COMPOSITIONS AND METHODS FOR GENE EDITING

Abstract

Provided herein are, inter alia, compositions and methods for manipulation of genomes of living organisms.

Description

CROSS-REFERENCE TO RELATED APPLICATIONS

[0001] This application is a continuation under 35 USC .sctn. 120 of International Application No. PCT/US2019/028377 filed Apr. 19, 2019, which claims priority to U.S. Application No. 62/660,023 filed Apr. 19, 2018, the disclosure of which is incorporated by reference herein in its entirety.

REFERENCE TO A "SEQUENCE LISTING," A TABLE, OR A COMPUTER PROGRAM LISTING APPENDIX SUBMITTED AS AN ASCII FILE

[0003] The Sequence Listing written in file 048536-620001WO_SequenceListing_ST25.txt, created May 14, 2019, 382,771 bytes, machine format IBM-PC, MS Windows operating system, is hereby incorporated by reference.

BACKGROUND

[0004] Although considered a promising therapeutic approach for treatment of disease, genome editing carries inherent risks due to the potential for genotoxicity from double strand breaks. Further, genome editing often is associated with an all-or-none effect on the target gene (i.e., it produces a full knockout). In contrast, targeted epigenome engineering does not carry the risk of DSB-induced genotoxicity; further, it affords the opportunity to create a more graded effect on gene expression and thus function from a complete silencing through a less pronounced effect.

[0005] Provided herein are solutions to these and other needs in the art.

BRIEF SUMMARY

[0006] In an aspect is provided a fusion protein including a nuclease-deficient RNA-guided DNA endonuclease enzyme, a Kruppel associated box (KRAB) domain and a DNA methyltransferase domain. In an aspect is provided a fusion protein of any one of SEQ ID NOS:1-15.

[0007] In an aspect is provided a nucleic acid sequence encoding the fusion protein as described herein, including embodiments and aspects thereof.

[0008] In an aspect is provided a complex including a fusion protein as described herein, including embodiments and aspects thereof, and a polynucleotide including (1) a DNA-targeting sequence that is complementary to a target polynucleotide sequence and (2) a binding sequence for the nuclease-deficient RNA-guided DNA endonuclease enzyme, wherein the nuclease-deficient RNA-guided DNA endonuclease enzyme is bound to the polynucleotide via the binding sequence.

[0009] In an aspect is provided a vector including the nucleic acid sequence of a fusion protein as described herein, including embodiments and aspects thereof.

[0010] In an aspect is provided a cell including a fusion protein as described herein, including embodiments and aspects thereof, a nucleic acid as described herein, including embodiments and aspects thereof, a complex as described herein, including embodiments and aspects thereof, or a vector as described herein, including embodiments and aspects thereof.

[0011] In an aspect is provided a method of silencing a target nucleic acid sequence in a cell, including delivering a first polynucleotide encoding a fusion protein as described herein, including embodiments and aspects thereof, to a cell containing the target nucleic acid, and delivering to the cell a second polynucleotide including (i) a DNA-targeting sequence that is complementary to the target nucleic acid sequence, and (ii) a binding sequence for the nuclease-deficient RNA-guide DNA endonuclease enzyme. Without intending to be bound by any theory, it is believed that the fusion protein silences the target nucleic acid sequence in the cell by methylating a chromatin containing the target nucleic acid sequence and/or by introducing repressive chromatin marks to a chromatin containing the target nucleic acid sequence. Thus, in aspects, the fusion protein silences the target nucleic acid sequence in the cell by methylating a chromatin containing the target nucleic acid sequence and/or by introducing repressive chromatin marks to a chromatin containing the target nucleic acid sequence.

[0012] In an aspect is provided a method of silencing a target nucleic acid sequence in a cell, including delivering a complex as described herein, including embodiments and aspects thereof, to a cell containing the target nucleic acid, wherein the complex silences the target nucleic acid sequence in the cell. Without intending to be bound by any theory, it is believed that the complex silences the target nucleic acid sequence in the cell by methylating a chromatin containing the target nucleic acid sequence and/or by introducing repressive chromatin marks to a chromatin containing the target nucleic acid sequence. Thus, in aspects, the complex silences the target nucleic acid sequence in the cell by methylating a chromatin containing the target nucleic acid sequence and/or by introducing repressive chromatin marks to a chromatin containing the target nucleic acid sequence

BRIEF DESCRIPTION OF THE DRAWINGS

[0013] FIG. 1A-1F describe engineering of an all-in-one protein for long-term gene silencing. FIG. 1A is a schematic of an all-in-one protein (SEQ ID NO:1) of the disclosure that has the KRAB domain fused to the --N-terminus of dCas9 (SEQ ID NO:23), separated by a GGSGGGS (SEQ ID NO:17) linker, and Dnmt3A-Dnmt3L at the C-terminus of dCas9 (separated by a EASGSGRASPGIPGSTR (SEQ ID NO:19) linker). FIG. 1B provides schematics of dCas9-fused epigenetic modulators tested for permanent gene silencing. The dCas9-KRAB protein is adapted from Gilbert et al., Cell 2013 for CRISPR interference (CRISPRi) applications. The dCas9-Dnmt3A-Dnmt3L fusion is adapted from Stepper et al., Nucleic Acids Research, 2016. The inventors engineered a novel all-in-one protein that combines the KRAB domain (SEQ ID NO:16), dCas9 (D10A, H208A), Dnmt3A-Dnmt3L (SEQ ID NO:33; where Dnmt3A is SEQ ID NO:26 and Dnmt3L is SEQ ID NO:28) into one polypeptide. FIG. 1C provides schematics of a methylation-sensitive GFP reporter (adapted from Stelzer et al., Cell 2015) that was used to assess long-term silencing by the all-in-one protein. FIGS. 1D-1E provide a diagram and results of a hit-and-run experimental workflow in HEK293T cells expressing the GFP reporter shown in FIG. 3. FIG. 1D shows that plasmids were co-transfected into cells, one encoding the hit-and-run protein and the other plasmid encoding a sgRNA. FIG. 1E shows the results of the hit-and-run assay sorted for cells that were co-transfected with the all-in-one plasmid and sgRNA plasmid. FIG. 1F shows the results of the silencing of the GFP reporter is dependent on the sgRNA sequence.

[0014] FIGS. 2A-2F describe long-term silencing of endogenous genes. FIGS. 2A-2C are representative flow cytometry data shown taken 22 days post-transfection following gene (CD29, CD81, CD151) targeting for long term silencing using the all-in-one protein. Quadrant IV represents cells that have turned off the gene, indicated by the percentage of cells with the gene off (i.e., 45%, 66%, and 53%, respectively). FIG. 2D provides quantification of silencing of CD29, CD81, and CD151 with three different sgRNA. FIG. 2E provides quantification of silencing of two or three genes simultaneously to show that the all-in-protein can be multiplexed by co-delivery of sgRNAs targeting different genes. FIG. 2F provides a plot representing a time point taken 9 months post transfection of the all-in-one protein and sgRNA targeting the CLTA gene, signifying that the majority of cells have stably turned off the CLTA gene.

[0015] FIGS. 3A-3I describe long-term silencing of endogenous genes. FIGS. 3A-3C shows that harvested cells lost expression of CD29 (FIG. 3A), CD81 (FIG. 3B), and CD151 (FIG. 3C) thirty-six days post-transfection, as determined by their RNA expression profiles. FIGS. 3D-3F are volcano plots showing that the targeted genes CD29 (FIG. 3D), CD81 (FIG. 3E) and CD151 (FIG. 3F) is the only significant gene knocked down for each experiment, signifying high specificity of gene silencing. FIGS. 3G-3I provides quantification of transcript levels of CD151 (FIG. 3G), CD81 (GIF. 3H), and CD29 (FIG. 3I) showing more than 96% knockdown of each of the targeted genes.

[0016] FIGS. 4A-4H describe long-term gene silencing in different mammalian cell lines. FIGS. 4A-4F are flow cytometry plots showing BFP expression (which is fused to the all-in-one protein) in HeLa (cervical)(FIG. 4A), U20S (bone)(FIG. 4B), and human induced pluripotent cells (iPSC)(FIG. 4C). FIGS. 4D-4F are the untransfected controls for FIGS. 4A-4C, respectively. FIG. 4G shows that stable silencing of endogenous genes in HeLa and U20S cells, measured at 18 days post-transfection with the all-in-one protein, was achieved. In FIGS. 4A-4F, the x-axis is BFP (fused to all-in-one protein), and the y-axis is mCherry. FIG. 4H shows that gene silencing was detected 14 days post transfection by qPCR in AML12 mouse hepatocyte cell lines when targeting Pcsk9, Npc1, Spcs1 and Cd81.

[0017] FIG. 5 provides schematics of the fusion proteins p76, p90-p102, and p112 which correspond to SEQ ID NOS:1-15, respectively.

[0018] FIGS. 6A-6E describe gene silencing activities of all-in-one protein variants. FIGS. 6A-6B shows the gene silencing results 18 days post-transfection of the fusion proteins of SEQ ID NOS:1-15 transfected into HEK293T cells for targeted silencing of the CLTA gene. The dCas9-KRAB and dCas9-Dnmt3A-Dnmt3L designs showed transient and lower efficiency of long term silencing. FIGS. 6C-6D provide a comparison of SEQ ID NO:1 (p76) and SEQ ID NO:15 (p112) for silencing the HIST2H2BE (H2B) endogenous gene (FIG. 6C) and a synthetic Snrpn-GFP reporter gene (FIG. 6D) stably expressed in HEK293T cells. FIG. 6E provides a plot of protein expression (dotted lines) of p76 and p112 over the 50 day time course to turn off the HIST2H2BE (H2B) gene. Protein levels were measured by flow cytometry detection of BFP, which is co-expressed with the all-in-one protein.

[0019] FIGS. 7A-7B provide Western blots of all-in-one-protein variants. FIG. 7A is a Western blot analysis of the all-in-one protein variants p76 and p90-p102 using an antibody against Steptococcuspyogenes Cas9. The top band represents full-length protein and smaller-sized bands represent proteolysis of the all-in-one protein. FIG. 7B is a Western blot analysis of all-in-one protein variants to detect free Dnmt3A that is cleaved from the fusion protein.

[0020] FIGS. 8A-8E describe pooled screen to determine optimal sgRNAs. FIG. 8A is a schematic of a pooled screen to determine the optimal sgRNAs that leads to long term gene silencing. FIGS. 8B-8E are flow cytometry histograms of the percent of cells undergoing gene silencing four weeks post-transfection. Four HEK293T cell lines were used, each with a different gene with a GFP tag, including CLTA (FIG. 8B), VIM (FIG. 8C), HIST2H2BE (H2B) (FIG. 8D), and RAB11A (FIG. 8E).

[0021] FIGS. 9A-9D are maps of sgRNA functionality across the transcription start site of the targeted gene, including CLTA (FIG. 9A), H2B (FIG. 9B), RAB11 (FIG. 9C), and VIM (FIG. 9D). The transcription start site (TSS) and CpG island are annotated above each plot. Each dot represents one sgRNA and its efficacy in long term gene silencing is plotted as the log 2 fold change in sgRNA abundance. Nucleosome occupancy (bottom plot) is plotted from MNase signal.

[0022] FIGS. 10A-10E describe functional sgRNAs for long term gene silencing. FIG. 10A is a workflow of a pooled screen in HEK293T cells to determine optimal sgRNA targeting positions for the all-in-one protein, adapted from a previous ricin tiling screen in K562 cells to determine optimal sgRNAs for dCas9-KRAB (Gilbert, Horlbeck et al., Cell 2014). FIGS. 10B-10E are representative plots showing growth phenotypes for four genes, including ARL1 (FIG. 10B), EIF6 (FIG. 10C), SMC3 (FIG. 10D), HEATRI (FIG. 10E), from existing dCas9-KRAB/CRISPRi datasets in K562 cells (Gilbert, Horlbeck et al., 2014) and with the all-in-one protein (bottom plot). Each dot represents an sgRNA. The TSS and annotated CpG island are shown for each gene.

[0023] FIGS. 11A-11B provide a comparison of growth phenotypes and nucleosome positioning (from MNase signal) for VPS53 (FIG. 11A) and VPS54 (FIG. 11B) showing the location of functional sgRNAs at nucleosome-depleted regions.

[0024] FIGS. 12A-12C show the delivery of the all-in-one protein by mRNA expression FIG. 12A shows the in vitro transcription of two all-in-one variants (p102 and p112) show full length synthesis of each design. FIG. 12B provides a flow cytometry plot showing expression of p102 and p112 one day post-transfection of mRNA into HEK293T cells. FIG. 12C provides the time course of CLTA endogenous gene silencing in HEK293T cells after transfecting mRNA expressing the p102 and p112 all-in-one variants.

[0025] FIGS. 13A-13G describe controlled expression of the all-in-one protein by doxycycline induction. FIG. 13A provides flow cytometry plots showing induced expression of the all-in-one protein by addition of doxycycline in K562 cells that stably encode the all-in-one protein under a doxycycline-inducible promoter. The dotted line represents the baseline median BFP fluorescence without doxycycline administration. FIG. 13B provides a Western blot of cells to detect expression of the all-in-one protein before and after doxycycline treatment. FIGS. 13C-13F are flow cytometry plots of CD81 (FIGS. 13C-13D) and CD151 (FIGS. 13E-13F) knockdown 14 days post-doxycycline treatment of K562 cells. FIG. 13G shows the quantification of CD81 and CD151 knockdown 14 days post-doxycycline treatment or without doxycycline treatment.

DETAILED DESCRIPTION

[0026] The technology described herein allows for, inter alia, permanent silencing of genes in mammalian cells without generating double stranded DNA breaks in the host genome. In embodiments, the central component is a single polypeptide chain composed of catalytically inactive Cas9 (dCas9) fused to Dnmt3A, Dnmt3L, and a KRAB domain (herein referred to as an "all-in-one protein"). This fusion protein provided herein can be directed to a specific site in a mammalian genome using a single guide RNA (sgRNA) and may add DNA methylation and/or repressive chromatin marks to the site. In embodiments, the result is gene silencing that is inheritable across subsequent cell divisions. In embodiments, the fusion protein provided herein (and sgRNA) are only expressed transiently, bypassing the use of viral delivery methods to induce permanent silencing.

[0027] In embodiments, the fusion proteins provided herein provide a robust long-term or permanent silencing of endogenous gene expression by epigenome editing rather than genome editing. Both alleles of a gene may be targeted or a single pathogenic allele may be selectively targeted. In embodiments, an advantage of the fusion protein provided herein is that epigenetic editing is reversible and therefore inherently safer than genome editing. Thus, in embodiments, fusion protein provided herein is useful in prophylactic applications. For example, gene silencing can enable acute protection from an infection/biologic toxin and then be reversed after the risk of infection or intoxication is absent. Thus, in embodiments, fusion protein provided herein is useful for viral or toxin that enters a cell through interaction with a protein that is required for long term organ function or homeostasis. In embodiments, fusion protein provided herein is useful in genome editing based therapeutics.

[0028] In embodiments, permanent gene silencing in mammalian cells can be accomplished with two components: a single polypeptide chain composed of dCas9 fused to three epigenetic modulators and a single guide RNA that directs the protein to a specific site in the host genome. In embodiments, the components are only expressed transiently in the host cell, thus reducing toxicity and off-target events.

[0029] In embodiments, the fusion protein provided herein does not induce DNA breaks in the host cell for permanent gene silencing. In embodiments, the epigenetic marks that are added to the genomic site of interest are reversible, thus allowing for removal of any off-target events that may occur.

Definitions

[0030] While various embodiments and aspects of the present invention are shown and described herein, it will be obvious to those skilled in the art that such embodiments and aspects are provided by way of example only. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the invention. It should be understood that various alternatives to the embodiments of the invention described herein may be employed in practicing the invention.

[0031] The section headings used herein are for organizational purposes only and are not to be construed as limiting the subject matter described. All documents, or portions of documents, cited in the application including, without limitation, patents, patent applications, articles, books, manuals, and treatises are hereby expressly incorporated by reference in their entirety for any purpose.

[0032] Unless defined otherwise, all technical and scientific terms used herein have the meaning commonly understood by a person skilled in the art to which this invention belongs. The following references provide one of skill with a general definition of many of the terms used in this invention: Singleton et al., Dictionary of Microbiology and Molecular Biology (2nd ed. 1994); The Cambridge Dictionary of Science and Technology (Walker ed., 1988); The Glossary of Genetics, 5th Ed., R. Rieger et al. (eds.), Springer Verlag (1991); and Hale & Marham, The Harper Collins Dictionary of Biology (1991). As used herein, the following terms have the meanings ascribed to them unless specified otherwise.

[0033] The use of a singular indefinite or definite article (e.g., "a," "an," "the," etc.) in this disclosure and in the following claims follows the traditional approach in patents of meaning "at least one" unless in a particular instance it is clear from context that the term is intended in that particular instance to mean specifically one and only one. Likewise, the term "comprising" is open ended, not excluding additional items, features, components, etc. References identified herein are expressly incorporated herein by reference in their entireties unless otherwise indicated.

[0034] The terms "comprise," "include," and "have," and the derivatives thereof, are used herein interchangeably as comprehensive, open-ended terms. For example, use of "comprising," "including," or "having" means that whatever element is comprised, had, or included, is not the only element encompassed by the subject of the clause that contains the verb.

[0035] "Nucleic acid" refers to nucleotides (e.g., deoxyribonucleotides or ribonucleotides) and polymers thereof in either single-, double- or multiple-stranded form, or complements thereof. The terms "polynucleotide," "oligonucleotide," "oligo" or the like refer, in the usual and customary sense, to a linear sequence of nucleotides. The term "nucleotide" refers, in the usual and customary sense, to a single unit of a polynucleotide, i.e., a monomer. Nucleotides can be ribonucleotides, deoxyribonucleotides, or modified versions thereof. Examples of polynucleotides contemplated herein include single and double stranded DNA, single and double stranded RNA, and hybrid molecules having mixtures of single and double stranded DNA and RNA. Examples of nucleic acids, e.g. polynucleotides, contemplated herein include, but are not limited to, any type of RNA, e.g., mRNA, siRNA, miRNA, sgRNA, and guide RNA and any type of DNA, genomic DNA, plasmid DNA, and minicircle DNA, and any fragments thereof. In aspects, the nucleic acid is messenger RNA. In aspects, the messenger RNA is messenger ribonucleoprotein (RNP). The term "duplex" in the context of polynucleotides refers, in the usual and customary sense, to double strandedness. Nucleic acids can be linear or branched. For example, nucleic acids can be a linear chain of nucleotides or the nucleic acids can be branched, e.g., such that the nucleic acids comprise one or more arms or branches of nucleotides. Optionally, the branched nucleic acids are repetitively branched to form higher ordered structures such as dendrimers and the like.

[0036] As may be used herein, the terms "nucleic acid," "nucleic acid molecule," "nucleic acid oligomer," "oligonucleotide," "nucleic acid sequence," "nucleic acid fragment" and "polynucleotide" are used interchangeably and are intended to include, but are not limited to, a polymeric form of nucleotides covalently linked together that may have various lengths, either deoxyribonucleotides or ribonucleotides, or analogs, derivatives or modifications thereof. Different polynucleotides may have different three-dimensional structures, and may perform various functions, known or unknown. Non-limiting examples of polynucleotides include a gene, a gene fragment, an exon, an intron, intergenic DNA (including, without limitation, heterochromatic DNA), messenger RNA (mRNA), transfer RNA, ribosomal RNA, a ribozyme, cDNA, a recombinant polynucleotide, a branched polynucleotide, a plasmid, a vector, isolated DNA of a sequence, isolated RNA of a sequence, sgRNA, guide RNA, a nucleic acid probe, and a primer. Polynucleotides useful in the methods of the disclosure may comprise natural nucleic acid sequences and variants thereof, artificial nucleic acid sequences, or a combination of such sequences.

[0037] A polynucleotide is typically composed of a specific sequence of four nucleotide bases: adenine (A); cytosine (C); guanine (G); and thymine (T) (uracil (U) for thymine (T) when the polynucleotide is RNA). Thus, the term "polynucleotide sequence" is the alphabetical representation of a polynucleotide molecule; alternatively, the term may be applied to the polynucleotide molecule itself. This alphabetical representation can be input into databases in a computer having a central processing unit and used for bioinformatics applications such as functional genomics and homology searching. Polynucleotides may optionally include one or more non-standard nucleotide(s), nucleotide analog(s) and/or modified nucleotides.

[0038] Nucleic acids, including e.g., nucleic acids with a phosphothioate backbone, can include one or more reactive moieties. As used herein, the term reactive moiety includes any group capable of reacting with another molecule, e.g., a nucleic acid or polypeptide through covalent, non-covalent or other interactions. By way of example, the nucleic acid can include an amino acid reactive moiety that reacts with an amio acid on a protein or polypeptide through a covalent, non-covalent or other interaction.

[0039] The terms also encompass nucleic acids containing known nucleotide analogs or modified backbone residues or linkages, which are synthetic, naturally occurring, and non-naturally occurring, which have similar binding properties as the reference nucleic acid, and which are metabolized in a manner similar to the reference nucleotides. Examples of such analogs include, include, without limitation, phosphodiester derivatives including, e.g., phosphoramidate, phosphorodiamidate, phosphorothioate (also known as phosphothioate having double bonded sulfur replacing oxygen in the phosphate), phosphorodithioate, phosphonocarboxylic acids, phosphonocarboxylates, phosphonoacetic acid, phosphonoformic acid, methyl phosphonate, boron phosphonate, or O-methylphosphoroamidite linkages (see Eckstein, Oligonucleotides and Analogues: A Practical Approach, Oxford University Press) as well as modifications to the nucleotide bases such as in 5-methyl cytidine or pseudouridine; and peptide nucleic acid backbones and linkages. Other analog nucleic acids include those with positive backbones; non-ionic backbones, modified sugars, and non-ribose backbones (e.g. phosphorodiamidate morpholino oligos or locked nucleic acids (LNA) as known in the art), including those described in U.S. Pat. Nos. 5,235,033 and 5,034,506, and Chapters 6 and 7, ASC Symposium Series 580, Carbohydrate Modifications in Antisense Research, Sanghui & Cook, eds. Nucleic acids containing one or more carbocyclic sugars are also included within one definition of nucleic acids. Modifications of the ribose-phosphate backbone may be done for a variety of reasons, e.g., to increase the stability and half-life of such molecules in physiological environments or as probes on a biochip. Mixtures of naturally occurring nucleic acids and analogs can be made; alternatively, mixtures of different nucleic acid analogs, and mixtures of naturally occurring nucleic acids and analogs may be made. In aspects, the internucleotide linkages in DNA are phosphodiester, phosphodiester derivatives, or a combination of both.

[0040] Nucleic acids can include nonspecific sequences. As used herein, the term "nonspecific sequence" refers to a nucleic acid sequence that contains a series of residues that are not designed to be complementary to or are only partially complementary to any other nucleic acid sequence. By way of example, a nonspecific nucleic acid sequence is a sequence of nucleic acid residues that does not function as an inhibitory nucleic acid when contacted with a cell or organism.

[0041] The term "complementary" or "complementarity" refers to the ability of a nucleic acid to form hydrogen bond(s) with another nucleic acid sequence by either traditional Watson-Crick or other non-traditional types. For example, the sequence A-G-T is complementary to the sequence T-C-A. A percent complementarity indicates the percentage of residues in a nucleic acid molecule which can form hydrogen bonds (e.g., Watson-Crick base pairing) with a second nucleic acid sequence (e.g., 5, 6, 7, 8, 9, 10 out of 10 being 50%, 60%, 70%, 80%, 90%, and 100% complementary, respectively). "Perfectly complementary" means that all the contiguous residues of a nucleic acid sequence will hydrogen bond with the same number of contiguous residues in a second nucleic acid sequence. "Substantially complementary" as used herein refers to a degree of complementarity that is at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%. 97%, 98%, 99%, or 100% over a region of 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, or more nucleotides, or refers to two nucleic acids that hybridize under stringent conditions (i.e., stringent hybridization conditions).

[0042] The phrase "stringent hybridization conditions" refers to conditions under which a probe will hybridize to its target subsequence, typically in a complex mixture of nucleic acids, but to no other sequences. Stringent conditions are sequence-dependent and will be different in different circumstances. Longer sequences hybridize specifically at higher temperatures. An extensive guide to the hybridization of nucleic acids is found in Tijssen, Techniques in Biochemistry and Molecular Biology--Hybridization with Nucleic Probes, "Overview of principles of hybridization and the strategy of nucleic acid assays" (1993). Generally, stringent conditions are selected to be about 5-10.degree. C. lower than the thermal melting point (T.sub.m) for the specific sequence at a defined ionic strength pH. The T.sub.m is the temperature (under defined ionic strength, pH, and nucleic concentration) at which 50% of the probes complementary to the target hybridize to the target sequence at equilibrium (as the target sequences are present in excess, at T.sub.m, 50% of the probes are occupied at equilibrium). Stringent conditions may also be achieved with the addition of destabilizing agents such as formamide. For selective or specific hybridization, a positive signal is at least two times background, preferably 10 times background hybridization. Exemplary stringent hybridization conditions can be as following: 50% formamide, 5.times.SSC, and 1% SDS, incubating at 42.degree. C., or, 5.times.SSC, 1% SDS, incubating at 65.degree. C., with wash in 0.2.times.SSC, and 0.1% SDS at 65.degree. C.

[0043] Nucleic acids that do not hybridize to each other under stringent conditions are still substantially identical if the polypeptides which they encode are substantially identical. This occurs, for example, when a copy of a nucleic acid is created using the maximum codon degeneracy permitted by the genetic code. In such cases, the nucleic acids typically hybridize under moderately stringent hybridization conditions. Exemplary "moderately stringent hybridization conditions" include a hybridization in a buffer of 40% formamide, 1 M NaCl, 1% SDS at 37.degree. C., and a wash in 1.times.SSC at 45.degree. C. A positive hybridization is at least twice background. One of ordinary skill will readily recognize that alternative hybridization and wash conditions can be utilized to provide conditions of similar stringency. Additional guidelines for determining hybridization parameters are provided in numerous references, e.g., Current Protocols in Molecular Biology, ed. Ausubel, et al., supra.

[0044] The term "gene" means the segment of DNA involved in producing a protein; it includes regions preceding and following the coding region (leader and trailer) as well as intervening sequences (introns) between individual coding segments (exons). The leader, the trailer as well as the introns include regulatory elements that are necessary during the transcription and the translation of a gene. Further, a "protein gene product" is a protein expressed from a particular gene.

[0045] The word "expression" or "expressed" as used herein in reference to a gene means the transcriptional and/or translational product of that gene. The level of expression of a DNA molecule in a cell may be determined on the basis of either the amount of corresponding mRNA that is present within the cell or the amount of protein encoded by that DNA produced by the cell. The level of expression of non-coding nucleic acid molecules (e.g., sgRNA) may be detected by standard PCR or Northern blot methods well known in the art. See, Sambrook et al., 1989 Molecular Cloning: A Laboratory Manual, 18.1-18.88.

[0046] The term "transcriptional regulatory sequence" as provided herein refers to a segment of DNA that is capable of increasing or decreasing transcription (e.g., expression) of a specific gene within an organism. Non-limiting examples of transcriptional regulatory sequences include promoters, enhancers, and silencers.

[0047] The terms "transcription start site" and transcription initiation site" may be used interchangeably to refer herein to the 5' end of a gene sequence (e.g., DNA sequence) where RNA polymerase (e.g., DNA-directed RNA polymerase) begins synthesizing the RNA transcript. The transcription start site may be the first nucleotide of a transcribed DNA sequence where RNA polymerase begins synthesizing the RNA transcript. A skilled artisan can determine a transcription start site via routine experimentation and analysis, for example, by performing a run-off transcription assay or by definitions according to FANTOM5 database.

[0048] The term "promoter" as used herein refers to a region of DNA that initiates transcription of a particular gene. Promoters are typically located near the transcription start site of a gene, upstream of the gene and on the same strand (i.e., 5' on the sense strand) on the DNA. Promoters may be about 100 to about 1000 base pairs in length.

[0049] The term "enhancer" as used herein refers to a region of DNA that may be bound by proteins (e.g., transcription factors) to increase the likelihood that transcription of a gene will occur. Enhancers may be about 50 to about 1500 base pairs in length. Enhancers may be located downstream or upstream of the transcription initiation site that it regulates and may be several hundreds of base pairs away from the transcription initiation site.

[0050] The term "silencer" as used herein refers to a DNA sequence capable of binding transcription regulation factors known as repressors, thereby negatively effecting transcription of a gene. Silencer DNA sequences may be found at many different positions throughout the DNA, including, but not limited to, upstream of a target gene for which it acts to repress transcription of the gene (e.g., silence gene expression).

[0051] A "guide RNA" or "gRNA" as provided herein refers to any polynucleotide sequence having sufficient complementarity with a target polynucleotide sequence to hybridize with the target sequence and direct sequence-specific binding of a CRISPR complex to the target sequence. In aspects, the degree of complementarity between a guide sequence and its corresponding target sequence, when optimally aligned using a suitable alignment algorithm, is about or more than about 50%, 60%, 75%, 80%, 85%, 90%, 95%, 97.5%, 99%, or more.

[0052] In embodiments, the polynucleotide (e.g., gRNA) is a single-stranded ribonucleic acid. In aspects, the polynucleotide (e.g., gRNA) is 10, 20, 30, 40, 50, 60, 70, 80, 90, 100 or more nucleic acid residues in length. In aspects, the polynucleotide (e.g., gRNA) is from 10 to 30 nucleic acid residues in length. In aspects, the polynucleotide (e.g., gRNA) is 20 nucleic acid residues in length.

[0053] In aspects, the length of the polynucleotide (e.g., gRNA) can be at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100 or more nucleic acid residues or sugar residues in length. In aspects, the polynucleotide (e.g., gRNA) is from 5 to 50, 10 to 50, 15 to 50, 20 to 50, 25 to 50, 30 to 50, 35 to 50, 40 to 50, 45 to 50, 5 to 75, 10 to 75, 15 to 75, 20 to 75, 25 to 75, 30 to 75, 35 to 75, 40 to 75, 45 to 75, 50 to 75, 55 to 75, 60 to 75, 65 to 75, 70 to 75, 5 to 100, 10 to 100, 15 to 100, 20 to 100, 25 to 100, 30 to 100, 35 to 100, 40 to 100, 45 to 100, 50 to 100, 55 to 100, 60 to 100, 65 to 100, 70 to 100, 75 to 100, 80 to 100, 85 to 100, 90 to 100, 95 to 100, or more residues in length. In aspects, the polynucleotide (e.g., gRNA) is from 10 to 15, 10 to 20, 10 to 30, 10 to 40, or 10 to 50 residues in length.

[0054] The term "amino acid" refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, .gamma.-carboxyglutamate, and 0-phosphoserine. Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid. Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid. The terms "non-naturally occurring amino acid" and "unnatural amino acid" refer to amino acid analogs, synthetic amino acids, and amino acid mimetics which are not found in nature.

[0055] Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-letter codes.

[0056] The terms "polypeptide," "peptide" and "protein" are used interchangeably herein to refer to a polymer of amino acid residues, wherein the polymer may, in aspects, be conjugated to a moiety that does not consist of amino acids. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymers. A "fusion protein" refers to a chimeric protein encoding two or more separate protein sequences that are recombinantly expressed as a single moiety.

[0057] "Conservatively modified variants" applies to both amino acid and nucleic acid sequences. With respect to particular nucleic acid sequences, "conservatively modified variants" refers to those nucleic acids that encode identical or essentially identical amino acid sequences. Because of the degeneracy of the genetic code, a number of nucleic acid sequences will encode any given protein. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide. Such nucleic acid variations are "silent variations," which are one species of conservatively modified variations. Every nucleic acid sequence herein which encodes a polypeptide also describes every possible silent variation of the nucleic acid. One of skill will recognize that each codon in a nucleic acid (except AUG, which is ordinarily the only codon for methionine, and TGG, which is ordinarily the only codon for tryptophan) can be modified to yield a functionally identical molecule. Accordingly, each silent variation of a nucleic acid which encodes a polypeptide is implicit in each described sequence.

[0058] As to amino acid sequences, one of skill will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters, adds or deletes a single amino acid or a small percentage of amino acids in the encoded sequence is a "conservatively modified variant" where the alteration results in the substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are well known in the art. Such conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles of the disclosure. The following eight groups each contain amino acids that are conservative substitutions for one another: (1) Alanine (A), Glycine (G); (2) Aspartic acid (D), Glutamic acid (E); (3) Asparagine (N), Glutamine (Q); (4) Arginine (R), Lysine (K); (5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); (6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); (7) Serine (S), Threonine (T); and (8) Cysteine (C), Methionine (M) (see, e.g., Creighton, Proteins (1984)).

[0059] "Percentage of sequence identity" is determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the polynucleotide or polypeptide sequence in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity.

[0060] The terms "identical" or percent "identity," in the context of two or more nucleic acids or polypeptide sequences, refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same (i.e., about 60% identity, preferably 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or higher identity over a specified region, when compared and aligned for maximum correspondence over a comparison window or designated region) as measured using a BLAST or BLAST 2.0 sequence comparison algorithms with default parameters described below, or by manual alignment and visual inspection (see, e.g., NCBI web site ncbi.nlm.nih.gov/BLAST/ or the like). Such sequences are then said to be "substantially identical." This definition also refers to, or may be applied to, the compliment of a test sequence. The definition also includes sequences that have deletions and/or additions, as well as those that have substitutions. As described below, the preferred algorithms can account for gaps and the like. Preferably, identity exists over a region that is at least about 25 amino acids or nucleotides in length, or more preferably over a region that is 50-100 amino acids or nucleotides in length.

[0061] An amino acid or nucleotide base "position" is denoted by a number that sequentially identifies each amino acid (or nucleotide base) in the reference sequence based on its position relative to the N-terminus (or 5'-end). Due to deletions, insertions, truncations, fusions, and the like that must be taken into account when determining an optimal alignment, in general the amino acid residue number in a test sequence determined by simply counting from the N-terminus will not necessarily be the same as the number of its corresponding position in the reference sequence. For example, in a case where a variant has a deletion relative to an aligned reference sequence, there will be no amino acid in the variant that corresponds to a position in the reference sequence at the site of deletion. Where there is an insertion in an aligned reference sequence, that insertion will not correspond to a numbered amino acid position in the reference sequence. In the case of truncations or fusions there can be stretches of amino acids in either the reference or aligned sequence that do not correspond to any amino acid in the corresponding sequence.

[0062] The terms "numbered with reference to" or "corresponding to," when used in the context of the numbering of a given amino acid or polynucleotide sequence, refers to the numbering of the residues of a specified reference sequence when the given amino acid or polynucleotide sequence is compared to the reference sequence.

[0063] For specific proteins described herein (e.g., KRAB, dCas9, Dnmt3A, Dnmt3L), the named protein includes any of the protein's naturally occurring forms, or variants or homologs that maintain the protein activity (e.g., within at least 50%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% activity compared to the native protein). In aspects, variants or homologs have at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% amino acid sequence identity across the whole sequence or a portion of the sequence (e.g. a 50, 100, 150 or 200 continuous amino acid portion) compared to a naturally occurring form. In aspects, the protein is the protein as identified by its NCBI sequence reference. In aspects, the protein is the protein as identified by its NCBI sequence reference or functional fragment or homolog thereof.

[0064] The term "Kruppel associated box domain" or "KRAB domain" as provided herein refers to a category of transcriptional repression domains present in approximately 400 human zinc finger protein-based transcription factors. KRAB domains typically include about 45 to about 75 amino acid residues. A description of KRAB domains, including their function and use, may be found, for example, in Ecco, G., Imbeault, M., Trono, D., KRAB zinc finger proteins, Development 144, 2017; Lambert et al. The human transcription factors, Cell 172, 2018; Gilbert et al., Cell (2013); and Gilbert et al., Cell (2014), all of which are incorporated herein by reference in their entirety. In aspects, the KRAB domain is a KRAB domain of Kox 1. In aspects, the KRAB domain includes the sequence set forth by SEQ ID NO:16. In aspects, the KRAB domain is the sequence of SEQ ID NO:16. In aspects, the KRAB domain includes an amino acid sequence that has at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:16. In aspects, the KRAB domain includes an amino acid sequence that has at least 75% sequence identity to SEQ ID NO:16. In aspects, the KRAB domain includes an amino acid sequence that has at least 80% sequence identity to SEQ ID NO:16. In aspects, the KRAB domain includes an amino acid sequence that has at least 85% sequence identity to SEQ ID NO:16. In aspects, the KRAB domain includes an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:16. In aspects, the KRAB domain includes an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:16.

[0065] The term "DNA methyltransferase" as provided herein refers to an enzyme that catalyzes the transfer of a methyl group to DNA. Non-limiting examples of DNA methyltransferases include Dnmt1, Dnmt3A, Dnmt3B, and Dnmt3L. In aspects, the DNA methyltransferase is a bacterial cytosine methyltransferase and/or a bacterial non-cytosine methyltransferase. Depending on the specific DNA methyltransferase, different regions of DNA are methylated. For example, Dnmt3A typically targets CpG dinucleotides for methylation. Through DNA methylation, DNA methyltransferases can modify the activity of a DNA segment (e.g., gene expression) without altering the DNA sequence. In aspects, DNA methylation results in repression of gene transcription and/or modulation of methylation sensitive transcription factors or CTCF. As described herein, fusion proteins may include one or more (e.g., two) DNA metyltransferases. When a DNA methyltransferase is included as part of a fusion protein, the DNA methyltransferase may be referred to as a "DNA methyltransferase domain." In aspects, a DNA methyltransferase domain includes one or more DNA methyltransferases. In aspects, a DNA methyltransferase domain includes two DNA methyltransferases. In aspects, the DNA methyltransferase domain is Dnmt3A. In aspects, the DNA methyltransferase domain has the amino acid sequence of SEQ ID NO:26. In aspects, the DNA methyltransferase domain has an amino acid sequence that has at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:26. In aspects, the DNA methyltransferase domain has an amino acid sequence that has at least 75% sequence identity to SEQ ID NO:26. In aspects, the DNA methyltransferase domain has an amino acid sequence that has at least 80% sequence identity to SEQ ID NO:26. In aspects, the DNA methyltransferase domain has an amino acid sequence that has at least 85% sequence identity to SEQ ID NO:26. In aspects, the DNA methyltransferase domain has an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:26. In aspects, the DNA methyltransferase domain has an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:26. In aspects, the DNA methyltransferase domain is Dnmt3L. In aspects, the DNA methyltransferase domain has the amino acid sequence of SEQ ID NO:28. In aspects, the DNA methyltransferase domain has an amino acid sequence that has at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:28. In aspects, the DNA methyltransferase domain has an amino acid sequence that has at least 75% sequence identity to SEQ ID NO:28. In aspects, the DNA methyltransferase domain has an amino acid sequence that has at least 80% sequence identity to SEQ ID NO:28. In aspects, the DNA methyltransferase domain has an amino acid sequence that has at least 85% sequence identity to SEQ ID NO:28. In aspects, the DNA methyltransferase domain has an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:28. In aspects, the DNA methyltransferase domain has an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:28. In aspects, the DNA methyltransferase domain includes Dnmt3A and Dnmt3L. In aspects, the DNA methyltransferase domain has the amino acid sequence of SEQ ID NO:33. In aspects, the DNA methyltransferase domain has an amino acid sequence that has at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:33. In aspects, the DNA methyltransferase domain has an amino acid sequence that has at least 75% sequence identity to SEQ ID NO:33. In aspects, the DNA methyltransferase domain has an amino acid sequence that has at least 80% sequence identity to SEQ ID NO:33. In aspects, the DNA methyltransferase domain has an amino acid sequence that has at least 85% sequence identity to SEQ ID NO:33. In aspects, the DNA methyltransferase domain has an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:33. In aspects, the DNA methyltransferase domain has an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:33. A description of Dnmt3A-3L domain structure and use may be found, for example, in Siddique et al, Targeted methylation and gene silencing of VEGF-A in human cells by using a designed Dnmt3a-Dnmt3L single-chain fusion protein with increased DNA methylation activity, J. Mol. Biol. 425, 2013 and Stepper et al, Efficient targeted DNA methylation with chimeric dCas9-Dnmt3a-Dnmt3L methyltransferase, Nucleic Acids Res. 45, 2017, which are incorporated herein by reference in their entirety and for all purposes.

[0066] A "Dnmt3A", "Dnmt3a," "DNA (cytosine-5)-methyltransferase 3A" or "DNA methyltransferase 3a" protein as referred to herein includes any of the recombinant or naturally-occurring forms of the Dnmt3A enzyme or variants or homologs thereof that maintain Dnmt3A enzyme activity (e.g. within at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% activity compared to Dnmt3A). In aspects, the variants or homologs have at least 90%, 95%, 96%, 97%, 98%, 99% or 100% amino acid sequence identity across the whole sequence or a portion of the sequence (e.g., a 50, 100, 150 or 200 continuous amino acid portion) compared to a naturally occurring Dnmt3A protein. In aspects, the Dnmt3A protein is substantially identical to the protein identified by the UniProt reference number Q9Y6K1 or a variant or homolog having substantial identity thereto. In aspects, the Dnmt3A polypeptide is encoded by a nucleic acid sequence identified by the NCBI reference sequence Accession number NM_022552, homologs or functional fragments thereof. In aspects, Dnmt3A includes the sequence set forth by SEQ ID NO:26. In aspects, Dnmt3A is the sequence set forth by SEQ ID NO:26. In aspects, Dnmt3A has an amino acid sequence that has at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:26. In aspects, the DNA methyltransferase domain has an amino acid sequence that has at least 75% sequence identity to SEQ ID NO:26. In aspects, the DNA methyltransferase domain has an amino acid sequence that has at least 80% sequence identity to SEQ ID NO:26. In aspects, the DNA methyltransferase domain has an amino acid sequence that has at least 85% sequence identity to SEQ ID NO:26. In aspects, Dnmt3A has an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:26. In aspects, Dnmt3A has an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:26.

[0067] A "Dnmt3L", "DNA (cytosine-5)-methyltransferase 3L" or "DNA methyltransferase 3L" protein as referred to herein includes any of the recombinant or naturally-occurring forms of the Dnmt3L enzyme or variants or homologs thereof that maintain Dnmt3L enzyme activity (e.g., within at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% activity compared to Dnmt3L). In aspects, the variants or homologs have at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% amino acid sequence identity across the whole sequence or a portion of the sequence (e.g., a 50, 100, 150 or 200 continuous amino acid portion) compared to a naturally occurring Dnmt3L protein. In aspects, the Dnmt3L protein is substantially identical to the protein identified by the UniProt reference number Q9CWR8 or a variant or homolog having substantial identity thereto. In aspects, the Dnmt3L protein is identical to the protein identified by the UniProt reference number Q9CWR8. In aspects, the Dnmt3L protein has at least 75% sequence identity to the amino acid sequence of the protein identified by the UniProt reference number Q9CWR8. In aspects, the Dnmt3L protein has at least 80% sequence identity to the amino acid sequence of the protein identified by the UniProt reference number Q9CWR8. In aspects, the Dnmt3L protein has at least 85% sequence identity to the amino acid sequence of the protein identified by the UniProt reference number Q9CWR8. In aspects, the Dnmt3L protein has at least 95% sequence identity to the amino acid sequence of the protein identified by the UniProt reference number Q9CWR8.

[0068] In aspects, the Dnmt3L protein is substantially identical to the protein identified by the UniProt reference number Q9UJW or a variant or homolog having substantial identity thereto. In aspects, the Dnmt3L protein is identical to the protein identified by the UniProt reference number Q9UJW. In aspects, the Dnmt3L protein has at least 50% sequence identity to the amino acid sequence of the protein identified by the UniProt reference number Q9UJW. In aspects, the Dnmt3L protein has at least 55% sequence identity to the protein identified by the UniProt reference number Q9UJW. In aspects, the Dnmt3L protein has at least 60% sequence identity to the amino acid sequence of the protein identified by the UniProt reference number Q9UJW. In aspects, the Dnmt3L protein has at least 65% sequence identity to the amino acid sequence of the protein identified by the UniProt reference number Q9UJW. In aspects, the Dnmt3L protein has at least 70% sequence identity to the amino acid sequence of the protein identified by the UniProt reference number Q9UJW. In aspects, the Dnmt3L protein has at least 75% sequence identity to the amino acid sequence of the protein identified by the UniProt reference number Q9UJW. In aspects, the Dnmt3L protein has at least 80% sequence identity to the amino acid sequence of the protein identified by the UniProt reference number Q9UJW. In aspects, the Dnmt3L protein has at least 85% sequence identity to the amino acid sequence of the protein identified by the UniProt reference number Q9UJW. In aspects, the Dnmt3L protein has at least 90% sequence identity to the amino acid sequence of the protein identified by the UniProt reference number Q9UJW. In aspects, the Dnmt3L protein has at least 95% sequence identity to the amino acid sequence of the protein identified by the UniProt reference number Q9UJW. In aspects, the Dnmt3L polypeptide is encoded by a nucleic acid sequence identified by the NCBI reference sequence Accession number NM_001081695, or homologs or functional fragments thereof. In aspects, Dnmt3L includes the sequence set forth by SEQ ID NO:28. In aspects, Dnmt3L is the sequence set forth by SEQ ID NO:28. In aspects, Dnmt3L has an amino acid sequence that has at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:28. In aspects, Dnmt3L has an amino acid sequence that has at least 50% sequence identity to SEQ ID NO:28. In aspects, Dnmt3L has an amino acid sequence that has at least 55% sequence identity to SEQ ID NO:28. In aspects, Dnmt3L has an amino acid sequence that has at least 60% sequence identity to SEQ ID NO:28. In aspects, Dnmt3L has an amino acid sequence that has at least 65% sequence identity to SEQ ID NO:28. In aspects, Dnmt3L has an amino acid sequence that has at least 97% sequence identity to SEQ ID NO:28. In aspects, Dnmt3L has an amino acid sequence that has at least 75% sequence identity to SEQ ID NO:28. In aspects, Dnmt3L has an amino acid sequence that has at least 80% sequence identity to SEQ ID NO:28. In aspects, Dnmt3L has an amino acid sequence that has at least 85% sequence identity to SEQ ID NO:28. In aspects, Dnmt3L has an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:28. In aspects, Dnmt3L has an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:28.

[0069] The term "RNA-guided DNA endonuclease" and the like refer, in the usual and customary sense, to an enzyme that cleave a phosphodiester bond within a DNA polynucleotide chain, wherein the recognition of the phosphodiester bond is facilitated by a separate RNA sequence (for example, a single guide RNA).

[0070] The term "Class II CRISPR endonuclease" refers to endonucleases that have similar endonuclease activity as Cas9 and participate in a Class II CRISPR system. An example Class II CRISPR system is the type II CRISPR locus from Streptococcus pyogenes SF370, which contains a cluster of four genes Cas9, Cas1, Cas2, and Csn1, as well as two non-coding RNA elements, tracrRNA and a characteristic array of repetitive sequences (direct repeats) interspaced by short stretches of non-repetitive sequences (spacers, about 30 bp each). The Cpf1 enzyme belongs to a putative type V CRISPR-Cas system. Both type II and type V systems are included in Class II of the CRISPR-Cas system.

[0071] A "nuclear localization sequence" or "nuclear localization signal" or "NLS" is a peptide that directs proteins to the nucleus. In aspects, the NLS includes five basic, positively charged amino acids. The NLS may be located anywhere on the peptide chain. In aspects, the NLS is an NLS derived from SV40. In aspects, the NLS includes the sequence set forth by SEQ ID NO:25. In aspects, the NLS is the sequence set forth by SEQ ID NO:25. In aspects, NLS has an amino acid sequence that has at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 25. In aspects, NLS has an amino acid sequence that has at least 75% sequence identity to SEQ ID NO:25. In aspects, NLS has an amino acid sequence that has at least 80% sequence identity to SEQ ID NO:25. In aspects, NLS has an amino acid sequence that has at least 85% sequence identity to SEQ ID NO:25. In aspects, NLS has an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:25. In aspects, NLS has an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:25. In aspects, NLS has an amino acid sequence of SEQ ID NO:25.

[0072] A "cell" as used herein, refers to a cell carrying out metabolic or other function sufficient to preserve or replicate its genomic DNA. A cell can be identified by well-known methods in the art including, for example, presence of an intact membrane, staining by a particular dye, ability to produce progeny or, in the case of a gamete, ability to combine with a second gamete to produce a viable offspring. Cells may include prokaryotic and eukaroytic cells. Prokaryotic cells include but are not limited to bacteria. Eukaryotic cells include but are not limited to yeast cells and cells derived from plants and animals, for example mammalian, insect (e.g., spodoptera) and human cells. Cells may be useful when they are naturally nonadherent or have been treated not to adhere to surfaces, for example by trypsinization.

[0073] As used herein, the term "vector" refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. One type of vector is a "plasmid", which refers to a linear or circular double stranded DNA loop into which additional DNA segments can be ligated. Another type of vector is a viral vector, wherein additional DNA segments can be ligated into the viral genome. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non episomal mammalian vectors) are integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operatively linked. Such vectors are referred to herein as "expression vectors." In general, expression vectors of utility in recombinant DNA techniques are often in the form of plasmids. In the present specification, "plasmid" and "vector" can be used interchangeably as the plasmid is the most commonly used form of vector. However, the invention is intended to include such other forms of expression vectors, such as viral vectors (e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses), which serve equivalent functions. Additionally, some viral vectors are capable of targeting a particular cells type either specifically or non-specifically. Replication-incompetent viral vectors or replication-defective viral vectors refer to viral vectors that are capable of infecting their target cells and delivering their viral payload, but then fail to continue the typical lytic pathway that leads to cell lysis and death.

[0074] The terms "transfection", "transduction", "transfecting" or "transducing" can be used interchangeably and are defined as a process of introducing a nucleic acid molecule and/or a protein to a cell. Nucleic acids may be introduced to a cell using non-viral or viral-based methods. The nucleic acid molecule can be a sequence encoding complete proteins or functional portions thereof. Typically, a nucleic acid vector, comprising the elements necessary for protein expression (e.g., a promoter, transcription start site, etc.). Non-viral methods of transfection include any appropriate method that does not use viral DNA or viral particles as a delivery system to introduce the nucleic acid molecule into the cell. Exemplary non-viral transfection methods include nanoparticle encapsulation of the nucleic acids that encode the fusion protein (e.g., lipid nanoparticles, gold nanoparticles, and the like), calcium phosphate transfection, liposomal transfection, nucleofection, sonoporation, transfection through heat shock, magnetifection and electroporation. For viral-based methods, any useful viral vector can be used in the methods described herein. Examples of viral vectors include, but are not limited to retroviral, adenoviral, lentiviral and adeno-associated viral vectors. In aspects, the nucleic acid molecules are introduced into a cell using a retroviral vector following standard procedures well known in the art. The terms "transfection" or "transduction" also refer to introducing proteins into a cell from the external environment. Typically, transduction or transfection of a protein relies on attachment of a peptide or protein capable of crossing the cell membrane to the protein of interest. See, e.g., Ford et al. (2001) Gene Therapy 8:1-4 and Prochiantz (2007) Nat. Methods 4:119-20.

[0075] A "peptide linker" as provided herein is a linker including a peptide moiety. In embodiments, the peptide linker is a divalent peptide, such as an amino acid sequence attached at the N-terminus and the C-terminus to the remainder of the compound (e.g., fusion protein provided herein. The peptide linker may be a peptide moiety (a divalent peptide moiety) capable of being cleaved (e.g., a P2A cleavable polypeptide). A peptide linker as provided herein may also be referred to interchangeably as an amino acid linker. In aspects, the peptide linker includes 1 to about 80 amino acid residues. In aspects, the peptide linker includes 1 to about 70 amino acid residues. In aspects, the peptide linker includes 1 to about 60 amino acid residues. In aspects, the peptide linker includes 1 to about 50 amino acid residues. In aspects, the peptide linker includes 1 to about 40 amino acid residues. In aspects, the peptide linker includes 1 to about 30 amino acid residues. In aspects, the peptide linker includes 1 to about 25 amino acid residues. In aspects, the peptide linker includes 1 to about 20 amino acid residues. In aspects, the peptide linker includes about 2 to about 20 amino acid residues. In aspects, the peptide linker includes about 2 to about 19 amino acid residues. In aspects, the peptide linker includes about 2 to about 18 amino acid residues. In aspects, the peptide linker includes about 2 to about 17 amino acid residues. In aspects, the peptide linker includes about 2 to about 16 amino acid residues. In aspects, the peptide linker includes about 2 to about 15 amino acid residues. In aspects, the peptide linker includes about 2 to about 14 amino acid residues. In aspects, the peptide linker includes about 2 to about 13 amino acid residues. In aspects, the peptide linker includes about 2 to about 12 amino acid residues. In aspects, the peptide linker includes about 2 to about 11 amino acid residues. In aspects, the peptide linker includes about 2 to about 10 amino acid residues. In aspects, the peptide linker includes about 2 to about 9 amino acid residues. In aspects, the peptide linker includes about 2 to about 8 amino acid residues. In aspects, the peptide linker includes about 2 to about 7 amino acid residues. In aspects, the peptide linker includes about 2 to about 6 amino acid residues. In aspects, the peptide linker includes about 2 to about 5 amino acid residues. In aspects, the peptide linker includes about 2 to about 4 amino acid residues. In aspects, the peptide linker includes about 2 to about 3 amino acid residues. In aspects, the peptide linker includes about 3 to about 19 amino acid residues. In aspects, the peptide linker includes about 3 to about 18 amino acid residues. In aspects, the peptide linker includes about 3 to about 17 amino acid residues. In aspects, the peptide linker includes about 3 to about 16 amino acid residues. In aspects, the peptide linker includes about 3 to about 15 amino acid residues. In aspects, the peptide linker includes about 3 to about 14 amino acid residues. In aspects, the peptide linker includes about 3 to about 13 amino acid residues. In aspects, the peptide linker includes about 3 to about 12 amino acid residues. In aspects, the peptide linker includes about 3 to about 11 amino acid residues. In aspects, the peptide linker includes about 3 to about 10 amino acid residues. In aspects, the peptide linker includes about 3 to about 9 amino acid residues. In aspects, the peptide linker includes about 3 to about 8 amino acid residues. In aspects, the peptide linker includes about 3 to about 7 amino acid residues. In aspects, the peptide linker includes about 3 to about 6 amino acid residues. In aspects, the peptide linker includes about 3 to about 5 amino acid residues. In aspects, the peptide linker includes about 3 to about 4 amino acid residues. In aspects, the peptide linker includes about 10 to about 20 amino acid residues. In aspects, the peptide linker includes about 15 to about 20 amino acid residues. In aspects, the peptide linker includes about 2 amino acid residues. In aspects, the peptide linker includes about 3 amino acid residues. In aspects, the peptide linker includes about 4 amino acid residues. In aspects, the peptide linker includes about 5 amino acid residues. In aspects, the peptide linker includes about 6 amino acid residues. In aspects, the peptide linker includes about 7 amino acid residues. In aspects, the peptide linker includes about 8 amino acid residues. In aspects, the peptide linker includes about 9 amino acid residues. In aspects, the peptide linker includes about 10 amino acid residues. In aspects, the peptide linker includes about 11 amino acid residues. In aspects, the peptide linker includes about 12 amino acid residues. In aspects, the peptide linker includes about 13 amino acid residues. In aspects, the peptide linker includes about 14 amino acid residues. In aspects, the peptide linker includes about 15 amino acid residues. In aspects, the peptide linker includes about 16 amino acid residues. In aspects, the peptide linker includes about 17 amino acid residues. In aspects, the peptide linker includes about 18 amino acid residues. In aspects, the peptide linker includes about 19 amino acid residues. In aspects, the peptide linker includes about 20 amino acid residues. In aspects, the peptide linker includes about 21 amino acid residues. In aspects, the peptide linker includes about 22 amino acid residues. In aspects, the peptide linker includes about 23 amino acid residues. In aspects, the peptide linker includes about 24 amino acid residues. In aspects, the peptide linker includes about 25 amino acid residues.

[0076] In aspects, the peptide linker includes the sequence set forth by SEQ ID NO:17. In aspects, the peptide linker is the sequence set forth by SEQ ID NO:17. In aspects, the peptide linker includes the sequence set forth by SEQ ID NO:18. In aspects, the peptide linker is the sequence set forth by SEQ ID NO:18. In aspects, the peptide linker includes the sequence set forth by SEQ ID NO:19. In aspects, the peptide linker is the sequence set forth by SEQ ID NO:19. In aspects, the peptide linker includes the sequence set forth by SEQ ID NO:20. In aspects, the peptide linker is the sequence set forth by SEQ ID NO:20. In aspects, the peptide linker includes the sequence set forth by SEQ ID NO:21. In aspects, the peptide linker is the sequence set forth by SEQ ID NO:21. In aspects, the peptide linker includes the sequence set forth by SEQ ID NO:22. In aspects, the peptide linker is the sequence set forth by SEQ ID NO:22. In aspects, the peptide linker includes the sequence set forth by SEQ ID NO:27. In aspects, the peptide linker is the sequence set forth by SEQ ID NO:27. In aspects, the peptide linker includes the sequence set forth by SEQ ID NO:24. In aspects, the peptide linker is the sequence set forth by SEQ ID NO:24. In aspects, the peptide linker includes the sequence set forth by SEQ ID NO:29. In aspects, the peptide linker is the sequence set forth by SEQ ID NO:29. In aspects, the peptide linker is an XTEN polypeptide. In aspects, the peptide linker has an amino acid sequence that has at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:17, 18, 19, 20, 21, 22, 24, 27, or 29. In aspects, the peptide linker has an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:17, 18, 19, 20, 21, 22, 24, 27, or 29.

[0077] In aspects, the peptide linker has an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:17. In aspects, the peptide linker has an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:18. In aspects, the peptide linker has an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:19. In aspects, the peptide linker has an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:20. In aspects, the peptide linker has an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:21. In aspects, the peptide linker has an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:22. In aspects, the peptide linker has an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:24. In aspects, the peptide linker has an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:27. In aspects, the peptide linker has an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:29. In aspects, the peptide linker has an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:17, 18, 19, 20, 21, 22, 24, 27, or 29. In aspects, the peptide linker has an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:17. In aspects, the peptide linker has an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:18. In aspects, the peptide linker has an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:19. In aspects, the peptide linker has an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:20. In aspects, the peptide linker has an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:21. In aspects, the peptide linker has an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:22. In aspects, the peptide linker has an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:24. In aspects, the peptide linker has an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:27. In aspects, the peptide linker has an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:29.

[0078] The terms "XTEN," "XTEN linker," or "XTEN polypeptide" as used herein refer to an recombinant polypeptide (e.g. unstructured recombinant peptide) lacking hydrophobic amino acid residues. The development and use of XTEN can be found in, for example, Schellenberger et al., Nature Biotechnology 27, 1186-1190 (2009), which is incorporated herein by reference in its entirety and for all purposes. In aspects, the XTEN linker includes the sequence set forth by SEQ ID NO:31. In aspects, the XTEN linker is the sequence set forth by SEQ ID NO:31. In aspects, the XTEN linker includes the sequence set forth by SEQ ID NO:32. In aspects, the XTEN linker is the sequence set forth by SEQ ID NO:32. In aspects, the XTEN linker has an amino acid sequence that has at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:31. In aspects, the XTEN linker has an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:31. In aspects, the XTEN linker has an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:31. In aspects, the XTEN linker has an amino acid sequence that has at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:32. In aspects, the XTEN linker has an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:32. In aspects, the XTEN linker has an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:32.

[0079] A "detectable agent" or "detectable moiety" is a composition detectable by appropriate means such as spectroscopic, photochemical, biochemical, immunochemical, chemical, magnetic resonance imaging, or other physical means. For example, useful detectable agents include .sup.18F, .sup.32P, .sup.33P, .sup.45Ti, .sup.47Sc, .sup.52Fe, .sup.59Fe, .sup.62Cu, .sup.64Cu, .sup.67Cu, .sup.67Ga, .sup.68Ga, .sup.77As, .sup.86Y, .sup.90Y, .sup.89Sr, .sup.89Zr, .sup.94Tc, .sup.94Tc, .sup.99mTc, .sup.99Mo, .sup.105Pd, .sup.105Rh, .sup.111Ag, .sup.111In, .sup.123I, .sup.124I, .sup.125I, .sup.131I, .sup.142Pr, .sup.143Pr, .sup.149Pm, .sup.153Sm, .sup.154-1581Gd, .sup.161Tb, .sup.166Dy, .sup.166Ho, .sup.169Er, .sup.175Lu, .sup.177Lu, .sup.186Re, .sup.188Re, .sup.189Re, .sup.194Ir, .sup.198Au, .sup.199Au, .sup.211At, .sup.211Pb, .sup.212Bi, .sup.212Pb, .sup.213Bi, .sup.223Ra, .sup.225Ac, Cr, V, Mn, Fe, Co, Ni, Cu, La, Ce, Pr, Nd, Pm, Sm, Eu, Gd, Tb, Dy, Ho, Er, T.sub.m, Yb, Lu, .sup.32P, fluorophore (e.g. fluorescent dyes), electron-dense reagents, enzymes (e.g., as commonly used in an ELISA), biotin, digoxigenin, paramagnetic molecules, paramagnetic nanoparticles, ultrasmall superparamagnetic iron oxide ("USPIO") nanoparticles, USPIO nanoparticle aggregates, superparamagnetic iron oxide ("SPIO") nanoparticles, SPIO nanoparticle aggregates, monochrystalline iron oxide nanoparticles, monochrystalline iron oxide, nanoparticle contrast agents, liposomes or other delivery vehicles containing Gadolinium chelate ("Gd-chelate") molecules, Gadolinium, radioisotopes, radionuclides (e.g. carbon-11, nitrogen-13, oxygen-15, fluorine-18, rubidium-82), fluorodeoxyglucose (e.g. fluorine-18 labeled), any gamma ray emitting radionuclides, positron-emitting radionuclide, radiolabeled glucose, radiolabeled water, radiolabeled ammonia, biocolloids, microbubbles (e.g. including microbubble shells including albumin, galactose, lipid, and/or polymers; microbubble gas core including air, heavy gas(es), perfluorcarbon, nitrogen, octafluoropropane, perflexane lipid microsphere, perflutren, etc.), iodinated contrast agents (e.g., iohexol, iodixanol, ioversol, iopamidol, ioxilan, iopromide, diatrizoate, metrizoate, ioxaglate), barium sulfate, thorium dioxide, gold, gold nanoparticles, gold nanoparticle aggregates, fluorophores, two-photon fluorophores, or haptens and proteins or other entities which can be made detectable, e.g., by incorporating a radiolabel into a peptide or antibody specifically reactive with a target peptide.

[0080] A detectable moiety is a monovalent detectable agent or a detectable agent capable of forming a bond with another composition. In aspects, the detectable agent is an HA tag. In aspects, the HA tag includes the sequence set forth by SEQ ID NO:24. In aspects, the HA tag is the sequence set forth by SEQ ID NO:24. In aspects, the HA tag has an amino acid sequence that has at least 80% sequence identity to SEQ ID NO:24. In aspects, the HA tag has an amino acid sequence that has at least 85% sequence identity to SEQ ID NO:24. In aspects, the HA tag has an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:24. In aspects, the HA tag has an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:24. In aspects, the detectable agent is blue fluorescent protein (BFP). In aspects, the BFP includes the sequence set forth by SEQ ID NO:30. In aspects, the BFP is the sequence set forth by SEQ ID NO:30. In aspects, the BFP has an amino acid sequence that has at least 80% sequence identity to SEQ ID NO:30. In aspects, the BFP has an amino acid sequence that has at least 85% sequence identity to SEQ ID NO:30. In aspects, the BFP has an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:30. In aspects, the BFP has an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:30.

