttgttgtt gactactttc 1320 ccattgatgg ctgttttctt gttgatggct ggtttcggtt tctggattcc attcgaaacc 1380 aacccacacg gtagattggc tgttatcact attggtatct acttgttcgc ttgtgtctac 1440 tctgctggtg aaggtccagt tccattcacc tactctgctg aagccttccc attgtacatc 1500 agagacttgg gtatgggttt cgctaccgct acctgttggt tcttcaactt cattttggct 1560 ttctcttggc caagaatgaa gaacgctttc aagcctcaag gtgctttcgg ttggtacgct 1620 gcttggaaca ttgttggttt cttcttggtt ttgtggttct tgccagaaac taagggtttg 1680 actttggaag aattggacga agttttcgac gttccattga gaaagcacgc tcactacaga 1740 actaaggaat tggtttacaa cttgagaaag tacttcttga gacaaaaccc aaagccattg 1800 ccaccattgt acgctcacca aagaatggct gttaccaacc cagaatggtt ggaaaagacc 1860 gaagtcaccc acgaagaaaa catctaa 1887 <210> SEQ ID NO 28 <211> LENGTH: 49 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Primer Y10 <400> SEQUENCE: 28 gaaaaaactg gtaccgttta atcagtactg acaataaaaa gattcttgt 49 <210> SEQ ID NO 29 <211> LENGTH: 49 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Primer Y10R <400> SEQUENCE: 29 taatttctct tcgtatccca tggttgttta tgttcggatg tgatgtgag 49 <210> SEQ ID NO 30 <211> LENGTH: 60 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Primer Y15 <400> SEQUENCE: 30 acgccgccat ccagtgtcga aaacgagctt tgtcttgtaa agagtcttcg gtcattttta 60 <210> SEQ ID NO 31 <211> LENGTH: 60 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Primer Y15R <400> SEQUENCE: 31 gcggccgcat aggccactag tggatctgat caatacatac aagcatctca caatcacaag 60 <210> SEQ ID NO 32 <211> LENGTH: 60 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Primer Y33 <400> SEQUENCE: 32 tttttcaccc acaacaaata atatcaaaag atgggttacg aggaaaagct tgtagcgccc 60 <210> SEQ ID NO 33 <211> LENGTH: 60 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Primer Y33R <400> SEQUENCE: 33 acgagaacac ccagctaaac gcggtgcgcg ttagaccgtg cccgtcttct cgtctgaaga 60 <210> SEQ ID NO 34 <211> LENGTH: 66 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Primer Y41 <400> SEQUENCE: 34 cagagcagat tgtactgaga gtgcaccagg cgcgccccat ccagtgtcga accatcatta 60 aaagat 66 <210> SEQ ID NO 35 <211> LENGTH: 68 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Primer Y41R <400> SEQUENCE: 35 ctccttacgc atctgtgcgg tatttcacac cgcactagac aatacataca agcatctcac 60 aatcacaa 68 <210> SEQ ID NO 36 <211> LENGTH: 38 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Primer Y53 <400> SEQUENCE: 36 tcagtactga caataaaaag attcttgttt tcaagaac 38 <210> SEQ ID NO 37 <211> LENGTH: 28 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Primer Y53R <400> SEQUENCE: 37 ctcacatcac atccgaacat aaacaacc 28 <210> SEQ ID NO 38 <211> LENGTH: 22 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Primer Y83 <400> SEQUENCE: 38 tatcccgtca cttccacatt cg 22 <210> SEQ ID NO 39 <211> LENGTH: 32 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Primer Y83R <400> SEQUENCE: 39 tattgatata gtgtttaagc gaatgacaga ag 32 <210> SEQ ID NO 40 <211> LENGTH: 62 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Primer Y96i <400> SEQUENCE: 40 atagaaagca aatagttata taatttttca tggacgtagg tctagagatc tgtttagctt 60 gc 62 <210> SEQ ID NO 41 <211> LENGTH: 66 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Primer Y95Ri <400> SEQUENCE: 41 aatgcaaaag cggctcctaa acagaaattc ttcagtcaat acatacaagc atctcacaat 60 cacaag 66 <210> SEQ ID NO 42 <211> LENGTH: 58 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Primer Y93Ri <400> SEQUENCE: 42 tcgtctatat caaaactgca tgtttctcta cgtctaatta agggttctcg agagctcg 58 <210> SEQ ID NO 43 <211> LENGTH: 56 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Primer Y91i <400> SEQUENCE: 43 acttcaatag acttcaatag aaagcaaata gttatatgcc ctgaggatgt atctgg 56 <210> SEQ ID NO 44 <211> LENGTH: 628 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: ubiquitin-deficient H0 Metschnikowia species Aps1p/Hgt19 codon optimized for expression in S. cerevisiae (with K4R; K20R; K30R and K93R mutations) <400> SEQUENCE: 44 Met Ser Glu Arg Pro Val Val Ser His Ser Ile Asp Thr Thr Ser Ser 1 5 10 15 Thr Ser Ser Arg Gln Val Tyr Asp Gly Asn Ser Leu Leu Arg Thr Ser 20 25 30 Asn Glu Arg Asp Gly Glu Arg Gly Asn Ile Leu Ser Gln Tyr Thr Glu 35 40 45 Glu Gln Ala Met Gln Met Gly Arg Asn Tyr Ala Leu Lys His Asn Leu 50 55 60 Asp Ala Thr Leu Phe Gly Lys Ala Ala Ala Val Ala Arg Asn Pro Tyr 65 70 75 80 Glu Phe Asn Ser Met Ser Phe Leu Thr Glu Glu Glu Arg Val Ala Leu 85 90 95 Asn Thr Glu Gln Thr Lys Lys Trp His Ile Pro Arg Lys Leu Val Glu 100 105 110 Val Ile Ala Leu Gly Ser Met Ala Ala Ala Val Gln Gly Met Asp Glu 115 120 125 Ser Val Val Asn Gly Ala Thr Leu Phe Tyr Pro Thr Ala Met Gly Ile 130 135 140 Thr Asp Ile Lys Asn Ala Asp Leu Ile Glu Gly Leu Ile Asn Gly Ala 145 150 155 160 Pro Tyr Leu Cys Cys Ala Ile Met Cys Trp Thr Ser Asp Tyr Trp Asn 165 170 175 Arg Lys Leu Gly Arg Lys Trp Thr Ile Phe Trp Thr Cys Ala Ile Ser 180 185 190 Ala Ile Thr Cys Ile Trp Gln Gly Leu Val Asn Leu Lys Trp Tyr His 195 200 205 Leu Phe Ile Ala Arg Phe Cys Leu Gly Phe Gly Ile Gly Val Lys Ser 210 215 220 Ala Thr Val Pro Ala Tyr Ala Ala Glu Thr Thr Pro Ala Lys Ile Arg 225 230 235 240 Gly Ser Leu Val Met Leu Trp Gln Phe Phe Thr Ala Val Gly Ile Met 245 250 255 Leu Gly Tyr Val Ala Ser Leu Ala Phe Tyr Tyr Ile Gly Asp Asn Gly 260 265 270 Ile Ser Gly Gly Leu Asn Trp Arg Leu Met Leu Gly Ser Ala Cys Leu 275 280 285 Pro Ala Ile Val Val Leu Val Gln Val Pro Phe Val Pro Glu Ser Pro 290 295 300 Arg Trp Leu Met Gly Lys Glu Arg His Ala Glu Ala Tyr Asp Ser Leu 305 310 315 320 Arg Gln Leu Arg Phe Ser Glu Ile Glu Ala Ala Arg Asp Cys Phe Tyr 325 330 335 Gln Tyr Val Leu Leu Lys Glu Glu Gly Ser Tyr Gly Thr Gln Pro Phe 340 345 350 Phe Ser Arg Ile Lys Glu Met Phe Thr Val Arg Arg Asn Arg Asn Gly 355 360 365 Ala Leu Gly Ala Trp Ile Val Met Phe Met Gln Gln Phe Cys Gly Ile 370 375 380 Asn Val Ile Ala Tyr Tyr Ser Ser Ser Ile Phe Val Glu Ser Asn Leu 385 390 395 400 Ser Glu Ile Lys Ala Met Leu Ala Ser Trp Gly Phe Gly Met Ile Asn 405 410 415 Phe Leu Phe Ala Ile Pro Ala Phe Tyr Thr Ile Asp Thr Phe Gly Arg 420 425 430 Arg Asn Leu Leu Leu Thr Thr Phe Pro Leu Met Ala Val Phe Leu Leu 435 440 445 Met Ala Gly Phe Gly Phe Trp Ile Pro Phe Glu Thr Asn Pro His Gly 450 455 460 Arg Leu Ala Val Ile Thr Ile Gly Ile Tyr Leu Phe Ala Cys Val Tyr 465 470 475 480 Ser Ala Gly Glu Gly Pro Val Pro Phe Thr Tyr Ser Ala Glu Ala Phe 485 490 495 Pro Leu Tyr Ile Arg Asp Leu Gly Met Gly Phe Ala Thr Ala Thr Cys 500 505 510 Trp Phe Phe Asn Phe Ile Leu Ala Phe Ser Trp Pro Arg Met Lys Asn 515 520 525 Ala Phe Lys Pro Gln Gly Ala Phe Gly Trp Tyr Ala Ala Trp Asn Ile 530 535 540 Val Gly Phe Phe Leu Val Leu Trp Phe Leu Pro Glu Thr Lys Gly Leu 545 550 555 560 Thr Leu Glu Glu Leu Asp Glu Val Phe Asp Val Pro Leu Arg Lys His 565 570 575 Ala His Tyr Arg Thr Lys Glu Leu Val Tyr Asn Leu Arg Lys Tyr Phe 580 585 590 Leu Arg Gln Asn Pro Lys Pro Leu Pro Pro Leu Tyr Ala His Gln Arg 595 600 605 Met Ala Val Thr Asn Pro Glu Trp Leu Glu Lys Thr Glu Val Thr His 610 615 620 Glu Glu Asn Ile 625 <210> SEQ ID NO 45 <211> LENGTH: 548 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: ubiquitin-deficient H0 Metschnikowia species Hxt5p (with K7R; K10R, K29R; K43R and K58R mutations) <400> SEQUENCE: 45 Met Ser Ile Phe Glu Gly Arg Asp Gly Arg Gly Val Ser Ser Thr Glu 1 5 10 15 Ser Leu Ser Asn Asp Val Arg Tyr Asp Asn Met Glu Arg Val Asp Gln 20 25 30 Asp Val Leu Arg His Asn Phe Asn Phe Asp Arg Glu Phe Glu Glu Leu 35 40 45 Glu Ile Glu Ala Ala Gln Val Asn Asp Arg Pro Ser Phe Val Asp Arg 50 55 60 Ile Leu Ser Leu Glu Tyr Lys Leu His Phe Glu Asn Lys Asn His Met 65 70 75 80 Val Trp Leu Leu Gly Ala Phe Ala Ala Ala Ala Gly Leu Leu Ser Gly 85 90 95 Leu Asp Gln Ser Ile Ile Ser Gly Ala Ser Ile Gly Met Asn Lys Ala 100 105 110 Leu Asn Leu Thr Glu Arg Glu Ala Ser Leu Val Ser Ser Leu Met Pro 115 120 125 Leu Gly Ala Met Ala Gly Ser Met Ile Met Thr Pro Leu Asn Glu Trp 130 135 140 Phe Gly Arg Lys Ser Ser Leu Ile Ile Ser Cys Ile Trp Tyr Thr Ile 145 150 155 160 Gly Ser Ala Leu Cys Ala Gly Ala Arg Asp His His Met Met Tyr Ala 165 170 175 Gly Arg Phe Ile Leu Gly Val Gly Val Gly Ile Glu Gly Gly Cys Val 180 185 190 Gly Ile Tyr Ile Ser Glu Ser Val Pro Ala Asn Val Arg Gly Ser Ile 195 200 205 Val Ser Met Tyr Gln Phe Asn Ile Ala Leu Gly Glu Val Leu Gly Tyr 210 215 220 Ala Val Ala Ala Ile Phe Tyr Thr Val His Gly Gly Trp Arg Phe Met 225 230 235 240 Val Gly Ser Ser Leu Val Phe Ser Thr Ile Leu Phe Ala Gly Leu Phe 245 250 255 Phe Leu Pro Glu Ser Pro Arg Trp Leu Val His Lys Gly Arg Asn Gly 260 265 270 Met Ala Tyr Asp Val Trp Lys Arg Leu Arg Asp Ile Asn Asp Glu Ser 275 280 285 Ala Lys Leu Glu Phe Leu Glu Met Arg Gln Ala Ala Tyr Gln Glu Arg 290 295 300 Glu Arg Arg Ser Gln Glu Ser Leu Phe Ser Ser Trp Gly Glu Leu Phe 305 310 315 320 Thr Ile Ala Arg Asn Arg Arg Ala Leu Thr Tyr Ser Val Ile Met Ile 325 330 335 Thr Leu Gly Gln Leu Thr Gly Val Asn Ala Val Met Tyr Tyr Met Ser 340 345 350 Thr Leu Met Gly Ala Ile Gly Phe Asn Glu Lys Asp Ser Val Phe Met 355 360 365 Ser Leu Val Gly Gly Gly Ser Leu Leu Ile Gly Thr Ile Pro Ala Ile 370 375 380 Leu Trp Met Asp Arg Phe Gly Arg Arg Val Trp Gly Tyr Asn Leu Val 385 390 395 400 Gly Phe Phe Val Gly Leu Val Leu Val Gly Val Gly Tyr Arg Phe Asn 405 410 415 Pro Val Thr Gln Lys Ala Ala Ser Glu Gly Val Tyr Leu Thr Gly Leu 420 425 430 Ile Val Tyr Phe Leu Phe Phe Gly Ser Tyr Ser Thr Leu Thr Trp Val 435 440 445 Ile Pro Ser Glu Ser Phe Asp Leu Arg Thr Arg Ser Leu Gly Met Thr 450 455 460 Ile Cys Ser Thr Phe Leu Tyr Leu Trp Ser Phe Thr Val Thr Tyr Asn 465 470 475 480 Phe Thr Lys Met Ser Ala Ala Phe Thr Tyr Thr Gly Leu Thr Leu Gly 485 490 495 Phe Tyr Gly Gly Ile Ala Phe Leu Gly Leu Ile Tyr Gln Val Cys Phe 500 505 510 Met Pro Glu Thr Lys Asp Lys Thr Leu Glu Glu Ile Asp Asp Ile Phe 515 520 525 Asn Arg Ser Ala Phe Ser Ile Ala Arg Glu Asn Ile Ser Asn Leu Lys 530 535 540 Lys Gly Ile Trp 545 <210> SEQ ID NO 46 <211> LENGTH: 548 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: H0 Metschnikowia species Gxf2p/Gal2p (with K23R, K26R, K35R, K542R and K546R mutations) <400> SEQUENCE: 46 Met Ser Ala Glu Gln Glu Gln Gln Val Ser Gly Thr Ser Ala Thr Ile 1 5 10 15 Asp Gly Leu Ala Ser Leu Arg Gln Glu Arg Thr Ala Glu Glu Glu Asp 20 25 30 Ala Phe Arg Pro Lys Pro Ala Thr Ala Tyr Phe Phe Ile Ser Phe Leu 35 40 45 Cys Gly Leu Val Ala Phe Gly Gly Tyr Val Phe Gly Phe Asp Thr Gly 50 55 60 Thr Ile Ser Gly Phe Val Asn Met Asp Asp Tyr Leu Met Arg Phe Gly 65 70 75 80 Gln Gln His Ala Asp Gly Thr Tyr Tyr Leu Ser Asn Val Arg Thr Gly 85 90 95 Leu Ile Val Ser Ile Phe Asn Ile Gly Cys Ala Val Gly Gly Leu Ala 100 105 110 Leu Ser Lys Val Gly Asp Ile Trp Gly Arg Arg Ile Gly Ile Met Val 115 120 125 Ala Met Ile Ile Tyr Met Val Gly Ile Ile Ile Gln Ile Ala Ser Gln 130 135 140 Asp Lys Trp Tyr Gln Tyr Phe Ile Gly Arg Leu Ile Thr Gly Leu Gly 145 150 155 160 Val Gly Thr Thr Ser Val Leu Ser Pro Leu Phe Ile Ser Glu Ser Ala 165 170 175 Pro Lys His Leu Arg Gly Thr Leu Val Cys Cys Phe Gln Leu Met Val 180 185 190 Thr Leu Gly Ile Phe Leu Gly Tyr Cys Thr Thr Tyr Gly Thr Lys Asn 195 200 205 Tyr Thr Asp Ser Arg Gln Trp Arg Ile Pro Leu Gly Leu Cys Phe Ala 210 215 220 Trp Ala Leu Leu Leu Ile Ser Gly Met Val Phe Met Pro Glu Ser Pro 225 230 235 240 Arg Phe Leu Ile Glu Arg Gln Arg Phe Asp Glu Ala Lys Ala Ser Val 245 250 255 Ala Lys Ser Asn Gln Val Ser Thr Glu Asp Pro Ala Val Tyr Thr Glu 260 265 270 Val Glu Leu Ile Gln Ala Gly Ile Asp Arg Glu Ala Leu Ala Gly Ser 275 280 285 Ala Gly Trp Lys Glu Leu Ile Thr Gly Lys Pro Lys Met Leu Gln Arg 290 295 300 Val Ile Leu Gly Met Met Leu Gln Ser Ile Gln Gln Leu Thr Gly Asn 305 310 315 320 Asn Tyr Phe Phe Tyr Tyr Gly Thr Thr Ile Phe Lys Ala Val Gly Met 325 330 335 Ser Asp Ser Phe Gln Thr Ser Ile Val Leu Gly Ile Val Asn Phe Ala 340 345 350 Ser Thr Phe Val Gly Ile Trp Ala Ile Glu Arg Met Gly Arg Arg Ser 355 360 365 Cys Leu Leu Val Gly Ser Ala Cys Met Ser Val Cys Phe Leu Ile Tyr 370 375 380 Ser Ile Leu Gly Ser Val Asn Leu Tyr Ile Asp Gly Tyr Glu Asn Thr 385 390 395 400 Pro Ser Asn Thr Arg Lys Pro Thr Gly Asn Ala Met Ile Phe Ile Thr 405 410 415 Cys Leu Phe Ile Phe Phe Phe Ala Ser Thr Trp Ala Gly Gly Val Tyr 420 425 430 Ser Ile Val Ser Glu Thr Tyr Pro Leu Arg Ile Arg Ser Lys Gly Met 435 440 445 Ala Val Ala Thr Ala Ala Asn Trp Met Trp Gly Phe Leu Ile Ser Phe 450 455 460 Phe Thr Pro Phe Ile Thr Ser Ala Ile His Phe Tyr Tyr Gly Phe Val 465 470 475 480 Phe Thr Gly Cys Leu Ile Phe Ser Phe Phe Tyr Val Phe Phe Phe Val 485 490 495 Arg Glu Thr Lys Gly Leu Ser Leu Glu Glu Val Asp Glu Leu Tyr Ala 500 505 510 Thr Asp Leu Pro Pro Trp Lys Thr Ala Gly Trp Thr Pro Pro Ser Ala 515 520 525 Glu Asp Met Ala His Thr Thr Gly Phe Ala Glu Ala Ala Arg Pro Thr 530 535 540 Asn Arg His Val 545 <210> SEQ ID NO 47 <211> LENGTH: 544 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: ubiquitin-deficient H0 Metschnikowia species Gxf1p (with K9R and K24R mutations) <400> SEQUENCE: 47 Met Ser Gln Asp Glu Leu His Thr Arg Ser Gly Val Glu Thr Pro Ile 1 5 10 15 Asn Asp Ser Leu Leu Glu Glu Arg His Asp Val Thr Pro Leu Ala Ala 20 25 30 Leu Pro Glu Lys Ser Phe Lys Asp Tyr Ile Ser Ile Ser Ile Phe Cys 35 40 45 Leu Phe Val Ala Phe Gly Gly Phe Val Phe Gly Phe Asp Thr Gly Thr 50 55 60 Ile Ser Gly Phe Val Asn Met Ser Asp Phe Lys Thr Arg Phe Gly Glu 65 70 75 80 Met Asn Ala Gln Gly Glu Tyr Tyr Leu Ser Asn Val Arg Thr Gly Leu 85 90 95 Met Val Ser Ile Phe Asn Val Gly Cys Ala Val Gly Gly Ile Phe Leu 100 105 110 Cys Lys Ile Ala Asp Val Tyr Gly Arg Arg Ile Gly Leu Met Phe Ser 115 120 125 Met Val Val Tyr Val Val Gly Ile Ile Ile Gln Ile Ala Ser Thr Thr 130 135 140 Lys Trp Tyr Gln Tyr Phe Ile Gly Arg Leu Ile Ala Gly Leu Ala Val 145 150 155 160 Gly Thr Val Ser Val Ile Ser Pro Leu Phe Ile Ser Glu Val Ala Pro 165 170 175 Lys Gln Leu Arg Gly Thr Leu Val Cys Cys Phe Gln Leu Cys Ile Thr 180 185 190 Leu Gly Ile Phe Leu Gly Tyr Cys Thr Thr Tyr Gly Thr Lys Thr Tyr 195 200 205 Thr Asp Ser Arg Gln Trp Arg Ile Pro Leu Gly Ile Cys Phe Ala Trp 210 215 220 Ala Leu Phe Leu Val Ala Gly Met Leu Asn Met Pro Glu Ser Pro Arg 225 230 235 240 Tyr Leu Val Glu Lys Ser Arg Ile Asp Asp Ala Arg Lys Ser Ile Ala 245 250 255 Arg Ser Asn Lys Val Ser Glu Glu Asp Pro Ala Val Tyr Thr Glu Val 260 265 270 Gln Leu Ile Gln Ala Gly Ile Asp Arg Glu Ala Leu Ala Gly Ser Ala 275 280 285 Thr Trp Met Glu Leu Val Thr Gly Lys Pro Lys Ile Phe Arg Arg Val 290 295 300 Ile Met Gly Val Met Leu Gln Ser Leu Gln Gln Leu Thr Gly Asp Asn 305 310 315 320 Tyr Phe Phe Tyr Tyr Gly Thr Thr Ile Phe Lys Ala Val Gly Leu Gln 325 330 335 Asp Ser Phe Gln Thr Ser Ile Ile Leu Gly Ile Val Asn Phe Ala Ser 340 345 350 Thr Phe Val Gly Ile Tyr Ala Ile Glu Arg Met Gly Arg Arg Leu Cys 355 360 365 Leu Leu Thr Gly Ser Ala Cys Met Phe Val Cys Phe Ile Ile Tyr Ser 370 375 380 Leu Ile Gly Thr Gln His Leu Tyr Lys Asn Gly Phe Ser Asn Glu Pro 385 390 395 400 Ser Asn Thr Tyr Lys Pro Ser Gly Asn Ala Met Ile Phe Ile Thr Cys 405 410 415 Leu Tyr Ile Phe Phe Phe Ala Ser Thr Trp Ala Gly Gly Val Tyr Cys 420 425 430 Ile Val Ser Glu Ser Tyr Pro Leu Arg Ile Arg Ser Lys Ala Met Ser 435 440 445 Val Ala Thr Ala Ala Asn Trp Met Trp Gly Phe Leu Ile Ser Phe Phe 450 455 460 Thr Pro Phe Ile Thr Ser Ala Ile His Phe Tyr Tyr Gly Phe Val Phe 465 470 475 480 Thr Gly Cys Leu Ala Phe Ser Phe Phe Tyr Val Tyr Phe Phe Val Val 485 490 495 Glu Thr Lys Gly Leu Ser Leu Glu Glu Val Asp Ile Leu Tyr Ala Ser 500 505 510 Gly Thr Leu Pro Trp Lys Ser Ser Gly Trp Val Pro Pro Thr Ala Asp 515 520 525 Glu Met Ala His Asn Ala Phe Asp Asn Lys Pro Thr Asp Glu Gln Val 530 535 540 <210> SEQ ID NO 48 <211> LENGTH: 543 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: ubiquitin-deficient H0 Metschnikowia species Xyt1p (with K6R and S75L mutations) <400> SEQUENCE: 48 Met Gly Tyr Glu Glu Arg Leu Val Ala Pro Ala Leu Lys Phe Lys Asn 1 5 10 15 Phe Leu Asp Lys Thr Pro Asn Ile His Asn Val Tyr Val Ile Ala Ala 20 25 30 Ile Ser Cys Thr Ser Gly Met Met Phe Gly Phe Asp Ile Ser Ser Met 35 40 45 Ser Val Phe Val Asp Gln Gln Pro Tyr Leu Lys Met Phe Asp Asn Pro 50 55 60 Ser Ser Val Ile Gln Gly Phe Ile Thr Ala Leu Met Ser Leu Gly Ser 65 70 75 80 Phe Phe Gly Ser Leu Thr Ser Thr Phe Ile Ser Glu Pro Phe Gly Arg 85 90 95 Arg Ala Ser Leu Phe Ile Cys Gly Ile Leu Trp Val Ile Gly Ala Ala 100 105 110 Val Gln Ser Ser Ser Gln Asn Arg Ala Gln Leu Ile Cys Gly Arg Ile 115 120 125 Ile Ala Gly Trp Gly Ile Gly Phe Gly Ser Ser Val Ala Pro Val Tyr 130 135 140 Gly Ser Glu Met Ala Pro Arg Lys Ile Arg Gly Thr Ile Gly Gly Ile 145 150 155 160 Phe Gln Phe Ser Val Thr Val Gly Ile Phe Ile Met Phe Leu Ile Gly 165 170 175 Tyr Gly Cys Ser Phe Ile Gln Gly Lys Ala Ser Phe Arg Ile Pro Trp 180 185 190 Gly Val Gln Met Val Pro Gly Leu Ile Leu Leu Ile Gly Leu Phe Phe 195 200 205 Ile Pro Glu Ser Pro Arg Trp Leu Ala Lys Gln Gly Tyr Trp Glu Asp 210 215 220 Ala Glu Ile Ile Val Ala Asn Val Gln Ala Lys Gly Asn Arg Asn Asp 225 230 235 240 Ala Asn Val Gln Ile Glu Met Ser Glu Ile Lys Asp Gln Leu Met Leu 245 250 255 Asp Glu His Leu Lys Glu Phe Thr Tyr Ala Asp Leu Phe Thr Lys Lys 260 265 270 Tyr Arg Gln Arg Thr Ile Thr Ala Ile Phe Ala Gln Ile Trp Gln Gln 275 280 285 Leu Thr Gly Met Asn Val Met Met Tyr Tyr Ile Val Tyr Ile Phe Gln 290 295 300 Met Ala Gly Tyr Ser Gly Asn Thr Asn Leu Val Pro Ser Leu Ile Gln 305 310 315 320 Tyr Ile Ile Asn Met Ala Val Thr Val Pro Ala Leu Phe Cys Leu Asp 325 330 335 Leu Leu Gly Arg Arg Thr Ile Leu Leu Ala Gly Ala Ala Phe Met Met 340 345 350 Ala Trp Gln Phe Gly Val Ala Gly Ile Leu Ala Thr Tyr Ser Glu Pro 355 360 365 Ala Tyr Ile Ser Asp Thr Val Arg Ile Thr Ile Pro Asp Asp His Lys 370 375 380 Ser Ala Ala Lys Gly Val Ile Ala Cys Cys Tyr Leu Phe Val Cys Ser 385 390 395 400 Phe Ala Phe Ser Trp Gly Val Gly Ile Trp Val Tyr Cys Ser Glu Val 405 410 415 Trp Gly Asp Ser Gln Ser Arg Gln Arg Gly Ala Ala Leu Ala Thr Ser 420 425 430 Ala Asn Trp Ile Phe Asn Phe Ala Ile Ala Met Phe Thr Pro Ser Ser 435 440 445 Phe Lys Asn Ile Thr Trp Lys Thr Tyr Ile Ile Tyr Ala Thr Phe Cys 450 455 460 Ala Cys Met Phe Ile His Val Phe Phe Phe Phe Pro Glu Thr Lys Gly 465 470 475 480 Lys Arg Leu Glu Glu Ile Gly Gln Leu Trp Asp Glu Gly Val Pro Ala 485 490 495 Trp Arg Ser Ala Lys Trp Gln Pro Thr Val Pro Leu Ala Ser Asp Ala 500 505 510 Glu Leu Ala His Lys Met Asp Val Ala His Ala Glu His Ala Asp Leu 515 520 525 Leu Ala Thr His Ser Pro Ser Ser Asp Glu Lys Thr Gly Thr Val 530 535 540 <210> SEQ ID NO 49 <211> LENGTH: 1887 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: ubiquitin-deficient H0 Metschnikowia species APS1/HGT19 (with K4R; K20R; K30R and K93R mutations) <400> SEQUENCE: 49 atgtctgaaa gaccagttgt ttctcactct atcgacacca cctcttctac ctcttctaga 60 caagtctacg acggtaactc tttgttgagg acctctaacg aaagagacgg tgaaagaggt 120 aacatcttgt ctcaatacac tgaagaacaa gcaatgcaaa tgggtagaaa ctacgctttg 180 aagcacaact tggacgctac cttgttcggt aaggctgctg ctgtcgctag aaacccatac 240 gagttcaact ctatgtcttt cttgaccgaa gaagaaagag tcgctttgaa caccgaacaa 300 accaagaagt ggcacatccc aagaaagttg gttgaagtta ttgctttggg ttctatggct 360 gctgctgttc aaggtatgga cgaatctgtt gttaacggtg ctaccttgtt ctacccaacc 420 gctatgggta tcaccgacat caagaacgct gacttgattg aaggtttgat taacggtgcc 480 ccatacttgt gttgtgctat tatgtgttgg acctctgact actggaacag aaagttgggt 540 agaaagtgga ccattttctg gacctgtgct atttctgcta tcacctgtat ctggcaaggt 600 ttggtcaact tgaagtggta tcacttgttc attgctagat tctgtttggg tttcggtatc 660 ggtgtcaagt ctgctaccgt tccagcctac gctgctgaaa ccaccccagc caagattaga 720 ggttctttgg ttatgttgtg gcaattcttc accgctgtcg gtattatgtt gggttacgtt 780 gcttctttgg ctttctacta cattggtgac aacggtattt ctggtggttt gaactggaga 840 ttgatgttgg gttctgcttg tttgccagcc atcgttgttt tggtccaagt tccattcgtt 900 ccagaatctc caagatggtt gatgggtaag gaaagacacg ctgaagccta cgactctttg 960 agacaattga gattctctga aatcgaagcc gctagagact gtttctacca atacgttttg 1020 ttgaaggaag aaggttctta cggtactcaa ccattcttct ctagaatcaa ggaaatgttc 1080 accgttagaa gaaacagaaa cggtgctttg ggtgcttgga ttgttatgtt tatgcaacaa 1140 ttctgtggta tcaacgtcat tgcttactac tcttcttcta tcttcgttga atctaacttg 1200 tctgaaatca aggctatgtt ggcttcttgg ggtttcggta tgattaactt cttgttcgct 1260 attccagcct tctacaccat tgacaccttc ggtagaagaa acttgttgtt gactactttc 1320 ccattgatgg ctgttttctt gttgatggct ggtttcggtt tctggattcc attcgaaacc 1380 aacccacacg gtagattggc tgttatcact attggtatct acttgttcgc ttgtgtctac 1440 tctgctggtg aaggtccagt tccattcacc tactctgctg aagccttccc attgtacatc 1500 agagacttgg gtatgggttt cgctaccgct acctgttggt tcttcaactt cattttggct 1560 ttctcttggc caagaatgaa gaacgctttc aagcctcaag gtgctttcgg ttggtacgct 1620 gcttggaaca ttgttggttt cttcttggtt ttgtggttct tgccagaaac taagggtttg 1680 actttggaag aattggacga agttttcgac gttccattga gaaagcacgc tcactacaga 1740 actaaggaat tggtttacaa cttgagaaag tacttcttga gacaaaaccc aaagccattg 1800 ccaccattgt acgctcacca aagaatggct gttaccaacc cagaatggtt ggaaaagacc 1860 gaagtcaccc acgaagaaaa catctaa 1887 <210> SEQ ID NO 50 <211> LENGTH: 1647 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: ubiquitin-deficient H0 Metschnikowia species HXT5 (with K7R; K10R, K29R; K43R and K58R mutations) <400> SEQUENCE: 50 atgtccattt tcgaaggtag ggatggtaga ggtgtttcct ctactgaatc cttgtctaac 60 gatgttagat acgacaacat ggaaagagtt gaccaagatg ttttgaggca caatttcaac 120 ttcgacagag agttcgaaga attggaaatt gaagctgccc aagttaacga tagaccatct 180 ttcgttgata ggatcttgtc tttggagtac aagttgcact tcgaaaacaa gaatcacatg 240 gtttggttgt tgggtgcttt tgctgctgct gcaggtttgt tgtctggttt ggatcaatct 300 attatttccg gtgcctctat cggtatgaac aaggctttga atttgaccga aagagaagcc 360 tctttggtca gttctttgat gccattgggt gctatggctg gttctatgat tatgactcca 420 ttgaatgaat ggttcggccg taaatcctcc ttgattattt cttgtatttg gtacaccatc 480 ggttctgctt tgtgtgctgg tgctagagat catcacatga tgtatgctgg tagattcatc 540 ttaggtgttg gtgttggtat tgaaggtggt tgcgttggta tctacatttc tgaatctgtt 600 ccagccaatg tcagaggttc tatcgtttct atgtaccagt tcaacattgc cttgggtgaa 660 gttttgggtt atgctgttgc tgctattttc tacactgttc atggtggttg gaggtttatg 720 gttggttctt ctttggtttt ctccaccatt ttgtttgccg gcttgttttt tttgccagaa 780 tctccaagat ggttggtcca taagggtaga aatggtatgg cttacgatgt ttggaagaga 840 ttgagagata tcaacgatga atccgccaag ttggaattct tggaaatgag acaagctgcc 900 taccaagaaa gagaaagaag atctcaagag tccttgtttt cttcatgggg tgagttgttt 960 accattgcta gaaatagaag ggctttgacc tactccgtta ttatgattac tttgggtcag 1020 ttgactggtg ttaacgctgt tatgtattac atgtctactt tgatgggtgc catcggtttt 1080 aacgaaaagg attctgtttt catgtccttg gttggtggtg gttctttgtt gattggtact 1140 attccagcta tcttgtggat ggatagattc ggtagaagag tttggggtta caatttggtt 1200 ggttttttcg tcggtttggt attggtcggt gttggttata gattcaaccc agttactcaa 1260 aaggctgctt ctgaaggtgt ttatttgact ggtttgatcg tctacttctt gttcttcggt 1320 tcttactcta cattgacctg ggttattcca tccgaatctt tcgatttgag aaccagatct 1380 ttgggtatga ccatttgctc tactttcttg tacttgtggt ctttcactgt cacttacaac 1440 ttcactaaga tgtctgctgc tttcacttac acaggtttga ctttgggttt ttacggtggt 1500 attgctttct tgggtttgat ctaccaagtt tgctttatgc cagaaactaa ggacaagacc 1560 ttggaagaaa tcgatgacat ctttaacaga tccgctttct ctattgccag ggaaaacatt 1620 agcaacttga agaaaggtat ctggtaa 1647 <210> SEQ ID NO 51 <211> LENGTH: 1647 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: ubiquitin-deficient H0 Metschnikowia species GXF2/GAL2 (with K23R, K26R, K35R, K542R and K546R mutations) <400> SEQUENCE: 51 atgtccgctg aacaagaaca acaagtttct ggtacttctg ccactattga tggtttggct 60 tctttgaggc aagaaaggac tgctgaagaa gaagatgctt ttaggccaaa accagctact 120 gcctacttct tcatttcttt cttgtgtggt ttggttgctt tcggtggtta cgtttttggt 180 tttgataccg gtactatctc cggtttcgtt aacatggatg attacttgat gagattcggt 240 caacaacatg ctgatggtac ttactacttg tccaatgtta gaaccggttt gatcgtcagt 300 attttcaaca ttggttgtgc tgttggtggt ttggcattgt ctaaagttgg tgatatttgg 360 ggtagaagaa tcggtattat ggttgccatg atcatctaca tggttggtat cattattcaa 420 atcgcctccc aagacaagtg gtatcaatac tttattggta gattgatcac cggtttgggt 480 gttggtacta cttctgtttt gtctcctttg ttcatttccg aatccgctcc aaaacatttg 540 agaggtactt tggtttgctg cttccaattg atggtaacct tgggtatttt cttgggttac 600 tgtactactt acggtactaa gaactacacc gattctagac aatggagaat tccattgggt 660 ttgtgttttg cttgggcctt gttgttgatt tctggtatgg tttttatgcc agaatcccca 720 agattcttga tcgaaagaca aagattcgat gaagctaagg cttctgttgc caagtctaat 780 caagtttcta ctgaagatcc agccgtttac actgaagttg aattgattca agccggtatt 840 gatagagaag ctttggctgg ttctgctggt tggaaagaat tgattactgg taagccaaag 900 atgttgcaaa gagtcatttt gggtatgatg ttacaatcca tccaacaatt gaccggtaac 960 aattacttct tctactacgg tacaaccatc ttcaaagctg ttggtatgtc cgattctttt 1020 caaacctcta tagtcttggg tatcgttaac ttcgcttcta cctttgttgg tatttgggcc 1080 attgaaagaa tgggtagaag atcttgtttg ttggttggtt cagcttgtat gtctgtttgc 1140 ttcttgatct actctatctt gggttcagtc aacttgtaca tcgatggtta cgaaaacact 1200 ccatctaaca ctagaaagcc aactggtaac gccatgattt tcattacctg tttgttcatc 1260 tttttcttcg cctctacttg ggctggtggt gtttattcta tagtttctga aacctaccca 1320 ttgagaatca gatctaaagg tatggctgtt gctactgctg ctaattggat gtggggtttt 1380 ttgatctctt tctttacccc attcatcacc tccgctattc atttttacta cggttttgtt 1440 ttcaccggtt gcttgatctt ctcattcttt tacgtattct ttttcgtccg tgaaactaag 1500 ggtttgtcct tggaagaagt tgacgaatta tacgctactg atttgccacc atggaaaact 1560 gcaggttgga ctccaccatc agctgaagat atggctcata caactggttt tgctgaagct 1620 gctaggccta caaacagaca cgtttga 1647 <210> SEQ ID NO 52 <211> LENGTH: 1635 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: ubiquitin-deficient H0 Metschnikowia species GXF1 (with K9R and K24R mutations) <400> SEQUENCE: 52 atgtctcaag atgaattgca caccagatct ggtgttgaaa ctccaatcaa cgactccttg 60 ttggaagaaa gacatgatgt tactccattg gctgctttgc cagaaaaatc tttcaaggac 120 tacatctcca tctccatttt ctgtttgttt gttgctttcg gtggtttcgt tttcggtttt 180 gatactggta ctatttccgg tttcgttaac atgtctgatt tcaagactag gttcggtgaa 240 atgaatgctc agggtgaata ttacttgtcc aacgttagaa ctggcctgat ggtttctatt 300 ttcaatgttg gttgtgctgt cggtggtatt ttcttgtgta aaattgctga tgtctacggt 360 agaaggatcg gtttgatgtt ttctatggtt gtctacgttg tcggtatcat tattcaaatt 420 gcttctacca ccaagtggta tcagtacttc attggtagat tgattgctgg tttggctgtt 480 ggtactgttt ctgttatttc ccctttgttc atttccgaag ttgctccaaa acaattgaga 540 ggtactttgg tttgctgttt ccaattgtgt attaccttgg gtatcttctt gggttactgt 600 actacttacg gtactaagac ttacaccgat tctagacaat ggcgtattcc attgggtatt 660 tgttttgctt gggctttgtt tttggttgcc ggtatgttga atatgccaga atctccaaga 720 tacttggtcg aaaagtccag aattgatgat gccagaaagt ccattgctag gtctaacaaa 780 gtttccgaag aagatccagc tgtttacacc gaagttcaat tgattcaagc cggtattgat 840 agagaagctt tggctggttc tgctacttgg atggaattgg ttactggtaa gcctaagatc 900 tttagaagag ttatcatggg tgtcatgttg caatccttgc aacaattgac tggtgacaac 960 tactttttct actacggtac aaccattttc aaggctgtcg gtttacaaga ttctttccaa 1020 acctccatca ttttgggtat cgttaacttc gcttctacct tcgttggtat ctacgctatt 1080 gaaagaatgg gtagaagatt gtgtttgttg acaggttctg cttgtatgtt cgtttgcttc 1140 atcatctact cattgatcgg tactcagcac ttgtacaaaa acggtttttc taacgaaccc 1200 tccaacactt acaaaccatc tggtaatgcc atgatcttca ttacctgcct gtacattttc 1260 tttttcgctt caacttgggc tggtggtgtt tactgtatag tttctgaatc ttacccactg 1320 aggatcagat ctaaagctat gtctgttgct actgctgcaa attggatgtg gggttttttg 1380 atttctttct ttaccccatt catcacctcc gctatccatt tttactatgg ttttgttttc 1440 accggttgct tggctttctc tttcttttac gtttacttct tcgtcgtcga gactaagggt 1500 ttgtctttgg aagaggttga tatcttgtat gcctctggta ctttgccatg gaaatcttca 1560 ggttgggttc caccaactgc tgacgaaatg gctcataatg cttttgataa caaaccaacc 1620 gatgaacagg tttaa 1635 <210> SEQ ID NO 53 <211> LENGTH: 1632 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: ubiquitin-deficient H0 Metschnikowia species XYT1 (with K6R and S75L mutations) <400> SEQUENCE: 53 atgggatacg aagagagatt agtggccccc gctttgaaat ttaagaactt tttggataag 60 accccaaata tacataacgt ttacgtaatt gcggcgatct cgtgtacctc aggtatgatg 120 ttcggtttcg atatatcgtc gatgtccgtg ttcgtggacc aacagccgta tttaaaaatg 180 tttgataacc ctagcagcgt gatacaaggg tttataactg cgttgatgtc tttggggagc 240 tttttcggat cgctaacgtc cacttttatt tcagaacctt ttggtagacg tgcctctttg 300 ttcatatgcg ggatcctttg ggtaattggg gcggcagttc aaagttcttc tcagaaccgt 360 gcgcagctta tttgtggccg aattattgca gggtggggca tcggattcgg ttctagcgtt 420 gcgccggtat acggttcaga aatggcccca cgcaaaatta gaggaacaat cggaggtatt 480 tttcaatttt ctgtcacggt cggaatattc ataatgttcc tgattggcta cggctgctca 540 tttatacaag gcaaggccag ttttagaatt ccgtggggag ttcaaatggt accaggtctc 600 attctgttga tcggactatt cttcattcct gaatccccaa gatggttagc caaacaaggc 660 tactgggaag acgctgagat catcgtagca aacgttcaag ctaagggtaa caggaacgat 720 gctaatgtgc aaattgaaat gtccgagata aaagatcagt taatgcttga cgagcattta 780 aaggagttta cttatgccga tttgtttacc aaaaaatacc ggcaaaggac gataacagct 840 atatttgccc aaatatggca acagctgaca ggtatgaatg tcatgatgta ctacatcgta 900 tatatatttc aaatggcagg ttattcaggt aatactaatt tagttccttc actcattcag 960 tatattataa atatggctgt tacggtcccc gcattgttct gtcttgatct gcttggcagg 1020 aggacaattt tattagctgg cgccgctttt atgatggcct ggcaatttgg tgttgctggc 1080 attttagcta cttattcaga gccagcctat atttcagata ccgtgagaat tacaattcca 1140 gatgaccata aaagtgccgc taagggtgtc atcgcttgct gctatttgtt tgtttgttcc 1200 ttcgcctttt cctggggtgt aggtatctgg gtttattgtt cagaagtgtg gggtgatagt 1260 caatccagac aaagaggtgc tgcattggca acttctgcta attggatctt caatttcgca 1320 attgcaatgt ttacaccttc ttctttcaaa aatatcactt ggaagactta tatcatttat 1380 gctacatttt gtgcttgtat gttcattcat gttttttttt ttttccctga aacaaagggt 1440 aagagactag aagaaattgg acagctatgg gatgaaggtg tcccagcatg gagatctgca 1500 aaatggcaac ccactgtccc actagcaagt gacgctgaat tagctcacaa aatggatgtt 1560 gcacacgctg aacacgcaga cttattggca acccattctc caagtagtga cgaaaaaact 1620 ggtaccgttt aa 1632 <210> SEQ ID NO 54 <211> LENGTH: 544 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: ubiquitin-deficient H0 Metschnikowia species Gxf1p (with K9R; K24R, K538R mutations) <400> SEQUENCE: 54 Met Ser Gln Asp Glu Leu His Thr Arg Ser Gly Val Glu Thr Pro Ile 1 5 10 15 Asn Asp Ser Leu Leu Glu Glu Arg His Asp Val Thr Pro Leu Ala Ala 20 25 30 Leu Pro Glu Lys Ser Phe Lys Asp Tyr Ile Ser Ile Ser Ile Phe Cys 35 40 45 Leu Phe Val Ala Phe Gly Gly Phe Val Phe Gly Phe Asp Thr Gly Thr 50 55 60 Ile Ser Gly Phe Val Asn Met Ser Asp Phe Lys Thr Arg Phe Gly Glu 65 70 75 80 Met Asn Ala Gln Gly Glu Tyr Tyr Leu Ser Asn Val Arg Thr Gly Leu 85 90 95 Met Val Ser Ile Phe Asn Val Gly Cys Ala Val Gly Gly Ile Phe Leu 100 105 110 Cys Lys Ile Ala Asp Val Tyr Gly Arg Arg Ile Gly Leu Met Phe Ser 115 120 125 Met Val Val Tyr Val Val Gly Ile Ile Ile Gln Ile Ala Ser Thr Thr 130 135 140 Lys Trp Tyr Gln Tyr Phe Ile Gly Arg Leu Ile Ala Gly Leu Ala Val 145 150 155 160 Gly Thr Val Ser Val Ile Ser Pro Leu Phe Ile Ser Glu Val Ala Pro 165 170 175 Lys Gln Leu Arg Gly Thr Leu Val Cys Cys Phe Gln Leu Cys Ile Thr 180 185 190 Leu Gly Ile Phe Leu Gly Tyr Cys Thr Thr Tyr Gly Thr Lys Thr Tyr 195 200 205 Thr Asp Ser Arg Gln Trp Arg Ile Pro Leu Gly Ile Cys Phe Ala Trp 210 215 220 Ala Leu Phe Leu Val Ala Gly Met Leu Asn Met Pro Glu Ser Pro Arg 225 230 235 240 Tyr Leu Val Glu Lys Ser Arg Ile Asp Asp Ala Arg Lys Ser Ile Ala 245 250 255 Arg Ser Asn Lys Val Ser Glu Glu Asp Pro Ala Val Tyr Thr Glu Val 260 265 270 Gln Leu Ile Gln Ala Gly Ile Asp Arg Glu Ala Leu Ala Gly Ser Ala 275 280 285 Thr Trp Met Glu Leu Val Thr Gly Lys Pro Lys Ile Phe Arg Arg Val 290 295 300 Ile Met Gly Val Met Leu Gln Ser Leu Gln Gln Leu Thr Gly Asp Asn 305 310 315 320 Tyr Phe Phe Tyr Tyr Gly Thr Thr Ile Phe Lys Ala Val Gly Leu Gln 325 330 335 Asp Ser Phe Gln Thr Ser Ile Ile Leu Gly Ile Val Asn Phe Ala Ser 340 345 350 Thr Phe Val Gly Ile Tyr Ala Ile Glu Arg Met Gly Arg Arg Leu Cys 355 360 365 Leu Leu Thr Gly Ser Ala Cys Met Phe Val Cys Phe Ile Ile Tyr Ser 370 375 380 Leu Ile Gly Thr Gln His Leu Tyr Lys Asn Gly Phe Ser Asn Glu Pro 385 390 395 400 Ser Asn Thr Tyr Lys Pro Ser Gly Asn Ala Met Ile Phe Ile Thr Cys 405 410 415 Leu Tyr Ile Phe Phe Phe Ala Ser Thr Trp Ala Gly Gly Val Tyr Cys 420 425 430 Ile Val Ser Glu Ser Tyr Pro Leu Arg Ile Arg Ser Lys Ala Met Ser 435 440 445 Val Ala Thr Ala Ala Asn Trp Met Trp Gly Phe Leu Ile Ser Phe Phe 450 455 460 Thr Pro Phe Ile Thr Ser Ala Ile His Phe Tyr Tyr Gly Phe Val Phe 465 470 475 480 Thr Gly Cys Leu Ala Phe Ser Phe Phe Tyr Val Tyr Phe Phe Val Val 485 490 495 Glu Thr Lys Gly Leu Ser Leu Glu Glu Val Asp Ile Leu Tyr Ala Ser 500 505 510 Gly Thr Leu Pro Trp Lys Ser Ser Gly Trp Val Pro Pro Thr Ala Asp 515 520 525 Glu Met Ala His Asn Ala Phe Asp Asn Arg Pro Thr Asp Glu Gln Val 530 535 540 <210> SEQ ID NO 55 <211> LENGTH: 543 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: ubiquitin-deficient H0 Metschnikowia species Xyt1p (with K6R, S75L, K517R, K539R mutations) <400> SEQUENCE: 55 Met Gly Tyr Glu Glu Arg Leu Val Ala Pro Ala Leu Lys Phe Lys Asn 1 5 10 15 Phe Leu Asp Lys Thr Pro Asn Ile His Asn Val Tyr Val Ile Ala Ala 20 25 30 Ile Ser Cys Thr Ser Gly Met Met Phe Gly Phe Asp Ile Ser Ser Met 35 40 45 Ser Val Phe Val Asp Gln Gln Pro Tyr Leu Lys Met Phe Asp Asn Pro 50 55 60 Ser Ser Val Ile Gln Gly Phe Ile Thr Ala Leu Met Ser Leu Gly Ser 65 70 75 80 Phe Phe Gly Ser Leu Thr Ser Thr Phe Ile Ser Glu Pro Phe Gly Arg 85 90 95 Arg Ala Ser Leu Phe Ile Cys Gly Ile Leu Trp Val Ile Gly Ala Ala 100 105 110 Val Gln Ser Ser Ser Gln Asn Arg Ala Gln Leu Ile Cys Gly Arg Ile 115 120 125 Ile Ala Gly Trp Gly Ile Gly Phe Gly Ser Ser Val Ala Pro Val Tyr 130 135 140 Gly Ser Glu Met Ala Pro Arg Lys Ile Arg Gly Thr Ile Gly Gly Ile 145 150 155 160 Phe Gln Phe Ser Val Thr Val Gly Ile Phe Ile Met Phe Leu Ile Gly 165 170 175 Tyr Gly Cys Ser Phe Ile Gln Gly Lys Ala Ser Phe Arg Ile Pro Trp 180 185 190 Gly Val Gln Met Val Pro Gly Leu Ile Leu Leu Ile Gly Leu Phe Phe 195 200 205 Ile Pro Glu Ser Pro Arg Trp Leu Ala Lys Gln Gly Tyr Trp Glu Asp 210 215 220 Ala Glu Ile Ile Val Ala Asn Val Gln Ala Lys Gly Asn Arg Asn Asp 225 230 235 240 Ala Asn Val Gln Ile Glu Met Ser Glu Ile Lys Asp Gln Leu Met Leu 245 250 255 Asp Glu His Leu Lys Glu Phe Thr Tyr Ala Asp Leu Phe Thr Lys Lys 260 265 270 Tyr Arg Gln Arg Thr Ile Thr Ala Ile Phe Ala Gln Ile Trp Gln Gln 275 280 285 Leu Thr Gly Met Asn Val Met Met Tyr Tyr Ile Val Tyr Ile Phe Gln 290 295 300 Met Ala Gly Tyr Ser Gly Asn Thr Asn Leu Val Pro Ser Leu Ile Gln 305 310 315 320 Tyr Ile Ile Asn Met Ala Val Thr Val Pro Ala Leu Phe Cys Leu Asp 325 330 335 Leu Leu Gly Arg Arg Thr Ile Leu Leu Ala Gly Ala Ala Phe Met Met 340 345 350 Ala Trp Gln Phe Gly Val Ala Gly Ile Leu Ala Thr Tyr Ser Glu Pro 355 360 365 Ala Tyr Ile Ser Asp Thr Val Arg Ile Thr Ile Pro Asp Asp His Lys 370 375 380 Ser Ala Ala Lys Gly Val Ile Ala Cys Cys Tyr Leu Phe Val Cys Ser 385 390 395 400 Phe Ala Phe Ser Trp Gly Val Gly Ile Trp Val Tyr Cys Ser Glu Val 405 410 415 Trp Gly Asp Ser Gln Ser Arg Gln Arg Gly Ala Ala Leu Ala Thr Ser 420 425 430 Ala Asn Trp Ile Phe Asn Phe Ala Ile Ala Met Phe Thr Pro Ser Ser 435 440 445 Phe Lys Asn Ile Thr Trp Lys Thr Tyr Ile Ile Tyr Ala Thr Phe Cys 450 455 460 Ala Cys Met Phe Ile His Val Phe Phe Phe Phe Pro Glu Thr Lys Gly 465 470 475 480 Lys Arg Leu Glu Glu Ile Gly Gln Leu Trp Asp Glu Gly Val Pro Ala 485 490 495 Trp Arg Ser Ala Lys Trp Gln Pro Thr Val Pro Leu Ala Ser Asp Ala 500 505 510 Glu Leu Ala His Arg Met Asp Val Ala His Ala Glu His Ala Asp Leu 515 520 525 Leu Ala Thr His Ser Pro Ser Ser Asp Glu Arg Thr Gly Thr Val 530 535 540 <210> SEQ ID NO 56 <211> LENGTH: 1635 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: ubiquitin-deficient H0 Metschnikowia species GXF1 (with K9R; K24R, K538R mutations) <400> SEQUENCE: 56 atgtctcaag atgaattgca caccagatct ggtgttgaaa ctccaatcaa cgactccttg 60 ttggaagaaa gacatgatgt tactccattg gctgctttgc cagaaaaatc tttcaaggac 120 tacatctcca tctccatttt ctgtttgttt gttgctttcg gtggtttcgt tttcggtttt 180 gatactggta ctatttccgg tttcgttaac atgtctgatt tcaagactag gttcggtgaa 240 atgaatgctc agggtgaata ttacttgtcc aacgttagaa ctggcctgat ggtttctatt 300 ttcaatgttg gttgtgctgt cggtggtatt ttcttgtgta aaattgctga tgtctacggt 360 agaaggatcg gtttgatgtt ttctatggtt gtctacgttg tcggtatcat tattcaaatt 420 gcttctacca ccaagtggta tcagtacttc attggtagat tgattgctgg tttggctgtt 480 ggtactgttt ctgttatttc ccctttgttc atttccgaag ttgctccaaa acaattgaga 540 ggtactttgg tttgctgttt ccaattgtgt attaccttgg gtatcttctt gggttactgt 600 actacttacg gtactaagac ttacaccgat tctagacaat ggcgtattcc attgggtatt 660 tgttttgctt gggctttgtt tttggttgcc ggtatgttga atatgccaga atctccaaga 720 tacttggtcg aaaagtccag aattgatgat gccagaaagt ccattgctag gtctaacaaa 780 gtttccgaag aagatccagc tgtttacacc gaagttcaat tgattcaagc cggtattgat 840 agagaagctt tggctggttc tgctacttgg atggaattgg ttactggtaa gcctaagatc 900 tttagaagag ttatcatggg tgtcatgttg caatccttgc aacaattgac tggtgacaac 960 tactttttct actacggtac aaccattttc aaggctgtcg gtttacaaga ttctttccaa 1020 acctccatca ttttgggtat cgttaacttc gcttctacct tcgttggtat ctacgctatt 1080 gaaagaatgg gtagaagatt gtgtttgttg acaggttctg cttgtatgtt cgtttgcttc 1140 atcatctact cattgatcgg tactcagcac ttgtacaaaa acggtttttc taacgaaccc 1200 tccaacactt acaaaccatc tggtaatgcc atgatcttca ttacctgcct gtacattttc 1260 tttttcgctt caacttgggc tggtggtgtt tactgtatag tttctgaatc ttacccactg 1320 aggatcagat ctaaagctat gtctgttgct actgctgcaa attggatgtg gggttttttg 1380 atttctttct ttaccccatt catcacctcc gctatccatt tttactatgg ttttgttttc 1440 accggttgct tggctttctc tttcttttac gtttacttct tcgtcgtcga gactaagggt 1500 ttgtctttgg aagaggttga tatcttgtat gcctctggta ctttgccatg gaaatcttca 1560 ggttgggttc caccaactgc tgacgaaatg gctcataatg cttttgataa cagaccaacc 1620 gatgaacagg tttaa 1635 <210> SEQ ID NO 57 <211> LENGTH: 1632 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: ubiquitin-deficient H0 Metschnikowia species XYT1 (with K6R, S75L, K517R, K539R mutations) <400> SEQUENCE: 57 atgggatacg aagagagatt agtggccccc gctttgaaat ttaagaactt tttggataag 60 accccaaata tacataacgt ttacgtaatt gcggcgatct cgtgtacctc aggtatgatg 120 ttcggtttcg atatatcgtc gatgtccgtg ttcgtggacc aacagccgta tttaaaaatg 180 tttgataacc ctagcagcgt gatacaaggg tttataactg cgttgatgtc tttggggagc 240 tttttcggat cgctaacgtc cacttttatt tcagaacctt ttggtagacg tgcctctttg 300 ttcatatgcg ggatcctttg ggtaattggg gcggcagttc aaagttcttc tcagaaccgt 360 gcgcagctta tttgtggccg aattattgca gggtggggca tcggattcgg ttctagcgtt 420 gcgccggtat acggttcaga aatggcccca cgcaaaatta gaggaacaat cggaggtatt 480 tttcaatttt ctgtcacggt cggaatattc ataatgttcc tgattggcta cggctgctca 540 tttatacaag gcaaggccag ttttagaatt ccgtggggag ttcaaatggt accaggtctc 600 attctgttga tcggactatt cttcattcct gaatccccaa gatggttagc caaacaaggc 660 tactgggaag acgctgagat catcgtagca aacgttcaag ctaagggtaa caggaacgat 720 gctaatgtgc aaattgaaat gtccgagata aaagatcagt taatgcttga cgagcattta 780 aaggagttta cttatgccga tttgtttacc aaaaaatacc ggcaaaggac gataacagct 840 atatttgccc aaatatggca acagctgaca ggtatgaatg tcatgatgta ctacatcgta 900 tatatatttc aaatggcagg ttattcaggt aatactaatt tagttccttc actcattcag 960 tatattataa atatggctgt tacggtcccc gcattgttct gtcttgatct gcttggcagg 1020 aggacaattt tattagctgg cgccgctttt atgatggcct ggcaatttgg tgttgctggc 1080 attttagcta cttattcaga gccagcctat atttcagata ccgtgagaat tacaattcca 1140 gatgaccata aaagtgccgc taagggtgtc atcgcttgct gctatttgtt tgtttgttcc 1200 ttcgcctttt cctggggtgt aggtatctgg gtttattgtt cagaagtgtg gggtgatagt 1260 caatccagac aaagaggtgc tgcattggca acttctgcta attggatctt caatttcgca 1320 attgcaatgt ttacaccttc ttctttcaaa aatatcactt ggaagactta tatcatttat 1380 gctacatttt gtgcttgtat gttcattcat gttttttttt ttttccctga aacaaagggt 1440 aagagactag aagaaattgg acagctatgg gatgaaggtg tcccagcatg gagatctgca 1500 aaatggcaac ccactgtccc actagcaagt gacgctgaat tagctcacag aatggatgtt 1560 gcacacgctg aacacgcaga cttattggca acccattctc caagtagtga cgaaagaact 1620 ggtaccgttt aa 1632 <210> SEQ ID NO 58 <211> LENGTH: 548 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: ubiquitin-deficient H0 Metschnikowia species Gxf2p/Gal2p (with K23R, K26R, and K35R, mutations) <400> SEQUENCE: 58 Met Ser Ala Glu Gln Glu Gln Gln Val Ser Gly Thr Ser Ala Thr Ile 1 5 10 15 Asp Gly Leu Ala Ser Leu Arg Gln Glu Arg Thr Ala Glu Glu Glu Asp 20 25 30 Ala Phe Arg Pro Lys Pro Ala Thr Ala Tyr Phe Phe Ile Ser Phe Leu 35 40 45 Cys Gly Leu Val Ala Phe Gly Gly Tyr Val Phe Gly Phe Asp Thr Gly 50 55 60 Thr Ile Ser Gly Phe Val Asn Met Asp Asp Tyr Leu Met Arg Phe Gly 65 70 75 80 Gln Gln His Ala Asp Gly Thr Tyr Tyr Leu Ser Asn Val Arg Thr Gly 85 90 95 Leu Ile Val Ser Ile Phe Asn Ile Gly Cys Ala Val Gly Gly Leu Ala 100 105 110 Leu Ser Lys Val Gly Asp Ile Trp Gly Arg Arg Ile Gly Ile Met Val 115 120 125 Ala Met Ile Ile Tyr Met Val Gly Ile Ile Ile Gln Ile Ala Ser Gln 130 135 140 Asp Lys Trp Tyr Gln Tyr Phe Ile Gly Arg Leu Ile Thr Gly Leu Gly 145 150 155 160 Val Gly Thr Thr Ser Val Leu Ser Pro Leu Phe Ile Ser Glu Ser Ala 165 170 175 Pro Lys His Leu Arg Gly Thr Leu Val Cys Cys Phe Gln Leu Met Val 180 185 190 Thr Leu Gly Ile Phe Leu Gly Tyr Cys Thr Thr Tyr Gly Thr Lys Asn 195 200 205 Tyr Thr Asp Ser Arg Gln Trp Arg Ile Pro Leu Gly Leu Cys Phe Ala 210 215 220 Trp Ala Leu Leu Leu Ile Ser Gly Met Val Phe Met Pro Glu Ser Pro 225 230 235 240 Arg Phe Leu Ile Glu Arg Gln Arg Phe Asp Glu Ala Lys Ala Ser Val 245 250 255 Ala Lys Ser Asn Gln Val Ser Thr Glu Asp Pro Ala Val Tyr Thr Glu 260 265 270 Val Glu Leu Ile Gln Ala Gly Ile Asp Arg Glu Ala Leu Ala Gly Ser 275 280 285 Ala Gly Trp Lys Glu Leu Ile Thr Gly Lys Pro Lys Met Leu Gln Arg 290 295 300 Val Ile Leu Gly Met Met Leu Gln Ser Ile Gln Gln Leu Thr Gly Asn 305 310 315 320 Asn Tyr Phe Phe Tyr Tyr Gly Thr Thr Ile Phe Lys Ala Val Gly Met 325 330 335 Ser Asp Ser Phe Gln Thr Ser Ile Val Leu Gly Ile Val Asn Phe Ala 340 345 350 Ser Thr Phe Val Gly Ile Trp Ala Ile Glu Arg Met Gly Arg Arg Ser 355 360 365 Cys Leu Leu Val Gly Ser Ala Cys Met Ser Val Cys Phe Leu Ile Tyr 370 375 380 Ser Ile Leu Gly Ser Val Asn Leu Tyr Ile Asp Gly Tyr Glu Asn Thr 385 390 395 400 Pro Ser Asn Thr Arg Lys Pro Thr Gly Asn Ala Met Ile Phe Ile Thr 405 410 415 Cys Leu Phe Ile Phe Phe Phe Ala Ser Thr Trp Ala Gly Gly Val Tyr 420 425 430 Ser Ile Val Ser Glu Thr Tyr Pro Leu Arg Ile Arg Ser Lys Gly Met 435 440 445 Ala Val Ala Thr Ala Ala Asn Trp Met Trp Gly Phe Leu Ile Ser Phe 450 455 460 Phe Thr Pro Phe Ile Thr Ser Ala Ile His Phe Tyr Tyr Gly Phe Val 465 470 475 480 Phe Thr Gly Cys Leu Ile Phe Ser Phe Phe Tyr Val Phe Phe Phe Val 485 490 495 Arg Glu Thr Lys Gly Leu Ser Leu Glu Glu Val Asp Glu Leu Tyr Ala 500 505 510 Thr Asp Leu Pro Pro Trp Lys Thr Ala Gly Trp Thr Pro Pro Ser Ala 515 520 525 Glu Asp Met Ala His Thr Thr Gly Phe Ala Glu Ala Ala Lys Pro Thr 530 535 540 Asn Lys His Val 545 <210> SEQ ID NO 59 <211> LENGTH: 1647 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: ubiquitin-deficient H0 Metschnikowia species Gxf2p/Gal2p (with K23R, K26R, and K35R, mutations) <400> SEQUENCE: 59 atgtccgctg aacaagaaca acaagtttct ggtacttctg ccactattga tggtttggct 60 tctttgaggc aagaaaggac tgctgaagaa gaagatgctt ttaggccaaa accagctact 120 gcctacttct tcatttcttt cttgtgtggt ttggttgctt tcggtggtta cgtttttggt 180 tttgataccg gtactatctc cggtttcgtt aacatggatg attacttgat gagattcggt 240 caacaacatg ctgatggtac ttactacttg tccaatgtta gaaccggttt gatcgtcagt 300 attttcaaca ttggttgtgc tgttggtggt ttggcattgt ctaaagttgg tgatatttgg 360 ggtagaagaa tcggtattat ggttgccatg atcatctaca tggttggtat cattattcaa 420 atcgcctccc aagacaagtg gtatcaatac tttattggta gattgatcac cggtttgggt 480 gttggtacta cttctgtttt gtctcctttg ttcatttccg aatccgctcc aaaacatttg 540 agaggtactt tggtttgctg cttccaattg atggtaacct tgggtatttt cttgggttac 600 tgtactactt acggtactaa gaactacacc gattctagac aatggagaat tccattgggt 660 ttgtgttttg cttgggcctt gttgttgatt tctggtatgg tttttatgcc agaatcccca 720 agattcttga tcgaaagaca aagattcgat gaagctaagg cttctgttgc caagtctaat 780 caagtttcta ctgaagatcc agccgtttac actgaagttg aattgattca agccggtatt 840 gatagagaag ctttggctgg ttctgctggt tggaaagaat tgattactgg taagccaaag 900 atgttgcaaa gagtcatttt gggtatgatg ttacaatcca tccaacaatt gaccggtaac 960 aattacttct tctactacgg tacaaccatc ttcaaagctg ttggtatgtc cgattctttt 1020 caaacctcta tagtcttggg tatcgttaac ttcgcttcta cctttgttgg tatttgggcc 1080 attgaaagaa tgggtagaag atcttgtttg ttggttggtt cagcttgtat gtctgtttgc 1140 ttcttgatct actctatctt gggttcagtc aacttgtaca tcgatggtta cgaaaacact 1200 ccatctaaca ctagaaagcc aactggtaac gccatgattt tcattacctg tttgttcatc 1260 tttttcttcg cctctacttg ggctggtggt gtttattcta tagtttctga aacctaccca 1320 ttgagaatca gatctaaagg tatggctgtt gctactgctg ctaattggat gtggggtttt 1380 ttgatctctt tctttacccc attcatcacc tccgctattc atttttacta cggttttgtt 1440 ttcaccggtt gcttgatctt ctcattcttt tacgtattct ttttcgtccg tgaaactaag 1500 ggtttgtcct tggaagaagt tgacgaatta tacgctactg atttgccacc atggaaaact 1560 gcaggttgga ctccaccatc agctgaagat atggctcata caactggttt tgctgaagct 1620 gctaagccta caaacaaaca cgtttga 1647