[0081] Radioactive substances (e.g., radioisotopes) that may be used as imaging and/or labeling agents in accordance with the aspects of the disclosure include, but are not limited to, .sup.18F, .sup.32P, .sup.33P, .sup.45Ti, .sup.47Sc, .sup.52Fe, .sup.59Fe, .sup.62Cu, .sup.64Cu, .sup.67Cu, .sup.67Ga, .sup.68Ga, .sup.77As, .sup.86Y, .sup.90Y, .sup.89Sr, .sup.89Zr, .sup.94Tc, .sup.94Tc, .sup.99mTc, .sup.99Mo, .sup.105Pd, .sup.105Rh, .sup.111Ag, .sup.111In, .sup.123I, .sup.124I, .sup.125I, .sup.131I, .sup.142Pr, .sup.143Pr, .sup.149Pm, .sup.153Sm, .sup.154-1581Gd, .sup.161Tb, .sup.166Dy, .sup.166Ho, .sup.169Er, .sup.175Lu, .sup.177Lu, .sup.186Re, .sup.188Re, .sup.189Re, .sup.194Ir, .sup.198Au, .sup.199Au, .sup.211At, .sup.211Pb, .sup.212Bi, .sup.212Pb, .sup.213Bi, .sup.223Ra and .sup.225Ac. Paramagnetic ions that may be used as additional imaging agents in accordance with the aspects of the disclosure include, but are not limited to, ions of transition and lanthanide metals (e.g., metals having atomic numbers of 21-29, 42, 43, 44, or 57-71). These metals include ions of Cr, V, Mn, Fe, Co, Ni, Cu, La, Ce, Pr, Nd, Pm, Sm, Eu, Gd, Tb, Dy, Ho, Er, T.sub.m, Yb and Lu.

[0082] "Contacting" is used in accordance with its plain ordinary meaning and refers to the process of allowing at least two distinct species to become sufficiently proximal to react, interact or physically touch. It should be appreciated, however, the resulting reaction product can be produced directly from a reaction between the added reagents or from an intermediate from one or more of the added reagents which can be produced in the reaction mixture.

[0083] The term "contacting" may include allowing two species to react, interact, or physically touch, wherein the two species may be, for example, a fusion protein as provided herein and a nucleic acid sequence (e.g., target DNA sequence).

[0084] As defined herein, the term "inhibition", "inhibit", "inhibiting," "repression," repressing," "silencing," "silence" and the like when used in reference to a composition as provided herein (e.g., fusion protein, complex, nucleic acid, vector) refer to negatively affecting (e.g., decreasing) the activity (e.g., transcription) of a nucleic acid sequence (e.g., decreasing transcription of a gene) relative to the activity of the nuclei acid sequence (e.g., transcription of a gene) in the absence of the composition (e.g., fusion protein, complex, nucleic acid, vector). In aspects, inhibition refers to reduction of a disease or symptoms of disease (e.g., cancer). Thus, inhibition includes, at least in part, partially or totally blocking activation (e.g., transcription), or decreasing, preventing, or delaying activation (e.g., transcription) of the nucleic acid sequence. The inhibited activity (e.g., transcription) may be 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, 10%, or less than that in a control. In aspects, the inhibition is 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold, or more in comparison to a control.

[0085] A "control" sample or value refers to a sample that serves as a reference, usually a known reference, for comparison to a test sample. For example, a test sample can be taken from a test condition, e.g., in the presence of a test compound, and compared to samples from known conditions, e.g., in the absence of the test compound (negative control), or in the presence of a known compound (positive control). A control can also represent an average value gathered from a number of tests or results. One of skill in the art will recognize that controls can be designed for assessment of any number of parameters. For example, a control can be devised to compare therapeutic benefit based on pharmacological data (e.g., half-life) or therapeutic measures (e.g., comparison of side effects). One of skill in the art will understand which controls are valuable in a given situation and be able to analyze data based on comparisons to control values. Controls are also valuable for determining the significance of data. For example, if values for a given parameter are widely variant in controls, variation in test samples will not be considered as significant.

[0086] Fusion Proteins

[0087] Provided herein are, inter alia, fusion proteins that can turn off genes permanently (e.g., irreversibly) and reversibly in mammalian cells using CRISPR-based epigenome editing. In embodiments, the fusion protein includes a single polypeptide fusion of four proteins (e.g., catalytically inactive Cas9 (e.g., dCas9), a KRAB domain, Dnmt3A and Dnmt3L) which can be expressed transiently in cells. The fusion protein can be directed to a specific site in a mammalian genome using a polynucleotide complementary to a target nucleic acid sequence (e.g., DNA sequence) and that further includes a sequence (i.e., binding sequence) capable of binding the fusion protein. Once properly positioned and without intending to be bound by a theory, the fusion protein adds DNA methylation and/or repressive chromatin marks to the target nucleic acid, resulting in gene silencing that is inheritable across subsequent cell divisions. In this way, the fusion protein can perform epigenome editing that bypasses the need to generate DNA double-strand breaks in the host genome, making it a safe and reversible way of manipulating the genome of a living organism.

[0088] In embodiments, the fustion protein comprises a nuclease-deficient RNA-guided DNA endonuclease enzyme; a KRAB domain, and a DNA methyltransferase domain. In aspects, the fusion protein comprises, from N-terminus to C-terminus, a DNA methyltransferase domain, a nuclease-deficient RNA-guided DNA endonuclease enzyme, and KRAB domain. In aspects, the fusion protein comprises, from N-terminus to C-terminus, a KRAB domain a nuclease-deficient RNA-guided DNA endonuclease enzyme, and a DNA methyltransferase domain. In embodiments, the fustion protein further comprises one or more peptide linkers. In aspects, the fusion protein further comprises one or more detectable tags. In aspects, the fusion protein further comprises one or more nuclear localization sequences. In aspects, the fusion protein further comprises one or more peptide linkers, one or more detectable tags, one or more nuclear localization sequences, or a combination of two or more of the foregoing. When the fusion protein comprises one or more peptide linkers, each peptide liner can be the same or different. When the fusion protein comprises one or more detectable tags, each detectable tag can be the same or different. In aspects, the fusion protein comprises from 1 to 10 detectable tags. In aspects, the fusion protein comprises from 1 to 9 detectable tags. In aspects, the fusion protein comprises from 1 to 8 detectable tags. In aspects, the fusion protein comprises from 1 to 7 detectable tags. In aspects, the fusion protein comprises from 1 to 6 detectable tags. In aspects, the fusion protein comprises from 1 to 5 detectable tags. In aspects, the fusion protein comprises from 1 to 4 detectable tags. In aspects, the fusion protein comprises from 1 to 3 detectable tags. In aspects, the fusion protein comprises from 1 to 2 detectable tags. In aspects, the fusion protein comprises 1 detectable tag. In aspects, the fusion protein comprises 2 detectable tags. In aspects, the fusion protein comprises 3 detectable tags. In aspects, the fusion protein comprises 4 detectable tags. In aspects, the fusion protein comprises 5 detectable tags.

[0089] In embodiments, the fusion protein comprises the structure: A-B-C, or B-A-C or C-A-B, or C-B-A, or B-C-A, or A-C-B; where A comprises a nuclease-deficient RNA-guided DNA endonuclease enzyme; B comprises a KRAB domain, C comprises a DNA methyltransferase domain; and wherein the component on the left is the N-terminus and the component on the right is the C-terminus. In aspects, the fusion protein further comprises one or more peptide linkers and one or more detectable tags. In aspects, A-B, B-A, B-C, C-B, A-C, and C-A are each independently linked together via a covalent bond, a peptide linker, a detectable tag, a nuclear localization sequence, or a combination of two or more thereof. The peptide linker can be any known in the art (e.g., P2A cleavable peptide, XTEN linker, and the like). In aspects, the fusion protein comprises other components, such as detectable tags (e.g., HA tag, blue fluorescent protein, and the like).

[0090] In embodiments, the fusion protein comprises the structure: A-L.sub.1-B-L.sub.2-C, where A comprises a nuclease-deficient RNA-guided DNA endonuclease enzyme; B comprises a KRAB domain, C comprises a DNA methyltransferase domain, L.sub.1 is a covalent bond or a peptide linker, and L.sub.2 is a covalent bond or a peptide linker; and where A is at the N-terminus and C is at the C-terminus. In aspects, A is covalently linked to B via a peptide linker. In aspects, A is covalently linked to B via a covalent bond. In aspects, B is covalently linked to C via a peptide linker. In aspects, B is covalently linked to C via a covalent bond. The peptide linker can be any known in the art (e.g., P2A cleavable peptide, XTEN linker, and the like). In aspects, the fusion protein comprises other components, such as detectable tags, nuclear localization sequences, and the like. In aspects, L.sub.1 is a covalent bond, a peptide linker, a detectable tag, a nuclear localization sequence, or a combination thereof. In aspects, L.sub.2 is a covalent bond, a peptide linker, a detectable tag, a nuclear localization sequence, or a combination thereof.

[0091] In embodiments, the fusion protein comprises the structure: B-L.sub.1-A-L.sub.2-C, where A comprise a nuclease-deficient RNA-guided DNA endonuclease enzyme; B comprises a KRAB domain, C comprises a DNA methyltransferase domain, L.sub.1 is a covalent bond or a peptide linker, and L.sub.2 is a covalent bond or a peptide linker; and where B is at the N-terminus and C is at the C-terminus. In aspects, L.sub.1 is a peptide linker. In aspects, L.sub.1 is a covalent bond. In aspects, L.sub.2 is a peptide linker. In aspects, L.sub.2 is a covalent bond. The peptide linker can be any known in the art or described herein (e.g., P2A cleavable peptide, XTEN linker, and the like). In aspects, the fusion protein comprises other components, such as detectable tags. In aspects, L.sub.1 is a covalent bond, a peptide linker, a detectable tag, or a combination thereof. In aspects, L.sub.2 is a covalent bond, a peptide linker, a detectable tag, or a combination thereof. In aspects, the fusion protein further comprises a nuclear localization sequence. Exemplary fusion proteins comprising the structure: B-L.sub.1-A-L.sub.2-C include p76, p90, p91, p92, p93, p94, p95, p96, p97, p98, p99, p100, p101, and p102 (FIG. 5)

[0092] In embodiments, the fusion protein comprises the structure: B-L.sub.3-A-L.sub.4-C-L.sub.5-D; where A comprises a nuclease-deficient RNA-guided DNA endonuclease enzyme; B comprises a KRAB domain, C comprises a DNA methyltransferase domain, D is absent or D comprises one or more detectable tags, L.sub.3 comprises a covalent bond, a peptide linker, a detectable tag, or a combination of two or more thereof, L.sub.4 comprises a covalent bond, a peptide linker, a detectable tag, or a combination of two or more thereof, L.sub.5 is absent or L.sub.5 comprises a covalent bond or a peptide linker; and where B is at the N-terminus and D is at the C-terminus. In aspects, L.sub.3 is a peptide linker. In aspects, L.sub.3 is a covalent bond. In aspects, L.sub.3 comprises a peptide linker and a detectable tag. In aspects, L.sub.3 comprises a detectable tag. In aspects, L.sub.4 is a peptide linker. In aspects, L.sub.4 comprises a peptide linker and a detectable tag. In aspects, L.sub.4 is a covalent bond. In aspects, L.sub.4 comprises a detectable tag. In aspects, L.sub.5 is a peptide linker. In aspects, L.sub.5 is a covalent bond. In aspects, D comprises one or a plurality of detectable tags. In aspects, D comprises one detectable tag. In aspects, D comprises two detectable tags. In aspects, D comprises three detectable tags. In aspects, D comprises a plurality of detectable tags. D can be any detectable tag known in the art and/or described herein (e.g., HA tag, blue fluorescent protein, and the like). In aspects L.sub.5 and D are absent. When L.sub.3, L.sub.4, L.sub.5, and D comprise two or more detectable tags, each detectable tag is the same or different. The peptide linker can be any known in the art and/or described herein (e.g., P2A cleavable peptide, XTEN linker, and the like). In aspects, the fusion protein further comprises a nuclear localization sequence. Exemplary fusion proteins comprising the structure: B-L.sub.3-A-L.sub.4-C-L.sub.5-D include p76, p90, p91, p92, p93, p94, p95, p96, p97, p98, p99, p100, p101, and p102, as shown in FIG. 5.

[0093] In embodiments, the fusion protein comprises the structure: C-L.sub.3-A-L.sub.4-B-L.sub.5-D, where A comprises a nuclease-deficient RNA-guided DNA endonuclease enzyme; B comprises a KRAB domain, C comprises a DNA methyltransferase domain, D is absent or D comprises one or more detectable tags, L.sub.3 comprises a covalent bond, a peptide linker, a detectable tag, or a combination of two or more thereof, L.sub.4 comprises a covalent bond, a peptide linker, a detectable tag, or a combination of two or more thereof, L.sub.5 is absent or L.sub.5 comprises a covalent bond or a peptide linker; and where C is at the N-terminus and D is at the C-terminus. In aspects, L.sub.3 is a peptide linker. In aspects, L.sub.3 is a covalent bond. In aspects, L.sub.3 comprises a detectable tag. In aspects, L.sub.3 comprises a peptide linker and a detectable tag. In aspects, L.sub.4 a peptide linker. In aspects, L.sub.4 is a covalent bond. In aspects, L.sub.4 comprises a detectable tag. In aspects, L.sub.4 comprises a peptide linker and a detectable tag. In aspects, L.sub.5 a peptide linker. In aspects, L.sub.5 is a covalent bond. In aspects, D comprises one or a plurality of detectable tags. In aspects, D comprises one detectable tag. In aspects, D comprises two detectable tags. In aspects, D comprises three detectable tags. In aspects, D comprises a plurality of detectable tags. D can be any detectable tag known in the art and/or described herein (e.g., HA tag, blue fluorescent protein, and the like). In aspects L.sub.5 and D are absent. When L.sub.3, L.sub.4, L.sub.5, and D comprise two or more detectable tags, each detectable tag is the same or different. The peptide linker can be any known in the art and/or described herein (e.g., P2A cleavable peptide, XTEN linker, and the like). In aspects, the fusion protein further comprises a nuclear localization sequence. Exemplary fusion proteins comprising the structure: C-L.sub.3-A-L.sub.4-B-L.sub.5-D include p112, as shown in FIG. 5.

[0094] The term "nuclease-deficient RNA-guided DNA endonuclease enzyme" and the like refer, in the usual and customary sense, to an RNA-guided DNA endonuclease (e.g. a mutated form of a naturally occurring RNA-guided DNA endonuclease) that targets a specific phosphodiester bond within a DNA polynucleotide, wherein the recognition of the phosphodiester bond is facilitated by a separate polynucleotide sequence (for example, a RNA sequence (e.g., single guide RNA (sgRNA)), but is incapable of cleaving the target phosphodiester bond to a significant degree (e.g. there is no measurable cleavage of the phosphodiester bond under physiological conditions). A nuclease-deficient RNA-guided DNA endonuclease thus retains DNA-binding ability (e.g. specific binding to a target sequence) when complexed with a polynucleotide (e.g., sgRNA), but lacks significant endonuclease activity (e.g. any amount of detectable endonuclease activity). In aspects, the nuclease-deficient RNA-guided DNA endonuclease enzyme is dCas9, ddCpf1, a nuclease-deficient Cas9 variant, or a nuclease-deficient Class II CRISPR endonuclease.

[0095] In embodiments, the nuclease-deficient RNA-guided DNA endonuclease enzyme is dCas9. The terms "dCas9" or "dCas9 protein" as referred to herein is a Cas9 protein in which both catalytic sites for endonuclease activity are defective or lack activity. In aspects, the dCas9 protein has mutations at positions corresponding to D10A and H840A of S. pyogenes Cas9. In aspects, the dCas9 protein lacks endonuclease activity due to point mutations at both endonuclease catalytic sites (RuvC and HNH) of wild type Cas9. The point mutations can be D10A and H840A. In aspects, the dCas9 has substantially no detectable endonuclease (e.g., endodeoxyribonuclease) activity. In aspects, dCas9 includes the amino acid sequence of SEQ ID NO:23. In aspects, dCas9 has the amino acid sequence of SEQ ID NO:23. In aspects, dCas9 has an amino acid sequence that has at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:23. In aspects, dCas9 has an amino acid sequence that has at least 75% sequence identity to SEQ ID NO:23. In aspects, dCas9 has an amino acid sequence that has at least 80% sequence identity to SEQ ID NO:23. In aspects, dCas9 has an amino acid sequence that has at least 85% sequence identity to SEQ ID NO:23. In aspects, dCas9 has an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:23. In aspects, dCas9 has an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:23.

[0096] A "CRISPR associated protein 9," "Cas9," "Csn1" or "Cas9 protein" as referred to herein includes any of the recombinant or naturally-occurring forms of the Cas9 endonuclease or variants or homologs thereof that maintain Cas9 endonuclease enzyme activity (e.g. within at least 50%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% activity compared to Cas9). In some aspects, the variants or homologs have at least 90%, 95%, 96%, 97%, 98%, 99% or 100% amino acid sequence identity across the whole sequence or a portion of the sequence (e.g. a 50, 100, 150 or 200 continuous amino acid portion) compared to a naturally occurring Cas9 protein. In aspects, the Cas9 protein is substantially identical to the protein identified by the UniProt reference number Q99ZW2 or a variant or homolog having substantial identity thereto. In aspects, the Cas9 protein has at least 75% sequence identity to the amino acid sequence of the protein identified by the UniProt reference number Q99ZW2. In aspects, the Cas9 protein has at least 80% sequence identity to the amino acid sequence of the protein identified by the UniProt reference number Q99ZW2. In aspects, the Cas9 protein has at least 85% sequence identity to the amino acid sequence of the protein identified by the UniProt reference number Q99ZW2. In aspects, the Cas9 protein has at least 90% sequence identity to the amino acid sequence of the protein identified by the UniProt reference number Q99ZW2. In aspects, the Cas9 protein has at least 95% sequence identity to the amino acid sequence of the protein identified by the UniProt reference number Q99ZW2.

[0097] In embodiments, the nuclease-deficient RNA-guided DNA endonuclease enzyme is "ddCpf1" or "ddCas12a". The terms "DNAse-dead Cpf1" or "ddCpf1" refer to mutated Acidaminococcus sp. Cpf1 (AsCpf1) resulting in the inactivation of Cpf1 DNAse activity. In aspects, ddCpf1 includes an E993A mutation in the RuvC domain of AsCpf1. In aspects, the ddCpf1 has substantially no detectable endonuclease (e.g., endodeoxyribonuclease) activity. In aspects, ddCpf1 includes the amino acid sequence of SEQ ID NO:34. In aspects, ddCpf1 has the amino acid sequence of SEQ ID NO:34. In aspects, ddCpf1 has an amino acid sequence that has at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:34. In aspects, ddCpf1 has an amino acid sequence that has at least 75% sequence identity to SEQ ID NO:34. In aspects, ddCpf1 has an amino acid sequence that has at least 80% sequence identity to SEQ ID NO:34. In aspects, ddCpf1 has an amino acid sequence that has at least 85% sequence identity to SEQ ID NO:34. In aspects, ddCpf1 has an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:34. In aspects, ddCpf1 has an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:34.

[0098] In embodiments, the nuclease-deficient RNA-guided DNA endonuclease enzyme is dLbCpf1. The term "dLbCpf1: refers to mutated Cpf1 from Lachnospiraceae bacterium ND2006 (LbCpf1) that lacks DNAse activity. In aspects, dLbCpf1 includes a D832A mutation. In aspects, the dLbCpf1 has substantially no detectable endonuclease (e.g., endodeoxyribo-nuclease) activity.

[0099] In aspects, dLbCpf1 includes the amino acid sequence of SEQ ID NO:35. In aspects, dLbCpf1 has the amino acid sequence of SEQ ID NO:35. In aspects, dLbCpf1 has an amino acid sequence that has at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:35. In aspects, dLbCpf1 has an amino acid sequence that has at least 75% sequence identity to SEQ ID NO:35. In aspects, dLbCpf1 has an amino acid sequence that has at least 80% sequence identity to SEQ ID NO:35. In aspects, dLbCpf1 has an amino acid sequence that has at least 85% sequence identity to SEQ ID NO:35. In aspects, dLbCpf1 has an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:35. In aspects, dLbCpf1 has an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:35.

[0100] In embodiments, the nuclease-deficient RNA-guided DNA endonuclease enzyme is dFnCpf1. The term "dFnCpf1" refers to mutated Cpf1 from Francisella novicida U112 (FnCpf1) that lacks DNAse activity. In aspects, dFnCpf1 includes a D917A mutation. In aspects, the dFnCpf1 has substantially no detectable endonuclease (e.g., endodeoxyribo-nuclease) activity. In aspects, dFnCpf1 includes the amino acid sequence of SEQ ID NO: 36. In aspects, dFnCpf1 has the amino acid sequence of SEQ ID NO: 36. In aspects, dFnCpf1 has an amino acid sequence that has at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:36. In aspects, dFnCpf1 has an amino acid sequence that has at least 75% sequence identity to SEQ ID NO:36. In aspects, dFnCpf1 has an amino acid sequence that has at least 80% sequence identity to SEQ ID NO:36. In aspects, dFnCpf1 has an amino acid sequence that has at least 85% sequence identity to SEQ ID NO:36. In aspects, dFnCpf1 has an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:36. In aspects, dFnCpf1 has an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:36.

[0101] A "Cpf1" or "Cpf1 protein" as referred to herein includes any of the recombinant or naturally-occurring forms of the Cpf1 (CRISPR from Prevotella and Francisella 1) endonuclease or variants or homologs thereof that maintain Cpf1 endonuclease enzyme activity (e.g. within at least 50%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% activity compared to Cpf1). In aspects, the variants or homologs have at least 90%, 95%, 96%, 97%, 98%, 99% or 100% amino acid sequence identity across the whole sequence or a portion of the sequence (e.g. a 50, 100, 150 or 200 continuous amino acid portion) compared to a naturally occurring Cpf1 protein. In aspects, the Cpf1 protein is substantially identical to the protein identified by the UniProt reference number U2UMQ6 or a variant or homolog having substantial identity thereto. In aspects, the Cpf1 protein is identical to the protein identified by the UniProt reference number U2UMQ6. In aspects, the Cpf1 protein has at least 75% sequence identity to the amino acid sequence of the protein identified by the UniProt reference number U2UMQ6. In aspects, the Cpf1 protein has at least 80% sequence identity to the amino acid sequence of the protein identified by the UniProt reference number U2UMQ6. In aspects, the Cpf1 protein is identical to the protein identified by the UniProt reference number U2UMQ6. In aspects, the Cpf1 protein has at least 85% sequence identity to the amino acid sequence of the protein identified by the UniProt reference number U2UMQ6. In aspects, the Cpf1 protein is identical to the protein identified by the UniProt reference number U2UMQ6. In aspects, the Cpf1 protein has at least 90% sequence identity to the amino acid sequence of the protein identified by the UniProt reference number U2UMQ6. In aspects, the Cpf1 protein is identical to the protein identified by the UniProt reference number U2UMQ6. In aspects, the Cpf1 protein has at least 95% sequence identity to the amino acid sequence of the protein identified by the UniProt reference number U2UMQ6.

[0102] In embodiments, the nuclease-deficient RNA-guided DNA endonuclease enzyme is a nuclease-deficient Cas9 variant. The term "nuclease-deficient Cas9 variant" refers to a Cas9 protein having one or more mutations that increase its binding specificity to PAM compared to wild type Cas9 and further include mutations that render the protein incapable of or having severely impaired endonuclease activity. Without wishing to be bound by theory, it is believed that the target sequence should be associated with a PAM (protospacer adjacent motif); that is, a short sequence recognized by the CRISPR complex. The precise sequence and length requirements for the PAM differ depending on the CRISPR enzyme used, but PAMs are typically 2-5 base pair sequences adjacent the protospacer (that is, the target sequence). The binding specificity of nuclease-deficient Cas9 variants to PAM can be determined by any method known in the art. Descriptions and uses of known Cas9 variants may be found, for example, in Shmakov et al., Diversity and evolution of class 2 CRISPR-Cas systems. Nat. Rev. Microbiol. 15, 2017 and Cebrian-Serrano et al, CRISPR-Cas orthologues and variants: optimizing the repertoire, specificity and delivery of genome engineering tools. Mamm. Genome 7-8, 2017, which are incorporated herein by reference in their entirety and for all purposes. Exemplary Cas9 variants are listed in the Table 4 below.

TABLE-US-00001 TABLE 4 Cas9 Variants PAM domains References Strep pyogenes NGG Hsu et al. (Sp) Cas9 2014 Cell Staph aureus NNGRRT or Ran et al. (Sa) Cas9 NNGRR 2015 Nature NNGGGT, NNGAAT, NNGAGT (Zetsche) SpCas9 VQR mutant NGAG > NGAT = Kleinstiver (D1135V, R1335Q, NGAA > NGAC et al. 2015 T1337R) NGCG Nature SpCas9 VRER mutant NGCG Kleinstiver (D1135V/G1218R/ et al. 2015 R1335E/T1337R) Nature SpCas9 D1135E NGG, greater Kleinstiver fidelity, et al. 2015 less cutting at NAG and NGA sites Nature eSpCas9 1.1 mutant NGG Slaymaker et (K848A/K1003A/ al. Science R1060A) 2015 SpCas9 HF1 NGG Kleinstiver (Q695A, Q926A, et al. 2016 N497A, R661A) Nature AsCpf1 TTTN Zetsche etal. (5' of sgRNA) 2015 Cell HypaCas9 (N692A, Chen et al., M694A, Nature volume Q695A, H698A) 550, pages 407-410 (19 October 2017)

[0103] In embodiments, the nuclease-deficient RNA-guided DNA endonuclease enzyme is a nuclease-deficient Class II CRISPR endonuclease. The term "nuclease-deficient Class II CRISPR endonuclease" as used herein refers to any Class II CRISPR endonuclease having mutations resulting in reduced, impaired, or inactive endonuclease activity.

[0104] In embodiments, the DNA methyltransferase domain is a Dnmt3A-3L domain. A "Dnmt3A-3L domain" as provided herein refers to a protein including both Dnmt3A and Dnmt3L. In aspects, the Dnmt3A and the Dnmt3L are covalently linked. In aspects, the Dnmt3A is covalently linked to the Dnmt3L through a peptide linker. In aspects, the peptide linker includes the sequence set forth by SEQ ID NO:27. In aspects, the peptide linker is the sequence set forth by SEQ ID NO:27. In aspects, the peptide linker has an amino acid sequence that has at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:27. In aspects, the peptide linker has an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:27. In aspects, the peptide linker has an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:27. In aspects, the Dnmt3A-3L domain includes the sequence set forth by SEQ ID NO:33. In aspects, the Dnmt3A-3L domain is the sequence set forth by SEQ ID NO:33. In aspects, the Dnmt3A-3L domain has an amino acid sequence that has at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:33. In aspects, the Dnmt3A-3L domain has an amino acid sequence that has at least 75% sequence identity to SEQ ID NO:33. In aspects, the Dnmt3A-3L domain has an amino acid sequence that has at least 80% sequence identity to SEQ ID NO:33. In aspects, the Dnmt3A-3L domain has an amino acid sequence that has at least 85% sequence identity to SEQ ID NO:33. In aspects, the Dnmt3A-3L domain has an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:33. In aspects, the Dnmt3A-3L domain has an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:33.

[0105] In embodiments, the peptide linker is a XTEN linker. In aspects, the XTEN linker includes about 16 to about 80 amino acid residues. In aspects, the XTEN linker includes about 17 to about 80 amino acid residues. In aspects, the XTEN linker includes about 18 to about 80 amino acid residues. In aspects, the XTEN linker includes about 19 to about 80 amino acid residues. In aspects, the XTEN linker includes about 20 to about 80 amino acid residues. In aspects, the XTEN linker includes about 30 to about 80 amino acid residues. In aspects, the XTEN linker includes about 40 to about 80 amino acid residues. In aspects, the XTEN linker includes about 50 to about 80 amino acid residues. In aspects, the XTEN linker includes about 60 to about 80 amino acid residues. In aspects, the XTEN linker includes about 70 to about 80 amino acid residues. In aspects, the XTEN linker includes about 16 to about 70 amino acid residues. In aspects, the XTEN linker includes about 16 to about 60 amino acid residues. In aspects, the XTEN linker includes about 16 to about 50 amino acid residues. In aspects, the XTEN linker includes about 16 to about 40 amino acid residues. In aspects, the XTEN linker includes about 16 to about 35 amino acid residues. In aspects, the XTEN linker includes about 16 to about 30 amino acid residues. In aspects, the XTEN linker includes about 16 to about 25 amino acid residues. In aspects, the XTEN linker includes about 16 to about 20 amino acid residues. In aspects, the XTEN linker includes about 16 amino acid residues. In aspects, the XTEN linker includes about 17 amino acid residues. In aspects, the XTEN linker includes about 18 amino acid residues. In aspects, the XTEN linker includes about 19 amino acid residues. In aspects, the XTEN linker includes about 20 amino acid residues.

[0106] In embodiments, the XTEN linker includes the sequence set forth by SEQ ID NO:31. In aspects, the XTEN linker is the sequence set forth by SEQ ID NO:31. In aspects, the XTEN linker includes the sequence set forth by SEQ ID NO:32. In aspects, the XTEN linker is the sequence set forth by SEQ ID NO:32. In aspects, the XTEN linker has an amino acid sequence that has at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:31. In aspects, the XTEN linker has an amino acid sequence that has at least 85% sequence identity to SEQ ID NO:31. In aspects, the XTEN linker has an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:31. In aspects, the XTEN linker has an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:31. In aspects, the XTEN linker has an amino acid sequence that has at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO:32. In aspects, the XTEN linker has an amino acid sequence that has at least 75% sequence identity to SEQ ID NO:32. In aspects, the XTEN linker has an amino acid sequence that has at least 80% sequence identity to SEQ ID NO:32. In aspects, the XTEN linker has an amino acid sequence that has at least 85% sequence identity to SEQ ID NO:32. In aspects, the XTEN linker has an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:32. In aspects, the XTEN linker has an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:32.

[0107] The fusion protein may include amino acid sequences useful for targeting the fusion protein to specific regions of a cell (e.g., cytoplasm, nucleus). Thus, in aspects, the fusion protein further includes a nuclear localization signal (NLS) peptide. In aspects, the NLS includes the sequence set forth by SEQ ID NO:25. In aspects, the NLS is the sequence set forth by SEQ ID NO:25. In aspects, the NLS has an amino acid sequence that has at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 25. In aspects, the NLS has an amino acid sequence that has at least 75% sequence identity to SEQ ID NO:25. In aspects, the NLS has an amino acid sequence that has at least 80% sequence identity to SEQ ID NO:25. In aspects, the NLS has an amino acid sequence that has at least 85% sequence identity to SEQ ID NO:25. In aspects, the NLS has an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:25. In aspects, the NLS has an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:25.

[0108] In embodiments, the fusion protein includes, from N-terminus to C-terminus, a KRAB domain, a nuclease-deficient RNA-guided DNA endonuclease enzyme, and a DNA methyltransferase domain.

[0109] In embodiments, the nuclease-deficient RNA-guided DNA endonuclease enzyme is dCas9 and the DNA methyltransferase domain is a Dnmt3A-3L domain.

[0110] In embodiments, the dCas9 is covalently linked to the KRAB domain via a peptide linker and wherein the dCas9 is covalently linked to the Dnmt3A-3L domain via a peptide linker.

[0111] In embodiments, peptide linker is an XTEN linker. In aspects, the XTEN linker includes the sequence set forth by SEQ ID NO:31. In aspects, the XTEN linker is the sequence set forth by SEQ ID NO:31. In aspects, the XTEN linker has an amino acid sequence that has at least 75% sequence identity to SEQ ID NO:31. In aspects, the XTEN linker has an amino acid sequence that has at least 80% sequence identity to SEQ ID NO:31. In aspects, the XTEN linker has an amino acid sequence that has at least 85% sequence identity to SEQ ID NO:31. In aspects, the XTEN linker has an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:31. In aspects, the XTEN linker has an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:31. In aspects, the XTEN linker includes the sequence set forth by SEQ ID NO:32. In aspects, the XTEN linker is the sequence set forth by SEQ ID NO:32. In aspects, the XTEN linker has an amino acid sequence that has at least 75% sequence identity to SEQ ID NO:32. In aspects, the XTEN linker has an amino acid sequence that has at least 80% sequence identity to SEQ ID NO:32. In aspects, the XTEN linker has an amino acid sequence that has at least 85% sequence identity to SEQ ID NO:32. In aspects, the XTEN linker has an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:32. In aspects, the XTEN linker has an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:32.

[0112] In embodiments, the fusion protein includes the amino acid sequence of SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 12, 13, 14 or 15. In aspects, the fusion protein includes the amino acid sequence of SEQ ID NO:1. In aspects, the fusion protein is the amino acid sequence of SEQ ID NO:1. In aspects, the fusion protein includes the amino acid sequence of SEQ ID NO:2. In aspects, the fusion protein is the amino acid sequence of SEQ ID NO:2 In aspects, the fusion protein includes the amino acid sequence of SEQ ID NO:3. In aspects, the fusion protein is the amino acid sequence of SEQ ID NO:3. In aspects, the fusion protein includes the amino acid sequence of SEQ ID NO:4. In aspects, the fusion protein is the amino acid sequence of SEQ ID NO:4. In aspects, the fusion protein includes the amino acid sequence of SEQ ID NO:5. In aspects, the fusion protein is the amino acid sequence of SEQ ID NO:5. In aspects, the fusion protein includes the amino acid sequence of SEQ ID NO:6. In aspects, the fusion protein is the amino acid sequence of SEQ ID NO:6. In aspects, the fusion protein includes the amino acid sequence of SEQ ID NO:7. In aspects, the fusion protein is the amino acid sequence of SEQ ID NO:7. In aspects, the fusion protein includes the amino acid sequence of SEQ ID NO:8. In aspects, the fusion protein is the amino acid sequence of SEQ ID NO:8. In aspects, the fusion protein includes the amino acid sequence of SEQ ID NO:9. In aspects, the fusion protein is the amino acid sequence of SEQ ID NO:9. In aspects, the fusion protein includes the amino acid sequence of SEQ ID NO:10. In aspects, the fusion protein is the amino acid sequence of SEQ ID NO:10. In aspects, the fusion protein includes the amino acid sequence of SEQ ID NO:11. In aspects, the fusion protein is the amino acid sequence of SEQ ID NO:11. In aspects, the fusion protein includes the amino acid sequence of SEQ ID NO:12. In aspects, the fusion protein is the amino acid sequence of SEQ ID NO:12. In aspects, the fusion protein includes the amino acid sequence of SEQ ID NO:13. In aspects, the fusion protein is the amino acid sequence of SEQ ID NO:13. In aspects, the fusion protein includes the amino acid sequence of SEQ ID NO:14. In aspects, the fusion protein is the amino acid sequence of SEQ ID NO:14. In aspects, the fusion protein includes the amino acid sequence of SEQ ID NO:15. In aspects, the fusion protein is the amino acid sequence of SEQ ID NO:15.

[0113] In embodiments, the fusion protein includes an amino acid sequence having at least 75%, 80% 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 12, 13, 14 or 15. In aspects, the fusion protein includes an amino acid sequence having at least 75%, 80% 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:1. In aspects, the fusion protein includes an amino acid sequence having at least 75%, 80% 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:2. In aspects, the fusion protein includes an amino acid sequence having at least 75%, 80% 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:3. In aspects, the fusion protein includes an amino acid sequence having at least 75%, 80% 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:4. In aspects, the fusion protein includes an amino acid sequence having at least 75%, 80% 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:5. In aspects, the fusion protein includes an amino acid sequence having at least 75%, 80% 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:6. In aspects, the fusion protein includes an amino acid sequence having at least 75%, 80% 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:7. In aspects, the fusion protein includes an amino acid sequence having at least 75%, 80% 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:8. In aspects, the fusion protein includes an amino acid sequence having at least 75%, 80% 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:9. In aspects, the fusion protein includes an amino acid sequence having at least 75%, 80% 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:10. In aspects, the fusion protein includes an amino acid sequence having at least 75%, 80% 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:11. In aspects, the fusion protein includes an amino acid sequence having at least 75%, 80% 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:12. In aspects, the fusion protein includes an amino acid sequence having at least 75%, 80% 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:13. In aspects, the fusion protein includes an amino acid sequence having at least 75%, 80% 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:14. In aspects, the fusion protein includes an amino acid sequence having at least 75%, 80% 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:15.

[0114] In embodiments, the fusion protein includes an amino acid sequence having at least 75% sequence identity to SEQ ID NO:1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 12, 13, 14 or 15. In aspects, the fusion protein includes an amino acid sequence having at least 75% sequence identity to SEQ ID NO:1. In aspects, the fusion protein includes an amino acid sequence having at least 75% sequence identity to SEQ ID NO:2. In aspects, the fusion protein includes an amino acid sequence having at least 75% sequence identity to SEQ ID NO:3. In aspects, the fusion protein includes an amino acid sequence having at least 75% sequence identity to SEQ ID NO:4. In aspects, the fusion protein includes an amino acid sequence having at least 75% sequence identity to SEQ ID NO:5. In aspects, the fusion protein includes an amino acid sequence having at least 75% sequence identity to SEQ ID NO:6. In aspects, the fusion protein includes an amino acid sequence having at least 75% sequence identity to SEQ ID NO:7. In aspects, the fusion protein includes an amino acid sequence having at least 75% sequence identity to SEQ ID NO:8. In aspects, the fusion protein includes an amino acid sequence having at least 75% sequence identity to SEQ ID NO:9. In aspects, the fusion protein includes an amino acid sequence having at least 75% sequence identity to SEQ ID NO:10. In aspects, the fusion protein includes an amino acid sequence having at least 75% sequence identity to SEQ ID NO:11. In aspects, the fusion protein includes an amino acid sequence having at least 75% sequence identity to SEQ ID NO:12. In aspects, the fusion protein includes an amino acid sequence having at least 75% sequence identity to SEQ ID NO:13. In aspects, the fusion protein includes an amino acid sequence having at least 75% sequence identity to SEQ ID NO:14. In aspects, the fusion protein includes an amino acid sequence having at least 75% sequence identity to SEQ ID NO:15.

[0115] In embodiments, the fusion protein includes an amino acid sequence having at least 80% sequence identity to SEQ ID NO:1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 12, 13, 14 or 15. In aspects, the fusion protein includes an amino acid sequence having at least 80% sequence identity to SEQ ID NO:1. In aspects, the fusion protein includes an amino acid sequence having at least 80% sequence identity to SEQ ID NO:2. In aspects, the fusion protein includes an amino acid sequence having at least 80% sequence identity to SEQ ID NO:3. In aspects, the fusion protein includes an amino acid sequence having at least 80% sequence identity to SEQ ID NO:4. In aspects, the fusion protein includes an amino acid sequence having at least 80% sequence identity to SEQ ID NO:5. In aspects, the fusion protein includes an amino acid sequence having at least 80% sequence identity to SEQ ID NO:6. In aspects, the fusion protein includes an amino acid sequence having at least 80% sequence identity to SEQ ID NO:7. In aspects, the fusion protein includes an amino acid sequence having at least 80% sequence identity to SEQ ID NO:8. In aspects, the fusion protein includes an amino acid sequence having at least 80% sequence identity to SEQ ID NO:9. In aspects, the fusion protein includes an amino acid sequence having at least 80% sequence identity to SEQ ID NO:10. In aspects, the fusion protein includes an amino acid sequence having at least 80% sequence identity to SEQ ID NO:11. In aspects, the fusion protein includes an amino acid sequence having at least 80% sequence identity to SEQ ID NO:12. In aspects, the fusion protein includes an amino acid sequence having at least 80% sequence identity to SEQ ID NO:13. In aspects, the fusion protein includes an amino acid sequence having at least 80% sequence identity to SEQ ID NO:14. In aspects, the fusion protein includes an amino acid sequence having at least 80% sequence identity to SEQ ID NO:15.

[0116] In embodiments, the fusion protein includes an amino acid sequence having at least 85% sequence identity to SEQ ID NO:1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 12, 13, 14 or 15. In aspects, the fusion protein includes an amino acid sequence having at least 85% sequence identity to SEQ ID NO:1. In aspects, the fusion protein includes an amino acid sequence having at least 85% sequence identity to SEQ ID NO:2. In aspects, the fusion protein includes an amino acid sequence having at least 85% sequence identity to SEQ ID NO:3. In aspects, the fusion protein includes an amino acid sequence having at least 85% sequence identity to SEQ ID NO:4. In aspects, the fusion protein includes an amino acid sequence having at least 85% sequence identity to SEQ ID NO:5. In aspects, the fusion protein includes an amino acid sequence having at least 85% sequence identity to SEQ ID NO:6. In aspects, the fusion protein includes an amino acid sequence having at least 85% sequence identity to SEQ ID NO:7. In aspects, the fusion protein includes an amino acid sequence having at least 85% sequence identity to SEQ ID NO:8. In aspects, the fusion protein includes an amino acid sequence having at least 85% sequence identity to SEQ ID NO:9. In aspects, the fusion protein includes an amino acid sequence having at least 85% sequence identity to SEQ ID NO:10. In aspects, the fusion protein includes an amino acid sequence having at least 85% sequence identity to SEQ ID NO:11. In aspects, the fusion protein includes an amino acid sequence having at least 85% sequence identity to SEQ ID NO:12. In aspects, the fusion protein includes an amino acid sequence having at least 85% sequence identity to SEQ ID NO:13. In aspects, the fusion protein includes an amino acid sequence having at least 85% sequence identity to SEQ ID NO:14. In aspects, the fusion protein includes an amino acid sequence having at least 85% sequence identity to SEQ ID NO:15.

[0117] In embodiments, the fusion protein includes an amino acid sequence having at least 90% sequence identity to SEQ ID NO:1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 12, 13, 14 or 15. In aspects, the fusion protein includes an amino acid sequence having at least 90% sequence identity to SEQ ID NO:1. In aspects, the fusion protein includes an amino acid sequence having at least 90% sequence identity to SEQ ID NO:2. In aspects, the fusion protein includes an amino acid sequence having at least 90% sequence identity to SEQ ID NO:3. In aspects, the fusion protein includes an amino acid sequence having at least 90% sequence identity to SEQ ID NO:4. In aspects, the fusion protein includes an amino acid sequence having at least 90% sequence identity to SEQ ID NO:5. In aspects, the fusion protein includes an amino acid sequence having at least 90% sequence identity to SEQ ID NO:6. In aspects, the fusion protein includes an amino acid sequence having at least 90% sequence identity to SEQ ID NO:7. In aspects, the fusion protein includes an amino acid sequence having at least 90% sequence identity to SEQ ID NO:8. In aspects, the fusion protein includes an amino acid sequence having at least 90% sequence identity to SEQ ID NO:9. In aspects, the fusion protein includes an amino acid sequence having at least 90% sequence identity to SEQ ID NO:10. In aspects, the fusion protein includes an amino acid sequence having at least 90% sequence identity to SEQ ID NO:11. In aspects, the fusion protein includes an amino acid sequence having at least 90% sequence identity to SEQ ID NO:12. In aspects, the fusion protein includes an amino acid sequence having at least 90% sequence identity to SEQ ID NO:13. In aspects, the fusion protein includes an amino acid sequence having at least 90% sequence identity to SEQ ID NO:14. In aspects, the fusion protein includes an amino acid sequence having at least 90% sequence identity to SEQ ID NO:15.

[0118] In embodiments, the fusion protein includes an amino acid sequence having at least 95% sequence identity to SEQ ID NO:1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 12, 13, 14 or 15. In aspects, the fusion protein includes an amino acid sequence having at least 95% sequence identity to SEQ ID NO:1. In aspects, the fusion protein includes an amino acid sequence having at least 95% sequence identity to SEQ ID NO:2. In aspects, the fusion protein includes an amino acid sequence having at least 95% sequence identity to SEQ ID NO:3. In aspects, the fusion protein includes an amino acid sequence having at least 95% sequence identity to SEQ ID NO:4. In aspects, the fusion protein includes an amino acid sequence having at least 95% sequence identity to SEQ ID NO:5. In aspects, the fusion protein includes an amino acid sequence having at least 95% sequence identity to SEQ ID NO:6. In aspects, the fusion protein includes an amino acid sequence having at least 95% sequence identity to SEQ ID NO:7. In aspects, the fusion protein includes an amino acid sequence having at least 95% sequence identity to SEQ ID NO:8. In aspects, the fusion protein includes an amino acid sequence having at least 95% sequence identity to SEQ ID NO:9. In aspects, the fusion protein includes an amino acid sequence having at least 95% sequence identity to SEQ ID NO:10. In aspects, the fusion protein includes an amino acid sequence having at least 95% sequence identity to SEQ ID NO:11. In aspects, the fusion protein includes an amino acid sequence having at least 95% sequence identity to SEQ ID NO:12. In aspects, the fusion protein includes an amino acid sequence having at least 95% sequence identity to SEQ ID NO:13. In aspects, the fusion protein includes an amino acid sequence having at least 95% sequence identity to SEQ ID NO:14. In aspects, the fusion protein includes an amino acid sequence having at least 95% sequence identity to SEQ ID NO:15.

[0119] Complexes

[0120] In order for the fusion protein to carry out epigenome editing, the fusion protein interacts with (e.g. is non-covalently bound to) a polynucleotide (e.g., sgRNA) that is complementary to a target polynucleotide sequence (e.g., a target DNA sequence to be edited) and further includes a sequence (i.e., a binding sequence) to which the nuclease-deficient RNA-guided DNA endonuclease enzyme of the fusion protein as described herein can bind. By forming this complex, the fusion protein is appropriately positioned to perform epigenome editing. The term "complex" refers to a composition that includes two or more components, where the components bind together to make a functional unit. In aspects, a complex described herein includes a fusion protein described herein and a polynucleotide described herein. Thus, in an aspect is provided a fusion protein as described herein, including embodiments and aspects thereof, and a polynucleotide including: (1) a DNA-targeting sequence that is complementary to a target polynucleotide sequence; and (2) a binding sequence for the nuclease-deficient RNA-guided DNA endonuclease enzyme, wherein the nuclease-deficient RNA-guided DNA endonuclease enzyme is bound to the polynucleotide via the binding sequence (e.g., an amino acid sequence capable of binding to the DNA-targeting sequence).

[0121] A DNA-targeting sequence refers to a polynucleotide that includes a nucleotide sequence complementary to the target polynucleotide sequence (DNA or RNA). In aspects, a DNA-targeting sequence can be a single RNA molecule (single RNA polynucleotide), which may include a "single-guide RNA," or "sgRNA." In aspects, the DNA-targeting sequence includes two RNA molecules (e.g., joined together via hybridization at the binding sequence (e.g., dCas9-binding sequence). In aspects, the DNA-targeting sequence (e.g., sgRNA) is at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% complementary to the target polynucleotide sequence. In aspects, the DNA-targeting sequence (e.g., sgRNA) is at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% complementary to the sequence of a cellular gene. In aspects, the DNA-targeting sequence (e.g., sgRNA) binds a cellular gene sequence.

[0122] In aspects, the DNA-targeting sequence (e.g., sgRNA) is at least 75% complementary to the sequence of a cellular gene. In aspects, the DNA-targeting sequence (e.g., sgRNA) is at least 80% complementary to the sequence of a cellular gene. In aspects, the DNA-targeting sequence (e.g., sgRNA) binds a cellular gene sequence. In aspects, the DNA-targeting sequence (e.g., sgRNA) is at least 85% complementary to the sequence of a cellular gene. In aspects, the DNA-targeting sequence (e.g., sgRNA) binds a cellular gene sequence. In aspects, the DNA-targeting sequence (e.g., sgRNA) is at least 90% complementary to the sequence of a cellular gene. In aspects, the DNA-targeting sequence (e.g., sgRNA) binds a cellular gene sequence. In aspects, the DNA-targeting sequence (e.g., sgRNA) is at least 95% complementary to the sequence of a cellular gene. In aspects, the DNA-targeting sequence (e.g., sgRNA) binds a cellular gene sequence.

[0123] A "target polynucleotide sequence" as provided herein is a nucleic acid sequence present in, or expressed by, a cell, to which a guide sequence (or a DNA-targeting sequence) is designed to have complementarity, where hybridization between a target sequence and a guide sequence (or a DNA-targeting sequence) promotes the formation of a CRISPR complex. Full complementarity is not necessarily required, provided there is sufficient complementarity to cause hybridization and promote formation of a CRISPR complex. In aspects, the target polynucleotide sequence is an exogenous nucleic acid sequence. In aspects, the target polynucleotide sequence is an endogenous nucleic acid sequence.

[0124] The target polynucleotide sequence may be any region of the polynucleotide (e.g., DNA sequence) suitable for epigenome editing. In aspects, the target polynucleotide sequence is part of a gene. In aspects, the target polynucleotide sequence is part of a transcriptional regulatory sequence. In aspects, the target polynucleotide sequence is part of a promoter, enhancer or silencer. In aspects, the target polynucleotide sequence is part of a promoter. In aspects, the target polynucleotide sequence is part of an enhancer. In aspects, the target polynucleotide sequence is part of a silencer.

[0125] In embodiments, the target polynucleotide sequence is a hypomethylated nucleic acid sequence. A "hypomethylated nucleic acid sequence" is used herein according to the standard meaning in the art and refers to a loss or lack of methyl groups on the 5-methylcytosine nucleotide (e.g., in CpG). The loss or lack of methyl groups may be relative to a standard control. Hypomethylation may occur, for example, in aging cells or in cancer (e.g., early stages of neoplasia) relative to the younger cell or non-cancer cell, respectively. Thus, the complex may be useful for reestablishing normal (e.g. non-aged of non-diseased) methylation levels.

[0126] In embodiments, the target polynucleotide sequence is within about 3000 base pairs (bp) flanking a transcription start site. In aspects, the target polynucleotide sequence is within about 3000, 2900, 2800, 2700, 2600, 2500, 2400, 2300, 2200, 2100, 2000, 1900, 1800, 1700, 1600, 1500, 1400, 1300, 1200, 1100, 1000, 900, 800, 700, 600, 500, 400, 300, 200, or 100 base pairs (bp) flanking a transcription start site.

[0127] In embodiments, the target polynucleotide sequence is at, near, or within a promoter sequence. In aspects, the target polynucleotide sequence is within a CpG island. In aspects, the target polynucleotide sequence is known to be associated with a disease or condition characterized by DNA hypomethylation.

[0128] In embodiments, exemplary target polynucleotide sequences include those described in Tables 1 and 2. In aspects, the target polynucleotide sequence include the sequence of SEQ ID NO:37, 39, 41, 43, 45, 47, 49, 51, 53, 55, 57, 59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, 87, 89, 91, 93, or 95. In aspects, the target polynucleotide sequence include an amino acid sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:37, 39, 41, 43, 45, 47, 49, 51, 53, 55, 57, 59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, 87, 89, 91, 93, or 95. In aspects, the target polynucleotide sequence is SEQ ID NO:37. In aspects, the target polynucleotide sequence is SEQ ID NO:39. In aspects, the target polynucleotide sequence is SEQ ID NO:41. In aspects, the target polynucleotide sequence is SEQ ID NO:43. In aspects, the target polynucleotide sequence is SEQ ID NO:45. In aspects, the target polynucleotide sequence is SEQ ID NO:47. In aspects, the target polynucleotide sequence is SEQ ID NO:49. In aspects, the target polynucleotide sequence is SEQ ID NO:51. In aspects, the target polynucleotide sequence is SEQ ID NO:53. In aspects, the target polynucleotide sequence is SEQ ID NO:55. In aspects, the target polynucleotide sequence is SEQ ID NO:57. In aspects, the target polynucleotide sequence is SEQ ID NO:59. In aspects, the target polynucleotide sequence is SEQ ID NO:61. In aspects, the target polynucleotide sequence is SEQ ID NO:63. In aspects, the target polynucleotide sequence is SEQ ID NO:65. In aspects, the target polynucleotide sequence is SEQ ID NO:67. In aspects, the target polynucleotide sequence is SEQ ID NO:69. In aspects, the target polynucleotide sequence is SEQ ID NO:71. In aspects, the target polynucleotide sequence is SEQ ID NO:73. In aspects, the target polynucleotide sequence is SEQ ID NO:75. In aspects, the target polynucleotide sequence is SEQ ID NO:77. In aspects, the target polynucleotide sequence is SEQ ID NO:79. In aspects, the target polynucleotide sequence is SEQ ID NO:81. In aspects, the target polynucleotide sequence is SEQ ID NO:83. In aspects, the target polynucleotide sequence is SEQ ID NO:85. In aspects, the target polynucleotide sequence is SEQ ID NO:87. In aspects, the target polynucleotide sequence is SEQ ID NO:89. In aspects, the target polynucleotide sequence is SEQ ID NO:91. In aspects, the target polynucleotide sequence is SEQ ID NO:93. In aspects, the target polynucleotide sequence is SEQ ID NO:95.

[0129] In aspects, the target polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:37. In aspects, the target polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:39. In aspects, the target polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:41. In aspects, the target polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:43. In aspects, the target polynucleotide sequence is SEQ ID NO:45. In aspects, the target polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:47. In aspects, the target polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:49. In aspects, the target polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:51. In aspects, the target polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:53. In aspects, the target polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:55. In aspects, the target polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:57. In aspects, the target polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:59. In aspects, the target polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:61. In aspects, the target polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:63. In aspects, the target polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:65. In aspects, the target polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:67. In aspects, the target polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:69. In aspects, the target polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:71. In aspects, the target polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:73. In aspects, the target polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:75. In aspects, the target polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:77. In aspects, the target polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:79. In aspects, the target polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:81. In aspects, the target polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:83. In aspects, the target polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:85. In aspects, the target polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:87. In aspects, the target polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:89. In aspects, the target polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:91. In aspects, the target polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:93. In aspects, the target polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:95.

[0130] In aspects, the target polynucleotide sequence has at least 90% sequence identity to SEQ ID NO:37. In aspects, the target polynucleotide sequence has at least 90% sequence identity to SEQ ID NO:39. In aspects, the target polynucleotide sequence has at least 90% sequence identity to SEQ ID NO:41. In aspects, the target polynucleotide sequence has at least 90% sequence identity to SEQ ID NO:43. In aspects, the target polynucleotide sequence is SEQ ID NO:45. In aspects, the target polynucleotide sequence has at least 90% sequence identity to SEQ ID NO:47. In aspects, the target polynucleotide sequence has at least 90% sequence identity to SEQ ID NO:49. In aspects, the target polynucleotide sequence has at least 90% sequence identity to SEQ ID NO:51. In aspects, the target polynucleotide sequence has at least 90% sequence identity to SEQ ID NO:53. In aspects, the target polynucleotide sequence has at least 90% sequence identity to SEQ ID NO:55. In aspects, the target polynucleotide sequence has at least 90% sequence identity to SEQ ID NO:57. In aspects, the target polynucleotide sequence has at least 90% sequence identity to SEQ ID NO:59. In aspects, the target polynucleotide sequence has at least 90% sequence identity to SEQ ID NO:61. In aspects, the target polynucleotide sequence has at least 90% sequence identity to SEQ ID NO:63. In aspects, the target polynucleotide sequence has at least 90% sequence identity to SEQ ID NO:65. In aspects, the target polynucleotide sequence has at least 90% sequence identity to SEQ ID NO:67. In aspects, the target polynucleotide sequence has at least 90% sequence identity to SEQ ID NO:69. In aspects, the target polynucleotide sequence has at least 90% sequence identity to SEQ ID NO:71. In aspects, the target polynucleotide sequence has at least 90% sequence identity to SEQ ID NO:73. In aspects, the target polynucleotide sequence has at least 90% sequence identity to SEQ ID NO:75. In aspects, the target polynucleotide sequence has at least 90% sequence identity to SEQ ID NO:77. In aspects, the target polynucleotide sequence has at least 90% sequence identity to SEQ ID NO:79. In aspects, the target polynucleotide sequence has at least 90% sequence identity to SEQ ID NO:81. In aspects, the target polynucleotide sequence has at least 90% sequence identity to SEQ ID NO:83. In aspects, the target polynucleotide sequence has at least 90% sequence identity to SEQ ID NO:85. In aspects, the target polynucleotide sequence has at least 90% sequence identity to SEQ ID NO:87. In aspects, the target polynucleotide sequence has at least 90% sequence identity to SEQ ID NO:89. In aspects, the target polynucleotide sequence has at least 90% sequence identity to SEQ ID NO:91. In aspects, the target polynucleotide sequence has at least 90% sequence identity to SEQ ID NO:93. In aspects, the target polynucleotide sequence has at least 90% sequence identity to SEQ ID NO:95.

[0131] In aspects, the target polynucleotide sequence has at least 95% sequence identity to SEQ ID NO:37. In aspects, the target polynucleotide sequence has at least 95% sequence identity to SEQ ID NO:39. In aspects, the target polynucleotide sequence has at least 95% sequence identity to SEQ ID NO:41. In aspects, the target polynucleotide sequence has at least 95% sequence identity to SEQ ID NO:43. In aspects, the target polynucleotide sequence is SEQ ID NO:45. In aspects, the target polynucleotide sequence has at least 95% sequence identity to SEQ ID NO:47. In aspects, the target polynucleotide sequence has at least 95% sequence identity to SEQ ID NO:49. In aspects, the target polynucleotide sequence has at least 95% sequence identity to SEQ ID NO:51. In aspects, the target polynucleotide sequence has at least 95% sequence identity to SEQ ID NO:53. In aspects, the target polynucleotide sequence has at least 95% sequence identity to SEQ ID NO:55. In aspects, the target polynucleotide sequence has at least 95% sequence identity to SEQ ID NO:57. In aspects, the target polynucleotide sequence has at least 95% sequence identity to SEQ ID NO:59. In aspects, the target polynucleotide sequence has at least 95% sequence identity to SEQ ID NO:61. In aspects, the target polynucleotide sequence has at least 95% sequence identity to SEQ ID NO:63. In aspects, the target polynucleotide sequence has at least 95% sequence identity to SEQ ID NO:65. In aspects, the target polynucleotide sequence has at least 95% sequence identity to SEQ ID NO:67. In aspects, the target polynucleotide sequence has at least 95% sequence identity to SEQ ID NO:69. In aspects, the target polynucleotide sequence has at least 95% sequence identity to SEQ ID NO:71. In aspects, the target polynucleotide sequence has at least 95% sequence identity to SEQ ID NO:73. In aspects, the target polynucleotide sequence has at least 95% sequence identity to SEQ ID NO:75. In aspects, the target polynucleotide sequence has at least 95% sequence identity to SEQ ID NO:77. In aspects, the target polynucleotide sequence has at least 95% sequence identity to SEQ ID NO:79. In aspects, the target polynucleotide sequence has at least 95% sequence identity to SEQ ID NO:81. In aspects, the target polynucleotide sequence has at least 95% sequence identity to SEQ ID NO:83. In aspects, the target polynucleotide sequence has at least 95% sequence identity to SEQ ID NO:85. In aspects, the target polynucleotide sequence has at least 95% sequence identity to SEQ ID NO:87. In aspects, the target polynucleotide sequence has at least 95% sequence identity to SEQ ID NO:89. In aspects, the target polynucleotide sequence has at least 95% sequence identity to SEQ ID NO:91. In aspects, the target polynucleotide sequence has at least 95% sequence identity to SEQ ID NO:93. In aspects, the target polynucleotide sequence has at least 95% sequence identity to SEQ ID NO:95.

[0132] In embodiments, the complex includes dCas9 bound to the polynucleotide through binding a binding sequence of the polynucleotide and thereby forming a ribonucleoprotein complex. In aspects, the binding sequence forms a hairpin structure. In aspects, the binding sequence is 30-100 nt, 35-50 nt, 37-47 nt, or 42 nt in length.

[0133] In embodiments, the binding sequence (e.g., Cas9-binding sequence) interacts with or binds to a Cas9 protein (e.g., dCas9 protein), and together they bind to the target polynucleotide sequence recognized by the DNA-targeting sequence. The binding sequence (e.g., Cas9-binding sequence) includes two complementary stretches of nucleotides that hybridize to one another to form a double stranded RNA duplex (a dsRNA duplex). These two complementary stretches of nucleotides may be covalently linked by intervening nucleotides known as linkers or linker nucleotides (e.g., in the case of a single-molecule polynucleotide), and hybridize to form the double stranded RNA duplex (dsRNA duplex, or "Cas9-binding hairpin") of the binding sequence (e.g., Cas9-binding sequence), thus resulting in a stem-loop structure. Alternatively, in some aspects, the two complementary stretches of nucleotides may not be covalently linked, but instead are held together by hybridization between complementary sequences (e.g., a two-molecule polynucleotide).

[0134] The binding sequence (e.g., Cas9-binding sequence) can have a length of from 10 nucleotides to 100 nucleotides, e.g., from 10 nucleotides (nt) to 20 nt, from 20 nt to 30 nt, from 30 nt to 40 nt, from 40 nt to 50 nt, from 50 nt to 60 nt, from 60 nt to 70 nt, from 70 nt to 80 nt, from 80 nt to 90 nt, or from 90 nt to 100 nt. In aspects, the binding sequence has a length of from 15 nucleotides (nt) to 80 nt. In aspects, the binding sequence has a length of from 15 nt to 50 nt. In aspects, the binding sequence has a length of from 15 nt to 40 nt. In aspects, the binding sequence has a length of from 15 nt to 30 nt. In aspects, the binding sequence has a length of from 37 nt to 47 nt (e.g., 42 nt). In aspects, the binding sequence has a length of from 15 nt to 25 nt.

[0135] The dsRNA duplex of the binding sequence (e.g., Cas9-binding sequence) can have a length from 6 base pairs (bp) to 50 bp. For example, the dsRNA duplex of the binding sequence (e.g., Cas9-binding sequence) can have a length from 6 bp to 40 bp, from 6 bp to 30 bp, from 6 bp to 25 bp, from 6 bp to 20 bp, from 6 bp to 15 bp, from 8 bp to 40 bp, from 8 bp to 30 bp, from 8 bp to 25 bp, from 8 bp to 20 bp or from 8 bp to 15 bp. In aspects, the dsRNA duplex of the binding sequence (e.g., Cas9-binding sequence) has a length from 8 bp to 10 bp. In aspects, the dsRNA duplex of the binding sequence (e.g., Cas9-binding sequence) has a length from 10 bp to 15 bp. In aspects, the dsRNA duplex of the binding sequence (e.g., Cas9-binding sequence) has a length from 15 bp to 18 bp. In aspects, the dsRNA duplex of the binding sequence (e.g., Cas9-binding sequence) has a length from 18 bp to 20 bp. In aspects, the dsRNA duplex of the binding sequence (e.g., Cas9-binding sequence) has a length from 20 bp to 25 bp. In aspects, the dsRNA duplex of the binding sequence (e.g., Cas9-binding sequence) has a length from 25 bp to 30 bp. In aspects, the dsRNA duplex of the binding sequence (e.g., Cas9-binding sequence) has a length from 30 bp to 35 bp. In aspects, the dsRNA duplex of the binding sequence (e.g., Cas9-binding sequence) has a length from 35 bp to 40 bp. In aspects, the dsRNA duplex of the binding sequence (e.g., Cas9-binding sequence) has a length from 40 bp to 50 bp.