1 SEQUENCE LISTING <160> NUMBER OF SEQ ID NOS: 59 <210> SEQ ID NO 1 <211> LENGTH: 543 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species Xyt1p <400> SEQUENCE: 1 Met Gly Tyr Glu Glu Lys Leu Val Ala Pro Ala Leu Lys Phe Lys Asn 1 5 10 15 Phe Leu Asp Lys Thr Pro Asn Ile His Asn Val Tyr Val Ile Ala Ala 20 25 30 Ile Ser Cys Thr Ser Gly Met Met Phe Gly Phe Asp Ile Ser Ser Met 35 40 45 Ser Val Phe Val Asp Gln Gln Pro Tyr Leu Lys Met Phe Asp Asn Pro 50 55 60 Ser Ser Val Ile Gln Gly Phe Ile Thr Ala Ser Met Ser Leu Gly Ser 65 70 75 80 Phe Phe Gly Ser Leu Thr Ser Thr Phe Ile Ser Glu Pro Phe Gly Arg 85 90 95 Arg Ala Ser Leu Phe Ile Cys Gly Ile Leu Trp Val Ile Gly Ala Ala 100 105 110 Val Gln Ser Ser Ser Gln Asn Arg Ala Gln Leu Ile Cys Gly Arg Ile 115 120 125 Ile Ala Gly Trp Gly Ile Gly Phe Gly Ser Ser Val Ala Pro Val Tyr 130 135 140 Gly Ser Glu Met Ala Pro Arg Lys Ile Arg Gly Thr Ile Gly Gly Ile 145 150 155 160 Phe Gln Phe Ser Val Thr Val Gly Ile Phe Ile Met Phe Leu Ile Gly 165 170 175 Tyr Gly Cys Ser Phe Ile Gln Gly Lys Ala Ser Phe Arg Ile Pro Trp 180 185 190 Gly Val Gln Met Val Pro Gly Leu Ile Leu Leu Ile Gly Leu Phe Phe 195 200 205 Ile Pro Glu Ser Pro Arg Trp Leu Ala Lys Gln Gly Tyr Trp Glu Asp 210 215 220 Ala Glu Ile Ile Val Ala Asn Val Gln Ala Lys Gly Asn Arg Asn Asp 225 230 235 240 Ala Asn Val Gln Ile Glu Met Ser Glu Ile Lys Asp Gln Leu Met Leu 245 250 255 Asp Glu His Leu Lys Glu Phe Thr Tyr Ala Asp Leu Phe Thr Lys Lys 260 265 270 Tyr Arg Gln Arg Thr Ile Thr Ala Ile Phe Ala Gln Ile Trp Gln Gln 275 280 285 Leu Thr Gly Met Asn Val Met Met Tyr Tyr Ile Val Tyr Ile Phe Gln 290 295 300 Met Ala Gly Tyr Ser Gly Asn Thr Asn Leu Val Pro Ser Leu Ile Gln 305 310 315 320 Tyr Ile Ile Asn Met Ala Val Thr Val Pro Ala Leu Phe Cys Leu Asp 325 330 335 Leu Leu Gly Arg Arg Thr Ile Leu Leu Ala Gly Ala Ala Phe Met Met 340 345 350 Ala Trp Gln Phe Gly Val Ala Gly Ile Leu Ala Thr Tyr Ser Glu Pro 355 360 365 Ala Tyr Ile Ser Asp Thr Val Arg Ile Thr Ile Pro Asp Asp His Lys 370 375 380 Ser Ala Ala Lys Gly Val Ile Ala Cys Cys Tyr Leu Phe Val Cys Ser 385 390 395 400 Phe Ala Phe Ser Trp Gly Val Gly Ile Trp Val Tyr Cys Ser Glu Val 405 410 415 Trp Gly Asp Ser Gln Ser Arg Gln Arg Gly Ala Ala Leu Ala Thr Ser 420 425 430 Ala Asn Trp Ile Phe Asn Phe Ala Ile Ala Met Phe Thr Pro Ser Ser 435 440 445 Phe Lys Asn Ile Thr Trp Lys Thr Tyr Ile Ile Tyr Ala Thr Phe Cys 450 455 460 Ala Cys Met Phe Ile His Val Phe Phe Phe Phe Pro Glu Thr Lys Gly 465 470 475 480 Lys Arg Leu Glu Glu Ile Gly Gln Leu Trp Asp Glu Gly Val Pro Ala 485 490 495 Trp Arg Ser Ala Lys Trp Gln Pro Thr Val Pro Leu Ala Ser Asp Ala 500 505 510 Glu Leu Ala His Lys Met Asp Val Ala His Ala Glu His Ala Asp Leu 515 520 525 Leu Ala Thr His Ser Pro Ser Ser Asp Glu Lys Thr Gly Thr Val 530 535 540 <210> SEQ ID NO 2 <211> LENGTH: 524 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species Gxf1p <400> SEQUENCE: 2 Met Ser Gln Asp Glu Leu His Thr Lys Ser Gly Val Glu Thr Pro Ile 1 5 10 15 Asn Asp Ser Leu Leu Glu Glu Lys His Asp Val Thr Pro Leu Ala Ala 20 25 30 Leu Pro Glu Lys Ser Phe Lys Asp Tyr Ile Ser Ile Ser Ile Phe Cys 35 40 45 Leu Phe Val Ala Phe Gly Gly Phe Val Phe Gly Phe Asp Thr Gly Thr 50 55 60 Ile Ser Gly Phe Val Asn Met Ser Asp Phe Lys Thr Arg Phe Gly Glu 65 70 75 80 Met Asn Ala Gln Gly Glu Tyr Tyr Leu Ser Asn Val Arg Thr Gly Leu 85 90 95 Met Val Ser Ile Phe Asn Val Gly Cys Ala Val Gly Gly Ile Phe Leu 100 105 110 Cys Lys Ile Ala Asp Val Tyr Gly Arg Arg Ile Gly Leu Met Phe Ser 115 120 125 Met Val Val Tyr Val Val Gly Ile Ile Ile Gln Ile Ala Ser Thr Thr 130 135 140 Lys Trp Tyr Gln Tyr Phe Ile Gly Arg Leu Ile Ala Gly Leu Ala Val 145 150 155 160 Gly Thr Val Ser Val Ile Ser Pro Leu Phe Ile Ser Glu Val Ala Pro 165 170 175 Lys Gln Leu Arg Gly Thr Leu Val Cys Cys Phe Gln Leu Cys Ile Thr 180 185 190 Leu Gly Ile Phe Leu Gly Tyr Cys Thr Thr Tyr Gly Thr Lys Thr Tyr 195 200 205 Thr Asp Ser Arg Gln Trp Arg Ile Pro Leu Gly Ile Cys Phe Ala Trp 210 215 220 Ala Leu Phe Leu Val Ala Gly Met Leu Asn Met Pro Glu Ser Pro Arg 225 230 235 240 Tyr Leu Val Glu Lys Ser Arg Ile Asp Asp Ala Arg Lys Ser Ile Ala 245 250 255 Arg Ser Asn Lys Val Ser Glu Glu Asp Pro Ala Val Tyr Thr Glu Val 260 265 270 Gln Leu Ile Gln Ala Gly Ile Asp Arg Glu Ala Leu Ala Gly Ser Ala 275 280 285 Thr Trp Met Glu Leu Val Thr Gly Lys Pro Lys Ile Phe Arg Arg Val 290 295 300 Ile Met Gly Val Met Leu Gln Ser Leu Gln Gln Leu Thr Gly Asp Asn 305 310 315 320 Tyr Phe Phe Tyr Tyr Gly Thr Thr Ile Phe Lys Ala Val Gly Leu Gln 325 330 335 Asp Ser Phe Gln Thr Ser Ile Ile Leu Gly Ile Val Asn Phe Ala Ser 340 345 350 Thr Phe Val Gly Ile Tyr Ala Ile Glu Arg Met Gly Arg Arg Leu Cys 355 360 365 Leu Leu Thr Gly Ser Ala Cys Met Phe Val Cys Phe Ile Ile Tyr Ser 370 375 380 Leu Ile Gly Thr Gln His Leu Tyr Lys Asn Gly Phe Ser Asn Glu Pro 385 390 395 400 Ser Asn Thr Tyr Lys Pro Ser Gly Asn Ala Met Ile Phe Ile Thr Cys 405 410 415 Leu Tyr Ile Phe Phe Phe Ala Ser Thr Trp Ala Gly Gly Val Tyr Cys 420 425 430 Ile Val Ser Glu Ser Tyr Pro Leu Arg Ile Arg Ser Lys Ala Met Ser 435 440 445 Val Ala Thr Ala Ala Asn Trp Met Trp Gly Phe Leu Ile Ser Phe Phe 450 455 460 Thr Pro Phe Ile Thr Ser Ala Ile His Phe Tyr Tyr Gly Phe Val Phe 465 470 475 480 Thr Gly Cys Leu Ala Phe Ser Phe Phe Tyr Val Tyr Phe Phe Val Val 485 490 495 Glu Thr Lys Gly Leu Ser Leu Glu Glu Val Asp Ile Leu Tyr Ala Ser 500 505 510 Gly Thr Leu Pro Trp Lys Ser Ser Gly Trp Val Pro 515 520 <210> SEQ ID NO 3 <211> LENGTH: 454 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species ?Gxf1p (variant of Gxf1p with shorter N-terminus) <400> SEQUENCE: 3 Met Ser Asp Phe Lys Thr Arg Phe Gly Glu Met Asn Ala Gln Gly Glu 1 5 10 15 Tyr Tyr Leu Ser Asn Val Arg Thr Gly Leu Met Val Ser Ile Phe Asn 20 25 30 Val Gly Cys Ala Val Gly Gly Ile Phe Leu Cys Lys Ile Ala Asp Val 35 40 45 Tyr Gly Arg Arg Ile Gly Leu Met Phe Ser Met Val Val Tyr Val Val 50 55 60