[0136] In embodiments, the exemplary polynucleotide that forms a complex with a fusion protein described herein includes those described in Tables 1 and 2 as sgRNA. In aspects, the polynucleotide that forms a complex with a fusion protein described herein includes the sequence of SEQ ID NO: 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, or 94 or their corresponding RNA sequence. In aspects, the polynucleotide that forms a complex with a fusion protein described herein includes the sequence having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO:38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, or 94 or their corresponding RNA sequence. In aspects, the polynucleotide that forms a complex with a fusion protein described herein includes the sequence of SEQ ID NO:38. In aspects, the polynucleotide that forms a complex with a fusion protein described herein includes the sequence of SEQ ID NO:40. In aspects, the polynucleotide that forms a complex with a fusion protein described herein includes the sequence of SEQ ID NO:42. In aspects, the polynucleotide that forms a complex with a fusion protein described herein includes the sequence of SEQ ID NO:44. In aspects, the polynucleotide that forms a complex with a fusion protein described herein includes the sequence of SEQ ID NO:46. In aspects, the polynucleotide that forms a complex with a fusion protein described herein includes the sequence of SEQ ID NO:48. In aspects, the polynucleotide that forms a complex with a fusion protein described herein includes the sequence of SEQ ID NO:50. In aspects, the polynucleotide that forms a complex with a fusion protein described herein includes the sequence of SEQ ID NO:52. In aspects, the polynucleotide that forms a complex with a fusion protein described herein includes the sequence of SEQ ID NO:54. In aspects, the polynucleotide that forms a complex with a fusion protein described herein includes the sequence of SEQ ID NO:56. In aspects, the polynucleotide that forms a complex with a fusion protein described herein includes the sequence of SEQ ID NO:58. In aspects, the polynucleotide that forms a complex with a fusion protein described herein includes the sequence of SEQ ID NO:60. In aspects, the polynucleotide that forms a complex with a fusion protein described herein includes the sequence of SEQ ID NO:62. In aspects, the polynucleotide that forms a complex with a fusion protein described herein includes the sequence of SEQ ID NO:64. In aspects, the polynucleotide that forms a complex with a fusion protein described herein includes the sequence of SEQ ID NO:66. In aspects, the polynucleotide that forms a complex with a fusion protein described herein includes the sequence of SEQ ID NO:68. In aspects, the polynucleotide that forms a complex with a fusion protein described herein includes the sequence of SEQ ID NO:70. In aspects, the polynucleotide that forms a complex with a fusion protein described herein includes the sequence of SEQ ID NO:72. In aspects, the polynucleotide that forms a complex with a fusion protein described herein includes the sequence of SEQ ID NO:74. In aspects, the polynucleotide that forms a complex with a fusion protein described herein includes the sequence of SEQ ID NO:76. In aspects, the polynucleotide that forms a complex with a fusion protein described herein includes the sequence of SEQ ID NO:78. In aspects, the polynucleotide that forms a complex with a fusion protein described herein includes the sequence of SEQ ID NO:80. In aspects, the polynucleotide that forms a complex with a fusion protein described herein includes the sequence of SEQ ID NO:82. In aspects, the polynucleotide that forms a complex with a fusion protein described herein includes the sequence of SEQ ID NO:84. In aspects, the polynucleotide that forms a complex with a fusion protein described herein includes the sequence of SEQ ID NO:86. In aspects, the polynucleotide that forms a complex with a fusion protein described herein includes the sequence of SEQ ID NO:88. In aspects, the polynucleotide that forms a complex with a fusion protein described herein includes the sequence of SEQ ID NO:90. In aspects, the polynucleotide that forms a complex with a fusion protein described herein includes the sequence of SEQ ID NO:92. In aspects, the polynucleotide that forms a complex with a fusion protein described herein includes the sequence of SEQ ID NO:94.

[0137] Nucleic Acids and Vectors

[0138] The fusion protein described herein, including embodiments and aspects thereof, may be provided as a nucleic acid sequence that encodes for the fusion protein. Thus, in an aspect is provided a nucleic acid sequence encoding the fusion protein described herein, including embodiments and aspects thereof. In an aspect is provided a nucleic acid sequence encoding the fusion protein described herein (including the DNA-targeting sequence), including embodiments and aspects thereof. In aspects, the nucleic acid sequence encodes for a fusion protein described herein, including fusion proteins having amino acid sequences with certain % sequence identities described herein. In aspects, the nucleic acid is RNA. In aspects, the nucleic acid is messenger RNA. In aspects, the messenger RNA is messenger RNP. In aspects, the nucleic acid sequence encodes for the fusion proteins described herein, including embodiments and aspects thereof. In aspects, the nucleic acid sequence encodes for the fusion protein of SEQ ID NO:1. In aspects, the nucleic acid sequence encodes for the fusion protein of SEQ ID NO:2. In aspects, the nucleic acid sequence encodes for the fusion protein of SEQ ID NO:3. In aspects, the nucleic acid sequence encodes for the fusion protein of SEQ ID NO:4. In aspects, the nucleic acid sequence encodes for the fusion protein of SEQ ID NO:5. In aspects, the nucleic acid sequence encodes for the fusion protein of SEQ ID NO:6. In aspects, the nucleic acid sequence encodes for the fusion protein of SEQ ID NO:7. In aspects, the nucleic acid sequence encodes for the fusion protein of SEQ ID NO:8. In aspects, the nucleic acid sequence encodes for the fusion protein of SEQ ID NO:9. In aspects, the nucleic acid sequence encodes for the fusion protein of SEQ ID NO:10. In aspects, the nucleic acid sequence encodes for the fusion protein of SEQ ID NO:11. In aspects, the nucleic acid sequence encodes for the fusion protein of SEQ ID NO:12. In aspects, the nucleic acid sequence encodes for the fusion protein of SEQ ID NO:13. In aspects, the nucleic acid sequence encodes for the fusion protein of SEQ ID NO:14. In aspects, the nucleic acid sequence encodes for the fusion protein of SEQ ID NO:15.

[0139] It is further contemplated that the nucleic acid sequence encoding the fusion protein as described herein, including embodiments and aspects thereof, may be included in a vector. Therefore, in an aspect is provided a vector including a nucleic acid sequence as described herein, including embodiments and aspects thereof. In aspects, the vector comprises a nucleic acid sequence that encodes for a fusion protein described herein, including fusion proteins having amino acid sequences with certain % sequence identities described herein. In aspects, the nucleic acid is messenger RNA. In aspects, the messenger RNA is messenger RNP. In aspects, the vector comprises a nucleic acid sequence that encodes for the fusion protein of SEQ ID NO:1. In aspects, the vector comprises a nucleic acid sequence that encodes for the fusion protein of SEQ ID NO:2. In aspects, the vector comprises a nucleic acid sequence that encodes for the fusion protein of SEQ ID NO:3. In aspects, the vector comprises a nucleic acid sequence that encodes for the fusion protein of SEQ ID NO:4. In aspects, the vector comprises a nucleic acid sequence that encodes for the fusion protein of SEQ ID NO:5. In aspects, the vector comprises a nucleic acid sequence that encodes for the fusion protein of SEQ ID NO:6. In aspects, the vector comprises a nucleic acid sequence that encodes for the fusion protein of SEQ ID NO:7. In aspects, the vector comprises a nucleic acid sequence that encodes for the fusion protein of SEQ ID NO:8. In aspects, the vector comprises a nucleic acid sequence that encodes for the fusion protein of SEQ ID NO:9. In aspects, the vector comprises a nucleic acid sequence that encodes for the fusion protein of SEQ ID NO:10. In aspects, the vector comprises a nucleic acid sequence that encodes for the fusion protein of SEQ ID NO:11. In aspects, the vector comprises a nucleic acid sequence that encodes for the fusion protein of SEQ ID NO:12. In aspects, the vector comprises a nucleic acid sequence that encodes for the fusion protein of SEQ ID NO:13. In aspects, the vector comprises a nucleic acid sequence that encodes for the fusion protein of SEQ ID NO:14. In aspects, the vector comprises a nucleic acid sequence that encodes for the fusion protein of SEQ ID NO:15.

[0140] In embodiments, the vector further includes a polynucleotide, wherein the polynucleotide includes: (1) a DNA-targeting sequence that is complementary to a target polynucleotide sequence; and (2) a binding sequence for the nuclease-deficient RNA-guided DNA endonuclease enzyme. Thus, one or more vectors may include all necessary components for preforming epigenome editing.

[0141] Cells

[0142] The compositions described herein may be incorporated into a cell. Inside the cell, the compositions as described herein, including embodiments and aspects thereof, may perform epigenome editing. Accordingly, in an aspect is provided a cell including a fusion protein as described herein, including embodiments and aspects thereof, a nucleic acid as described herein, including embodiments and aspects thereof, a complex as described herein, including embodiments and aspects thereof, or a vector as described herein, including embodiments and aspects thereof. In aspects is provided a cell including a fusion protein as described herein, including embodiments and aspects thereof. In aspects is provided a cell including a nucleic acid as described herein, including embodiments and aspects thereof. In aspects is provided a cell including a complex as described herein, including embodiments and aspects thereof. In aspects is provided a cell including a vector as described herein, including embodiments and aspects thereof. In aspects, the cell is a eukaryotic cell. In aspects, the cell is a mammalian cell.

[0143] Methods

[0144] It is contemplated that the compositions described herein may be used for epigenome editing, and more particularly epigenome editing resulting in the repression or silencing of target nucleic acid sequences (e.g., genes). Without intending to be bound by any theory, silencing may result from methylation of and/or the introduction of repressive chromatin markers (e.g., mono-, di-, or tri-methylation of specific histones (e.g., H3K9, H3K27), deacetylation, acetylation, phosphorylation, ubiquitination) on chromatin containing a target nucleic acid sequence. Without intending to be bound by any theory, the method can be used to change epigenetic state by, for example, closing chromatin via methylation or introducing repressive chromatin markers on chromatin containing the target nuclei acid sequence (e.g., gene). Without intending to be bound by any theory, it is contemplated that the Dnmt3A-3L fusion functions to add methyl marks at CG DNA sites found in CpG islands and the KRAB domain recruits epigenetic factors that modify the histones by introducing repressive marks. Without intending to be bound by any theory, DNA is methylated at the C nucleotide of CG sequences found in CpG islands (i.e., adding methyl marks at the C nucleotide of CG DNA sites found in CpG islands).

[0145] In an aspect is provided a method of silencing a target nucleic acid sequence in a cell, including delivering a first polynucleotide encoding a fusion protein as described herein, including embodiments and aspects thereof, to a cell containing the target nucleic acid; and delivering to the cell a second polynucleotide including: (i) a DNA-targeting sequence that is complementary to the target nucleic acid sequence; and (ii) a binding sequence for the nuclease-deficient RNA-guide DNA endonuclease enzyme. Without intending to be bound by any theory, the fusion protein silences the target nucleic acid sequence in the cell by methylating a chromatin containing the target nucleic acid sequence and/or by introducing repressive chromatin marks to a chromatin containing the target nucleic acid sequence. Without intending to be bound by any theory, methylating a chromatin means that DNA is methylated at the C nucleotide of CG sequences found in CpG islands (i.e., adding methyl marks at the C nucleotide of CG DNA sites found in CpG islands). In aspects, the sequence that is within about 3000 base pairs of the target nucleic acid sequence is methylated. In aspects, the sequence that is within about 3000, 2900, 2800, 2700, 2600, 2500, 2400, 2300, 2200, 2100, 2000, 1900, 1800, 1700, 1600, 1500, 1400, 1300, 1200, 1100, 1000, 900, 800, 700, 600, 500, 400, 300, 200, or 100 base pairs of the target nucleic acid sequence is methylated.

[0146] The term "repressive chromatin markers" as used herein refers to modifications made to the chromatin that result in silencing (e.g., decreasing or inhibiting of transcription) of the target nucleic acid sequence (e.g., a gene). Examples of repressive chromatin markers include, but are not limited to, mono-, di-, and/or tri-methylation, acetylation/deacetylation, phosphorylation, and ubiquitination of histones (e.g., H3K9, H3K27, H3K79, H2BK5).

[0147] In embodiments, silencing refers to a complete suppression of transcription. In aspects, silencing refers to a significant decrease in transcription compared to control levels of transcription.

[0148] In embodiments, the first polynucleotide is contained within a first vector. In aspects, the first polynucleotide is contained within a second vector. In aspects, the first vector and the second vector are the same. In aspects, the first vector is different from the second vector.

[0149] In embodiments, the polynucleotide described herein is delivered into the cell by any method known in the art, for example, by transfection, electroporation or transduction.

[0150] Alternatively, in an aspect is provided a method of silencing a target nucleic acid sequence in a cell, including delivering a complex as described herein, including embodiments and aspects thereof, to a cell containing the target nucleic acid. Without intending to be bound by any theory, the complex silences the target nucleic acid sequence in the cell by methylating a chromatin containing the target nucleic acid sequence and/or by introducing repressive chromatin marks to a chromatin containing the target nucleic acid sequence.

[0151] In embodiments, the cell is a mammalian cell.

[0152] In embodiments, the method has a specificity that is 2-fold higher than a specificity to a non-target nucleic acid sequence. In aspects, the method has a specificity that is at least 2-fold (e.g., 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-fold) higher than a specificity to a non-target nucleic acid sequence. Methods for determining specificity are well known in the art and include, but are not limited to, RNA-seq, bisulfite sequencing, chromatin immunoprecipitation, flow cytometry, and qPCR. Thus, in aspects, specificity is determined by RNA-seq. In aspects, specificity is determined by bisulfite sequencing. In aspects, specificity is determined by chromatin immunoprecipitation. In aspects, specificity is determined by flow cytometry. In aspects, specificity is determined by qPCR.

[0153] In aspects, the complex is delivered into the cell via any methods known in the art, for example, via ribonucleoprotein (RNP) delivery.

Embodiments N1--N41

[0154] Embodiment N1. A fusion protein comprising a nuclease-deficient RNA-guided DNA endonuclease enzyme, a Kruppel associated box domain, and a DNA methyltransferase domain.

[0155] Embodiment N2. The fusion protein of Embodiment N1, wherein the nuclease-deficient RNA-guided DNA endonuclease enzyme is dCas9, ddCpf1, a nuclease-deficient Cas9 variant, or a nuclease-deficient Class II CRISPR endonuclease.

[0156] Embodiment N3. The fusion protein of Embodiment N1 or N2, wherein the DNA methyltransferase domain is a Dnmt3A-3L domain.

[0157] Embodiment N4. The fusion protein of Embodiment N1, wherein the fusion protein comprises, from N-terminus to C-terminus, the DNA methyltransferase domain, the nuclease-deficient RNA-guided DNA endonuclease enzyme, and the Kruppel associated box domain

[0158] Embodiment N5. The fusion protein of Embodiment N4, wherein the nuclease-deficient RNA-guided DNA endonuclease enzyme is dCas9 and the DNA methyltransferase domain is a Dnmt3A-3L domain

[0159] Embodiment N6. The fusion protein of Embodiment N5, wherein the nuclease-deficient RNA-guided DNA endonuclease enzyme is dCas9 and the DNA methyltransferase domain is a Dnmt3A-3L domain

[0160] Embodiment N7. The fusion protein of Embodiment N6, wherein the peptide linker is a XTEN linker.

[0161] Embodiment N8. The fusion protein of Embodiment N1, wherein the fusion protein comprises, from N-terminus to C-terminus, the Kruppel associated box, the nuclease-deficient RNA-guided DNA endonuclease enzyme, and the DNA methyltransferase domain

[0162] Embodiment N9. The fusion protein of Embodiment N8, wherein the nuclease-deficient RNA-guided DNA endonuclease enzyme is dCas9 and the DNA methyltransferase domain is a Dnmt3A-3L domain.

[0163] Embodiment N10. The fusion protein of Embodiment N9, wherein the dCas9 is covalently linked to the Dnmt3A-3L domain via a peptide linker and wherein the Kruppel associated box domain is covalently linked to the dCas9 via a peptide linker.

[0164] Embodiment N11. The fusion protein of Embodiment N10, wherein the peptide linker is a XTEN linker.

[0165] Embodiment N12. The fusion protein of anyone of Embodiments N1 to N3, wherein the nuclease-deficient RNA-guided DNA endonuclease enzyme is covalently linked to the Kruppel associated box domain via a peptide linker.

[0166] Embodiment N13. The fusion protein of anyone of Embodiments N1 to N3, wherein the nuclease-deficient RNA-guided DNA endonuclease enzyme is covalently linked to the DNA methyltransferase domain via a peptide linker.

[0167] Embodiment N14. The fusion protein of anyone of Embodiments N1 to N3, wherein the Kruppel associated box domain is covalently linked to the DNA methyltransferase domain via a peptide linker.

[0168] Embodiment N15. The fusion protein of anyone of Embodiments N12 to N14, wherein the peptide linker is a XTEN linker.

[0169] Embodiment N16. The fusion protein of Embodiment N15, wherein the XTEN linker comprises about 16 to 80 amino acid residues.

[0170] Embodiment N17. The fusion protein of anyone of Embodiments N1 to N16, further comprising a nuclear localization signal peptide.

[0171] Embodiment N18. The fusion protein of Embodiment N1, wherein the fusion protein comprises the amino acid sequence of SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 12, 13, 14, or 15.

[0172] Embodiment N19. A nucleic acid sequence encoding the fusion protein of anyone of Embodiments N1 to N18.

[0173] Embodiment N20. The nucleic acid sequence of Embodiment N19, wherein the nucleic acid sequence is messenger RNA.

[0174] Embodiment N21. A complex comprising: (i) a fusion protein of anyone of Embodiments N1 to N18; and (ii) a polynucleotide comprising: (a) a DNA-targeting sequence that is complementary to a target polynucleotide sequence; and (b) a binding sequence for the nuclease-deficient RNA-guided DNA endonuclease enzyme, wherein the nuclease-deficient RNA-guided DNA endonuclease enzyme is bound to the polynucleotide via the binding sequence.

[0175] Embodiment N22. The complex of Embodiment N21, wherein the target polynucleotide sequence is part of a gene.

[0176] Embodiment N23. The complex of Embodiment N21, wherein the target polynucleotide sequence is part of a transcriptional regulatory sequence.

[0177] Embodiment N24. The complex of Embodiment N21, wherein the target polynucleotide sequence is part of a promoter, enhancer, or silencer.

[0178] Embodiment N25. The complex of Embodiment N21, wherein the target polynucleotide sequence is within about 3000 bp flanking a transcription start site.

[0179] Embodiment N26. A vector comprising the nucleic acid sequence of Embodiment N19 or N20.

[0180] Embodiment N27. The vector of Embodiment N26, further comprising a polynucleotide, wherein the polynucleotide comprises: (a) a DNA-targeting sequence that is complementary to a target polynucleotide sequence; and (b) a binding sequence for the nuclease-deficient RNA-guided DNA endonuclease enzyme.

[0181] Embodiment N28. A cell comprising the fusion protein of anyone of Embodiments N1 to N18; the nucleic acid of Embodiment N19 or N20; the complex of anyone of Embodiments N21 to N25, or the vector of Embodiment N26 or N27.

[0182] Embodiment N29. The cell of Embodiment N28, wherein the cell is a eukaryotic cell.

[0183] Embodiment N30. The cell of Embodiment N28, wherein the cell is a mammalian cell.

[0184] Embodiment N31. A method of silencing a target nucleic acid sequence in a cell, comprising: (i) delivering a first polynucleotide encoding a fusion protein of any one of Embodiments N1 to N18 to a cell containing the target nucleic acid; and (ii) delivering to the cell a second polynucleotide comprising: (a) a DNA-targeting sequence that is complementary to the target nucleic acid sequence; and (b) a binding sequence for the nuclease-deficient RNA-guide DNA endonuclease enzyme

[0185] Embodiment N32. The method of Embodiment N31, wherein the fusion protein silences the target nucleic acid sequence in the cell by methylating a chromatin containing the target nucleic acid sequence and/or by introducing repressive chromatin marks to a chromatin containing the target nucleic acid sequence.

[0186] Embodiment N33. The method of Embodiment N31 or N32, wherein the first polynucleotide is contained within a first vector.

[0187] Embodiment N34. The method of anyone of Embodiments N31 to N33, wherein the first polynucleotide is contained within a second vector.

[0188] Embodiment N35. The method of Embodiment N34, wherein the first vector and the second vector are the same.

[0189] Embodiment N36. The method of Embodiment N34, wherein the first vector is different from the second vector.

[0190] Embodiment N37. The method of Embodiment N31, wherein the cell is a mammalian cell.

[0191] Embodiment N38. The method of Embodiment N31, wherein the method has a specificity that is 2-fold higher than a specificity to a non-target nucleic acid sequence.

[0192] Embodiment N39. A method of silencing a target nucleic acid sequence in a cell, the method comprising delivering the complex of any one of Embodiments N21 to N25 to a cell containing the target nucleic acid.

[0193] Embodiment N40. The method of Embodiment N39, wherein the complex silences the target nucleic acid sequence in the cell by methylating a chromatin containing the target nucleic acid sequence and/or by introducing repressive chromatin marks to a chromatin containing the target nucleic acid sequence.

[0194] Embodiment N41. The method of Embodiment N39 or N40, wherein the cell is a mammalian cell.

[0195] Embodiment N42. The method of any one of Embodiments N39 to N41, wherein the method has a specificity that is 2-fold higher than a specificity to a non-target nucleic acid sequence.

[0196] Embodiments 1 to 36

[0197] Embodiment 1. A fusion protein comprising a nuclease-deficient RNA-guided DNA endonuclease enzyme, a Kruppel associated box (KRAB) domain, and a DNA methyltransferase domain.

[0198] Embodiment 2. The fusion protein of Embodiment 1, wherein the nuclease-deficient RNA-guided DNA endonuclease enzyme is dCas9, ddCpf1, a nuclease-deficient Cas9 variant, or a nuclease-deficient Class II CRISPR endonuclease.

[0199] Embodiment 3. The fusion protein of Embodiment 1 or 2, wherein the DNA methyltransferase domain is a Dnmt3A-3L domain.

[0200] Embodiment 4. The fusion protein of any one of Embodiments 1 to 3, wherein the nuclease-deficient RNA-guided DNA endonuclease enzyme is covalently linked to the KRAB domain via a peptide linker.

[0201] Embodiment 5. The fusion protein of any one of Embodiments 1 to 4, wherein the nuclease-deficient RNA-guided DNA endonuclease enzyme is covalently linked to the DNA methyltransferase domain via a peptide linker.

[0202] Embodiment 6. The fusion protein of any one of Embodiments 1 to 5, wherein the KRAB domain is covalently linked to the DNA methyltransferase domain via a peptide linker.

[0203] Embodiment 7. The fusion protein of any one of Embodiments 4 to 6, wherein the peptide linker is a XTEN linker.

[0204] Embodiment 8. The fusion protein of Embodiment 7, wherein the XTEN linker comprises about 16 to 80 amino acid residues.

[0205] Embodiment 9. The fusion protein of any one of Embodiments 1 to 8, further comprising a nuclear localization signal peptide.

[0206] Embodiment 10. The fusion protein of any one of Embodiments 1 to 9, wherein the fusion protein comprises, from N-terminus to C-terminus, a KRAB domain, a nuclease-deficient RNA-guided DNA endonuclease enzyme, and a DNA methyltransferase domain.

[0207] Embodiment 11. The fusion protein of anyone of Embodiments 1 to 10, wherein the nuclease-deficient RNA-guided DNA endonuclease enzyme is dCas9 and the DNA methyltransferase domain is a Dnmt3A-3L domain.

[0208] Embodiment 12. The fusion protein of Embodiment 11, wherein the dCas9 is covalently linked to the KRAB domain via a peptide linker and wherein the dCas9 is covalently linked to the Dnmt3A-3L domain via a peptide linker.

[0209] Embodiment 13. The fusion protein of Embodiment 12, wherein the peptide linker is a XTEN linker.

[0210] Embodiment 14. The fusion protein of any one of Embodiments 1 to 13, wherein the fusion protein comprises the amino acid sequence of SEQ ID NO:1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 12, 13, 14, or 15.

[0211] Embodiment 15. A nucleic acid sequence encoding the fusion protein of anyone of Embodiments 1 to 14.

[0212] Embodiment 16. A complex comprising: (i) a fusion protein of any one of Embodiments 1 to 14; and (ii) a polynucleotide comprising: (a) a DNA-targeting sequence that is complementary to a target polynucleotide sequence; and (b) a binding sequence for the nuclease-deficient RNA-guided DNA endonuclease enzyme, wherein the nuclease-deficient RNA-guided DNA endonuclease enzyme is bound to the polynucleotide via the binding sequence.

[0213] Embodiment 17. The complex of Embodiment 16, wherein the target polynucleotide sequence is part of a gene.

[0214] Embodiment 18. The complex of Embodiment 16, wherein the target polynucleotide sequence is part of a transcriptional regulatory sequence.

[0215] Embodiment 19. The complex of Embodiment 16, wherein the target polynucleotide sequence is part of a promoter, enhancer, or silencer.

[0216] Embodiment 20. The complex of Embodiment 16, wherein the target polynucleotide sequence is a hypomethylated nucleic acid sequence.

[0217] Embodiment 21. The complex of Embodiment 16, wherein the target polynucleotide sequence is within about 3000 bp flanking a transcription start site.

[0218] Embodiment 22. A vector comprising the nucleic acid sequence of Embodiment 15.

[0219] Embodiment 23. The vector of Embodiment 17, further comprising a polynucleotide, wherein the polynucleotide comprises: (a) a DNA-targeting sequence that is complementary to a target polynucleotide sequence; and (b) a binding sequence for the nuclease-deficient RNA-guided DNA endonuclease enzyme.

[0220] Embodiment 24. A cell comprising the fusion protein of any one of Embodiments 1 to 14; the nucleic acid of Embodiment 15; the complex of any one of Embodiments 16 to 21; or the vector of Embodiment 22 or 23.

[0221] Embodiment 25. The cell of Embodiment 18, wherein the cell is a eukaryotic cell.

[0222] Embodiment 26. The cell of Embodiment 18, wherein the cell is a mammalian cell.

[0223] Embodiment 27. A method of silencing a target nucleic acid sequence in a cell, comprising: (i) delivering a first polynucleotide encoding a fusion protein according to any one of Embodiments 1 to 14 to a cell containing the target nucleic acid; and (ii) delivering to the cell a second polynucleotide comprising: (a) a DNA-targeting sequence that is complementary to the target nucleic acid sequence; and (b) a binding sequence for the nuclease-deficient RNA-guide DNA endonuclease enzyme, wherein the fusion protein silences the target nucleic acid sequence in the cell by methylating a chromatin containing the target nucleic acid sequence and/or by introducing repressive chromatin marks to a chromatin containing the target nucleic acid sequence

[0224] Embodiment 28. The method of Embodiment 27, wherein the first polynucleotide is contained within a first vector.

[0225] Embodiment 29. The method of Embodiment 27, wherein the first polynucleotide is contained within a second vector.

[0226] Embodiment 30. The method of Embodiment 28 or 29, wherein the first vector and the second vector are the same.

[0227] Embodiment 31. The method of Embodiment 28 or 29, wherein the first vector is different from the second vector.

[0228] Embodiment 32. The method of anyone of Embodiments 27 to 31, wherein the cell is a mammalian cell.

[0229] Embodiment 33. The method of any one of Embodiments 27 to 32, wherein the method has a specificity that is 2-fold higher than a specificity to a non-target nucleic acid sequence.

[0230] Embodiment 34. A method of silencing a target nucleic acid sequence in a cell, the method comprising delivering the complex of any one of Embodiments 16 to 20 to a cell containing the target nucleic acid, wherein the complex silences the target nucleic acid sequence in the cell by: (i) methylating a chromatin containing the target nucleic acid sequence, (ii) introducing repressive chromatin marks to a chromatin containing the target nucleic acid sequence, or (iii) methylating a chromatin containing the target nucleic acid sequence and introducing repressive chromatin marks to a chromatin containing the target nucleic acid sequence.

[0231] Embodiment 35. The method of Embodiment 34, wherein the cell is a mammalian cell.

[0232] Embodiment 36. The method of Embodiment 34 or 35, wherein the method has a specificity that is 2-fold higher than a specificity to a non-target nucleic acid sequence.

EXAMPLES

[0233] Embodiments and aspects herein are further illustrated by the following examples. The examples are merely intended to illustrate embodiments and aspects, and are not to be construed to limit the scope herein.

Example 1

[0234] dCas9-fused epigenetic modulators tested for permanent gene silencing. The initial version (V1, p76 (SEQ ID NO:1)) of the all-in-one protein (FIG. 1A) has the KRAB domain fused to the --N-terminus of dCas9 (SEQ ID NO:23), separated by a GGSGGGS (SEQ ID NO:17) linker, and Dnmt3A-Dnmt3L at the C-terminus of dCas9 (separated by a EASGSGRASPGIPGSTR (SEQ ID NO:19) linker). Another all-in-one proteins that combined the KRAB domain (SEQ ID NO:16), dCas9 (D10A, H208A), Dnmt3A-Dnmt3L (SEQ ID NO:33; where SEQ ID NO:26 is Dnmt3A and SEQ ID NO:28 is Dnmt3L) into one polypeptide (FIG. 1i). With reference to FIG. 1B, the dCas9-KRAB protein was adapted from Gilbert et al., Cell 2013 for CRISPR interference (CRISPRi) applications, and the dCas9-Dnmt3A-Dnmt3L fusion was adapted from Stepper et al., Nucleic Acids Research, 2016.

[0235] The activity of the V1 epigenetic editor was tested in HEK293T cells using a DNA-methylation sensitive GFP reporter (adapted from Stelzer et al., Cell 2015) to assess long-term silencing by the all-in-one protein (FIG. 1C). A ubiquitous chromatin opening element (UCOE) was added upstream of the GAPDH CpG island (CGI) to prevent background silencing of the lentiviral vector in mammalian cells. The gfp gene is turned off when the GAPDH CGI is methylated. A, B and C denote positions we encoded single guide RNAs (sgRNA) to target in the promoter. These targeted sequences and corresponding sgRNA sequences are listed in the Table 1 below. Two plasmids were co-transfected into cells, one encoding the hit-and-run protein and the other plasmid encoding a sgRNA (FIG. 1D). Two days post-transfection, cells that express the hit-and-run protein and sgRNA-expressing vector are sorted. GFP fluorescence is assessed over time by flow cytometry. A population of cells undergoing long-term silencing of the GFP reporter was observed when the all-in-one protein is expressed with sgRNAs (FIG. 1E). The number of cells undergoing long-term silencing was higher than dCas9-Dnmt3A-Dnmt3L (lacking the KRAB domain).

TABLE-US-00002 TABLE 1 Targeted sequence sgRNA sequence Name (5' to 3') (5' to 3') A (JKNg156) ACTGCGGAAATTTGAGCGT ACGCTCAAATTTCC (SEQ ID NO: 37) GCAGT (SEQ ID NO: 38) B (JKNg158) AGGCAATGGCTGCACATGC GCATGTGCAGCCAT (SEQ ID NO: 39) TGCCT (SEQ ID NO: 40) C (JKNg160) GACGCTTGGTTCTGAGGAG CTCCTCAGAACCAA (SEQ ID NO: 41) GCGTC (SEQ ID NO: 42)

[0236] Silencing of the GFP reporter is dependent on the sgRNA sequence, with guide C resulting in the highest level of silencing among the three sgRNA sequences tested. Pooling the sgRNAs encoding different sequences did not have a significant change in gene silencing.

Example 2

[0237] Three genes (CD29, CD81, CD151) were targeted for long term silencing using the hit-and-run fusion protein. All three proteins are cell surface-localized and knockdown was assessed by cell surface antibody staining of cells, followed by flow cytometry. Representative flow cytometry data are shown in FIGS. 2A-2C taken 22 days post-transfection. Quadrant IV represents cells that have turned off the gene, indicated by the percentage of cells with the gene off. The lack of cells in Quadrants I and II signify that the hit-and-run protein (marked by BFP) is no longer present in the cells. FIG. 2D provides quantification of silencing of CD29, CD81 and CD151 with three different sgRNA sequences or a pool of all three sgRNAs. The targeted DNA sequences and their sgRNAs used in this experiment are summarized in Table 2.

TABLE-US-00003 TABLE 2 Targeted sequence sgRNA sequence Name (5' to 3') (5' to 3') CD29, sgRNA-A TCCGGAAACGCATTCCTCT AGAGGAATGCGTTT (SEQ ID NO: 43) CCGGA (SEQ ID NO: 44) CD29, sgRNA-B CCGCGTCAGCCCGGCCCGG CCGGGCCGGGCTGA (SEQ ID NO: 45) CGCGG (SEQ ID NO: 46) CD29, sgRNA-C CGACTCCCGCTGGGCCTCT AGAGGCCCAGCGGG (SEQ ID NO: 47) AGTCG (SEQ ID NO: 48) CD81, sgRNA-A ccgttgcgcgctcgctctc gagagcgagcgcgc (SEQ ID NO: 49) aacgg (SEQ ID NO: 50) CD81, sgRNA-B CCGCGCATCCTGCCAGGCC GGCCTGGCAGGATG (SEQ ID NO: 51) CGCGG (SEQ ID NO: 52) CD81, sgRNA-C CCAACTTGGCGCGTTTCGG CCGAAACGCGCCAA (SEQ ID NO:53) GTTGG (SEQ ID NO: 54) CD151, sgRNA-A ACCACGCGTCCGAGTCCGG CCGGACTCGGACGC (SEQ ID NO: 55) GTGGT (SEQ ID NO: 56) CD151, sgRNA-B TGCTCATTGTCCCTGGACA TGTCCAGGGACAAT (SEQ ID NO: 57) GAGCA (SEQ ID NO: 58) CD151, sgRNA-C GGACACCCTGCTCATTGTC GACAATGAGCAGGG TGTCC (SEQ ID NO: 59) (SEQ ID NO: 60)

[0238] Two or three genes were simultaneously targeted to show that the all-in-protein can be multiplexed by co-delivery of sgRNAs targeting different genes. NT sgRNA refers to non-targeting sgRNA control. The results are shown in FIG. 2E.

[0239] Gene silencing of cells that started as a single clone were followed and it was observed the majority of cells have maintained the targeted CLTA gene off (37 out of 39 clones). The plot in FIG. 2F represents a time point taken 9 months post transfection of the all-in-one protein and sgRNA targeting the CLTA gene.

[0240] The system described herein can target any genes in the mammalian genomes, especially those that contain CpG islands at the gene promoter. The Dnmt3A-Dnmt3L canonically targets CpG dinucleotides. Examples of genes that can be targeted include, but are not limited to, CXCR4, CD4, CD8, CD45, PD-1, CLTA-4, TGFBR, TCRa, TCRb, B2M.

Example 3

[0241] Cells were harvested that lost expression of ITGB1 (CD29), CD81 and CD151 thirty-six days post-transfection and analyzed their RNA expression profiles were analyzed. As shown in FIGS. 3A-3C, successful knockdown of the targeted genes was detected compared to the non-targeting sgRNA control. FIGS. 3D-3F are volcano plots show that the targeted gene is the only significant gene knocked down for each experiment, signifying high specificity of gene silencing. FIGS. 3G-3I are the quantification of transcript levels showing greater than 96% knockdown of the targeted gene.

Example 4

[0242] The all-in-one protein can be transfected and expressed in HeLa (cervical), U2OS (bone) and human induced pluripotent stem cells (iPSC). Flow cytometry plots in FIGS. 4A-4F show BFP expression, which is fused to the protein. Three endogenous genes in HeLa and U2OS cells (i.e., CD29, CD81, and CD151) were targeted. As shown in FIG. 4G, stable silencing, measured at 18 days post-transfection, was detected. Gene silencing in AML12 mouse hepatocyte cell lines was detected when targeting Pcsk9, Npc1, Spcs1 and Cd81. Silencing was detected by qPCR, measured 14 days post transfection, as shown in FIG. 4H. The sgRNA sequences used in this experiment are summarized in Table 3

TABLE-US-00004 TABLE 3 Targeted sequence sgRNA sequence Name (5' to 3') (5' to 3') Pcsk9 TCCGGAAACGCATTCCTCT AGAGGAATGCGTTTCCGGA sgRNA-1 (SEQ ID NO: 43) (SEQ ID NO: 44) Pcsk9 ACCGGCAGCCTGCGCGTCC GGACGCGCAGGCTGCCGGT sgRNA-2 (SEQ ID NO: 61) (SEQ ID NO: 62) Pcsk9 CGATGGGCACCCACTGCTC GAGCAGTGGGTGCCCATCG sgRNA-3 (SEQ ID NO: 63) (SEQ ID NO: 64) Pcsk9 CCTTCACGTGGACGCGCAG CTGCGCGTCCACGTGAAGG sgRNA-4 (SEQ ID NO: 65) (SEQ ID NO: 66) Pcsk9 CGTGAAGGTGGAAGCCTTC GAAGGCTTCCACCTTCACG sgRNA-5 (SEQ ID NO: 67) (SEQ ID NO: 68) Npc1 CTCCTTGGTCAGGCGCCGG CCGGCGCCTGACCAAGGAG sgRNA-1 (SEQ ID NO: 69) (SEQ ID NO: 70) Npc1 TGGTCAGGCGCCGGTTCCG CGGAACCGGCGCCTGACCA sgRNA-2 (SEQ ID NO: 71) (SEQ ID NO: 72) Npc1 TAGAGGTCGCCTTCTCCTC GAGGAGAAGGCGACCTCTA sgRNA-3 (SEQ ID NO: 73) (SEQ ID NO: 74) Npc1 CGACGCTCGGGTCGCGGTG CACCGCGACCCGAGCGTCG sgRNA-4 (SEQ ID NO: 75) (SEQ ID NO: 76) Npc1 ATGCTGTCGCCGCGCGGGG CCCCGCGCGGCGACAGCAT sgRNA-5 (SEQ ID NO: 77) (SEQ ID NO: 78) Spcs1 CTCACCCTCACCGGAGCCA TGGCTCCGGTGAGGGTGAG sgRNA-1 (SEQ ID NO: 79) (SEQ ID NO: 80) Spcs1 CCGCAAACTTTACTCCTTA TAAGGAGTAAAGTTTGCGG sgRNA-2 (SEQ ID NO: 81) (SEQ ID NO: 82) Spcs1 CTCGGAGACATCCGCTTCC GGAAGCGGATGTCTCCGAG sgRNA-3 (SEQ ID NO: 60) (SEQ ID NO: 60) Spcs1 CTCCTAAGATTGGCTTCAC GTGAAGCCAATCTTAGGAG sgRNA-4 (SEQ ID NO: 83) (SEQ ID NO: 84) Spcs1 CCGGAGCCACTCCTAAGAT ATCTTAGGAGTGGCTCCGG sgRNA-5 (SEQ ID NO: 85) (SEQ ID NO: 86) Cd81 TTCTCTACCCTACGTCTCA TGAGACGTAGGGTAGAGAA sgRNA-1 (SEQ ID NO: 87) (SEQ ID NO: 88) Cd81 TACGTCTCATTCTCCGCAA TTGCGGAGAATGAGACGTA sgRNA-2 (SEQ ID NO: 89) (SEQ ID NO: 90) Cd81 GCTAGGCCTCCAGCCCTTC GAAGGGCTGGAGGCCTAGC sgRNA-3 (SEQ ID NO: 91) (SEQ ID NO: 92) Cd81 ACAGGTGGCGCCGCAACTT AAGTTGCGGCGCCACCTGT sgRNA-4 (SEQ ID NO: 93) (SEQ ID NO: 94) Cd81 AGCCGGAGGCGCGAGAGTC GACTCTCGCGCCTCCGGCT sgRNA-5 (SEQ ID NO: 95) (SEQ ID NO: 96)

Example 5

[0243] FIG. 5 provides a schematic of the all-in-one protein constructs that were designed and tested for gene silencing. The initial design (p76, V1) of SEQ ID NO:1 was modified to encode XTEN linkers (e.g., 16 amino acids (SEQ ID NO: 31) or 80 amino acids (SEQ ID NO:32)) at either the N or C terminus of dCas9 (SEQ ID NO:29). All vectors contain HA tags (SEQ ID NO:24) at the C-terminus of dCas9. In aspects, CAG promoter is used since it provides good expression, for example, in constructs p76, and p90-102, p112 (V2). With reference to FIG. 5, the protein constructs of p90 to p102 correspond to SEQ ID NOS:2-14, respectively, and protein construct p112 corresponds to SEQ ID NO: 15.

Example 6

[0244] The protein constructs shown in FIG. 5 were tested for silencing of the CLTA gene in HEK293T cells for 18 days post-transfection (FIGS. 6A-6B). Variable levels of gene silencing activities were detected, including a panel of variants with more durable gene silencing compared to the p76 (Vi) design such as p99 (SEQ ID NO:11), p100 (SEQ ID NO:12), and p112 (SEQ ID NO:15). FIGS. 6A and 6B show tat the dCas9-KRAB and dCas9-Dnmt3A-Dnmt3L constructs showed transient and lower efficiency of long term silencing.

[0245] p76 (SEQ ID NO:1), p112 (SEQ ID NO:15) were tested for silencing the HIST2H2BE (H2B) endogenous gene and a synthetic Snrpn-GFP reporter gene stably expressed in HEK293T cells (FIGS. 6C-6D). Cells were followed for 50 days post-transfection. The p112 variant sustained gene silencing at a higher efficiency than the p76 (V1) design. The dCas9-Dnmt3A-Dnmt3L and dCas9-KRAB fusion proteins have transient and lower efficiency of long term silencing. FIG. 6E provides a plot of protein expression of p76 and p112 over the 50 day time course to turn off the HIST2H2BE (H2B) gene. Protein levels were measured by flow cytometry detection of BFP, which is co-expressed with the all-in-one protein.

Example 7

[0246] Western blot analysis was performed with the all-in-one protein variants p76, p90-p102 using an antibody against Streptococcus pyogenes Cas9. With reference to FIG. 7A, the top band represents full-length protein and smaller-sized bands represent proteolysis of the all-in-one protein. Variants that show little proteolysis, such as p99 (SEQ ID NO:11), p100 (SEQ ID NO:12), and p102 (SEQ ID NO:14), exhibited higher efficiency of gene silencing. Variants with high levels of proteolysis, such as p96 (SEQ ID NO:8) and p97 (SEQ ID NO:9), led to lower efficiency of sustained gene silencing.

[0247] Western blot analysis was performed with the all-in-one protein variants to detect free Dnmt3A that is cleaved from the fusion protein. As shown in FIG. 7B, variants that had little or no detectable free Dnmt3, such as p92 (SEQ ID NO:4), p100 (SEQ ID NO:12), p101 (SEQ ID NO:13), and p102 (SEQ ID NO:14), had higher efficiency of sustained gene silencing compared to variants with detectable cleaved Dnmt3A, i.e., p76 (SEQ ID NO:1), p91 (SEQ ID NO:3), p96 (SEQ ID NO:8), p98 (SEQ ID NO:10).

Example 8

[0248] A pooled screen was assayed, as shown in FIG. 8A, to determine the optimal sgRNAs that leads to long term gene silencing. Four HEK293T cell lines were used, each with a different gene with a GFP tag (CLTA, VIM, HIST2H2BE (H2B), and RAB11A). Tiling libraries consisting of sgRNAs that span +/-2.5 kb from the transcription start site (TSS) of each gene were stably expressed in cells by lentiviral delivery, followed by transient expression plasmid DNA expressing the all-in-one protein. Four weeks post-transfection, cells that maintained gene silencing were sorted to determine the sgRNA identity. FIGS. 8B-8E are flow cytometry histograms showing the percent of cells undergoing gene silencing four weeks post-transfection.

[0249] FIGS. 9A-9D are maps of sgRNA functionality across the transcription start site of the targeted gene (CLTA, H2B, RAB11, VIM). The transcription start site (TSS) and CpG island are annotated above each plot. Each dot represents one sgRNA and its efficacy in long term gene silencing is plotted as the log 2 fold change in sgRNA abundance. Nucleosome occupancy (bottom plot) is plotted from MNase signal.

Example 9

[0250] FIG. 10A shows the workflow of a pooled screen in HEK293T cells to determine optimal sgRNA targeting positions for the all-in-one protein, adapted from a previous ricin tiling screen in K562 cells to determine optimal sgRNAs for dCas9-KRAB (Gilbert, Horlbeck et al., Cell 2014). The sgRNAs are first stably expressed in HEK293T cells by lentiviral delivery, followed by transient transfection of a plasmid encoding the all-in-one protein (Day 0). Cells expressing the all-in-one protein are sorted (Day 2) and allowed to grow for three more days. Cells are split on Day 5, from which half are harvested as an initial time point, and the other half are passaged for ten more days (Day 15) for a final time point. The growth phenotype (.gamma.) is calculated as the log 2 sgRNA enrichment divided by the number of cell doublings between T(initial) and T(final).

[0251] FIGS. 10B-10E are representative plots showing growth phenotypes for four genes (ARL1, EIF6, SMC3, HEATRI) from existing dCas9-KRAB/CRISPRi datasets in K562 cells (Gilbert, Horlbeck et al., 2014) and with the all-in-one protein (bottom plot). Each dot represents an sgRNA. The TSS and annotated CpG island are shown for each gene. The functional sgRNAs using the all-in-one protein spans a wider range than the functional sgRNAs, signifying a broader range of effective targeting.

Example 10

[0252] FIGS. 11A-11B provide a comparison of growth phenotypes and nucleosome positioning (from MNase signal) for VPS53 and VPS54 and show the location of functional sgRNAs at nucleosome-depleted regions. Furthermore, the range of functional sgRNAs is broader when using the all-in-one protein compared to dCas9-KRAB/CRISPRi.

Example 11

[0253] The in vitro transcription of two all-in-one variants (p102 (SEQ ID NO:14) and p112 (SEQ ID NO:15)) show full length synthesis of each design (FIG. 12A). FIG. 12B provides a flow cytometry plot showing expression of p102 and p112 one day post-transfection of mRNA into HEK293T cells. FIG. 12C shows the time course of CLTA endogenous gene silencing in HEK293T cells after transfecting mRNA expressing the p102 and p112 all-in-one variants.

Example 12

[0254] FIG. 13A provides flow cytometry plots showing induced expression of the all-in-one protein by addition of doxycycline in K562 cells that stably encode the all-in-one protein under a doxycycline-inducible promoter. Protein expression was followed for four days after doxycycline induction. The dotted lines in the panels in FIG. 13A represent the baseline median BFP fluorescence without doxycycline administration. Western blots of cells were performed to detect expression of the all-in-one protein before and after doxycycline treatment (FIG. 13B). The presence of the all-in-one protein is not detectable by 96 hours post-induction. Flow cytometry plots of CD81 and CD151 knockdown 14 days post-doxycycline treatment of K562 cells are shown in FIGS. 13C-13F. The percent of cells with the targeted gene knocked down is shown. There is no detectable expression of the all-in-one protein, as no cells are present in the BFP+ quadrants. Quantification of CD81 and CD151 knockdown 14 days post-doxycycline treatment or without doxycycline treatment is shown in FIG. 13G.

REFERENCES

[0255] Ecco et al, Development 144, 2017. Lambert et al, Cell 172, 2018. Siddique et al., J. Mol. Biol., 425, 2013. Stepper et al, Nucleic Acids Res., 45, 2017. Shmakov et al., Nat. Rev. Microbiol. 15, 2017. Cebrian-Serrano et al, Mamm. Genome 7-8, 2017. Pulecio et al., Cell Stem Cell 21, 2017.

[0256] Informal Sequence Listing

[0257] SEQ ID NO:1 (p76 (all-in-one protein sequence, version 1): KRAB (bold; from Gilbert et al., Cell, 2013, 2014), Linkers (underlined), dCas9 (italics), HA tag (lowercase), SV40 NLS (lowercase italics), Dnmt3A (bold italics; residues 612-912; from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), 27 amino acid linker (italics underlined; from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), Dnmt3L (bold underlined; from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), P2A peptide cleavage sequence (lowercase bold), BFP (lowercase underlined

TABLE-US-00005 DAKSLTAWSRTLVTFKDVFVDFTREEWKLLDTAQQIVYRNVMLENYKNLV SLGYQLTKPDVILRLEKGEEPGGSGGGSMDKKYSIGLAIGTNSVGWAVIT DEYKVPSKKEKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRY TRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERHPIFGNI VDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEG DLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRL ENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYD DDLDNLLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMI KRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYAGYIDGGASQEEF YKFIKPILEMIDGTEELLVKLNREDLLRKQRTFDNGSIPHQIHLGELHAI LRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRFAWMTRKSEET ITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYN ELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKI ECFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLT LTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRD KQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHE HIANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIVIEMARENQTTQK GQKNSREMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMY VDQELDINRLSDYDVDAIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSE EVVKKMKNYWRQLLNAKLITQRKEDNLTKAERGGLSELDKAGFIKRQLVE TRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFY KVREINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIA KSEQEIGKATAKYFFYSNIMNFFKTEITLANGEIRKRPLIEINGETGEIV WDKGRDFATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARK KDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGITIMERSS FEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKG NELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQI SEFSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAA FKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDSRADy pydvpdyaSGSpkkkrkvEASGSGRASPGIPGSTR SSGNSNANSRGPSFSSGLVPLSLRGSHMGPMEIYKTVSAWKRQPVRVLSL FRNIDKVLKSLGFLESGSGSGGGTLKYVEDVTNVVRRDVEKWGPFDLVYG STQPLGSSCDRCPGWYMFQFHRILQYALPRQESQRPFFWIFMDNLLLTED DQETTTRFLQTEAVTLQDVRGRDYQNAMRVWSNIPGLKSKHAPLTPKEEE YLQAQVRSRSKLDAPKVDLLVKNCLLPLREYFKYFSQNSLPLSRADpkkk rkvGSGatnfsllkqagdveenpgpselikenmhmklymegtvdnhhfkc tsegegkpyegtqtmrikvveggplpfafdilatsflygsktfinhtqgi pdffkqsfpegftwervttyedggvltatqdtslqdgcliynvkirgvnf tsngpvmqkktlgweaftetlypadgglegrndmalklvggshlianikt tyrskkpaknlkmpgvyyvdyrlerikeannetyveqhevavarycdlps klghkln*

[0258] SEQ ID NO:2 (p90 (KRAB-dCas9-XTEN16-Dnmt3A-Dnmt3L-P2A-BFP): KRAB (bold, from Gilbert et al., Cell, 2013, 2014); Linkers (underlined), dCas9 (italics); HA tag (lowercase), SV40 NLS (lowercase italics), XTEN16 (uppercase, 16 amino acid sequence), Dnmt3A (bold italics; from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), 27 amino acid linker (italics underlined, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), Dnmt3L (bold underlined, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), P2A peptide cleavage sequence (lowercase bold), BFP (lowercase underlined))

TABLE-US-00006 DAKSLTAWSRTLVTFKDVFVDFTREEWKLLDTAQQIVYRNVMLENYKNLV SLGYQLTKPDVILRLEKGEEPGGSGGGSMDKKYSIGLAIGTNSVGWAVIT DEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRY TRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERHPIFGNI VDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEG DLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRL ENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYD DDLDNLLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMI KRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYAGYIDGGASQEEF YKFIKPILEKMDGTEELLVKLNREDLLRKQRTFDNGSIPHQIHLGELHAI LRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRFAWMTRKSEET ITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYN ELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKI ECFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLT LTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRD KQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHE HIANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIVIEMARENQTTQK GQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMY VDQELDINRLSDYDVDAIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSE EVVKKMKNYWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVE TRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFY KVREINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIA KSEQEIGKATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIV WDKGRDFATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARK KDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGITIMERSS FEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKG NELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQI SEFSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAA FKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDSRADy pydvpdyaSGSpkkkrkvSPGSGSETPGTSESATPES SSGNSNANSRGPSFSSGLVPLSLRGSHMGPMEIYKTVSAWKRQPVRVLSL FRNIDKVLKSLGFLESGSGSGGGTLKYVEDVTNVVRRDVEKWGPFDLVYG STQPLGSSCDRCPGWYMFQFHRILQYALPRQESQRPFFWIFMDNLLLTED DQETTTRFLQTEAVTLQDVRGRDYQNAMRVWSNIPGLKSKHAPLTPKEEE YLQAQVRSRSKLDAPKVDLLVKNCLLPLREYFKYFSQNSLPLSRADpkkk rkvGSGatnfsllkqagdveenpgpselikenmhmklymegtvdnhhfkc tsegegkpyegtqtmrikvveggplpfafdilatsflygsktfinhtqgi pdffkqsfpegftwervttyedggvltatqdtslqdgcliynvkirgvnf tsngpvmqkktlgweaftetlypadgglegrndmalklvggshlianikt tyrskkpaknlkmpgvyyvdyrlerikeannetyveqhevavarycdlps klghkln*

[0259] SEQ ID NO:3 (p91 (KRAB-dCas9-Dnmt3A-Dnmt3L-P2A-P2A-BFP): KRAB (bold, from Gilbert et al., Cell, 2013, 2014), Linkers (underlined), dCas9 (italics), HA tag (lowercase), SV40 NLS (lowercase italics), Dnmt3A (bold italics, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), 27 amino acid linker (italics underlined, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), Dnmt3L (bold underlined, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), P2A peptide cleavage sequence (lowercase bold), BFP(lowercase underlined))

TABLE-US-00007 DAKSLTAWSRTLVTFKDVFVDFTREEWKLLDTAQQIVYRNVMLENYKNLV SLGYQLTKPDVILRLEKGEEPGGSGGGSMDKKYSIGLAIGTNSVGWAVIT DEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRY TRRKNRICYLQEIFSNEMAKVDDSFFHRLEESELVEEDKKHERHPIFGNI VDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEG DLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRL ENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYD DDLDNLLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMI KRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYAGYIDGGASQEEF YKFIKPILEKMDGTEELLVKLNREDLLRKQRTEDNGSIPHQIHLGELHAI LRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRFAWMTRKSEET ITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYN ELTKVKYVTEGMRKPAFLSGEQKKAIVDLLEKTNRKVTVKQLKEDYFKKI ECFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLT LTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRD KQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHE HIANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIVIEMARENQTTQK GQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDM YVDQELDINRLSDYDVDAIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPS EEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLV ETRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQF YKVREINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMI AKSEQEIGKATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEI VWDKGRDFATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIAR KKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGITIMERS SFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQK GNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQ ISEFSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPA AFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDSRAD ypydvpdyaSGSpkkkrkvEASGSGRASPGIPGSTR SSGNSNANSRGPSFSSGLVPLSLRGSHMGPMEIYKTVSAWKRQPVRVLSL FRNIDKVLKSLGFLESGSGSGGGTLKYVEDVTNVVRRDVEKWGPFDLVYG STQPLGSSCDRCPGWYMFQFHRILQYALPRQESQRPFFWIFMDNLLLTED DQETTTRFLQTEAVTLQDVRGRDYQNAMRVWSNIPGLKSKHAPLTPKEEE YLQAQVRSRSKLDAPKVDLLVKNCLLPLREYFKYFSQNSLPLSRADpkkk rkvGSGatnfsllkqagdveenpgpGSGatnfsllkqagdveenpgpsel ikenmhmklymegtvdnhhfkctsegegkpyegtqtmrikvveggplpfa fdilatsflygsktfinhtqgipdffkqsfpegftwervttyedggvlta tqdtslqdgcliynvkirgvnftsngpvmqkktlgweaftetlypadggl egrndmalklvggshlianikttyrskkpaknlkmpgvyyvdyrlerike annetyveqhevavarycdlpsklghkln*

[0260] SEQ ID NO: 4 (p92 (KRAB-dCas9-XTEN16-Dnmt3A-Dnmt3L-P2A-P2A-BFP): KRAB (bold, from Gilbert et al., Cell, 2013, 2014), Linkers (underlined), dCas9 (italics), HA tag (lowercase), SV40 NLS (lowercase italics), XTEN16 (16 amino acid sequence), Dnmt3A (bold italics, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), 27 amino acid linker (italics underlined, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), Dnmt3L (bold underlined, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), P2A peptide cleavage sequence (lowercase bold), BFP (lowercase underlined))

TABLE-US-00008 DAKSLTAWSRTLVTFKDVFVDFTREEWKLLDTAQQIVYRNVMLENYKNL VSLGYQLTKPDVILRLEKGEEPGGSGGGSMDKKYSIGLAIGTNSVGWAV ITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTAR RRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERHPI FGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKFRGH FLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARL SKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQ LSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEITK APLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYAGYI DGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTFDNGSIPH QIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSR FAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPK HSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKV TVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLD NEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYT GWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKE DIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRHK PENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENT QLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDAIVPQSFLKDDSID NKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNLTK AERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLIR EVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKK YPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKTE ITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKT EVQTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVA KVEKGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLII KLPKYSLFELENGRKRMLASAGELQKGNELALPSKYVNFLYLASHYEKL KGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADANLDKVLSAY NKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVL DATLIHQSITGLYETRIDLSQLGGDSRADypydvpdyaSGSpkkkrkvS PGSGSETPGTSESATPES SSGNSNANSRGPSFSSGLVPLSLRGSHMGPMEIYKTVSAWKRQPVRVLS LFRNIDKVLKSLGFLESGSGSGGGTLKYVEDVTNVVRRDVEKWGPFDLV YGSTQPLGSSCDRCPGWYMFQFHRILQYALPRQESQRPFFWIFMDNLLL TEDDQETTTRFLQTEAVTLQDVRGRDYQNAMRVWSNIPGLKSKHAPLTP KEEEYLQAQVRSRSKLDAPKVDLLVKNCLLPLREYFKYFSQNSLPLSRA DpkkkrkvGSGatnfsllkqagdveenpgpGSGatnfsllkqagdveen pgpselikenmhmklymegtvdnhhfkctsegegkpyegtqtmrikvve ggplpfafdilatsflygsktfinhtqgipdffkqsfpegftwervtty edggvltatqdtslqdgcliynvkirgvnftsngpvmqkktlgweafte tlypadgglegrndmalklvggshlianikttyrskkpaknlkmpgvyy vdyrlerikeannetyveqhevavarycdlpsklghkln*

[0261] SEQ ID NO:5 (p93 (KRAB-dCas9-XTEN80-Dnmt3A-Dnmt3L-P2A-BFP): KRAB (bold, from Gilbert et al., Cell, 2013, 2014), Linkers (underlined), dCas9 (italics), HA tag (lowercase), SV40 NLS (lowercase italics), XTEN80 (80 amino acid sequence), Dnmt3A (bold italics, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), 27 amino acid linker (italics underlined; from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), Dnmt3L (bold underlined, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), P2A peptide cleavage sequence (lowercase bold), BFP (lowercase underlined))

TABLE-US-00009 DAKSLTAWSRTLVTFKDVFVDFTREEWKLLDTAQQIVYRNVMLENYKNL VSLGYQLTKPDVILRLEKGEEPGGSGGGSMDKKYSIGLAIGTNSVGWAV ITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTAR RRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERHPI FGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKFRGH FLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARL SKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQ LSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEITK APLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYAGYI DGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTFDNGSIPH QIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSR FAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPK HSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKV TVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLD NEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYT GWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKE DIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRHK PENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENT QLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDAIVPQSFLKDDSID NKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNLTK AERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRNINTKYDENDKLI REVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIK KYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKT EITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKK TEVQTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVV AKVEKGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLI IKLPKYSLFELENGRKRMLASAGELQKGNELALPSKYVNFLYLASHYEK LKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADANLDKVLSA YNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEV LDATLIHQSITGLYETRIDLSQLGGDSRADypydvpdyaSGSpkkkrkv SPGGGPSSGAPPPSGGSPAGSPTSTEEGTSESATPESGPGTSTEPSEGS APGSPAGSPTSTEEGTSTEPSEGSAPGTSTEPSE SSGNSNANSRGPSFSSGLVPLSLRGSH MGPMEIYKTVSAWKRQPVRVLSLFRNIDKVLKSLGFLESGSGSGGGTLKY VEDVTNVVRRDVEKWGPFDLVYGSTQPLGSSCDRCPGWYMFQFHRILQYA LPRQESQRPFFWIFMDNLLLTEDDQETTTRFLQTEAVTLQDVRGRDYQNA MRVWSNIPGLKSKHAPLTPKEEEYLQAQVRSRSKLDAPKVDLLVKNCLLP LREYFKYFSQNSLPLSRADpkkkrkvGSGatnfsllkqagdveenpgpse likenmhmklymegtvdnhhfkctsegegkpyegtqtmrikvveggplpf afdilatsflygsktfinhtqgipdffkqsfpegftwervttyedggylt atqdtslqdgcliynvkirgvnftsngpvmqkktlgweaftetlypadgg legrndmalklvggshlianikttyrskkpaknlkmpgvyyvdyrlerik eannetyveqhevavarycdlpsklghkln*

[0262] SEQ ID NO:6 (p94 (KRAB-dCas9-XTEN80-Dnmt3A-Dnmt3L-P2A-P2A-BFP): KRAB (bold, from Gilbert et al., Cell, 2013, 2014), Linkers (underlined), dCas9 (italics), HA tag (lowercase), SV40 NLS (lowercase italics), XTEN80 (80 amino acid sequence), Dnmt3A (bold italics, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), 27 amino acid linker (italics underlined, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), Dnmt3L (bold underlined, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), P2A peptide cleavage sequence (lowercase bold), BFP (lowercase underlined))

TABLE-US-00010 DAKSLTAWSRTLVTFKDVFVDFTREEWKLLDTAQQIVYRNVMLENYKNL VSLGYQLTKPDVILRLEKGEEPGGSGGGSMDKKYSIGLAIGTNSVGWAV ITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTAR RRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERHPI FGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKFRGH FLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARL SKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQ LSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEITK APLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYAGYI DGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTFDNGSIPH QIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSR FAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPK HSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKV TVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLD NEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYT GWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKE DIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRHK PENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENT QLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDAIVPQSFLKDDSID NKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNLTK AERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLIR EVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKK YPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKTE ITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKT EVQTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVA KVEKGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLII KLPKYSLFELENGRKRMLASAGELQKGNELALPSKYVNFLYLASHYEKL KGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADANLDKVLSAY NKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVL DATLIHQSITGLYETRIDLSQLGGDSRADypydvpdyaSGSpkkkrkvS PGGGPSSGAPPPSGGSPAGSPTSTEEGTSESATPESGPGTSTEPSEGSA PGSPAGSPTSTEEGTSTEPSEGSAPGTSTEPSE SSGNSNANSRGPSFSSGLVPLSLRGSH MGPMEIYKTVSAWKRQPVRVLSLFRNIDKVLKSLGFLESGSGSGGGTLK YVEDVTNVVRRDVEKWGPFDLVYGSTQPLGSSCDRCPGWYMFQFHRILQ YALPRQESQRPFFWIFMDNLLLTEDDQETTTRFLQTEAVTLQDVRGRDY QNAMRVWSNIPGLKSKHAPLTPKEEEYLQAQVRSRSKLDAPKVDLLVKN CLLPLREYFKYFSQNSLPLSRADpkkkrkvGSGatnfsllkqagdveen pgpGSGatnfsllkqagdveenpgpselikenmhmklymegtvdnhhfk ctsegegkpyegtqtmrikvveggplpfafdilatsflygsktfinhtq gipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvkirg vnftsngpvmqkktlgweaftetlypadgglegrndmalklvggshlia nikttyrskkpaknlkmpgvyyvdyrlerikeannetyveqhevavary cdlpsklghkln*

[0263] SEQ ID NO:7 (p95 (KRAB-XTEN16-dCas9-Dnmt3A-Dnmt3L-P2A-BFP): KRAB (bold, from Gilbert et al., Cell, 2013, 2014), Linkers (underlined), XTEN16 (16 amino acid sequence), dCas9 (italics), HA tag (lowercase), SV40 NLS (lowercase italics), Dnmt3A (bold italics, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), 27 amino acid linker (italics underlined, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), Dnmt3L (bold underlined, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), P2A peptide cleavage sequence (lowercase bold), BFP (lowercase underlined))

TABLE-US-00011 DAKSLTAWSRTLVTFKDVFVDFTREEWKLLDTAQQIVYRNVMLENYKNL VSLGYQLTKPDVILRLEKGEEPSGSETPGTSESATPESMDKKYSIGLAI GTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAE ATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEE DKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLAL AHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVD AKAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNF DLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDI LRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQ SKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQR TFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYV GPLARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKN LPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVD LLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLK IIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVM KQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLI HDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDE LVKVMGRHKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQI LKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDAIVPQ SFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKWKNYWRQLLNAKLIT QRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTK YDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYLNA VVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYS NIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSM PQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPT VAYSVLVVAKVEKGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGY KEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNELALPSKYVNFL YLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADA NLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRK RYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDSRADypydvpdyaSG SpkkkrkvEASGSGRASPGIPGSTR SSGNSNANSRGPSFSSGLVPL SLRGSHMGPMEIYKTVSAWKRQPVRVLSLFRNIDKVLKSLGFLESGSGS GGGTLKYVEDVTNVVRRDVEKWGPFDLVYGSTQPLGSSCDRCPGWYMFQ FHRILQYALPRQESQRPFFWIFMDNLLLTEDDQETTTRFLQTEAVTLQD VRGRDYQNAMRVWSNIPGLKSKHAPLTPKEEEYLQAQVRSRSKLDAPKV DLLVKNCLLPLREYFKYFSQNSLPLSRADpkkkrkvGSGatnfsllkqa gdveenpgpselikenmhmklymegtvdnhhfkctsegegkpyegtqtm rikvveggplpfafdilatsflygsktfinhtqgipdffkqsfpegftw ervttyedggvltatqdtslqdgcliynvkirgvnftsngpvmqkktlg weaftetlypadgglegrndmalklvggshlianikttyrskkpaknlk mpgvyyvdyrlerikeannetyveqhevavarycdlpsklghkln*

[0264] SEQ ID NO:8 (p96 (KRAB-XTEN16-dCas9-Dnmt3A-Dnmt3L-P2A-P2A-BFP): KRAB (bold, from Gilbert et al., Cell, 2013, 2014), Linkers (underlined), XTEN16 (16 amino acid sequence), dCas9 (italics), HA tag (lowercase), SV40 NLS (lowercase italics), Dnmt3A (bold italics, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), 27 amino acid linker (italics underlined, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), Dnmt3L (bold underlined, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), P2A peptide cleavage sequence (lowercase bold); BFP (lowercase underlined))

TABLE-US-00012 DAKSLTAWSRTLVTFKDVFVDFTREEWKLLDTAQQIVYRNVMLENYKNL VSLGYQLTKPDVILRLEKGEEPSGSETPGTSESATPESMDKKYSIGLAI GTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAE ATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEE DKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLAL AHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVD AKAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNF DLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDI LRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQ SKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQR TFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYV GPLARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKN LPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVD LLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLK IIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVM KQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLI HDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDE LVKVMGRHKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQI LKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDAIVPQ SFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLIT QRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTK YDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYLNA VVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYS NIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSM PQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPT VAYSVLVVAKVEKGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGY KEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNELALPSKYVNFL YLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADA NLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRK RYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDSRADypydvpdyaSG SpkkkrkvEASGSGRASPGIPGSTR SSGNSNANSRGPSFSSGLVP LSLRGSHMGPMEIYKTVSAWKRQPVRVLSLFRNIDKVLKSLGFLESGSG SGGGTLKYVEDVTNVVRRDVEKWGPFDLVYGSTQPLGSSCDRCPGWYMF QFHRILQYALPRQESQRPFFWIFMDNLLLTEDDQETTTRFLQTEAVTLQ DVRGRDYQNAMRVWSNIPGLKSKHAPLTPKEEEYLQAQVRSRSKLDAPK VDLLVKNCLLPLREYFKYFSQNSLPLSRADpkkkrkvGSGatnfsllkq agdveenpgpGSGatnfsllkqagdveenpgpselikenmhmklymegt vdnhhfkctsegegkpyegtqtmrikvveggplpfafdilatsflygsk tfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcli ynvkirgvnftsngpvmqkktlgweaftetlypadgglegrndmalklv ggshlianikttyrskkpaknlkmpgvyyvdyrlerikeannetyveqh evavarycdlpsklghkln*

[0265] SEQ ID NO:9 (p97 (KRAB-XTEN80-dCas9-Dnmt3A-Dnmt3L-P2A-BFP): KRAB (bold, from Gilbert et al., Cell, 2013, 2014), Linkers (underlined), XTEN80 (80 amino acid sequence), dCas9 (italics); HA tag (lowercase), SV40 NLS (lowercase italics), Dnmt3A (bold italics, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), 27 amino acid linker (italics underlined, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), Dnmt3L (bold underlined, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), P2A peptide cleavage sequence (lowercase bold), BFP (lowercase underlined))

TABLE-US-00013 DAKSLTAWSRTLVTFKDVFVDFTREEWKLLDTAQQIVYRNVMLENYKNL VSLGYQLTKPDVILRLEKGEEPGGPSSGAPPPSGGSPAGSPTSTEEGTS ESATPESGPGTSTEPSEGSAPGSPAGSPTSTEEGTSTEPSEGSAPGTST EPSEMDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKK NLIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVD DSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLV DSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTY NQLFEENPINASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFGNL IALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLF LAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALV RQQLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEE LLVKLNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNR EKIEKILTFRIPYYVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGA SAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMR KPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVE DRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIE ERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDF LKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSP AIKKGILQTVKVVDELVKVMGRHKPENIVIEMARENQTTQKGQKNSRER MKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELD INRLSDYDVDAIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKM KNYWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQIT KHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVRE INNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSE QEIGKATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWD KGRDFATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKK DWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGITIMERSS FEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQK GNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIE QISEFSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGA PAAFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDS RADypydvpdyaSGSpkkkrkvEASGSGRASPGIPGSTR SSGNSNANSRGPSFSSGL VPLSLRGSHMGPMEIYKTVSAWKRQPVRVLSLFRNIDKVLKSLGFLESG SGSGGGTLKYVEDVTNVVRRDVEKWGPFDLVYGSTQPLGSSCDRCPGWY MFQFHRILQYALPRQESQRPFFWIFMDNLLLTEDDQETTTRFLQTEAVT LQDVRGRDYQNAMRVWSNIPGLKSKHAPLTPKEEEYLQAQVRSRSKLDA PKVDLLVKNCLLPLREYFKYFSQNSLPLSRADpkkkrkvGSGatnfsll kqagdveenpgpselikenmhmklymegtvdnhhfkctsegegkpyegt qtmrikvveggplpfafdilatsflygsktfinhtqgipdffkqsfpeg ftwervttyedggvltatqdtslqdgcliynvkirgvnftsngpvmqkk tlgweaftetlypadgglegrndmalklvggshlianikttyrskkpak nlkmpgvyyvdyrlerikeannetyveqhevavarycdlpsklghkln*

[0266] SEQ ID NO:10 (p98 (KRAB-XTEN80-dCas9-Dnmt3A-Dnmt3L-P2A-P2A-BFP): KRAB (bold, from Gilbert et al., Cell, 2013, 2014), Linkers (underlined), XTEN80 (80 amino acid sequence), dCas9 (italics), HA tag (lowercase), SV40 NLS (lowercase italics), Dnmt3A (bold italics, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), 27 amino acid linker (italics underlined, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), Dnmt3L (bold underlined, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), P2A peptide cleavage sequence (lowercase bold), BFP (lowercase underlined))

TABLE-US-00014 DAKSLTAWSRTLVTFKDVFVDFTREEWKLLDTAQQIVYRNVMLENYKNL VSLGYQLTKPDVILRLEKGEEPGGPSSGAPPPSGGSPAGSPTSTEEGTS ESATPESGPGTSTEPSEGSAPGSPAGSPTSTEEGTSTEPSEGSAPGTST EPSEMDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKK NLIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVD DSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLV DSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTY NQLFEENPINASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFGNL IALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLF LAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALV RQQLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEE LLVKLNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNR EKIEKILTFRIPYYVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGA SAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMR KPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVE DRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIE ERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDF LKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSP AIKKGILQTVKVVDELVKVMGRHKPENIVIEMARENQTTQKGQKNSRER MKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELD INRLSDYDVDAIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKK MKNYWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQI TKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVR EINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKS EQEIGKATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVW DKGRDFATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARK KDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGITIMERS SFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQ KGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEII EQISEFSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLG APAAFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGD SRADypydvpdyaSGSpkkkrkvEASGSGRASPGIPGSTR SSGNSNANSRGPSFSSGLVP LSLRGSHMGPMEIYKTVSAWKRQPVRVLSLFRNIDKVLKSLGFLESGSG SGGGTLKYVEDVTNVVRRDVEKWGPFDLVYGSTQPLGSSCDRCPGWYMF QFHRILQYALPRQESQRPFFWIFMDNLLLTEDDQETTTRFLQTEAVTLQ DVRGRDYQNAMRVWSNIPGLKSKHAPLTPKEEEYLQAQVRSRSKLDAPK VDLLVKNCLLPLREYFKYFSQNSLPLSRADpkkkrkvGSGatnfsllkq agdveenpgpGSGatnfsllkqagdveenpgpselikenmhmklymegt vdnhhfkctsegegkpyegtqtmrikvveggplpfafdilatsflygsk tfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcli ynvkirgvnftsngpvmqkktlgweaftetlypadgglegrndmalklv ggshlianikttyrskkpaknlkmpgvyyvdyrlerikeannetyveqh evavarycdlpsklghkln*

[0267] SEQ ID NO:11 (p99 (KRAB-XTEN16-dCas9-XTEN80-Dnmt3A-Dnmt3L-P2A-BFP): KRAB (bold, from Gilbert et al., Cell, 2013, 2014), XTEN16 (16 amino acid sequence), dCas9 (italics), HA tag (lowercase), Linkers (underlined), SV40 NLS (lowercase italics), XTEN80 (lowercase italics bold, 80 amino acid sequence), Dnmt3A (bold italics, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), 27 amino acid linker (italics underlined, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), Dnmt3L (old underlined, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), P2A peptide cleavage sequence (lowercase bold), BFP (lowercase underlined))

TABLE-US-00015 DAKSLTAWSRTLVTFKDVFVDFTREEWKLLDTAQQIVYRNVMLENYKNL VSLGYQLTKPDVILRLEKGEEPSGSETPGTSESATPESMDKKYSIGLAI GTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAE ATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEE DKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLAL AHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVD AKAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNF DLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDI LRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQ SKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQR TFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYV GPLARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKN LPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVD LLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLK IIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVM KQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLI HDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDE LVKVMGRHKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQI LKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDAIVPQ SFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLIT QRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTK YDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYLNA VVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYS NIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSM PQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPT VAYSVLVVAKVEKGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGY KEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNELALPSKYVNFL YLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADA NLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRK RYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDSRADypydvpdyaSG SpkkkrkvSPG SSGNSNANSRGPSF SSGLVPLSLRGSHMGPMEIYKTVSAWKRQPVRVLSLFRNIDKVLKSLGF LESGSGSGGGTLKYVEDVTNVVRRDVEKWGPFDLVYGSTQPLGSSCDRC PGWYMFQFHRILQYALPRQESQRPFFWIFMDNLLLTEDDQETTTRFLQT EAVTLQDVRGRDYQNAMRVWSNIPGLKSKHAPLTPKEEEYLQAQVRSRS KLDAPKVDLLVKNCLLPLREYFKYFSQNSLPLSRADpkkkrkvGSGatn fsllkqagdveenpgpselikenmhmklymegtvdnhhfkctsegegkp yegtqtmrikvveggplpfafdilatsflygsktfinhtqgipdffkqs fpegftwervttyedggvltatqdtslqdgcliynvkirgvnftsngpv mqkktlgweaftetlypadgglegrndmalklvggshlianikttyrsk kpaknlkmpgvyyvdyrlerikeannetyveqhevavarycdlpsklgh kln*

[0268] SEQ ID NO:12 (p100 (KRAB-XTEN16-dCas9-XTEN80-Dnmt3A-Dnmt3L-P2A-P2A-BFP): KRAB (bold, from Gilbert et al., Cell, 2013, 2014), XTEN16 (16 amino acid sequence), dCas9 (italics), HA tag (lowercase), Linkers (underlined), SV40 NLS (lowercase italics), XTEN80 (lowercase bold italics, 80 amino acid sequence), Dnmt3A (bold italics, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), 27 amino acid linker (italics underlined, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), Dnmt3L (bold underlined, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), P2A peptide cleavage sequence (lowercase bold), BFP (lowercase underlined))

TABLE-US-00016 DAKSLTAWSRTLVTFKDVFVDFTREEWKLLDTAQQIVYRNVMLENYKNL VSLGYQLTKPDVILRLEKGEEPSGSETPGTSESATPESMDKKYSIGLAI GTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAE ATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEE DKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLAL AHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVD AKAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNF DLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDI LRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQ SKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQR TFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYV GPLARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKN LPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVD LLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLK IIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVM KQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLI HDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDE LVKVMGRHKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQI LKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDAIVPQ SFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLIT QRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTK YDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYLNA VVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYS NIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSM PQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPT VAYSVLVVAKVEKGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGY KEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNELALPSKYVNFL YLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADA NLDKVLSAYNKHRDKPIREQAENIITILFTLTNLGAPAAFKYFDTTIDR KRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDSRADypydvpdyaS GSpkkkrkvSPG SSGNSNANSRGPSFSSGLVPLSLRGSHMGPMEIYKTVSAWKRQPVRVLS LFRNIDKVLKSLGFLESGSGSGGGTLKYVEDVTNVVRRDVEKWGPFDLV YGSTQPLGSSCDRCPGWYMFQFHRILQYALPRQESQRPFFWIFMDNLLL TEDDQETTTRFLQTEAVTLQDVRGRDYQNAMRVWSNIPGLKSKHAPLTP KEEEYLQAQVRSRSKLDAPKVDLLVKNCLLPLREYFKYFSQNSLPLSRA DpkkkrkvGSGatnfsllkqagdveenpgpGSGatnfsllkqagdveen pgpselikenmhmklymegtvdnhhfkctsegegkpyegtqtmrikvve ggplpfafdilatsflygsktfinhtqgipdffkqsfpegftwervtty edggvltatqdtslqdgcliynvkirgvnftsngpvmqkktlgweafte tlypadgglegrndmalklvggshhanikttyrskkpaknlkmpgvyyv dyrlerikeannetyveqhevavarycdlpsklghkln*

[0269] SEQ ID NO:13 (p101 (KRAB-XTEN80-dCas9-XTEN16-Dnmt3A-Dnmt3L-P2A-BFP): KRAB (bold, from Gilbert et al., Cell, 2013, 2014), Linkers (underlined), XTEN80 (lowercase bold italics, 80 amino acid sequence), dCas9 (italics), HA tag (lowercase), SV40 NLS (lowercase italics), XTEN16 (16 amino acid sequence), Dnmt3A (bold italics, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), 27 amino acid linker (italics underlined, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), Dnmt3L (bold underlined, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), P2A peptide cleavage sequence (lowercase bold), BFP (lowercase underlined))

TABLE-US-00017 DAKSLTAWSRTLVTFKDVFVDFTREEWKLLDTAQQIVYRNVMLENYKNL VSLGYQLTKPDVILRLEKGEEP MDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIG ALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFF HRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTD KADLRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLF EENPINASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALS LGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAK NLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQL PEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVK LNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIE KILTFRIPYYVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQS FIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAF LSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFN ASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLK TYAHLFDDKMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDG FANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKG ILQTVKVVDELVKVMGRHKPENIVIEMARENQTTQKGQKNSREMKRIEE GIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSD YDVDAIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWR QLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKHVAQ ILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYH HAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGK ATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDF ATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWDPK KYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGITIMERSSFEKNP IDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNELA LPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEF SKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFK YFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDSRADyp ydvpdyaSGSpkkkrkvSPGSGSETPGTSESATPES SSGNSNANSRGP SFSSGLVPLSLRGSHMGPMEIYKTVSAWKRQPVRVLSLFRNIDKVLKSL GFLESGSGSGGGTLKYVEDVTNVVRRDVEKWGPFDLVYGSTQPLGSSCD RCPGWYMFQFHRILQYALPRQESQRPFFWIFMDNLLLTEDDQETTTRFL QTEAVTLQDVRGRDYQNAMRVWSNIPGLKSKHAPLTPKEEEYLQAQVRS RSKLDAPKVDLLVKNCLLPLREYFKYFSQNSLPLSRADpkkkrkvGSGa tnfsllkqagdveenpgpselikenmhmklymegtvdnhhfkctsegeg kpyegtqtmrikvveggplpfafdilatsflygsktfinhtqgipdffk qsfpegftwervttyedggvltatqdtslqdgcliynvkirgvnftsng pvmqkktlgweaftetlypadgglegrndmalklvggshlianikttyr skkpaknlkmpgvyyvdyrlerikeannetyveqhevavarycdlpskl ghkln*

[0270] SEQ ID NO:14 (p102 (KRAB-XTEN80-dCas9-XTEN16-Dnmt3A-Dnmt3L-P2A-BFP): KRAB (bold, from Gilbert et al., Cell, 2013, 2014), Linkers (underlined), XTEN80 (lowercase bold italics, 80 amino acid sequence), dCas9 (italics), HA tag (lowercase), SV40 NLS (lowercase italics), XTEN16 (16 amino acid sequence), Dnmt3A (bold italics, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), 27 amino acid linker (italics underlined, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), Dnmt3L (bold underlined, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), P2A peptide cleavage sequence (lowercase bold), BFP (lowercase underlined))

TABLE-US-00018 DAKSLTAWSRTLVTFKDVFVDFTREEWKLLDTAQQIVYRNVMLENYKNL VSLGYQLTKPDVILRLEKGEEP MDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIG ALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFF HRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTD KADLRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLF EENPINASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALS LGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAK NLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQL PEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVK LNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIE KILTFRIPYYVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQS FIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAF LSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFN ASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLK TYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSD GFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKK GILQTVKVVDELVKVMGRHKPENIVIEMARENQTTQKGQKNSREMKRIE EGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDINRLS DYDVDAIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYW RQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKHVA QILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNY HHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIG KATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRD FATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWDP KKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGITIMERSSFEKN PIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNEL ALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISE FSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAF KYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDSRADy pydvpdyaSGSpkkkrkvSPGSGSETPGTSESATPES SGNSNANSRGPSFSSGLVPLSLRGSHMGPMEIYKTVSAWKRQPVRVLS LFRNIDKVLKSLGFLESGSGSGGGTLKYVEDVTNVVRRDVEKWGPFDLV YGSTQPLGSSCDRCPGWYMFQFHRILQYALPRQESQRPFFWIFMDNLLL TEDDQETTTRFLQTEAVTLQDVRGRDYQNAMRVWSNIPGLKSKHAPLTP KEEEYLQAQVRSRSKLDAPKVDLLVKNCLLPLREYFKYFSQNSLPLSRA DpkkkrkvGSGatnfsllkqagdveenpgpGSGatnfsllkqagdveen pgpselikenmhmklymegtvdnhhfkctsegegkpyegtqtmrikvve ggplpfafdilatsflygsktfinhtqgipdffkqsfpegftwervtty edggvltatqdtslqdgcliynvkirgvnftsngpvmqkktlgweafte tlypadgglegrndmalklvggshlianikttyrskkpaknlkmpgvyy vdyrlerikeannetyveqhevavarycdlpsklghkln*

[0271] SEQ ID NO:15 (p112 (Dnmt3A-Dnmt3L-XTEN80-dCas9-BFP-KRAB); KRAB (bold, from Gilbert et al., Cell, 2013, 2014), Linkers (underlined), XTEN80 (lowercase bold italics, 80 amino acid sequence), dCas9 (italics), HA tag (lowercase), SV40 NLS (lowercase italics), Dnmt3A (bold italics, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), 27 amino acid linker (italics underlined, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), Dnmt3L (bold underlined, from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016), BFP (lowercase underlined))

TABLE-US-00019 SSGNSNANSRGPSFSSGLVPLSLRGSHMGPMEIYKTVSAWKRQPVRVLSLFRNIDKVLKSL GFLESGSGSGGGTLKYVEDVTNVVRRDVEKWGPFDLVYGSTQPLGSSCDRCPGWYMFQFHR ILQYALPRQESQRPFFWIFMDNLLLTEDDQETTTRFLQTEAVTLQDVRGRDYQNAMRVWSN IPGLKSKHAPLTPKEEEYLQAQVRSRSKLDAPKVDLINKNCLLPLREYFKYFSQNSLPL MDKKYSIGLAIGTNSVGWAVITDE YKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFS NEMAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKAD LRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILS ARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLD NLLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALV RQQLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQ RTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRFAWM TRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVK YVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASL GTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRR RYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQG DSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIVIEMARENQTTQKGQKNSRER MKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDAIVP QSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERG GLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKD FQFYKVREINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKA TAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIV KKTEVQTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLK SVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQ KGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILAD ANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLDATL IHQSITGLYETRIDLSQLGGDAypydvpdyaSLGSGSpkkkrkvEDpkkkrkvDGIGSGSNGS SGSselikenmhmklymegtvdnhhfkctsegegkpyegtqtmrikvveggplpfafdilats flygsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvkirgv nftsngpvmqkktlgweaftetlypadgglegrndmalklvggshlianikttyrskkpaknl kmpgvyyvdyrlerikeannetyveqhevavarycdlpsklghldnGGGGGMDAKSLTAWSRT LVTFKDVFVDFTREEWKLLDTAQQIVYRNVMLENYKNLVSLGYQLTKPDVILRLEKGEEP* (KRAB; from Gilbert etal., Cell, 2013, 2014) SEQ ID NO: 16 DAKSLTAWSRTLVTFKDVFVDFTREEWKLLDTAQQIVYRNVMLENYKNLVSLGYQLTKP DVILRLEKGEEP (Linker) SEQ ID NO: 17 GGSGGGS (Linker) SEQ ID NO: 18 SGS (Linker) SEQ ID NO: 19 EASGSGRASPGIPGSTR (Linker) SEQ ID NO: 20 SRAD (Linker) SEQ ID NO: 21 GSG (Linker SEQ ID NO: 22 SPG (dCas9) SEQ ID NO: 23 MDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEA TRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIV DEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKL FIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLG LTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDILRV NTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYAGYIDGGASQ EEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFYPF LKDNREKIEKILTFRIPYYVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIER MTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFK TNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDIL EDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGK TILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQ TVKVVDELVKVMGRHKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHP VENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDAIVPQSFLKDDSIDNKVLTRS DKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKR QLVETRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINN YHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYS NIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQT GGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKE LLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGN ELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADAN LDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLDATLI HQSITGLYETRIDLSQLGGD (HA tag) SEQ ID NO: 24 YPYDVPDYA (SV40 NLS) SEQ ID NO: 25 PKKKRKV (Dnmt3A; residues 612-912; from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016) SEQ ID NO: 26 NHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRYIASEVCEDSITVG MVRHQGKIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEF YRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAKEVSAAHRARYF WGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEK EDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFAPLKEYFACV (27 amino acid linker; from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016) SEQ ID NO: 27 SSGNSNANSRGPSFSSGLVPLSLRGSH (Dnmt3L; from Siddique et al., JMB, 2013; Stepper et al., NAR, 2016) SEQ ID NO: 28 MGPMEIYKTVSAWKRQPVRVLSLFRNIDKVLKSLGFLESGSGSGGGTLKYVEDVTNVVRR DVEKWGPFDLVYGSTQPLGSSCDRCPGWYMFQFHRILQYALPRQESQRPFFWIFMDNLLL TEDDQETTTRFLQTEAVTLQDVRGRDYQNAMRVWSNIPGLKSKHAPLTPKEEEYLQAQVR SRSKLDAPKVDLLVKNCLLPLREYFKYFSQNSLPL (P2A peptide cleave sequence) SEQ ID NO: 29 ATNFSLLKQAGDVEENPGP (BFP) SEQ ID NO: 30 SELIKENMHMKLYMEGTVDNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSF LYGSKTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGV NFTSNGPVMQKKTLGWEAFTETLYPADGGLEGRNDMALKLVGGSHLIANIKTTYRSKKPA KNLKMPGVYYVDYRLERIKEANNETYVEQHEVAVARYCDLPSKLGHKLN* (XTEN16 (16 amino acid sequence)) SEQ ID NO: 31 SGSETPGTSESATPES (XTEN80 (80 amino acid sequence)) SEQ ID NO: 32 GGPSSGAPPPSGGSPAGSPTSTEEGTSESATPESGPGTSTEPSEGSAPGSPAGSPTSTEEGTSTE PSEGSAPGTSTEPSE (Dnmt3A-Dnmt3L domain) SEQ ID NO: 33 NHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRYIASEVCEDSITVG MVRHQGKIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEF YRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAKEVSAAHRARYF WGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEK EDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFAPLKEYFACVSSGN SNANSRGPSFSSGLVPLSLRGSHMGPMEIYKTVSAWKRQPVRVLSLFRNIDKVLKSLGFLES GSGSGGGTLKYVEDVTNVVRRDVEKWGPFDLVYGSTQPLGSSCDRCPGWYMFQFHRILQ YALPRQESQRPFFWIFMDNLLLTEDDQETTTRFLQTEAVTLQDVRGRDYQNAMRVWSNIP GLKSKHAPLTPKEEEYLQAQVRSRSKLDAPKVDLLVKNCLLPLREYFKYFSQNSLPL (ddAsCfp1) SEQ ID NO: 34 MTQFEGFTNLYQVSKTLRFELIPQGKTLKHIQEQGFIEEDKARNDHYKELKPIIDRIYKTYA DQCLQLVQLDWENLSAAIDSYRKEKTEETRNALIEEQATYRNAIHDYFIGRTDNLTDAINK RHAEIYKGLFKAELFNGKVLKQLGTVTTTEHENALLRSFDKFTTYFSGFYENRKNVFSAEDI STAIPHRIVQDNFPKFKENCHIFTRLITAVPSLREHFENVKKAIGIFVSTSIEEVFSFPFYNQLL TQTQIDLYNQLLGGISREAGTEKIKGLNEVLNLAIQKNDETAHIIASLPHRFIPLFKQILSDRN TLSFILEEFKSDEEVIQSFCKYKTLLRNENVLETAEALFNELNSIDLTHIFISHKKLETISSALC DHWDTLRNALYERRISELTGKITKSAKEKVQRSLKHEDINLQEIISAAGKELSEAFKQKTSEI

LSHAHAALDQPLPTTLKKQEEKEILKSQLDSLLGLYHLLDWFAVDESNEVDPEFSARLTGIK LEMEPSLSFYNKARNYATKKPYSVEKFKLNFQMPTLASGWDVNKEKNNGAILFVKNGLY YLGIMPKQKGRYKALSFEPTEKTSEGFDKMYYDYFPDAAKMIPKCSTQLKAVTAHFQTHT TPILLSNNFIEPLEITKEIYDLNNPEKEPKKFQTAYAKKTGDQKGYREALCKWIDFTRDFLSK YTKTTSIDLSSLRPSSQYKDLGEYYAELNPLLYHISFQRIAEKEIMDAVETGKLYLFQIYNKD FAKGHHGKPNLHTLYWTGLFSPENLAKTSIKLNGQAELFYRPKSRMKRMAHRLGEKMLN KKLKDQKTPIPDTLYQELYDYVNHRLSHDLSDEARALLPNVITKEVSHEIIKDRRFTSDKFF FHVPITLNYQAANSPSKFNQRVNAYLKEHPETPIIGIDRGERNLIYITVIDSTGKILEQRSLNTI QQFDYQKKLDNREKERVAARQAWSVVGTIKDLKQGYLSQVIHEIVDLMIHYQAVVVLAN LNFGFKSKRTGIAEKAVYQQFEKMLIDKLNCLVLKDYPAEKVGGVLNPYQLTDQFTSFAK MGTQSGFLFYVPAPYTSKIDPLTGFVDPFVWKTIKNHESRKHFLEGFDFLHYDVKTGDFILH FKMNRNLSFQRGLPGFMPAWDIVFEKNETQFDAKGTPFIAGKRIVPVIENHRFTGRYRDLY PANELIALLEEKGIVFRDGSNILPKLLENDDSHAIDTMVALIRSVLQMRNSNAATGEDYINSP VRDLNGVCFDSRFQNPEWPMDADANGAYHIALKGQLLLNHLKESKDLKLQNGISNQDWL AYIQELRN (ddLbCfp1) SEQ ID NO: 35 MSKLEKFTNCYSLSKTLRFKAIPVGKTQENIDNKRLLVEDEKRAEDYKGVKKLLDRYYLSF INDVLHSIKLKNLNNYISLFRKKTRTEKENKELENLEINLRKEIAKAFKGNEGYKSLFKKDII ETILPEFLDDKDEIALVNSFNGFTTAFTGFFDNRENMFSEEAKSTSIAFRCINENLTRYISNMD IFEKVDAIFDKHEVQEIKEKILNSDYDVEDFFEGEFFNFVLTQEGIDVYNAIIGGFVTESGEKI KGLNEYINLYNQKTKQKLPKFKPLYKQVLSDRESLSFYGEGYTSDEEVLEVFRNTLNKNSE IFSSIKKLEKLFKNFDEYSSAGIFVKNGPAISTISKDIFGEWNVIRDKWNAEYDDIHLKKKAV VTEKYEDDRRKSFKKIGSFSLEQLQEYADADLSVVEKLKEIIIQKVDEIYKVYGSSEKLFDA DFVLEKSLKKNDAVVAIMKDLLDSVKSFENYIKAFFGEGKETNRDESFYGDFVLAYDILLK VDHIYDAIRNYVTQKPYSKDKFKLYFQNPQFMGGWDKDKETDYRATILRYGSKYYLAIM DKKYAKCLQKIDKDDVNGNYEKINYKLLPGPNKMLPKVFFSKKWMAYYNPSEDIQKIYK NGTFKKGDMFNLNDCHKLIDFFKDSISRYPKWSNAYDFNFSETEKYKDIAGFYREVEEQGY KVSFESASKKEVDKLVEEGKLYMFQIYNKDFSDKSHGTPNLHTMYFKLLFDENNHGQIRLS GGAELFMRRASLKKEELVVHPANSPIANKNPDNPKKTTTLSYDVYKDKRFSEDQYELHIPI AINKCPKNIFKINTEVRVLLKHDDNPYVIGIARGERNLLYIVVVDGKGNIVEQYSLNEIINNF NGIRIKTDYHSLLDKKEKERFEARQNWTSIENIKELKAGYISQVVHKICELVEKYDAVIALA DLNSGFKNSRVKVEKQVYQKFEKMLIDKLNYMVDKKSNPCATGGALKGYQITNKFESFKS MSTQNGFIFYIPAWLTSKIDPSTGFVNLLKTKYTSIADSKKFISSFDRIMYVPEEDLFEFALDY KNFSRTDADYIKKWKLYSYGNRIRIFRNPKKNNVFDWEEVCLTSAYKELFNKYGINYQQG DIRALLCEQSDKAFYSSFMALMSLMLQMRNSITGRTDVDFLISPVKNSDGIFYDSRNYEAQ ENAILPKNADANGAYNIARKVLWAIGQFKKAEDEKLDKVKIAISNKEWLEYAQTSVKH (ddFnCfp1) SEQ ID NO: 36 MYPYDVPDYASGSGMSIYQEFVNKYSLSKTLRFELIPQGKTLENIKARGLILDDEKRAKDY KKAKQIIDKYHQFFIEEILSSVCISEDLLQNYSDVYFKLKKSDDDNLQKDFKSAKDTIKKQIS EYIKDSEKFKNLFNQNLIDAKKGQESDLILWLKQSKDNGIELFKANSDITDIDEALEIIKSFK GWTTYFKGFHENRKNVYSSNDIPTSIIYRIVDDNLPKFLENKAKYESLKDKAPEAINYEQIK KDLAEELTFDIDYKTSEVNQRVFSLDEVFEIANFNNYLNQSGITKFNTIIGGKFVNGENTKR KGINEYINLYSQQINDKTLKKYKMSVLFKQILSDTESKSFVIDKLEDDSDVVTTMQSFYEQI AAFKTVEEKSIKETLSLLFDDLKAQKLDLSKIYFKNDKSLTDLSQQVFDDYSVIGTAVLEYI TQQIAPKNLDNPSKKEQELIAKKTEKAKYLSLETIKLALEEFNKHRDIDKQCRFEEILANFA AIPMIFDEIAQNKDNLAQISIKYQNQGKKDLLQASAEDDVKAIKDLLDQTNNLLHKLKIFHI SQSEDKANILDKDEHFYLVFEECYFELANIVPLYNKIRNYITQKPYSDEKFKLNFENSTLAN GWDKNKEPDNTAILFIKDDKYYLGVMNKKNNKIFDDKAIKENKGEGYKKIVYKLLPGAN KMLPKVFFSAKSIKFYNPSEDILRIRNHSTHTKNGSPQKGYEKFEFNIEDCRKFIDFYKQSISK HPEWKDFGFRFSDTQRYNSIDEFYREVENQGYKLTFENISESYIDSVVNQGKLYLFQIYNKD FSAYSKGRPNLHTLYWKALFDERNLQDVVYKLNGEAELFYRKQSIPKKITHPAKEAIANKN KDNPKKESVFEYDLIKDKRFTEDKFFFHCPITINFKSSGANKFNDEINLLLKEKANDVHILSI ARGERHLAYYTLVDGKGNIIKQDTFNIIGNDRMKTNYHDKLAAIEKDRDSARKDWKKINN IKEMKEGYLSQVVHEIAKLVIEYNAIVVFEDLNFGFKRGRFKVEKQVYQKLEKMLIEKLNY LVFKDNEFDKTGGVLRAYQLTAPFETFKKMGKQTGIIYYVPAGFTSKICPVTGFVNQLYPK YESVSKSQEFFSKFDKICYNLDKGYFEFSFDYKNFGDKAAKGKWTIASFGSRLINFRNSDKN HNWDTREVYPTKELEKLLKDYSIEYGHGECIKAAICGESDKKFFAKLTSVLNTILQMRNSK TGTELDYLISPVADVNGNFFDSRQAPKNMPQDADANGAYHIGLKGLMLLGRIKNNQEGKK LNLVIKNEEYFEFVQNRNN

Sequence CWU 1

1

9612294PRTArtificial sequenceSynthetic polypeptide 1Asp Ala Lys Ser Leu Thr Ala Trp Ser Arg Thr Leu Val Thr Phe Lys1 5 10 15Asp Val Phe Val Asp Phe Thr Arg Glu Glu Trp Lys Leu Leu Asp Thr 20 25 30Ala Gln Gln Ile Val Tyr Arg Asn Val Met Leu Glu Asn Tyr Lys Asn 35 40 45Leu Val Ser Leu Gly Tyr Gln Leu Thr Lys Pro Asp Val Ile Leu Arg 50 55 60Leu Glu Lys Gly Glu Glu Pro Gly Gly Ser Gly Gly Gly Ser Met Asp65 70 75 80Lys Lys Tyr Ser Ile Gly Leu Ala Ile Gly Thr Asn Ser Val Gly Trp 85 90 95Ala Val Ile Thr Asp Glu Tyr Lys Val Pro Ser Lys Lys Phe Lys Val 100 105 110Leu Gly Asn Thr Asp Arg His Ser Ile Lys Lys Asn Leu Ile Gly Ala 115 120 125Leu Leu Phe Asp Ser Gly Glu Thr Ala Glu Ala Thr Arg Leu Lys Arg 130 135 140Thr Ala Arg Arg Arg Tyr Thr Arg Arg Lys Asn Arg Ile Cys Tyr Leu145 150 155 160Gln Glu Ile Phe Ser Asn Glu Met Ala Lys Val Asp Asp Ser Phe Phe 165 170 175His Arg Leu Glu Glu Ser Phe Leu Val Glu Glu Asp Lys Lys His Glu 180 185 190Arg His Pro Ile Phe Gly Asn Ile Val Asp Glu Val Ala Tyr His Glu 195 200 205Lys Tyr Pro Thr Ile Tyr His Leu Arg Lys Lys Leu Val Asp Ser Thr 210 215 220Asp Lys Ala Asp Leu Arg Leu Ile Tyr Leu Ala Leu Ala His Met Ile225 230 235 240Lys Phe Arg Gly His Phe Leu Ile Glu Gly Asp Leu Asn Pro Asp Asn 245 250 255Ser Asp Val Asp Lys Leu Phe Ile Gln Leu Val Gln Thr Tyr Asn Gln 260 265 270Leu Phe Glu Glu Asn Pro Ile Asn Ala Ser Gly Val Asp Ala Lys Ala 275 280 285Ile Leu Ser Ala Arg Leu Ser Lys Ser Arg Arg Leu Glu Asn Leu Ile 290 295 300Ala Gln Leu Pro Gly Glu Lys Lys Asn Gly Leu Phe Gly Asn Leu Ile305 310 315 320Ala Leu Ser Leu Gly Leu Thr Pro Asn Phe Lys Ser Asn Phe Asp Leu 325 330 335Ala Glu Asp Ala Lys Leu Gln Leu Ser Lys Asp Thr Tyr Asp Asp Asp 340 345 350Leu Asp Asn Leu Leu Ala Gln Ile Gly Asp Gln Tyr Ala Asp Leu Phe 355 360 365Leu Ala Ala Lys Asn Leu Ser Asp Ala Ile Leu Leu Ser Asp Ile Leu 370 375 380Arg Val Asn Thr Glu Ile Thr Lys Ala Pro Leu Ser Ala Ser Met Ile385 390 395 400Lys Arg Tyr Asp Glu His His Gln Asp Leu Thr Leu Leu Lys Ala Leu 405 410 415Val Arg Gln Gln Leu Pro Glu Lys Tyr Lys Glu Ile Phe Phe Asp Gln 420 425 430Ser Lys Asn Gly Tyr Ala Gly Tyr Ile Asp Gly Gly Ala Ser Gln Glu 435 440 445Glu Phe Tyr Lys Phe Ile Lys Pro Ile Leu Glu Lys Met Asp Gly Thr 450 455 460Glu Glu Leu Leu Val Lys Leu Asn Arg Glu Asp Leu Leu Arg Lys Gln465 470 475 480Arg Thr Phe Asp Asn Gly Ser Ile Pro His Gln Ile His Leu Gly Glu 485 490 495Leu His Ala Ile Leu Arg Arg Gln Glu Asp Phe Tyr Pro Phe Leu Lys 500 505 510Asp Asn Arg Glu Lys Ile Glu Lys Ile Leu Thr Phe Arg Ile Pro Tyr 515 520 525Tyr Val Gly Pro Leu Ala Arg Gly Asn Ser Arg Phe Ala Trp Met Thr 530 535 540Arg Lys Ser Glu Glu Thr Ile Thr Pro Trp Asn Phe Glu Glu Val Val545 550 555 560Asp Lys Gly Ala Ser Ala Gln Ser Phe Ile Glu Arg Met Thr Asn Phe 565 570 575Asp Lys Asn Leu Pro Asn Glu Lys Val Leu Pro Lys His Ser Leu Leu 580 585 590Tyr Glu Tyr Phe Thr Val Tyr Asn Glu Leu Thr Lys Val Lys Tyr Val 595 600 605Thr Glu Gly Met Arg Lys Pro Ala Phe Leu Ser Gly Glu Gln Lys Lys 610 615 620Ala Ile Val Asp Leu Leu Phe Lys Thr Asn Arg Lys Val Thr Val Lys625 630 635 640Gln Leu Lys Glu Asp Tyr Phe Lys Lys Ile Glu Cys Phe Asp Ser Val 645 650 655Glu Ile Ser Gly Val Glu Asp Arg Phe Asn Ala Ser Leu Gly Thr Tyr 660 665 670His Asp Leu Leu Lys Ile Ile Lys Asp Lys Asp Phe Leu Asp Asn Glu 675 680 685Glu Asn Glu Asp Ile Leu Glu Asp Ile Val Leu Thr Leu Thr Leu Phe 690 695 700Glu Asp Arg Glu Met Ile Glu Glu Arg Leu Lys Thr Tyr Ala His Leu705 710 715 720Phe Asp Asp Lys Val Met Lys Gln Leu Lys Arg Arg Arg Tyr Thr Gly 725 730 735Trp Gly Arg Leu Ser Arg Lys Leu Ile Asn Gly Ile Arg Asp Lys Gln 740 745 750Ser Gly Lys Thr Ile Leu Asp Phe Leu Lys Ser Asp Gly Phe Ala Asn 755 760 765Arg Asn Phe Met Gln Leu Ile His Asp Asp Ser Leu Thr Phe Lys Glu 770 775 780Asp Ile Gln Lys Ala Gln Val Ser Gly Gln Gly Asp Ser Leu His Glu785 790 795 800His Ile Ala Asn Leu Ala Gly Ser Pro Ala Ile Lys Lys Gly Ile Leu 805 810 815Gln Thr Val Lys Val Val Asp Glu Leu Val Lys Val Met Gly Arg His 820 825 830Lys Pro Glu Asn Ile Val Ile Glu Met Ala Arg Glu Asn Gln Thr Thr 835 840 845Gln Lys Gly Gln Lys Asn Ser Arg Glu Arg Met Lys Arg Ile Glu Glu 850 855 860Gly Ile Lys Glu Leu Gly Ser Gln Ile Leu Lys Glu His Pro Val Glu865 870 875 880Asn Thr Gln Leu Gln Asn Glu Lys Leu Tyr Leu Tyr Tyr Leu Gln Asn 885 890 895Gly Arg Asp Met Tyr Val Asp Gln Glu Leu Asp Ile Asn Arg Leu Ser 900 905 910Asp Tyr Asp Val Asp Ala Ile Val Pro Gln Ser Phe Leu Lys Asp Asp 915 920 925Ser Ile Asp Asn Lys Val Leu Thr Arg Ser Asp Lys Asn Arg Gly Lys 930 935 940Ser Asp Asn Val Pro Ser Glu Glu Val Val Lys Lys Met Lys Asn Tyr945 950 955 960Trp Arg Gln Leu Leu Asn Ala Lys Leu Ile Thr Gln Arg Lys Phe Asp 965 970 975Asn Leu Thr Lys Ala Glu Arg Gly Gly Leu Ser Glu Leu Asp Lys Ala 980 985 990Gly Phe Ile Lys Arg Gln Leu Val Glu Thr Arg Gln Ile Thr Lys His 995 1000 1005Val Ala Gln Ile Leu Asp Ser Arg Met Asn Thr Lys Tyr Asp Glu 1010 1015 1020Asn Asp Lys Leu Ile Arg Glu Val Lys Val Ile Thr Leu Lys Ser 1025 1030 1035Lys Leu Val Ser Asp Phe Arg Lys Asp Phe Gln Phe Tyr Lys Val 1040 1045 1050Arg Glu Ile Asn Asn Tyr His His Ala His Asp Ala Tyr Leu Asn 1055 1060 1065Ala Val Val Gly Thr Ala Leu Ile Lys Lys Tyr Pro Lys Leu Glu 1070 1075 1080Ser Glu Phe Val Tyr Gly Asp Tyr Lys Val Tyr Asp Val Arg Lys 1085 1090 1095Met Ile Ala Lys Ser Glu Gln Glu Ile Gly Lys Ala Thr Ala Lys 1100 1105 1110Tyr Phe Phe Tyr Ser Asn Ile Met Asn Phe Phe Lys Thr Glu Ile 1115 1120 1125Thr Leu Ala Asn Gly Glu Ile Arg Lys Arg Pro Leu Ile Glu Thr 1130 1135 1140Asn Gly Glu Thr Gly Glu Ile Val Trp Asp Lys Gly Arg Asp Phe 1145 1150 1155Ala Thr Val Arg Lys Val Leu Ser Met Pro Gln Val Asn Ile Val 1160 1165 1170Lys Lys Thr Glu Val Gln Thr Gly Gly Phe Ser Lys Glu Ser Ile 1175 1180 1185Leu Pro Lys Arg Asn Ser Asp Lys Leu Ile Ala Arg Lys Lys Asp 1190 1195 1200Trp Asp Pro Lys Lys Tyr Gly Gly Phe Asp Ser Pro Thr Val Ala 1205 1210 1215Tyr Ser Val Leu Val Val Ala Lys Val Glu Lys Gly Lys Ser Lys 1220 1225 1230Lys Leu Lys Ser Val Lys Glu Leu Leu Gly Ile Thr Ile Met Glu 1235 1240 1245Arg Ser Ser Phe Glu Lys Asn Pro Ile Asp Phe Leu Glu Ala Lys 1250 1255 1260Gly Tyr Lys Glu Val Lys Lys Asp Leu Ile Ile Lys Leu Pro Lys 1265 1270 1275Tyr Ser Leu Phe Glu Leu Glu Asn Gly Arg Lys Arg Met Leu Ala 1280 1285 1290Ser Ala Gly Glu Leu Gln Lys Gly Asn Glu Leu Ala Leu Pro Ser 1295 1300 1305Lys Tyr Val Asn Phe Leu Tyr Leu Ala Ser His Tyr Glu Lys Leu 1310 1315 1320Lys Gly Ser Pro Glu Asp Asn Glu Gln Lys Gln Leu Phe Val Glu 1325 1330 1335Gln His Lys His Tyr Leu Asp Glu Ile Ile Glu Gln Ile Ser Glu 1340 1345 1350Phe Ser Lys Arg Val Ile Leu Ala Asp Ala Asn Leu Asp Lys Val 1355 1360 1365Leu Ser Ala Tyr Asn Lys His Arg Asp Lys Pro Ile Arg Glu Gln 1370 1375 1380Ala Glu Asn Ile Ile His Leu Phe Thr Leu Thr Asn Leu Gly Ala 1385 1390 1395Pro Ala Ala Phe Lys Tyr Phe Asp Thr Thr Ile Asp Arg Lys Arg 1400 1405 1410Tyr Thr Ser Thr Lys Glu Val Leu Asp Ala Thr Leu Ile His Gln 1415 1420 1425Ser Ile Thr Gly Leu Tyr Glu Thr Arg Ile Asp Leu Ser Gln Leu 1430 1435 1440Gly Gly Asp Ser Arg Ala Asp Tyr Pro Tyr Asp Val Pro Asp Tyr 1445 1450 1455Ala Ser Gly Ser Pro Lys Lys Lys Arg Lys Val Glu Ala Ser Gly 1460 1465 1470Ser Gly Arg Ala Ser Pro Gly Ile Pro Gly Ser Thr Arg Asn His 1475 1480 1485Asp Gln Glu Phe Asp Pro Pro Lys Val Tyr Pro Pro Val Pro Ala 1490 1495 1500Glu Lys Arg Lys Pro Ile Arg Val Leu Ser Leu Phe Asp Gly Ile 1505 1510 1515Ala Thr Gly Leu Leu Val Leu Lys Asp Leu Gly Ile Gln Val Asp 1520 1525 1530Arg Tyr Ile Ala Ser Glu Val Cys Glu Asp Ser Ile Thr Val Gly 1535 1540 1545Met Val Arg His Gln Gly Lys Ile Met Tyr Val Gly Asp Val Arg 1550 1555 1560Ser Val Thr Gln Lys His Ile Gln Glu Trp Gly Pro Phe Asp Leu 1565 1570 1575Val Ile Gly Gly Ser Pro Cys Asn Asp Leu Ser Ile Val Asn Pro 1580 1585 1590Ala Arg Lys Gly Leu Tyr Glu Gly Thr Gly Arg Leu Phe Phe Glu 1595 1600 1605Phe Tyr Arg Leu Leu His Asp Ala Arg Pro Lys Glu Gly Asp Asp 1610 1615 1620Arg Pro Phe Phe Trp Leu Phe Glu Asn Val Val Ala Met Gly Val 1625 1630 1635Ser Asp Lys Arg Asp Ile Ser Arg Phe Leu Glu Ser Asn Pro Val 1640 1645 1650Met Ile Asp Ala Lys Glu Val Ser Ala Ala His Arg Ala Arg Tyr 1655 1660 1665Phe Trp Gly Asn Leu Pro Gly Met Asn Arg Pro Leu Ala Ser Thr 1670 1675 1680Val Asn Asp Lys Leu Glu Leu Gln Glu Cys Leu Glu His Gly Arg 1685 1690 1695Ile Ala Lys Phe Ser Lys Val Arg Thr Ile Thr Thr Arg Ser Asn 1700 1705 1710Ser Ile Lys Gln Gly Lys Asp Gln His Phe Pro Val Phe Met Asn 1715 1720 1725Glu Lys Glu Asp Ile Leu Trp Cys Thr Glu Met Glu Arg Val Phe 1730 1735 1740Gly Phe Pro Val His Tyr Thr Asp Val Ser Asn Met Ser Arg Leu 1745 1750 1755Ala Arg Gln Arg Leu Leu Gly Arg Ser Trp Ser Val Pro Val Ile 1760 1765 1770Arg His Leu Phe Ala Pro Leu Lys Glu Tyr Phe Ala Cys Val Ser 1775 1780 1785Ser Gly Asn Ser Asn Ala Asn Ser Arg Gly Pro Ser Phe Ser Ser 1790 1795 1800Gly Leu Val Pro Leu Ser Leu Arg Gly Ser His Met Gly Pro Met 1805 1810 1815Glu Ile Tyr Lys Thr Val Ser Ala Trp Lys Arg Gln Pro Val Arg 1820 1825 1830Val Leu Ser Leu Phe Arg Asn Ile Asp Lys Val Leu Lys Ser Leu 1835 1840 1845Gly Phe Leu Glu Ser Gly Ser Gly Ser Gly Gly Gly Thr Leu Lys 1850 1855 1860Tyr Val Glu Asp Val Thr Asn Val Val Arg Arg Asp Val Glu Lys 1865 1870 1875Trp Gly Pro Phe Asp Leu Val Tyr Gly Ser Thr Gln Pro Leu Gly 1880 1885 1890Ser Ser Cys Asp Arg Cys Pro Gly Trp Tyr Met Phe Gln Phe His 1895 1900 1905Arg Ile Leu Gln Tyr Ala Leu Pro Arg Gln Glu Ser Gln Arg Pro 1910 1915 1920Phe Phe Trp Ile Phe Met Asp Asn Leu Leu Leu Thr Glu Asp Asp 1925 1930 1935Gln Glu Thr Thr Thr Arg Phe Leu Gln Thr Glu Ala Val Thr Leu 1940 1945 1950Gln Asp Val Arg Gly Arg Asp Tyr Gln Asn Ala Met Arg Val Trp 1955 1960 1965Ser Asn Ile Pro Gly Leu Lys Ser Lys His Ala Pro Leu Thr Pro 1970 1975 1980Lys Glu Glu Glu Tyr Leu Gln Ala Gln Val Arg Ser Arg Ser Lys 1985 1990 1995Leu Asp Ala Pro Lys Val Asp Leu Leu Val Lys Asn Cys Leu Leu 2000 2005 2010Pro Leu Arg Glu Tyr Phe Lys Tyr Phe Ser Gln Asn Ser Leu Pro 2015 2020 2025Leu Ser Arg Ala Asp Pro Lys Lys Lys Arg Lys Val Gly Ser Gly 2030 2035 2040Ala Thr Asn Phe Ser Leu Leu Lys Gln Ala Gly Asp Val Glu Glu 2045 2050 2055Asn Pro Gly Pro Ser Glu Leu Ile Lys Glu Asn Met His Met Lys 2060 2065 2070Leu Tyr Met Glu Gly Thr Val Asp Asn His His Phe Lys Cys Thr 2075 2080 2085Ser Glu Gly Glu Gly Lys Pro Tyr Glu Gly Thr Gln Thr Met Arg 2090 2095 2100Ile Lys Val Val Glu Gly Gly Pro Leu Pro Phe Ala Phe Asp Ile 2105 2110 2115Leu Ala Thr Ser Phe Leu Tyr Gly Ser Lys Thr Phe Ile Asn His 2120 2125 2130Thr Gln Gly Ile Pro Asp Phe Phe Lys Gln Ser Phe Pro Glu Gly 2135 2140 2145Phe Thr Trp Glu Arg Val Thr Thr Tyr Glu Asp Gly Gly Val Leu 2150 2155 2160Thr Ala Thr Gln Asp Thr Ser Leu Gln Asp Gly Cys Leu Ile Tyr 2165 2170 2175Asn Val Lys Ile Arg Gly Val Asn Phe Thr Ser Asn Gly Pro Val 2180 2185 2190Met Gln Lys Lys Thr Leu Gly Trp Glu Ala Phe Thr Glu Thr Leu 2195 2200 2205Tyr Pro Ala Asp Gly Gly Leu Glu Gly Arg Asn Asp Met Ala Leu 2210 2215 2220Lys Leu Val Gly Gly Ser His Leu Ile Ala Asn Ile Lys Thr Thr 2225 2230 2235Tyr Arg Ser Lys Lys Pro Ala Lys Asn Leu Lys Met Pro Gly Val 2240 2245 2250Tyr Tyr Val Asp Tyr Arg Leu Glu Arg Ile Lys Glu Ala Asn Asn 2255 2260 2265Glu Thr Tyr Val Glu Gln His Glu Val Ala Val Ala Arg Tyr Cys 2270 2275 2280Asp Leu Pro Ser Lys Leu Gly His Lys Leu Asn 2285 229022296PRTArtificial sequenceSynthetic polypeptide 2Asp Ala Lys Ser Leu Thr Ala Trp Ser Arg Thr Leu Val Thr Phe Lys1 5 10 15Asp Val Phe Val Asp Phe Thr Arg Glu Glu Trp Lys Leu Leu Asp Thr 20 25 30Ala Gln Gln Ile Val Tyr Arg Asn Val Met Leu Glu Asn Tyr Lys Asn 35 40 45Leu Val Ser Leu Gly Tyr Gln Leu Thr Lys Pro Asp Val Ile Leu Arg 50 55 60Leu Glu Lys Gly Glu Glu Pro Gly Gly Ser Gly Gly Gly Ser Met Asp65 70 75 80Lys Lys Tyr Ser Ile Gly Leu Ala Ile Gly Thr Asn Ser Val Gly Trp 85 90 95Ala Val Ile Thr Asp Glu Tyr Lys Val Pro Ser Lys Lys Phe Lys Val 100 105 110Leu Gly Asn Thr Asp Arg His Ser Ile Lys Lys Asn Leu Ile Gly Ala 115 120 125Leu Leu Phe Asp Ser Gly Glu Thr Ala Glu Ala Thr Arg Leu Lys Arg 130 135 140Thr Ala Arg Arg Arg Tyr Thr