Gly Ile Ile Ile Gln Ile Ala Ser Thr Thr Lys Trp Tyr Gln Tyr Phe 65 70 75 80 Ile Gly Arg Leu Ile Ala Gly Leu Ala Val Gly Thr Val Ser Val Ile 85 90 95 Ser Pro Leu Phe Ile Ser Glu Val Ala Pro Lys Gln Leu Arg Gly Thr 100 105 110 Leu Val Cys Cys Phe Gln Leu Cys Ile Thr Leu Gly Ile Phe Leu Gly 115 120 125 Tyr Cys Thr Thr Tyr Gly Thr Lys Thr Tyr Thr Asp Ser Arg Gln Trp 130 135 140 Arg Ile Pro Leu Gly Ile Cys Phe Ala Trp Ala Leu Phe Leu Val Ala 145 150 155 160 Gly Met Leu Asn Met Pro Glu Ser Pro Arg Tyr Leu Val Glu Lys Ser 165 170 175 Arg Ile Asp Asp Ala Arg Lys Ser Ile Ala Arg Ser Asn Lys Val Ser 180 185 190 Glu Glu Asp Pro Ala Val Tyr Thr Glu Val Gln Leu Ile Gln Ala Gly 195 200 205 Ile Asp Arg Glu Ala Leu Ala Gly Ser Ala Thr Trp Met Glu Leu Val 210 215 220 Thr Gly Lys Pro Lys Ile Phe Arg Arg Val Ile Met Gly Val Met Leu 225 230 235 240 Gln Ser Leu Gln Gln Leu Thr Gly Asp Asn Tyr Phe Phe Tyr Tyr Gly 245 250 255 Thr Thr Ile Phe Lys Ala Val Gly Leu Gln Asp Ser Phe Gln Thr Ser 260 265 270 Ile Ile Leu Gly Ile Val Asn Phe Ala Ser Thr Phe Val Gly Ile Tyr 275 280 285 Ala Ile Glu Arg Met Gly Arg Arg Leu Cys Leu Leu Thr Gly Ser Ala 290 295 300 Cys Met Phe Val Cys Phe Ile Ile Tyr Ser Leu Ile Gly Thr Gln His 305 310 315 320 Leu Tyr Lys Asn Gly Phe Ser Asn Glu Pro Ser Asn Thr Tyr Lys Pro 325 330 335 Ser Gly Asn Ala Met Ile Phe Ile Thr Cys Leu Tyr Ile Phe Phe Phe 340 345 350 Ala Ser Thr Trp Ala Gly Gly Val Tyr Cys Ile Val Ser Glu Ser Tyr 355 360 365 Pro Leu Arg Ile Arg Ser Lys Ala Met Ser Val Ala Thr Ala Ala Asn 370 375 380 Trp Met Trp Gly Phe Leu Ile Ser Phe Phe Thr Pro Phe Ile Thr Ser 385 390 395 400 Ala Ile His Phe Tyr Tyr Gly Phe Val Phe Thr Gly Cys Leu Ala Phe 405 410 415 Ser Phe Phe Tyr Val Tyr Phe Phe Val Val Glu Thr Lys Gly Leu Ser 420 425 430 Leu Glu Glu Val Asp Ile Leu Tyr Ala Ser Gly Thr Leu Pro Trp Lys 435 440 445 Ser Ser Gly Trp Val Pro 450 <210> SEQ ID NO 4 <211> LENGTH: 548 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species Gxf2p/Gal2p <400> SEQUENCE: 4 Met Ser Ala Glu Gln Glu Gln Gln Val Ser Gly Thr Ser Ala Thr Ile 1 5 10 15 Asp Gly Leu Ala Ser Leu Lys Gln Glu Lys Thr Ala Glu Glu Glu Asp 20 25 30 Ala Phe Lys Pro Lys Pro Ala Thr Ala Tyr Phe Phe Ile Ser Phe Leu 35 40 45 Cys Gly Leu Val Ala Phe Gly Gly Tyr Val Phe Gly Phe Asp Thr Gly 50 55 60 Thr Ile Ser Gly Phe Val Asn Met Asp Asp Tyr Leu Met Arg Phe Gly 65 70 75 80 Gln Gln His Ala Asp Gly Thr Tyr Tyr Leu Ser Asn Val Arg Thr Gly 85 90 95 Leu Ile Val Ser Ile Phe Asn Ile Gly Cys Ala Val Gly Gly Leu Ala 100 105 110 Leu Ser Lys Val Gly Asp Ile Trp Gly Arg Arg Ile Gly Ile Met Val 115 120 125 Ala Met Ile Ile Tyr Met Val Gly Ile Ile Ile Gln Ile Ala Ser Gln 130 135 140 Asp Lys Trp Tyr Gln Tyr Phe Ile Gly Arg Leu Ile Thr Gly Leu Gly 145 150 155 160 Val Gly Thr Thr Ser Val Leu Ser Pro Leu Phe Ile Ser Glu Ser Ala 165 170 175 Pro Lys His Leu Arg Gly Thr Leu Val Cys Cys Phe Gln Leu Met Val 180 185 190 Thr Leu Gly Ile Phe Leu Gly Tyr Cys Thr Thr Tyr Gly Thr Lys Asn 195 200 205 Tyr Thr Asp Ser Arg Gln Trp Arg Ile Pro Leu Gly Leu Cys Phe Ala 210 215 220 Trp Ala Leu Leu Leu Ile Ser Gly Met Val Phe Met Pro Glu Ser Pro 225 230 235 240 Arg Phe Leu Ile Glu Arg Gln Arg Phe Asp Glu Ala Lys Ala Ser Val 245 250 255 Ala Lys Ser Asn Gln Val Ser Thr Glu Asp Pro Ala Val Tyr Thr Glu 260 265 270 Val Glu Leu Ile Gln Ala Gly Ile Asp Arg Glu Ala Leu Ala Gly Ser 275 280 285 Ala Gly Trp Lys Glu Leu Ile Thr Gly Lys Pro Lys Met Leu Gln Arg 290 295 300 Val Ile Leu Gly Met Met Leu Gln Ser Ile Gln Gln Leu Thr Gly Asn 305 310 315 320 Asn Tyr Phe Phe Tyr Tyr Gly Thr Thr Ile Phe Lys Ala Val Gly Met 325 330 335 Ser Asp Ser Phe Gln Thr Ser Ile Val Leu Gly Ile Val Asn Phe Ala 340 345 350 Ser Thr Phe Val Gly Ile Trp Ala Ile Glu Arg Met Gly Arg Arg Ser 355 360 365 Cys Leu Leu Val Gly Ser Ala Cys Met Ser Val Cys Phe Leu Ile Tyr 370 375 380 Ser Ile Leu Gly Ser Val Asn Leu Tyr Ile Asp Gly Tyr Glu Asn Thr 385 390 395 400 Pro Ser Asn Thr Arg Lys Pro Thr Gly Asn Ala Met Ile Phe Ile Thr 405 410 415 Cys Leu Phe Ile Phe Phe Phe Ala Ser Thr Trp Ala Gly Gly Val Tyr 420 425 430 Ser Ile Val Ser Glu Thr Tyr Pro Leu Arg Ile Arg Ser Lys Gly Met 435 440 445 Ala Val Ala Thr Ala Ala Asn Trp Met Trp Gly Phe Leu Ile Ser Phe 450 455 460 Phe Thr Pro Phe Ile Thr Ser Ala Ile His Phe Tyr Tyr Gly Phe Val 465 470 475 480 Phe Thr Gly Cys Leu Ile Phe Ser Phe Phe Tyr Val Phe Phe Phe Val 485 490 495 Arg Glu Thr Lys Gly Leu Ser Leu Glu Glu Val Asp Glu Leu Tyr Ala 500 505 510 Thr Asp Leu Pro Pro Trp Lys Thr Ala Gly Trp Thr Pro Pro Ser Ala 515 520 525 Glu Asp Met Ala His Thr Thr Gly Phe Ala Glu Ala Ala Lys Pro Thr 530 535 540 Asn Lys His Val 545 <210> SEQ ID NO 5 <211> LENGTH: 502 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species delta-Gxs1p/Delta-Hgt12p (variant of Gxs1p/Hgt12p with shorter N-terminus) <400> SEQUENCE: 5 Met Gly Ile Phe Val Gly Val Phe Ala Ala Leu Gly Gly Val Leu Phe 1 5 10 15 Gly Tyr Asp Thr Gly Thr Ile Ser Gly Val Met Ala Met Pro Trp Val 20 25 30 Lys Glu His Phe Pro Lys Asp Arg Val Ala Phe Ser Ala Ser Glu Ser 35 40 45 Ser Leu Ile Val Ser Ile Leu Ser Ala Gly Thr Phe Phe Gly Ala Ile 50 55 60 Leu Ala Pro Leu Leu Thr Asp Thr Leu Gly Arg Arg Trp Cys Ile Ile 65 70 75 80 Ile Ser Ser Leu Val Val Phe Asn Leu Gly Ala Ala Leu Gln Thr Ala 85 90 95 Ala Thr Asp Ile Pro Leu Leu Ile Val Gly Arg Val Ile Ala Gly Leu 100 105 110 Gly Val Gly Leu Ile Ser Ser Thr Ile Pro Leu Tyr Gln Ser Glu Ala 115 120 125 Leu Pro Lys Trp Ile Arg Gly Ala Val Val Ser Cys Tyr Gln Trp Ala 130 135 140 Ile Thr Ile Gly Ile Phe Leu Ala Ala Val Ile Asn Gln Gly Thr His 145 150 155 160 Lys Ile Asn Ser Pro Ala Ser Tyr Arg Ile Pro Leu Gly Ile Gln Met 165 170 175 Ala Trp Gly Leu Ile Leu Gly Val Gly Met Phe Phe Leu Pro Glu Thr 180 185 190 Pro Arg Phe Tyr Ile Ser Lys Gly Gln Asn Ala Lys Ala Ala Val Ser 195 200 205 Leu Ala Arg Leu Arg Lys Leu Pro Gln Asp His Pro Glu Leu Leu Glu 210 215 220 Glu Leu Glu Asp Ile Gln Ala Ala Tyr Glu Phe Glu Thr Val His Gly 225 230 235 240 Lys Ser Ser Trp Ser Gln Val Phe Thr Asn Lys Asn Lys Gln Leu Lys 245 250 255

Lys Leu Ala Thr Gly Val Cys Leu Gln Ala Phe Gln Gln Leu Thr Gly 260 265 270 Val Asn Phe Ile Phe Tyr Phe Gly Thr Thr Phe Phe Asn Ser Val Gly 275 280 285 Leu Asp Gly Phe Thr Thr Ser Leu Ala Thr Asn Ile Val Asn Val Gly 290 295 300 Ser Thr Ile Pro Gly Ile Leu Gly Val Glu Ile Phe Gly Arg Arg Lys 305 310 315 320 Val Leu Leu Thr Gly Ala Ala Gly Met Cys Leu Ser Gln Phe Ile Val 325 330 335 Ala Ile Val Gly Val Ala Thr Asp Ser Lys Ala Ala Asn Gln Val Leu 340 345 350 Ile Ala Phe Cys Cys Ile Phe Ile Ala Phe Phe Ala Ala Thr Trp Gly 355 360 365 Pro Thr Ala Trp Val Val Cys Gly Glu Ile Phe Pro Leu Arg Thr Arg 370 375 380 Ala Lys Ser Ile Ala Met Cys Ala Ala Ser Asn Trp Leu Leu Asn Trp 385 390 395 400 Ala Ile Ala Tyr Ala Thr Pro Tyr Leu Val Asp Ser Asp Lys Gly Asn 405 410 415 Leu Gly Thr Asn Val Phe Phe Ile Trp Gly Ser Cys Asn Phe Phe Cys 420 425 430 Leu Val Phe Ala Tyr Phe Met Ile Tyr Glu Thr Lys Gly Leu Ser Leu 435 440 445 Glu Gln Val Asp Glu Leu Tyr Glu Lys Val Ala Ser Ala Arg Lys Ser 450 455 460 Pro Gly Phe Val Pro Ser Glu His Ala Phe Arg Glu His Ala Asp Val 465 470 475 480 Glu Thr Ala Met Pro Asp Asn Phe Asn Leu Lys Ala Glu Ala Ile Ser 485 490 495 Val Glu Asp Ala Ser Val 500 <210> SEQ ID NO 6 <400> SEQUENCE: 6 000 <210> SEQ ID NO 7 <211> LENGTH: 526 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species Gxs1p/Hgt12 <400> SEQUENCE: 7 Met Gly Leu Glu Ser Asn Lys Leu Ile Arg Lys Tyr Ile Asn Val Gly 1 5 10 15 Glu Lys Arg Ala Gly Ser Ser Gly Met Gly Ile Phe Val Gly Val Phe 20 25 30 Ala Ala Leu Gly Gly Val Leu Phe Gly Tyr Asp Thr Gly Thr Ile Ser 35 40 45 Gly Val Met Ala Met Pro Trp Val Lys Glu His Phe Pro Lys Asp Arg 50 55 60 Val Ala Phe Ser Ala Ser Glu Ser Ser Leu Ile Val Ser Ile Leu Ser 65 70 75 80 Ala Gly Thr Phe Phe Gly Ala Ile Leu Ala Pro Leu Leu Thr Asp Thr 85 90 95 Leu Gly Arg Arg Trp Cys Ile Ile Ile Ser Ser Leu Val Val Phe Asn 100 105 110 Leu Gly Ala Ala Leu Gln Thr Ala Ala Thr Asp Ile Pro Leu Leu Ile 115 120 125 Val Gly Arg Val Ile Ala Gly Leu Gly Val Gly Leu Ile Ser Ser Thr 130 135 140 Ile Pro Leu Tyr Gln Ser Glu Ala Leu Pro Lys Trp Ile Arg Gly Ala 145 150 155 160 Val Val Ser Cys Tyr Gln Trp Ala Ile Thr Ile Gly Ile Phe Leu Ala 165 170 175 Ala Val Ile Asn Gln Gly Thr His Lys Ile Asn Ser Pro Ala Ser Tyr 180 185 190 Arg Ile Pro Leu Gly Ile Gln Met Ala Trp Gly Leu Ile Leu Gly Val 195 200 205 Gly Met Phe Phe Leu Pro Glu Thr Pro Arg Phe Tyr Ile Ser Lys Gly 210 215 220 Gln Asn Ala Lys Ala Ala Val Ser Leu Ala Arg Leu Arg Lys Leu Pro 225 230 235 240 Gln Asp His Pro Glu Leu Leu Glu Glu Leu Glu Asp Ile Gln Ala Ala 245 250 255 Tyr Glu Phe Glu Thr Val His Gly Lys Ser Ser Trp Ser Gln Val Phe 260 265 270 Thr Asn Lys Asn Lys Gln Leu Lys Lys Leu Ala Thr Gly Val Cys Leu 275 280 285 Gln Ala Phe Gln Gln Leu Thr Gly Val Asn Phe Ile Phe Tyr Phe Gly 290 295 300 Thr Thr Phe Phe Asn Ser Val Gly Leu Asp Gly Phe Thr Thr Ser Leu 305 310 315 320 Ala Thr Asn Ile Val Asn Val Gly Ser Thr Ile Pro Gly Ile Leu Gly 325 330 335 Val Glu Ile Phe Gly Arg Arg Lys Val Leu Leu Thr Gly Ala Ala Gly 340 345 350 Met Cys Leu Ser Gln Phe Ile Val Ala Ile Val Gly Val Ala Thr Asp 355 360 365 Ser Lys Ala Ala Asn Gln Val Leu Ile Ala Phe Cys Cys Ile Phe Ile 370 375 380 Ala Phe Phe Ala Ala Thr Trp Gly Pro Thr Ala Trp Val Val Cys Gly 385 390 395 400 Glu Ile Phe Pro Leu Arg Thr Arg Ala Lys Ser Ile Ala Met Cys Ala 405 410 415 Ala Ser Asn Trp Leu Leu Asn Trp Ala Ile Ala Tyr Ala Thr Pro Tyr 420 425 430 Leu Val Asp Ser Asp Lys Gly Asn Leu Gly Thr Asn Val Phe Phe Ile 435 440 445 Trp Gly Ser Cys Asn Phe Phe Cys Leu Val Phe Ala Tyr Phe Met Ile 450 455 460 Tyr Glu Thr Lys Gly Leu Ser Leu Glu Gln Val Asp Glu Leu Tyr Glu 465 470 475 480 Lys Val Ala Ser Ala Arg Lys Ser Pro Gly Phe Val Pro Ser Glu His 485 490 495 Ala Phe Arg Glu His Ala Asp Val Glu Thr Ala Met Pro Asp Asn Phe 500 505 510 Asn Leu Lys Ala Glu Ala Ile Ser Val Glu Asp Ala Ser Val 515 520 525 <210> SEQ ID NO 8 <211> LENGTH: 548 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species Hxt5p <400> SEQUENCE: 8 Met Ser Ile Phe Glu Gly Lys Asp Gly Lys Gly Val Ser Ser Thr Glu 1 5 10 15 Ser Leu Ser Asn Asp Val Arg Tyr Asp Asn Met Glu Lys Val Asp Gln 20 25 30 Asp Val Leu Arg His Asn Phe Asn Phe Asp Lys Glu Phe Glu Glu Leu 35 40 45 Glu Ile Glu Ala Ala Gln Val Asn Asp Lys Pro Ser Phe Val Asp Arg 50 55 60 Ile Leu Ser Leu Glu Tyr Lys Leu His Phe Glu Asn Lys Asn His Met 65 70 75 80 Val Trp Leu Leu Gly Ala Phe Ala Ala Ala Ala Gly Leu Leu Ser Gly 85 90 95 Leu Asp Gln Ser Ile Ile Ser Gly Ala Ser Ile Gly Met Asn Lys Ala 100 105 110 Leu Asn Leu Thr Glu Arg Glu Ala Ser Leu Val Ser Ser Leu Met Pro 115 120 125 Leu Gly Ala Met Ala Gly Ser Met Ile Met Thr Pro Leu Asn Glu Trp 130 135 140 Phe Gly Arg Lys Ser Ser Leu Ile Ile Ser Cys Ile Trp Tyr Thr Ile 145 150 155 160 Gly Ser Ala Leu Cys Ala Gly Ala Arg Asp His His Met Met Tyr Ala 165 170 175 Gly Arg Phe Ile Leu Gly Val Gly Val Gly Ile Glu Gly Gly Cys Val 180 185 190 Gly Ile Tyr Ile Ser Glu Ser Val Pro Ala Asn Val Arg Gly Ser Ile 195 200 205 Val Ser Met Tyr Gln Phe Asn Ile Ala Leu Gly Glu Val Leu Gly Tyr 210 215 220 Ala Val Ala Ala Ile Phe Tyr Thr Val His Gly Gly Trp Arg Phe Met 225 230 235 240 Val Gly Ser Ser Leu Val Phe Ser Thr Ile Leu Phe Ala Gly Leu Phe 245 250 255 Phe Leu Pro Glu Ser Pro Arg Trp Leu Val His Lys Gly Arg Asn Gly 260 265 270 Met Ala Tyr Asp Val Trp Lys Arg Leu Arg Asp Ile Asn Asp Glu Ser 275 280 285 Ala Lys Leu Glu Phe Leu Glu Met Arg Gln Ala Ala Tyr Gln Glu Arg 290 295 300 Glu Arg Arg Ser Gln Glu Ser Leu Phe Ser Ser Trp Gly Glu Leu Phe 305 310 315 320 Thr Ile Ala Arg Asn Arg Arg Ala Leu Thr Tyr Ser Val Ile Met Ile 325 330 335 Thr Leu Gly Gln Leu Thr Gly Val Asn Ala Val Met Tyr Tyr Met Ser 340 345 350 Thr Leu Met Gly Ala Ile Gly Phe Asn Glu Lys Asp Ser Val Phe Met 355 360 365 Ser Leu Val Gly Gly Gly Ser Leu Leu Ile Gly Thr Ile Pro Ala Ile 370 375 380 Leu Trp Met Asp Arg Phe Gly Arg Arg Val Trp Gly Tyr Asn Leu Val 385 390 395 400 Gly Phe Phe Val Gly Leu Val Leu Val Gly Val Gly Tyr Arg Phe Asn

405 410 415 Pro Val Thr Gln Lys Ala Ala Ser Glu Gly Val Tyr Leu Thr Gly Leu 420 425 430 Ile Val Tyr Phe Leu Phe Phe Gly Ser Tyr Ser Thr Leu Thr Trp Val 435 440 445 Ile Pro Ser Glu Ser Phe Asp Leu Arg Thr Arg Ser Leu Gly Met Thr 450 455 460 Ile Cys Ser Thr Phe Leu Tyr Leu Trp Ser Phe Thr Val Thr Tyr Asn 465 470 475 480 Phe Thr Lys Met Ser Ala Ala Phe Thr Tyr Thr Gly Leu Thr Leu Gly 485 490 495 Phe Tyr Gly Gly Ile Ala Phe Leu Gly Leu Ile Tyr Gln Val Cys Phe 500 505 510 Met Pro Glu Thr Lys Asp Lys Thr Leu Glu Glu Ile Asp Asp Ile Phe 515 520 525 Asn Arg Ser Ala Phe Ser Ile Ala Arg Glu Asn Ile Ser Asn Leu Lys 530 535 540 Lys Gly Ile Trp 545 <210> SEQ ID NO 9 <211> LENGTH: 543 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species Xyt1p with S75L mutation <400> SEQUENCE: 9 Met Gly Tyr Glu Glu Lys Leu Val Ala Pro Ala Leu Lys Phe Lys Asn 1 5 10 15 Phe Leu Asp Lys Thr Pro Asn Ile His Asn Val Tyr Val Ile Ala Ala 20 25 30 Ile Ser Cys Thr Ser Gly Met Met Phe Gly Phe Asp Ile Ser Ser Met 35 40 45 Ser Val Phe Val Asp Gln Gln Pro Tyr Leu Lys Met Phe Asp Asn Pro 50 55 60 Ser Ser Val Ile Gln Gly Phe Ile Thr Ala Leu Met Ser Leu Gly Ser 65 70 75 80 Phe Phe Gly Ser Leu Thr Ser Thr Phe Ile Ser Glu Pro Phe Gly Arg 85 90 95 Arg Ala Ser Leu Phe Ile Cys Gly Ile Leu Trp Val Ile Gly Ala Ala 100 105 110 Val Gln Ser Ser Ser Gln Asn Arg Ala Gln Leu Ile Cys Gly Arg Ile 115 120 125 Ile Ala Gly Trp Gly Ile Gly Phe Gly Ser Ser Val Ala Pro Val Tyr 130 135 140 Gly Ser Glu Met Ala Pro Arg Lys Ile Arg Gly Thr Ile Gly Gly Ile 145 150 155 160 Phe Gln Phe Ser Val Thr Val Gly Ile Phe Ile Met Phe Leu Ile Gly 165 170 175 Tyr Gly Cys Ser Phe Ile Gln Gly Lys Ala Ser Phe Arg Ile Pro Trp 180 185 190 Gly Val Gln Met Val Pro Gly Leu Ile Leu Leu Ile Gly Leu Phe Phe 195 200 205 Ile Pro Glu Ser Pro Arg Trp Leu Ala Lys Gln Gly Tyr Trp Glu Asp 210 215 220 Ala Glu Ile Ile Val Ala Asn Val Gln Ala Lys Gly Asn Arg Asn Asp 225 230 235 240 Ala Asn Val Gln Ile Glu Met Ser Glu Ile Lys Asp Gln Leu Met Leu 245 250 255 Asp Glu His Leu Lys Glu Phe Thr Tyr Ala Asp Leu Phe Thr Lys Lys 260 265 270 Tyr Arg Gln Arg Thr Ile Thr Ala Ile Phe Ala Gln Ile Trp Gln Gln 275 280 285 Leu Thr Gly Met Asn Val Met Met Tyr Tyr Ile Val Tyr Ile Phe Gln 290 295 300 Met Ala Gly Tyr Ser Gly Asn Thr Asn Leu Val Pro Ser Leu Ile Gln 305 310 315 320 Tyr Ile Ile Asn Met Ala Val Thr Val Pro Ala Leu Phe Cys Leu Asp 325 330 335 Leu Leu Gly Arg Arg Thr Ile Leu Leu Ala Gly Ala Ala Phe Met Met 340 345 350 Ala Trp Gln Phe Gly Val Ala Gly Ile Leu Ala Thr Tyr Ser Glu Pro 355 360 365 Ala Tyr Ile Ser Asp Thr Val Arg Ile Thr Ile Pro Asp Asp His Lys 370 375 380 Ser Ala Ala Lys Gly Val Ile Ala Cys Cys Tyr Leu Phe Val Cys Ser 385 390 395 400 Phe Ala Phe Ser Trp Gly Val Gly Ile Trp Val Tyr Cys Ser Glu Val 405 410 415 Trp Gly Asp Ser Gln Ser Arg Gln Arg Gly Ala Ala Leu Ala Thr Ser 420 425 430 Ala Asn Trp Ile Phe Asn Phe Ala Ile Ala Met Phe Thr Pro Ser Ser 435 440 445 Phe Lys Asn Ile Thr Trp Lys Thr Tyr Ile Ile Tyr Ala Thr Phe Cys 450 455 460 Ala Cys Met Phe Ile His Val Phe Phe Phe Phe Pro Glu Thr Lys Gly 465 470 475 480 Lys Arg Leu Glu Glu Ile Gly Gln Leu Trp Asp Glu Gly Val Pro Ala 485 490 495 Trp Arg Ser Ala Lys Trp Gln Pro Thr Val Pro Leu Ala Ser Asp Ala 500 505 510 Glu Leu Ala His Lys Met Asp Val Ala His Ala Glu His Ala Asp Leu 515 520 525 Leu Ala Thr His Ser Pro Ser Ser Asp Glu Lys Thr Gly Thr Val 530 535 540 <210> SEQ ID NO 10 <211> LENGTH: 524 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species Hxt2.6p <400> SEQUENCE: 10 Met Ser Ser Thr Thr Asp Thr Leu Glu Lys Arg Asp Thr Glu Pro Phe 1 5 10 15 Thr Ser Asp Ala Pro Val Thr Val His Asp Tyr Ile Ala Glu Glu Arg 20 25 30 Pro Trp Trp Lys Val Pro His Leu Arg Val Leu Thr Trp Ser Val Phe 35 40 45 Val Ile Thr Leu Thr Ser Thr Asn Asn Gly Tyr Asp Gly Ser Met Leu 50 55 60 Asn Gly Leu Gln Ser Leu Asp Ile Trp Gln Glu Asp Leu Gly His Pro 65 70 75 80 Ala Gly Gln Lys Leu Gly Ala Leu Ala Asn Gly Val Leu Phe Gly Asn 85 90 95 Leu Ala Ala Val Pro Phe Ala Ser Tyr Phe Cys Asp Arg Phe Gly Arg 100 105 110 Arg Pro Val Ile Cys Phe Gly Gln Ile Leu Thr Ile Val Gly Ala Val 115 120 125 Leu Gln Gly Leu Ser Asn Ser Tyr Gly Phe Phe Leu Gly Ser Arg Ile 130 135 140 Val Leu Gly Phe Gly Ala Met Ile Ala Thr Ile Pro Ser Pro Thr Leu 145 150 155 160 Ile Ser Glu Ile Ala Tyr Pro Thr His Arg Glu Thr Ser Thr Phe Ala 165 170 175 Tyr Asn Val Cys Trp Tyr Leu Gly Ala Ile Ile Ala Ser Trp Val Thr 180 185 190 Tyr Gly Thr Arg Asp Leu Gln Ser Lys Ala Cys Trp Ser Ile Pro Ser 195 200 205 Tyr Leu Gln Ala Ala Leu Pro Phe Phe Gln Val Cys Met Ile Trp Phe 210 215 220 Val Pro Glu Ser Pro Arg Phe Leu Val Ala Lys Gly Lys Ile Asp Gln 225 230 235 240 Ala Arg Ala Val Leu Ser Lys Tyr His Thr Gly Asp Ser Thr Asp Pro 245 250 255 Arg Asp Val Ala Leu Val Asp Phe Glu Leu His Glu Ile Glu Ser Ala 260 265 270 Leu Glu Gln Glu Lys Leu Asn Thr Arg Ser Ser Tyr Phe Asp Phe Phe 275 280 285 Lys Lys Arg Asn Phe Arg Lys Arg Gly Phe Leu Cys Val Met Val Gly 290 295 300 Val Ala Met Gln Leu Ser Gly Asn Gly Leu Val Ser Tyr Tyr Leu Ser 305 310 315 320 Lys Val Leu Asp Ser Ile Gly Ile Thr Glu Thr Lys Arg Gln Leu Glu 325 330 335 Ile Asn Gly Cys Leu Met Ile Tyr Asn Phe Val Ile Cys Val Ser Leu 340 345 350 Met Ser Val Cys Arg Met Phe Lys Arg Arg Val Leu Phe Leu Thr Cys 355 360 365 Phe Ser Gly Met Thr Val Cys Tyr Thr Ile Trp Thr Ile Leu Ser Ala 370 375 380 Leu Asn Glu Gln Arg His Phe Glu Asp Lys Gly Leu Ala Asn Gly Val 385 390 395 400 Leu Ala Met Ile Phe Phe Tyr Tyr Phe Phe Tyr Asn Val Gly Ile Asn 405 410 415 Gly Leu Pro Phe Leu Tyr Ile Thr Glu Ile Leu Pro Tyr Ser His Arg 420 425 430 Ala Lys Gly Leu Asn Leu Phe Gln Phe Ser Gln Phe Leu Thr Gln Ile 435 440 445 Tyr Asn Gly Tyr Val Asn Pro Ile Ala Met Asp Ala Ile Ser Trp Lys 450 455 460 Tyr Tyr Ile Val Tyr Cys Cys Ile Leu Phe Val Glu Leu Val Ile Val 465 470 475 480 Phe Phe Thr Phe Pro Glu Thr Ser Gly Tyr Thr Leu Glu Glu Val Ala 485 490 495 Gln Val Phe Gly Asp Glu Ala Pro Gly Leu His Asn Arg Gln Leu Asp 500 505 510 Val Ala Lys Glu Ser Leu Glu His Val Glu His Val 515 520

<210> SEQ ID NO 11 <211> LENGTH: 556 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species Qup2p <400> SEQUENCE: 11 Met Gly Phe Arg Asn Leu Lys Arg Arg Leu Ser Asn Val Gly Asp Ser 1 5 10 15 Met Ser Val His Ser Val Lys Glu Glu Glu Asp Phe Ser Arg Val Glu 20 25 30 Ile Pro Asp Glu Ile Tyr Asn Tyr Lys Ile Val Leu Val Ala Leu Thr 35 40 45 Ala Ala Ser Ala Ala Ile Ile Ile Gly Tyr Asp Ala Gly Phe Ile Gly 50 55 60 Gly Thr Val Ser Leu Thr Ala Phe Lys Ser Glu Phe Gly Leu Asp Lys 65 70 75 80 Met Ser Ala Thr Ala Ala Ser Ala Ile Glu Ala Asn Val Val Ser Val 85 90 95 Phe Gln Ala Gly Ala Tyr Phe Gly Cys Leu Phe Phe Tyr Pro Ile Gly 100 105 110 Glu Ile Trp Gly Arg Lys Ile Gly Leu Leu Leu Ser Gly Phe Leu Leu 115 120 125 Thr Phe Gly Ala Ala Ile Ser Leu Ile Ser Asn Ser Ser Arg Gly Leu 130 135 140 Gly Ala Ile Tyr Ala Gly Arg Val Leu Thr Gly Leu Gly Ile Gly Gly 145 150 155 160 Cys Ser Ser Leu Ala Pro Ile Tyr Val Ser Glu Ile Ala Pro Ala Ala 165 170 175 Ile Arg Gly Lys Leu Val Gly Cys Trp Glu Val Ser Trp Gln Val Gly 180 185 190 Gly Ile Val Gly Tyr Trp Ile Asn Tyr Gly Val Leu Gln Thr Leu Pro 195 200 205 Ile Ser Ser Gln Gln Trp Ile Ile Pro Phe Ala Val Gln Leu Ile Pro 210 215 220 Ser Gly Leu Phe Trp Gly Leu Cys Leu Leu Ile Pro Glu Ser Pro Arg 225 230 235 240 Phe Leu Val Ser Lys Gly Lys Ile Asp Lys Ala Arg Lys Asn Leu Ala 245 250 255 Tyr Leu Arg Gly Leu Ser Glu Asp His Pro Tyr Ser Val Phe Glu Leu 260 265 270 Glu Asn Ile Ser Lys Ala Ile Glu Glu Asn Phe Glu Gln Thr Gly Arg 275 280 285 Gly Phe Phe Asp Pro Leu Lys Ala Leu Phe Phe Ser Lys Lys Met Leu 290 295 300 Tyr Arg Leu Leu Leu Ser Thr Ser Met Phe Met Met Gln Asn Gly Tyr 305 310 315 320 Gly Ile Asn Ala Val Thr Tyr Tyr Ser Pro Thr Ile Phe Lys Ser Leu 325 330 335 Gly Val Gln Gly Ser Asn Ala Gly Leu Leu Ser Thr Gly Ile Phe Gly 340 345 350 Leu Leu Lys Gly Ala Ala Ser Val Phe Trp Val Phe Phe Leu Val Asp 355 360 365 Thr Phe Gly Arg Arg Phe Cys Leu Cys Tyr Leu Ser Leu Pro Cys Ser 370 375 380 Ile Cys Met Trp Tyr Ile Gly Ala Tyr Ile Lys Ile Ala Asn Pro Ser 385 390 395 400 Ala Lys Leu Ala Ala Gly Asp Thr Ala Thr Thr Pro Ala Gly Thr Ala 405 410 415 Ala Lys Ala Met Leu Tyr Ile Trp Thr Ile Phe Tyr Gly Ile Thr Trp 420 425 430 Asn Gly Thr Thr Trp Val Ile Cys Ala Glu Ile Phe Pro Gln Ser Val 435 440 445 Arg Thr Ala Ala Gln Ala Val Asn Ala Ser Ser Asn Trp Phe Trp Ala 450 455 460 Phe Met Ile Gly His Phe Thr Gly Gln Ala Leu Glu Asn Ile Gly Tyr 465 470 475 480 Gly Tyr Tyr Phe Leu Phe Ala Ala Cys Ser Ala Ile Phe Pro Val Val 485 490 495 Val Trp Phe Val Tyr Pro Glu Thr Lys Gly Val Pro Leu Glu Ala Val 500 505 510 Glu Tyr Leu Phe Glu Val Arg Pro Trp Lys Ala His Ser Tyr Ala Leu 515 520 525 Glu Lys Tyr Gln Ile Glu Tyr Asn Glu Gly Glu Phe His Gln His Lys 530 535 540 Pro Glu Val Leu Leu Gln Gly Ser Glu Asn Ser Asp 545 550 555 <210> SEQ ID NO 12 <211> LENGTH: 543 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species Aps1p/Hgt19p <400> SEQUENCE: 12 Met Gly Tyr Glu Glu Lys Leu Val Ala Pro Ala Leu Lys Phe Lys Asn 1 5 10 15 Phe Leu Asp Lys Thr Pro Asn Ile His Asn Val Tyr Val Ile Ala Ala 20 25 30 Ile Ser Cys Thr Ser Gly Met Met Phe Gly Phe Asp Ile Ser Ser Met 35 40 45 Ser Val Phe Val Asp Gln Gln Pro Tyr Leu Lys Met Phe Asp Asn Pro 50 55 60 Ser Ser Val Ile Gln Gly Phe Ile Thr Ala Ser Met Ser Leu Gly Ser 65 70 75 80 Phe Phe Gly Ser Leu Thr Ser Thr Phe Ile Ser Glu Pro Phe Gly Arg 85 90 95 Arg Ala Ser Leu Phe Ile Cys Gly Ile Leu Trp Val Ile Gly Ala Ala 100 105 110 Val Gln Ser Ser Ser Gln Asn Arg Ala Gln Leu Ile Cys Gly Arg Ile 115 120 125 Ile Ala Gly Trp Gly Ile Gly Phe Gly Ser Ser Val Ala Pro Val Tyr 130 135 140 Gly Ser Glu Met Ala Pro Arg Lys Ile Arg Gly Thr Ile Gly Gly Ile 145 150 155 160 Phe Gln Phe Ser Val Thr Val Gly Ile Phe Ile Met Phe Leu Ile Gly 165 170 175 Tyr Gly Cys Ser Phe Ile Gln Gly Lys Ala Ser Phe Arg Ile Pro Trp 180 185 190 Gly Val Gln Met Val Pro Gly Leu Ile Leu Leu Ile Gly Leu Phe Phe 195 200 205 Ile Pro Glu Ser Pro Arg Trp Leu Ala Lys Gln Gly Tyr Trp Glu Asp 210 215 220 Ala Glu Ile Ile Val Ala Asn Val Gln Ala Lys Gly Asn Arg Asn Asp 225 230 235 240 Ala Asn Val Gln Ile Glu Met Ser Glu Ile Lys Asp Gln Leu Met Leu 245 250 255 Asp Glu His Leu Lys Glu Phe Thr Tyr Ala Asp Leu Phe Thr Lys Lys 260 265 270 Tyr Arg Gln Arg Thr Ile Thr Ala Ile Phe Ala Gln Ile Trp Gln Gln 275 280 285 Leu Thr Gly Met Asn Val Met Met Tyr Tyr Ile Val Tyr Ile Phe Gln 290 295 300 Met Ala Gly Tyr Ser Gly Asn Thr Asn Leu Val Pro Ser Leu Ile Gln 305 310 315 320 Tyr Ile Ile Asn Met Ala Val Thr Val Pro Ala Leu Phe Cys Leu Asp 325 330 335 Leu Leu Gly Arg Arg Thr Ile Leu Leu Ala Gly Ala Ala Phe Met Met 340 345 350 Ala Trp Gln Phe Gly Val Ala Gly Ile Leu Ala Thr Tyr Ser Glu Pro 355 360 365 Ala Tyr Ile Ser Asp Thr Val Arg Ile Thr Ile Pro Asp Asp His Lys 370 375 380 Ser Ala Ala Lys Gly Val Ile Ala Cys Cys Tyr Leu Phe Val Cys Ser 385 390 395 400 Phe Ala Phe Ser Trp Gly Val Gly Ile Trp Val Tyr Cys Ser Glu Val 405 410 415 Trp Gly Asp Ser Gln Ser Arg Gln Arg Gly Ala Ala Leu Ala Thr Ser 420 425 430 Ala Asn Trp Ile Phe Asn Phe Ala Ile Ala Met Phe Thr Pro Ser Ser 435 440 445 Phe Lys Asn Ile Thr Trp Lys Thr Tyr Ile Ile Tyr Ala Thr Phe Cys 450 455 460 Ala Cys Met Phe Ile His Val Phe Phe Phe Phe Pro Glu Thr Lys Gly 465 470 475 480 Lys Arg Leu Glu Glu Ile Gly Gln Leu Trp Asp Glu Gly Val Pro Ala 485 490 495 Trp Arg Ser Ala Lys Trp Gln Pro Thr Val Pro Leu Ala Ser Asp Ala 500 505 510 Glu Leu Ala His Lys Met Asp Val Ala His Ala Glu His Ala Asp Leu 515 520 525 Leu Ala Thr His Ser Pro Ser Ser Asp Glu Lys Thr Gly Thr Val 530 535 540 <210> SEQ ID NO 13 <211> LENGTH: 1632 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species XYT1 <400> SEQUENCE: 13 atgggttacg aggaaaagct tgtagcgccc gcgttgaaat tcaaaaactt tcttgacaaa 60 acccccaata ttcacaatgt ctatgtcatt gccgccatct cctgtacatc aggtatgatg 120 tttggatttg atatctcgtc gatgtctgtc tttgtcgacc agcagccata cttgaagatg 180 tttgacaacc ctagttccgt gattcaaggt ttcattaccg cgctgatgag tttgggctcg 240 tttttcggct cgctcacatc cacgttcatc tctgagcctt ttggtcgtcg tgcatcgttg 300 ttcatttgtg gtattctttg ggtaattgga gcagcggttc aaagttcgtc gcagaacagg 360