Arg Arg Lys Asn Arg Ile Cys Tyr Leu145 150 155 160Gln Glu Ile Phe Ser Asn Glu Met Ala Lys Val Asp Asp Ser Phe Phe 165 170 175His Arg Leu Glu Glu Ser Phe Leu Val Glu Glu Asp Lys Lys His Glu 180 185 190Arg His Pro Ile Phe Gly Asn Ile Val Asp Glu Val Ala Tyr His Glu 195 200 205Lys Tyr Pro Thr Ile Tyr His Leu Arg Lys Lys Leu Val Asp Ser Thr 210 215 220Asp Lys Ala Asp Leu Arg Leu Ile Tyr Leu Ala Leu Ala His Met Ile225 230 235 240Lys Phe Arg Gly His Phe Leu Ile Glu Gly Asp Leu Asn Pro Asp Asn 245 250 255Ser Asp Val Asp Lys Leu Phe Ile Gln Leu Val Gln Thr Tyr Asn Gln 260 265 270Leu Phe Glu Glu Asn Pro Ile Asn Ala Ser Gly Val Asp Ala Lys Ala 275 280 285Ile Leu Ser Ala Arg Leu Ser Lys Ser Arg Arg Leu Glu Asn Leu Ile 290 295 300Ala Gln Leu Pro Gly Glu Lys Lys Asn Gly Leu Phe Gly Asn Leu Ile305 310 315 320Ala Leu Ser Leu Gly Leu Thr Pro Asn Phe Lys Ser Asn Phe Asp Leu 325 330 335Ala Glu Asp Ala Lys Leu Gln Leu Ser Lys Asp Thr Tyr Asp Asp Asp 340 345 350Leu Asp Asn Leu Leu Ala Gln Ile Gly Asp Gln Tyr Ala Asp Leu Phe 355 360 365Leu Ala Ala Lys Asn Leu Ser Asp Ala Ile Leu Leu Ser Asp Ile Leu 370 375 380Arg Val Asn Thr Glu Ile Thr Lys Ala Pro Leu Ser Ala Ser Met Ile385 390 395 400Lys Arg Tyr Asp Glu His His Gln Asp Leu Thr Leu Leu Lys Ala Leu 405 410 415Val Arg Gln Gln Leu Pro Glu Lys Tyr Lys Glu Ile Phe Phe Asp Gln 420 425 430Ser Lys Asn Gly Tyr Ala Gly Tyr Ile Asp Gly Gly Ala Ser Gln Glu 435 440 445Glu Phe Tyr Lys Phe Ile Lys Pro Ile Leu Glu Lys Met Asp Gly Thr 450 455 460Glu Glu Leu Leu Val Lys Leu Asn Arg Glu Asp Leu Leu Arg Lys Gln465 470 475 480Arg Thr Phe Asp Asn Gly Ser Ile Pro His Gln Ile His Leu Gly Glu 485 490 495Leu His Ala Ile Leu Arg Arg Gln Glu Asp Phe Tyr Pro Phe Leu Lys 500 505 510Asp Asn Arg Glu Lys Ile Glu Lys Ile Leu Thr Phe Arg Ile Pro Tyr 515 520 525Tyr Val Gly Pro Leu Ala Arg Gly Asn Ser Arg Phe Ala Trp Met Thr 530 535 540Arg Lys Ser Glu Glu Thr Ile Thr Pro Trp Asn Phe Glu Glu Val Val545 550 555 560Asp Lys Gly Ala Ser Ala Gln Ser Phe Ile Glu Arg Met Thr Asn Phe 565 570 575Asp Lys Asn Leu Pro Asn Glu Lys Val Leu Pro Lys His Ser Leu Leu 580 585 590Tyr Glu Tyr Phe Thr Val Tyr Asn Glu Leu Thr Lys Val Lys Tyr Val 595 600 605Thr Glu Gly Met Arg Lys Pro Ala Phe Leu Ser Gly Glu Gln Lys Lys 610 615 620Ala Ile Val Asp Leu Leu Phe Lys Thr Asn Arg Lys Val Thr Val Lys625 630 635 640Gln Leu Lys Glu Asp Tyr Phe Lys Lys Ile Glu Cys Phe Asp Ser Val 645 650 655Glu Ile Ser Gly Val Glu Asp Arg Phe Asn Ala Ser Leu Gly Thr Tyr 660 665 670His Asp Leu Leu Lys Ile Ile Lys Asp Lys Asp Phe Leu Asp Asn Glu 675 680 685Glu Asn Glu Asp Ile Leu Glu Asp Ile Val Leu Thr Leu Thr Leu Phe 690 695 700Glu Asp Arg Glu Met Ile Glu Glu Arg Leu Lys Thr Tyr Ala His Leu705 710 715 720Phe Asp Asp Lys Val Met Lys Gln Leu Lys Arg Arg Arg Tyr Thr Gly 725 730 735Trp Gly Arg Leu Ser Arg Lys Leu Ile Asn Gly Ile Arg Asp Lys Gln 740 745 750Ser Gly Lys Thr Ile Leu Asp Phe Leu Lys Ser Asp Gly Phe Ala Asn 755 760 765Arg Asn Phe Met Gln Leu Ile His Asp Asp Ser Leu Thr Phe Lys Glu 770 775 780Asp Ile Gln Lys Ala Gln Val Ser Gly Gln Gly Asp Ser Leu His Glu785 790 795 800His Ile Ala Asn Leu Ala Gly Ser Pro Ala Ile Lys Lys Gly Ile Leu 805 810 815Gln Thr Val Lys Val Val Asp Glu Leu Val Lys Val Met Gly Arg His 820 825 830Lys Pro Glu Asn Ile Val Ile Glu Met Ala Arg Glu Asn Gln Thr Thr 835 840 845Gln Lys Gly Gln Lys Asn Ser Arg Glu Arg Met Lys Arg Ile Glu Glu 850 855 860Gly Ile Lys Glu Leu Gly Ser Gln Ile Leu Lys Glu His Pro Val Glu865 870 875 880Asn Thr Gln Leu Gln Asn Glu Lys Leu Tyr Leu Tyr Tyr Leu Gln Asn 885 890 895Gly Arg Asp Met Tyr Val Asp Gln Glu Leu Asp Ile Asn Arg Leu Ser 900 905 910Asp Tyr Asp Val Asp Ala Ile Val Pro Gln Ser Phe Leu Lys Asp Asp 915 920 925Ser Ile Asp Asn Lys Val Leu Thr Arg Ser Asp Lys Asn Arg Gly Lys 930 935 940Ser Asp Asn Val Pro Ser Glu Glu Val Val Lys Lys Met Lys Asn Tyr945 950 955 960Trp Arg Gln Leu Leu Asn Ala Lys Leu Ile Thr Gln Arg Lys Phe Asp 965 970 975Asn Leu Thr Lys Ala Glu Arg Gly Gly Leu Ser Glu Leu Asp Lys Ala 980 985 990Gly Phe Ile Lys Arg Gln Leu Val Glu Thr Arg Gln Ile Thr Lys His 995 1000 1005Val Ala Gln Ile Leu Asp Ser Arg Met Asn Thr Lys Tyr Asp Glu 1010 1015 1020Asn Asp Lys Leu Ile Arg Glu Val Lys Val Ile Thr Leu Lys Ser 1025 1030 1035Lys Leu Val Ser Asp Phe Arg Lys Asp Phe Gln Phe Tyr Lys Val 1040 1045 1050Arg Glu Ile Asn Asn Tyr His His Ala His Asp Ala Tyr Leu Asn 1055 1060 1065Ala Val Val Gly Thr Ala Leu Ile Lys Lys Tyr Pro Lys Leu Glu 1070 1075 1080Ser Glu Phe Val Tyr Gly Asp Tyr Lys Val Tyr Asp Val Arg Lys 1085 1090 1095Met Ile Ala Lys Ser Glu Gln Glu Ile Gly Lys Ala Thr Ala Lys 1100 1105 1110Tyr Phe Phe Tyr Ser Asn Ile Met Asn Phe Phe Lys Thr Glu Ile 1115 1120 1125Thr Leu Ala Asn Gly Glu Ile Arg Lys Arg Pro Leu Ile Glu Thr 1130 1135 1140Asn Gly Glu Thr Gly Glu Ile Val Trp Asp Lys Gly Arg Asp Phe 1145 1150 1155Ala Thr Val Arg Lys Val Leu Ser Met Pro Gln Val Asn Ile Val 1160 1165 1170Lys Lys Thr Glu Val Gln Thr Gly Gly Phe Ser Lys Glu Ser Ile 1175 1180 1185Leu Pro Lys Arg Asn Ser Asp Lys Leu Ile Ala Arg Lys Lys Asp 1190 1195 1200Trp Asp Pro Lys Lys Tyr Gly Gly Phe Asp Ser Pro Thr Val Ala 1205 1210 1215Tyr Ser Val Leu Val Val Ala Lys Val Glu Lys Gly Lys Ser Lys 1220 1225 1230Lys Leu Lys Ser Val Lys Glu Leu Leu Gly Ile Thr Ile Met Glu 1235 1240 1245Arg Ser Ser Phe Glu Lys Asn Pro Ile Asp Phe Leu Glu Ala Lys 1250 1255 1260Gly Tyr Lys Glu Val Lys Lys Asp Leu Ile Ile Lys Leu Pro Lys 1265 1270 1275Tyr Ser Leu Phe Glu Leu Glu Asn Gly Arg Lys Arg Met Leu Ala 1280 1285 1290Ser Ala Gly Glu Leu Gln Lys Gly Asn Glu Leu Ala Leu Pro Ser 1295 1300 1305Lys Tyr Val Asn Phe Leu Tyr Leu Ala Ser His Tyr Glu Lys Leu 1310 1315 1320Lys Gly Ser Pro Glu Asp Asn Glu Gln Lys Gln Leu Phe Val Glu 1325 1330 1335Gln His Lys His Tyr Leu Asp Glu Ile Ile Glu Gln Ile Ser Glu 1340 1345 1350Phe Ser Lys Arg Val Ile Leu Ala Asp Ala Asn Leu Asp Lys Val 1355 1360 1365Leu Ser Ala Tyr Asn Lys His Arg Asp Lys Pro Ile Arg Glu Gln 1370 1375 1380Ala Glu Asn Ile Ile His Leu Phe Thr Leu Thr Asn Leu Gly Ala 1385 1390 1395Pro Ala Ala Phe Lys Tyr Phe Asp Thr Thr Ile Asp Arg Lys Arg 1400 1405 1410Tyr Thr Ser Thr Lys Glu Val Leu Asp Ala Thr Leu Ile His Gln 1415 1420 1425Ser Ile Thr Gly Leu Tyr Glu Thr Arg Ile Asp Leu Ser Gln Leu 1430 1435 1440Gly Gly Asp Ser Arg Ala Asp Tyr Pro Tyr Asp Val Pro Asp Tyr 1445 1450 1455Ala Ser Gly Ser Pro Lys Lys Lys Arg Lys Val Ser Pro Gly Ser 1460 1465 1470Gly Ser Glu Thr Pro Gly Thr Ser Glu Ser Ala Thr Pro Glu Ser 1475 1480 1485Asn His Asp Gln Glu Phe Asp Pro Pro Lys Val Tyr Pro Pro Val 1490 1495 1500Pro Ala Glu Lys Arg Lys Pro Ile Arg Val Leu Ser Leu Phe Asp 1505 1510 1515Gly Ile Ala Thr Gly Leu Leu Val Leu Lys Asp Leu Gly Ile Gln 1520 1525 1530Val Asp Arg Tyr Ile Ala Ser Glu Val Cys Glu Asp Ser Ile Thr 1535 1540 1545Val Gly Met Val Arg His Gln Gly Lys Ile Met Tyr Val Gly Asp 1550 1555 1560Val Arg Ser Val Thr Gln Lys His Ile Gln Glu Trp Gly Pro Phe 1565 1570 1575Asp Leu Val Ile Gly Gly Ser Pro Cys Asn Asp Leu Ser Ile Val 1580 1585 1590Asn Pro Ala Arg Lys Gly Leu Tyr Glu Gly Thr Gly Arg Leu Phe 1595 1600 1605Phe Glu Phe Tyr Arg Leu Leu His Asp Ala Arg Pro Lys Glu Gly 1610 1615 1620Asp Asp Arg Pro Phe Phe Trp Leu Phe Glu Asn Val Val Ala Met 1625 1630 1635Gly Val Ser Asp Lys Arg Asp Ile Ser Arg Phe Leu Glu Ser Asn 1640 1645 1650Pro Val Met Ile Asp Ala Lys Glu Val Ser Ala Ala His Arg Ala 1655 1660 1665Arg Tyr Phe Trp Gly Asn Leu Pro Gly Met Asn Arg Pro Leu Ala 1670 1675 1680Ser Thr Val Asn Asp Lys Leu Glu Leu Gln Glu Cys Leu Glu His 1685 1690 1695Gly Arg Ile Ala Lys Phe Ser Lys Val Arg Thr Ile Thr Thr Arg 1700 1705 1710Ser Asn Ser Ile Lys Gln Gly Lys Asp Gln His Phe Pro Val Phe 1715 1720 1725Met Asn Glu Lys Glu Asp Ile Leu Trp Cys Thr Glu Met Glu Arg 1730 1735 1740Val Phe Gly Phe Pro Val His Tyr Thr Asp Val Ser Asn Met Ser 1745 1750 1755Arg Leu Ala Arg Gln Arg Leu Leu Gly Arg Ser Trp Ser Val Pro 1760 1765 1770Val Ile Arg His Leu Phe Ala Pro Leu Lys Glu Tyr Phe Ala Cys 1775 1780 1785Val Ser Ser Gly Asn Ser Asn Ala Asn Ser Arg Gly Pro Ser Phe 1790 1795 1800Ser Ser Gly Leu Val Pro Leu Ser Leu Arg Gly Ser His Met Gly 1805 1810 1815Pro Met Glu Ile Tyr Lys Thr Val Ser Ala Trp Lys Arg Gln Pro 1820 1825 1830Val Arg Val Leu Ser Leu Phe Arg Asn Ile Asp Lys Val Leu Lys 1835 1840 1845Ser Leu Gly Phe Leu Glu Ser Gly Ser Gly Ser Gly Gly Gly Thr 1850 1855 1860Leu Lys Tyr Val Glu Asp Val Thr Asn Val Val Arg Arg Asp Val 1865 1870 1875Glu Lys Trp Gly Pro Phe Asp Leu Val Tyr Gly Ser Thr Gln Pro 1880 1885 1890Leu Gly Ser Ser Cys Asp Arg Cys Pro Gly Trp Tyr Met Phe Gln 1895 1900 1905Phe His Arg Ile Leu Gln Tyr Ala Leu Pro Arg Gln Glu Ser Gln 1910 1915 1920Arg Pro Phe Phe Trp Ile Phe Met Asp Asn Leu Leu Leu Thr Glu 1925 1930 1935Asp Asp Gln Glu Thr Thr Thr Arg Phe Leu Gln Thr Glu Ala Val 1940 1945 1950Thr Leu Gln Asp Val Arg Gly Arg Asp Tyr Gln Asn Ala Met Arg 1955 1960 1965Val Trp Ser Asn Ile Pro Gly Leu Lys Ser Lys His Ala Pro Leu 1970 1975 1980Thr Pro Lys Glu Glu Glu Tyr Leu Gln Ala Gln Val Arg Ser Arg 1985 1990 1995Ser Lys Leu Asp Ala Pro Lys Val Asp Leu Leu Val Lys Asn Cys 2000 2005 2010Leu Leu Pro Leu Arg Glu Tyr Phe Lys Tyr Phe Ser Gln Asn Ser 2015 2020 2025Leu Pro Leu Ser Arg Ala Asp Pro Lys Lys Lys Arg Lys Val Gly 2030 2035 2040Ser Gly Ala Thr Asn Phe Ser Leu Leu Lys Gln Ala Gly Asp Val 2045 2050 2055Glu Glu Asn Pro Gly Pro Ser Glu Leu Ile Lys Glu Asn Met His 2060 2065 2070Met Lys Leu Tyr Met Glu Gly Thr Val Asp Asn His His Phe Lys 2075 2080 2085Cys Thr Ser Glu Gly Glu Gly Lys Pro Tyr Glu Gly Thr Gln Thr 2090 2095 2100Met Arg Ile Lys Val Val Glu Gly Gly Pro Leu Pro Phe Ala Phe 2105 2110 2115Asp Ile Leu Ala Thr Ser Phe Leu Tyr Gly Ser Lys Thr Phe Ile 2120 2125 2130Asn His Thr Gln Gly Ile Pro Asp Phe Phe Lys Gln Ser Phe Pro 2135 2140 2145Glu Gly Phe Thr Trp Glu Arg Val Thr Thr Tyr Glu Asp Gly Gly 2150 2155 2160Val Leu Thr Ala Thr Gln Asp Thr Ser Leu Gln Asp Gly Cys Leu 2165 2170 2175Ile Tyr Asn Val Lys Ile Arg Gly Val Asn Phe Thr Ser Asn Gly 2180 2185 2190Pro Val Met Gln Lys Lys Thr Leu Gly Trp Glu Ala Phe Thr Glu 2195 2200 2205Thr Leu Tyr Pro Ala Asp Gly Gly Leu Glu Gly Arg Asn Asp Met 2210 2215 2220Ala Leu Lys Leu Val Gly Gly Ser His Leu Ile Ala Asn Ile Lys 2225 2230 2235Thr Thr Tyr Arg Ser Lys Lys Pro Ala Lys Asn Leu Lys Met Pro 2240 2245 2250Gly Val Tyr Tyr Val Asp Tyr Arg Leu Glu Arg Ile Lys Glu Ala 2255 2260 2265Asn Asn Glu Thr Tyr Val Glu Gln His Glu Val Ala Val Ala Arg 2270 2275 2280Tyr Cys Asp Leu Pro Ser Lys Leu Gly His Lys Leu Asn 2285 2290 229532316PRTArtificial sequenceSynthetic polypeptide 3Asp Ala Lys Ser Leu Thr Ala Trp Ser Arg Thr Leu Val Thr Phe Lys1 5 10 15Asp Val Phe Val Asp Phe Thr Arg Glu Glu Trp Lys Leu Leu Asp Thr 20 25 30Ala Gln Gln Ile Val Tyr Arg Asn Val Met Leu Glu Asn Tyr Lys Asn 35 40 45Leu Val Ser Leu Gly Tyr Gln Leu Thr Lys Pro Asp Val Ile Leu Arg 50 55 60Leu Glu Lys Gly Glu Glu Pro Gly Gly Ser Gly Gly Gly Ser Met Asp65 70 75 80Lys Lys Tyr Ser Ile Gly Leu Ala Ile Gly Thr Asn Ser Val Gly Trp 85 90 95Ala Val Ile Thr Asp Glu Tyr Lys Val Pro Ser Lys Lys Phe Lys Val 100 105 110Leu Gly Asn Thr Asp Arg His Ser Ile Lys Lys Asn Leu Ile Gly Ala 115 120 125Leu Leu Phe Asp Ser Gly Glu Thr Ala Glu Ala Thr Arg Leu Lys Arg 130 135 140Thr Ala Arg Arg Arg Tyr Thr Arg Arg Lys Asn Arg Ile Cys Tyr Leu145 150 155 160Gln Glu Ile Phe Ser Asn Glu Met Ala Lys Val Asp Asp Ser Phe Phe 165 170 175His Arg Leu Glu Glu Ser Phe Leu Val Glu Glu Asp Lys Lys His Glu 180 185 190Arg His Pro Ile Phe Gly Asn Ile Val Asp Glu Val Ala Tyr His Glu 195 200 205Lys Tyr Pro Thr Ile Tyr His Leu Arg Lys Lys Leu Val Asp Ser Thr 210 215 220Asp Lys Ala Asp Leu Arg Leu Ile Tyr Leu Ala Leu Ala His Met Ile225 230 235 240Lys Phe Arg Gly His Phe Leu Ile Glu Gly Asp Leu Asn Pro Asp Asn 245 250 255Ser Asp Val Asp Lys Leu Phe Ile Gln Leu Val Gln Thr Tyr Asn Gln 260 265 270Leu Phe Glu Glu Asn Pro Ile Asn Ala Ser Gly Val Asp Ala Lys Ala 275 280 285Ile Leu Ser Ala Arg Leu Ser Lys Ser Arg Arg Leu Glu Asn Leu Ile 290

295 300Ala Gln Leu Pro Gly Glu Lys Lys Asn Gly Leu Phe Gly Asn Leu Ile305 310 315 320Ala Leu Ser Leu Gly Leu Thr Pro Asn Phe Lys Ser Asn Phe Asp Leu 325 330 335Ala Glu Asp Ala Lys Leu Gln Leu Ser Lys Asp Thr Tyr Asp Asp Asp 340 345 350Leu Asp Asn Leu Leu Ala Gln Ile Gly Asp Gln Tyr Ala Asp Leu Phe 355 360 365Leu Ala Ala Lys Asn Leu Ser Asp Ala Ile Leu Leu Ser Asp Ile Leu 370 375 380Arg Val Asn Thr Glu Ile Thr Lys Ala Pro Leu Ser Ala Ser Met Ile385 390 395 400Lys Arg Tyr Asp Glu His His Gln Asp Leu Thr Leu Leu Lys Ala Leu 405 410 415Val Arg Gln Gln Leu Pro Glu Lys Tyr Lys Glu Ile Phe Phe Asp Gln 420 425 430Ser Lys Asn Gly Tyr Ala Gly Tyr Ile Asp Gly Gly Ala Ser Gln Glu 435 440 445Glu Phe Tyr Lys Phe Ile Lys Pro Ile Leu Glu Lys Met Asp Gly Thr 450 455 460Glu Glu Leu Leu Val Lys Leu Asn Arg Glu Asp Leu Leu Arg Lys Gln465 470 475 480Arg Thr Phe Asp Asn Gly Ser Ile Pro His Gln Ile His Leu Gly Glu 485 490 495Leu His Ala Ile Leu Arg Arg Gln Glu Asp Phe Tyr Pro Phe Leu Lys 500 505 510Asp Asn Arg Glu Lys Ile Glu Lys Ile Leu Thr Phe Arg Ile Pro Tyr 515 520 525Tyr Val Gly Pro Leu Ala Arg Gly Asn Ser Arg Phe Ala Trp Met Thr 530 535 540Arg Lys Ser Glu Glu Thr Ile Thr Pro Trp Asn Phe Glu Glu Val Val545 550 555 560Asp Lys Gly Ala Ser Ala Gln Ser Phe Ile Glu Arg Met Thr Asn Phe 565 570 575Asp Lys Asn Leu Pro Asn Glu Lys Val Leu Pro Lys His Ser Leu Leu 580 585 590Tyr Glu Tyr Phe Thr Val Tyr Asn Glu Leu Thr Lys Val Lys Tyr Val 595 600 605Thr Glu Gly Met Arg Lys Pro Ala Phe Leu Ser Gly Glu Gln Lys Lys 610 615 620Ala Ile Val Asp Leu Leu Phe Lys Thr Asn Arg Lys Val Thr Val Lys625 630 635 640Gln Leu Lys Glu Asp Tyr Phe Lys Lys Ile Glu Cys Phe Asp Ser Val 645 650 655Glu Ile Ser Gly Val Glu Asp Arg Phe Asn Ala Ser Leu Gly Thr Tyr 660 665 670His Asp Leu Leu Lys Ile Ile Lys Asp Lys Asp Phe Leu Asp Asn Glu 675 680 685Glu Asn Glu Asp Ile Leu Glu Asp Ile Val Leu Thr Leu Thr Leu Phe 690 695 700Glu Asp Arg Glu Met Ile Glu Glu Arg Leu Lys Thr Tyr Ala His Leu705 710 715 720Phe Asp Asp Lys Val Met Lys Gln Leu Lys Arg Arg Arg Tyr Thr Gly 725 730 735Trp Gly Arg Leu Ser Arg Lys Leu Ile Asn Gly Ile Arg Asp Lys Gln 740 745 750Ser Gly Lys Thr Ile Leu Asp Phe Leu Lys Ser Asp Gly Phe Ala Asn 755 760 765Arg Asn Phe Met Gln Leu Ile His Asp Asp Ser Leu Thr Phe Lys Glu 770 775 780Asp Ile Gln Lys Ala Gln Val Ser Gly Gln Gly Asp Ser Leu His Glu785 790 795 800His Ile Ala Asn Leu Ala Gly Ser Pro Ala Ile Lys Lys Gly Ile Leu 805 810 815Gln Thr Val Lys Val Val Asp Glu Leu Val Lys Val Met Gly Arg His 820 825 830Lys Pro Glu Asn Ile Val Ile Glu Met Ala Arg Glu Asn Gln Thr Thr 835 840 845Gln Lys Gly Gln Lys Asn Ser Arg Glu Arg Met Lys Arg Ile Glu Glu 850 855 860Gly Ile Lys Glu Leu Gly Ser Gln Ile Leu Lys Glu His Pro Val Glu865 870 875 880Asn Thr Gln Leu Gln Asn Glu Lys Leu Tyr Leu Tyr Tyr Leu Gln Asn 885 890 895Gly Arg Asp Met Tyr Val Asp Gln Glu Leu Asp Ile Asn Arg Leu Ser 900 905 910Asp Tyr Asp Val Asp Ala Ile Val Pro Gln Ser Phe Leu Lys Asp Asp 915 920 925Ser Ile Asp Asn Lys Val Leu Thr Arg Ser Asp Lys Asn Arg Gly Lys 930 935 940Ser Asp Asn Val Pro Ser Glu Glu Val Val Lys Lys Met Lys Asn Tyr945 950 955 960Trp Arg Gln Leu Leu Asn Ala Lys Leu Ile Thr Gln Arg Lys Phe Asp 965 970 975Asn Leu Thr Lys Ala Glu Arg Gly Gly Leu Ser Glu Leu Asp Lys Ala 980 985 990Gly Phe Ile Lys Arg Gln Leu Val Glu Thr Arg Gln Ile Thr Lys His 995 1000 1005Val Ala Gln Ile Leu Asp Ser Arg Met Asn Thr Lys Tyr Asp Glu 1010 1015 1020Asn Asp Lys Leu Ile Arg Glu Val Lys Val Ile Thr Leu Lys Ser 1025 1030 1035Lys Leu Val Ser Asp Phe Arg Lys Asp Phe Gln Phe Tyr Lys Val 1040 1045 1050Arg Glu Ile Asn Asn Tyr His His Ala His Asp Ala Tyr Leu Asn 1055 1060 1065Ala Val Val Gly Thr Ala Leu Ile Lys Lys Tyr Pro Lys Leu Glu 1070 1075 1080Ser Glu Phe Val Tyr Gly Asp Tyr Lys Val Tyr Asp Val Arg Lys 1085 1090 1095Met Ile Ala Lys Ser Glu Gln Glu Ile Gly Lys Ala Thr Ala Lys 1100 1105 1110Tyr Phe Phe Tyr Ser Asn Ile Met Asn Phe Phe Lys Thr Glu Ile 1115 1120 1125Thr Leu Ala Asn Gly Glu Ile Arg Lys Arg Pro Leu Ile Glu Thr 1130 1135 1140Asn Gly Glu Thr Gly Glu Ile Val Trp Asp Lys Gly Arg Asp Phe 1145 1150 1155Ala Thr Val Arg Lys Val Leu Ser Met Pro Gln Val Asn Ile Val 1160 1165 1170Lys Lys Thr Glu Val Gln Thr Gly Gly Phe Ser Lys Glu Ser Ile 1175 1180 1185Leu Pro Lys Arg Asn Ser Asp Lys Leu Ile Ala Arg Lys Lys Asp 1190 1195 1200Trp Asp Pro Lys Lys Tyr Gly Gly Phe Asp Ser Pro Thr Val Ala 1205 1210 1215Tyr Ser Val Leu Val Val Ala Lys Val Glu Lys Gly Lys Ser Lys 1220 1225 1230Lys Leu Lys Ser Val Lys Glu Leu Leu Gly Ile Thr Ile Met Glu 1235 1240 1245Arg Ser Ser Phe Glu Lys Asn Pro Ile Asp Phe Leu Glu Ala Lys 1250 1255 1260Gly Tyr Lys Glu Val Lys Lys Asp Leu Ile Ile Lys Leu Pro Lys 1265 1270 1275Tyr Ser Leu Phe Glu Leu Glu Asn Gly Arg Lys Arg Met Leu Ala 1280 1285 1290Ser Ala Gly Glu Leu Gln Lys Gly Asn Glu Leu Ala Leu Pro Ser 1295 1300 1305Lys Tyr Val Asn Phe Leu Tyr Leu Ala Ser His Tyr Glu Lys Leu 1310 1315 1320Lys Gly Ser Pro Glu Asp Asn Glu Gln Lys Gln Leu Phe Val Glu 1325 1330 1335Gln His Lys His Tyr Leu Asp Glu Ile Ile Glu Gln Ile Ser Glu 1340 1345 1350Phe Ser Lys Arg Val Ile Leu Ala Asp Ala Asn Leu Asp Lys Val 1355 1360 1365Leu Ser Ala Tyr Asn Lys His Arg Asp Lys Pro Ile Arg Glu Gln 1370 1375 1380Ala Glu Asn Ile Ile His Leu Phe Thr Leu Thr Asn Leu Gly Ala 1385 1390 1395Pro Ala Ala Phe Lys Tyr Phe Asp Thr Thr Ile Asp Arg Lys Arg 1400 1405 1410Tyr Thr Ser Thr Lys Glu Val Leu Asp Ala Thr Leu Ile His Gln 1415 1420 1425Ser Ile Thr Gly Leu Tyr Glu Thr Arg Ile Asp Leu Ser Gln Leu 1430 1435 1440Gly Gly Asp Ser Arg Ala Asp Tyr Pro Tyr Asp Val Pro Asp Tyr 1445 1450 1455Ala Ser Gly Ser Pro Lys Lys Lys Arg Lys Val Glu Ala Ser Gly 1460 1465 1470Ser Gly Arg Ala Ser Pro Gly Ile Pro Gly Ser Thr Arg Asn His 1475 1480 1485Asp Gln Glu Phe Asp Pro Pro Lys Val Tyr Pro Pro Val Pro Ala 1490 1495 1500Glu Lys Arg Lys Pro Ile Arg Val Leu Ser Leu Phe Asp Gly Ile 1505 1510 1515Ala Thr Gly Leu Leu Val Leu Lys Asp Leu Gly Ile Gln Val Asp 1520 1525 1530Arg Tyr Ile Ala Ser Glu Val Cys Glu Asp Ser Ile Thr Val Gly 1535 1540 1545Met Val Arg His Gln Gly Lys Ile Met Tyr Val Gly Asp Val Arg 1550 1555 1560Ser Val Thr Gln Lys His Ile Gln Glu Trp Gly Pro Phe Asp Leu 1565 1570 1575Val Ile Gly Gly Ser Pro Cys Asn Asp Leu Ser Ile Val Asn Pro 1580 1585 1590Ala Arg Lys Gly Leu Tyr Glu Gly Thr Gly Arg Leu Phe Phe Glu 1595 1600 1605Phe Tyr Arg Leu Leu His Asp Ala Arg Pro Lys Glu Gly Asp Asp 1610 1615 1620Arg Pro Phe Phe Trp Leu Phe Glu Asn Val Val Ala Met Gly Val 1625 1630 1635Ser Asp Lys Arg Asp Ile Ser Arg Phe Leu Glu Ser Asn Pro Val 1640 1645 1650Met Ile Asp Ala Lys Glu Val Ser Ala Ala His Arg Ala Arg Tyr 1655 1660 1665Phe Trp Gly Asn Leu Pro Gly Met Asn Arg Pro Leu Ala Ser Thr 1670 1675 1680Val Asn Asp Lys Leu Glu Leu Gln Glu Cys Leu Glu His Gly Arg 1685 1690 1695Ile Ala Lys Phe Ser Lys Val Arg Thr Ile Thr Thr Arg Ser Asn 1700 1705 1710Ser Ile Lys Gln Gly Lys Asp Gln His Phe Pro Val Phe Met Asn 1715 1720 1725Glu Lys Glu Asp Ile Leu Trp Cys Thr Glu Met Glu Arg Val Phe 1730 1735 1740Gly Phe Pro Val His Tyr Thr Asp Val Ser Asn Met Ser Arg Leu 1745 1750 1755Ala Arg Gln Arg Leu Leu Gly Arg Ser Trp Ser Val Pro Val Ile 1760 1765 1770Arg His Leu Phe Ala Pro Leu Lys Glu Tyr Phe Ala Cys Val Ser 1775 1780 1785Ser Gly Asn Ser Asn Ala Asn Ser Arg Gly Pro Ser Phe Ser Ser 1790 1795 1800Gly Leu Val Pro Leu Ser Leu Arg Gly Ser His Met Gly Pro Met 1805 1810 1815Glu Ile Tyr Lys Thr Val Ser Ala Trp Lys Arg Gln Pro Val Arg 1820 1825 1830Val Leu Ser Leu Phe Arg Asn Ile Asp Lys Val Leu Lys Ser Leu 1835 1840 1845Gly Phe Leu Glu Ser Gly Ser Gly Ser Gly Gly Gly Thr Leu Lys 1850 1855 1860Tyr Val Glu Asp Val Thr Asn Val Val Arg Arg Asp Val Glu Lys 1865 1870 1875Trp Gly Pro Phe Asp Leu Val Tyr Gly Ser Thr Gln Pro Leu Gly 1880 1885 1890Ser Ser Cys Asp Arg Cys Pro Gly Trp Tyr Met Phe Gln Phe His 1895 1900 1905Arg Ile Leu Gln Tyr Ala Leu Pro Arg Gln Glu Ser Gln Arg Pro 1910 1915 1920Phe Phe Trp Ile Phe Met Asp Asn Leu Leu Leu Thr Glu Asp Asp 1925 1930 1935Gln Glu Thr Thr Thr Arg Phe Leu Gln Thr Glu Ala Val Thr Leu 1940 1945 1950Gln Asp Val Arg Gly Arg Asp Tyr Gln Asn Ala Met Arg Val Trp 1955 1960 1965Ser Asn Ile Pro Gly Leu Lys Ser Lys His Ala Pro Leu Thr Pro 1970 1975 1980Lys Glu Glu Glu Tyr Leu Gln Ala Gln Val Arg Ser Arg Ser Lys 1985 1990 1995Leu Asp Ala Pro Lys Val Asp Leu Leu Val Lys Asn Cys Leu Leu 2000 2005 2010Pro Leu Arg Glu Tyr Phe Lys Tyr Phe Ser Gln Asn Ser Leu Pro 2015 2020 2025Leu Ser Arg Ala Asp Pro Lys Lys Lys Arg Lys Val Gly Ser Gly 2030 2035 2040Ala Thr Asn Phe Ser Leu Leu Lys Gln Ala Gly Asp Val Glu Glu 2045 2050 2055Asn Pro Gly Pro Gly Ser Gly Ala Thr Asn Phe Ser Leu Leu Lys 2060 2065 2070Gln Ala Gly Asp Val Glu Glu Asn Pro Gly Pro Ser Glu Leu Ile 2075 2080 2085Lys Glu Asn Met His Met Lys Leu Tyr Met Glu Gly Thr Val Asp 2090 2095 2100Asn His His Phe Lys Cys Thr Ser Glu Gly Glu Gly Lys Pro Tyr 2105 2110 2115Glu Gly Thr Gln Thr Met Arg Ile Lys Val Val Glu Gly Gly Pro 2120 2125 2130Leu Pro Phe Ala Phe Asp Ile Leu Ala Thr Ser Phe Leu Tyr Gly 2135 2140 2145Ser Lys Thr Phe Ile Asn His Thr Gln Gly Ile Pro Asp Phe Phe 2150 2155 2160Lys Gln Ser Phe Pro Glu Gly Phe Thr Trp Glu Arg Val Thr Thr 2165 2170 2175Tyr Glu Asp Gly Gly Val Leu Thr Ala Thr Gln Asp Thr Ser Leu 2180 2185 2190Gln Asp Gly Cys Leu Ile Tyr Asn Val Lys Ile Arg Gly Val Asn 2195 2200 2205Phe Thr Ser Asn Gly Pro Val Met Gln Lys Lys Thr Leu Gly Trp 2210 2215 2220Glu Ala Phe Thr Glu Thr Leu Tyr Pro Ala Asp Gly Gly Leu Glu 2225 2230 2235Gly Arg Asn Asp Met Ala Leu Lys Leu Val Gly Gly Ser His Leu 2240 2245 2250Ile Ala Asn Ile Lys Thr Thr Tyr Arg Ser Lys Lys Pro Ala Lys 2255 2260 2265Asn Leu Lys Met Pro Gly Val Tyr Tyr Val Asp Tyr Arg Leu Glu 2270 2275 2280Arg Ile Lys Glu Ala Asn Asn Glu Thr Tyr Val Glu Gln His Glu 2285 2290 2295Val Ala Val Ala Arg Tyr Cys Asp Leu Pro Ser Lys Leu Gly His 2300 2305 2310Lys Leu Asn 231542318PRTArtificial sequenceSynthetic polypeptide 4Asp Ala Lys Ser Leu Thr Ala Trp Ser Arg Thr Leu Val Thr Phe Lys1 5 10 15Asp Val Phe Val Asp Phe Thr Arg Glu Glu Trp Lys Leu Leu Asp Thr 20 25 30Ala Gln Gln Ile Val Tyr Arg Asn Val Met Leu Glu Asn Tyr Lys Asn 35 40 45Leu Val Ser Leu Gly Tyr Gln Leu Thr Lys Pro Asp Val Ile Leu Arg 50 55 60Leu Glu Lys Gly Glu Glu Pro Gly Gly Ser Gly Gly Gly Ser Met Asp65 70 75 80Lys Lys Tyr Ser Ile Gly Leu Ala Ile Gly Thr Asn Ser Val Gly Trp 85 90 95Ala Val Ile Thr Asp Glu Tyr Lys Val Pro Ser Lys Lys Phe Lys Val 100 105 110Leu Gly Asn Thr Asp Arg His Ser Ile Lys Lys Asn Leu Ile Gly Ala 115 120 125Leu Leu Phe Asp Ser Gly Glu Thr Ala Glu Ala Thr Arg Leu Lys Arg 130 135 140Thr Ala Arg Arg Arg Tyr Thr Arg Arg Lys Asn Arg Ile Cys Tyr Leu145 150 155 160Gln Glu Ile Phe Ser Asn Glu Met Ala Lys Val Asp Asp Ser Phe Phe 165 170 175His Arg Leu Glu Glu Ser Phe Leu Val Glu Glu Asp Lys Lys His Glu 180 185 190Arg His Pro Ile Phe Gly Asn Ile Val Asp Glu Val Ala Tyr His Glu 195 200 205Lys Tyr Pro Thr Ile Tyr His Leu Arg Lys Lys Leu Val Asp Ser Thr 210 215 220Asp Lys Ala Asp Leu Arg Leu Ile Tyr Leu Ala Leu Ala His Met Ile225 230 235 240Lys Phe Arg Gly His Phe Leu Ile Glu Gly Asp Leu Asn Pro Asp Asn 245 250 255Ser Asp Val Asp Lys Leu Phe Ile Gln Leu Val Gln Thr Tyr Asn Gln 260 265 270Leu Phe Glu Glu Asn Pro Ile Asn Ala Ser Gly Val Asp Ala Lys Ala 275 280 285Ile Leu Ser Ala Arg Leu Ser Lys Ser Arg Arg Leu Glu Asn Leu Ile 290 295 300Ala Gln Leu Pro Gly Glu Lys Lys Asn Gly Leu Phe Gly Asn Leu Ile305 310 315 320Ala Leu Ser Leu Gly Leu Thr Pro Asn Phe Lys Ser Asn Phe Asp Leu 325 330 335Ala Glu Asp Ala Lys Leu Gln Leu Ser Lys Asp Thr Tyr Asp Asp Asp 340 345 350Leu Asp Asn Leu Leu Ala Gln Ile Gly Asp Gln Tyr Ala Asp Leu Phe 355 360 365Leu Ala Ala Lys Asn Leu Ser Asp Ala Ile Leu Leu Ser Asp Ile Leu 370 375 380Arg Val Asn Thr Glu Ile Thr Lys Ala Pro Leu Ser Ala Ser Met Ile385 390 395 400Lys Arg Tyr Asp Glu His His Gln Asp Leu Thr Leu Leu Lys Ala Leu 405 410 415Val Arg Gln Gln Leu Pro Glu Lys Tyr Lys Glu Ile Phe Phe Asp Gln 420

425 430Ser Lys Asn Gly Tyr Ala Gly Tyr Ile Asp Gly Gly Ala Ser Gln Glu 435 440 445Glu Phe Tyr Lys Phe Ile Lys Pro Ile Leu Glu Lys Met Asp Gly Thr 450 455 460Glu Glu Leu Leu Val Lys Leu Asn Arg Glu Asp Leu Leu Arg Lys Gln465 470 475 480Arg Thr Phe Asp Asn Gly Ser Ile Pro His Gln Ile His Leu Gly Glu 485 490 495Leu His Ala Ile Leu Arg Arg Gln Glu Asp Phe Tyr Pro Phe Leu Lys 500 505 510Asp Asn Arg Glu Lys Ile Glu Lys Ile Leu Thr Phe Arg Ile Pro Tyr 515 520 525Tyr Val Gly Pro Leu Ala Arg Gly Asn Ser Arg Phe Ala Trp Met Thr 530 535 540Arg Lys Ser Glu Glu Thr Ile Thr Pro Trp Asn Phe Glu Glu Val Val545 550 555 560Asp Lys Gly Ala Ser Ala Gln Ser Phe Ile Glu Arg Met Thr Asn Phe 565 570 575Asp Lys Asn Leu Pro Asn Glu Lys Val Leu Pro Lys His Ser Leu Leu 580 585 590Tyr Glu Tyr Phe Thr Val Tyr Asn Glu Leu Thr Lys Val Lys Tyr Val 595 600 605Thr Glu Gly Met Arg Lys Pro Ala Phe Leu Ser Gly Glu Gln Lys Lys 610 615 620Ala Ile Val Asp Leu Leu Phe Lys Thr Asn Arg Lys Val Thr Val Lys625 630 635 640Gln Leu Lys Glu Asp Tyr Phe Lys Lys Ile Glu Cys Phe Asp Ser Val 645 650 655Glu Ile Ser Gly Val Glu Asp Arg Phe Asn Ala Ser Leu Gly Thr Tyr 660 665 670His Asp Leu Leu Lys Ile Ile Lys Asp Lys Asp Phe Leu Asp Asn Glu 675 680 685Glu Asn Glu Asp Ile Leu Glu Asp Ile Val Leu Thr Leu Thr Leu Phe 690 695 700Glu Asp Arg Glu Met Ile Glu Glu Arg Leu Lys Thr Tyr Ala His Leu705 710 715 720Phe Asp Asp Lys Val Met Lys Gln Leu Lys Arg Arg Arg Tyr Thr Gly 725 730 735Trp Gly Arg Leu Ser Arg Lys Leu Ile Asn Gly Ile Arg Asp Lys Gln 740 745 750Ser Gly Lys Thr Ile Leu Asp Phe Leu Lys Ser Asp Gly Phe Ala Asn 755 760 765Arg Asn Phe Met Gln Leu Ile His Asp Asp Ser Leu Thr Phe Lys Glu 770 775 780Asp Ile Gln Lys Ala Gln Val Ser Gly Gln Gly Asp Ser Leu His Glu785 790 795 800His Ile Ala Asn Leu Ala Gly Ser Pro Ala Ile Lys Lys Gly Ile Leu 805 810 815Gln Thr Val Lys Val Val Asp Glu Leu Val Lys Val Met Gly Arg His 820 825 830Lys Pro Glu Asn Ile Val Ile Glu Met Ala Arg Glu Asn Gln Thr Thr 835 840 845Gln Lys Gly Gln Lys Asn Ser Arg Glu Arg Met Lys Arg Ile Glu Glu 850 855 860Gly Ile Lys Glu Leu Gly Ser Gln Ile Leu Lys Glu His Pro Val Glu865 870 875 880Asn Thr Gln Leu Gln Asn Glu Lys Leu Tyr Leu Tyr Tyr Leu Gln Asn 885 890 895Gly Arg Asp Met Tyr Val Asp Gln Glu Leu Asp Ile Asn Arg Leu Ser 900 905 910Asp Tyr Asp Val Asp Ala Ile Val Pro Gln Ser Phe Leu Lys Asp Asp 915 920 925Ser Ile Asp Asn Lys Val Leu Thr Arg Ser Asp Lys Asn Arg Gly Lys 930 935 940Ser Asp Asn Val Pro Ser Glu Glu Val Val Lys Lys Met Lys Asn Tyr945 950 955 960Trp Arg Gln Leu Leu Asn Ala Lys Leu Ile Thr Gln Arg Lys Phe Asp 965 970 975Asn Leu Thr Lys Ala Glu Arg Gly Gly Leu Ser Glu Leu Asp Lys Ala 980 985 990Gly Phe Ile Lys Arg Gln Leu Val Glu Thr Arg Gln Ile Thr Lys His 995 1000 1005Val Ala Gln Ile Leu Asp Ser Arg Met Asn Thr Lys Tyr Asp Glu 1010 1015 1020Asn Asp Lys Leu Ile Arg Glu Val Lys Val Ile Thr Leu Lys Ser 1025 1030 1035Lys Leu Val Ser Asp Phe Arg Lys Asp Phe Gln Phe Tyr Lys Val 1040 1045 1050Arg Glu Ile Asn Asn Tyr His His Ala His Asp Ala Tyr Leu Asn 1055 1060 1065Ala Val Val Gly Thr Ala Leu Ile Lys Lys Tyr Pro Lys Leu Glu 1070 1075 1080Ser Glu Phe Val Tyr Gly Asp Tyr Lys Val Tyr Asp Val Arg Lys 1085 1090 1095Met Ile Ala Lys Ser Glu Gln Glu Ile Gly Lys Ala Thr Ala Lys 1100 1105 1110Tyr Phe Phe Tyr Ser Asn Ile Met Asn Phe Phe Lys Thr Glu Ile 1115 1120 1125Thr Leu Ala Asn Gly Glu Ile Arg Lys Arg Pro Leu Ile Glu Thr 1130 1135 1140Asn Gly Glu Thr Gly Glu Ile Val Trp Asp Lys Gly Arg Asp Phe 1145 1150 1155Ala Thr Val Arg Lys Val Leu Ser Met Pro Gln Val Asn Ile Val 1160 1165 1170Lys Lys Thr Glu Val Gln Thr Gly Gly Phe Ser Lys Glu Ser Ile 1175 1180 1185Leu Pro Lys Arg Asn Ser Asp Lys Leu Ile Ala Arg Lys Lys Asp 1190 1195 1200Trp Asp Pro Lys Lys Tyr Gly Gly Phe Asp Ser Pro Thr Val Ala 1205 1210 1215Tyr Ser Val Leu Val Val Ala Lys Val Glu Lys Gly Lys Ser Lys 1220 1225 1230Lys Leu Lys Ser Val Lys Glu Leu Leu Gly Ile Thr Ile Met Glu 1235 1240 1245Arg Ser Ser Phe Glu Lys Asn Pro Ile Asp Phe Leu Glu Ala Lys 1250 1255 1260Gly Tyr Lys Glu Val Lys Lys Asp Leu Ile Ile Lys Leu Pro Lys 1265 1270 1275Tyr Ser Leu Phe Glu Leu Glu Asn Gly Arg Lys Arg Met Leu Ala 1280 1285 1290Ser Ala Gly Glu Leu Gln Lys Gly Asn Glu Leu Ala Leu Pro Ser 1295 1300 1305Lys Tyr Val Asn Phe Leu Tyr Leu Ala Ser His Tyr Glu Lys Leu 1310 1315 1320Lys Gly Ser Pro Glu Asp Asn Glu Gln Lys Gln Leu Phe Val Glu 1325 1330 1335Gln His Lys His Tyr Leu Asp Glu Ile Ile Glu Gln Ile Ser Glu 1340 1345 1350Phe Ser Lys Arg Val Ile Leu Ala Asp Ala Asn Leu Asp Lys Val 1355 1360 1365Leu Ser Ala Tyr Asn Lys His Arg Asp Lys Pro Ile Arg Glu Gln 1370 1375 1380Ala Glu Asn Ile Ile His Leu Phe Thr Leu Thr Asn Leu Gly Ala 1385 1390 1395Pro Ala Ala Phe Lys Tyr Phe Asp Thr Thr Ile Asp Arg Lys Arg 1400 1405 1410Tyr Thr Ser Thr Lys Glu Val Leu Asp Ala Thr Leu Ile His Gln 1415 1420 1425Ser Ile Thr Gly Leu Tyr Glu Thr Arg Ile Asp Leu Ser Gln Leu 1430 1435 1440Gly Gly Asp Ser Arg Ala Asp Tyr Pro Tyr Asp Val Pro Asp Tyr 1445 1450 1455Ala Ser Gly Ser Pro Lys Lys Lys Arg Lys Val Ser Pro Gly Ser 1460 1465 1470Gly Ser Glu Thr Pro Gly Thr Ser Glu Ser Ala Thr Pro Glu Ser 1475 1480 1485Asn His Asp Gln Glu Phe Asp Pro Pro Lys Val Tyr Pro Pro Val 1490 1495 1500Pro Ala Glu Lys Arg Lys Pro Ile Arg Val Leu Ser Leu Phe Asp 1505 1510 1515Gly Ile Ala Thr Gly Leu Leu Val Leu Lys Asp Leu Gly Ile Gln 1520 1525 1530Val Asp Arg Tyr Ile Ala Ser Glu Val Cys Glu Asp Ser Ile Thr 1535 1540 1545Val Gly Met Val Arg His Gln Gly Lys Ile Met Tyr Val Gly Asp 1550 1555 1560Val Arg Ser Val Thr Gln Lys His Ile Gln Glu Trp Gly Pro Phe 1565 1570 1575Asp Leu Val Ile Gly Gly Ser Pro Cys Asn Asp Leu Ser Ile Val 1580 1585 1590Asn Pro Ala Arg Lys Gly Leu Tyr Glu Gly Thr Gly Arg Leu Phe 1595 1600 1605Phe Glu Phe Tyr Arg Leu Leu His Asp Ala Arg Pro Lys Glu Gly 1610 1615 1620Asp Asp Arg Pro Phe Phe Trp Leu Phe Glu Asn Val Val Ala Met 1625 1630 1635Gly Val Ser Asp Lys Arg Asp Ile Ser Arg Phe Leu Glu Ser Asn 1640 1645 1650Pro Val Met Ile Asp Ala Lys Glu Val Ser Ala Ala His Arg Ala 1655 1660 1665Arg Tyr Phe Trp Gly Asn Leu Pro Gly Met Asn Arg Pro Leu Ala 1670 1675 1680Ser Thr Val Asn Asp Lys Leu Glu Leu Gln Glu Cys Leu Glu His 1685 1690 1695Gly Arg Ile Ala Lys Phe Ser Lys Val Arg Thr Ile Thr Thr Arg 1700 1705 1710Ser Asn Ser Ile Lys Gln Gly Lys Asp Gln His Phe Pro Val Phe 1715 1720 1725Met Asn Glu Lys Glu Asp Ile Leu Trp Cys Thr Glu Met Glu Arg 1730 1735 1740Val Phe Gly Phe Pro Val His Tyr Thr Asp Val Ser Asn Met Ser 1745 1750 1755Arg Leu Ala Arg Gln Arg Leu Leu Gly Arg Ser Trp Ser Val Pro 1760 1765 1770Val Ile Arg His Leu Phe Ala Pro Leu Lys Glu Tyr Phe Ala Cys 1775 1780 1785Val Ser Ser Gly Asn Ser Asn Ala Asn Ser Arg Gly Pro Ser Phe 1790 1795 1800Ser Ser Gly Leu Val Pro Leu Ser Leu Arg Gly Ser His Met Gly 1805 1810 1815Pro Met Glu Ile Tyr Lys Thr Val Ser Ala Trp Lys Arg Gln Pro 1820 1825 1830Val Arg Val Leu Ser Leu Phe Arg Asn Ile Asp Lys Val Leu Lys 1835 1840 1845Ser Leu Gly Phe Leu Glu Ser Gly Ser Gly Ser Gly Gly Gly Thr 1850 1855 1860Leu Lys Tyr Val Glu Asp Val Thr Asn Val Val Arg Arg Asp Val 1865 1870 1875Glu Lys Trp Gly Pro Phe Asp Leu Val Tyr Gly Ser Thr Gln Pro 1880 1885 1890Leu Gly Ser Ser Cys Asp Arg Cys Pro Gly Trp Tyr Met Phe Gln 1895 1900 1905Phe His Arg Ile Leu Gln Tyr Ala Leu Pro Arg Gln Glu Ser Gln 1910 1915 1920Arg Pro Phe Phe Trp Ile Phe Met Asp Asn Leu Leu Leu Thr Glu 1925 1930 1935Asp Asp Gln Glu Thr Thr Thr Arg Phe Leu Gln Thr Glu Ala Val 1940 1945 1950Thr Leu Gln Asp Val Arg Gly Arg Asp Tyr Gln Asn Ala Met Arg 1955 1960 1965Val Trp Ser Asn Ile Pro Gly Leu Lys Ser Lys His Ala Pro Leu 1970 1975 1980Thr Pro Lys Glu Glu Glu Tyr Leu Gln Ala Gln Val Arg Ser Arg 1985 1990 1995Ser Lys Leu Asp Ala Pro Lys Val Asp Leu Leu Val Lys Asn Cys 2000 2005 2010Leu Leu Pro Leu Arg Glu Tyr Phe Lys Tyr Phe Ser Gln Asn Ser 2015 2020 2025Leu Pro Leu Ser Arg Ala Asp Pro Lys Lys Lys Arg Lys Val Gly 2030 2035 2040Ser Gly Ala Thr Asn Phe Ser Leu Leu Lys Gln Ala Gly Asp Val 2045 2050 2055Glu Glu Asn Pro Gly Pro Gly Ser Gly Ala Thr Asn Phe Ser Leu 2060 2065 2070Leu Lys Gln Ala Gly Asp Val Glu Glu Asn Pro Gly Pro Ser Glu 2075 2080 2085Leu Ile Lys Glu Asn Met His Met Lys Leu Tyr Met Glu Gly Thr 2090 2095 2100Val Asp Asn His His Phe Lys Cys Thr Ser Glu Gly Glu Gly Lys 2105 2110 2115Pro Tyr Glu Gly Thr Gln Thr Met Arg Ile Lys Val Val Glu Gly 2120 2125 2130Gly Pro Leu Pro Phe Ala Phe Asp Ile Leu Ala Thr Ser Phe Leu 2135 2140 2145Tyr Gly Ser Lys Thr Phe Ile Asn His Thr Gln Gly Ile Pro Asp 2150 2155 2160Phe Phe Lys Gln Ser Phe Pro Glu Gly Phe Thr Trp Glu Arg Val 2165 2170 2175Thr Thr Tyr Glu Asp Gly Gly Val Leu Thr Ala Thr Gln Asp Thr 2180 2185 2190Ser Leu Gln Asp Gly Cys Leu Ile Tyr Asn Val Lys Ile Arg Gly 2195 2200 2205Val Asn Phe Thr Ser Asn Gly Pro Val Met Gln Lys Lys Thr Leu 2210 2215 2220Gly Trp Glu Ala Phe Thr Glu Thr Leu Tyr Pro Ala Asp Gly Gly 2225 2230 2235Leu Glu Gly Arg Asn Asp Met Ala Leu Lys Leu Val Gly Gly Ser 2240 2245 2250His Leu Ile Ala Asn Ile Lys Thr Thr Tyr Arg Ser Lys Lys Pro 2255 2260 2265Ala Lys Asn Leu Lys Met Pro Gly Val Tyr Tyr Val Asp Tyr Arg 2270 2275 2280Leu Glu Arg Ile Lys Glu Ala Asn Asn Glu Thr Tyr Val Glu Gln 2285 2290 2295His Glu Val Ala Val Ala Arg Tyr Cys Asp Leu Pro Ser Lys Leu 2300 2305 2310Gly His Lys Leu Asn 231552360PRTArtificial sequenceSynthetic polypeptide 5Asp Ala Lys Ser Leu Thr Ala Trp Ser Arg Thr Leu Val Thr Phe Lys1 5 10 15Asp Val Phe Val Asp Phe Thr Arg Glu Glu Trp Lys Leu Leu Asp Thr 20 25 30Ala Gln Gln Ile Val Tyr Arg Asn Val Met Leu Glu Asn Tyr Lys Asn 35 40 45Leu Val Ser Leu Gly Tyr Gln Leu Thr Lys Pro Asp Val Ile Leu Arg 50 55 60Leu Glu Lys Gly Glu Glu Pro Gly Gly Ser Gly Gly Gly Ser Met Asp65 70 75 80Lys Lys Tyr Ser Ile Gly Leu Ala Ile Gly Thr Asn Ser Val Gly Trp 85 90 95Ala Val Ile Thr Asp Glu Tyr Lys Val Pro Ser Lys Lys Phe Lys Val 100 105 110Leu Gly Asn Thr Asp Arg His Ser Ile Lys Lys Asn Leu Ile Gly Ala 115 120 125Leu Leu Phe Asp Ser Gly Glu Thr Ala Glu Ala Thr Arg Leu Lys Arg 130 135 140Thr Ala Arg Arg Arg Tyr Thr Arg Arg Lys Asn Arg Ile Cys Tyr Leu145 150 155 160Gln Glu Ile Phe Ser Asn Glu Met Ala Lys Val Asp Asp Ser Phe Phe 165 170 175His Arg Leu Glu Glu Ser Phe Leu Val Glu Glu Asp Lys Lys His Glu 180 185 190Arg His Pro Ile Phe Gly Asn Ile Val Asp Glu Val Ala Tyr His Glu 195 200 205Lys Tyr Pro Thr Ile Tyr His Leu Arg Lys Lys Leu Val Asp Ser Thr 210 215 220Asp Lys Ala Asp Leu Arg Leu Ile Tyr Leu Ala Leu Ala His Met Ile225 230 235 240Lys Phe Arg Gly His Phe Leu Ile Glu Gly Asp Leu Asn Pro Asp Asn 245 250 255Ser Asp Val Asp Lys Leu Phe Ile Gln Leu Val Gln Thr Tyr Asn Gln 260 265 270Leu Phe Glu Glu Asn Pro Ile Asn Ala Ser Gly Val Asp Ala Lys Ala 275 280 285Ile Leu Ser Ala Arg Leu Ser Lys Ser Arg Arg Leu Glu Asn Leu Ile 290 295 300Ala Gln Leu Pro Gly Glu Lys Lys Asn Gly Leu Phe Gly Asn Leu Ile305 310 315 320Ala Leu Ser Leu Gly Leu Thr Pro Asn Phe Lys Ser Asn Phe Asp Leu 325 330 335Ala Glu Asp Ala Lys Leu Gln Leu Ser Lys Asp Thr Tyr Asp Asp Asp 340 345 350Leu Asp Asn Leu Leu Ala Gln Ile Gly Asp Gln Tyr Ala Asp Leu Phe 355 360 365Leu Ala Ala Lys Asn Leu Ser Asp Ala Ile Leu Leu Ser Asp Ile Leu 370 375 380Arg Val Asn Thr Glu Ile Thr Lys Ala Pro Leu Ser Ala Ser Met Ile385 390 395 400Lys Arg Tyr Asp Glu His His Gln Asp Leu Thr Leu Leu Lys Ala Leu 405 410 415Val Arg Gln Gln Leu Pro Glu Lys Tyr Lys Glu Ile Phe Phe Asp Gln 420 425 430Ser Lys Asn Gly Tyr Ala Gly Tyr Ile Asp Gly Gly Ala Ser Gln Glu 435 440 445Glu Phe Tyr Lys Phe Ile Lys Pro Ile Leu Glu Lys Met Asp Gly Thr 450 455 460Glu Glu Leu Leu Val Lys Leu Asn Arg Glu Asp Leu Leu Arg Lys Gln465 470 475 480Arg Thr Phe Asp Asn Gly Ser Ile Pro His Gln Ile His Leu Gly Glu 485 490 495Leu His Ala Ile Leu Arg Arg Gln Glu Asp Phe Tyr Pro Phe Leu Lys 500 505 510Asp Asn Arg Glu Lys Ile Glu Lys Ile Leu Thr Phe Arg Ile Pro Tyr 515 520 525Tyr Val Gly Pro Leu Ala Arg Gly Asn Ser Arg Phe Ala Trp Met Thr 530 535 540Arg Lys Ser Glu Glu Thr Ile Thr Pro Trp Asn Phe Glu Glu Val Val545 550

555 560Asp Lys Gly Ala Ser Ala Gln Ser Phe Ile Glu Arg Met Thr Asn Phe 565 570 575Asp Lys Asn Leu Pro Asn Glu Lys Val Leu Pro Lys His Ser Leu Leu 580 585 590Tyr Glu Tyr Phe Thr Val Tyr Asn Glu Leu Thr Lys Val Lys Tyr Val 595 600 605Thr Glu Gly Met Arg Lys Pro Ala Phe Leu Ser Gly Glu Gln Lys Lys 610 615 620Ala Ile Val Asp Leu Leu Phe Lys Thr Asn Arg Lys Val Thr Val Lys625 630 635 640Gln Leu Lys Glu Asp Tyr Phe Lys Lys Ile Glu Cys Phe Asp Ser Val 645 650 655Glu Ile Ser Gly Val Glu Asp Arg Phe Asn Ala Ser Leu Gly Thr Tyr 660 665 670His Asp Leu Leu Lys Ile Ile Lys Asp Lys Asp Phe Leu Asp Asn Glu 675 680 685Glu Asn Glu Asp Ile Leu Glu Asp Ile Val Leu Thr Leu Thr Leu Phe 690 695 700Glu Asp Arg Glu Met Ile Glu Glu Arg Leu Lys Thr Tyr Ala His Leu705 710 715 720Phe Asp Asp Lys Val Met Lys Gln Leu Lys Arg Arg Arg Tyr Thr Gly 725 730 735Trp Gly Arg Leu Ser Arg Lys Leu Ile Asn Gly Ile Arg Asp Lys Gln 740 745 750Ser Gly Lys Thr Ile Leu Asp Phe Leu Lys Ser Asp Gly Phe Ala Asn 755 760 765Arg Asn Phe Met Gln Leu Ile His Asp Asp Ser Leu Thr Phe Lys Glu 770 775 780Asp Ile Gln Lys Ala Gln Val Ser Gly Gln Gly Asp Ser Leu His Glu785 790 795 800His Ile Ala Asn Leu Ala Gly Ser Pro Ala Ile Lys Lys Gly Ile Leu 805 810 815Gln Thr Val Lys Val Val Asp Glu Leu Val Lys Val Met Gly Arg His 820 825 830Lys Pro Glu Asn Ile Val Ile Glu Met Ala Arg Glu Asn Gln Thr Thr 835 840 845Gln Lys Gly Gln Lys Asn Ser Arg Glu Arg Met Lys Arg Ile Glu Glu 850 855 860Gly Ile Lys Glu Leu Gly Ser Gln Ile Leu Lys Glu His Pro Val Glu865 870 875 880Asn Thr Gln Leu Gln Asn Glu Lys Leu Tyr Leu Tyr Tyr Leu Gln Asn 885 890 895Gly Arg Asp Met Tyr Val Asp Gln Glu Leu Asp Ile Asn Arg Leu Ser 900 905 910Asp Tyr Asp Val Asp Ala Ile Val Pro Gln Ser Phe Leu Lys Asp Asp 915 920 925Ser Ile Asp Asn Lys Val Leu Thr Arg Ser Asp Lys Asn Arg Gly Lys 930 935 940Ser Asp Asn Val Pro Ser Glu Glu Val Val Lys Lys Met Lys Asn Tyr945 950 955 960Trp Arg Gln Leu Leu Asn Ala Lys Leu Ile Thr Gln Arg Lys Phe Asp 965 970 975Asn Leu Thr Lys Ala Glu Arg Gly Gly Leu Ser Glu Leu Asp Lys Ala 980 985 990Gly Phe Ile Lys Arg Gln Leu Val Glu Thr Arg Gln Ile Thr Lys His 995 1000 1005Val Ala Gln Ile Leu Asp Ser Arg Met Asn Thr Lys Tyr Asp Glu 1010 1015 1020Asn Asp Lys Leu Ile Arg Glu Val Lys Val Ile Thr Leu Lys Ser 1025 1030 1035Lys Leu Val Ser Asp Phe Arg Lys Asp Phe Gln Phe Tyr Lys Val 1040 1045 1050Arg Glu Ile Asn Asn Tyr His His Ala His Asp Ala Tyr Leu Asn 1055 1060 1065Ala Val Val Gly Thr Ala Leu Ile Lys Lys Tyr Pro Lys Leu Glu 1070 1075 1080Ser Glu Phe Val Tyr Gly Asp Tyr Lys Val Tyr Asp Val Arg Lys 1085 1090 1095Met Ile Ala Lys Ser Glu Gln Glu Ile Gly Lys Ala Thr Ala Lys 1100 1105 1110Tyr Phe Phe Tyr Ser Asn Ile Met Asn Phe Phe Lys Thr Glu Ile 1115 1120 1125Thr Leu Ala Asn Gly Glu Ile Arg Lys Arg Pro Leu Ile Glu Thr 1130 1135 1140Asn Gly Glu Thr Gly Glu Ile Val Trp Asp Lys Gly Arg Asp Phe 1145 1150 1155Ala Thr Val Arg Lys Val Leu Ser Met Pro Gln Val Asn Ile Val 1160 1165 1170Lys Lys Thr Glu Val Gln Thr Gly Gly Phe Ser Lys Glu Ser Ile 1175 1180 1185Leu Pro Lys Arg Asn Ser Asp Lys Leu Ile Ala Arg Lys Lys Asp 1190 1195 1200Trp Asp Pro Lys Lys Tyr Gly Gly Phe Asp Ser Pro Thr Val Ala 1205 1210 1215Tyr Ser Val Leu Val Val Ala Lys Val Glu Lys Gly Lys Ser Lys 1220 1225 1230Lys Leu Lys Ser Val Lys Glu Leu Leu Gly Ile Thr Ile Met Glu 1235 1240 1245Arg Ser Ser Phe Glu Lys Asn Pro Ile Asp Phe Leu Glu Ala Lys 1250 1255 1260Gly Tyr Lys Glu Val Lys Lys Asp Leu Ile Ile Lys Leu Pro Lys 1265 1270 1275Tyr Ser Leu Phe Glu Leu Glu Asn Gly Arg Lys Arg Met Leu Ala 1280 1285 1290Ser Ala Gly Glu Leu Gln Lys Gly Asn Glu Leu Ala Leu Pro Ser 1295 1300 1305Lys Tyr Val Asn Phe Leu Tyr Leu Ala Ser His Tyr Glu Lys Leu 1310 1315 1320Lys Gly Ser Pro Glu Asp Asn Glu Gln Lys Gln Leu Phe Val Glu 1325 1330 1335Gln His Lys His Tyr Leu Asp Glu Ile Ile Glu Gln Ile Ser Glu 1340 1345 1350Phe Ser Lys Arg Val Ile Leu Ala Asp Ala Asn Leu Asp Lys Val 1355 1360 1365Leu Ser Ala Tyr Asn Lys His Arg Asp Lys Pro Ile Arg Glu Gln 1370 1375 1380Ala Glu Asn Ile Ile His Leu Phe Thr Leu Thr Asn Leu Gly Ala 1385 1390 1395Pro Ala Ala Phe Lys Tyr Phe Asp Thr Thr Ile Asp Arg Lys Arg 1400 1405 1410Tyr Thr Ser Thr Lys Glu Val Leu Asp Ala Thr Leu Ile His Gln 1415 1420 1425Ser Ile Thr Gly Leu Tyr Glu Thr Arg Ile Asp Leu Ser Gln Leu 1430 1435 1440Gly Gly Asp Ser Arg Ala Asp Tyr Pro Tyr Asp Val Pro Asp Tyr 1445 1450 1455Ala Ser Gly Ser Pro Lys Lys Lys Arg Lys Val Ser Pro Gly Gly 1460 1465 1470Gly Pro Ser Ser Gly Ala Pro Pro Pro Ser Gly Gly Ser Pro Ala 1475 1480 1485Gly Ser Pro Thr Ser Thr Glu Glu Gly Thr Ser Glu Ser Ala Thr 1490 1495 1500Pro Glu Ser Gly Pro Gly Thr Ser Thr Glu Pro Ser Glu Gly Ser 1505 1510 1515Ala Pro Gly Ser Pro Ala Gly Ser Pro Thr Ser Thr Glu Glu Gly 1520 1525 1530Thr Ser Thr Glu Pro Ser Glu Gly Ser Ala Pro Gly Thr Ser Thr 1535 1540 1545Glu Pro Ser Glu Asn His Asp Gln Glu Phe Asp Pro Pro Lys Val 1550 1555 1560Tyr Pro Pro Val Pro Ala Glu Lys Arg Lys Pro Ile Arg Val Leu 1565 1570 1575Ser Leu Phe Asp Gly Ile Ala Thr Gly Leu Leu Val Leu Lys Asp 1580 1585 1590Leu Gly Ile Gln Val Asp Arg Tyr Ile Ala Ser Glu Val Cys Glu 1595 1600 1605Asp Ser Ile Thr Val Gly Met Val Arg His Gln Gly Lys Ile Met 1610 1615 1620Tyr Val Gly Asp Val Arg Ser Val Thr Gln Lys His Ile Gln Glu 1625 1630 1635Trp Gly Pro Phe Asp Leu Val Ile Gly Gly Ser Pro Cys Asn Asp 1640 1645 1650Leu Ser Ile Val Asn Pro Ala Arg Lys Gly Leu Tyr Glu Gly Thr 1655 1660 1665Gly Arg Leu Phe Phe Glu Phe Tyr Arg Leu Leu His Asp Ala Arg 1670 1675 1680Pro Lys Glu Gly Asp Asp Arg Pro Phe Phe Trp Leu Phe Glu Asn 1685 1690 1695Val Val Ala Met Gly Val Ser Asp Lys Arg Asp Ile Ser Arg Phe 1700 1705 1710Leu Glu Ser Asn Pro Val Met Ile Asp Ala Lys Glu Val Ser Ala 1715 1720 1725Ala His Arg Ala Arg Tyr Phe Trp Gly Asn Leu Pro Gly Met Asn 1730 1735 1740Arg Pro Leu Ala Ser Thr Val Asn Asp Lys Leu Glu Leu Gln Glu 1745 1750 1755Cys Leu Glu His Gly Arg Ile Ala Lys Phe Ser Lys Val Arg Thr 1760 1765 1770Ile Thr Thr Arg Ser Asn Ser Ile Lys Gln Gly Lys Asp Gln His 1775 1780 1785Phe Pro Val Phe Met Asn Glu Lys Glu Asp Ile Leu Trp Cys Thr 1790 1795 1800Glu Met Glu Arg Val Phe Gly Phe Pro Val His Tyr Thr Asp Val 1805 1810 1815Ser Asn Met Ser Arg Leu Ala Arg Gln Arg Leu Leu Gly Arg Ser 1820 1825 1830Trp Ser Val Pro Val Ile Arg His Leu Phe Ala Pro Leu Lys Glu 1835 1840 1845Tyr Phe Ala Cys Val Ser Ser Gly Asn Ser Asn Ala Asn Ser Arg 1850 1855 1860Gly Pro Ser Phe Ser Ser Gly Leu Val Pro Leu Ser Leu Arg Gly 1865 1870 1875Ser His Met Gly Pro Met Glu Ile Tyr Lys Thr Val Ser Ala Trp 1880 1885 1890Lys Arg Gln Pro Val Arg Val Leu Ser Leu Phe Arg Asn Ile Asp 1895 1900 1905Lys Val Leu Lys Ser Leu Gly Phe Leu Glu Ser Gly Ser Gly Ser 1910 1915 1920Gly Gly Gly Thr Leu Lys Tyr Val Glu Asp Val Thr Asn Val Val 1925 1930 1935Arg Arg Asp Val Glu Lys Trp Gly Pro Phe Asp Leu Val Tyr Gly 1940 1945 1950Ser Thr Gln Pro Leu Gly Ser Ser Cys Asp Arg Cys Pro Gly Trp 1955 1960 1965Tyr Met Phe Gln Phe His Arg Ile Leu Gln Tyr Ala Leu Pro Arg 1970 1975 1980Gln Glu Ser Gln Arg Pro Phe Phe Trp Ile Phe Met Asp Asn Leu 1985 1990 1995Leu Leu Thr Glu Asp Asp Gln Glu Thr Thr Thr Arg Phe Leu Gln 2000 2005 2010Thr Glu Ala Val Thr Leu Gln Asp Val Arg Gly Arg Asp Tyr Gln 2015 2020 2025Asn Ala Met Arg Val Trp Ser Asn Ile Pro Gly Leu Lys Ser Lys 2030 2035 2040His Ala Pro Leu Thr Pro Lys Glu Glu Glu Tyr Leu Gln Ala Gln 2045 2050 2055Val Arg Ser Arg Ser Lys Leu Asp Ala Pro Lys Val Asp Leu Leu 2060 2065 2070Val Lys Asn Cys Leu Leu Pro Leu Arg Glu Tyr Phe Lys Tyr Phe 2075 2080 2085Ser Gln Asn Ser Leu Pro Leu Ser Arg Ala Asp Pro Lys Lys Lys 2090 2095 2100Arg Lys Val Gly Ser Gly Ala Thr Asn Phe Ser Leu Leu Lys Gln 2105 2110 2115Ala Gly Asp Val Glu Glu Asn Pro Gly Pro Ser Glu Leu Ile Lys 2120 2125 2130Glu Asn Met His Met Lys Leu Tyr Met Glu Gly Thr Val Asp Asn 2135 2140 2145His His Phe Lys Cys Thr Ser Glu Gly Glu Gly Lys Pro Tyr Glu 2150 2155 2160Gly Thr Gln Thr Met Arg Ile Lys Val Val Glu Gly Gly Pro Leu 2165 2170 2175Pro Phe Ala Phe Asp Ile Leu Ala Thr Ser Phe Leu Tyr Gly Ser 2180 2185 2190Lys Thr Phe Ile Asn His Thr Gln Gly Ile Pro Asp Phe Phe Lys 2195 2200 2205Gln Ser Phe Pro Glu Gly Phe Thr Trp Glu Arg Val Thr Thr Tyr 2210 2215 2220Glu Asp Gly Gly Val Leu Thr Ala Thr Gln Asp Thr Ser Leu Gln 2225 2230 2235Asp Gly Cys Leu Ile Tyr Asn Val Lys Ile Arg Gly Val Asn Phe 2240 2245 2250Thr Ser Asn Gly Pro Val Met Gln Lys Lys Thr Leu Gly Trp Glu 2255 2260 2265Ala Phe Thr Glu Thr Leu Tyr Pro Ala Asp Gly Gly Leu Glu Gly 2270 2275 2280Arg Asn Asp Met Ala Leu Lys Leu Val Gly Gly Ser His Leu Ile 2285 2290 2295Ala Asn Ile Lys Thr Thr Tyr Arg Ser Lys Lys Pro Ala Lys Asn 2300 2305 2310Leu Lys Met Pro Gly Val Tyr Tyr Val Asp Tyr Arg Leu Glu Arg 2315 2320 2325Ile Lys Glu Ala Asn Asn Glu Thr Tyr Val Glu Gln His Glu Val 2330 2335 2340Ala Val Ala Arg Tyr Cys Asp Leu Pro Ser Lys Leu Gly His Lys 2345 2350 2355Leu Asn 236062382PRTArtificial sequenceSynthetic polypeptide 6Asp Ala Lys Ser Leu Thr Ala Trp Ser Arg Thr Leu Val Thr Phe Lys1 5 10 15Asp Val Phe Val Asp Phe Thr Arg Glu Glu Trp Lys Leu Leu Asp Thr 20 25 30Ala Gln Gln Ile Val Tyr Arg Asn Val Met Leu Glu Asn Tyr Lys Asn 35 40 45Leu Val Ser Leu Gly Tyr Gln Leu Thr Lys Pro Asp Val Ile Leu Arg 50 55 60Leu Glu Lys Gly Glu Glu Pro Gly Gly Ser Gly Gly Gly Ser Met Asp65 70 75 80Lys Lys Tyr Ser Ile Gly Leu Ala Ile Gly Thr Asn Ser Val Gly Trp 85 90 95Ala Val Ile Thr Asp Glu Tyr Lys Val Pro Ser Lys Lys Phe Lys Val 100 105 110Leu Gly Asn Thr Asp Arg His Ser Ile Lys Lys Asn Leu Ile Gly Ala 115 120 125Leu Leu Phe Asp Ser Gly Glu Thr Ala Glu Ala Thr Arg Leu Lys Arg 130 135 140Thr Ala Arg Arg Arg Tyr Thr Arg Arg Lys Asn Arg Ile Cys Tyr Leu145 150 155 160Gln Glu Ile Phe Ser Asn Glu Met Ala Lys Val Asp Asp Ser Phe Phe 165 170 175His Arg Leu Glu Glu Ser Phe Leu Val Glu Glu Asp Lys Lys His Glu 180 185 190Arg His Pro Ile Phe Gly Asn Ile Val Asp Glu Val Ala Tyr His Glu 195 200 205Lys Tyr Pro Thr Ile Tyr His Leu Arg Lys Lys Leu Val Asp Ser Thr 210 215 220Asp Lys Ala Asp Leu Arg Leu Ile Tyr Leu Ala Leu Ala His Met Ile225 230 235 240Lys Phe Arg Gly His Phe Leu Ile Glu Gly Asp Leu Asn Pro Asp Asn 245 250 255Ser Asp Val Asp Lys Leu Phe Ile Gln Leu Val Gln Thr Tyr Asn Gln 260 265 270Leu Phe Glu Glu Asn Pro Ile Asn Ala Ser Gly Val Asp Ala Lys Ala 275 280 285Ile Leu Ser Ala Arg Leu Ser Lys Ser Arg Arg Leu Glu Asn Leu Ile 290 295 300Ala Gln Leu Pro Gly Glu Lys Lys Asn Gly Leu Phe Gly Asn Leu Ile305 310 315 320Ala Leu Ser Leu Gly Leu Thr Pro Asn Phe Lys Ser Asn Phe Asp Leu 325 330 335Ala Glu Asp Ala Lys Leu Gln Leu Ser Lys Asp Thr Tyr Asp Asp Asp 340 345 350Leu Asp Asn Leu Leu Ala Gln Ile Gly Asp Gln Tyr Ala Asp Leu Phe 355 360 365Leu Ala Ala Lys Asn Leu Ser Asp Ala Ile Leu Leu Ser Asp Ile Leu 370 375 380Arg Val Asn Thr Glu Ile Thr Lys Ala Pro Leu Ser Ala Ser Met Ile385 390 395 400Lys Arg Tyr Asp Glu His His Gln Asp Leu Thr Leu Leu Lys Ala Leu 405 410 415Val Arg Gln Gln Leu Pro Glu Lys Tyr Lys Glu Ile Phe Phe Asp Gln 420 425 430Ser Lys Asn Gly Tyr Ala Gly Tyr Ile Asp Gly Gly Ala Ser Gln Glu 435 440 445Glu Phe Tyr Lys Phe Ile Lys Pro Ile Leu Glu Lys Met Asp Gly Thr 450 455 460Glu Glu Leu Leu Val Lys Leu Asn Arg Glu Asp Leu Leu Arg Lys Gln465 470 475 480Arg Thr Phe Asp Asn Gly Ser Ile Pro His Gln Ile His Leu Gly Glu 485 490 495Leu His Ala Ile Leu Arg Arg Gln Glu Asp Phe Tyr Pro Phe Leu Lys 500 505 510Asp Asn Arg Glu Lys Ile Glu Lys Ile Leu Thr Phe Arg Ile Pro Tyr 515 520 525Tyr Val Gly Pro Leu Ala Arg Gly Asn Ser Arg Phe Ala Trp Met Thr 530 535 540Arg Lys Ser Glu Glu Thr Ile Thr Pro Trp Asn Phe Glu Glu Val Val545 550 555 560Asp Lys Gly Ala Ser Ala Gln Ser Phe Ile Glu Arg Met Thr Asn Phe 565 570 575Asp Lys Asn Leu Pro Asn Glu Lys Val Leu Pro Lys His Ser Leu Leu 580 585 590Tyr Glu Tyr Phe Thr Val Tyr Asn Glu Leu Thr Lys Val Lys Tyr Val 595 600 605Thr Glu Gly Met Arg Lys Pro Ala Phe Leu Ser Gly Glu Gln Lys Lys 610 615 620Ala Ile Val Asp Leu Leu Phe Lys Thr Asn Arg Lys Val Thr Val Lys625 630 635

640Gln Leu Lys Glu Asp Tyr Phe Lys Lys Ile Glu Cys Phe Asp Ser Val 645 650 655Glu Ile Ser Gly Val Glu Asp Arg Phe Asn Ala Ser Leu Gly Thr Tyr 660 665 670His Asp Leu Leu Lys Ile Ile Lys Asp Lys Asp Phe Leu Asp Asn Glu 675 680 685Glu Asn Glu Asp Ile Leu Glu Asp Ile Val Leu Thr Leu Thr Leu Phe 690 695 700Glu Asp Arg Glu Met Ile Glu Glu Arg Leu Lys Thr Tyr Ala His Leu705 710 715 720Phe Asp Asp Lys Val Met Lys Gln Leu Lys Arg Arg Arg Tyr Thr Gly 725 730 735Trp Gly Arg Leu Ser Arg Lys Leu Ile Asn Gly Ile Arg Asp Lys Gln 740 745 750Ser Gly Lys Thr Ile Leu Asp Phe Leu Lys Ser Asp Gly Phe Ala Asn 755 760 765Arg Asn Phe Met Gln Leu Ile His Asp Asp Ser Leu Thr Phe Lys Glu 770 775 780Asp Ile Gln Lys Ala Gln Val Ser Gly Gln Gly Asp Ser Leu His Glu785 790 795 800His Ile Ala Asn Leu Ala Gly Ser Pro Ala Ile Lys Lys Gly Ile Leu 805 810 815Gln Thr Val Lys Val Val Asp Glu Leu Val Lys Val Met Gly Arg His 820 825 830Lys Pro Glu Asn Ile Val Ile Glu Met Ala Arg Glu Asn Gln Thr Thr 835 840 845Gln Lys Gly Gln Lys Asn Ser Arg Glu Arg Met Lys Arg Ile Glu Glu 850 855 860Gly Ile Lys Glu Leu Gly Ser Gln Ile Leu Lys Glu His Pro Val Glu865 870 875 880Asn Thr Gln Leu Gln Asn Glu Lys Leu Tyr Leu Tyr Tyr Leu Gln Asn 885 890 895Gly Arg Asp Met Tyr Val Asp Gln Glu Leu Asp Ile Asn Arg Leu Ser 900 905 910Asp Tyr Asp Val Asp Ala Ile Val Pro Gln Ser Phe Leu Lys Asp Asp 915 920 925Ser Ile Asp Asn Lys Val Leu Thr Arg Ser Asp Lys Asn Arg Gly Lys 930 935 940Ser Asp Asn Val Pro Ser Glu Glu Val Val Lys Lys Met Lys Asn Tyr945 950 955 960Trp Arg Gln Leu Leu Asn Ala Lys Leu Ile Thr Gln Arg Lys Phe Asp 965 970 975Asn Leu Thr Lys Ala Glu Arg Gly Gly Leu Ser Glu Leu Asp Lys Ala 980 985 990Gly Phe Ile Lys Arg Gln Leu Val Glu Thr Arg Gln Ile Thr Lys His 995 1000 1005Val Ala Gln Ile Leu Asp Ser Arg Met Asn Thr Lys Tyr Asp Glu 1010 1015 1020Asn Asp Lys Leu Ile Arg Glu Val Lys Val Ile Thr Leu Lys Ser 1025 1030 1035Lys Leu Val Ser Asp Phe Arg Lys Asp Phe Gln Phe Tyr Lys Val 1040 1045 1050Arg Glu Ile Asn Asn Tyr His His Ala His Asp Ala Tyr Leu Asn 1055 1060 1065Ala Val Val Gly Thr Ala Leu Ile Lys Lys Tyr Pro Lys Leu Glu 1070 1075 1080Ser Glu Phe Val Tyr Gly Asp Tyr Lys Val Tyr Asp Val Arg Lys 1085 1090 1095Met Ile Ala Lys Ser Glu Gln Glu Ile Gly Lys Ala Thr Ala Lys 1100 1105 1110Tyr Phe Phe Tyr Ser Asn Ile Met Asn Phe Phe Lys Thr Glu Ile 1115 1120 1125Thr Leu Ala Asn Gly Glu Ile Arg Lys Arg Pro Leu Ile Glu Thr 1130 1135 1140Asn Gly Glu Thr Gly Glu Ile Val Trp Asp Lys Gly Arg Asp Phe 1145 1150 1155Ala Thr Val Arg Lys Val Leu Ser Met Pro Gln Val Asn Ile Val 1160 1165 1170Lys Lys Thr Glu Val Gln Thr Gly Gly Phe Ser Lys Glu Ser Ile 1175 1180 1185Leu Pro Lys Arg Asn Ser Asp Lys Leu Ile Ala Arg Lys Lys Asp 1190 1195 1200Trp Asp Pro Lys Lys Tyr Gly Gly Phe Asp Ser Pro Thr Val Ala 1205 1210 1215Tyr Ser Val Leu Val Val Ala Lys Val Glu Lys Gly Lys Ser Lys 1220 1225 1230Lys Leu Lys Ser Val Lys Glu Leu Leu Gly Ile Thr Ile Met Glu 1235 1240 1245Arg Ser Ser Phe Glu Lys Asn Pro Ile Asp Phe Leu Glu Ala Lys 1250 1255 1260Gly Tyr Lys Glu Val Lys Lys Asp Leu Ile Ile Lys Leu Pro Lys 1265 1270 1275Tyr Ser Leu Phe Glu Leu Glu Asn Gly Arg Lys Arg Met Leu Ala 1280 1285 1290Ser Ala Gly Glu Leu Gln Lys Gly Asn Glu Leu Ala Leu Pro Ser 1295 1300 1305Lys Tyr Val Asn Phe Leu Tyr Leu Ala Ser His Tyr Glu Lys Leu 1310 1315 1320Lys Gly Ser Pro Glu Asp Asn Glu Gln Lys Gln Leu Phe Val Glu 1325 1330 1335Gln His Lys His Tyr Leu Asp Glu Ile Ile Glu Gln Ile Ser Glu 1340 1345 1350Phe Ser Lys Arg Val Ile Leu Ala Asp Ala Asn Leu Asp Lys Val 1355 1360 1365Leu Ser Ala Tyr Asn Lys His Arg Asp Lys Pro Ile Arg Glu Gln 1370 1375 1380Ala Glu Asn Ile Ile His Leu Phe Thr Leu Thr Asn Leu Gly Ala 1385 1390 1395Pro Ala Ala Phe Lys Tyr Phe Asp Thr Thr Ile Asp Arg Lys Arg 1400 1405 1410Tyr Thr Ser Thr Lys Glu Val Leu Asp Ala Thr Leu Ile His Gln 1415 1420 1425Ser Ile Thr Gly Leu Tyr Glu Thr Arg Ile Asp Leu Ser Gln Leu 1430 1435 1440Gly Gly Asp Ser Arg Ala Asp Tyr Pro Tyr Asp Val Pro Asp Tyr 1445 1450 1455Ala Ser Gly Ser Pro Lys Lys Lys Arg Lys Val Ser Pro Gly Gly 1460 1465 1470Gly Pro Ser Ser Gly Ala Pro Pro Pro Ser Gly Gly Ser Pro Ala 1475 1480 1485Gly Ser Pro Thr Ser Thr Glu Glu Gly Thr Ser Glu Ser Ala Thr 1490 1495 1500Pro Glu Ser Gly Pro Gly Thr Ser Thr Glu Pro Ser Glu Gly Ser 1505 1510 1515Ala Pro Gly Ser Pro Ala Gly Ser Pro Thr Ser Thr Glu Glu Gly 1520 1525 1530Thr Ser Thr Glu Pro Ser Glu Gly Ser Ala Pro Gly Thr Ser Thr 1535 1540 1545Glu Pro Ser Glu Asn His Asp Gln Glu Phe Asp Pro Pro Lys Val 1550 1555 1560Tyr Pro Pro Val Pro Ala Glu Lys Arg Lys Pro Ile Arg Val Leu 1565 1570 1575Ser Leu Phe Asp Gly Ile Ala Thr Gly Leu Leu Val Leu Lys Asp 1580 1585 1590Leu Gly Ile Gln Val Asp Arg Tyr Ile Ala Ser Glu Val Cys Glu 1595 1600 1605Asp Ser Ile Thr Val Gly Met Val Arg His Gln Gly Lys Ile Met 1610 1615 1620Tyr Val Gly Asp Val Arg Ser Val Thr Gln Lys His Ile Gln Glu 1625 1630 1635Trp Gly Pro Phe Asp Leu Val Ile Gly Gly Ser Pro Cys Asn Asp 1640 1645 1650Leu Ser Ile Val Asn Pro Ala Arg Lys Gly Leu Tyr Glu Gly Thr 1655 1660 1665Gly Arg Leu Phe Phe Glu Phe Tyr Arg Leu Leu His Asp Ala Arg 1670 1675 1680Pro Lys Glu Gly Asp Asp Arg Pro Phe Phe Trp Leu Phe Glu Asn 1685 1690 1695Val Val Ala Met Gly Val Ser Asp Lys Arg Asp Ile Ser Arg Phe 1700 1705 1710Leu Glu Ser Asn Pro Val Met Ile Asp Ala Lys Glu Val Ser Ala 1715 1720 1725Ala His Arg Ala Arg Tyr Phe Trp Gly Asn Leu Pro Gly Met Asn 1730 1735 1740Arg Pro Leu Ala Ser Thr Val Asn Asp Lys Leu Glu Leu Gln Glu 1745 1750 1755Cys Leu Glu His Gly Arg Ile Ala Lys Phe Ser Lys Val Arg Thr 1760 1765 1770Ile Thr Thr Arg Ser Asn Ser Ile Lys Gln Gly Lys Asp Gln His 1775 1780 1785Phe Pro Val Phe Met Asn Glu Lys Glu Asp Ile Leu Trp Cys Thr 1790 1795 1800Glu Met Glu Arg Val Phe Gly Phe Pro Val His Tyr Thr Asp Val 1805 1810 1815Ser Asn Met Ser Arg Leu Ala Arg Gln Arg Leu Leu Gly Arg Ser 1820 1825 1830Trp Ser Val Pro Val Ile Arg His Leu Phe Ala Pro Leu Lys Glu 1835 1840 1845Tyr Phe Ala Cys Val Ser Ser Gly Asn Ser Asn Ala Asn Ser Arg 1850 1855 1860Gly Pro Ser Phe Ser Ser Gly Leu Val Pro Leu Ser Leu Arg Gly 1865 1870 1875Ser His Met Gly Pro Met Glu Ile Tyr Lys Thr Val Ser Ala Trp 1880 1885 1890Lys Arg Gln Pro Val Arg Val Leu Ser Leu Phe Arg Asn Ile Asp 1895 1900 1905Lys Val Leu Lys Ser Leu Gly Phe Leu Glu Ser Gly Ser Gly Ser 1910 1915 1920Gly Gly Gly Thr Leu Lys Tyr Val Glu Asp Val Thr Asn Val Val 1925 1930 1935Arg Arg Asp Val Glu Lys Trp Gly Pro Phe Asp Leu Val Tyr Gly 1940 1945 1950Ser Thr Gln Pro Leu Gly Ser Ser Cys Asp Arg Cys Pro Gly Trp 1955 1960 1965Tyr Met Phe Gln Phe His Arg Ile Leu Gln Tyr Ala Leu Pro Arg 1970 1975 1980Gln Glu Ser Gln Arg Pro Phe Phe Trp Ile Phe Met Asp Asn Leu 1985 1990 1995Leu Leu Thr Glu Asp Asp Gln Glu Thr Thr Thr Arg Phe Leu Gln 2000 2005 2010Thr Glu Ala Val Thr Leu Gln Asp Val Arg Gly Arg Asp Tyr Gln 2015 2020 2025Asn Ala Met Arg Val Trp Ser Asn Ile Pro Gly Leu Lys Ser Lys 2030 2035 2040His Ala Pro Leu Thr Pro Lys Glu Glu Glu Tyr Leu Gln Ala Gln 2045 2050 2055Val Arg Ser Arg Ser Lys Leu Asp Ala Pro Lys Val Asp Leu Leu 2060 2065 2070Val Lys Asn Cys Leu Leu Pro Leu Arg Glu Tyr Phe Lys Tyr Phe 2075 2080 2085Ser Gln Asn Ser Leu Pro Leu Ser Arg Ala Asp Pro Lys Lys Lys 2090 2095 2100Arg Lys Val Gly Ser Gly Ala Thr Asn Phe Ser Leu Leu Lys Gln 2105 2110 2115Ala Gly Asp Val Glu Glu Asn Pro Gly Pro Gly Ser Gly Ala Thr 2120 2125 2130Asn Phe Ser Leu Leu Lys Gln Ala Gly Asp Val Glu Glu Asn Pro 2135 2140 2145Gly Pro Ser Glu Leu Ile Lys Glu Asn Met His Met Lys Leu Tyr 2150 2155 2160Met Glu Gly Thr Val Asp Asn His His Phe Lys Cys Thr Ser Glu 2165 2170 2175Gly Glu Gly Lys Pro Tyr Glu Gly Thr Gln Thr Met Arg Ile Lys 2180 2185 2190Val Val Glu Gly Gly Pro Leu Pro Phe Ala Phe Asp Ile Leu Ala 2195 2200 2205Thr Ser Phe Leu Tyr Gly Ser Lys Thr Phe Ile Asn His Thr Gln 2210 2215 2220Gly Ile Pro Asp Phe Phe Lys Gln Ser Phe Pro Glu Gly Phe Thr 2225 2230 2235Trp Glu Arg Val Thr Thr Tyr Glu Asp Gly Gly Val Leu Thr Ala 2240 2245 2250Thr Gln Asp Thr Ser Leu Gln Asp Gly Cys Leu Ile Tyr Asn Val 2255 2260 2265Lys Ile Arg Gly Val Asn Phe Thr Ser Asn Gly Pro Val Met Gln 2270 2275 2280Lys Lys Thr Leu Gly Trp Glu Ala Phe Thr Glu Thr Leu Tyr Pro 2285 2290 2295Ala Asp Gly Gly Leu Glu Gly Arg Asn Asp Met Ala Leu Lys Leu 2300 2305 2310Val Gly Gly Ser His Leu Ile Ala Asn Ile Lys Thr Thr Tyr Arg 2315 2320 2325Ser Lys Lys Pro Ala Lys Asn Leu Lys Met Pro Gly Val Tyr Tyr 2330 2335 2340Val Asp Tyr Arg Leu Glu Arg Ile Lys Glu Ala Asn Asn Glu Thr 2345 2350 2355Tyr Val Glu Gln His Glu Val Ala Val Ala Arg Tyr Cys Asp Leu 2360 2365 2370Pro Ser Lys Leu Gly His Lys Leu Asn 2375 238072303PRTArtificial sequenceSynthetic polypeptide 7Asp Ala Lys Ser Leu Thr Ala Trp Ser Arg Thr Leu Val Thr Phe Lys1 5 10 15Asp Val Phe Val Asp Phe Thr Arg Glu Glu Trp Lys Leu Leu Asp Thr 20 25 30Ala Gln Gln Ile Val Tyr Arg Asn Val Met Leu Glu Asn Tyr Lys Asn 35 40 45Leu Val Ser Leu Gly Tyr Gln Leu Thr Lys Pro Asp Val Ile Leu Arg 50 55 60Leu Glu Lys Gly Glu Glu Pro Ser Gly Ser Glu Thr Pro Gly Thr Ser65 70 75 80Glu Ser Ala Thr Pro Glu Ser Met Asp Lys Lys Tyr Ser Ile Gly Leu 85 90 95Ala Ile Gly Thr Asn Ser Val Gly Trp Ala Val Ile Thr Asp Glu Tyr 100 105 110Lys Val Pro Ser Lys Lys Phe Lys Val Leu Gly Asn Thr Asp Arg His 115 120 125Ser Ile Lys Lys Asn Leu Ile Gly Ala Leu Leu Phe Asp Ser Gly Glu 130 135 140Thr Ala Glu Ala Thr Arg Leu Lys Arg Thr Ala Arg Arg Arg Tyr Thr145 150 155 160Arg Arg Lys Asn Arg Ile Cys Tyr Leu Gln Glu Ile Phe Ser Asn Glu 165 170 175Met Ala Lys Val Asp Asp Ser Phe Phe His Arg Leu Glu Glu Ser Phe 180 185 190Leu Val Glu Glu Asp Lys Lys His Glu Arg His Pro Ile Phe Gly Asn 195 200 205Ile Val Asp Glu Val Ala Tyr His Glu Lys Tyr Pro Thr Ile Tyr His 210 215 220Leu Arg Lys Lys Leu Val Asp Ser Thr Asp Lys Ala Asp Leu Arg Leu225 230 235 240Ile Tyr Leu Ala Leu Ala His Met Ile Lys Phe Arg Gly His Phe Leu 245 250 255Ile Glu Gly Asp Leu Asn Pro Asp Asn Ser Asp Val Asp Lys Leu Phe 260 265 270Ile Gln Leu Val Gln Thr Tyr Asn Gln Leu Phe Glu Glu Asn Pro Ile 275 280 285Asn Ala Ser Gly Val Asp Ala Lys Ala Ile Leu Ser Ala Arg Leu Ser 290 295 300Lys Ser Arg Arg Leu Glu Asn Leu Ile Ala Gln Leu Pro Gly Glu Lys305 310 315 320Lys Asn Gly Leu Phe Gly Asn Leu Ile Ala Leu Ser Leu Gly Leu Thr 325 330 335Pro Asn Phe Lys Ser Asn Phe Asp Leu Ala Glu Asp Ala Lys Leu Gln 340 345 350Leu Ser Lys Asp Thr Tyr Asp Asp Asp Leu Asp Asn Leu Leu Ala Gln 355 360 365Ile Gly Asp Gln Tyr Ala Asp Leu Phe Leu Ala Ala Lys Asn Leu Ser 370 375 380Asp Ala Ile Leu Leu Ser Asp Ile Leu Arg Val Asn Thr Glu Ile Thr385 390 395 400Lys Ala Pro Leu Ser Ala Ser Met Ile Lys Arg Tyr Asp Glu His His 405 410 415Gln Asp Leu Thr Leu Leu Lys Ala Leu Val Arg Gln Gln Leu Pro Glu 420 425 430Lys Tyr Lys Glu Ile Phe Phe Asp Gln Ser Lys Asn Gly Tyr Ala Gly 435 440 445Tyr Ile Asp Gly Gly Ala Ser Gln Glu Glu Phe Tyr Lys Phe Ile Lys 450 455 460Pro Ile Leu Glu Lys Met Asp Gly Thr Glu Glu Leu Leu Val Lys Leu465 470 475 480Asn Arg Glu Asp Leu Leu Arg Lys Gln Arg Thr Phe Asp Asn Gly Ser 485 490 495Ile Pro His Gln Ile His Leu Gly Glu Leu His Ala Ile Leu Arg Arg 500 505 510Gln Glu Asp Phe Tyr Pro Phe Leu Lys Asp Asn Arg Glu Lys Ile Glu 515 520 525Lys Ile Leu Thr Phe Arg Ile Pro Tyr Tyr Val Gly Pro Leu Ala Arg 530 535 540Gly Asn Ser Arg Phe Ala Trp Met Thr Arg Lys Ser Glu Glu Thr Ile545 550 555 560Thr Pro Trp Asn Phe Glu Glu Val Val Asp Lys Gly Ala Ser Ala Gln 565 570 575Ser Phe Ile Glu Arg Met Thr Asn Phe Asp Lys Asn Leu Pro Asn Glu 580 585 590Lys Val Leu Pro Lys His Ser Leu Leu Tyr Glu Tyr Phe Thr Val Tyr 595 600 605Asn Glu Leu Thr Lys Val Lys Tyr Val Thr Glu Gly Met Arg Lys Pro 610 615 620Ala Phe Leu Ser Gly Glu Gln Lys Lys Ala Ile Val Asp Leu Leu Phe625 630 635 640Lys Thr Asn Arg Lys Val Thr Val Lys Gln Leu Lys Glu Asp Tyr Phe 645 650 655Lys Lys Ile Glu Cys Phe Asp Ser Val Glu Ile Ser Gly Val Glu Asp 660 665 670Arg Phe Asn Ala Ser Leu Gly Thr Tyr His Asp Leu Leu Lys Ile Ile 675 680 685Lys Asp Lys Asp Phe Leu Asp Asn Glu Glu Asn Glu Asp Ile Leu Glu 690 695

700Asp Ile Val Leu Thr Leu Thr Leu Phe Glu Asp Arg Glu Met Ile Glu705 710 715 720Glu Arg Leu Lys Thr Tyr Ala His Leu Phe Asp Asp Lys Val Met Lys 725 730 735Gln Leu Lys Arg Arg Arg Tyr Thr Gly Trp Gly Arg Leu Ser Arg Lys 740 745 750Leu Ile Asn Gly Ile Arg Asp Lys Gln Ser Gly Lys Thr Ile Leu Asp 755 760 765Phe Leu Lys Ser Asp Gly Phe Ala Asn Arg Asn Phe Met Gln Leu Ile 770 775 780His Asp Asp Ser Leu Thr Phe Lys Glu Asp Ile Gln Lys Ala Gln Val785 790 795 800Ser Gly Gln Gly Asp Ser Leu His Glu His Ile Ala Asn Leu Ala Gly 805 810 815Ser Pro Ala Ile Lys Lys Gly Ile Leu Gln Thr Val Lys Val Val Asp 820 825 830Glu Leu Val Lys Val Met Gly Arg His Lys Pro Glu Asn Ile Val Ile 835 840 845Glu Met Ala Arg Glu Asn Gln Thr Thr Gln Lys Gly Gln Lys Asn Ser 850 855 860Arg Glu Arg Met Lys Arg Ile Glu Glu Gly Ile Lys Glu Leu Gly Ser865 870 875 880Gln Ile Leu Lys Glu His Pro Val Glu Asn Thr Gln Leu Gln Asn Glu 885 890 895Lys Leu Tyr Leu Tyr Tyr Leu Gln Asn Gly Arg Asp Met Tyr Val Asp 900 905 910Gln Glu Leu Asp Ile Asn Arg Leu Ser Asp Tyr Asp Val Asp Ala Ile 915 920 925Val Pro Gln Ser Phe Leu Lys Asp Asp Ser Ile Asp Asn Lys Val Leu 930 935 940Thr Arg Ser Asp Lys Asn Arg Gly Lys Ser Asp Asn Val Pro Ser Glu945 950 955 960Glu Val Val Lys Lys Met Lys Asn Tyr Trp Arg Gln Leu Leu Asn Ala 965 970 975Lys Leu Ile Thr Gln Arg Lys Phe Asp Asn Leu Thr Lys Ala Glu Arg 980 985 990Gly Gly Leu Ser Glu Leu Asp Lys Ala Gly Phe Ile Lys Arg Gln Leu 995 1000 1005Val Glu Thr Arg Gln Ile Thr Lys His Val Ala Gln Ile Leu Asp 1010 1015 1020Ser Arg Met Asn Thr Lys Tyr Asp Glu Asn Asp Lys Leu Ile Arg 1025 1030 1035Glu Val Lys Val Ile Thr Leu Lys Ser Lys Leu Val Ser Asp Phe 1040 1045 1050Arg Lys Asp Phe Gln Phe Tyr Lys Val Arg Glu Ile Asn Asn Tyr 1055 1060 1065His His Ala His Asp Ala Tyr Leu Asn Ala Val Val Gly Thr Ala 1070 1075 1080Leu Ile Lys Lys Tyr Pro Lys Leu Glu Ser Glu Phe Val Tyr Gly 1085 1090 1095Asp Tyr Lys Val Tyr Asp Val Arg Lys Met Ile Ala Lys Ser Glu 1100 1105 1110Gln Glu Ile Gly Lys Ala Thr Ala Lys Tyr Phe Phe Tyr Ser Asn 1115 1120 1125Ile Met Asn Phe Phe Lys Thr Glu Ile Thr Leu Ala Asn Gly Glu 1130 1135 1140Ile Arg Lys Arg Pro Leu Ile Glu Thr Asn Gly Glu Thr Gly Glu 1145 1150 1155Ile Val Trp Asp Lys Gly Arg Asp Phe Ala Thr Val Arg Lys Val 1160 1165 1170Leu Ser Met Pro Gln Val Asn Ile Val Lys Lys Thr Glu Val Gln 1175 1180 1185Thr Gly Gly Phe Ser Lys Glu Ser Ile Leu Pro Lys Arg Asn Ser 1190 1195 1200Asp Lys Leu Ile Ala Arg Lys Lys Asp Trp Asp Pro Lys Lys Tyr 1205 1210 1215Gly Gly Phe Asp Ser Pro Thr Val Ala Tyr Ser Val Leu Val Val 1220 1225 1230Ala Lys Val Glu Lys Gly Lys Ser Lys Lys Leu Lys Ser Val Lys 1235 1240 1245Glu Leu Leu Gly Ile Thr Ile Met Glu Arg Ser Ser Phe Glu Lys 1250 1255 1260Asn Pro Ile Asp Phe Leu Glu Ala Lys Gly Tyr Lys Glu Val Lys 1265 1270 1275Lys Asp Leu Ile Ile Lys Leu Pro Lys Tyr Ser Leu Phe Glu Leu 1280 1285 1290Glu Asn Gly Arg Lys Arg Met Leu Ala Ser Ala Gly Glu Leu Gln 1295 1300 1305Lys Gly Asn Glu Leu Ala Leu Pro Ser Lys Tyr Val Asn Phe Leu 1310 1315 1320Tyr Leu Ala Ser His Tyr Glu Lys Leu Lys Gly Ser Pro Glu Asp 1325 1330 1335Asn Glu Gln Lys Gln Leu Phe Val Glu Gln His Lys His Tyr Leu 1340 1345 1350Asp Glu Ile Ile Glu Gln Ile Ser Glu Phe Ser Lys Arg Val Ile 1355 1360 1365Leu Ala Asp Ala Asn Leu Asp Lys Val Leu Ser Ala Tyr Asn Lys 1370 1375 1380His Arg Asp Lys Pro Ile Arg Glu Gln Ala Glu Asn Ile Ile His 1385 1390 1395Leu Phe Thr Leu Thr Asn Leu Gly Ala Pro Ala Ala Phe Lys Tyr 1400 1405 1410Phe Asp Thr Thr Ile Asp Arg Lys Arg Tyr Thr Ser Thr Lys Glu 1415 1420 1425Val Leu Asp Ala Thr Leu Ile His Gln Ser Ile Thr Gly Leu Tyr 1430 1435 1440Glu Thr Arg Ile Asp Leu Ser Gln Leu Gly Gly Asp Ser Arg Ala 1445 1450 1455Asp Tyr Pro Tyr Asp Val Pro Asp Tyr Ala Ser Gly Ser Pro Lys 1460 1465 1470Lys Lys Arg Lys Val Glu Ala Ser Gly Ser Gly Arg Ala Ser Pro 1475 1480 1485Gly Ile Pro Gly Ser Thr Arg Asn His Asp Gln Glu Phe Asp Pro 1490 1495 1500Pro Lys Val Tyr Pro Pro Val Pro Ala Glu Lys Arg Lys Pro Ile 1505 1510 1515Arg Val Leu Ser Leu Phe Asp Gly Ile Ala Thr Gly Leu Leu Val 1520 1525 1530Leu Lys Asp Leu Gly Ile Gln Val Asp Arg Tyr Ile Ala Ser Glu 1535 1540 1545Val Cys Glu Asp Ser Ile Thr Val Gly Met Val Arg His Gln Gly 1550 1555 1560Lys Ile Met Tyr Val Gly Asp Val Arg Ser Val Thr Gln Lys His 1565 1570 1575Ile Gln Glu Trp Gly Pro Phe Asp Leu Val Ile Gly Gly Ser Pro 1580 1585 1590Cys Asn Asp Leu Ser Ile Val Asn Pro Ala Arg Lys Gly Leu Tyr 1595 1600 1605Glu Gly Thr Gly Arg Leu Phe Phe Glu Phe Tyr Arg Leu Leu His 1610 1615 1620Asp Ala Arg Pro Lys Glu Gly Asp Asp Arg Pro Phe Phe Trp Leu 1625 1630 1635Phe Glu Asn Val Val Ala Met Gly Val Ser Asp Lys Arg Asp Ile 1640 1645 1650Ser Arg Phe Leu Glu Ser Asn Pro Val Met Ile Asp Ala Lys Glu 1655 1660 1665Val Ser Ala Ala His Arg Ala Arg Tyr Phe Trp Gly Asn Leu Pro 1670 1675 1680Gly Met Asn Arg Pro Leu Ala Ser Thr Val Asn Asp Lys Leu Glu 1685 1690 1695Leu Gln Glu Cys Leu Glu His Gly Arg Ile Ala Lys Phe Ser Lys 1700 1705 1710Val Arg Thr Ile Thr Thr Arg Ser Asn Ser Ile Lys Gln Gly Lys 1715 1720 1725Asp Gln His Phe Pro Val Phe Met Asn Glu Lys Glu Asp Ile Leu 1730 1735 1740Trp Cys Thr Glu Met Glu Arg Val Phe Gly Phe Pro Val His Tyr 1745 1750 1755Thr Asp Val Ser Asn Met Ser Arg Leu Ala Arg Gln Arg Leu Leu 1760 1765 1770Gly Arg Ser Trp Ser Val Pro Val Ile Arg His Leu Phe Ala Pro 1775 1780 1785Leu Lys Glu Tyr Phe Ala Cys Val Ser Ser Gly Asn Ser Asn Ala 1790 1795 1800Asn Ser Arg Gly Pro Ser Phe Ser Ser Gly Leu Val Pro Leu Ser 1805 1810 1815Leu Arg Gly Ser His Met Gly Pro Met Glu Ile Tyr Lys Thr Val 1820 1825 1830Ser Ala Trp Lys Arg Gln Pro Val Arg Val Leu Ser Leu Phe Arg 1835 1840 1845Asn Ile Asp Lys Val Leu Lys Ser Leu Gly Phe Leu Glu Ser Gly 1850 1855 1860Ser Gly Ser Gly Gly Gly Thr Leu Lys Tyr Val Glu Asp Val Thr 1865 1870 1875Asn Val Val Arg Arg Asp Val Glu Lys Trp Gly Pro Phe Asp Leu 1880 1885 1890Val Tyr Gly Ser Thr Gln Pro Leu Gly Ser Ser Cys Asp Arg Cys 1895 1900 1905Pro Gly Trp Tyr Met Phe Gln Phe His Arg Ile Leu Gln Tyr Ala 1910 1915 1920Leu Pro Arg Gln Glu Ser Gln Arg Pro Phe Phe Trp Ile Phe Met 1925 1930 1935Asp Asn Leu Leu Leu Thr Glu Asp Asp Gln Glu Thr Thr Thr Arg 1940 1945 1950Phe Leu Gln Thr Glu Ala Val Thr Leu Gln Asp Val Arg Gly Arg 1955 1960 1965Asp Tyr Gln Asn Ala Met Arg Val Trp Ser Asn Ile Pro Gly Leu 1970 1975 1980Lys Ser Lys His Ala Pro Leu Thr Pro Lys Glu Glu Glu Tyr Leu 1985 1990 1995Gln Ala Gln Val Arg Ser Arg Ser Lys Leu Asp Ala Pro Lys Val 2000 2005 2010Asp Leu Leu Val Lys Asn Cys Leu Leu Pro Leu Arg Glu Tyr Phe 2015 2020 2025Lys Tyr Phe Ser Gln Asn Ser Leu Pro Leu Ser Arg Ala Asp Pro 2030 2035 2040Lys Lys Lys Arg Lys Val Gly Ser Gly Ala Thr Asn Phe Ser Leu 2045 2050 2055Leu Lys Gln Ala Gly Asp Val Glu Glu Asn Pro Gly Pro Ser Glu 2060 2065 2070Leu Ile Lys Glu Asn Met His Met Lys Leu Tyr Met Glu Gly Thr 2075 2080 2085Val Asp Asn His His Phe Lys Cys Thr Ser Glu Gly Glu Gly Lys 2090 2095 2100Pro Tyr Glu Gly Thr Gln Thr Met Arg Ile Lys Val Val Glu Gly 2105 2110 2115Gly Pro Leu Pro Phe Ala Phe Asp Ile Leu Ala Thr Ser Phe Leu 2120 2125 2130Tyr Gly Ser Lys Thr Phe Ile Asn His Thr Gln Gly Ile Pro Asp 2135 2140 2145Phe Phe Lys Gln Ser Phe Pro Glu Gly Phe Thr Trp Glu Arg Val 2150 2155 2160Thr Thr Tyr Glu Asp Gly Gly Val Leu Thr Ala Thr Gln Asp Thr 2165 2170 2175Ser Leu Gln Asp Gly Cys Leu Ile Tyr Asn Val Lys Ile Arg Gly 2180 2185 2190Val Asn Phe Thr Ser Asn Gly Pro Val Met Gln Lys Lys Thr Leu 2195 2200 2205Gly Trp Glu Ala Phe Thr Glu Thr Leu Tyr Pro Ala Asp Gly Gly 2210 2215 2220Leu Glu Gly Arg Asn Asp Met Ala Leu Lys Leu Val Gly Gly Ser 2225 2230 2235His Leu Ile Ala Asn Ile Lys Thr Thr Tyr Arg Ser Lys Lys Pro 2240 2245 2250Ala Lys Asn Leu Lys Met Pro Gly Val Tyr Tyr Val Asp Tyr Arg 2255 2260 2265Leu Glu Arg Ile Lys Glu Ala Asn Asn Glu Thr Tyr Val Glu Gln 2270 2275 2280His Glu Val Ala Val Ala Arg Tyr Cys Asp Leu Pro Ser Lys Leu 2285 2290 2295Gly His Lys Leu Asn 230082325PRTArtificial sequenceSynthetic polypeptide 8Asp Ala Lys Ser Leu Thr Ala Trp Ser Arg Thr Leu Val Thr Phe Lys1 5 10 15Asp Val Phe Val Asp Phe Thr Arg Glu Glu Trp Lys Leu Leu Asp Thr 20 25 30Ala Gln Gln Ile Val Tyr Arg Asn Val Met Leu Glu Asn Tyr Lys Asn 35 40 45Leu Val Ser Leu Gly Tyr Gln Leu Thr Lys Pro Asp Val Ile Leu Arg 50 55 60Leu Glu Lys Gly Glu Glu Pro Ser Gly Ser Glu Thr Pro Gly Thr Ser65 70 75 80Glu Ser Ala Thr Pro Glu Ser Met Asp Lys Lys Tyr Ser Ile Gly Leu 85 90 95Ala Ile Gly Thr Asn Ser Val Gly Trp Ala Val Ile Thr Asp Glu Tyr 100 105 110Lys Val Pro Ser Lys Lys Phe Lys Val Leu Gly Asn Thr Asp Arg His 115 120 125Ser Ile Lys Lys Asn Leu Ile Gly Ala Leu Leu Phe Asp Ser Gly Glu 130 135 140Thr Ala Glu Ala Thr Arg Leu Lys Arg Thr Ala Arg Arg Arg Tyr Thr145 150 155 160Arg Arg Lys Asn Arg Ile Cys Tyr Leu Gln Glu Ile Phe Ser Asn Glu 165 170 175Met Ala Lys Val Asp Asp Ser Phe Phe His Arg Leu Glu Glu Ser Phe 180 185 190Leu Val Glu Glu Asp Lys Lys His Glu Arg His Pro Ile Phe Gly Asn 195 200 205Ile Val Asp Glu Val Ala Tyr His Glu Lys Tyr Pro Thr Ile Tyr His 210 215 220Leu Arg Lys Lys Leu Val Asp Ser Thr Asp Lys Ala Asp Leu Arg Leu225 230 235 240Ile Tyr Leu Ala Leu Ala His Met Ile Lys Phe Arg Gly His Phe Leu 245 250 255Ile Glu Gly Asp Leu Asn Pro Asp Asn Ser Asp Val Asp Lys Leu Phe 260 265 270Ile Gln Leu Val Gln Thr Tyr Asn Gln Leu Phe Glu Glu Asn Pro Ile 275 280 285Asn Ala Ser Gly Val Asp Ala Lys Ala Ile Leu Ser Ala Arg Leu Ser 290 295 300Lys Ser Arg Arg Leu Glu Asn Leu Ile Ala Gln Leu Pro Gly Glu Lys305 310 315 320Lys Asn Gly Leu Phe Gly Asn Leu Ile Ala Leu Ser Leu Gly Leu Thr 325 330 335Pro Asn Phe Lys Ser Asn Phe Asp Leu Ala Glu Asp Ala Lys Leu Gln 340 345 350Leu Ser Lys Asp Thr Tyr Asp Asp Asp Leu Asp Asn Leu Leu Ala Gln 355 360 365Ile Gly Asp Gln Tyr Ala Asp Leu Phe Leu Ala Ala Lys Asn Leu Ser 370 375 380Asp Ala Ile Leu Leu Ser Asp Ile Leu Arg Val Asn Thr Glu Ile Thr385 390 395 400Lys Ala Pro Leu Ser Ala Ser Met Ile Lys Arg Tyr Asp Glu His His 405 410 415Gln Asp Leu Thr Leu Leu Lys Ala Leu Val Arg Gln Gln Leu Pro Glu 420 425 430Lys Tyr Lys Glu Ile Phe Phe Asp Gln Ser Lys Asn Gly Tyr Ala Gly 435 440 445Tyr Ile Asp Gly Gly Ala Ser Gln Glu Glu Phe Tyr Lys Phe Ile Lys 450 455 460Pro Ile Leu Glu Lys Met Asp Gly Thr Glu Glu Leu Leu Val Lys Leu465 470 475 480Asn Arg Glu Asp Leu Leu Arg Lys Gln Arg Thr Phe Asp Asn Gly Ser 485 490 495Ile Pro His Gln Ile His Leu Gly Glu Leu His Ala Ile Leu Arg Arg 500 505 510Gln Glu Asp Phe Tyr Pro Phe Leu Lys Asp Asn Arg Glu Lys Ile Glu 515 520 525Lys Ile Leu Thr Phe Arg Ile Pro Tyr Tyr Val Gly Pro Leu Ala Arg 530 535 540Gly Asn Ser Arg Phe Ala Trp Met Thr Arg Lys Ser Glu Glu Thr Ile545 550 555 560Thr Pro Trp Asn Phe Glu Glu Val Val Asp Lys Gly Ala Ser Ala Gln 565 570 575Ser Phe Ile Glu Arg Met Thr Asn Phe Asp Lys Asn Leu Pro Asn Glu 580 585 590Lys Val Leu Pro Lys His Ser Leu Leu Tyr Glu Tyr Phe Thr Val Tyr 595 600 605Asn Glu Leu Thr Lys Val Lys Tyr Val Thr Glu Gly Met Arg Lys Pro 610 615 620Ala Phe Leu Ser Gly Glu Gln Lys Lys Ala Ile Val Asp Leu Leu Phe625 630 635 640Lys Thr Asn Arg Lys Val Thr Val Lys Gln Leu Lys Glu Asp Tyr Phe 645 650 655Lys Lys Ile Glu Cys Phe Asp Ser Val Glu Ile Ser Gly Val Glu Asp 660 665 670Arg Phe Asn Ala Ser Leu Gly Thr Tyr His Asp Leu Leu Lys Ile Ile 675 680 685Lys Asp Lys Asp Phe Leu Asp Asn Glu Glu Asn Glu Asp Ile Leu Glu 690 695 700Asp Ile Val Leu Thr Leu Thr Leu Phe Glu Asp Arg Glu Met Ile Glu705 710 715 720Glu Arg Leu Lys Thr Tyr Ala His Leu Phe Asp Asp Lys Val Met Lys 725 730 735Gln Leu Lys Arg Arg Arg Tyr Thr Gly Trp Gly Arg Leu Ser Arg Lys 740 745 750Leu Ile Asn Gly Ile Arg Asp Lys Gln Ser Gly Lys Thr Ile Leu Asp 755 760 765Phe Leu Lys Ser Asp Gly Phe Ala Asn Arg Asn Phe Met Gln Leu Ile 770 775 780His Asp Asp Ser Leu Thr Phe Lys Glu Asp Ile Gln Lys Ala Gln Val785 790 795 800Ser Gly Gln Gly Asp Ser Leu His Glu His Ile Ala Asn Leu Ala Gly 805 810 815Ser Pro Ala Ile Lys Lys Gly Ile Leu Gln Thr Val Lys Val Val Asp 820 825 830Glu Leu Val Lys Val Met Gly Arg His Lys Pro Glu Asn Ile Val Ile 835 840 845Glu

Met Ala Arg Glu Asn Gln Thr Thr Gln Lys Gly Gln Lys Asn Ser 850 855 860Arg Glu Arg Met Lys Arg Ile Glu Glu Gly Ile Lys Glu Leu Gly Ser865 870 875 880Gln Ile Leu Lys Glu His Pro Val Glu Asn Thr Gln Leu Gln Asn Glu 885 890 895Lys Leu Tyr Leu Tyr Tyr Leu Gln Asn Gly Arg Asp Met Tyr Val Asp 900 905 910Gln Glu Leu Asp Ile Asn Arg Leu Ser Asp Tyr Asp Val Asp Ala Ile 915 920 925Val Pro Gln Ser Phe Leu Lys Asp Asp Ser Ile Asp Asn Lys Val Leu 930 935 940Thr Arg Ser Asp Lys Asn Arg Gly Lys Ser Asp Asn Val Pro Ser Glu945 950 955 960Glu Val Val Lys Lys Met Lys Asn Tyr Trp Arg Gln Leu Leu Asn Ala 965 970 975Lys Leu Ile Thr Gln Arg Lys Phe Asp Asn Leu Thr Lys Ala Glu Arg 980 985 990Gly Gly Leu Ser Glu Leu Asp Lys Ala Gly Phe Ile Lys Arg Gln Leu 995 1000 1005Val Glu Thr Arg Gln Ile Thr Lys His Val Ala Gln Ile Leu Asp 1010 1015 1020Ser Arg Met Asn Thr Lys Tyr Asp Glu Asn Asp Lys Leu Ile Arg 1025 1030 1035Glu Val Lys Val Ile Thr Leu Lys Ser Lys Leu Val Ser Asp Phe 1040 1045 1050Arg Lys Asp Phe Gln Phe Tyr Lys Val Arg Glu Ile Asn Asn Tyr 1055 1060 1065His His Ala His Asp Ala Tyr Leu Asn Ala Val Val Gly Thr Ala 1070 1075 1080Leu Ile Lys Lys Tyr Pro Lys Leu Glu Ser Glu Phe Val Tyr Gly 1085 1090 1095Asp Tyr Lys Val Tyr Asp Val Arg Lys Met Ile Ala Lys Ser Glu 1100 1105 1110Gln Glu Ile Gly Lys Ala Thr Ala Lys Tyr Phe Phe Tyr Ser Asn 1115 1120 1125Ile Met Asn Phe Phe Lys Thr Glu Ile Thr Leu Ala Asn Gly Glu 1130 1135 1140Ile Arg Lys Arg Pro Leu Ile Glu Thr Asn Gly Glu Thr Gly Glu 1145 1150 1155Ile Val Trp Asp Lys Gly Arg Asp Phe Ala Thr Val Arg Lys Val 1160 1165 1170Leu Ser Met Pro Gln Val Asn Ile Val Lys Lys Thr Glu Val Gln 1175 1180 1185Thr Gly Gly Phe Ser Lys Glu Ser Ile Leu Pro Lys Arg Asn Ser 1190 1195 1200Asp Lys Leu Ile Ala Arg Lys Lys Asp Trp Asp Pro Lys Lys Tyr 1205 1210 1215Gly Gly Phe Asp Ser Pro Thr Val Ala Tyr Ser Val Leu Val Val 1220 1225 1230Ala Lys Val Glu Lys Gly Lys Ser Lys Lys Leu Lys Ser Val Lys 1235 1240 1245Glu Leu Leu Gly Ile Thr Ile Met Glu Arg Ser Ser Phe Glu Lys 1250 1255 1260Asn Pro Ile Asp Phe Leu Glu Ala Lys Gly Tyr Lys Glu Val Lys 1265 1270 1275Lys Asp Leu Ile Ile Lys Leu Pro Lys Tyr Ser Leu Phe Glu Leu 1280 1285 1290Glu Asn Gly Arg Lys Arg Met Leu Ala Ser Ala Gly Glu Leu Gln 1295 1300 1305Lys Gly Asn Glu Leu Ala Leu Pro Ser Lys Tyr Val Asn Phe Leu 1310 1315 1320Tyr Leu Ala Ser His Tyr Glu Lys Leu Lys Gly Ser Pro Glu Asp 1325 1330 1335Asn Glu Gln Lys Gln Leu Phe Val Glu Gln His Lys His Tyr Leu 1340 1345 1350Asp Glu Ile Ile Glu Gln Ile Ser Glu Phe Ser Lys Arg Val Ile 1355 1360 1365Leu Ala Asp Ala Asn Leu Asp Lys Val Leu Ser Ala Tyr Asn Lys 1370 1375 1380His Arg Asp Lys Pro Ile Arg Glu Gln Ala Glu Asn Ile Ile His 1385 1390 1395Leu Phe Thr Leu Thr Asn Leu Gly Ala Pro Ala Ala Phe Lys Tyr 1400 1405 1410Phe Asp Thr Thr Ile Asp Arg Lys Arg Tyr Thr Ser Thr Lys Glu 1415 1420 1425Val Leu Asp Ala Thr Leu Ile His Gln Ser Ile Thr Gly Leu Tyr 1430 1435 1440Glu Thr Arg Ile Asp Leu Ser Gln Leu Gly Gly Asp Ser Arg Ala 1445 1450 1455Asp Tyr Pro Tyr Asp Val Pro Asp Tyr Ala Ser Gly Ser Pro Lys 1460 1465 1470Lys Lys Arg Lys Val Glu Ala Ser Gly Ser Gly Arg Ala Ser Pro 1475 1480 1485Gly Ile Pro Gly Ser Thr Arg Asn His Asp Gln Glu Phe Asp Pro 1490 1495 1500Pro Lys Val Tyr Pro Pro Val Pro Ala Glu Lys Arg Lys Pro Ile 1505 1510 1515Arg Val Leu Ser Leu Phe Asp Gly Ile Ala Thr Gly Leu Leu Val 1520 1525 1530Leu Lys Asp Leu Gly Ile Gln Val Asp Arg Tyr Ile Ala Ser Glu 1535 1540 1545Val Cys Glu Asp Ser Ile Thr Val Gly Met Val Arg His Gln Gly 1550 1555 1560Lys Ile Met Tyr Val Gly Asp Val Arg Ser Val Thr Gln Lys His 1565 1570 1575Ile Gln Glu Trp Gly Pro Phe Asp Leu Val Ile Gly Gly Ser Pro 1580 1585 1590Cys Asn Asp Leu Ser Ile Val Asn Pro Ala Arg Lys Gly Leu Tyr 1595 1600 1605Glu Gly Thr Gly Arg Leu Phe Phe Glu Phe Tyr Arg Leu Leu His 1610 1615 1620Asp Ala Arg Pro Lys Glu Gly Asp Asp Arg Pro Phe Phe Trp Leu 1625 1630 1635Phe Glu Asn Val Val Ala Met Gly Val Ser Asp Lys Arg Asp Ile 1640 1645 1650Ser Arg Phe Leu Glu Ser Asn Pro Val Met Ile Asp Ala Lys Glu 1655 1660 1665Val Ser Ala Ala His Arg Ala Arg Tyr Phe Trp Gly Asn Leu Pro 1670 1675 1680Gly Met Asn Arg Pro Leu Ala Ser Thr Val Asn Asp Lys Leu Glu 1685 1690 1695Leu Gln Glu Cys Leu Glu His Gly Arg Ile Ala Lys Phe Ser Lys 1700 1705 1710Val Arg Thr Ile Thr Thr Arg Ser Asn Ser Ile Lys Gln Gly Lys 1715 1720 1725Asp Gln His Phe Pro Val Phe Met Asn Glu Lys Glu Asp Ile Leu 1730 1735 1740Trp Cys Thr Glu Met Glu Arg Val Phe Gly Phe Pro Val His Tyr 1745 1750 1755Thr Asp Val Ser Asn Met Ser Arg Leu Ala Arg Gln Arg Leu Leu 1760 1765 1770Gly Arg Ser Trp Ser Val Pro Val Ile Arg His Leu Phe Ala Pro 1775 1780 1785Leu Lys Glu Tyr Phe Ala Cys Val Ser Ser Gly Asn Ser Asn Ala 1790 1795 1800Asn Ser Arg Gly Pro Ser Phe Ser Ser Gly Leu Val Pro Leu Ser 1805 1810 1815Leu Arg Gly Ser His Met Gly Pro Met Glu Ile Tyr Lys Thr Val 1820 1825 1830Ser Ala Trp Lys Arg Gln Pro Val Arg Val Leu Ser Leu Phe Arg 1835 1840 1845Asn Ile Asp Lys Val Leu Lys Ser Leu Gly Phe Leu Glu Ser Gly 1850 1855 1860Ser Gly Ser Gly Gly Gly Thr Leu Lys Tyr Val Glu Asp Val Thr 1865 1870 1875Asn Val Val Arg Arg Asp Val Glu Lys Trp Gly Pro Phe Asp Leu 1880 1885 1890Val Tyr Gly Ser Thr Gln Pro Leu Gly Ser Ser Cys Asp Arg Cys 1895 1900 1905Pro Gly Trp Tyr Met Phe Gln Phe His Arg Ile Leu Gln Tyr Ala 1910 1915 1920Leu Pro Arg Gln Glu Ser Gln Arg Pro Phe Phe Trp Ile Phe Met 1925 1930 1935Asp Asn Leu Leu Leu Thr Glu Asp Asp Gln Glu Thr Thr Thr Arg 1940 1945 1950Phe Leu Gln Thr Glu Ala Val Thr Leu Gln Asp Val Arg Gly Arg 1955 1960 1965Asp Tyr Gln Asn Ala Met Arg Val Trp Ser Asn Ile Pro Gly Leu 1970 1975 1980Lys Ser Lys His Ala Pro Leu Thr Pro Lys Glu Glu Glu Tyr Leu 1985 1990 1995Gln Ala Gln Val Arg Ser Arg Ser Lys Leu Asp Ala Pro Lys Val 2000 2005 2010Asp Leu Leu Val Lys Asn Cys Leu Leu Pro Leu Arg Glu Tyr Phe 2015 2020 2025Lys Tyr Phe Ser Gln Asn Ser Leu Pro Leu Ser Arg Ala Asp Pro 2030 2035 2040Lys Lys Lys Arg Lys Val Gly Ser Gly Ala Thr Asn Phe Ser Leu 2045 2050 2055Leu Lys Gln Ala Gly Asp Val Glu Glu Asn Pro Gly Pro Gly Ser 2060 2065 2070Gly Ala Thr Asn Phe Ser Leu Leu Lys Gln Ala Gly Asp Val Glu 2075 2080 2085Glu Asn Pro Gly Pro Ser Glu Leu Ile Lys Glu Asn Met His Met 2090 2095 2100Lys Leu Tyr Met Glu Gly Thr Val Asp Asn His His Phe Lys Cys 2105 2110 2115Thr Ser Glu Gly Glu Gly Lys Pro Tyr Glu Gly Thr Gln Thr Met 2120 2125 2130Arg Ile Lys Val Val Glu Gly Gly Pro Leu Pro Phe Ala Phe Asp 2135 2140 2145Ile Leu Ala Thr Ser Phe Leu Tyr Gly Ser Lys Thr Phe Ile Asn 2150 2155 2160His Thr Gln Gly Ile Pro Asp Phe Phe Lys Gln Ser Phe Pro Glu 2165 2170 2175Gly Phe Thr Trp Glu Arg Val Thr Thr Tyr Glu Asp Gly Gly Val 2180 2185 2190Leu Thr Ala Thr Gln Asp Thr Ser Leu Gln Asp Gly Cys Leu Ile 2195 2200 2205Tyr Asn Val Lys Ile Arg Gly Val Asn Phe Thr Ser Asn Gly Pro 2210 2215 2220Val Met Gln Lys Lys Thr Leu Gly Trp Glu Ala Phe Thr Glu Thr 2225 2230 2235Leu Tyr Pro Ala Asp Gly Gly Leu Glu Gly Arg Asn Asp Met Ala 2240 2245 2250Leu Lys Leu Val Gly Gly Ser His Leu Ile Ala Asn Ile Lys Thr 2255 2260 2265Thr Tyr Arg Ser Lys Lys Pro Ala Lys Asn Leu Lys Met Pro Gly 2270 2275 2280Val Tyr Tyr Val Asp Tyr Arg Leu Glu Arg Ile Lys Glu Ala Asn 2285 2290 2295Asn Glu Thr Tyr Val Glu Gln His Glu Val Ala Val Ala Arg Tyr 2300 2305 2310Cys Asp Leu Pro Ser Lys Leu Gly His Lys Leu Asn 2315 2320 232592367PRTArtificial sequenceSynthetic polypeptide 9Asp Ala Lys Ser Leu Thr Ala Trp Ser Arg Thr Leu Val Thr Phe Lys1 5 10 15Asp Val Phe Val Asp Phe Thr Arg Glu Glu Trp Lys Leu Leu Asp Thr 20 25 30Ala Gln Gln Ile Val Tyr Arg Asn Val Met Leu Glu Asn Tyr Lys Asn 35 40 45Leu Val Ser Leu Gly Tyr Gln Leu Thr Lys Pro Asp Val Ile Leu Arg 50 55 60Leu Glu Lys Gly Glu Glu Pro Gly Gly Pro Ser Ser Gly Ala Pro Pro65 70 75 80Pro Ser Gly Gly Ser Pro Ala Gly Ser Pro Thr Ser Thr Glu Glu Gly 85 90 95Thr Ser Glu Ser Ala Thr Pro Glu Ser Gly Pro Gly Thr Ser Thr Glu 100 105 110Pro Ser Glu Gly Ser Ala Pro Gly Ser Pro Ala Gly Ser Pro Thr Ser 115 120 125Thr Glu Glu Gly Thr Ser Thr Glu Pro Ser Glu Gly Ser Ala Pro Gly 130 135 140Thr Ser Thr Glu Pro Ser Glu Met Asp Lys Lys Tyr Ser Ile Gly Leu145 150 155 160Ala Ile Gly Thr Asn Ser Val Gly Trp Ala Val Ile Thr Asp Glu Tyr 165 170 175Lys Val Pro Ser Lys Lys Phe Lys Val Leu Gly Asn Thr Asp Arg His 180 185 190Ser Ile Lys Lys Asn Leu Ile Gly Ala Leu Leu Phe Asp Ser Gly Glu 195 200 205Thr Ala Glu Ala Thr Arg Leu Lys Arg Thr Ala Arg Arg Arg Tyr Thr 210 215 220Arg Arg Lys Asn Arg Ile Cys Tyr Leu Gln Glu Ile Phe Ser Asn Glu225 230 235 240Met Ala Lys Val Asp Asp Ser Phe Phe His Arg Leu Glu Glu Ser Phe 245 250 255Leu Val Glu Glu Asp Lys Lys His Glu Arg His Pro Ile Phe Gly Asn 260 265 270Ile Val Asp Glu Val Ala Tyr His Glu Lys Tyr Pro Thr Ile Tyr His 275 280 285Leu Arg Lys Lys Leu Val Asp Ser Thr Asp Lys Ala Asp Leu Arg Leu 290 295 300Ile Tyr Leu Ala Leu Ala His Met Ile Lys Phe Arg Gly His Phe Leu305 310 315 320Ile Glu Gly Asp Leu Asn Pro Asp Asn Ser Asp Val Asp Lys Leu Phe 325 330 335Ile Gln Leu Val Gln Thr Tyr Asn Gln Leu Phe Glu Glu Asn Pro Ile 340 345 350Asn Ala Ser Gly Val Asp Ala Lys Ala Ile Leu Ser Ala Arg Leu Ser 355 360 365Lys Ser Arg Arg Leu Glu Asn Leu Ile Ala Gln Leu Pro Gly Glu Lys 370 375 380Lys Asn Gly Leu Phe Gly Asn Leu Ile Ala Leu Ser Leu Gly Leu Thr385 390 395 400Pro Asn Phe Lys Ser Asn Phe Asp Leu Ala Glu Asp Ala Lys Leu Gln 405 410 415Leu Ser Lys Asp Thr Tyr Asp Asp Asp Leu Asp Asn Leu Leu Ala Gln 420 425 430Ile Gly Asp Gln Tyr Ala Asp Leu Phe Leu Ala Ala Lys Asn Leu Ser 435 440 445Asp Ala Ile Leu Leu Ser Asp Ile Leu Arg Val Asn Thr Glu Ile Thr 450 455 460Lys Ala Pro Leu Ser Ala Ser Met Ile Lys Arg Tyr Asp Glu His His465 470 475 480Gln Asp Leu Thr Leu Leu Lys Ala Leu Val Arg Gln Gln Leu Pro Glu 485 490 495Lys Tyr Lys Glu Ile Phe Phe Asp Gln Ser Lys Asn Gly Tyr Ala Gly 500 505 510Tyr Ile Asp Gly Gly Ala Ser Gln Glu Glu Phe Tyr Lys Phe Ile Lys 515 520 525Pro Ile Leu Glu Lys Met Asp Gly Thr Glu Glu Leu Leu Val Lys Leu 530 535 540Asn Arg Glu Asp Leu Leu Arg Lys Gln Arg Thr Phe Asp Asn Gly Ser545 550 555 560Ile Pro His Gln Ile His Leu Gly Glu Leu His Ala Ile Leu Arg Arg 565 570 575Gln Glu Asp Phe Tyr Pro Phe Leu Lys Asp Asn Arg Glu Lys Ile Glu 580 585 590Lys Ile Leu Thr Phe Arg Ile Pro Tyr Tyr Val Gly Pro Leu Ala Arg 595 600 605Gly Asn Ser Arg Phe Ala Trp Met Thr Arg Lys Ser Glu Glu Thr Ile 610 615 620Thr Pro Trp Asn Phe Glu Glu Val Val Asp Lys Gly Ala Ser Ala Gln625 630 635 640Ser Phe Ile Glu Arg Met Thr Asn Phe Asp Lys Asn Leu Pro Asn Glu 645 650 655Lys Val Leu Pro Lys His Ser Leu Leu Tyr Glu Tyr Phe Thr Val Tyr 660 665 670Asn Glu Leu Thr Lys Val Lys Tyr Val Thr Glu Gly Met Arg Lys Pro 675 680 685Ala Phe Leu Ser Gly Glu Gln Lys Lys Ala Ile Val Asp Leu Leu Phe 690 695 700Lys Thr Asn Arg Lys Val Thr Val Lys Gln Leu Lys Glu Asp Tyr Phe705 710 715 720Lys Lys Ile Glu Cys Phe Asp Ser Val Glu Ile Ser Gly Val Glu Asp 725 730 735Arg Phe Asn Ala Ser Leu Gly Thr Tyr His Asp Leu Leu Lys Ile Ile 740 745 750Lys Asp Lys Asp Phe Leu Asp Asn Glu Glu Asn Glu Asp Ile Leu Glu 755 760 765Asp Ile Val Leu Thr Leu Thr Leu Phe Glu Asp Arg Glu Met Ile Glu 770 775 780Glu Arg Leu Lys Thr Tyr Ala His Leu Phe Asp Asp Lys Val Met Lys785 790 795 800Gln Leu Lys Arg Arg Arg Tyr Thr Gly Trp Gly Arg Leu Ser Arg Lys 805 810 815Leu Ile Asn Gly Ile Arg Asp Lys Gln Ser Gly Lys Thr Ile Leu Asp 820 825 830Phe Leu Lys Ser Asp Gly Phe Ala Asn Arg Asn Phe Met Gln Leu Ile 835 840 845His Asp Asp Ser Leu Thr Phe Lys Glu Asp Ile Gln Lys Ala Gln Val 850 855 860Ser Gly Gln Gly Asp Ser Leu His Glu His Ile Ala Asn Leu Ala Gly865 870 875 880Ser Pro Ala Ile Lys Lys Gly Ile Leu Gln Thr Val Lys Val Val Asp 885 890 895Glu Leu Val Lys Val Met Gly Arg His Lys Pro Glu Asn Ile Val Ile 900 905 910Glu Met Ala Arg Glu Asn Gln Thr Thr Gln Lys Gly Gln Lys Asn Ser 915 920 925Arg Glu Arg Met Lys Arg Ile Glu Glu Gly Ile Lys Glu Leu Gly Ser 930 935 940Gln Ile Leu Lys Glu His Pro Val Glu Asn Thr Gln Leu Gln Asn Glu945 950 955 960Lys Leu Tyr Leu Tyr Tyr Leu Gln Asn Gly Arg Asp Met Tyr Val Asp