gcccaattga tttgtgggcg tatcattgca ggatggggca ttggctttgg gtcatcggtg 420 gctcctgttt acgggtccga gatggctccg agaaagatca gaggcacgat tggtggaatc 480 ttccagttct ccgtcaccgt gggtatcttt atcatgttct tgattgggta cggatgctct 540 ttcattcaag gaaaggcctc tttccggatc ccctggggtg tgcaaatggt tcccggcctt 600 atcctcttga ttggactttt ctttattcct gaatctcccc gttggttggc caaacagggc 660 tactgggaag acgccgaaat cattgtggcc aatgtgcagg ccaagggtaa ccgtaacgac 720 gccaacgtgc agattgaaat gtcggagatt aaggatcaat tgatgcttga cgagcacttg 780 aaggagttta cgtacgctga ccttttcacg aagaagtacc gccagcgcac gatcacggcg 840 atctttgccc agatctggca acagttgacc ggtatgaatg tgatgatgta ctacattgtg 900 tacattttcc agatggcagg ctacagcggc aacacgaact tggtgcccag tttgatccag 960 tacatcatca acatggcggt cacggtgccg gcgcttttct gcttggatct cttgggccgt 1020 cgtaccattt tgctcgcggg tgccgcgttc atgatggcgt ggcaattcgg cgtggcgggc 1080 attttggcca cttactcaga accggcatat atctctgaca ctgtgcgtat cacgatcccc 1140 gacgaccaca agtctgctgc aaaaggtgtg attgcatgct gctatttgtt tgtgtgctcg 1200 tttgcattct cgtggggtgt cggtatttgg gtgtactgtt ccgaggtttg gggtgactcc 1260 cagtcgagac aaagaggcgc cgctcttgcg acgtcggcca actggatctt caacttcgcc 1320 attgccatgt tcacgccgtc ctcattcaag aatatcacgt ggaagacgta tatcatctac 1380 gccacgttct gtgcgtgcat gttcatacac gtgtttttct ttttcccaga aacaaagggc 1440 aagcgtttgg aggagatagg ccagctttgg gacgaaggag tcccagcatg gaggtcagcc 1500 aagtggcagc caacagtgcc gctcgcgtcc gacgcagagc ttgcacacaa gatggatgtt 1560 gcgcacgcgg agcacgcgga cttattggcc acgcactcgc catcttcaga cgagaagacg 1620 ggcacggtct aa 1632 <210> SEQ ID NO 14 <211> LENGTH: 1635 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species GXF1 <400> SEQUENCE: 14 atgtctcaag acgaacttca tacaaagtct ggtgttgaaa caccaatcaa cgattcgctt 60 ctcgaggaga agcacgatgt caccccactc gcggcattgc ccgagaagtc cttcaaggac 120 tacatttcca tttccatttt ctgtttgttt gtggcatttg gtggttttgt tttcggtttc 180 gacaccggta cgatttccgg tttcgtcaac atgtccgact tcaagaccag atttggtgag 240 atgaatgccc agggcgaata ctacttgtcc aatgttagaa ctggtttgat ggtttctatt 300 ttcaacgtcg gttgcgccgt tggtggtatc ttcctttgta agattgccga tgtttatggc 360 agaagaattg gtcttatgtt ttccatggtg gtttatgtcg ttggtatcat tattcagatt 420 gcctccacca ccaaatggta ccaatacttc attggccgtc ttattgctgg cttggctgtg 480 ggtactgttt ccgtcatctc gccacttttc atttccgagg ttgctcctaa acagctcaga 540 ggtacgcttg tgtgctgctt ccagttgtgt atcaccttgg gtatcttttt gggttactgc 600 acgacctacg gtacaaagac ttacactgac tccagacagt ggagaatccc attgggtatc 660 tgtttcgcgt gggctttgtt tttggtggcc ggtatgttga acatgcccga gtctcctaga 720 tacttggttg agaaatcgag aatcgacgat gccagaaagt ccattgccag atccaacaag 780 gtttccgagg aagaccccgc cgtgtacacc gaggtgcagc ttatccaggc tggtattgac 840 agagaggccc ttgccggcag cgccacatgg atggagcttg tgactggtaa gcccaaaatc 900 ttcagaagag tcatcatggg tgtcatgctt cagtccttgc aacaattgac tggtgacaac 960 tactttttct actacggaac cacgattttc aaggctgttg gcttgcagga ctctttccag 1020 acgtcgatta tcttgggtat tgtcaacttt gcctcgactt ttgtcggtat ttacgccatt 1080 gagagaatgg gcagaagatt gtgtttgttg accggatctg cgtgcatgtt tgtgtgtttc 1140 atcatctact cgctcattgg tacgcagcac ttgtacaaga acggcttctc taacgaacct 1200 tccaacacat acaagccttc cggtaacgcc atgatcttca tcacgtgtct ttacattttc 1260 ttctttgcct cgacctgggc cggtggtgtt tactgtatcg tgtccgagtc ttacccattg 1320 agaatcagat ccaaggccat gtctgtcgcc accgccgcca actggatgtg gggtttcttg 1380 atctcgttct tcacgccttt catcacctcc gccatccact tttactacgg ttttgttttc 1440 actggctgct tggcgttctc cttcttctac gtctacttct ttgtcgtgga gaccaagggt 1500 ctttccttgg aggaggttga cattttgtac gcttccggta cgcttccatg gaagtcctct 1560 ggctgggtgc ctcctaccgc ggacgaaatg gcccacaacg ccttcgacaa caagccaact 1620 gacgaacaag tctaa 1635 <210> SEQ ID NO 15 <211> LENGTH: 1425 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species delta-GXF1 (variant of GXF1 with shorter N-terminus) <400> SEQUENCE: 15 atgtccgact tcaagaccag atttggtgag atgaatgccc agggcgaata ctacttgtcc 60 aatgttagaa ctggtttgat ggtttctatt ttcaacgtcg gttgcgccgt tggtggtatc 120 ttcctttgta agattgccga tgtttatggc agaagaattg gtcttatgtt ttccatggtg 180 gtttatgtcg ttggtatcat tattcagatt gcctccacca ccaaatggta ccaatacttc 240 attggccgtc ttattgctgg cttggctgtg ggtactgttt ccgtcatctc gccacttttc 300 atttccgagg ttgctcctaa acagctcaga ggtacgcttg tgtgctgctt ccagttgtgt 360 atcaccttgg gtatcttttt gggttactgc acgacctacg gtacaaagac ttacactgac 420 tccagacagt ggagaatccc attgggtatc tgtttcgcgt gggctttgtt tttggtggcc 480 ggtatgttga acatgcccga gtctcctaga tacttggttg agaaatcgag aatcgacgat 540 gccagaaagt ccattgccag atccaacaag gtttccgagg aagaccccgc cgtgtacacc 600 gaggtgcagc ttatccaggc tggtattgac agagaggccc ttgccggcag cgccacatgg 660 atggagcttg tgactggtaa gcccaaaatc ttcagaagag tcatcatggg tgtcatgctt 720 cagtccttgc aacaattgac tggtgacaac tactttttct actacggaac cacgattttc 780 aaggctgttg gcttgcagga ctctttccag acgtcgatta tcttgggtat tgtcaacttt 840 gcctcgactt ttgtcggtat ttacgccatt gagagaatgg gcagaagatt gtgtttgttg 900 accggatctg cgtgcatgtt tgtgtgtttc atcatctact cgctcattgg tacgcagcac 960 ttgtacaaga acggcttctc taacgaacct tccaacacat acaagccttc cggtaacgcc 1020 atgatcttca tcacgtgtct ttacattttc ttctttgcct cgacctgggc cggtggtgtt 1080 tactgtatcg tgtccgagtc ttacccattg agaatcagat ccaaggccat gtctgtcgcc 1140 accgccgcca actggatgtg gggtttcttg atctcgttct tcacgccttt catcacctcc 1200 gccatccact tttactacgg ttttgttttc actggctgct tggcgttctc cttcttctac 1260 gtctacttct ttgtcgtgga gaccaagggt ctttccttgg aggaggttga cattttgtac 1320 gcttccggta cgcttccatg gaagtcctct ggctgggtgc ctcctaccgc ggacgaaatg 1380 gcccacaacg ccttcgacaa caagccaact gacgaacaag tctaa 1425 <210> SEQ ID NO 16 <211> LENGTH: 1647 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species GXF2/GAL2 <400> SEQUENCE: 16 atgagtgccg aacaggaaca acaagtatcg ggcacatctg ccacgataga tgggctggcg 60 tccttgaagc aagaaaaaac cgccgaggag gaagacgcct tcaagcctaa gcccgccacg 120 gcgtactttt tcatttcgtt cctctgtggc ttggtcgcct ttggcggcta cgttttcggt 180 ttcgataccg gtacgatttc cgggtttgtt aacatggacg actatttgat gagattcggc 240 cagcagcacg ctgatggcac gtattacctt tccaacgtga gaaccggttt gatcgtgtcg 300 atcttcaaca ttggctgtgc cgttggtggt cttgcgcttt cgaaagtcgg tgacatttgg 360 ggcagaagaa ttggtattat ggttgctatg atcatctaca tggtgggaat catcatccag 420 atcgcttcac aggataaatg gtaccagtac ttcattggcc gtttgatcac cggattgggt 480 gtcggcacca cgtccgtgct tagtcctctt ttcatctccg agtcggctcc gaagcatttg 540 agaggcaccc ttgtgtgttg tttccagctc atggtcacct tgggtatctt tttgggctac 600 tgcacgacct acggtaccaa gaactacact gactcgcgcc agtggcggat tcccttgggt 660 ctttgcttcg catgggctct tttgttgatc tcgggaatgg ttttcatgcc tgaatcccca 720 cgtttcttga ttgagcgcca gagattcgac gaggccaagg cttccgtggc caaatcgaac 780 caggtttcga ccgaggaccc cgccgtgtac actgaagtcg agttgatcca ggccggtatt 840 gaccgtgagg cattggccgg atccgctggc tggaaagagc ttatcacggg taagcccaag 900 atgttgcagc gtgtgatttt gggaatgatg ctccagtcga tccagcagct taccggtaac 960 aactactttt tctactatgg taccacgatc ttcaaggccg tgggcatgtc ggactcgttc 1020 cagacctcga ttgttttggg tattgtcaac ttcgcctcca cttttgtcgg aatctgggcc 1080 atcgaacgca tgggccgcag atcttgtttg cttgttggtt ccgcgtgcat gagtgtgtgt 1140 ttcttgatct actccatctt gggttccgtc aacctttaca tcgacggcta cgagaacacg 1200 ccttccaaca cgcgtaagcc taccggtaac gccatgattt tcatcacgtg tttgttcatc 1260 ttcttcttcg cctccacctg ggccggtggt gtgtacagta ttgtgtctga aacataccca 1320 ttgagaatcc gctctaaagg tatggccgtg gccaccgctg ccaactggat gtggggtttc 1380 ttgatttcgt tcttcacgcc tttcatcacc tcggccatcc acttctacta cgggtttgtg 1440 ttcacagggt gtcttatttt ctccttcttc tacgtgttct tctttgttag ggaaaccaag 1500 ggtctctcgt tggaagaggt ggatgagtta tatgccactg acctcccacc atggaagacc 1560 gcgggctgga cgcctccttc tgctgaggat atggcccaca ccaccgggtt tgccgaggcc 1620 gcaaagccta cgaacaaaca cgtttaa 1647 <210> SEQ ID NO 17 <211> LENGTH: 1509 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species delta-GXS1/delta-HGT12 (variant of GXS1 /HGT12 with shorter N-terminus) <400> SEQUENCE: 17 atgggcattt tcgttggcgt tttcgccgcg cttggcggtg ttctctttgg ctacgatacc 60 ggtaccatct ctggtgtgat ggccatgcct tgggtcaagg aacatttccc aaaagaccgt 120

gttgcattta gtgcttccga gtcgtcgttg attgtgtcta ttttatctgc aggaactttc 180 tttggagcca ttcttgctcc gctcttgacc gatacattgg gtagacgctg gtgtattatc 240 atctcttcgc tcgttgtgtt caatttgggt gctgctttgc agacggctgc cacggatatc 300 ccgctcttga ttgttggtcg tgtcattgcc ggtttagggg ttggtttgat ttcgctgacg 360 attccattgt accagtccga agcgcttccc aaatggatta gaggtgctgt tgtctcgtgc 420 taccaatggg ccattactat tggtatcttt ttggctgccg tgatcaacca gggcactcac 480 aagatcaaca gccctgcgtc gtacagaatt ccattgggta ttcagatggc atggggtctt 540 atcttgggtg tcggcatgtt cttcttgccc gagacgcctc gtttctacat ttccaagggc 600 cagaatgcga aggctgctgt ttcattggcg cgtttgagaa agcttccgca agatcacccg 660 gagttgttgg aggaattgga agatatccag gcggcatacg agtttgagac tgtccatggc 720 aagtcttcat ggctgcaggt tttcaccaac aagaacaaac aattgaagaa gttggccacg 780 ggcgtgtgct tgcaggcgtt ccaacaattg actggtgtga acttcatttt ctactttggc 840 acgactttct tcaacagtgt tgggcttgac ggattcacca cctccttggc caccaacatt 900 gtcaatgttg gctcgacgat ccctggtatt ttgggtgttg agattttcgg cagaagaaaa 960 gtgttgttga ccggcgctgc tggtatgtgt ctttcgcaat tcattgttgc cattgttggt 1020 gtagccaccg actccaaggc tgcgaaccaa gttcttattg ccttctgctg cattttcatt 1080 gcgttctttg cagccacctg gggccccacc gcatgggttg tttgtggcga gattttcccc 1140 ttgagaacca gagccaagtc gattgccatg tgcgctgctt cgaactggtt gttgaactgg 1200 gcaattgcat acgccacgcc atacttggtt gactccgata agggtaactt gggcaccaat 1260 gtgtttttca tttggggaag ctgtaacttc ttctgccttg tgtttgccta cttcatgatt 1320 tacgagacca agggtctttc cttggagcag gttgatgagc tttacgagaa ggttgccagc 1380 gccagaaagt cgcctggctt cgtgccaagc gagcacgctt tcagagagca cgccgatgtg 1440 gagaccgcca tgccagacaa cttcaacttg aaggcggagg cgatttctgt cgaggatgcc 1500 tctgtttaa 1509 <210> SEQ ID NO 18 <400> SEQUENCE: 18 000 <210> SEQ ID NO 19 <211> LENGTH: 1647 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species GXS1/HGT12 <400> SEQUENCE: 19 atgagcatct ttgaaggcaa agacgggaag ggggtatcct ccaccgagtc gctttccaat 60 gacgtcagat atgacaacat ggagaaagtt gatcaggatg ttcttagaca caacttcaac 120 tttgacaaag aattcgagga gctcgaaatc gaggcggcgc aagtcaacga caaaccttct 180 tttgtcgaca ggattttatc cctcgaatac aagcttcatt tcgaaaacaa gaaccacatg 240 gtgtggctct tgggcgcttt cgcagccgcc gcaggcttat tgtctggctt ggatcagtcc 300 attatttctg gtgcatccat tggaatgaac aaagcattga acttgactga acgtgaagcc 360 tcattggtgt cttcgcttat gcctttaggc gccatggcag gctccatgat tatgacacct 420 cttaatgagt ggttcggaag aaaatcatcg ttgattattt cttgtatttg gtataccatc 480 ggatccgctt tgtgcgctgg cgccagagat caccacatga tgtacgctgg cagatttatt 540 cttggtgtcg gtgtgggtat agaaggtggg tgtgtgggca tttacatttc cgagtctgtc 600 ccagccaatg tgcgtggtag tatcgtgtcg atgtaccagt tcaatattgc tttgggtgaa 660 gttctagggt atgctgttgc tgccattttc tacactgttc atggtggatg gaggttcatg 720 gtggggtctt ctttagtatt ctctactata ttgtttgccg gattgttttt cttgcccgag 780 tcacctcgtt ggttggtgca caaaggcaga aacggaatgg catacgatgt gtggaagaga 840 ttgagagaca taaacgatga aagcgcaaag ttggaatttt tggagatgag acaggctgct 900 tatcaagaga gagaaagacg ctcgcaagag tctttgttct ccagctgggg cgaattattc 960 accatcgcta gaaacagaag agcacttact tactctgtca taatgatcac tttgggtcaa 1020 ttgactggtg tcaatgccgt catgtactac atgtcgactt tgatgggtgc aattggtttc 1080 aacgagaaag actctgtgtt catgtccctt gtgggaggcg gttctttgct tataggtacc 1140 attcctgcca ttttgtggat ggaccgtttc ggcagaagag tttggggtta taatcttgtt 1200 ggtttcttcg ttggtttggt gctcgttggt gttggctacc gtttcaatcc cgtcactcaa 1260 aaggcggctt cagaaggtgt gtacttgacg ggtctcattg tctatttctt gttctttggt 1320 tcctactcga ccttaacttg ggtcattcca tccgagtctt ttgatttgag aacaagatct 1380 ttgggtatga caatctgttc cactttcctt tacttgtggt ctttcaccgt cacctacaac 1440 ttcaccaaga tgtccgccgc cttcacatac actgggttga cacttggttt ctacggtggc 1500 attgcgttcc ttggtttgat ttaccaggtc tgcttcatgc ccgagacgaa ggacaagact 1560 ttggaagaaa ttgacgatat cttcaatcgt tctgcgttct ctatcgcgcg cgagaacatc 1620 tccaacttga agaagggtat ttggtaa 1647 <210> SEQ ID NO 20 <211> LENGTH: 1647 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species HXT5 <400> SEQUENCE: 20 atgagcatct ttgaaggcaa agacgggaag ggggtatcct ccaccgagtc gctttccaat 60 gacgtcagat atgacaacat ggagaaagtt gatcaggatg ttcttagaca caacttcaac 120 tttgacaaag aattcgagga gctcgaaatc gaggcggcgc aagtcaacga caaaccttct 180 tttgtcgaca ggattttatc cctcgaatac aagcttcatt tcgaaaacaa gaaccacatg 240 gtgtggctct tgggcgcttt cgcagccgcc gcaggcttat tgtctggctt ggatcagtcc 300 attatttctg gtgcatccat tggaatgaac aaagcattga acttgactga acgtgaagcc 360 tcattggtgt cttcgcttat gcctttaggc gccatggcag gctccatgat tatgacacct 420 cttaatgagt ggttcggaag aaaatcatcg ttgattattt cttgtatttg gtataccatc 480 ggatccgctt tgtgcgctgg cgccagagat caccacatga tgtacgctgg cagatttatt 540 cttggtgtcg gtgtgggtat agaaggtggg tgtgtgggca tttacatttc cgagtctgtc 600 ccagccaatg tgcgtggtag tatcgtgtcg atgtaccagt tcaatattgc tttgggtgaa 660 gttctagggt atgctgttgc tgccattttc tacactgttc atggtggatg gaggttcatg 720 gtggggtctt ctttagtatt ctctactata ttgtttgccg gattgttttt cttgcccgag 780 tcacctcgtt ggttggtgca caaaggcaga aacggaatgg catacgatgt gtggaagaga 840 ttgagagaca taaacgatga aagcgcaaag ttggaatttt tggagatgag acaggctgct 900 tatcaagaga gagaaagacg ctcgcaagag tctttgttct ccagctgggg cgaattattc 960 accatcgcta gaaacagaag agcacttact tactctgtca taatgatcac tttgggtcaa 1020 ttgactggtg tcaatgccgt catgtactac atgtcgactt tgatgggtgc aattggtttc 1080 aacgagaaag actctgtgtt catgtccctt gtgggaggcg gttctttgct tataggtacc 1140 attcctgcca ttttgtggat ggaccgtttc ggcagaagag tttggggtta taatcttgtt 1200 ggtttcttcg ttggtttggt gctcgttggt gttggctacc gtttcaatcc cgtcactcaa 1260 aaggcggctt cagaaggtgt gtacttgacg ggtctcattg tctatttctt gttctttggt 1320 tcctactcga ccttaacttg ggtcattcca tccgagtctt ttgatttgag aacaagatct 1380 ttgggtatga caatctgttc cactttcctt tacttgtggt ctttcaccgt cacctacaac 1440 ttcaccaaga tgtccgccgc cttcacatac actgggttga cacttggttt ctacggtggc 1500 attgcgttcc ttggtttgat ttaccaggtc tgcttcatgc ccgagacgaa ggacaagact 1560 ttggaagaaa ttgacgatat cttcaatcgt tctgcgttct ctatcgcgcg cgagaacatc 1620 tccaacttga agaagggtat ttggtaa 1647 <210> SEQ ID NO 21 <211> LENGTH: 1632 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species XYT1 codon optimized for expression in S. cerevisiae <400> SEQUENCE: 21 atgggatacg aagagaaatt agtggccccc gctttgaaat ttaagaactt tttggataag 60 accccaaata tacataacgt ttacgtaatt gcggcgatct cgtgtacctc aggtatgatg 120 ttcggtttcg atatatcgtc gatgtccgtg ttcgtggacc aacagccgta tttaaaaatg 180 tttgataacc ctagcagcgt gatacaaggg tttataactg cgttgatgtc tttggggagc 240 tttttcggat cgctaacgtc cacttttatt tcagaacctt ttggtagacg tgcctctttg 300 ttcatatgcg ggatcctttg ggtaattggg gcggcagttc aaagttcttc tcagaaccgt 360 gcgcagctta tttgtggccg aattattgca gggtggggca tcggattcgg ttctagcgtt 420 gcgccggtat acggttcaga aatggcccca cgcaaaatta gaggaacaat cggaggtatt 480 tttcaatttt ctgtcacggt cggaatattc ataatgttcc tgattggcta cggctgctca 540 tttatacaag gcaaggccag ttttagaatt ccgtggggag ttcaaatggt accaggtctc 600 attctgttga tcggactatt cttcattcct gaatccccaa gatggttagc caaacaaggc 660 tactgggaag acgctgagat catcgtagca aacgttcaag ctaagggtaa caggaacgat 720 gctaatgtgc aaattgaaat gtccgagata aaagatcagt taatgcttga cgagcattta 780 aaggagttta cttatgccga tttgtttacc aaaaaatacc ggcaaaggac gataacagct 840 atatttgccc aaatatggca acagctgaca ggtatgaatg tcatgatgta ctacatcgta 900 tatatatttc aaatggcagg ttattcaggt aatactaatt tagttccttc actcattcag 960 tatattataa atatggctgt tacggtcccc gcattgttct gtcttgatct gcttggcagg 1020 aggacaattt tattagctgg cgccgctttt atgatggcct ggcaatttgg tgttgctggc 1080 attttagcta cttattcaga gccagcctat atttcagata ccgtgagaat tacaattcca 1140 gatgaccata aaagtgccgc taagggtgtc atcgcttgct gctatttgtt tgtttgttcc 1200 ttcgcctttt cctggggtgt aggtatctgg gtttattgtt cagaagtgtg gggtgatagt 1260 caatccagac aaagaggtgc tgcattggca acttctgcta attggatctt caatttcgca 1320 attgcaatgt ttacaccttc ttctttcaaa aatatcactt ggaagactta tatcatttat 1380 gctacatttt gtgcttgtat gttcattcat gttttttttt ttttccctga aacaaagggt 1440 aagagactag aagaaattgg acagctatgg gatgaaggtg tcccagcatg gagatctgca 1500 aaatggcaac ccactgtccc actagcaagt gacgctgaat tagctcacaa aatggatgtt 1560