965 970 975Gln Glu Leu Asp Ile Asn Arg Leu Ser Asp Tyr Asp Val Asp Ala Ile 980 985 990Val Pro Gln Ser Phe Leu Lys Asp Asp Ser Ile Asp Asn Lys Val Leu 995 1000 1005Thr Arg Ser Asp Lys Asn Arg Gly Lys Ser Asp Asn Val Pro Ser 1010 1015 1020Glu Glu Val Val Lys Lys Met Lys Asn Tyr Trp Arg Gln Leu Leu 1025 1030 1035Asn Ala Lys Leu Ile Thr Gln Arg Lys Phe Asp Asn Leu Thr Lys 1040 1045 1050Ala Glu Arg Gly Gly Leu Ser Glu Leu Asp Lys Ala Gly Phe Ile 1055 1060 1065Lys Arg Gln Leu Val Glu Thr Arg Gln Ile Thr Lys His Val Ala 1070 1075 1080Gln Ile Leu Asp Ser Arg Met Asn Thr Lys Tyr Asp Glu Asn Asp 1085 1090 1095Lys Leu Ile Arg Glu Val Lys Val Ile Thr Leu Lys Ser Lys Leu 1100 1105 1110Val Ser Asp Phe Arg Lys Asp Phe Gln Phe Tyr Lys Val Arg Glu 1115 1120 1125Ile Asn Asn Tyr His His Ala His Asp Ala Tyr Leu Asn Ala Val 1130 1135 1140Val Gly Thr Ala Leu Ile Lys Lys Tyr Pro Lys Leu Glu Ser Glu 1145 1150 1155Phe Val Tyr Gly Asp Tyr Lys Val Tyr Asp Val Arg Lys Met Ile 1160 1165 1170Ala Lys Ser Glu Gln Glu Ile Gly Lys Ala Thr Ala Lys Tyr Phe 1175 1180 1185Phe Tyr Ser Asn Ile Met Asn Phe Phe Lys Thr Glu Ile Thr Leu 1190 1195 1200Ala Asn Gly Glu Ile Arg Lys Arg Pro Leu Ile Glu Thr Asn Gly 1205 1210 1215Glu Thr Gly Glu Ile Val Trp Asp Lys Gly Arg Asp Phe Ala Thr 1220 1225 1230Val Arg Lys Val Leu Ser Met Pro Gln Val Asn Ile Val Lys Lys 1235 1240 1245Thr Glu Val Gln Thr Gly Gly Phe Ser Lys Glu Ser Ile Leu Pro 1250 1255 1260Lys Arg Asn Ser Asp Lys Leu Ile Ala Arg Lys Lys Asp Trp Asp 1265 1270 1275Pro Lys Lys Tyr Gly Gly Phe Asp Ser Pro Thr Val Ala Tyr Ser 1280 1285 1290Val Leu Val Val Ala Lys Val Glu Lys Gly Lys Ser Lys Lys Leu 1295 1300 1305Lys Ser Val Lys Glu Leu Leu Gly Ile Thr Ile Met Glu Arg Ser 1310 1315 1320Ser Phe Glu Lys Asn Pro Ile Asp Phe Leu Glu Ala Lys Gly Tyr 1325 1330 1335Lys Glu Val Lys Lys Asp Leu Ile Ile Lys Leu Pro Lys Tyr Ser 1340 1345 1350Leu Phe Glu Leu Glu Asn Gly Arg Lys Arg Met Leu Ala Ser Ala 1355 1360 1365Gly Glu Leu Gln Lys Gly Asn Glu Leu Ala Leu Pro Ser Lys Tyr 1370 1375 1380Val Asn Phe Leu Tyr Leu Ala Ser His Tyr Glu Lys Leu Lys Gly 1385 1390 1395Ser Pro Glu Asp Asn Glu Gln Lys Gln Leu Phe Val Glu Gln His 1400 1405 1410Lys His Tyr Leu Asp Glu Ile Ile Glu Gln Ile Ser Glu Phe Ser 1415 1420 1425Lys Arg Val Ile Leu Ala Asp Ala Asn Leu Asp Lys Val Leu Ser 1430 1435 1440Ala Tyr Asn Lys His Arg Asp Lys Pro Ile Arg Glu Gln Ala Glu 1445 1450 1455Asn Ile Ile His Leu Phe Thr Leu Thr Asn Leu Gly Ala Pro Ala 1460 1465 1470Ala Phe Lys Tyr Phe Asp Thr Thr Ile Asp Arg Lys Arg Tyr Thr 1475 1480 1485Ser Thr Lys Glu Val Leu Asp Ala Thr Leu Ile His Gln Ser Ile 1490 1495 1500Thr Gly Leu Tyr Glu Thr Arg Ile Asp Leu Ser Gln Leu Gly Gly 1505 1510 1515Asp Ser Arg Ala Asp Tyr Pro Tyr Asp Val Pro Asp Tyr Ala Ser 1520 1525 1530Gly Ser Pro Lys Lys Lys Arg Lys Val Glu Ala Ser Gly Ser Gly 1535 1540 1545Arg Ala Ser Pro Gly Ile Pro Gly Ser Thr Arg Asn His Asp Gln 1550 1555 1560Glu Phe Asp Pro Pro Lys Val Tyr Pro Pro Val Pro Ala Glu Lys 1565 1570 1575Arg Lys Pro Ile Arg Val Leu Ser Leu Phe Asp Gly Ile Ala Thr 1580 1585 1590Gly Leu Leu Val Leu Lys Asp Leu Gly Ile Gln Val Asp Arg Tyr 1595 1600 1605Ile Ala Ser Glu Val Cys Glu Asp Ser Ile Thr Val Gly Met Val 1610 1615 1620Arg His Gln Gly Lys Ile Met Tyr Val Gly Asp Val Arg Ser Val 1625 1630 1635Thr Gln Lys His Ile Gln Glu Trp Gly Pro Phe Asp Leu Val Ile 1640 1645 1650Gly Gly Ser Pro Cys Asn Asp Leu Ser Ile Val Asn Pro Ala Arg 1655 1660 1665Lys Gly Leu Tyr Glu Gly Thr Gly Arg Leu Phe Phe Glu Phe Tyr 1670 1675 1680Arg Leu Leu His Asp Ala Arg Pro Lys Glu Gly Asp Asp Arg Pro 1685 1690 1695Phe Phe Trp Leu Phe Glu Asn Val Val Ala Met Gly Val Ser Asp 1700 1705 1710Lys Arg Asp Ile Ser Arg Phe Leu Glu Ser Asn Pro Val Met Ile 1715 1720 1725Asp Ala Lys Glu Val Ser Ala Ala His Arg Ala Arg Tyr Phe Trp 1730 1735 1740Gly Asn Leu Pro Gly Met Asn Arg Pro Leu Ala Ser Thr Val Asn 1745 1750 1755Asp Lys Leu Glu Leu Gln Glu Cys Leu Glu His Gly Arg Ile Ala 1760 1765 1770Lys Phe Ser Lys Val Arg Thr Ile Thr Thr Arg Ser Asn Ser Ile 1775 1780 1785Lys Gln Gly Lys Asp Gln His Phe Pro Val Phe Met Asn Glu Lys 1790 1795 1800Glu Asp Ile Leu Trp Cys Thr Glu Met Glu Arg Val Phe Gly Phe 1805 1810 1815Pro Val His Tyr Thr Asp Val Ser Asn Met Ser Arg Leu Ala Arg 1820 1825 1830Gln Arg Leu Leu Gly Arg Ser Trp Ser Val Pro Val Ile Arg His 1835 1840 1845Leu Phe Ala Pro Leu Lys Glu Tyr Phe Ala Cys Val Ser Ser Gly 1850 1855 1860Asn Ser Asn Ala Asn Ser Arg Gly Pro Ser Phe Ser Ser Gly Leu 1865 1870 1875Val Pro Leu Ser Leu Arg Gly Ser His Met Gly Pro Met Glu Ile 1880 1885 1890Tyr Lys Thr Val Ser Ala Trp Lys Arg Gln Pro Val Arg Val Leu 1895 1900 1905Ser Leu Phe Arg Asn Ile Asp Lys Val Leu Lys Ser Leu Gly Phe 1910 1915 1920Leu Glu Ser Gly Ser Gly Ser Gly Gly Gly Thr Leu Lys Tyr Val 1925 1930 1935Glu Asp Val Thr Asn Val Val Arg Arg Asp Val Glu Lys Trp Gly 1940 1945 1950Pro Phe Asp Leu Val Tyr Gly Ser Thr Gln Pro Leu Gly Ser Ser 1955 1960 1965Cys Asp Arg Cys Pro Gly Trp Tyr Met Phe Gln Phe His Arg Ile 1970 1975 1980Leu Gln Tyr Ala Leu Pro Arg Gln Glu Ser Gln Arg Pro Phe Phe 1985 1990 1995Trp Ile Phe Met Asp Asn Leu Leu Leu Thr Glu Asp Asp Gln Glu 2000 2005 2010Thr Thr Thr Arg Phe Leu Gln Thr Glu Ala Val Thr Leu Gln Asp 2015 2020 2025Val Arg Gly Arg Asp Tyr Gln Asn Ala Met Arg Val Trp Ser Asn 2030 2035 2040Ile Pro Gly Leu Lys Ser Lys His Ala Pro Leu Thr Pro Lys Glu 2045 2050 2055Glu Glu Tyr Leu Gln Ala Gln Val Arg Ser Arg Ser Lys Leu Asp 2060 2065 2070Ala Pro Lys Val Asp Leu Leu Val Lys Asn Cys Leu Leu Pro Leu 2075 2080 2085Arg Glu Tyr Phe Lys Tyr Phe Ser Gln Asn Ser Leu Pro Leu Ser 2090 2095 2100Arg Ala Asp Pro Lys Lys Lys Arg Lys Val Gly Ser Gly Ala Thr 2105 2110 2115Asn Phe Ser Leu Leu Lys Gln Ala Gly Asp Val Glu Glu Asn Pro 2120 2125 2130Gly Pro Ser Glu Leu Ile Lys Glu Asn Met His Met Lys Leu Tyr 2135 2140 2145Met Glu Gly Thr Val Asp Asn His His Phe Lys Cys Thr Ser Glu 2150 2155 2160Gly Glu Gly Lys Pro Tyr Glu Gly Thr Gln Thr Met Arg Ile Lys 2165 2170 2175Val Val Glu Gly Gly Pro Leu Pro Phe Ala Phe Asp Ile Leu Ala 2180 2185 2190Thr Ser Phe Leu Tyr Gly Ser Lys Thr Phe Ile Asn His Thr Gln 2195 2200 2205Gly Ile Pro Asp Phe Phe Lys Gln Ser Phe Pro Glu Gly Phe Thr 2210 2215 2220Trp Glu Arg Val Thr Thr Tyr Glu Asp Gly Gly Val Leu Thr Ala 2225 2230 2235Thr Gln Asp Thr Ser Leu Gln Asp Gly Cys Leu Ile Tyr Asn Val 2240 2245 2250Lys Ile Arg Gly Val Asn Phe Thr Ser Asn Gly Pro Val Met Gln 2255 2260 2265Lys Lys Thr Leu Gly Trp Glu Ala Phe Thr Glu Thr Leu Tyr Pro 2270 2275 2280Ala Asp Gly Gly Leu Glu Gly Arg Asn Asp Met Ala Leu Lys Leu 2285 2290 2295Val Gly Gly Ser His Leu Ile Ala Asn Ile Lys Thr Thr Tyr Arg 2300 2305 2310Ser Lys Lys Pro Ala Lys Asn Leu Lys Met Pro Gly Val Tyr Tyr 2315 2320 2325Val Asp Tyr Arg Leu Glu Arg Ile Lys Glu Ala Asn Asn Glu Thr 2330 2335 2340Tyr Val Glu Gln His Glu Val Ala Val Ala Arg Tyr Cys Asp Leu 2345 2350 2355Pro Ser Lys Leu Gly His Lys Leu Asn 2360 2365102389PRTArtificial sequenceSynthetic polypeptide 10Asp Ala Lys Ser Leu Thr Ala Trp Ser Arg Thr Leu Val Thr Phe Lys1 5 10 15Asp Val Phe Val Asp Phe Thr Arg Glu Glu Trp Lys Leu Leu Asp Thr 20 25 30Ala Gln Gln Ile Val Tyr Arg Asn Val Met Leu Glu Asn Tyr Lys Asn 35 40 45Leu Val Ser Leu Gly Tyr Gln Leu Thr Lys Pro Asp Val Ile Leu Arg 50 55 60Leu Glu Lys Gly Glu Glu Pro Gly Gly Pro Ser Ser Gly Ala Pro Pro65 70 75 80Pro Ser Gly Gly Ser Pro Ala Gly Ser Pro Thr Ser Thr Glu Glu Gly 85 90 95Thr Ser Glu Ser Ala Thr Pro Glu Ser Gly Pro Gly Thr Ser Thr Glu 100 105 110Pro Ser Glu Gly Ser Ala Pro Gly Ser Pro Ala Gly Ser Pro Thr Ser 115 120 125Thr Glu Glu Gly Thr Ser Thr Glu Pro Ser Glu Gly Ser Ala Pro Gly 130 135 140Thr Ser Thr Glu Pro Ser Glu Met Asp Lys Lys Tyr Ser Ile Gly Leu145 150 155 160Ala Ile Gly Thr Asn Ser Val Gly Trp Ala Val Ile Thr Asp Glu Tyr 165 170 175Lys Val Pro Ser Lys Lys Phe Lys Val Leu Gly Asn Thr Asp Arg His 180 185 190Ser Ile Lys Lys Asn Leu Ile Gly Ala Leu Leu Phe Asp Ser Gly Glu 195 200 205Thr Ala Glu Ala Thr Arg Leu Lys Arg Thr Ala Arg Arg Arg Tyr Thr 210 215 220Arg Arg Lys Asn Arg Ile Cys Tyr Leu Gln Glu Ile Phe Ser Asn Glu225 230 235 240Met Ala Lys Val Asp Asp Ser Phe Phe His Arg Leu Glu Glu Ser Phe 245 250 255Leu Val Glu Glu Asp Lys Lys His Glu Arg His Pro Ile Phe Gly Asn 260 265 270Ile Val Asp Glu Val Ala Tyr His Glu Lys Tyr Pro Thr Ile Tyr His 275 280 285Leu Arg Lys Lys Leu Val Asp Ser Thr Asp Lys Ala Asp Leu Arg Leu 290 295 300Ile Tyr Leu Ala Leu Ala His Met Ile Lys Phe Arg Gly His Phe Leu305 310 315 320Ile Glu Gly Asp Leu Asn Pro Asp Asn Ser Asp Val Asp Lys Leu Phe 325 330 335Ile Gln Leu Val Gln Thr Tyr Asn Gln Leu Phe Glu Glu Asn Pro Ile 340 345 350Asn Ala Ser Gly Val Asp Ala Lys Ala Ile Leu Ser Ala Arg Leu Ser 355 360 365Lys Ser Arg Arg Leu Glu Asn Leu Ile Ala Gln Leu Pro Gly Glu Lys 370 375 380Lys Asn Gly Leu Phe Gly Asn Leu Ile Ala Leu Ser Leu Gly Leu Thr385 390 395 400Pro Asn Phe Lys Ser Asn Phe Asp Leu Ala Glu Asp Ala Lys Leu Gln 405 410 415Leu Ser Lys Asp Thr Tyr Asp Asp Asp Leu Asp Asn Leu Leu Ala Gln 420 425 430Ile Gly Asp Gln Tyr Ala Asp Leu Phe Leu Ala Ala Lys Asn Leu Ser 435 440 445Asp Ala Ile Leu Leu Ser Asp Ile Leu Arg Val Asn Thr Glu Ile Thr 450 455 460Lys Ala Pro Leu Ser Ala Ser Met Ile Lys Arg Tyr Asp Glu His His465 470 475 480Gln Asp Leu Thr Leu Leu Lys Ala Leu Val Arg Gln Gln Leu Pro Glu 485 490 495Lys Tyr Lys Glu Ile Phe Phe Asp Gln Ser Lys Asn Gly Tyr Ala Gly 500 505 510Tyr Ile Asp Gly Gly Ala Ser Gln Glu Glu Phe Tyr Lys Phe Ile Lys 515 520 525Pro Ile Leu Glu Lys Met Asp Gly Thr Glu Glu Leu Leu Val Lys Leu 530 535 540Asn Arg Glu Asp Leu Leu Arg Lys Gln Arg Thr Phe Asp Asn Gly Ser545 550 555 560Ile Pro His Gln Ile His Leu Gly Glu Leu His Ala Ile Leu Arg Arg 565 570 575Gln Glu Asp Phe Tyr Pro Phe Leu Lys Asp Asn Arg Glu Lys Ile Glu 580 585 590Lys Ile Leu Thr Phe Arg Ile Pro Tyr Tyr Val Gly Pro Leu Ala Arg 595 600 605Gly Asn Ser Arg Phe Ala Trp Met Thr Arg Lys Ser Glu Glu Thr Ile 610 615 620Thr Pro Trp Asn Phe Glu Glu Val Val Asp Lys Gly Ala Ser Ala Gln625 630 635 640Ser Phe Ile Glu Arg Met Thr Asn Phe Asp Lys Asn Leu Pro Asn Glu 645 650 655Lys Val Leu Pro Lys His Ser Leu Leu Tyr Glu Tyr Phe Thr Val Tyr 660 665 670Asn Glu Leu Thr Lys Val Lys Tyr Val Thr Glu Gly Met Arg Lys Pro 675 680 685Ala Phe Leu Ser Gly Glu Gln Lys Lys Ala Ile Val Asp Leu Leu Phe 690 695 700Lys Thr Asn Arg Lys Val Thr Val Lys Gln Leu Lys Glu Asp Tyr Phe705 710 715 720Lys Lys Ile Glu Cys Phe Asp Ser Val Glu Ile Ser Gly Val Glu Asp 725 730 735Arg Phe Asn Ala Ser Leu Gly Thr Tyr His Asp Leu Leu Lys Ile Ile 740 745 750Lys Asp Lys Asp Phe Leu Asp Asn Glu Glu Asn Glu Asp Ile Leu Glu 755 760 765Asp Ile Val Leu Thr Leu Thr Leu Phe Glu Asp Arg Glu Met Ile Glu 770 775 780Glu Arg Leu Lys Thr Tyr Ala His Leu Phe Asp Asp Lys Val Met Lys785 790 795 800Gln Leu Lys Arg Arg Arg Tyr Thr Gly Trp Gly Arg Leu Ser Arg Lys 805 810 815Leu Ile Asn Gly Ile Arg Asp Lys Gln Ser Gly Lys Thr Ile Leu Asp 820 825 830Phe Leu Lys Ser Asp Gly Phe Ala Asn Arg Asn Phe Met Gln Leu Ile 835 840 845His Asp Asp Ser Leu Thr Phe Lys Glu Asp Ile Gln Lys Ala Gln Val 850 855 860Ser Gly Gln Gly Asp Ser Leu His Glu His Ile Ala Asn Leu Ala Gly865 870 875 880Ser Pro Ala Ile Lys Lys Gly Ile Leu Gln Thr Val Lys Val Val Asp 885 890 895Glu Leu Val Lys Val Met Gly Arg His Lys Pro Glu Asn Ile Val Ile 900 905 910Glu Met Ala Arg Glu Asn Gln Thr Thr Gln Lys Gly Gln Lys Asn Ser 915 920 925Arg Glu Arg Met Lys Arg Ile Glu Glu Gly Ile Lys Glu Leu Gly Ser 930 935 940Gln Ile Leu Lys Glu His Pro Val Glu Asn Thr Gln Leu Gln Asn Glu945 950 955 960Lys Leu Tyr Leu Tyr Tyr Leu Gln Asn Gly Arg Asp Met Tyr Val Asp 965 970 975Gln Glu Leu Asp Ile Asn Arg Leu Ser Asp Tyr Asp Val Asp Ala Ile 980 985 990Val Pro Gln Ser Phe Leu Lys Asp Asp Ser Ile Asp Asn Lys Val Leu 995 1000 1005Thr Arg Ser Asp Lys Asn Arg Gly Lys Ser Asp Asn Val Pro Ser 1010 1015 1020Glu Glu Val Val Lys Lys Met Lys Asn Tyr Trp Arg Gln Leu Leu 1025 1030 1035Asn Ala Lys Leu Ile Thr Gln Arg Lys Phe Asp Asn Leu Thr

Lys 1040 1045 1050Ala Glu Arg Gly Gly Leu Ser Glu Leu Asp Lys Ala Gly Phe Ile 1055 1060 1065Lys Arg Gln Leu Val Glu Thr Arg Gln Ile Thr Lys His Val Ala 1070 1075 1080Gln Ile Leu Asp Ser Arg Met Asn Thr Lys Tyr Asp Glu Asn Asp 1085 1090 1095Lys Leu Ile Arg Glu Val Lys Val Ile Thr Leu Lys Ser Lys Leu 1100 1105 1110Val Ser Asp Phe Arg Lys Asp Phe Gln Phe Tyr Lys Val Arg Glu 1115 1120 1125Ile Asn Asn Tyr His His Ala His Asp Ala Tyr Leu Asn Ala Val 1130 1135 1140Val Gly Thr Ala Leu Ile Lys Lys Tyr Pro Lys Leu Glu Ser Glu 1145 1150 1155Phe Val Tyr Gly Asp Tyr Lys Val Tyr Asp Val Arg Lys Met Ile 1160 1165 1170Ala Lys Ser Glu Gln Glu Ile Gly Lys Ala Thr Ala Lys Tyr Phe 1175 1180 1185Phe Tyr Ser Asn Ile Met Asn Phe Phe Lys Thr Glu Ile Thr Leu 1190 1195 1200Ala Asn Gly Glu Ile Arg Lys Arg Pro Leu Ile Glu Thr Asn Gly 1205 1210 1215Glu Thr Gly Glu Ile Val Trp Asp Lys Gly Arg Asp Phe Ala Thr 1220 1225 1230Val Arg Lys Val Leu Ser Met Pro Gln Val Asn Ile Val Lys Lys 1235 1240 1245Thr Glu Val Gln Thr Gly Gly Phe Ser Lys Glu Ser Ile Leu Pro 1250 1255 1260Lys Arg Asn Ser Asp Lys Leu Ile Ala Arg Lys Lys Asp Trp Asp 1265 1270 1275Pro Lys Lys Tyr Gly Gly Phe Asp Ser Pro Thr Val Ala Tyr Ser 1280 1285 1290Val Leu Val Val Ala Lys Val Glu Lys Gly Lys Ser Lys Lys Leu 1295 1300 1305Lys Ser Val Lys Glu Leu Leu Gly Ile Thr Ile Met Glu Arg Ser 1310 1315 1320Ser Phe Glu Lys Asn Pro Ile Asp Phe Leu Glu Ala Lys Gly Tyr 1325 1330 1335Lys Glu Val Lys Lys Asp Leu Ile Ile Lys Leu Pro Lys Tyr Ser 1340 1345 1350Leu Phe Glu Leu Glu Asn Gly Arg Lys Arg Met Leu Ala Ser Ala 1355 1360 1365Gly Glu Leu Gln Lys Gly Asn Glu Leu Ala Leu Pro Ser Lys Tyr 1370 1375 1380Val Asn Phe Leu Tyr Leu Ala Ser His Tyr Glu Lys Leu Lys Gly 1385 1390 1395Ser Pro Glu Asp Asn Glu Gln Lys Gln Leu Phe Val Glu Gln His 1400 1405 1410Lys His Tyr Leu Asp Glu Ile Ile Glu Gln Ile Ser Glu Phe Ser 1415 1420 1425Lys Arg Val Ile Leu Ala Asp Ala Asn Leu Asp Lys Val Leu Ser 1430 1435 1440Ala Tyr Asn Lys His Arg Asp Lys Pro Ile Arg Glu Gln Ala Glu 1445 1450 1455Asn Ile Ile His Leu Phe Thr Leu Thr Asn Leu Gly Ala Pro Ala 1460 1465 1470Ala Phe Lys Tyr Phe Asp Thr Thr Ile Asp Arg Lys Arg Tyr Thr 1475 1480 1485Ser Thr Lys Glu Val Leu Asp Ala Thr Leu Ile His Gln Ser Ile 1490 1495 1500Thr Gly Leu Tyr Glu Thr Arg Ile Asp Leu Ser Gln Leu Gly Gly 1505 1510 1515Asp Ser Arg Ala Asp Tyr Pro Tyr Asp Val Pro Asp Tyr Ala Ser 1520 1525 1530Gly Ser Pro Lys Lys Lys Arg Lys Val Glu Ala Ser Gly Ser Gly 1535 1540 1545Arg Ala Ser Pro Gly Ile Pro Gly Ser Thr Arg Asn His Asp Gln 1550 1555 1560Glu Phe Asp Pro Pro Lys Val Tyr Pro Pro Val Pro Ala Glu Lys 1565 1570 1575Arg Lys Pro Ile Arg Val Leu Ser Leu Phe Asp Gly Ile Ala Thr 1580 1585 1590Gly Leu Leu Val Leu Lys Asp Leu Gly Ile Gln Val Asp Arg Tyr 1595 1600 1605Ile Ala Ser Glu Val Cys Glu Asp Ser Ile Thr Val Gly Met Val 1610 1615 1620Arg His Gln Gly Lys Ile Met Tyr Val Gly Asp Val Arg Ser Val 1625 1630 1635Thr Gln Lys His Ile Gln Glu Trp Gly Pro Phe Asp Leu Val Ile 1640 1645 1650Gly Gly Ser Pro Cys Asn Asp Leu Ser Ile Val Asn Pro Ala Arg 1655 1660 1665Lys Gly Leu Tyr Glu Gly Thr Gly Arg Leu Phe Phe Glu Phe Tyr 1670 1675 1680Arg Leu Leu His Asp Ala Arg Pro Lys Glu Gly Asp Asp Arg Pro 1685 1690 1695Phe Phe Trp Leu Phe Glu Asn Val Val Ala Met Gly Val Ser Asp 1700 1705 1710Lys Arg Asp Ile Ser Arg Phe Leu Glu Ser Asn Pro Val Met Ile 1715 1720 1725Asp Ala Lys Glu Val Ser Ala Ala His Arg Ala Arg Tyr Phe Trp 1730 1735 1740Gly Asn Leu Pro Gly Met Asn Arg Pro Leu Ala Ser Thr Val Asn 1745 1750 1755Asp Lys Leu Glu Leu Gln Glu Cys Leu Glu His Gly Arg Ile Ala 1760 1765 1770Lys Phe Ser Lys Val Arg Thr Ile Thr Thr Arg Ser Asn Ser Ile 1775 1780 1785Lys Gln Gly Lys Asp Gln His Phe Pro Val Phe Met Asn Glu Lys 1790 1795 1800Glu Asp Ile Leu Trp Cys Thr Glu Met Glu Arg Val Phe Gly Phe 1805 1810 1815Pro Val His Tyr Thr Asp Val Ser Asn Met Ser Arg Leu Ala Arg 1820 1825 1830Gln Arg Leu Leu Gly Arg Ser Trp Ser Val Pro Val Ile Arg His 1835 1840 1845Leu Phe Ala Pro Leu Lys Glu Tyr Phe Ala Cys Val Ser Ser Gly 1850 1855 1860Asn Ser Asn Ala Asn Ser Arg Gly Pro Ser Phe Ser Ser Gly Leu 1865 1870 1875Val Pro Leu Ser Leu Arg Gly Ser His Met Gly Pro Met Glu Ile 1880 1885 1890Tyr Lys Thr Val Ser Ala Trp Lys Arg Gln Pro Val Arg Val Leu 1895 1900 1905Ser Leu Phe Arg Asn Ile Asp Lys Val Leu Lys Ser Leu Gly Phe 1910 1915 1920Leu Glu Ser Gly Ser Gly Ser Gly Gly Gly Thr Leu Lys Tyr Val 1925 1930 1935Glu Asp Val Thr Asn Val Val Arg Arg Asp Val Glu Lys Trp Gly 1940 1945 1950Pro Phe Asp Leu Val Tyr Gly Ser Thr Gln Pro Leu Gly Ser Ser 1955 1960 1965Cys Asp Arg Cys Pro Gly Trp Tyr Met Phe Gln Phe His Arg Ile 1970 1975 1980Leu Gln Tyr Ala Leu Pro Arg Gln Glu Ser Gln Arg Pro Phe Phe 1985 1990 1995Trp Ile Phe Met Asp Asn Leu Leu Leu Thr Glu Asp Asp Gln Glu 2000 2005 2010Thr Thr Thr Arg Phe Leu Gln Thr Glu Ala Val Thr Leu Gln Asp 2015 2020 2025Val Arg Gly Arg Asp Tyr Gln Asn Ala Met Arg Val Trp Ser Asn 2030 2035 2040Ile Pro Gly Leu Lys Ser Lys His Ala Pro Leu Thr Pro Lys Glu 2045 2050 2055Glu Glu Tyr Leu Gln Ala Gln Val Arg Ser Arg Ser Lys Leu Asp 2060 2065 2070Ala Pro Lys Val Asp Leu Leu Val Lys Asn Cys Leu Leu Pro Leu 2075 2080 2085Arg Glu Tyr Phe Lys Tyr Phe Ser Gln Asn Ser Leu Pro Leu Ser 2090 2095 2100Arg Ala Asp Pro Lys Lys Lys Arg Lys Val Gly Ser Gly Ala Thr 2105 2110 2115Asn Phe Ser Leu Leu Lys Gln Ala Gly Asp Val Glu Glu Asn Pro 2120 2125 2130Gly Pro Gly Ser Gly Ala Thr Asn Phe Ser Leu Leu Lys Gln Ala 2135 2140 2145Gly Asp Val Glu Glu Asn Pro Gly Pro Ser Glu Leu Ile Lys Glu 2150 2155 2160Asn Met His Met Lys Leu Tyr Met Glu Gly Thr Val Asp Asn His 2165 2170 2175His Phe Lys Cys Thr Ser Glu Gly Glu Gly Lys Pro Tyr Glu Gly 2180 2185 2190Thr Gln Thr Met Arg Ile Lys Val Val Glu Gly Gly Pro Leu Pro 2195 2200 2205Phe Ala Phe Asp Ile Leu Ala Thr Ser Phe Leu Tyr Gly Ser Lys 2210 2215 2220Thr Phe Ile Asn His Thr Gln Gly Ile Pro Asp Phe Phe Lys Gln 2225 2230 2235Ser Phe Pro Glu Gly Phe Thr Trp Glu Arg Val Thr Thr Tyr Glu 2240 2245 2250Asp Gly Gly Val Leu Thr Ala Thr Gln Asp Thr Ser Leu Gln Asp 2255 2260 2265Gly Cys Leu Ile Tyr Asn Val Lys Ile Arg Gly Val Asn Phe Thr 2270 2275 2280Ser Asn Gly Pro Val Met Gln Lys Lys Thr Leu Gly Trp Glu Ala 2285 2290 2295Phe Thr Glu Thr Leu Tyr Pro Ala Asp Gly Gly Leu Glu Gly Arg 2300 2305 2310Asn Asp Met Ala Leu Lys Leu Val Gly Gly Ser His Leu Ile Ala 2315 2320 2325Asn Ile Lys Thr Thr Tyr Arg Ser Lys Lys Pro Ala Lys Asn Leu 2330 2335 2340Lys Met Pro Gly Val Tyr Tyr Val Asp Tyr Arg Leu Glu Arg Ile 2345 2350 2355Lys Glu Ala Asn Asn Glu Thr Tyr Val Glu Gln His Glu Val Ala 2360 2365 2370Val Ala Arg Tyr Cys Asp Leu Pro Ser Lys Leu Gly His Lys Leu 2375 2380 2385Asn112369PRTArtificial sequenceSynthetic polypeptide 11Asp Ala Lys Ser Leu Thr Ala Trp Ser Arg Thr Leu Val Thr Phe Lys1 5 10 15Asp Val Phe Val Asp Phe Thr Arg Glu Glu Trp Lys Leu Leu Asp Thr 20 25 30Ala Gln Gln Ile Val Tyr Arg Asn Val Met Leu Glu Asn Tyr Lys Asn 35 40 45Leu Val Ser Leu Gly Tyr Gln Leu Thr Lys Pro Asp Val Ile Leu Arg 50 55 60Leu Glu Lys Gly Glu Glu Pro Ser Gly Ser Glu Thr Pro Gly Thr Ser65 70 75 80Glu Ser Ala Thr Pro Glu Ser Met Asp Lys Lys Tyr Ser Ile Gly Leu 85 90 95Ala Ile Gly Thr Asn Ser Val Gly Trp Ala Val Ile Thr Asp Glu Tyr 100 105 110Lys Val Pro Ser Lys Lys Phe Lys Val Leu Gly Asn Thr Asp Arg His 115 120 125Ser Ile Lys Lys Asn Leu Ile Gly Ala Leu Leu Phe Asp Ser Gly Glu 130 135 140Thr Ala Glu Ala Thr Arg Leu Lys Arg Thr Ala Arg Arg Arg Tyr Thr145 150 155 160Arg Arg Lys Asn Arg Ile Cys Tyr Leu Gln Glu Ile Phe Ser Asn Glu 165 170 175Met Ala Lys Val Asp Asp Ser Phe Phe His Arg Leu Glu Glu Ser Phe 180 185 190Leu Val Glu Glu Asp Lys Lys His Glu Arg His Pro Ile Phe Gly Asn 195 200 205Ile Val Asp Glu Val Ala Tyr His Glu Lys Tyr Pro Thr Ile Tyr His 210 215 220Leu Arg Lys Lys Leu Val Asp Ser Thr Asp Lys Ala Asp Leu Arg Leu225 230 235 240Ile Tyr Leu Ala Leu Ala His Met Ile Lys Phe Arg Gly His Phe Leu 245 250 255Ile Glu Gly Asp Leu Asn Pro Asp Asn Ser Asp Val Asp Lys Leu Phe 260 265 270Ile Gln Leu Val Gln Thr Tyr Asn Gln Leu Phe Glu Glu Asn Pro Ile 275 280 285Asn Ala Ser Gly Val Asp Ala Lys Ala Ile Leu Ser Ala Arg Leu Ser 290 295 300Lys Ser Arg Arg Leu Glu Asn Leu Ile Ala Gln Leu Pro Gly Glu Lys305 310 315 320Lys Asn Gly Leu Phe Gly Asn Leu Ile Ala Leu Ser Leu Gly Leu Thr 325 330 335Pro Asn Phe Lys Ser Asn Phe Asp Leu Ala Glu Asp Ala Lys Leu Gln 340 345 350Leu Ser Lys Asp Thr Tyr Asp Asp Asp Leu Asp Asn Leu Leu Ala Gln 355 360 365Ile Gly Asp Gln Tyr Ala Asp Leu Phe Leu Ala Ala Lys Asn Leu Ser 370 375 380Asp Ala Ile Leu Leu Ser Asp Ile Leu Arg Val Asn Thr Glu Ile Thr385 390 395 400Lys Ala Pro Leu Ser Ala Ser Met Ile Lys Arg Tyr Asp Glu His His 405 410 415Gln Asp Leu Thr Leu Leu Lys Ala Leu Val Arg Gln Gln Leu Pro Glu 420 425 430Lys Tyr Lys Glu Ile Phe Phe Asp Gln Ser Lys Asn Gly Tyr Ala Gly 435 440 445Tyr Ile Asp Gly Gly Ala Ser Gln Glu Glu Phe Tyr Lys Phe Ile Lys 450 455 460Pro Ile Leu Glu Lys Met Asp Gly Thr Glu Glu Leu Leu Val Lys Leu465 470 475 480Asn Arg Glu Asp Leu Leu Arg Lys Gln Arg Thr Phe Asp Asn Gly Ser 485 490 495Ile Pro His Gln Ile His Leu Gly Glu Leu His Ala Ile Leu Arg Arg 500 505 510Gln Glu Asp Phe Tyr Pro Phe Leu Lys Asp Asn Arg Glu Lys Ile Glu 515 520 525Lys Ile Leu Thr Phe Arg Ile Pro Tyr Tyr Val Gly Pro Leu Ala Arg 530 535 540Gly Asn Ser Arg Phe Ala Trp Met Thr Arg Lys Ser Glu Glu Thr Ile545 550 555 560Thr Pro Trp Asn Phe Glu Glu Val Val Asp Lys Gly Ala Ser Ala Gln 565 570 575Ser Phe Ile Glu Arg Met Thr Asn Phe Asp Lys Asn Leu Pro Asn Glu 580 585 590Lys Val Leu Pro Lys His Ser Leu Leu Tyr Glu Tyr Phe Thr Val Tyr 595 600 605Asn Glu Leu Thr Lys Val Lys Tyr Val Thr Glu Gly Met Arg Lys Pro 610 615 620Ala Phe Leu Ser Gly Glu Gln Lys Lys Ala Ile Val Asp Leu Leu Phe625 630 635 640Lys Thr Asn Arg Lys Val Thr Val Lys Gln Leu Lys Glu Asp Tyr Phe 645 650 655Lys Lys Ile Glu Cys Phe Asp Ser Val Glu Ile Ser Gly Val Glu Asp 660 665 670Arg Phe Asn Ala Ser Leu Gly Thr Tyr His Asp Leu Leu Lys Ile Ile 675 680 685Lys Asp Lys Asp Phe Leu Asp Asn Glu Glu Asn Glu Asp Ile Leu Glu 690 695 700Asp Ile Val Leu Thr Leu Thr Leu Phe Glu Asp Arg Glu Met Ile Glu705 710 715 720Glu Arg Leu Lys Thr Tyr Ala His Leu Phe Asp Asp Lys Val Met Lys 725 730 735Gln Leu Lys Arg Arg Arg Tyr Thr Gly Trp Gly Arg Leu Ser Arg Lys 740 745 750Leu Ile Asn Gly Ile Arg Asp Lys Gln Ser Gly Lys Thr Ile Leu Asp 755 760 765Phe Leu Lys Ser Asp Gly Phe Ala Asn Arg Asn Phe Met Gln Leu Ile 770 775 780His Asp Asp Ser Leu Thr Phe Lys Glu Asp Ile Gln Lys Ala Gln Val785 790 795 800Ser Gly Gln Gly Asp Ser Leu His Glu His Ile Ala Asn Leu Ala Gly 805 810 815Ser Pro Ala Ile Lys Lys Gly Ile Leu Gln Thr Val Lys Val Val Asp 820 825 830Glu Leu Val Lys Val Met Gly Arg His Lys Pro Glu Asn Ile Val Ile 835 840 845Glu Met Ala Arg Glu Asn Gln Thr Thr Gln Lys Gly Gln Lys Asn Ser 850 855 860Arg Glu Arg Met Lys Arg Ile Glu Glu Gly Ile Lys Glu Leu Gly Ser865 870 875 880Gln Ile Leu Lys Glu His Pro Val Glu Asn Thr Gln Leu Gln Asn Glu 885 890 895Lys Leu Tyr Leu Tyr Tyr Leu Gln Asn Gly Arg Asp Met Tyr Val Asp 900 905 910Gln Glu Leu Asp Ile Asn Arg Leu Ser Asp Tyr Asp Val Asp Ala Ile 915 920 925Val Pro Gln Ser Phe Leu Lys Asp Asp Ser Ile Asp Asn Lys Val Leu 930 935 940Thr Arg Ser Asp Lys Asn Arg Gly Lys Ser Asp Asn Val Pro Ser Glu945 950 955 960Glu Val Val Lys Lys Met Lys Asn Tyr Trp Arg Gln Leu Leu Asn Ala 965 970 975Lys Leu Ile Thr Gln Arg Lys Phe Asp Asn Leu Thr Lys Ala Glu Arg 980 985 990Gly Gly Leu Ser Glu Leu Asp Lys Ala Gly Phe Ile Lys Arg Gln Leu 995 1000 1005Val Glu Thr Arg Gln Ile Thr Lys His Val Ala Gln Ile Leu Asp 1010 1015 1020Ser Arg Met Asn Thr Lys Tyr Asp Glu Asn Asp Lys Leu Ile Arg 1025 1030 1035Glu Val Lys Val Ile Thr Leu Lys Ser Lys Leu Val Ser Asp Phe 1040 1045 1050Arg Lys Asp Phe Gln Phe Tyr Lys Val Arg Glu Ile Asn Asn Tyr 1055 1060 1065His His Ala His Asp Ala Tyr Leu Asn Ala Val Val Gly Thr Ala 1070 1075 1080Leu Ile Lys Lys Tyr Pro Lys Leu Glu Ser Glu Phe Val Tyr Gly 1085 1090 1095Asp Tyr Lys Val Tyr Asp Val Arg Lys

Met Ile Ala Lys Ser Glu 1100 1105 1110Gln Glu Ile Gly Lys Ala Thr Ala Lys Tyr Phe Phe Tyr Ser Asn 1115 1120 1125Ile Met Asn Phe Phe Lys Thr Glu Ile Thr Leu Ala Asn Gly Glu 1130 1135 1140Ile Arg Lys Arg Pro Leu Ile Glu Thr Asn Gly Glu Thr Gly Glu 1145 1150 1155Ile Val Trp Asp Lys Gly Arg Asp Phe Ala Thr Val Arg Lys Val 1160 1165 1170Leu Ser Met Pro Gln Val Asn Ile Val Lys Lys Thr Glu Val Gln 1175 1180 1185Thr Gly Gly Phe Ser Lys Glu Ser Ile Leu Pro Lys Arg Asn Ser 1190 1195 1200Asp Lys Leu Ile Ala Arg Lys Lys Asp Trp Asp Pro Lys Lys Tyr 1205 1210 1215Gly Gly Phe Asp Ser Pro Thr Val Ala Tyr Ser Val Leu Val Val 1220 1225 1230Ala Lys Val Glu Lys Gly Lys Ser Lys Lys Leu Lys Ser Val Lys 1235 1240 1245Glu Leu Leu Gly Ile Thr Ile Met Glu Arg Ser Ser Phe Glu Lys 1250 1255 1260Asn Pro Ile Asp Phe Leu Glu Ala Lys Gly Tyr Lys Glu Val Lys 1265 1270 1275Lys Asp Leu Ile Ile Lys Leu Pro Lys Tyr Ser Leu Phe Glu Leu 1280 1285 1290Glu Asn Gly Arg Lys Arg Met Leu Ala Ser Ala Gly Glu Leu Gln 1295 1300 1305Lys Gly Asn Glu Leu Ala Leu Pro Ser Lys Tyr Val Asn Phe Leu 1310 1315 1320Tyr Leu Ala Ser His Tyr Glu Lys Leu Lys Gly Ser Pro Glu Asp 1325 1330 1335Asn Glu Gln Lys Gln Leu Phe Val Glu Gln His Lys His Tyr Leu 1340 1345 1350Asp Glu Ile Ile Glu Gln Ile Ser Glu Phe Ser Lys Arg Val Ile 1355 1360 1365Leu Ala Asp Ala Asn Leu Asp Lys Val Leu Ser Ala Tyr Asn Lys 1370 1375 1380His Arg Asp Lys Pro Ile Arg Glu Gln Ala Glu Asn Ile Ile His 1385 1390 1395Leu Phe Thr Leu Thr Asn Leu Gly Ala Pro Ala Ala Phe Lys Tyr 1400 1405 1410Phe Asp Thr Thr Ile Asp Arg Lys Arg Tyr Thr Ser Thr Lys Glu 1415 1420 1425Val Leu Asp Ala Thr Leu Ile His Gln Ser Ile Thr Gly Leu Tyr 1430 1435 1440Glu Thr Arg Ile Asp Leu Ser Gln Leu Gly Gly Asp Ser Arg Ala 1445 1450 1455Asp Tyr Pro Tyr Asp Val Pro Asp Tyr Ala Ser Gly Ser Pro Lys 1460 1465 1470Lys Lys Arg Lys Val Ser Pro Gly Gly Gly Pro Ser Ser Gly Ala 1475 1480 1485Pro Pro Pro Ser Gly Gly Ser Pro Ala Gly Ser Pro Thr Ser Thr 1490 1495 1500Glu Glu Gly Thr Ser Glu Ser Ala Thr Pro Glu Ser Gly Pro Gly 1505 1510 1515Thr Ser Thr Glu Pro Ser Glu Gly Ser Ala Pro Gly Ser Pro Ala 1520 1525 1530Gly Ser Pro Thr Ser Thr Glu Glu Gly Thr Ser Thr Glu Pro Ser 1535 1540 1545Glu Gly Ser Ala Pro Gly Thr Ser Thr Glu Pro Ser Glu Asn His 1550 1555 1560Asp Gln Glu Phe Asp Pro Pro Lys Val Tyr Pro Pro Val Pro Ala 1565 1570 1575Glu Lys Arg Lys Pro Ile Arg Val Leu Ser Leu Phe Asp Gly Ile 1580 1585 1590Ala Thr Gly Leu Leu Val Leu Lys Asp Leu Gly Ile Gln Val Asp 1595 1600 1605Arg Tyr Ile Ala Ser Glu Val Cys Glu Asp Ser Ile Thr Val Gly 1610 1615 1620Met Val Arg His Gln Gly Lys Ile Met Tyr Val Gly Asp Val Arg 1625 1630 1635Ser Val Thr Gln Lys His Ile Gln Glu Trp Gly Pro Phe Asp Leu 1640 1645 1650Val Ile Gly Gly Ser Pro Cys Asn Asp Leu Ser Ile Val Asn Pro 1655 1660 1665Ala Arg Lys Gly Leu Tyr Glu Gly Thr Gly Arg Leu Phe Phe Glu 1670 1675 1680Phe Tyr Arg Leu Leu His Asp Ala Arg Pro Lys Glu Gly Asp Asp 1685 1690 1695Arg Pro Phe Phe Trp Leu Phe Glu Asn Val Val Ala Met Gly Val 1700 1705 1710Ser Asp Lys Arg Asp Ile Ser Arg Phe Leu Glu Ser Asn Pro Val 1715 1720 1725Met Ile Asp Ala Lys Glu Val Ser Ala Ala His Arg Ala Arg Tyr 1730 1735 1740Phe Trp Gly Asn Leu Pro Gly Met Asn Arg Pro Leu Ala Ser Thr 1745 1750 1755Val Asn Asp Lys Leu Glu Leu Gln Glu Cys Leu Glu His Gly Arg 1760 1765 1770Ile Ala Lys Phe Ser Lys Val Arg Thr Ile Thr Thr Arg Ser Asn 1775 1780 1785Ser Ile Lys Gln Gly Lys Asp Gln His Phe Pro Val Phe Met Asn 1790 1795 1800Glu Lys Glu Asp Ile Leu Trp Cys Thr Glu Met Glu Arg Val Phe 1805 1810 1815Gly Phe Pro Val His Tyr Thr Asp Val Ser Asn Met Ser Arg Leu 1820 1825 1830Ala Arg Gln Arg Leu Leu Gly Arg Ser Trp Ser Val Pro Val Ile 1835 1840 1845Arg His Leu Phe Ala Pro Leu Lys Glu Tyr Phe Ala Cys Val Ser 1850 1855 1860Ser Gly Asn Ser Asn Ala Asn Ser Arg Gly Pro Ser Phe Ser Ser 1865 1870 1875Gly Leu Val Pro Leu Ser Leu Arg Gly Ser His Met Gly Pro Met 1880 1885 1890Glu Ile Tyr Lys Thr Val Ser Ala Trp Lys Arg Gln Pro Val Arg 1895 1900 1905Val Leu Ser Leu Phe Arg Asn Ile Asp Lys Val Leu Lys Ser Leu 1910 1915 1920Gly Phe Leu Glu Ser Gly Ser Gly Ser Gly Gly Gly Thr Leu Lys 1925 1930 1935Tyr Val Glu Asp Val Thr Asn Val Val Arg Arg Asp Val Glu Lys 1940 1945 1950Trp Gly Pro Phe Asp Leu Val Tyr Gly Ser Thr Gln Pro Leu Gly 1955 1960 1965Ser Ser Cys Asp Arg Cys Pro Gly Trp Tyr Met Phe Gln Phe His 1970 1975 1980Arg Ile Leu Gln Tyr Ala Leu Pro Arg Gln Glu Ser Gln Arg Pro 1985 1990 1995Phe Phe Trp Ile Phe Met Asp Asn Leu Leu Leu Thr Glu Asp Asp 2000 2005 2010Gln Glu Thr Thr Thr Arg Phe Leu Gln Thr Glu Ala Val Thr Leu 2015 2020 2025Gln Asp Val Arg Gly Arg Asp Tyr Gln Asn Ala Met Arg Val Trp 2030 2035 2040Ser Asn Ile Pro Gly Leu Lys Ser Lys His Ala Pro Leu Thr Pro 2045 2050 2055Lys Glu Glu Glu Tyr Leu Gln Ala Gln Val Arg Ser Arg Ser Lys 2060 2065 2070Leu Asp Ala Pro Lys Val Asp Leu Leu Val Lys Asn Cys Leu Leu 2075 2080 2085Pro Leu Arg Glu Tyr Phe Lys Tyr Phe Ser Gln Asn Ser Leu Pro 2090 2095 2100Leu Ser Arg Ala Asp Pro Lys Lys Lys Arg Lys Val Gly Ser Gly 2105 2110 2115Ala Thr Asn Phe Ser Leu Leu Lys Gln Ala Gly Asp Val Glu Glu 2120 2125 2130Asn Pro Gly Pro Ser Glu Leu Ile Lys Glu Asn Met His Met Lys 2135 2140 2145Leu Tyr Met Glu Gly Thr Val Asp Asn His His Phe Lys Cys Thr 2150 2155 2160Ser Glu Gly Glu Gly Lys Pro Tyr Glu Gly Thr Gln Thr Met Arg 2165 2170 2175Ile Lys Val Val Glu Gly Gly Pro Leu Pro Phe Ala Phe Asp Ile 2180 2185 2190Leu Ala Thr Ser Phe Leu Tyr Gly Ser Lys Thr Phe Ile Asn His 2195 2200 2205Thr Gln Gly Ile Pro Asp Phe Phe Lys Gln Ser Phe Pro Glu Gly 2210 2215 2220Phe Thr Trp Glu Arg Val Thr Thr Tyr Glu Asp Gly Gly Val Leu 2225 2230 2235Thr Ala Thr Gln Asp Thr Ser Leu Gln Asp Gly Cys Leu Ile Tyr 2240 2245 2250Asn Val Lys Ile Arg Gly Val Asn Phe Thr Ser Asn Gly Pro Val 2255 2260 2265Met Gln Lys Lys Thr Leu Gly Trp Glu Ala Phe Thr Glu Thr Leu 2270 2275 2280Tyr Pro Ala Asp Gly Gly Leu Glu Gly Arg Asn Asp Met Ala Leu 2285 2290 2295Lys Leu Val Gly Gly Ser His Leu Ile Ala Asn Ile Lys Thr Thr 2300 2305 2310Tyr Arg Ser Lys Lys Pro Ala Lys Asn Leu Lys Met Pro Gly Val 2315 2320 2325Tyr Tyr Val Asp Tyr Arg Leu Glu Arg Ile Lys Glu Ala Asn Asn 2330 2335 2340Glu Thr Tyr Val Glu Gln His Glu Val Ala Val Ala Arg Tyr Cys 2345 2350 2355Asp Leu Pro Ser Lys Leu Gly His Lys Leu Asn 2360 2365122391PRTArtificial sequenceSynthetic polypeptide 12Asp Ala Lys Ser Leu Thr Ala Trp Ser Arg Thr Leu Val Thr Phe Lys1 5 10 15Asp Val Phe Val Asp Phe Thr Arg Glu Glu Trp Lys Leu Leu Asp Thr 20 25 30Ala Gln Gln Ile Val Tyr Arg Asn Val Met Leu Glu Asn Tyr Lys Asn 35 40 45Leu Val Ser Leu Gly Tyr Gln Leu Thr Lys Pro Asp Val Ile Leu Arg 50 55 60Leu Glu Lys Gly Glu Glu Pro Ser Gly Ser Glu Thr Pro Gly Thr Ser65 70 75 80Glu Ser Ala Thr Pro Glu Ser Met Asp Lys Lys Tyr Ser Ile Gly Leu 85 90 95Ala Ile Gly Thr Asn Ser Val Gly Trp Ala Val Ile Thr Asp Glu Tyr 100 105 110Lys Val Pro Ser Lys Lys Phe Lys Val Leu Gly Asn Thr Asp Arg His 115 120 125Ser Ile Lys Lys Asn Leu Ile Gly Ala Leu Leu Phe Asp Ser Gly Glu 130 135 140Thr Ala Glu Ala Thr Arg Leu Lys Arg Thr Ala Arg Arg Arg Tyr Thr145 150 155 160Arg Arg Lys Asn Arg Ile Cys Tyr Leu Gln Glu Ile Phe Ser Asn Glu 165 170 175Met Ala Lys Val Asp Asp Ser Phe Phe His Arg Leu Glu Glu Ser Phe 180 185 190Leu Val Glu Glu Asp Lys Lys His Glu Arg His Pro Ile Phe Gly Asn 195 200 205Ile Val Asp Glu Val Ala Tyr His Glu Lys Tyr Pro Thr Ile Tyr His 210 215 220Leu Arg Lys Lys Leu Val Asp Ser Thr Asp Lys Ala Asp Leu Arg Leu225 230 235 240Ile Tyr Leu Ala Leu Ala His Met Ile Lys Phe Arg Gly His Phe Leu 245 250 255Ile Glu Gly Asp Leu Asn Pro Asp Asn Ser Asp Val Asp Lys Leu Phe 260 265 270Ile Gln Leu Val Gln Thr Tyr Asn Gln Leu Phe Glu Glu Asn Pro Ile 275 280 285Asn Ala Ser Gly Val Asp Ala Lys Ala Ile Leu Ser Ala Arg Leu Ser 290 295 300Lys Ser Arg Arg Leu Glu Asn Leu Ile Ala Gln Leu Pro Gly Glu Lys305 310 315 320Lys Asn Gly Leu Phe Gly Asn Leu Ile Ala Leu Ser Leu Gly Leu Thr 325 330 335Pro Asn Phe Lys Ser Asn Phe Asp Leu Ala Glu Asp Ala Lys Leu Gln 340 345 350Leu Ser Lys Asp Thr Tyr Asp Asp Asp Leu Asp Asn Leu Leu Ala Gln 355 360 365Ile Gly Asp Gln Tyr Ala Asp Leu Phe Leu Ala Ala Lys Asn Leu Ser 370 375 380Asp Ala Ile Leu Leu Ser Asp Ile Leu Arg Val Asn Thr Glu Ile Thr385 390 395 400Lys Ala Pro Leu Ser Ala Ser Met Ile Lys Arg Tyr Asp Glu His His 405 410 415Gln Asp Leu Thr Leu Leu Lys Ala Leu Val Arg Gln Gln Leu Pro Glu 420 425 430Lys Tyr Lys Glu Ile Phe Phe Asp Gln Ser Lys Asn Gly Tyr Ala Gly 435 440 445Tyr Ile Asp Gly Gly Ala Ser Gln Glu Glu Phe Tyr Lys Phe Ile Lys 450 455 460Pro Ile Leu Glu Lys Met Asp Gly Thr Glu Glu Leu Leu Val Lys Leu465 470 475 480Asn Arg Glu Asp Leu Leu Arg Lys Gln Arg Thr Phe Asp Asn Gly Ser 485 490 495Ile Pro His Gln Ile His Leu Gly Glu Leu His Ala Ile Leu Arg Arg 500 505 510Gln Glu Asp Phe Tyr Pro Phe Leu Lys Asp Asn Arg Glu Lys Ile Glu 515 520 525Lys Ile Leu Thr Phe Arg Ile Pro Tyr Tyr Val Gly Pro Leu Ala Arg 530 535 540Gly Asn Ser Arg Phe Ala Trp Met Thr Arg Lys Ser Glu Glu Thr Ile545 550 555 560Thr Pro Trp Asn Phe Glu Glu Val Val Asp Lys Gly Ala Ser Ala Gln 565 570 575Ser Phe Ile Glu Arg Met Thr Asn Phe Asp Lys Asn Leu Pro Asn Glu 580 585 590Lys Val Leu Pro Lys His Ser Leu Leu Tyr Glu Tyr Phe Thr Val Tyr 595 600 605Asn Glu Leu Thr Lys Val Lys Tyr Val Thr Glu Gly Met Arg Lys Pro 610 615 620Ala Phe Leu Ser Gly Glu Gln Lys Lys Ala Ile Val Asp Leu Leu Phe625 630 635 640Lys Thr Asn Arg Lys Val Thr Val Lys Gln Leu Lys Glu Asp Tyr Phe 645 650 655Lys Lys Ile Glu Cys Phe Asp Ser Val Glu Ile Ser Gly Val Glu Asp 660 665 670Arg Phe Asn Ala Ser Leu Gly Thr Tyr His Asp Leu Leu Lys Ile Ile 675 680 685Lys Asp Lys Asp Phe Leu Asp Asn Glu Glu Asn Glu Asp Ile Leu Glu 690 695 700Asp Ile Val Leu Thr Leu Thr Leu Phe Glu Asp Arg Glu Met Ile Glu705 710 715 720Glu Arg Leu Lys Thr Tyr Ala His Leu Phe Asp Asp Lys Val Met Lys 725 730 735Gln Leu Lys Arg Arg Arg Tyr Thr Gly Trp Gly Arg Leu Ser Arg Lys 740 745 750Leu Ile Asn Gly Ile Arg Asp Lys Gln Ser Gly Lys Thr Ile Leu Asp 755 760 765Phe Leu Lys Ser Asp Gly Phe Ala Asn Arg Asn Phe Met Gln Leu Ile 770 775 780His Asp Asp Ser Leu Thr Phe Lys Glu Asp Ile Gln Lys Ala Gln Val785 790 795 800Ser Gly Gln Gly Asp Ser Leu His Glu His Ile Ala Asn Leu Ala Gly 805 810 815Ser Pro Ala Ile Lys Lys Gly Ile Leu Gln Thr Val Lys Val Val Asp 820 825 830Glu Leu Val Lys Val Met Gly Arg His Lys Pro Glu Asn Ile Val Ile 835 840 845Glu Met Ala Arg Glu Asn Gln Thr Thr Gln Lys Gly Gln Lys Asn Ser 850 855 860Arg Glu Arg Met Lys Arg Ile Glu Glu Gly Ile Lys Glu Leu Gly Ser865 870 875 880Gln Ile Leu Lys Glu His Pro Val Glu Asn Thr Gln Leu Gln Asn Glu 885 890 895Lys Leu Tyr Leu Tyr Tyr Leu Gln Asn Gly Arg Asp Met Tyr Val Asp 900 905 910Gln Glu Leu Asp Ile Asn Arg Leu Ser Asp Tyr Asp Val Asp Ala Ile 915 920 925Val Pro Gln Ser Phe Leu Lys Asp Asp Ser Ile Asp Asn Lys Val Leu 930 935 940Thr Arg Ser Asp Lys Asn Arg Gly Lys Ser Asp Asn Val Pro Ser Glu945 950 955 960Glu Val Val Lys Lys Met Lys Asn Tyr Trp Arg Gln Leu Leu Asn Ala 965 970 975Lys Leu Ile Thr Gln Arg Lys Phe Asp Asn Leu Thr Lys Ala Glu Arg 980 985 990Gly Gly Leu Ser Glu Leu Asp Lys Ala Gly Phe Ile Lys Arg Gln Leu 995 1000 1005Val Glu Thr Arg Gln Ile Thr Lys His Val Ala Gln Ile Leu Asp 1010 1015 1020Ser Arg Met Asn Thr Lys Tyr Asp Glu Asn Asp Lys Leu Ile Arg 1025 1030 1035Glu Val Lys Val Ile Thr Leu Lys Ser Lys Leu Val Ser Asp Phe 1040 1045 1050Arg Lys Asp Phe Gln Phe Tyr Lys Val Arg Glu Ile Asn Asn Tyr 1055 1060 1065His His Ala His Asp Ala Tyr Leu Asn Ala Val Val Gly Thr Ala 1070 1075 1080Leu Ile Lys Lys Tyr Pro Lys Leu Glu Ser Glu Phe Val Tyr Gly 1085 1090 1095Asp Tyr Lys Val Tyr Asp Val Arg Lys Met Ile Ala Lys Ser Glu 1100 1105 1110Gln Glu Ile Gly Lys Ala Thr Ala Lys Tyr Phe Phe Tyr Ser Asn 1115 1120 1125Ile Met Asn Phe Phe Lys Thr Glu Ile Thr Leu Ala Asn Gly Glu 1130 1135 1140Ile Arg Lys Arg Pro Leu Ile Glu Thr Asn Gly Glu Thr Gly Glu 1145 1150 1155Ile Val Trp Asp Lys Gly Arg Asp Phe Ala Thr Val Arg Lys Val 1160 1165 1170Leu Ser Met Pro Gln Val Asn Ile Val