gcacacgctg aacacgcaga cttattggca acccattctc caagtagtga cgaaaaaact 1620 ggtaccgttt aa 1632 <210> SEQ ID NO 22 <211> LENGTH: 1575 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species HXT2.6 <400> SEQUENCE: 22 atgctgagca ctaccgatac cctcgaaaaa agggacaccg agcctttcac ttcagatgct 60 cctgtcacag tccatgacta tatcgcagag gagcgtccgt ggtggaaagt gccgcatttg 120 cgtgtattga cttggtctgt tttcgtgatc accctcacct ccaccaacaa cgggtatgat 180 ggcctgatgt tgaatggatt gcaatccttg gacatttggc aggaggattt gggtcaccct 240 gcgggccaga aattgggtgc cttggccaac ggtgttttgt ttggtaacct tgctgctgtg 300 ccttttgctt cgtatttctg cgatcgtttt ggtagaaggc cggtcatttg tttcggacag 360 atcttgacaa ttgttggtgc tgtattacaa ggtttgtcca acagctatgg attttttttg 420 ggttcgagaa ttgtgttggg ttttggtgct atgatagcca ctattccgct gccaacattg 480 atttccgaaa tcgcctaccc tacgcataga gaaacttcca ctttcgccta caacgtgtgc 540 tggtatttgg gagccattat cgcctcctgg gtcacatacg gcaccagaga tttacagagc 600 aaggcttgct ggtcaattcc ttcttatctc caggccgcct tacctttctt tcaagtgtgc 660 atgatttggt ttgtgccaga gtctcccaga ttcctcgttg ccaagggcaa gatcgaccaa 720 gcaagggctg ttttgtctaa ataccataca ggagactcga ctgaccccag agacgttgcg 780 ttggttgact ttgagctcca tgagattgag agtgcattgg agcaggaaaa attgaacact 840 cgctcgtcat actttgactt tttcaagaag agaaacttta gaaagagagg cttcttgtgt 900 gtcatggtcg gtgttgcaat gcagctttct ggaaacggct tagtgtccta ttacttgtcg 960 aaagtgctag actcgattgg aatcactgaa accaagagac agctcgagat caatggctgc 1020 ttgatgatct ataactttgt catctgcgtc tcgttgatga gtgtttgccg tatgttcaaa 1080 agaagagtat tatttctcac gtgtttctca ggaatgacgg tttgctacac gatatggacg 1140 attttgtcag cgcttaatga acagagacac tttgaggata aaggcttggc caatggcgtg 1200 ttggcaatga tcttcttcta ctattttttc tacaacgttg gcatcaatgg attgccattc 1260 ctatacatca ccgagatctt gccttactca cacagagcaa aaggcttgaa tttattccaa 1320 ttctcgcaat ttctcacgca aatctacaat ggctatgtga acccaatcgc catggacgca 1380 atcagctgga agtattacat tgtgtactgc tgtattctct tcgtggagtt ggtgattgtg 1440 tttttcacgt tcccagaaac ttcgggatac actttggagg aggtcgccca ggtatttggt 1500 gatgaggctc ccgggctcca caacagacaa ttggatgttg cgaaagaatc actcgagcat 1560 gttgagcatg tttga 1575 <210> SEQ ID NO 23 <211> LENGTH: 1605 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species HXT2.6 codon optimized for expression in S. cerevisiae <400> SEQUENCE: 23 atgagccagt ctaaagaaaa gtccaacgtt attaccaccg tcttgtctga agaattgcca 60 gttaagtact ccgaagaaat ctccgattac gtttaccatg atcaacattg gtggaagtac 120 aaccacttca gaaaattgca ttggtacatc ttcgttctga ctttgacttc taccaacaat 180 ggttacgatg gctctatgtt gaacggtcta caatctttgt ctacttggaa agatgctatg 240 ggtaatcctg aaggttacat tttgggtgct ttggctaatg gtactatttt cggtggtgtt 300 ttggctgttg cttttgcttc ttgggcttgt gatagatttg gtagaaagtt gactacctgc 360 ttcggttcta tcgttactgt tattggtgct atattgcaag gtgcctctac taattacgca 420 ttctttttcg tttcccgtat ggttattggt tttggtttcg gtctagcttc tgttgcttct 480 ccaactttga ttgctgaatt gtctttccca acttacagac caacttgtac tgccttgtac 540 aatgtttttt ggtacttggg tgctgttatt gctgcatggg ttacttatgg tactagaact 600 atcgtttctg cctactcttg gagaattcca tcttacttgc aaggtttgtt gccattggtt 660 caagtttgtt tggtttggtg ggttccagaa tctccaagat tcttggtttc taagggtaag 720 attgaaaagg ccagggaatt cttgattaag ttccatactg gtaacgacac ccaagaacaa 780 gctactagat tggtcgaatt tgagttgaaa gaaattgaag ccgccttgga gatggaaaag 840 attaactcta attctaagta caccgacttc atcaccatca agactttcag aaagagaatc 900 ttcttggttg ctttcactgc ttgtatgact caattgtctg gtaacggttt ggtgtcttac 960 tacttgtcca aggttttgat ctccattggt attaccggtg agaaagaaca attgcaaatc 1020 aacggttgcc tgatgatcta caacttggtt ttgtctttag ctgttgcctt cacctgttac 1080 ttgtttagaa gaaaggccct gttcatcttc tcttgctcat tcatgttgtt gtcctacgtt 1140 atttggacca ttctgtccgc tatcaatcaa cagagaaact tcgaacaaaa aggtctaggt 1200 caaggtgtct tggctatgat ttttatctac tacttggcct acaacatcgg tttgaatggt 1260 ttgccatact tgtacgttac cgaaatcttg ccatatactc atagagctaa gggcatcaac 1320 ttgtattcct tggttattaa catcaccctg atctataacg gtttcgttaa cgctattgct 1380 atggatgcta tttcctggaa gtactacatc gtttactgct gcattattgc cgttgaattg 1440 gttgttgtta tcttcaccta cgttgaaact ttcggttaca ccttggaaga agttgctaga 1500 gtttttgaag gtactgattc tttggccatg gacattaact tgaacggtac agtttccaac 1560 gaaaagatcg atatcgttca ctctgaaaga ggttcctctg cttaa 1605 <210> SEQ ID NO 24 <211> LENGTH: 1692 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species QUP2 <400> SEQUENCE: 24 atgggctttc gcaacttaaa gcgcaggctc tcaaatgttg gcgactccat gtcagtgcac 60 tctgtgaaag aggaggaaga cttctcccgc gtggaaatcc cggatgaaat ctacaactat 120 aagatcgtcc ttgtggcttt aacagcggcg tcggctgcca tcatcatcgg ctacgatgca 180 ggcttcattg gtggcacggt ttcgttgacg gcgttcaaac tggaatttgg cttggacaaa 240 atgtctgcga cggcggcttc tgctatcgaa gccaacgttg tttccgtgtt ccaggccggc 300 gcctactttg ggtgtctttt cttctatccg attggcgaga tttggggccg taaaatcggt 360 cttcttcttt ccggctttct tttgacgttt ggtgctgcta tttctttgat ttcgaactcg 420 tctcgtggcc ttggtgccat atatgctgga agagtactaa caggtttggg gattggcgga 480 tgtctgagtt tggccccaat ctacgtttct gaaatcgcgc ctgcagcaat cagaggcaag 540 cttgtgggct gctgggaagt gtcatggcag gtgggcggca ttgttggcta ctggatcaat 600 tacggagtct tgcagactct tccgattagc tcacaacaat ggatcatccc gtttgctgta 660 caattgatcc catcggggct tttctggggc ctttgtcttt tgattccaga gctgccacgt 720 tttcttgtat cgaagggaaa gatcgataag gcgcgcaaaa acttagcgta cttgcgtgga 780 cttagcgagg accaccccta ttctgttttt gagttggaga acattagtaa ggccattgaa 840 gagaacttcg agcaaacagg aaggggtttt ttcgacccat tgaaagcttt gtttttcagc 900 aaaaaaatgc tttaccgcct tctcttgtcc acgtcaatgt tcatgatgca gaatggctat 960 ggaatcaatg ctgtgacata ctactcgccc acgatcttca aatccttagg cgttcagggc 1020 tcaaacgccg gtttgctctc aacaggaatt ttcggtcttc ttaaaggtgc cgcttcggtg 1080 ttctgggtct ttttcttggt tgacacattc ggccgccggt tttgtctttg ctacctctct 1140 ctcccctgct cgatctgcat gtggtatatt ggcgcataca tcaagattgc caacccttca 1200 gcgaagcttg ctgcaggaga cacagccacc accccagcag gaactgcagc gaaagcgatg 1260 ctttacatat ggacgatttt ctacggcatt acgtggaatg gtacgacctg ggtgatctgc 1320 gcggagattt tcccccagtc ggtgagaaca gccgcgcagg ccgtcaacgc ttcttctaat 1380 tggttctggg ctttcatgat cggccacttc actggccagg cgctcgagaa tattgggtac 1440 ggatactact tcttgtttgc ggcgtgctct gcaatcttcc ctgtggtagt ctggtttgtg 1500 taccccgaaa caaagggtgt gcctttggag gccgtggagt atttgttcga ggtgcgtcct 1560 tggaaagcgc actcatatgc tttggagaag taccagattg agtacaacga gggtgaattc 1620 caccaacata agcccgaagt actcttacaa gggtctgaaa actcggacac gagcgagaaa 1680 agcctcgcct ga 1692 <210> SEQ ID NO 25 <211> LENGTH: 2049 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species QUP2 codon optimized for expression in S. cerevisiae <400> SEQUENCE: 25 atgggtttca gaaacttgaa gagaagattg tctaacgttg gtgactccat gtctgttcac 60 tctgttaagg aagaagaaga cttctccaga gttgaaatcc cagatgaaat ctacaactac 120 aagatcgtct tggttgcttt gactgctgct tctgctgcta tcatcatcgg ttacgatgct 180 ggtttcattg gtggtactgt ttctttgact gctttcaagt ctgaattcgg tttggacaag 240 atgtctgcta ctgctgcttc tgctatcgaa atgggtttca gaaacttgaa gaggcgtttg 300 tctaatgttg gtgattccat gtctgttcac tccgtcaaag aagaagagga tttctccaga 360 gttgaaatcc cagacgaaat ctacaactac aagatcgttt tggttgcttt gactgctgct 420 tctgctgcta ttatcattgg ttatgatgct ggtttcatcg gtggtactgt ttctttgaca 480 gctttcaagt ctgaattcgg tttggataag atgtctgcta cagctgcttc agctattgaa 540 gctaatgttg tctctgtttt tcaagctggt gcttactttg gttgcctgtt tttttaccca 600 attggtgaaa tttggggtcg taagattggt ttgttgttgt ctggtttctt gttgactttt 660 ggtgctgcca tttccttgat ctctaattct tctagaggtt tgggtgctat ctatgctggt 720 agagttttga ctggtttagg tattggtggt tgttcttctt tagctcccat ctacgttagt 780 gaaattgctc cagctgcaat tagaggtaag ttagttggtt gttgggaagt ttcttggcaa 840 gttggtggta tcgttggtta ttggattaac tatggtgtct tgcaaaccct gccaatctct 900 tctcaacaat ggattattcc attcgccgtt caattgattc catctggttt gttttggggt 960 ttgtgcttgt tgattccaga atctccaaga ttcttggtgt ccaaaggtaa gattgataag 1020 gccagaaaga acttggctta cttgagaggt ttgtctgaag atcatccata ctccgttttt 1080

gagttggaga acatttccaa ggccatcgaa gaaaactttg aacaaacagg tagaggtttc 1140 ttcgacccat tgaaggcttt gtttttcagc aagaaaatgc tgtacaggct gctgttgtct 1200 acttctatgt ttatgatgca aaacggctac ggtattaacg ctgttactta ttactctccc 1260 accatcttta agtccttggg tgttcaaggt tctaatgccg gtttgttatc tactggtatt 1320 ttcggtttgt tgaaaggtgc cgcttctgtt ttttgggttt tcttcttggt tgataccttc 1380 ggtagaagat tctgtttgtg ctatttgtct ttgccatgct ctatctgcat gtggtatatt 1440 ggtgcctaca ttaagattgc taacccatct gctaaattgg ctgctggtga tactgctact 1500 actccagctg gtactgctgc taaagctatg ttgtatattt ggaccatctt ctacggtatc 1560 acttggaatg gtactacctg ggttatttgc gctgaaattt ttccacaatc tgttagaaca 1620 gctgctcaag ctgttaatgc ttcttctaat tggttttggg ccttcatgat tggtcatttt 1680 actggtcaag ctttggaaaa cattggttac ggttactact ttttgttcgc tgcttgttcc 1740 gctattttcc cagttgtagt ttggttcgtt tacccagaaa caaaaggtgt tccattggaa 1800 gctgttgaat acttgtttga agttagacca tggaaggctc attcttacgc tttagaaaag 1860 taccagatcg agtacaacga aggtgaattc catcaacata agccagaagt tttgttgcag 1920 ggttctgaaa actctgatac ctctgaaaag tctttggcct gaaacgaagg tgaattccac 1980 caacataagc cagaagtttt gttgcaaggt tctgaaaact ctgacacttc tgaaaagtct 2040 ttggcttaa 2049 <210> SEQ ID NO 26 <211> LENGTH: 1887 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species APS1/HGT19 <400> SEQUENCE: 26 atgtcagaaa agcctgttgt gtcgcacagc atcgacacga cgctgtctac gtcatcgaaa 60 caagtctatg acggtaactc gcttcttaag accctgaatg agcgcgatgg cgaacgcggc 120 aatatcttgt cgcagtacac tgaggaacag gccatgcaaa tgggccgcaa ctatgcgttg 180 aagcacaatt tagatgcgac actctttgga aaggcggccg cggtcgcaag aaacccatac 240 gagttcaatt cgatgagttt tttgaccgaa gaggaaaaag tcgcgcttaa cacggagcag 300 accaagaaat ggcacatccc aagaaagttg gtggaggtga ttgcattggg gtccatggcc 360 gctgcggtgc agggtatgga tgagtcggtg gtgaatggtg caacgctttt ctaccccacg 420 gcaatgggta tcacagatat caagaatgcc gatttgattg aaggtttgat caacggtgcg 480 ccctatcttt gctgcgccat catgtgctgg acatctgatt actggaacag gaagttgggc 540 cgtaagtgga ccattttctg gacatgtgcc atttctgcaa tcacatgtat ctggcaaggt 600 ctcgtcaatt tgaaatggta ccatttgttc attgcgcgtt tctgcttggg tttcggtatc 660 ggtgtcaagt ctgccaccgt gcctgcgtat gctgccgaaa ccaccccggc caaaatcaga 720 ggctcgttgg tcatgctttg gcagttcttc accgctgtcg gaatcatgct tggttacgtg 780 gcgtctttgg cattctatta cattggtgac aatggcattt ctggcggctt gaactggaga 840 ttgatgctag gatctgcatg tcttccagct atcgttgtgt tagtccaagt tccgtttgtt 900 ccagaatccc ctcgttggct catgggtaag gaaagacacg ctgaagcata tgattcgctc 960 cggcaattgc ggttcagtga aatcgaggcg gcccgtgact gtttctacca gtacgtgttg 1020 ttgaaagagg agggctctta tggaacgcag ccattcttca gcagaatcaa ggagatgttc 1080 accgtgagaa gaaacagaaa tggtgcattg ggcgcgtgga tcgtcatgtt catgcagcag 1140 ttctgtggaa tcaacgtcat tgcttactac tcgtcgtcga tcttcgtgga gtcgaatctt 1200 tctgagatca aggccatgtt ggcgtcttgg gggttcggta tgatcaattt cttgtttgca 1260 attccagcgt tctacaccat tgacacgttt ggccgacgca acttgttgct cactactttc 1320 cctcttatgg cggtattctt actcatggcc ggattcgggt tctggatccc gttcgagaca 1380 aacccacacg gccgtttggc ggtgatcact attggtatct atttgtttgc atgtgtctac 1440 tctgcgggcg agggaccagt tcccttcaca tactctgccg aagcattccc gttgtatatc 1500 cgtgacttgg gtatgggctt tgccacggcc acgtgttggt tcttcaactt cattttggca 1560 ttttcctggc ctagaatgaa gaatgcattc aagcctcaag gtgcctttgg ctggtatgcc 1620 gcctggaaca ttgttggctt cttcttagtg ttatggttct tgcccgagac aaagggcttg 1680 acgttggagg aattggacga agtgtttgat gtgcctttga gaaaacacgc gcactaccgt 1740 accaaagaat tagtatacaa cttgcgcaaa tacttcttga ggcagaaccc taagccattg 1800 ccgccacttt atgcacacca aagaatggct gttaccaacc cagaatggtt ggaaaagacc 1860 gaggtcacgc acgaggagaa tatctag 1887 <210> SEQ ID NO 27 <211> LENGTH: 1887 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: sequence of H0 Metschnikowia species APS1/HGT19 codon optimized for expression in S. cerevisiae <400> SEQUENCE: 27 atgtctgaaa agccagttgt ttctcactct atcgacacca cctcttctac ctcttctaag 60 caagtctacg acggtaactc tttgttgaag acctctaacg aaagagacgg tgaaagaggt 120 aacatcttgt ctcaatacac tgaagaacaa gcaatgcaaa tgggtagaaa ctacgctttg 180 aagcacaact tggacgctac cttgttcggt aaggctgctg ctgtcgctag aaacccatac 240 gagttcaact ctatgtcttt cttgaccgaa gaagaaaagg tcgctttgaa caccgaacaa 300 accaagaagt ggcacatccc aagaaagttg gttgaagtta ttgctttggg ttctatggct 360 gctgctgttc aaggtatgga cgaatctgtt gttaacggtg ctaccttgtt ctacccaacc 420 gctatgggta tcaccgacat caagaacgct gacttgattg aaggtttgat taacggtgcc 480 ccatacttgt gttgtgctat tatgtgttgg acctctgact actggaacag aaagttgggt 540 agaaagtgga ccattttctg gacctgtgct atttctgcta tcacctgtat ctggcaaggt 600 ttggtcaact tgaagtggta tcacttgttc attgctagat tctgtttggg tttcggtatc 660 ggtgtcaagt ctgctaccgt tccagcctac gctgctgaaa ccaccccagc caagattaga 720 ggttctttgg ttatgttgtg gcaattcttc accgctgtcg gtattatgtt gggttacgtt 780 gcttctttgg ctttctacta cattggtgac aacggtattt ctggtggttt gaactggaga 840 ttgatgttgg gttctgcttg tttgccagcc atcgttgttt tggtccaagt tccattcgtt 900 ccagaatctc caagatggtt gatgggtaag gaaagacacg ctgaagccta cgactctttg 960 agacaattga gattctctga aatcgaagcc gctagagact gtttctacca atacgttttg 1020 ttgaaggaag aaggttctta cggtactcaa ccattcttct ctagaatcaa ggaaatgttc 1080 accgttagaa gaaacagaaa cggtgctttg ggtgcttgga ttgttatgtt tatgcaacaa 1140 ttctgtggta tcaacgtcat tgcttactac tcttcttcta tcttcgttga atctaacttg 1200 tctgaaatca aggctatgtt ggcttcttgg ggtttcggta tgattaactt cttgttcgct 1260 attccagcct tctacaccat tgacaccttc ggtagaagaa acttgttgtt gactactttc 1320 ccattgatgg ctgttttctt gttgatggct ggtttcggtt tctggattcc attcgaaacc 1380 aacccacacg gtagattggc tgttatcact attggtatct acttgttcgc ttgtgtctac 1440 tctgctggtg aaggtccagt tccattcacc tactctgctg aagccttccc attgtacatc 1500 agagacttgg gtatgggttt cgctaccgct acctgttggt tcttcaactt cattttggct 1560 ttctcttggc caagaatgaa gaacgctttc aagcctcaag gtgctttcgg ttggtacgct 1620 gcttggaaca ttgttggttt cttcttggtt ttgtggttct tgccagaaac taagggtttg 1680 actttggaag aattggacga agttttcgac gttccattga gaaagcacgc tcactacaga 1740 actaaggaat tggtttacaa cttgagaaag tacttcttga gacaaaaccc aaagccattg 1800 ccaccattgt acgctcacca aagaatggct gttaccaacc cagaatggtt ggaaaagacc 1860 gaagtcaccc acgaagaaaa catctaa 1887 <210> SEQ ID NO 28 <211> LENGTH: 49 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Primer Y10 <400> SEQUENCE: 28 gaaaaaactg gtaccgttta atcagtactg acaataaaaa gattcttgt 49 <210> SEQ ID NO 29 <211> LENGTH: 49 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Primer Y10R <400> SEQUENCE: 29 taatttctct tcgtatccca tggttgttta tgttcggatg tgatgtgag 49 <210> SEQ ID NO 30 <211> LENGTH: 60 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Primer Y15 <400> SEQUENCE: 30 acgccgccat ccagtgtcga aaacgagctt tgtcttgtaa agagtcttcg gtcattttta 60 <210> SEQ ID NO 31 <211> LENGTH: 60 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Primer Y15R <400> SEQUENCE: 31 gcggccgcat aggccactag tggatctgat caatacatac aagcatctca caatcacaag 60 <210> SEQ ID NO 32 <211> LENGTH: 60 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Primer Y33 <400> SEQUENCE: 32 tttttcaccc acaacaaata atatcaaaag atgggttacg aggaaaagct tgtagcgccc 60 <210> SEQ ID NO 33 <211> LENGTH: 60 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Primer Y33R

<400> SEQUENCE: 33 acgagaacac ccagctaaac gcggtgcgcg ttagaccgtg cccgtcttct cgtctgaaga 60 <210> SEQ ID NO 34 <211> LENGTH: 66 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Primer Y41 <400> SEQUENCE: 34 cagagcagat tgtactgaga gtgcaccagg cgcgccccat ccagtgtcga accatcatta 60 aaagat 66 <210> SEQ ID NO 35 <211> LENGTH: 68 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Primer Y41R <400> SEQUENCE: 35 ctccttacgc atctgtgcgg tatttcacac cgcactagac aatacataca agcatctcac 60 aatcacaa 68 <210> SEQ ID NO 36 <211> LENGTH: 38 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Primer Y53 <400> SEQUENCE: 36 tcagtactga caataaaaag attcttgttt tcaagaac 38 <210> SEQ ID NO 37 <211> LENGTH: 28 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Primer Y53R <400> SEQUENCE: 37 ctcacatcac atccgaacat aaacaacc 28 <210> SEQ ID NO 38 <211> LENGTH: 22 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Primer Y83 <400> SEQUENCE: 38 tatcccgtca cttccacatt cg 22 <210> SEQ ID NO 39 <211> LENGTH: 32 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Primer Y83R <400> SEQUENCE: 39 tattgatata gtgtttaagc gaatgacaga ag 32 <210> SEQ ID NO 40 <211> LENGTH: 62 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Primer Y96i <400> SEQUENCE: 40 atagaaagca aatagttata taatttttca tggacgtagg tctagagatc tgtttagctt 60 gc 62 <210> SEQ ID NO 41 <211> LENGTH: 66 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Primer Y95Ri <400> SEQUENCE: 41 aatgcaaaag cggctcctaa acagaaattc ttcagtcaat acatacaagc atctcacaat 60 cacaag 66 <210> SEQ ID NO 42 <211> LENGTH: 58 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Primer Y93Ri <400> SEQUENCE: 42 tcgtctatat caaaactgca tgtttctcta cgtctaatta agggttctcg agagctcg 58 <210> SEQ ID NO 43 <211> LENGTH: 56 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: Primer Y91i <400> SEQUENCE: 43 acttcaatag acttcaatag aaagcaaata gttatatgcc ctgaggatgt atctgg 56 <210> SEQ ID NO 44 <211> LENGTH: 628 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: ubiquitin-deficient H0 Metschnikowia species Aps1p/Hgt19 codon optimized for expression in S. cerevisiae (with K4R; K20R; K30R and K93R mutations) <400> SEQUENCE: 44 Met Ser Glu Arg Pro Val Val Ser His Ser Ile Asp Thr Thr Ser Ser 1 5 10 15 Thr Ser Ser Arg Gln Val Tyr Asp Gly Asn Ser Leu Leu Arg Thr Ser 20 25 30 Asn Glu Arg Asp Gly Glu Arg Gly Asn Ile Leu Ser Gln Tyr Thr Glu 35 40 45 Glu Gln Ala Met Gln Met Gly Arg Asn Tyr Ala Leu Lys His Asn Leu 50 55 60 Asp Ala Thr Leu Phe Gly Lys Ala Ala Ala Val Ala Arg Asn Pro Tyr 65 70 75 80 Glu Phe Asn Ser Met Ser Phe Leu Thr Glu Glu Glu Arg Val Ala Leu 85 90 95 Asn Thr Glu Gln Thr Lys Lys Trp His Ile Pro Arg Lys Leu Val Glu 100 105 110 Val Ile Ala Leu Gly Ser Met Ala Ala Ala Val Gln Gly Met Asp Glu 115 120 125 Ser Val Val Asn Gly Ala Thr Leu Phe Tyr Pro Thr Ala Met Gly Ile 130 135 140 Thr Asp Ile Lys Asn Ala Asp Leu Ile Glu Gly Leu Ile Asn Gly Ala 145 150 155 160 Pro Tyr Leu Cys Cys Ala Ile Met Cys Trp Thr Ser Asp Tyr Trp Asn 165 170 175 Arg Lys Leu Gly Arg Lys Trp Thr Ile Phe Trp Thr Cys Ala Ile Ser 180 185 190 Ala Ile Thr Cys Ile Trp Gln Gly Leu Val Asn Leu Lys Trp Tyr His 195 200 205 Leu Phe Ile Ala Arg Phe Cys Leu Gly Phe Gly Ile Gly Val Lys Ser 210 215 220 Ala Thr Val Pro Ala Tyr Ala Ala Glu Thr Thr Pro Ala Lys Ile Arg 225 230 235 240 Gly Ser Leu Val Met Leu Trp Gln Phe Phe Thr Ala Val Gly Ile Met 245 250 255 Leu Gly Tyr Val Ala Ser Leu Ala Phe Tyr Tyr Ile Gly Asp Asn Gly 260 265 270 Ile Ser Gly Gly Leu Asn Trp Arg Leu Met Leu Gly Ser Ala Cys Leu 275 280 285 Pro Ala Ile Val Val Leu Val Gln Val Pro Phe Val Pro Glu Ser Pro 290 295 300 Arg Trp Leu Met Gly Lys Glu Arg His Ala Glu Ala Tyr Asp Ser Leu 305 310 315 320 Arg Gln Leu Arg Phe Ser Glu Ile Glu Ala Ala Arg Asp Cys Phe Tyr 325 330 335 Gln Tyr Val Leu Leu Lys Glu Glu Gly Ser Tyr Gly Thr Gln Pro Phe 340 345 350 Phe Ser Arg Ile Lys Glu Met Phe Thr Val Arg Arg Asn Arg Asn Gly 355 360 365 Ala Leu Gly Ala Trp Ile Val Met Phe Met Gln Gln Phe Cys Gly Ile 370 375 380 Asn Val Ile Ala Tyr Tyr Ser Ser Ser Ile Phe Val Glu Ser Asn Leu 385 390 395 400 Ser Glu Ile Lys Ala Met Leu Ala Ser Trp Gly Phe Gly Met Ile Asn 405 410 415 Phe Leu Phe Ala Ile Pro Ala Phe Tyr Thr Ile Asp Thr Phe Gly Arg 420 425 430 Arg Asn Leu Leu Leu Thr Thr Phe Pro Leu Met Ala Val Phe Leu Leu 435 440 445 Met Ala Gly Phe Gly Phe Trp Ile Pro Phe Glu Thr Asn Pro His Gly 450 455 460 Arg Leu Ala Val Ile Thr Ile Gly Ile Tyr Leu Phe Ala Cys Val Tyr 465 470 475 480 Ser Ala Gly Glu Gly Pro Val Pro Phe Thr Tyr Ser Ala Glu Ala Phe 485 490 495 Pro Leu Tyr Ile Arg Asp Leu Gly Met Gly Phe Ala Thr Ala Thr Cys 500 505 510 Trp Phe Phe Asn Phe Ile Leu Ala Phe Ser Trp Pro Arg Met Lys Asn 515 520 525 Ala Phe Lys Pro Gln Gly Ala Phe Gly Trp Tyr Ala Ala Trp Asn Ile 530 535 540 Val Gly Phe Phe Leu Val Leu Trp Phe Leu Pro Glu Thr Lys Gly Leu 545 550 555 560

Thr Leu Glu Glu Leu Asp Glu Val Phe Asp Val Pro Leu Arg Lys His 565 570 575 Ala His Tyr Arg Thr Lys Glu Leu Val Tyr Asn Leu Arg Lys Tyr Phe 580 585 590 Leu Arg Gln Asn Pro Lys Pro Leu Pro Pro Leu Tyr Ala His Gln Arg 595 600 605 Met Ala Val Thr Asn Pro Glu Trp Leu Glu Lys Thr Glu Val Thr His 610 615 620 Glu Glu Asn Ile 625 <210> SEQ ID NO 45 <211> LENGTH: 548 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: ubiquitin-deficient H0 Metschnikowia species Hxt5p (with K7R; K10R, K29R; K43R and K58R mutations) <400> SEQUENCE: 45 Met Ser Ile Phe Glu Gly Arg Asp Gly Arg Gly Val Ser Ser Thr Glu 1 5 10 15 Ser Leu Ser Asn Asp Val Arg Tyr Asp Asn Met Glu Arg Val Asp Gln 20 25 30 Asp Val Leu Arg His Asn Phe Asn Phe Asp Arg Glu Phe Glu Glu Leu 35 40 45 Glu Ile Glu Ala Ala Gln Val Asn Asp Arg Pro Ser Phe Val Asp Arg 50 55 60 Ile Leu Ser Leu Glu Tyr Lys Leu His Phe Glu Asn Lys Asn His Met 65 70 75 80 Val Trp Leu Leu Gly Ala Phe Ala Ala Ala Ala Gly Leu Leu Ser Gly 85 90 95 Leu Asp Gln Ser Ile Ile Ser Gly Ala Ser Ile Gly Met Asn Lys Ala 100 105 110 Leu Asn Leu Thr Glu Arg Glu Ala Ser Leu Val Ser Ser Leu Met Pro 115 120 125 Leu Gly Ala Met Ala Gly Ser Met Ile Met Thr Pro Leu Asn Glu Trp 130 135 140 Phe Gly Arg Lys Ser Ser Leu Ile Ile Ser Cys Ile Trp Tyr Thr Ile 145 150 155 160 Gly Ser Ala Leu Cys Ala Gly Ala Arg Asp His His Met Met Tyr Ala 165 170 175 Gly Arg Phe Ile Leu Gly Val Gly Val Gly Ile Glu Gly Gly Cys Val 180 185 190 Gly Ile Tyr Ile Ser Glu Ser Val Pro Ala Asn Val Arg Gly Ser Ile 195 200 205 Val Ser Met Tyr Gln Phe Asn Ile Ala Leu Gly Glu Val Leu Gly Tyr 210 215 220 Ala Val Ala Ala Ile Phe Tyr Thr Val His Gly Gly Trp Arg Phe Met 225 230 235 240 Val Gly Ser Ser Leu Val Phe Ser Thr Ile Leu Phe Ala Gly Leu Phe 245 250 255 Phe Leu Pro Glu Ser Pro Arg Trp Leu Val His Lys Gly Arg Asn Gly 260 265 270 Met Ala Tyr Asp Val Trp Lys Arg Leu Arg Asp Ile Asn Asp Glu Ser 275 280 285 Ala Lys Leu Glu Phe Leu Glu Met Arg Gln Ala Ala Tyr Gln Glu Arg 290 295 300 Glu Arg Arg Ser Gln Glu Ser Leu Phe Ser Ser Trp Gly Glu Leu Phe 305 310 315 320 Thr Ile Ala Arg Asn Arg Arg Ala Leu Thr Tyr Ser Val Ile Met Ile 325 330 335 Thr Leu Gly Gln Leu Thr Gly Val Asn Ala Val Met Tyr Tyr Met Ser 340 345 350 Thr Leu Met Gly Ala Ile Gly Phe Asn Glu Lys Asp Ser Val Phe Met 355 360 365 Ser Leu Val Gly Gly Gly Ser Leu Leu Ile Gly Thr Ile Pro Ala Ile 370 375 380 Leu Trp Met Asp Arg Phe Gly Arg Arg Val Trp Gly Tyr Asn Leu Val 385 390 395 400 Gly Phe Phe Val Gly Leu Val Leu Val Gly Val Gly Tyr Arg Phe Asn 405 410 415 Pro Val Thr Gln Lys Ala Ala Ser Glu Gly Val Tyr Leu Thr Gly Leu 420 425 430 Ile Val Tyr Phe Leu Phe Phe Gly Ser Tyr Ser Thr Leu Thr Trp Val 435 440 445 Ile Pro Ser Glu Ser Phe Asp Leu Arg Thr Arg Ser Leu Gly Met Thr 450 455 460 Ile Cys Ser Thr Phe Leu Tyr Leu Trp Ser Phe Thr Val Thr Tyr Asn 465 470 475 480 Phe Thr Lys Met Ser Ala Ala Phe Thr Tyr Thr Gly Leu Thr Leu Gly 485 490 495 Phe Tyr Gly Gly Ile Ala Phe Leu Gly Leu Ile Tyr Gln Val Cys Phe 500 505 510 Met Pro Glu Thr Lys Asp Lys Thr Leu Glu Glu Ile Asp Asp Ile Phe 515 520 525 Asn Arg Ser Ala Phe Ser Ile Ala Arg Glu Asn Ile Ser Asn Leu Lys 530 535 540 Lys Gly Ile Trp 545 <210> SEQ ID NO 46 <211> LENGTH: 548 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: H0 Metschnikowia species Gxf2p/Gal2p (with K23R, K26R, K35R, K542R and K546R mutations) <400> SEQUENCE: 46 Met Ser Ala Glu Gln Glu Gln Gln Val Ser Gly Thr Ser Ala Thr Ile 1 5 10 15 Asp Gly Leu Ala Ser Leu Arg Gln Glu Arg Thr Ala Glu Glu Glu Asp 20 25 30 Ala Phe Arg Pro Lys Pro Ala Thr Ala Tyr Phe Phe Ile Ser Phe Leu 35 40 45 Cys Gly Leu Val Ala Phe Gly Gly Tyr Val Phe Gly Phe Asp Thr Gly 50 55 60 Thr Ile Ser Gly Phe Val Asn Met Asp Asp Tyr Leu Met Arg Phe Gly 65 70 75 80 Gln Gln His Ala Asp Gly Thr Tyr Tyr Leu Ser Asn Val Arg Thr Gly 85 90 95 Leu Ile Val Ser Ile Phe Asn Ile Gly Cys Ala Val Gly Gly Leu Ala 100 105 110 Leu Ser Lys Val Gly Asp Ile Trp Gly Arg Arg Ile Gly Ile Met Val 115 120 125 Ala Met Ile Ile Tyr Met Val Gly Ile Ile Ile Gln Ile Ala Ser Gln 130 135 140 Asp Lys Trp Tyr Gln Tyr Phe Ile Gly Arg Leu Ile Thr Gly Leu Gly 145 150 155 160 Val Gly Thr Thr Ser Val Leu Ser Pro Leu Phe Ile Ser Glu Ser Ala 165 170 175 Pro Lys His Leu Arg Gly Thr Leu Val Cys Cys Phe Gln Leu Met Val 180 185 190 Thr Leu Gly Ile Phe Leu Gly Tyr Cys Thr Thr Tyr Gly Thr Lys Asn 195 200 205 Tyr Thr Asp Ser Arg Gln Trp Arg Ile Pro Leu Gly Leu Cys Phe Ala 210 215 220 Trp Ala Leu Leu Leu Ile Ser Gly Met Val Phe Met Pro Glu Ser Pro 225 230 235 240 Arg Phe Leu Ile Glu Arg Gln Arg Phe Asp Glu Ala Lys Ala Ser Val 245 250 255 Ala Lys Ser Asn Gln Val Ser Thr Glu Asp Pro Ala Val Tyr Thr Glu 260 265 270 Val Glu Leu Ile Gln Ala Gly Ile Asp Arg Glu Ala Leu Ala Gly Ser 275 280 285 Ala Gly Trp Lys Glu Leu Ile Thr Gly Lys Pro Lys Met Leu Gln Arg 290 295 300 Val Ile Leu Gly Met Met Leu Gln Ser Ile Gln Gln Leu Thr Gly Asn 305 310 315 320 Asn Tyr Phe Phe Tyr Tyr Gly Thr Thr Ile Phe Lys Ala Val Gly Met 325 330 335 Ser Asp Ser Phe Gln Thr Ser Ile Val Leu Gly Ile Val Asn Phe Ala 340 345 350 Ser Thr Phe Val Gly Ile Trp Ala Ile Glu Arg Met Gly Arg Arg Ser 355 360 365 Cys Leu Leu Val Gly Ser Ala Cys Met Ser Val Cys Phe Leu Ile Tyr 370 375 380 Ser Ile Leu Gly Ser Val Asn Leu Tyr Ile Asp Gly Tyr Glu Asn Thr 385 390 395 400 Pro Ser Asn Thr Arg Lys Pro Thr Gly Asn Ala Met Ile Phe Ile Thr 405 410 415 Cys Leu Phe Ile Phe Phe Phe Ala Ser Thr Trp Ala Gly Gly Val Tyr 420 425 430 Ser Ile Val Ser Glu Thr Tyr Pro Leu Arg Ile Arg Ser Lys Gly Met 435 440 445 Ala Val Ala Thr Ala Ala Asn Trp Met Trp Gly Phe Leu Ile Ser Phe 450 455 460 Phe Thr Pro Phe Ile Thr Ser Ala Ile His Phe Tyr Tyr Gly Phe Val 465 470 475 480 Phe Thr Gly Cys Leu Ile Phe Ser Phe Phe Tyr Val Phe Phe Phe Val 485 490 495 Arg Glu Thr Lys Gly Leu Ser Leu Glu Glu Val Asp Glu Leu Tyr Ala 500 505 510 Thr Asp Leu Pro Pro Trp Lys Thr Ala Gly Trp Thr Pro Pro Ser Ala 515 520 525 Glu Asp Met Ala His Thr Thr Gly Phe Ala Glu Ala Ala Arg Pro Thr 530 535 540 Asn Arg His Val 545 <210> SEQ ID NO 47 <211> LENGTH: 544

<212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: ubiquitin-deficient H0 Metschnikowia species Gxf1p (with K9R and K24R mutations) <400> SEQUENCE: 47 Met Ser Gln Asp Glu Leu His Thr Arg Ser Gly Val Glu Thr Pro Ile 1 5 10 15 Asn Asp Ser Leu Leu Glu Glu Arg His Asp Val Thr Pro Leu Ala Ala 20 25 30 Leu Pro Glu Lys Ser Phe Lys Asp Tyr Ile Ser Ile Ser Ile Phe Cys 35 40 45 Leu Phe Val Ala Phe Gly Gly Phe Val Phe Gly Phe Asp Thr Gly Thr 50 55 60 Ile Ser Gly Phe Val Asn Met Ser Asp Phe Lys Thr Arg Phe Gly Glu 65 70 75 80 Met Asn Ala Gln Gly Glu Tyr Tyr Leu Ser Asn Val Arg Thr Gly Leu 85 90 95 Met Val Ser Ile Phe Asn Val Gly Cys Ala Val Gly Gly Ile Phe Leu 100 105 110 Cys Lys Ile Ala Asp Val Tyr Gly Arg Arg Ile Gly Leu Met Phe Ser 115 120 125 Met Val Val Tyr Val Val Gly Ile Ile Ile Gln Ile Ala Ser Thr Thr 130 135 140 Lys Trp Tyr Gln Tyr Phe Ile Gly Arg Leu Ile Ala Gly Leu Ala Val 145 150 155 160 Gly Thr Val Ser Val Ile Ser Pro Leu Phe Ile Ser Glu Val Ala Pro 165 170 175 Lys Gln Leu Arg Gly Thr Leu Val Cys Cys Phe Gln Leu Cys Ile Thr 180 185 190 Leu Gly Ile Phe Leu Gly Tyr Cys Thr Thr Tyr Gly Thr Lys Thr Tyr 195 200 205 Thr Asp Ser Arg Gln Trp Arg Ile Pro Leu Gly Ile Cys Phe Ala Trp 210 215 220 Ala Leu Phe Leu Val Ala Gly Met Leu Asn Met Pro Glu Ser Pro Arg 225 230 235 240 Tyr Leu Val Glu Lys Ser Arg Ile Asp Asp Ala Arg Lys Ser Ile Ala 245 250 255 Arg Ser Asn Lys Val Ser Glu Glu Asp Pro Ala Val Tyr Thr Glu Val 260 265 270 Gln Leu Ile Gln Ala Gly Ile Asp Arg Glu Ala Leu Ala Gly Ser Ala 275 280 285 Thr Trp Met Glu Leu Val Thr Gly Lys Pro Lys Ile Phe Arg Arg Val 290 295 300 Ile Met Gly Val Met Leu Gln Ser Leu Gln Gln Leu Thr Gly Asp Asn 305 310 315 320 Tyr Phe Phe Tyr Tyr Gly Thr Thr Ile Phe Lys Ala Val Gly Leu Gln 325 330 335 Asp Ser Phe Gln Thr Ser Ile Ile Leu Gly Ile Val Asn Phe Ala Ser 340 345 350 Thr Phe Val Gly Ile Tyr Ala Ile Glu Arg Met Gly Arg Arg Leu Cys 355 360 365 Leu Leu Thr Gly Ser Ala Cys Met Phe Val Cys Phe Ile Ile Tyr Ser 370 375 380 Leu Ile Gly Thr Gln His Leu Tyr Lys Asn Gly Phe Ser Asn Glu Pro 385 390 395 400 Ser Asn Thr Tyr Lys Pro Ser Gly Asn Ala Met Ile Phe Ile Thr Cys 405 410 415 Leu Tyr Ile Phe Phe Phe Ala Ser Thr Trp Ala Gly Gly Val Tyr Cys 420 425 430 Ile Val Ser Glu Ser Tyr Pro Leu Arg Ile Arg Ser Lys Ala Met Ser 435 440 445 Val Ala Thr Ala Ala Asn Trp Met Trp Gly Phe Leu Ile Ser Phe Phe 450 455 460 Thr Pro Phe Ile Thr Ser Ala Ile His Phe Tyr Tyr Gly Phe Val Phe 465 470 475 480 Thr Gly Cys Leu Ala Phe Ser Phe Phe Tyr Val Tyr Phe Phe Val Val 485 490 495 Glu Thr Lys Gly Leu Ser Leu Glu Glu Val Asp Ile Leu Tyr Ala Ser 500 505 510 Gly Thr Leu Pro Trp Lys Ser Ser Gly Trp Val Pro Pro Thr Ala Asp 515 520 525 Glu Met Ala His Asn Ala Phe Asp Asn Lys Pro Thr Asp Glu Gln Val 530 535 540 <210> SEQ ID NO 48 <211> LENGTH: 543 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: ubiquitin-deficient H0 Metschnikowia species Xyt1p (with K6R and S75L mutations) <400> SEQUENCE: 48 Met Gly Tyr Glu Glu Arg Leu Val Ala Pro Ala Leu Lys Phe Lys Asn 1 5 10 15 Phe Leu Asp Lys Thr Pro Asn Ile His Asn Val Tyr Val Ile Ala Ala 20 25 30 Ile Ser Cys Thr Ser Gly Met Met Phe Gly Phe Asp Ile Ser Ser Met 35 40 45 Ser Val Phe Val Asp Gln Gln Pro Tyr Leu Lys Met Phe Asp Asn Pro 50 55 60 Ser Ser Val Ile Gln Gly Phe Ile Thr Ala Leu Met Ser Leu Gly Ser 65 70 75 80 Phe Phe Gly Ser Leu Thr Ser Thr Phe Ile Ser Glu Pro Phe Gly Arg 85 90 95 Arg Ala Ser Leu Phe Ile Cys Gly Ile Leu Trp Val Ile Gly Ala Ala 100 105 110 Val Gln Ser Ser Ser Gln Asn Arg Ala Gln Leu Ile Cys Gly Arg Ile 115 120 125 Ile Ala Gly Trp Gly Ile Gly Phe Gly Ser Ser Val Ala Pro Val Tyr 130 135 140 Gly Ser Glu Met Ala Pro Arg Lys Ile Arg Gly Thr Ile Gly Gly Ile 145 150 155 160 Phe Gln Phe Ser Val Thr Val Gly Ile Phe Ile Met Phe Leu Ile Gly 165 170 175 Tyr Gly Cys Ser Phe Ile Gln Gly Lys Ala Ser Phe Arg Ile Pro Trp 180 185 190 Gly Val Gln Met Val Pro Gly Leu Ile Leu Leu Ile Gly Leu Phe Phe 195 200 205 Ile Pro Glu Ser Pro Arg Trp Leu Ala Lys Gln Gly Tyr Trp Glu Asp 210 215 220 Ala Glu Ile Ile Val Ala Asn Val Gln Ala Lys Gly Asn Arg Asn Asp 225 230 235 240 Ala Asn Val Gln Ile Glu Met Ser Glu Ile Lys Asp Gln Leu Met Leu 245 250 255 Asp Glu His Leu Lys Glu Phe Thr Tyr Ala Asp Leu Phe Thr Lys Lys 260 265 270 Tyr Arg Gln Arg Thr Ile Thr Ala Ile Phe Ala Gln Ile Trp Gln Gln 275 280 285 Leu Thr Gly Met Asn Val Met Met Tyr Tyr Ile Val Tyr Ile Phe Gln 290 295 300 Met Ala Gly Tyr Ser Gly Asn Thr Asn Leu Val Pro Ser Leu Ile Gln 305 310 315 320 Tyr Ile Ile Asn Met Ala Val Thr Val Pro Ala Leu Phe Cys Leu Asp 325 330 335 Leu Leu Gly Arg Arg Thr Ile Leu Leu Ala Gly Ala Ala Phe Met Met 340 345 350 Ala Trp Gln Phe Gly Val Ala Gly Ile Leu Ala Thr Tyr Ser Glu Pro 355 360 365 Ala Tyr Ile Ser Asp Thr Val Arg Ile Thr Ile Pro Asp Asp His Lys 370 375 380 Ser Ala Ala Lys Gly Val Ile Ala Cys Cys Tyr Leu Phe Val Cys Ser 385 390 395 400 Phe Ala Phe Ser Trp Gly Val Gly Ile Trp Val Tyr Cys Ser Glu Val 405 410 415 Trp Gly Asp Ser Gln Ser Arg Gln Arg Gly Ala Ala Leu Ala Thr Ser 420 425 430 Ala Asn Trp Ile Phe Asn Phe Ala Ile Ala Met Phe Thr Pro Ser Ser 435 440 445 Phe Lys Asn Ile Thr Trp Lys Thr Tyr Ile Ile Tyr Ala Thr Phe Cys 450 455 460 Ala Cys Met Phe Ile His Val Phe Phe Phe Phe Pro Glu Thr Lys Gly 465 470 475 480 Lys Arg Leu Glu Glu Ile Gly Gln Leu Trp Asp Glu Gly Val Pro Ala 485 490 495 Trp Arg Ser Ala Lys Trp Gln Pro Thr Val Pro Leu Ala Ser Asp Ala 500 505 510 Glu Leu Ala His Lys Met Asp Val Ala His Ala Glu His Ala Asp Leu 515 520 525 Leu Ala Thr His Ser Pro Ser Ser Asp Glu Lys Thr Gly Thr Val 530 535 540 <210> SEQ ID NO 49 <211> LENGTH: 1887 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: ubiquitin-deficient H0 Metschnikowia species APS1/HGT19 (with K4R; K20R; K30R and K93R mutations) <400> SEQUENCE: 49 atgtctgaaa gaccagttgt ttctcactct atcgacacca cctcttctac ctcttctaga 60 caagtctacg acggtaactc tttgttgagg acctctaacg aaagagacgg tgaaagaggt 120 aacatcttgt ctcaatacac tgaagaacaa gcaatgcaaa tgggtagaaa ctacgctttg 180 aagcacaact tggacgctac cttgttcggt aaggctgctg ctgtcgctag aaacccatac 240 gagttcaact ctatgtcttt cttgaccgaa gaagaaagag tcgctttgaa caccgaacaa 300 accaagaagt ggcacatccc aagaaagttg gttgaagtta ttgctttggg ttctatggct 360 gctgctgttc aaggtatgga cgaatctgtt gttaacggtg ctaccttgtt ctacccaacc 420

gctatgggta tcaccgacat caagaacgct gacttgattg aaggtttgat taacggtgcc 480 ccatacttgt gttgtgctat tatgtgttgg acctctgact actggaacag aaagttgggt 540 agaaagtgga ccattttctg gacctgtgct atttctgcta tcacctgtat ctggcaaggt 600 ttggtcaact tgaagtggta tcacttgttc attgctagat tctgtttggg tttcggtatc 660 ggtgtcaagt ctgctaccgt tccagcctac gctgctgaaa ccaccccagc caagattaga 720 ggttctttgg ttatgttgtg gcaattcttc accgctgtcg gtattatgtt gggttacgtt 780 gcttctttgg ctttctacta cattggtgac aacggtattt ctggtggttt gaactggaga 840 ttgatgttgg gttctgcttg tttgccagcc atcgttgttt tggtccaagt tccattcgtt 900 ccagaatctc caagatggtt gatgggtaag gaaagacacg ctgaagccta cgactctttg 960 agacaattga gattctctga aatcgaagcc gctagagact gtttctacca atacgttttg 1020 ttgaaggaag aaggttctta cggtactcaa ccattcttct ctagaatcaa ggaaatgttc 1080 accgttagaa gaaacagaaa cggtgctttg ggtgcttgga ttgttatgtt tatgcaacaa 1140 ttctgtggta tcaacgtcat tgcttactac tcttcttcta tcttcgttga atctaacttg 1200 tctgaaatca aggctatgtt ggcttcttgg ggtttcggta tgattaactt cttgttcgct 1260 attccagcct tctacaccat tgacaccttc ggtagaagaa acttgttgtt gactactttc 1320 ccattgatgg ctgttttctt gttgatggct ggtttcggtt tctggattcc attcgaaacc 1380 aacccacacg gtagattggc tgttatcact attggtatct acttgttcgc ttgtgtctac 1440 tctgctggtg aaggtccagt tccattcacc tactctgctg aagccttccc attgtacatc 1500 agagacttgg gtatgggttt cgctaccgct acctgttggt tcttcaactt cattttggct 1560 ttctcttggc caagaatgaa gaacgctttc aagcctcaag gtgctttcgg ttggtacgct 1620 gcttggaaca ttgttggttt cttcttggtt ttgtggttct tgccagaaac taagggtttg 1680 actttggaag aattggacga agttttcgac gttccattga gaaagcacgc tcactacaga 1740 actaaggaat tggtttacaa cttgagaaag tacttcttga gacaaaaccc aaagccattg 1800 ccaccattgt acgctcacca aagaatggct gttaccaacc cagaatggtt ggaaaagacc 1860 gaagtcaccc acgaagaaaa catctaa 1887 <210> SEQ ID NO 50 <211> LENGTH: 1647 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: ubiquitin-deficient H0 Metschnikowia species HXT5 (with K7R; K10R, K29R; K43R and K58R mutations) <400> SEQUENCE: 50 atgtccattt tcgaaggtag ggatggtaga ggtgtttcct ctactgaatc cttgtctaac 60 gatgttagat acgacaacat ggaaagagtt gaccaagatg ttttgaggca caatttcaac 120 ttcgacagag agttcgaaga attggaaatt gaagctgccc aagttaacga tagaccatct 180 ttcgttgata ggatcttgtc tttggagtac aagttgcact tcgaaaacaa gaatcacatg 240 gtttggttgt tgggtgcttt tgctgctgct gcaggtttgt tgtctggttt ggatcaatct 300 attatttccg gtgcctctat cggtatgaac aaggctttga atttgaccga aagagaagcc 360 tctttggtca gttctttgat gccattgggt gctatggctg gttctatgat tatgactcca 420 ttgaatgaat ggttcggccg taaatcctcc ttgattattt cttgtatttg gtacaccatc 480 ggttctgctt tgtgtgctgg tgctagagat catcacatga tgtatgctgg tagattcatc 540 ttaggtgttg gtgttggtat tgaaggtggt tgcgttggta tctacatttc tgaatctgtt 600 ccagccaatg tcagaggttc tatcgtttct atgtaccagt tcaacattgc cttgggtgaa 660 gttttgggtt atgctgttgc tgctattttc tacactgttc atggtggttg gaggtttatg 720 gttggttctt ctttggtttt ctccaccatt ttgtttgccg gcttgttttt tttgccagaa 780 tctccaagat ggttggtcca taagggtaga aatggtatgg cttacgatgt ttggaagaga 840 ttgagagata tcaacgatga atccgccaag ttggaattct tggaaatgag acaagctgcc 900 taccaagaaa gagaaagaag atctcaagag tccttgtttt cttcatgggg tgagttgttt 960 accattgcta gaaatagaag ggctttgacc tactccgtta ttatgattac tttgggtcag 1020 ttgactggtg ttaacgctgt tatgtattac atgtctactt tgatgggtgc catcggtttt 1080 aacgaaaagg attctgtttt catgtccttg gttggtggtg gttctttgtt gattggtact 1140 attccagcta tcttgtggat ggatagattc ggtagaagag tttggggtta caatttggtt 1200 ggttttttcg tcggtttggt attggtcggt gttggttata gattcaaccc agttactcaa 1260 aaggctgctt ctgaaggtgt ttatttgact ggtttgatcg tctacttctt gttcttcggt 1320 tcttactcta cattgacctg ggttattcca tccgaatctt tcgatttgag aaccagatct 1380 ttgggtatga ccatttgctc tactttcttg tacttgtggt ctttcactgt cacttacaac 1440 ttcactaaga tgtctgctgc tttcacttac acaggtttga ctttgggttt ttacggtggt 1500 attgctttct tgggtttgat ctaccaagtt tgctttatgc cagaaactaa ggacaagacc 1560 ttggaagaaa tcgatgacat ctttaacaga tccgctttct ctattgccag ggaaaacatt 1620 agcaacttga agaaaggtat ctggtaa 1647 <210> SEQ ID NO 51 <211> LENGTH: 1647 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: ubiquitin-deficient H0 Metschnikowia species GXF2/GAL2 (with K23R, K26R, K35R, K542R and K546R mutations) <400> SEQUENCE: 51 atgtccgctg aacaagaaca acaagtttct ggtacttctg ccactattga tggtttggct 60 tctttgaggc aagaaaggac tgctgaagaa gaagatgctt ttaggccaaa accagctact 120 gcctacttct tcatttcttt cttgtgtggt ttggttgctt tcggtggtta cgtttttggt 180 tttgataccg gtactatctc cggtttcgtt aacatggatg attacttgat gagattcggt 240 caacaacatg ctgatggtac ttactacttg tccaatgtta gaaccggttt gatcgtcagt 300 attttcaaca ttggttgtgc tgttggtggt ttggcattgt ctaaagttgg tgatatttgg 360 ggtagaagaa tcggtattat ggttgccatg atcatctaca tggttggtat cattattcaa 420 atcgcctccc aagacaagtg gtatcaatac tttattggta gattgatcac cggtttgggt 480 gttggtacta cttctgtttt gtctcctttg ttcatttccg aatccgctcc aaaacatttg 540 agaggtactt tggtttgctg cttccaattg atggtaacct tgggtatttt cttgggttac 600 tgtactactt acggtactaa gaactacacc gattctagac aatggagaat tccattgggt 660 ttgtgttttg cttgggcctt gttgttgatt tctggtatgg tttttatgcc agaatcccca 720 agattcttga tcgaaagaca aagattcgat gaagctaagg cttctgttgc caagtctaat 780 caagtttcta ctgaagatcc agccgtttac actgaagttg aattgattca agccggtatt 840 gatagagaag ctttggctgg ttctgctggt tggaaagaat tgattactgg taagccaaag 900 atgttgcaaa gagtcatttt gggtatgatg ttacaatcca tccaacaatt gaccggtaac 960 aattacttct tctactacgg tacaaccatc ttcaaagctg ttggtatgtc cgattctttt 1020 caaacctcta tagtcttggg tatcgttaac ttcgcttcta cctttgttgg tatttgggcc 1080 attgaaagaa tgggtagaag atcttgtttg ttggttggtt cagcttgtat gtctgtttgc 1140 ttcttgatct actctatctt gggttcagtc aacttgtaca tcgatggtta cgaaaacact 1200 ccatctaaca ctagaaagcc aactggtaac gccatgattt tcattacctg tttgttcatc 1260 tttttcttcg cctctacttg ggctggtggt gtttattcta tagtttctga aacctaccca 1320 ttgagaatca gatctaaagg tatggctgtt gctactgctg ctaattggat gtggggtttt 1380 ttgatctctt tctttacccc attcatcacc tccgctattc atttttacta cggttttgtt 1440 ttcaccggtt gcttgatctt ctcattcttt tacgtattct ttttcgtccg tgaaactaag 1500 ggtttgtcct tggaagaagt tgacgaatta tacgctactg atttgccacc atggaaaact 1560 gcaggttgga ctccaccatc agctgaagat atggctcata caactggttt tgctgaagct 1620 gctaggccta caaacagaca cgtttga 1647 <210> SEQ ID NO 52 <211> LENGTH: 1635 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: ubiquitin-deficient H0 Metschnikowia species GXF1 (with K9R and K24R mutations) <400> SEQUENCE: 52 atgtctcaag atgaattgca caccagatct ggtgttgaaa ctccaatcaa cgactccttg 60 ttggaagaaa gacatgatgt tactccattg gctgctttgc cagaaaaatc tttcaaggac 120 tacatctcca tctccatttt ctgtttgttt gttgctttcg gtggtttcgt tttcggtttt 180 gatactggta ctatttccgg tttcgttaac atgtctgatt tcaagactag gttcggtgaa 240 atgaatgctc agggtgaata ttacttgtcc aacgttagaa ctggcctgat ggtttctatt 300 ttcaatgttg gttgtgctgt cggtggtatt ttcttgtgta aaattgctga tgtctacggt 360 agaaggatcg gtttgatgtt ttctatggtt gtctacgttg tcggtatcat tattcaaatt 420 gcttctacca ccaagtggta tcagtacttc attggtagat tgattgctgg tttggctgtt 480 ggtactgttt ctgttatttc ccctttgttc atttccgaag ttgctccaaa acaattgaga 540 ggtactttgg tttgctgttt ccaattgtgt attaccttgg gtatcttctt gggttactgt 600 actacttacg gtactaagac ttacaccgat tctagacaat ggcgtattcc attgggtatt 660 tgttttgctt gggctttgtt tttggttgcc ggtatgttga atatgccaga atctccaaga 720 tacttggtcg aaaagtccag aattgatgat gccagaaagt ccattgctag gtctaacaaa 780 gtttccgaag aagatccagc tgtttacacc gaagttcaat tgattcaagc cggtattgat 840 agagaagctt tggctggttc tgctacttgg atggaattgg ttactggtaa gcctaagatc 900 tttagaagag ttatcatggg tgtcatgttg caatccttgc aacaattgac tggtgacaac 960 tactttttct actacggtac aaccattttc aaggctgtcg gtttacaaga ttctttccaa 1020 acctccatca ttttgggtat cgttaacttc gcttctacct tcgttggtat ctacgctatt 1080 gaaagaatgg gtagaagatt gtgtttgttg acaggttctg cttgtatgtt cgtttgcttc 1140 atcatctact cattgatcgg tactcagcac ttgtacaaaa acggtttttc taacgaaccc 1200 tccaacactt acaaaccatc tggtaatgcc atgatcttca ttacctgcct gtacattttc 1260 tttttcgctt caacttgggc tggtggtgtt tactgtatag tttctgaatc ttacccactg 1320 aggatcagat ctaaagctat gtctgttgct actgctgcaa attggatgtg gggttttttg 1380 atttctttct ttaccccatt catcacctcc gctatccatt tttactatgg ttttgttttc 1440 accggttgct tggctttctc tttcttttac gtttacttct tcgtcgtcga gactaagggt 1500 ttgtctttgg aagaggttga tatcttgtat gcctctggta ctttgccatg gaaatcttca 1560 ggttgggttc caccaactgc tgacgaaatg gctcataatg cttttgataa caaaccaacc 1620

gatgaacagg tttaa 1635 <210> SEQ ID NO 53 <211> LENGTH: 1632 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: ubiquitin-deficient H0 Metschnikowia species XYT1 (with K6R and S75L mutations) <400> SEQUENCE: 53 atgggatacg aagagagatt agtggccccc gctttgaaat ttaagaactt tttggataag 60 accccaaata tacataacgt ttacgtaatt gcggcgatct cgtgtacctc aggtatgatg 120 ttcggtttcg atatatcgtc gatgtccgtg ttcgtggacc aacagccgta tttaaaaatg 180 tttgataacc ctagcagcgt gatacaaggg tttataactg cgttgatgtc tttggggagc 240 tttttcggat cgctaacgtc cacttttatt tcagaacctt ttggtagacg tgcctctttg 300 ttcatatgcg ggatcctttg ggtaattggg gcggcagttc aaagttcttc tcagaaccgt 360 gcgcagctta tttgtggccg aattattgca gggtggggca tcggattcgg ttctagcgtt 420 gcgccggtat acggttcaga aatggcccca cgcaaaatta gaggaacaat cggaggtatt 480 tttcaatttt ctgtcacggt cggaatattc ataatgttcc tgattggcta cggctgctca 540 tttatacaag gcaaggccag ttttagaatt ccgtggggag ttcaaatggt accaggtctc 600 attctgttga tcggactatt cttcattcct gaatccccaa gatggttagc caaacaaggc 660 tactgggaag acgctgagat catcgtagca aacgttcaag ctaagggtaa caggaacgat 720 gctaatgtgc aaattgaaat gtccgagata aaagatcagt taatgcttga cgagcattta 780 aaggagttta cttatgccga tttgtttacc aaaaaatacc ggcaaaggac gataacagct 840 atatttgccc aaatatggca acagctgaca ggtatgaatg tcatgatgta ctacatcgta 900 tatatatttc aaatggcagg ttattcaggt aatactaatt tagttccttc actcattcag 960 tatattataa atatggctgt tacggtcccc gcattgttct gtcttgatct gcttggcagg 1020 aggacaattt tattagctgg cgccgctttt atgatggcct ggcaatttgg tgttgctggc 1080 attttagcta cttattcaga gccagcctat atttcagata ccgtgagaat tacaattcca 1140 gatgaccata aaagtgccgc taagggtgtc atcgcttgct gctatttgtt tgtttgttcc 1200 ttcgcctttt cctggggtgt aggtatctgg gtttattgtt cagaagtgtg gggtgatagt 1260 caatccagac aaagaggtgc tgcattggca acttctgcta attggatctt caatttcgca 1320 attgcaatgt ttacaccttc ttctttcaaa aatatcactt ggaagactta tatcatttat 1380 gctacatttt gtgcttgtat gttcattcat gttttttttt ttttccctga aacaaagggt 1440 aagagactag aagaaattgg acagctatgg gatgaaggtg tcccagcatg gagatctgca 1500 aaatggcaac ccactgtccc actagcaagt gacgctgaat tagctcacaa aatggatgtt 1560 gcacacgctg aacacgcaga cttattggca acccattctc caagtagtga cgaaaaaact 1620 ggtaccgttt aa 1632 <210> SEQ ID NO 54 <211> LENGTH: 544 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: ubiquitin-deficient H0 Metschnikowia species Gxf1p (with K9R; K24R, K538R mutations) <400> SEQUENCE: 54 Met Ser Gln Asp Glu Leu His Thr Arg Ser Gly Val Glu Thr Pro Ile 1 5 10 15 Asn Asp Ser Leu Leu Glu Glu Arg His Asp Val Thr Pro Leu Ala Ala 20 25 30 Leu Pro Glu Lys Ser Phe Lys Asp Tyr Ile Ser Ile Ser Ile Phe Cys 35 40 45 Leu Phe Val Ala Phe Gly Gly Phe Val Phe Gly Phe Asp Thr Gly Thr 50 55 60 Ile Ser Gly Phe Val Asn Met Ser Asp Phe Lys Thr Arg Phe Gly Glu 65 70 75 80 Met Asn Ala Gln Gly Glu Tyr Tyr Leu Ser Asn Val Arg Thr Gly Leu 85 90 95 Met Val Ser Ile Phe Asn Val Gly Cys Ala Val Gly Gly Ile Phe Leu 100 105 110 Cys Lys Ile Ala Asp Val Tyr Gly Arg Arg Ile Gly Leu Met Phe Ser 115 120 125 Met Val Val Tyr Val Val Gly Ile Ile Ile Gln Ile Ala Ser Thr Thr 130 135 140 Lys Trp Tyr Gln Tyr Phe Ile Gly Arg Leu Ile Ala Gly Leu Ala Val 145 150 155 160 Gly Thr Val Ser Val Ile Ser Pro Leu Phe Ile Ser Glu Val Ala Pro 165 170 175 Lys Gln Leu Arg Gly Thr Leu Val Cys Cys Phe Gln Leu Cys Ile Thr 180 185 190 Leu Gly Ile Phe Leu Gly Tyr Cys Thr Thr Tyr Gly Thr Lys Thr Tyr 195 200 205 Thr Asp Ser Arg Gln Trp Arg Ile Pro Leu Gly Ile Cys Phe Ala Trp 210 215 220 Ala Leu Phe Leu Val Ala Gly Met Leu Asn Met Pro Glu Ser Pro Arg 225 230 235 240 Tyr Leu Val Glu Lys Ser Arg Ile Asp Asp Ala Arg Lys Ser Ile Ala 245 250 255 Arg Ser Asn Lys Val Ser Glu Glu Asp Pro Ala Val Tyr Thr Glu Val 260 265 270 Gln Leu Ile Gln Ala Gly Ile Asp Arg Glu Ala Leu Ala Gly Ser Ala 275 280 285 Thr Trp Met Glu Leu Val Thr Gly Lys Pro Lys Ile Phe Arg Arg Val 290 295 300 Ile Met Gly Val Met Leu Gln Ser Leu Gln Gln Leu Thr Gly Asp Asn 305 310 315 320 Tyr Phe Phe Tyr Tyr Gly Thr Thr Ile Phe Lys Ala Val Gly Leu Gln 325 330 335 Asp Ser Phe Gln Thr Ser Ile Ile Leu Gly Ile Val Asn Phe Ala Ser 340 345 350 Thr Phe Val Gly Ile Tyr Ala Ile Glu Arg Met Gly Arg Arg Leu Cys 355 360 365 Leu Leu Thr Gly Ser Ala Cys Met Phe Val Cys Phe Ile Ile Tyr Ser 370 375 380 Leu Ile Gly Thr Gln His Leu Tyr Lys Asn Gly Phe Ser Asn Glu Pro 385 390 395 400 Ser Asn Thr Tyr Lys Pro Ser Gly Asn Ala Met Ile Phe Ile Thr Cys 405 410 415 Leu Tyr Ile Phe Phe Phe Ala Ser Thr Trp Ala Gly Gly Val Tyr Cys 420 425 430 Ile Val Ser Glu Ser Tyr Pro Leu Arg Ile Arg Ser Lys Ala Met Ser 435 440 445 Val Ala Thr Ala Ala Asn Trp Met Trp Gly Phe Leu Ile Ser Phe Phe 450 455 460 Thr Pro Phe Ile Thr Ser Ala Ile His Phe Tyr Tyr Gly Phe Val Phe 465 470 475 480 Thr Gly Cys Leu Ala Phe Ser Phe Phe Tyr Val Tyr Phe Phe Val Val 485 490 495 Glu Thr Lys Gly Leu Ser Leu Glu Glu Val Asp Ile Leu Tyr Ala Ser 500 505 510 Gly Thr Leu Pro Trp Lys Ser Ser Gly Trp Val Pro Pro Thr Ala Asp 515 520 525 Glu Met Ala His Asn Ala Phe Asp Asn Arg Pro Thr Asp Glu Gln Val 530 535 540 <210> SEQ ID NO 55 <211> LENGTH: 543 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: ubiquitin-deficient H0 Metschnikowia species Xyt1p (with K6R, S75L, K517R, K539R mutations) <400> SEQUENCE: 55 Met Gly Tyr Glu Glu Arg Leu Val Ala Pro Ala Leu Lys Phe Lys Asn 1 5 10 15 Phe Leu Asp Lys Thr Pro Asn Ile His Asn Val Tyr Val Ile Ala Ala 20 25 30 Ile Ser Cys Thr Ser Gly Met Met Phe Gly Phe Asp Ile Ser Ser Met 35 40 45 Ser Val Phe Val Asp Gln Gln Pro Tyr Leu Lys Met Phe Asp Asn Pro 50 55 60 Ser Ser Val Ile Gln Gly Phe Ile Thr Ala Leu Met Ser Leu Gly Ser 65 70 75 80 Phe Phe Gly Ser Leu Thr Ser Thr Phe Ile Ser Glu Pro Phe Gly Arg 85 90 95 Arg Ala Ser Leu Phe Ile Cys Gly Ile Leu Trp Val Ile Gly Ala Ala 100 105 110 Val Gln Ser Ser Ser Gln Asn Arg Ala Gln Leu Ile Cys Gly Arg Ile 115 120 125 Ile Ala Gly Trp Gly Ile Gly Phe Gly Ser Ser Val Ala Pro Val Tyr 130 135 140 Gly Ser Glu Met Ala Pro Arg Lys Ile Arg Gly Thr Ile Gly Gly Ile 145 150 155 160 Phe Gln Phe Ser Val Thr Val Gly Ile Phe Ile Met Phe Leu Ile Gly 165 170 175 Tyr Gly Cys Ser Phe Ile Gln Gly Lys Ala Ser Phe Arg Ile Pro Trp 180 185 190 Gly Val Gln Met Val Pro Gly Leu Ile Leu Leu Ile Gly Leu Phe Phe 195 200 205 Ile Pro Glu Ser Pro Arg Trp Leu Ala Lys Gln Gly Tyr Trp Glu Asp 210 215 220 Ala Glu Ile Ile Val Ala Asn Val Gln Ala Lys Gly Asn Arg Asn Asp 225 230 235 240 Ala Asn Val Gln Ile Glu Met Ser Glu Ile Lys Asp Gln Leu Met Leu 245 250 255 Asp Glu His Leu Lys Glu Phe Thr Tyr Ala Asp Leu Phe Thr Lys Lys 260 265 270 Tyr Arg Gln Arg Thr Ile Thr Ala Ile Phe Ala Gln Ile Trp Gln Gln 275 280 285

Leu Thr Gly Met Asn Val Met Met Tyr Tyr Ile Val Tyr Ile Phe Gln 290 295 300 Met Ala Gly Tyr Ser Gly Asn Thr Asn Leu Val Pro Ser Leu Ile Gln 305 310 315 320 Tyr Ile Ile Asn Met Ala Val Thr Val Pro Ala Leu Phe Cys Leu Asp 325 330 335 Leu Leu Gly Arg Arg Thr Ile Leu Leu Ala Gly Ala Ala Phe Met Met 340 345 350 Ala Trp Gln Phe Gly Val Ala Gly Ile Leu Ala Thr Tyr Ser Glu Pro 355 360 365 Ala Tyr Ile Ser Asp Thr Val Arg Ile Thr Ile Pro Asp Asp His Lys 370 375 380 Ser Ala Ala Lys Gly Val Ile Ala Cys Cys Tyr Leu Phe Val Cys Ser 385 390 395 400 Phe Ala Phe Ser Trp Gly Val Gly Ile Trp Val Tyr Cys Ser Glu Val 405 410 415 Trp Gly Asp Ser Gln Ser Arg Gln Arg Gly Ala Ala Leu Ala Thr Ser 420 425 430 Ala Asn Trp Ile Phe Asn Phe Ala Ile Ala Met Phe Thr Pro Ser Ser 435 440 445 Phe Lys Asn Ile Thr Trp Lys Thr Tyr Ile Ile Tyr Ala Thr Phe Cys 450 455 460 Ala Cys Met Phe Ile His Val Phe Phe Phe Phe Pro Glu Thr Lys Gly 465 470 475 480 Lys Arg Leu Glu Glu Ile Gly Gln Leu Trp Asp Glu Gly Val Pro Ala 485 490 495 Trp Arg Ser Ala Lys Trp Gln Pro Thr Val Pro Leu Ala Ser Asp Ala 500 505 510 Glu Leu Ala His Arg Met Asp Val Ala His Ala Glu His Ala Asp Leu 515 520 525 Leu Ala Thr His Ser Pro Ser Ser Asp Glu Arg Thr Gly Thr Val 530 535 540 <210> SEQ ID NO 56 <211> LENGTH: 1635 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: ubiquitin-deficient H0 Metschnikowia species GXF1 (with K9R; K24R, K538R mutations) <400> SEQUENCE: 56 atgtctcaag atgaattgca caccagatct ggtgttgaaa ctccaatcaa cgactccttg 60 ttggaagaaa gacatgatgt tactccattg gctgctttgc cagaaaaatc tttcaaggac 120 tacatctcca tctccatttt ctgtttgttt gttgctttcg gtggtttcgt tttcggtttt 180 gatactggta ctatttccgg tttcgttaac atgtctgatt tcaagactag gttcggtgaa 240 atgaatgctc agggtgaata ttacttgtcc aacgttagaa ctggcctgat ggtttctatt 300 ttcaatgttg gttgtgctgt cggtggtatt ttcttgtgta aaattgctga tgtctacggt 360 agaaggatcg gtttgatgtt ttctatggtt gtctacgttg tcggtatcat tattcaaatt 420 gcttctacca ccaagtggta tcagtacttc attggtagat tgattgctgg tttggctgtt 480 ggtactgttt ctgttatttc ccctttgttc atttccgaag ttgctccaaa acaattgaga 540 ggtactttgg tttgctgttt ccaattgtgt attaccttgg gtatcttctt gggttactgt 600 actacttacg gtactaagac ttacaccgat tctagacaat ggcgtattcc attgggtatt 660 tgttttgctt gggctttgtt tttggttgcc ggtatgttga atatgccaga atctccaaga 720 tacttggtcg aaaagtccag aattgatgat gccagaaagt ccattgctag gtctaacaaa 780 gtttccgaag aagatccagc tgtttacacc gaagttcaat tgattcaagc cggtattgat 840 agagaagctt tggctggttc tgctacttgg atggaattgg ttactggtaa gcctaagatc 900 tttagaagag ttatcatggg tgtcatgttg caatccttgc aacaattgac tggtgacaac 960 tactttttct actacggtac aaccattttc aaggctgtcg gtttacaaga ttctttccaa 1020 acctccatca ttttgggtat cgttaacttc gcttctacct tcgttggtat ctacgctatt 1080 gaaagaatgg gtagaagatt gtgtttgttg acaggttctg cttgtatgtt cgtttgcttc 1140 atcatctact cattgatcgg tactcagcac ttgtacaaaa acggtttttc taacgaaccc 1200 tccaacactt acaaaccatc tggtaatgcc atgatcttca ttacctgcct gtacattttc 1260 tttttcgctt caacttgggc tggtggtgtt tactgtatag tttctgaatc ttacccactg 1320 aggatcagat ctaaagctat gtctgttgct actgctgcaa attggatgtg gggttttttg 1380 atttctttct ttaccccatt catcacctcc gctatccatt tttactatgg ttttgttttc 1440 accggttgct tggctttctc tttcttttac gtttacttct tcgtcgtcga gactaagggt 1500 ttgtctttgg aagaggttga tatcttgtat gcctctggta ctttgccatg gaaatcttca 1560 ggttgggttc caccaactgc tgacgaaatg gctcataatg cttttgataa cagaccaacc 1620 gatgaacagg tttaa 1635 <210> SEQ ID NO 57 <211> LENGTH: 1632 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: ubiquitin-deficient H0 Metschnikowia species XYT1 (with K6R, S75L, K517R, K539R mutations) <400> SEQUENCE: 57 atgggatacg aagagagatt agtggccccc gctttgaaat ttaagaactt tttggataag 60 accccaaata tacataacgt ttacgtaatt gcggcgatct cgtgtacctc aggtatgatg 120 ttcggtttcg atatatcgtc gatgtccgtg ttcgtggacc aacagccgta tttaaaaatg 180 tttgataacc ctagcagcgt gatacaaggg tttataactg cgttgatgtc tttggggagc 240 tttttcggat cgctaacgtc cacttttatt tcagaacctt ttggtagacg tgcctctttg 300 ttcatatgcg ggatcctttg ggtaattggg gcggcagttc aaagttcttc tcagaaccgt 360 gcgcagctta tttgtggccg aattattgca gggtggggca tcggattcgg ttctagcgtt 420 gcgccggtat acggttcaga aatggcccca cgcaaaatta gaggaacaat cggaggtatt 480 tttcaatttt ctgtcacggt cggaatattc ataatgttcc tgattggcta cggctgctca 540 tttatacaag gcaaggccag ttttagaatt ccgtggggag ttcaaatggt accaggtctc 600 attctgttga tcggactatt cttcattcct gaatccccaa gatggttagc caaacaaggc 660 tactgggaag acgctgagat catcgtagca aacgttcaag ctaagggtaa caggaacgat 720 gctaatgtgc aaattgaaat gtccgagata aaagatcagt taatgcttga cgagcattta 780 aaggagttta cttatgccga tttgtttacc aaaaaatacc ggcaaaggac gataacagct 840 atatttgccc aaatatggca acagctgaca ggtatgaatg tcatgatgta ctacatcgta 900 tatatatttc aaatggcagg ttattcaggt aatactaatt tagttccttc actcattcag 960 tatattataa atatggctgt tacggtcccc gcattgttct gtcttgatct gcttggcagg 1020 aggacaattt tattagctgg cgccgctttt atgatggcct ggcaatttgg tgttgctggc 1080 attttagcta cttattcaga gccagcctat atttcagata ccgtgagaat tacaattcca 1140 gatgaccata aaagtgccgc taagggtgtc atcgcttgct gctatttgtt tgtttgttcc 1200 ttcgcctttt cctggggtgt aggtatctgg gtttattgtt cagaagtgtg gggtgatagt 1260 caatccagac aaagaggtgc tgcattggca acttctgcta attggatctt caatttcgca 1320 attgcaatgt ttacaccttc ttctttcaaa aatatcactt ggaagactta tatcatttat 1380 gctacatttt gtgcttgtat gttcattcat gttttttttt ttttccctga aacaaagggt 1440 aagagactag aagaaattgg acagctatgg gatgaaggtg tcccagcatg gagatctgca 1500 aaatggcaac ccactgtccc actagcaagt gacgctgaat tagctcacag aatggatgtt 1560 gcacacgctg aacacgcaga cttattggca acccattctc caagtagtga cgaaagaact 1620 ggtaccgttt aa 1632 <210> SEQ ID NO 58 <211> LENGTH: 548 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: ubiquitin-deficient H0 Metschnikowia species Gxf2p/Gal2p (with K23R, K26R, and K35R, mutations) <400> SEQUENCE: 58 Met Ser Ala Glu Gln Glu Gln Gln Val Ser Gly Thr Ser Ala Thr Ile 1 5 10 15 Asp Gly Leu Ala Ser Leu Arg Gln Glu Arg Thr Ala Glu Glu Glu Asp 20 25 30 Ala Phe Arg Pro Lys Pro Ala Thr Ala Tyr Phe Phe Ile Ser Phe Leu 35 40 45 Cys Gly Leu Val Ala Phe Gly Gly Tyr Val Phe Gly Phe Asp Thr Gly 50 55 60 Thr Ile Ser Gly Phe Val Asn Met Asp Asp Tyr Leu Met Arg Phe Gly 65 70 75 80 Gln Gln His Ala Asp Gly Thr Tyr Tyr Leu Ser Asn Val Arg Thr Gly 85 90 95 Leu Ile Val Ser Ile Phe Asn Ile Gly Cys Ala Val Gly Gly Leu Ala 100 105 110 Leu Ser Lys Val Gly Asp Ile Trp Gly Arg Arg Ile Gly Ile Met Val 115 120 125 Ala Met Ile Ile Tyr Met Val Gly Ile Ile Ile Gln Ile Ala Ser Gln 130 135 140 Asp Lys Trp Tyr Gln Tyr Phe Ile Gly Arg Leu Ile Thr Gly Leu Gly 145 150 155 160 Val Gly Thr Thr Ser Val Leu Ser Pro Leu Phe Ile Ser Glu Ser Ala 165 170 175 Pro Lys His Leu Arg Gly Thr Leu Val Cys Cys Phe Gln Leu Met Val 180 185 190 Thr Leu Gly Ile Phe Leu Gly Tyr Cys Thr Thr Tyr Gly Thr Lys Asn 195 200 205 Tyr Thr Asp Ser Arg Gln Trp Arg Ile Pro Leu Gly Leu Cys Phe Ala 210 215 220 Trp Ala Leu Leu Leu Ile Ser Gly Met Val Phe Met Pro Glu Ser Pro 225 230 235 240 Arg Phe Leu Ile Glu Arg Gln Arg Phe Asp Glu Ala Lys Ala Ser Val 245 250 255 Ala Lys Ser Asn Gln Val Ser Thr Glu Asp Pro Ala Val Tyr Thr Glu 260 265 270 Val Glu Leu Ile Gln Ala Gly Ile Asp Arg Glu Ala Leu Ala Gly Ser 275 280 285 Ala Gly Trp Lys Glu Leu Ile Thr Gly Lys Pro Lys Met Leu Gln Arg

290 295 300 Val Ile Leu Gly Met Met Leu Gln Ser Ile Gln Gln Leu Thr Gly Asn 305 310 315 320 Asn Tyr Phe Phe Tyr Tyr Gly Thr Thr Ile Phe Lys Ala Val Gly Met 325 330 335 Ser Asp Ser Phe Gln Thr Ser Ile Val Leu Gly Ile Val Asn Phe Ala 340 345 350 Ser Thr Phe Val Gly Ile Trp Ala Ile Glu Arg Met Gly Arg Arg Ser 355 360 365 Cys Leu Leu Val Gly Ser Ala Cys Met Ser Val Cys Phe Leu Ile Tyr 370 375 380 Ser Ile Leu Gly Ser Val Asn Leu Tyr Ile Asp Gly Tyr Glu Asn Thr 385 390 395 400 Pro Ser Asn Thr Arg Lys Pro Thr Gly Asn Ala Met Ile Phe Ile Thr 405 410 415 Cys Leu Phe Ile Phe Phe Phe Ala Ser Thr Trp Ala Gly Gly Val Tyr 420 425 430 Ser Ile Val Ser Glu Thr Tyr Pro Leu Arg Ile Arg Ser Lys Gly Met 435 440 445 Ala Val Ala Thr Ala Ala Asn Trp Met Trp Gly Phe Leu Ile Ser Phe 450 455 460 Phe Thr Pro Phe Ile Thr Ser Ala Ile His Phe Tyr Tyr Gly Phe Val 465 470 475 480 Phe Thr Gly Cys Leu Ile Phe Ser Phe Phe Tyr Val Phe Phe Phe Val 485 490 495 Arg Glu Thr Lys Gly Leu Ser Leu Glu Glu Val Asp Glu Leu Tyr Ala 500 505 510 Thr Asp Leu Pro Pro Trp Lys Thr Ala Gly Trp Thr Pro Pro Ser Ala 515 520 525 Glu Asp Met Ala His Thr Thr Gly Phe Ala Glu Ala Ala Lys Pro Thr 530 535 540 Asn Lys His Val 545 <210> SEQ ID NO 59 <211> LENGTH: 1647 <212> TYPE: DNA <213> ORGANISM: Artificial Sequence <220> FEATURE: <223> OTHER INFORMATION: ubiquitin-deficient H0 Metschnikowia species Gxf2p/Gal2p (with K23R, K26R, and K35R, mutations) <400> SEQUENCE: 59 atgtccgctg aacaagaaca acaagtttct ggtacttctg ccactattga tggtttggct 60 tctttgaggc aagaaaggac tgctgaagaa gaagatgctt ttaggccaaa accagctact 120 gcctacttct tcatttcttt cttgtgtggt ttggttgctt tcggtggtta cgtttttggt 180 tttgataccg gtactatctc cggtttcgtt aacatggatg attacttgat gagattcggt 240 caacaacatg ctgatggtac ttactacttg tccaatgtta gaaccggttt gatcgtcagt 300 attttcaaca ttggttgtgc tgttggtggt ttggcattgt ctaaagttgg tgatatttgg 360 ggtagaagaa tcggtattat ggttgccatg atcatctaca tggttggtat cattattcaa 420 atcgcctccc aagacaagtg gtatcaatac tttattggta gattgatcac cggtttgggt 480 gttggtacta cttctgtttt gtctcctttg ttcatttccg aatccgctcc aaaacatttg 540 agaggtactt tggtttgctg cttccaattg atggtaacct tgggtatttt cttgggttac 600 tgtactactt acggtactaa gaactacacc gattctagac aatggagaat tccattgggt 660 ttgtgttttg cttgggcctt gttgttgatt tctggtatgg tttttatgcc agaatcccca 720 agattcttga tcgaaagaca aagattcgat gaagctaagg cttctgttgc caagtctaat 780 caagtttcta ctgaagatcc agccgtttac actgaagttg aattgattca agccggtatt 840 gatagagaag ctttggctgg ttctgctggt tggaaagaat tgattactgg taagccaaag 900 atgttgcaaa gagtcatttt gggtatgatg ttacaatcca tccaacaatt gaccggtaac 960 aattacttct tctactacgg tacaaccatc ttcaaagctg ttggtatgtc cgattctttt 1020 caaacctcta tagtcttggg tatcgttaac ttcgcttcta cctttgttgg tatttgggcc 1080 attgaaagaa tgggtagaag atcttgtttg ttggttggtt cagcttgtat gtctgtttgc 1140 ttcttgatct actctatctt gggttcagtc aacttgtaca tcgatggtta cgaaaacact 1200 ccatctaaca ctagaaagcc aactggtaac gccatgattt tcattacctg tttgttcatc 1260 tttttcttcg cctctacttg ggctggtggt gtttattcta tagtttctga aacctaccca 1320 ttgagaatca gatctaaagg tatggctgtt gctactgctg ctaattggat gtggggtttt 1380 ttgatctctt tctttacccc attcatcacc tccgctattc atttttacta cggttttgtt 1440 ttcaccggtt gcttgatctt ctcattcttt tacgtattct ttttcgtccg tgaaactaag 1500 ggtttgtcct tggaagaagt tgacgaatta tacgctactg atttgccacc atggaaaact 1560 gcaggttgga ctccaccatc agctgaagat atggctcata caactggttt tgctgaagct 1620 gctaagccta caaacaaaca cgtttga 1647



User Contributions:

Comment about this patent or add new information about this topic:

CAPTCHA
New patent applications in this class:
DateTitle
2022-09-22Electronic device
2022-09-22Front-facing proximity detection using capacitive sensor
2022-09-22Touch-control panel and touch-control display apparatus
2022-09-22Sensing circuit with signal compensation
2022-09-22Reduced-size interfaces for managing alerts
Website © 2025 Advameg, Inc.