Lys Lys Thr Glu Val Gln 1175 1180 1185Thr Gly Gly Phe Ser Lys Glu Ser Ile Leu Pro Lys Arg Asn Ser 1190 1195 1200Asp Lys Leu Ile Ala Arg Lys Lys Asp Trp Asp Pro Lys Lys Tyr 1205 1210 1215Gly Gly Phe Asp Ser Pro Thr Val Ala Tyr Ser Val Leu Val Val 1220 1225 1230Ala Lys Val Glu Lys Gly Lys Ser Lys Lys Leu Lys Ser Val Lys 1235 1240 1245Glu Leu Leu Gly Ile Thr Ile Met Glu Arg Ser Ser Phe Glu Lys 1250 1255 1260Asn Pro Ile Asp Phe Leu Glu Ala Lys Gly Tyr Lys Glu Val Lys 1265 1270 1275Lys Asp Leu Ile Ile Lys Leu Pro Lys Tyr Ser Leu Phe Glu Leu 1280 1285 1290Glu Asn Gly Arg Lys Arg Met Leu Ala Ser Ala Gly Glu Leu Gln 1295 1300 1305Lys Gly Asn Glu Leu Ala Leu Pro Ser Lys Tyr Val Asn Phe Leu 1310 1315 1320Tyr Leu Ala Ser His Tyr Glu Lys Leu Lys Gly Ser Pro Glu Asp 1325 1330 1335Asn Glu Gln Lys Gln Leu Phe Val Glu Gln His Lys His Tyr Leu 1340 1345 1350Asp Glu Ile Ile Glu Gln Ile Ser Glu Phe Ser Lys Arg Val Ile 1355 1360 1365Leu Ala Asp Ala Asn Leu Asp Lys Val Leu Ser Ala Tyr Asn Lys 1370 1375 1380His Arg Asp Lys Pro Ile Arg Glu Gln Ala Glu Asn Ile Ile His 1385 1390 1395Leu Phe Thr Leu Thr Asn Leu Gly Ala Pro Ala Ala Phe Lys Tyr 1400 1405 1410Phe Asp Thr Thr Ile Asp Arg Lys Arg Tyr Thr Ser Thr Lys Glu 1415 1420 1425Val Leu Asp Ala Thr Leu Ile His Gln Ser Ile Thr Gly Leu Tyr 1430 1435 1440Glu Thr Arg Ile Asp Leu Ser Gln Leu Gly Gly Asp Ser Arg Ala 1445 1450 1455Asp Tyr Pro Tyr Asp Val Pro Asp Tyr Ala Ser Gly Ser Pro Lys 1460 1465 1470Lys Lys Arg Lys Val Ser Pro Gly Gly Gly Pro Ser Ser Gly Ala 1475 1480 1485Pro Pro Pro Ser Gly Gly Ser Pro Ala Gly Ser Pro Thr Ser Thr 1490 1495 1500Glu Glu Gly Thr Ser Glu Ser Ala Thr Pro Glu Ser Gly Pro Gly 1505 1510 1515Thr Ser Thr Glu Pro Ser Glu Gly Ser Ala Pro Gly Ser Pro Ala 1520 1525 1530Gly Ser Pro Thr Ser Thr Glu Glu Gly Thr Ser Thr Glu Pro Ser 1535 1540 1545Glu Gly Ser Ala Pro Gly Thr Ser Thr Glu Pro Ser Glu Asn His 1550 1555 1560Asp Gln Glu Phe Asp Pro Pro Lys Val Tyr Pro Pro Val Pro Ala 1565 1570 1575Glu Lys Arg Lys Pro Ile Arg Val Leu Ser Leu Phe Asp Gly Ile 1580 1585 1590Ala Thr Gly Leu Leu Val Leu Lys Asp Leu Gly Ile Gln Val Asp 1595 1600 1605Arg Tyr Ile Ala Ser Glu Val Cys Glu Asp Ser Ile Thr Val Gly 1610 1615 1620Met Val Arg His Gln Gly Lys Ile Met Tyr Val Gly Asp Val Arg 1625 1630 1635Ser Val Thr Gln Lys His Ile Gln Glu Trp Gly Pro Phe Asp Leu 1640 1645 1650Val Ile Gly Gly Ser Pro Cys Asn Asp Leu Ser Ile Val Asn Pro 1655 1660 1665Ala Arg Lys Gly Leu Tyr Glu Gly Thr Gly Arg Leu Phe Phe Glu 1670 1675 1680Phe Tyr Arg Leu Leu His Asp Ala Arg Pro Lys Glu Gly Asp Asp 1685 1690 1695Arg Pro Phe Phe Trp Leu Phe Glu Asn Val Val Ala Met Gly Val 1700 1705 1710Ser Asp Lys Arg Asp Ile Ser Arg Phe Leu Glu Ser Asn Pro Val 1715 1720 1725Met Ile Asp Ala Lys Glu Val Ser Ala Ala His Arg Ala Arg Tyr 1730 1735 1740Phe Trp Gly Asn Leu Pro Gly Met Asn Arg Pro Leu Ala Ser Thr 1745 1750 1755Val Asn Asp Lys Leu Glu Leu Gln Glu Cys Leu Glu His Gly Arg 1760 1765 1770Ile Ala Lys Phe Ser Lys Val Arg Thr Ile Thr Thr Arg Ser Asn 1775 1780 1785Ser Ile Lys Gln Gly Lys Asp Gln His Phe Pro Val Phe Met Asn 1790 1795 1800Glu Lys Glu Asp Ile Leu Trp Cys Thr Glu Met Glu Arg Val Phe 1805 1810 1815Gly Phe Pro Val His Tyr Thr Asp Val Ser Asn Met Ser Arg Leu 1820 1825 1830Ala Arg Gln Arg Leu Leu Gly Arg Ser Trp Ser Val Pro Val Ile 1835 1840 1845Arg His Leu Phe Ala Pro Leu Lys Glu Tyr Phe Ala Cys Val Ser 1850 1855 1860Ser Gly Asn Ser Asn Ala Asn Ser Arg Gly Pro Ser Phe Ser Ser 1865 1870 1875Gly Leu Val Pro Leu Ser Leu Arg Gly Ser His Met Gly Pro Met 1880 1885 1890Glu Ile Tyr Lys Thr Val Ser Ala Trp Lys Arg Gln Pro Val Arg 1895 1900 1905Val Leu Ser Leu Phe Arg Asn Ile Asp Lys Val Leu Lys Ser Leu 1910 1915 1920Gly Phe Leu Glu Ser Gly Ser Gly Ser Gly Gly Gly Thr Leu Lys 1925 1930 1935Tyr Val Glu Asp Val Thr Asn Val Val Arg Arg Asp Val Glu Lys 1940 1945 1950Trp Gly Pro Phe Asp Leu Val Tyr Gly Ser Thr Gln Pro Leu Gly 1955 1960 1965Ser Ser Cys Asp Arg Cys Pro Gly Trp Tyr Met Phe Gln Phe His 1970 1975 1980Arg Ile Leu Gln Tyr Ala Leu Pro Arg Gln Glu Ser Gln Arg Pro 1985 1990 1995Phe Phe Trp Ile Phe Met Asp Asn Leu Leu Leu Thr Glu Asp Asp 2000 2005 2010Gln Glu Thr Thr Thr Arg Phe Leu Gln Thr Glu Ala Val Thr Leu 2015 2020 2025Gln Asp Val Arg Gly Arg Asp Tyr Gln Asn Ala Met Arg Val Trp 2030 2035 2040Ser Asn Ile Pro Gly Leu Lys Ser Lys His Ala Pro Leu Thr Pro 2045 2050 2055Lys Glu Glu Glu Tyr Leu Gln Ala Gln Val Arg Ser Arg Ser Lys 2060 2065 2070Leu Asp Ala Pro Lys Val Asp Leu Leu Val Lys Asn Cys Leu Leu 2075 2080 2085Pro Leu Arg Glu Tyr Phe Lys Tyr Phe Ser Gln Asn Ser Leu Pro 2090 2095 2100Leu Ser Arg Ala Asp Pro Lys Lys Lys Arg Lys Val Gly Ser Gly 2105 2110 2115Ala Thr Asn Phe Ser Leu Leu Lys Gln Ala Gly Asp Val Glu Glu 2120 2125 2130Asn Pro Gly Pro Gly Ser Gly Ala Thr Asn Phe Ser Leu Leu Lys 2135 2140 2145Gln Ala Gly Asp Val Glu Glu Asn Pro Gly Pro Ser Glu Leu Ile 2150 2155 2160Lys Glu Asn Met His Met Lys Leu Tyr Met Glu Gly Thr Val Asp 2165 2170 2175Asn His His Phe Lys Cys Thr Ser Glu Gly Glu Gly Lys Pro Tyr 2180 2185 2190Glu Gly Thr Gln Thr Met Arg Ile Lys Val Val Glu Gly Gly Pro 2195 2200 2205Leu Pro Phe Ala Phe Asp Ile Leu Ala Thr Ser Phe Leu Tyr Gly 2210 2215 2220Ser Lys Thr Phe Ile Asn His Thr Gln Gly Ile Pro Asp Phe Phe 2225 2230 2235Lys Gln Ser Phe Pro Glu Gly Phe Thr Trp Glu Arg Val Thr Thr 2240 2245 2250Tyr Glu Asp Gly Gly Val Leu Thr Ala Thr Gln Asp Thr Ser Leu 2255 2260 2265Gln Asp Gly Cys Leu Ile Tyr Asn Val Lys Ile Arg Gly Val Asn 2270 2275 2280Phe Thr Ser Asn Gly Pro Val Met Gln Lys Lys Thr Leu Gly Trp 2285 2290 2295Glu Ala Phe Thr Glu Thr Leu Tyr Pro Ala Asp Gly Gly Leu Glu 2300 2305 2310Gly Arg Asn Asp Met Ala Leu Lys Leu Val Gly Gly Ser His Leu 2315 2320 2325Ile Ala Asn Ile Lys Thr Thr Tyr Arg Ser Lys Lys Pro Ala Lys 2330 2335 2340Asn Leu Lys Met Pro Gly Val Tyr Tyr Val Asp Tyr Arg Leu Glu 2345 2350 2355Arg Ile Lys Glu Ala Asn Asn Glu Thr Tyr Val Glu Gln His Glu 2360 2365 2370Val Ala Val Ala Arg Tyr Cys Asp Leu Pro Ser Lys Leu Gly His 2375 2380 2385Lys Leu Asn 2390132369PRTArtificial sequenceSynthetic polypeptide 13Asp Ala Lys Ser Leu Thr Ala Trp Ser Arg Thr Leu Val Thr Phe Lys1 5 10 15Asp Val Phe Val Asp Phe Thr Arg Glu Glu Trp Lys Leu Leu Asp Thr 20 25 30Ala Gln Gln Ile Val Tyr Arg Asn Val Met Leu Glu Asn Tyr Lys Asn 35 40 45Leu Val Ser Leu Gly Tyr Gln Leu Thr Lys Pro Asp Val Ile Leu Arg 50 55 60Leu Glu Lys Gly Glu Glu Pro Gly Gly Pro Ser Ser Gly Ala Pro Pro65 70 75 80Pro Ser Gly Gly Ser Pro Ala Gly Ser Pro Thr Ser Thr Glu Glu Gly 85 90 95Thr Ser Glu Ser Ala Thr Pro Glu Ser Gly Pro Gly Thr Ser Thr Glu 100 105 110Pro Ser Glu Gly Ser Ala Pro Gly Ser Pro Ala Gly Ser Pro Thr Ser 115 120 125Thr Glu Glu Gly Thr Ser Thr Glu Pro Ser Glu Gly Ser Ala Pro Gly 130 135 140Thr Ser Thr Glu Pro Ser Glu Met Asp Lys Lys Tyr Ser Ile Gly Leu145 150 155 160Ala Ile Gly Thr Asn Ser Val Gly Trp Ala Val Ile Thr Asp Glu Tyr 165 170 175Lys Val Pro Ser Lys Lys Phe Lys Val Leu Gly Asn Thr Asp Arg His 180 185 190Ser Ile Lys Lys Asn Leu Ile Gly Ala Leu Leu Phe Asp Ser Gly Glu 195 200 205Thr Ala Glu Ala Thr Arg Leu Lys Arg Thr Ala Arg Arg Arg Tyr Thr 210 215 220Arg Arg Lys Asn Arg Ile Cys Tyr Leu Gln Glu Ile Phe Ser Asn Glu225 230 235 240Met Ala Lys Val Asp Asp Ser Phe Phe His Arg Leu Glu Glu Ser Phe 245 250 255Leu Val Glu Glu Asp Lys Lys His Glu Arg His Pro Ile Phe Gly Asn 260 265 270Ile Val Asp Glu Val Ala Tyr His Glu Lys Tyr Pro Thr Ile Tyr His 275 280 285Leu Arg Lys Lys Leu Val Asp Ser Thr Asp Lys Ala Asp Leu Arg Leu 290 295 300Ile Tyr Leu Ala Leu Ala His Met Ile Lys Phe Arg Gly His Phe Leu305 310 315 320Ile Glu Gly Asp Leu Asn Pro Asp Asn Ser Asp Val Asp Lys Leu Phe 325 330 335Ile Gln Leu Val Gln Thr Tyr Asn Gln Leu Phe Glu Glu Asn Pro Ile 340 345 350Asn Ala Ser Gly Val Asp Ala Lys Ala Ile Leu Ser Ala Arg Leu Ser 355 360 365Lys Ser Arg Arg Leu Glu Asn Leu Ile Ala Gln Leu Pro Gly Glu Lys 370 375 380Lys Asn Gly Leu Phe Gly Asn Leu Ile Ala Leu Ser Leu Gly Leu Thr385 390 395 400Pro Asn Phe Lys Ser Asn Phe Asp Leu Ala Glu Asp Ala Lys Leu Gln 405 410 415Leu Ser Lys Asp Thr Tyr Asp Asp Asp Leu Asp Asn Leu Leu Ala Gln 420 425 430Ile Gly Asp Gln Tyr Ala Asp Leu Phe Leu Ala Ala Lys Asn Leu Ser 435 440 445Asp Ala Ile Leu Leu Ser Asp Ile Leu Arg Val Asn Thr Glu Ile Thr 450 455 460Lys Ala Pro Leu Ser Ala Ser Met Ile Lys Arg Tyr Asp Glu His His465 470 475 480Gln Asp Leu Thr Leu Leu Lys Ala Leu Val Arg Gln Gln Leu Pro Glu 485 490 495Lys Tyr Lys Glu Ile Phe Phe Asp Gln Ser Lys Asn Gly Tyr Ala Gly 500 505 510Tyr Ile Asp Gly Gly Ala Ser Gln Glu Glu Phe Tyr Lys Phe Ile Lys 515 520 525Pro Ile Leu Glu Lys Met Asp Gly Thr Glu Glu Leu Leu Val Lys Leu 530 535 540Asn Arg Glu Asp Leu Leu Arg Lys Gln Arg Thr Phe Asp Asn Gly Ser545 550 555 560Ile Pro His Gln Ile His Leu Gly Glu Leu His Ala Ile Leu Arg Arg 565 570 575Gln Glu Asp Phe Tyr Pro Phe Leu Lys Asp Asn Arg Glu Lys Ile Glu 580 585 590Lys Ile Leu Thr Phe Arg Ile Pro Tyr Tyr Val Gly Pro Leu Ala Arg 595 600 605Gly Asn Ser Arg Phe Ala Trp Met Thr Arg Lys Ser Glu Glu Thr Ile 610 615 620Thr Pro Trp Asn Phe Glu Glu Val Val Asp Lys Gly Ala Ser Ala Gln625 630 635 640Ser Phe Ile Glu Arg Met Thr Asn Phe Asp Lys Asn Leu Pro Asn Glu 645 650 655Lys Val Leu Pro Lys His Ser Leu Leu Tyr Glu Tyr Phe Thr Val Tyr 660 665 670Asn Glu Leu Thr Lys Val Lys Tyr Val Thr Glu Gly Met Arg Lys Pro 675 680 685Ala Phe Leu Ser Gly Glu Gln Lys Lys Ala Ile Val Asp Leu Leu Phe 690 695 700Lys Thr Asn Arg Lys Val Thr Val Lys Gln Leu Lys Glu Asp Tyr Phe705 710 715 720Lys Lys Ile Glu Cys Phe Asp Ser Val Glu Ile Ser Gly Val Glu Asp 725 730 735Arg Phe Asn Ala Ser Leu Gly Thr Tyr His Asp Leu Leu Lys Ile Ile 740 745 750Lys Asp Lys Asp Phe Leu Asp Asn Glu Glu Asn Glu Asp Ile Leu Glu 755 760 765Asp Ile Val Leu Thr Leu Thr Leu Phe Glu Asp Arg Glu Met Ile Glu 770 775 780Glu Arg Leu Lys Thr Tyr Ala His Leu Phe Asp Asp Lys Val Met Lys785 790 795 800Gln Leu Lys Arg Arg Arg Tyr Thr Gly Trp Gly Arg Leu Ser Arg Lys 805 810 815Leu Ile Asn Gly Ile Arg Asp Lys Gln Ser Gly Lys Thr Ile Leu Asp 820 825 830Phe Leu Lys Ser Asp Gly Phe Ala Asn Arg Asn Phe Met Gln Leu Ile 835 840 845His Asp Asp Ser Leu Thr Phe Lys Glu Asp Ile Gln Lys Ala Gln Val 850 855 860Ser Gly Gln Gly Asp Ser Leu His Glu His Ile Ala Asn Leu Ala Gly865 870 875 880Ser Pro Ala Ile Lys Lys Gly Ile Leu Gln Thr Val Lys Val Val Asp 885 890 895Glu Leu Val Lys Val Met Gly Arg His Lys Pro Glu Asn Ile Val Ile 900 905 910Glu Met Ala Arg Glu Asn Gln Thr Thr Gln Lys Gly Gln Lys Asn Ser 915 920 925Arg Glu Arg Met Lys Arg Ile Glu Glu Gly Ile Lys Glu Leu Gly Ser 930 935 940Gln Ile Leu Lys Glu His Pro Val Glu Asn Thr Gln Leu Gln Asn Glu945 950 955 960Lys Leu Tyr Leu Tyr Tyr Leu Gln Asn Gly Arg Asp Met Tyr Val Asp 965 970 975Gln Glu Leu Asp Ile Asn Arg Leu Ser Asp Tyr Asp Val Asp Ala Ile 980 985 990Val Pro Gln Ser Phe Leu Lys Asp Asp Ser Ile Asp Asn Lys Val Leu 995 1000 1005Thr Arg Ser Asp Lys Asn Arg Gly Lys Ser Asp Asn Val Pro Ser 1010 1015 1020Glu Glu Val Val Lys Lys Met Lys Asn Tyr Trp Arg Gln Leu Leu 1025 1030 1035Asn Ala Lys Leu Ile Thr Gln Arg Lys Phe Asp Asn Leu Thr Lys 1040 1045 1050Ala Glu Arg Gly Gly Leu Ser Glu Leu Asp Lys Ala Gly Phe Ile 1055 1060 1065Lys Arg Gln Leu Val Glu Thr Arg Gln Ile Thr Lys His Val Ala 1070 1075 1080Gln Ile Leu Asp Ser Arg Met Asn Thr Lys Tyr Asp Glu Asn Asp 1085 1090 1095Lys Leu Ile Arg Glu Val Lys Val Ile Thr Leu Lys Ser Lys Leu 1100 1105 1110Val Ser Asp Phe Arg Lys Asp Phe Gln Phe Tyr Lys Val Arg Glu 1115 1120 1125Ile Asn Asn Tyr His His Ala His Asp Ala Tyr Leu Asn Ala Val 1130 1135 1140Val Gly Thr Ala Leu Ile Lys Lys Tyr Pro Lys Leu Glu Ser Glu 1145 1150 1155Phe Val Tyr Gly Asp Tyr Lys Val Tyr Asp Val Arg Lys Met Ile 1160 1165 1170Ala Lys Ser Glu Gln Glu Ile Gly Lys Ala Thr Ala Lys Tyr Phe 1175 1180 1185Phe Tyr Ser Asn Ile Met Asn Phe Phe Lys Thr Glu Ile Thr Leu 1190 1195 1200Ala Asn Gly Glu Ile Arg Lys Arg Pro Leu Ile Glu Thr Asn Gly 1205 1210 1215Glu Thr Gly Glu Ile Val Trp Asp Lys Gly Arg Asp Phe Ala Thr 1220 1225

1230Val Arg Lys Val Leu Ser Met Pro Gln Val Asn Ile Val Lys Lys 1235 1240 1245Thr Glu Val Gln Thr Gly Gly Phe Ser Lys Glu Ser Ile Leu Pro 1250 1255 1260Lys Arg Asn Ser Asp Lys Leu Ile Ala Arg Lys Lys Asp Trp Asp 1265 1270 1275Pro Lys Lys Tyr Gly Gly Phe Asp Ser Pro Thr Val Ala Tyr Ser 1280 1285 1290Val Leu Val Val Ala Lys Val Glu Lys Gly Lys Ser Lys Lys Leu 1295 1300 1305Lys Ser Val Lys Glu Leu Leu Gly Ile Thr Ile Met Glu Arg Ser 1310 1315 1320Ser Phe Glu Lys Asn Pro Ile Asp Phe Leu Glu Ala Lys Gly Tyr 1325 1330 1335Lys Glu Val Lys Lys Asp Leu Ile Ile Lys Leu Pro Lys Tyr Ser 1340 1345 1350Leu Phe Glu Leu Glu Asn Gly Arg Lys Arg Met Leu Ala Ser Ala 1355 1360 1365Gly Glu Leu Gln Lys Gly Asn Glu Leu Ala Leu Pro Ser Lys Tyr 1370 1375 1380Val Asn Phe Leu Tyr Leu Ala Ser His Tyr Glu Lys Leu Lys Gly 1385 1390 1395Ser Pro Glu Asp Asn Glu Gln Lys Gln Leu Phe Val Glu Gln His 1400 1405 1410Lys His Tyr Leu Asp Glu Ile Ile Glu Gln Ile Ser Glu Phe Ser 1415 1420 1425Lys Arg Val Ile Leu Ala Asp Ala Asn Leu Asp Lys Val Leu Ser 1430 1435 1440Ala Tyr Asn Lys His Arg Asp Lys Pro Ile Arg Glu Gln Ala Glu 1445 1450 1455Asn Ile Ile His Leu Phe Thr Leu Thr Asn Leu Gly Ala Pro Ala 1460 1465 1470Ala Phe Lys Tyr Phe Asp Thr Thr Ile Asp Arg Lys Arg Tyr Thr 1475 1480 1485Ser Thr Lys Glu Val Leu Asp Ala Thr Leu Ile His Gln Ser Ile 1490 1495 1500Thr Gly Leu Tyr Glu Thr Arg Ile Asp Leu Ser Gln Leu Gly Gly 1505 1510 1515Asp Ser Arg Ala Asp Tyr Pro Tyr Asp Val Pro Asp Tyr Ala Ser 1520 1525 1530Gly Ser Pro Lys Lys Lys Arg Lys Val Ser Pro Gly Ser Gly Ser 1535 1540 1545Glu Thr Pro Gly Thr Ser Glu Ser Ala Thr Pro Glu Ser Asn His 1550 1555 1560Asp Gln Glu Phe Asp Pro Pro Lys Val Tyr Pro Pro Val Pro Ala 1565 1570 1575Glu Lys Arg Lys Pro Ile Arg Val Leu Ser Leu Phe Asp Gly Ile 1580 1585 1590Ala Thr Gly Leu Leu Val Leu Lys Asp Leu Gly Ile Gln Val Asp 1595 1600 1605Arg Tyr Ile Ala Ser Glu Val Cys Glu Asp Ser Ile Thr Val Gly 1610 1615 1620Met Val Arg His Gln Gly Lys Ile Met Tyr Val Gly Asp Val Arg 1625 1630 1635Ser Val Thr Gln Lys His Ile Gln Glu Trp Gly Pro Phe Asp Leu 1640 1645 1650Val Ile Gly Gly Ser Pro Cys Asn Asp Leu Ser Ile Val Asn Pro 1655 1660 1665Ala Arg Lys Gly Leu Tyr Glu Gly Thr Gly Arg Leu Phe Phe Glu 1670 1675 1680Phe Tyr Arg Leu Leu His Asp Ala Arg Pro Lys Glu Gly Asp Asp 1685 1690 1695Arg Pro Phe Phe Trp Leu Phe Glu Asn Val Val Ala Met Gly Val 1700 1705 1710Ser Asp Lys Arg Asp Ile Ser Arg Phe Leu Glu Ser Asn Pro Val 1715 1720 1725Met Ile Asp Ala Lys Glu Val Ser Ala Ala His Arg Ala Arg Tyr 1730 1735 1740Phe Trp Gly Asn Leu Pro Gly Met Asn Arg Pro Leu Ala Ser Thr 1745 1750 1755Val Asn Asp Lys Leu Glu Leu Gln Glu Cys Leu Glu His Gly Arg 1760 1765 1770Ile Ala Lys Phe Ser Lys Val Arg Thr Ile Thr Thr Arg Ser Asn 1775 1780 1785Ser Ile Lys Gln Gly Lys Asp Gln His Phe Pro Val Phe Met Asn 1790 1795 1800Glu Lys Glu Asp Ile Leu Trp Cys Thr Glu Met Glu Arg Val Phe 1805 1810 1815Gly Phe Pro Val His Tyr Thr Asp Val Ser Asn Met Ser Arg Leu 1820 1825 1830Ala Arg Gln Arg Leu Leu Gly Arg Ser Trp Ser Val Pro Val Ile 1835 1840 1845Arg His Leu Phe Ala Pro Leu Lys Glu Tyr Phe Ala Cys Val Ser 1850 1855 1860Ser Gly Asn Ser Asn Ala Asn Ser Arg Gly Pro Ser Phe Ser Ser 1865 1870 1875Gly Leu Val Pro Leu Ser Leu Arg Gly Ser His Met Gly Pro Met 1880 1885 1890Glu Ile Tyr Lys Thr Val Ser Ala Trp Lys Arg Gln Pro Val Arg 1895 1900 1905Val Leu Ser Leu Phe Arg Asn Ile Asp Lys Val Leu Lys Ser Leu 1910 1915 1920Gly Phe Leu Glu Ser Gly Ser Gly Ser Gly Gly Gly Thr Leu Lys 1925 1930 1935Tyr Val Glu Asp Val Thr Asn Val Val Arg Arg Asp Val Glu Lys 1940 1945 1950Trp Gly Pro Phe Asp Leu Val Tyr Gly Ser Thr Gln Pro Leu Gly 1955 1960 1965Ser Ser Cys Asp Arg Cys Pro Gly Trp Tyr Met Phe Gln Phe His 1970 1975 1980Arg Ile Leu Gln Tyr Ala Leu Pro Arg Gln Glu Ser Gln Arg Pro 1985 1990 1995Phe Phe Trp Ile Phe Met Asp Asn Leu Leu Leu Thr Glu Asp Asp 2000 2005 2010Gln Glu Thr Thr Thr Arg Phe Leu Gln Thr Glu Ala Val Thr Leu 2015 2020 2025Gln Asp Val Arg Gly Arg Asp Tyr Gln Asn Ala Met Arg Val Trp 2030 2035 2040Ser Asn Ile Pro Gly Leu Lys Ser Lys His Ala Pro Leu Thr Pro 2045 2050 2055Lys Glu Glu Glu Tyr Leu Gln Ala Gln Val Arg Ser Arg Ser Lys 2060 2065 2070Leu Asp Ala Pro Lys Val Asp Leu Leu Val Lys Asn Cys Leu Leu 2075 2080 2085Pro Leu Arg Glu Tyr Phe Lys Tyr Phe Ser Gln Asn Ser Leu Pro 2090 2095 2100Leu Ser Arg Ala Asp Pro Lys Lys Lys Arg Lys Val Gly Ser Gly 2105 2110 2115Ala Thr Asn Phe Ser Leu Leu Lys Gln Ala Gly Asp Val Glu Glu 2120 2125 2130Asn Pro Gly Pro Ser Glu Leu Ile Lys Glu Asn Met His Met Lys 2135 2140 2145Leu Tyr Met Glu Gly Thr Val Asp Asn His His Phe Lys Cys Thr 2150 2155 2160Ser Glu Gly Glu Gly Lys Pro Tyr Glu Gly Thr Gln Thr Met Arg 2165 2170 2175Ile Lys Val Val Glu Gly Gly Pro Leu Pro Phe Ala Phe Asp Ile 2180 2185 2190Leu Ala Thr Ser Phe Leu Tyr Gly Ser Lys Thr Phe Ile Asn His 2195 2200 2205Thr Gln Gly Ile Pro Asp Phe Phe Lys Gln Ser Phe Pro Glu Gly 2210 2215 2220Phe Thr Trp Glu Arg Val Thr Thr Tyr Glu Asp Gly Gly Val Leu 2225 2230 2235Thr Ala Thr Gln Asp Thr Ser Leu Gln Asp Gly Cys Leu Ile Tyr 2240 2245 2250Asn Val Lys Ile Arg Gly Val Asn Phe Thr Ser Asn Gly Pro Val 2255 2260 2265Met Gln Lys Lys Thr Leu Gly Trp Glu Ala Phe Thr Glu Thr Leu 2270 2275 2280Tyr Pro Ala Asp Gly Gly Leu Glu Gly Arg Asn Asp Met Ala Leu 2285 2290 2295Lys Leu Val Gly Gly Ser His Leu Ile Ala Asn Ile Lys Thr Thr 2300 2305 2310Tyr Arg Ser Lys Lys Pro Ala Lys Asn Leu Lys Met Pro Gly Val 2315 2320 2325Tyr Tyr Val Asp Tyr Arg Leu Glu Arg Ile Lys Glu Ala Asn Asn 2330 2335 2340Glu Thr Tyr Val Glu Gln His Glu Val Ala Val Ala Arg Tyr Cys 2345 2350 2355Asp Leu Pro Ser Lys Leu Gly His Lys Leu Asn 2360 2365142391PRTArtificial sequenceSynthetic polypeptide 14Asp Ala Lys Ser Leu Thr Ala Trp Ser Arg Thr Leu Val Thr Phe Lys1 5 10 15Asp Val Phe Val Asp Phe Thr Arg Glu Glu Trp Lys Leu Leu Asp Thr 20 25 30Ala Gln Gln Ile Val Tyr Arg Asn Val Met Leu Glu Asn Tyr Lys Asn 35 40 45Leu Val Ser Leu Gly Tyr Gln Leu Thr Lys Pro Asp Val Ile Leu Arg 50 55 60Leu Glu Lys Gly Glu Glu Pro Gly Gly Pro Ser Ser Gly Ala Pro Pro65 70 75 80Pro Ser Gly Gly Ser Pro Ala Gly Ser Pro Thr Ser Thr Glu Glu Gly 85 90 95Thr Ser Glu Ser Ala Thr Pro Glu Ser Gly Pro Gly Thr Ser Thr Glu 100 105 110Pro Ser Glu Gly Ser Ala Pro Gly Ser Pro Ala Gly Ser Pro Thr Ser 115 120 125Thr Glu Glu Gly Thr Ser Thr Glu Pro Ser Glu Gly Ser Ala Pro Gly 130 135 140Thr Ser Thr Glu Pro Ser Glu Met Asp Lys Lys Tyr Ser Ile Gly Leu145 150 155 160Ala Ile Gly Thr Asn Ser Val Gly Trp Ala Val Ile Thr Asp Glu Tyr 165 170 175Lys Val Pro Ser Lys Lys Phe Lys Val Leu Gly Asn Thr Asp Arg His 180 185 190Ser Ile Lys Lys Asn Leu Ile Gly Ala Leu Leu Phe Asp Ser Gly Glu 195 200 205Thr Ala Glu Ala Thr Arg Leu Lys Arg Thr Ala Arg Arg Arg Tyr Thr 210 215 220Arg Arg Lys Asn Arg Ile Cys Tyr Leu Gln Glu Ile Phe Ser Asn Glu225 230 235 240Met Ala Lys Val Asp Asp Ser Phe Phe His Arg Leu Glu Glu Ser Phe 245 250 255Leu Val Glu Glu Asp Lys Lys His Glu Arg His Pro Ile Phe Gly Asn 260 265 270Ile Val Asp Glu Val Ala Tyr His Glu Lys Tyr Pro Thr Ile Tyr His 275 280 285Leu Arg Lys Lys Leu Val Asp Ser Thr Asp Lys Ala Asp Leu Arg Leu 290 295 300Ile Tyr Leu Ala Leu Ala His Met Ile Lys Phe Arg Gly His Phe Leu305 310 315 320Ile Glu Gly Asp Leu Asn Pro Asp Asn Ser Asp Val Asp Lys Leu Phe 325 330 335Ile Gln Leu Val Gln Thr Tyr Asn Gln Leu Phe Glu Glu Asn Pro Ile 340 345 350Asn Ala Ser Gly Val Asp Ala Lys Ala Ile Leu Ser Ala Arg Leu Ser 355 360 365Lys Ser Arg Arg Leu Glu Asn Leu Ile Ala Gln Leu Pro Gly Glu Lys 370 375 380Lys Asn Gly Leu Phe Gly Asn Leu Ile Ala Leu Ser Leu Gly Leu Thr385 390 395 400Pro Asn Phe Lys Ser Asn Phe Asp Leu Ala Glu Asp Ala Lys Leu Gln 405 410 415Leu Ser Lys Asp Thr Tyr Asp Asp Asp Leu Asp Asn Leu Leu Ala Gln 420 425 430Ile Gly Asp Gln Tyr Ala Asp Leu Phe Leu Ala Ala Lys Asn Leu Ser 435 440 445Asp Ala Ile Leu Leu Ser Asp Ile Leu Arg Val Asn Thr Glu Ile Thr 450 455 460Lys Ala Pro Leu Ser Ala Ser Met Ile Lys Arg Tyr Asp Glu His His465 470 475 480Gln Asp Leu Thr Leu Leu Lys Ala Leu Val Arg Gln Gln Leu Pro Glu 485 490 495Lys Tyr Lys Glu Ile Phe Phe Asp Gln Ser Lys Asn Gly Tyr Ala Gly 500 505 510Tyr Ile Asp Gly Gly Ala Ser Gln Glu Glu Phe Tyr Lys Phe Ile Lys 515 520 525Pro Ile Leu Glu Lys Met Asp Gly Thr Glu Glu Leu Leu Val Lys Leu 530 535 540Asn Arg Glu Asp Leu Leu Arg Lys Gln Arg Thr Phe Asp Asn Gly Ser545 550 555 560Ile Pro His Gln Ile His Leu Gly Glu Leu His Ala Ile Leu Arg Arg 565 570 575Gln Glu Asp Phe Tyr Pro Phe Leu Lys Asp Asn Arg Glu Lys Ile Glu 580 585 590Lys Ile Leu Thr Phe Arg Ile Pro Tyr Tyr Val Gly Pro Leu Ala Arg 595 600 605Gly Asn Ser Arg Phe Ala Trp Met Thr Arg Lys Ser Glu Glu Thr Ile 610 615 620Thr Pro Trp Asn Phe Glu Glu Val Val Asp Lys Gly Ala Ser Ala Gln625 630 635 640Ser Phe Ile Glu Arg Met Thr Asn Phe Asp Lys Asn Leu Pro Asn Glu 645 650 655Lys Val Leu Pro Lys His Ser Leu Leu Tyr Glu Tyr Phe Thr Val Tyr 660 665 670Asn Glu Leu Thr Lys Val Lys Tyr Val Thr Glu Gly Met Arg Lys Pro 675 680 685Ala Phe Leu Ser Gly Glu Gln Lys Lys Ala Ile Val Asp Leu Leu Phe 690 695 700Lys Thr Asn Arg Lys Val Thr Val Lys Gln Leu Lys Glu Asp Tyr Phe705 710 715 720Lys Lys Ile Glu Cys Phe Asp Ser Val Glu Ile Ser Gly Val Glu Asp 725 730 735Arg Phe Asn Ala Ser Leu Gly Thr Tyr His Asp Leu Leu Lys Ile Ile 740 745 750Lys Asp Lys Asp Phe Leu Asp Asn Glu Glu Asn Glu Asp Ile Leu Glu 755 760 765Asp Ile Val Leu Thr Leu Thr Leu Phe Glu Asp Arg Glu Met Ile Glu 770 775 780Glu Arg Leu Lys Thr Tyr Ala His Leu Phe Asp Asp Lys Val Met Lys785 790 795 800Gln Leu Lys Arg Arg Arg Tyr Thr Gly Trp Gly Arg Leu Ser Arg Lys 805 810 815Leu Ile Asn Gly Ile Arg Asp Lys Gln Ser Gly Lys Thr Ile Leu Asp 820 825 830Phe Leu Lys Ser Asp Gly Phe Ala Asn Arg Asn Phe Met Gln Leu Ile 835 840 845His Asp Asp Ser Leu Thr Phe Lys Glu Asp Ile Gln Lys Ala Gln Val 850 855 860Ser Gly Gln Gly Asp Ser Leu His Glu His Ile Ala Asn Leu Ala Gly865 870 875 880Ser Pro Ala Ile Lys Lys Gly Ile Leu Gln Thr Val Lys Val Val Asp 885 890 895Glu Leu Val Lys Val Met Gly Arg His Lys Pro Glu Asn Ile Val Ile 900 905 910Glu Met Ala Arg Glu Asn Gln Thr Thr Gln Lys Gly Gln Lys Asn Ser 915 920 925Arg Glu Arg Met Lys Arg Ile Glu Glu Gly Ile Lys Glu Leu Gly Ser 930 935 940Gln Ile Leu Lys Glu His Pro Val Glu Asn Thr Gln Leu Gln Asn Glu945 950 955 960Lys Leu Tyr Leu Tyr Tyr Leu Gln Asn Gly Arg Asp Met Tyr Val Asp 965 970 975Gln Glu Leu Asp Ile Asn Arg Leu Ser Asp Tyr Asp Val Asp Ala Ile 980 985 990Val Pro Gln Ser Phe Leu Lys Asp Asp Ser Ile Asp Asn Lys Val Leu 995 1000 1005Thr Arg Ser Asp Lys Asn Arg Gly Lys Ser Asp Asn Val Pro Ser 1010 1015 1020Glu Glu Val Val Lys Lys Met Lys Asn Tyr Trp Arg Gln Leu Leu 1025 1030 1035Asn Ala Lys Leu Ile Thr Gln Arg Lys Phe Asp Asn Leu Thr Lys 1040 1045 1050Ala Glu Arg Gly Gly Leu Ser Glu Leu Asp Lys Ala Gly Phe Ile 1055 1060 1065Lys Arg Gln Leu Val Glu Thr Arg Gln Ile Thr Lys His Val Ala 1070 1075 1080Gln Ile Leu Asp Ser Arg Met Asn Thr Lys Tyr Asp Glu Asn Asp 1085 1090 1095Lys Leu Ile Arg Glu Val Lys Val Ile Thr Leu Lys Ser Lys Leu 1100 1105 1110Val Ser Asp Phe Arg Lys Asp Phe Gln Phe Tyr Lys Val Arg Glu 1115 1120 1125Ile Asn Asn Tyr His His Ala His Asp Ala Tyr Leu Asn Ala Val 1130 1135 1140Val Gly Thr Ala Leu Ile Lys Lys Tyr Pro Lys Leu Glu Ser Glu 1145 1150 1155Phe Val Tyr Gly Asp Tyr Lys Val Tyr Asp Val Arg Lys Met Ile 1160 1165 1170Ala Lys Ser Glu Gln Glu Ile Gly Lys Ala Thr Ala Lys Tyr Phe 1175 1180 1185Phe Tyr Ser Asn Ile Met Asn Phe Phe Lys Thr Glu Ile Thr Leu 1190 1195 1200Ala Asn Gly Glu Ile Arg Lys Arg Pro Leu Ile Glu Thr Asn Gly 1205 1210 1215Glu Thr Gly Glu Ile Val Trp Asp Lys Gly Arg Asp Phe Ala Thr 1220 1225 1230Val Arg Lys Val Leu Ser Met Pro Gln Val Asn Ile Val Lys Lys 1235 1240 1245Thr Glu Val Gln Thr Gly Gly Phe Ser Lys Glu Ser Ile Leu Pro 1250 1255 1260Lys Arg Asn Ser Asp Lys Leu Ile Ala Arg Lys Lys Asp Trp Asp 1265 1270 1275Pro Lys Lys Tyr Gly Gly Phe Asp Ser Pro Thr Val Ala Tyr Ser 1280 1285 1290Val Leu Val Val Ala Lys Val Glu Lys Gly Lys Ser Lys Lys Leu 1295 1300 1305Lys

Ser Val Lys Glu Leu Leu Gly Ile Thr Ile Met Glu Arg Ser 1310 1315 1320Ser Phe Glu Lys Asn Pro Ile Asp Phe Leu Glu Ala Lys Gly Tyr 1325 1330 1335Lys Glu Val Lys Lys Asp Leu Ile Ile Lys Leu Pro Lys Tyr Ser 1340 1345 1350Leu Phe Glu Leu Glu Asn Gly Arg Lys Arg Met Leu Ala Ser Ala 1355 1360 1365Gly Glu Leu Gln Lys Gly Asn Glu Leu Ala Leu Pro Ser Lys Tyr 1370 1375 1380Val Asn Phe Leu Tyr Leu Ala Ser His Tyr Glu Lys Leu Lys Gly 1385 1390 1395Ser Pro Glu Asp Asn Glu Gln Lys Gln Leu Phe Val Glu Gln His 1400 1405 1410Lys His Tyr Leu Asp Glu Ile Ile Glu Gln Ile Ser Glu Phe Ser 1415 1420 1425Lys Arg Val Ile Leu Ala Asp Ala Asn Leu Asp Lys Val Leu Ser 1430 1435 1440Ala Tyr Asn Lys His Arg Asp Lys Pro Ile Arg Glu Gln Ala Glu 1445 1450 1455Asn Ile Ile His Leu Phe Thr Leu Thr Asn Leu Gly Ala Pro Ala 1460 1465 1470Ala Phe Lys Tyr Phe Asp Thr Thr Ile Asp Arg Lys Arg Tyr Thr 1475 1480 1485Ser Thr Lys Glu Val Leu Asp Ala Thr Leu Ile His Gln Ser Ile 1490 1495 1500Thr Gly Leu Tyr Glu Thr Arg Ile Asp Leu Ser Gln Leu Gly Gly 1505 1510 1515Asp Ser Arg Ala Asp Tyr Pro Tyr Asp Val Pro Asp Tyr Ala Ser 1520 1525 1530Gly Ser Pro Lys Lys Lys Arg Lys Val Ser Pro Gly Ser Gly Ser 1535 1540 1545Glu Thr Pro Gly Thr Ser Glu Ser Ala Thr Pro Glu Ser Asn His 1550 1555 1560Asp Gln Glu Phe Asp Pro Pro Lys Val Tyr Pro Pro Val Pro Ala 1565 1570 1575Glu Lys Arg Lys Pro Ile Arg Val Leu Ser Leu Phe Asp Gly Ile 1580 1585 1590Ala Thr Gly Leu Leu Val Leu Lys Asp Leu Gly Ile Gln Val Asp 1595 1600 1605Arg Tyr Ile Ala Ser Glu Val Cys Glu Asp Ser Ile Thr Val Gly 1610 1615 1620Met Val Arg His Gln Gly Lys Ile Met Tyr Val Gly Asp Val Arg 1625 1630 1635Ser Val Thr Gln Lys His Ile Gln Glu Trp Gly Pro Phe Asp Leu 1640 1645 1650Val Ile Gly Gly Ser Pro Cys Asn Asp Leu Ser Ile Val Asn Pro 1655 1660 1665Ala Arg Lys Gly Leu Tyr Glu Gly Thr Gly Arg Leu Phe Phe Glu 1670 1675 1680Phe Tyr Arg Leu Leu His Asp Ala Arg Pro Lys Glu Gly Asp Asp 1685 1690 1695Arg Pro Phe Phe Trp Leu Phe Glu Asn Val Val Ala Met Gly Val 1700 1705 1710Ser Asp Lys Arg Asp Ile Ser Arg Phe Leu Glu Ser Asn Pro Val 1715 1720 1725Met Ile Asp Ala Lys Glu Val Ser Ala Ala His Arg Ala Arg Tyr 1730 1735 1740Phe Trp Gly Asn Leu Pro Gly Met Asn Arg Pro Leu Ala Ser Thr 1745 1750 1755Val Asn Asp Lys Leu Glu Leu Gln Glu Cys Leu Glu His Gly Arg 1760 1765 1770Ile Ala Lys Phe Ser Lys Val Arg Thr Ile Thr Thr Arg Ser Asn 1775 1780 1785Ser Ile Lys Gln Gly Lys Asp Gln His Phe Pro Val Phe Met Asn 1790 1795 1800Glu Lys Glu Asp Ile Leu Trp Cys Thr Glu Met Glu Arg Val Phe 1805 1810 1815Gly Phe Pro Val His Tyr Thr Asp Val Ser Asn Met Ser Arg Leu 1820 1825 1830Ala Arg Gln Arg Leu Leu Gly Arg Ser Trp Ser Val Pro Val Ile 1835 1840 1845Arg His Leu Phe Ala Pro Leu Lys Glu Tyr Phe Ala Cys Val Ser 1850 1855 1860Ser Gly Asn Ser Asn Ala Asn Ser Arg Gly Pro Ser Phe Ser Ser 1865 1870 1875Gly Leu Val Pro Leu Ser Leu Arg Gly Ser His Met Gly Pro Met 1880 1885 1890Glu Ile Tyr Lys Thr Val Ser Ala Trp Lys Arg Gln Pro Val Arg 1895 1900 1905Val Leu Ser Leu Phe Arg Asn Ile Asp Lys Val Leu Lys Ser Leu 1910 1915 1920Gly Phe Leu Glu Ser Gly Ser Gly Ser Gly Gly Gly Thr Leu Lys 1925 1930 1935Tyr Val Glu Asp Val Thr Asn Val Val Arg Arg Asp Val Glu Lys 1940 1945 1950Trp Gly Pro Phe Asp Leu Val Tyr Gly Ser Thr Gln Pro Leu Gly 1955 1960 1965Ser Ser Cys Asp Arg Cys Pro Gly Trp Tyr Met Phe Gln Phe His 1970 1975 1980Arg Ile Leu Gln Tyr Ala Leu Pro Arg Gln Glu Ser Gln Arg Pro 1985 1990 1995Phe Phe Trp Ile Phe Met Asp Asn Leu Leu Leu Thr Glu Asp Asp 2000 2005 2010Gln Glu Thr Thr Thr Arg Phe Leu Gln Thr Glu Ala Val Thr Leu 2015 2020 2025Gln Asp Val Arg Gly Arg Asp Tyr Gln Asn Ala Met Arg Val Trp 2030 2035 2040Ser Asn Ile Pro Gly Leu Lys Ser Lys His Ala Pro Leu Thr Pro 2045 2050 2055Lys Glu Glu Glu Tyr Leu Gln Ala Gln Val Arg Ser Arg Ser Lys 2060 2065 2070Leu Asp Ala Pro Lys Val Asp Leu Leu Val Lys Asn Cys Leu Leu 2075 2080 2085Pro Leu Arg Glu Tyr Phe Lys Tyr Phe Ser Gln Asn Ser Leu Pro 2090 2095 2100Leu Ser Arg Ala Asp Pro Lys Lys Lys Arg Lys Val Gly Ser Gly 2105 2110 2115Ala Thr Asn Phe Ser Leu Leu Lys Gln Ala Gly Asp Val Glu Glu 2120 2125 2130Asn Pro Gly Pro Gly Ser Gly Ala Thr Asn Phe Ser Leu Leu Lys 2135 2140 2145Gln Ala Gly Asp Val Glu Glu Asn Pro Gly Pro Ser Glu Leu Ile 2150 2155 2160Lys Glu Asn Met His Met Lys Leu Tyr Met Glu Gly Thr Val Asp 2165 2170 2175Asn His His Phe Lys Cys Thr Ser Glu Gly Glu Gly Lys Pro Tyr 2180 2185 2190Glu Gly Thr Gln Thr Met Arg Ile Lys Val Val Glu Gly Gly Pro 2195 2200 2205Leu Pro Phe Ala Phe Asp Ile Leu Ala Thr Ser Phe Leu Tyr Gly 2210 2215 2220Ser Lys Thr Phe Ile Asn His Thr Gln Gly Ile Pro Asp Phe Phe 2225 2230 2235Lys Gln Ser Phe Pro Glu Gly Phe Thr Trp Glu Arg Val Thr Thr 2240 2245 2250Tyr Glu Asp Gly Gly Val Leu Thr Ala Thr Gln Asp Thr Ser Leu 2255 2260 2265Gln Asp Gly Cys Leu Ile Tyr Asn Val Lys Ile Arg Gly Val Asn 2270 2275 2280Phe Thr Ser Asn Gly Pro Val Met Gln Lys Lys Thr Leu Gly Trp 2285 2290 2295Glu Ala Phe Thr Glu Thr Leu Tyr Pro Ala Asp Gly Gly Leu Glu 2300 2305 2310Gly Arg Asn Asp Met Ala Leu Lys Leu Val Gly Gly Ser His Leu 2315 2320 2325Ile Ala Asn Ile Lys Thr Thr Tyr Arg Ser Lys Lys Pro Ala Lys 2330 2335 2340Asn Leu Lys Met Pro Gly Val Tyr Tyr Val Asp Tyr Arg Leu Glu 2345 2350 2355Arg Ile Lys Glu Ala Asn Asn Glu Thr Tyr Val Glu Gln His Glu 2360 2365 2370Val Ala Val Ala Arg Tyr Cys Asp Leu Pro Ser Lys Leu Gly His 2375 2380 2385Lys Leu Asn 2390152345PRTArtificial sequenceSynthetic polypeptide 15Asn His Asp Gln Glu Phe Asp Pro Pro Lys Val Tyr Pro Pro Val Pro1 5 10 15Ala Glu Lys Arg Lys Pro Ile Arg Val Leu Ser Leu Phe Asp Gly Ile 20 25 30Ala Thr Gly Leu Leu Val Leu Lys Asp Leu Gly Ile Gln Val Asp Arg 35 40 45Tyr Ile Ala Ser Glu Val Cys Glu Asp Ser Ile Thr Val Gly Met Val 50 55 60Arg His Gln Gly Lys Ile Met Tyr Val Gly Asp Val Arg Ser Val Thr65 70 75 80Gln Lys His Ile Gln Glu Trp Gly Pro Phe Asp Leu Val Ile Gly Gly 85 90 95Ser Pro Cys Asn Asp Leu Ser Ile Val Asn Pro Ala Arg Lys Gly Leu 100 105 110Tyr Glu Gly Thr Gly Arg Leu Phe Phe Glu Phe Tyr Arg Leu Leu His 115 120 125Asp Ala Arg Pro Lys Glu Gly Asp Asp Arg Pro Phe Phe Trp Leu Phe 130 135 140Glu Asn Val Val Ala Met Gly Val Ser Asp Lys Arg Asp Ile Ser Arg145 150 155 160Phe Leu Glu Ser Asn Pro Val Met Ile Asp Ala Lys Glu Val Ser Ala 165 170 175Ala His Arg Ala Arg Tyr Phe Trp Gly Asn Leu Pro Gly Met Asn Arg 180 185 190Pro Leu Ala Ser Thr Val Asn Asp Lys Leu Glu Leu Gln Glu Cys Leu 195 200 205Glu His Gly Arg Ile Ala Lys Phe Ser Lys Val Arg Thr Ile Thr Thr 210 215 220Arg Ser Asn Ser Ile Lys Gln Gly Lys Asp Gln His Phe Pro Val Phe225 230 235 240Met Asn Glu Lys Glu Asp Ile Leu Trp Cys Thr Glu Met Glu Arg Val 245 250 255Phe Gly Phe Pro Val His Tyr Thr Asp Val Ser Asn Met Ser Arg Leu 260 265 270Ala Arg Gln Arg Leu Leu Gly Arg Ser Trp Ser Val Pro Val Ile Arg 275 280 285His Leu Phe Ala Pro Leu Lys Glu Tyr Phe Ala Cys Val Ser Ser Gly 290 295 300Asn Ser Asn Ala Asn Ser Arg Gly Pro Ser Phe Ser Ser Gly Leu Val305 310 315 320Pro Leu Ser Leu Arg Gly Ser His Met Gly Pro Met Glu Ile Tyr Lys 325 330 335Thr Val Ser Ala Trp Lys Arg Gln Pro Val Arg Val Leu Ser Leu Phe 340 345 350Arg Asn Ile Asp Lys Val Leu Lys Ser Leu Gly Phe Leu Glu Ser Gly 355 360 365Ser Gly Ser Gly Gly Gly Thr Leu Lys Tyr Val Glu Asp Val Thr Asn 370 375 380Val Val Arg Arg Asp Val Glu Lys Trp Gly Pro Phe Asp Leu Val Tyr385 390 395 400Gly Ser Thr Gln Pro Leu Gly Ser Ser Cys Asp Arg Cys Pro Gly Trp 405 410 415Tyr Met Phe Gln Phe His Arg Ile Leu Gln Tyr Ala Leu Pro Arg Gln 420 425 430Glu Ser Gln Arg Pro Phe Phe Trp Ile Phe Met Asp Asn Leu Leu Leu 435 440 445Thr Glu Asp Asp Gln Glu Thr Thr Thr Arg Phe Leu Gln Thr Glu Ala 450 455 460Val Thr Leu Gln Asp Val Arg Gly Arg Asp Tyr Gln Asn Ala Met Arg465 470 475 480Val Trp Ser Asn Ile Pro Gly Leu Lys Ser Lys His Ala Pro Leu Thr 485 490 495Pro Lys Glu Glu Glu Tyr Leu Gln Ala Gln Val Arg Ser Arg Ser Lys 500 505 510Leu Asp Ala Pro Lys Val Asp Leu Leu Val Lys Asn Cys Leu Leu Pro 515 520 525Leu Arg Glu Tyr Phe Lys Tyr Phe Ser Gln Asn Ser Leu Pro Leu Gly 530 535 540Gly Pro Ser Ser Gly Ala Pro Pro Pro Ser Gly Gly Ser Pro Ala Gly545 550 555 560Ser Pro Thr Ser Thr Glu Glu Gly Thr Ser Glu Ser Ala Thr Pro Glu 565 570 575Ser Gly Pro Gly Thr Ser Thr Glu Pro Ser Glu Gly Ser Ala Pro Gly 580 585 590Ser Pro Ala Gly Ser Pro Thr Ser Thr Glu Glu Gly Thr Ser Thr Glu 595 600 605Pro Ser Glu Gly Ser Ala Pro Gly Thr Ser Thr Glu Pro Ser Glu Met 610 615 620Asp Lys Lys Tyr Ser Ile Gly Leu Ala Ile Gly Thr Asn Ser Val Gly625 630 635 640Trp Ala Val Ile Thr Asp Glu Tyr Lys Val Pro Ser Lys Lys Phe Lys 645 650 655Val Leu Gly Asn Thr Asp Arg His Ser Ile Lys Lys Asn Leu Ile Gly 660 665 670Ala Leu Leu Phe Asp Ser Gly Glu Thr Ala Glu Ala Thr Arg Leu Lys 675 680 685Arg Thr Ala Arg Arg Arg Tyr Thr Arg Arg Lys Asn Arg Ile Cys Tyr 690 695 700Leu Gln Glu Ile Phe Ser Asn Glu Met Ala Lys Val Asp Asp Ser Phe705 710 715 720Phe His Arg Leu Glu Glu Ser Phe Leu Val Glu Glu Asp Lys Lys His 725 730 735Glu Arg His Pro Ile Phe Gly Asn Ile Val Asp Glu Val Ala Tyr His 740 745 750Glu Lys Tyr Pro Thr Ile Tyr His Leu Arg Lys Lys Leu Val Asp Ser 755 760 765Thr Asp Lys Ala Asp Leu Arg Leu Ile Tyr Leu Ala Leu Ala His Met 770 775 780Ile Lys Phe Arg Gly His Phe Leu Ile Glu Gly Asp Leu Asn Pro Asp785 790 795 800Asn Ser Asp Val Asp Lys Leu Phe Ile Gln Leu Val Gln Thr Tyr Asn 805 810 815Gln Leu Phe Glu Glu Asn Pro Ile Asn Ala Ser Gly Val Asp Ala Lys 820 825 830Ala Ile Leu Ser Ala Arg Leu Ser Lys Ser Arg Arg Leu Glu Asn Leu 835 840 845Ile Ala Gln Leu Pro Gly Glu Lys Lys Asn Gly Leu Phe Gly Asn Leu 850 855 860Ile Ala Leu Ser Leu Gly Leu Thr Pro Asn Phe Lys Ser Asn Phe Asp865 870 875 880Leu Ala Glu Asp Ala Lys Leu Gln Leu Ser Lys Asp Thr Tyr Asp Asp 885 890 895Asp Leu Asp Asn Leu Leu Ala Gln Ile Gly Asp Gln Tyr Ala Asp Leu 900 905 910Phe Leu Ala Ala Lys Asn Leu Ser Asp Ala Ile Leu Leu Ser Asp Ile 915 920 925Leu Arg Val Asn Thr Glu Ile Thr Lys Ala Pro Leu Ser Ala Ser Met 930 935 940Ile Lys Arg Tyr Asp Glu His His Gln Asp Leu Thr Leu Leu Lys Ala945 950 955 960Leu Val Arg Gln Gln Leu Pro Glu Lys Tyr Lys Glu Ile Phe Phe Asp 965 970 975Gln Ser Lys Asn Gly Tyr Ala Gly Tyr Ile Asp Gly Gly Ala Ser Gln 980 985 990Glu Glu Phe Tyr Lys Phe Ile Lys Pro Ile Leu Glu Lys Met Asp Gly 995 1000 1005Thr Glu Glu Leu Leu Val Lys Leu Asn Arg Glu Asp Leu Leu Arg 1010 1015 1020Lys Gln Arg Thr Phe Asp Asn Gly Ser Ile Pro His Gln Ile His 1025 1030 1035Leu Gly Glu Leu His Ala Ile Leu Arg Arg Gln Glu Asp Phe Tyr 1040 1045 1050Pro Phe Leu Lys Asp Asn Arg Glu Lys Ile Glu Lys Ile Leu Thr 1055 1060 1065Phe Arg Ile Pro Tyr Tyr Val Gly Pro Leu Ala Arg Gly Asn Ser 1070 1075 1080Arg Phe Ala Trp Met Thr Arg Lys Ser Glu Glu Thr Ile Thr Pro 1085 1090 1095Trp Asn Phe Glu Glu Val Val Asp Lys Gly Ala Ser Ala Gln Ser 1100 1105 1110Phe Ile Glu Arg Met Thr Asn Phe Asp Lys Asn Leu Pro Asn Glu 1115 1120 1125Lys Val Leu Pro Lys His Ser Leu Leu Tyr Glu Tyr Phe Thr Val 1130 1135 1140Tyr Asn Glu Leu Thr Lys Val Lys Tyr Val Thr Glu Gly Met Arg 1145 1150 1155Lys Pro Ala Phe Leu Ser Gly Glu Gln Lys Lys Ala Ile Val Asp 1160 1165 1170Leu Leu Phe Lys Thr Asn Arg Lys Val Thr Val Lys Gln Leu Lys 1175 1180 1185Glu Asp Tyr Phe Lys Lys Ile Glu Cys Phe Asp Ser Val Glu Ile 1190 1195 1200Ser Gly Val Glu Asp Arg Phe Asn Ala Ser Leu Gly Thr Tyr His 1205 1210 1215Asp Leu Leu Lys Ile Ile Lys Asp Lys Asp Phe Leu Asp Asn Glu 1220 1225 1230Glu Asn Glu Asp Ile Leu Glu Asp Ile Val Leu Thr Leu Thr Leu 1235 1240 1245Phe Glu Asp Arg Glu Met Ile Glu Glu Arg Leu Lys Thr Tyr Ala 1250 1255 1260His Leu Phe Asp Asp Lys Val Met Lys Gln Leu Lys Arg Arg Arg 1265 1270 1275Tyr Thr Gly Trp Gly Arg Leu Ser Arg Lys Leu Ile Asn Gly Ile 1280 1285 1290Arg Asp Lys Gln Ser Gly Lys Thr Ile Leu Asp Phe Leu Lys Ser 1295 1300 1305Asp Gly Phe Ala Asn Arg Asn Phe Met Gln Leu Ile His Asp Asp 1310 1315 1320Ser Leu Thr Phe Lys Glu Asp Ile Gln Lys Ala Gln Val Ser Gly 1325 1330 1335Gln Gly Asp Ser Leu His Glu His Ile Ala Asn Leu Ala Gly Ser 1340 1345 1350Pro Ala Ile Lys Lys Gly Ile Leu Gln Thr Val

Lys Val Val Asp 1355 1360 1365Glu Leu Val Lys Val Met Gly Arg His Lys Pro Glu Asn Ile Val 1370 1375 1380Ile Glu Met Ala Arg Glu Asn Gln Thr Thr Gln Lys Gly Gln Lys 1385 1390 1395Asn Ser Arg Glu Arg Met Lys Arg Ile Glu Glu Gly Ile Lys Glu 1400 1405 1410Leu Gly Ser Gln Ile Leu Lys Glu His Pro Val Glu Asn Thr Gln 1415 1420 1425Leu Gln Asn Glu Lys Leu Tyr Leu Tyr Tyr Leu Gln Asn Gly Arg 1430 1435 1440Asp Met Tyr Val Asp Gln Glu Leu Asp Ile Asn Arg Leu Ser Asp 1445 1450 1455Tyr Asp Val Asp Ala Ile Val Pro Gln Ser Phe Leu Lys Asp Asp 1460 1465 1470Ser Ile Asp Asn Lys Val Leu Thr Arg Ser Asp Lys Asn Arg Gly 1475 1480 1485Lys Ser Asp Asn Val Pro Ser Glu Glu Val Val Lys Lys Met Lys 1490 1495 1500Asn Tyr Trp Arg Gln Leu Leu Asn Ala Lys Leu Ile Thr Gln Arg 1505 1510 1515Lys Phe Asp Asn Leu Thr Lys Ala Glu Arg Gly Gly Leu Ser Glu 1520 1525 1530Leu Asp Lys Ala Gly Phe Ile Lys Arg Gln Leu Val Glu Thr Arg 1535 1540 1545Gln Ile Thr Lys His Val Ala Gln Ile Leu Asp Ser Arg Met Asn 1550 1555 1560Thr Lys Tyr Asp Glu Asn Asp Lys Leu Ile Arg Glu Val Lys Val 1565 1570 1575Ile Thr Leu Lys Ser Lys Leu Val Ser Asp Phe Arg Lys Asp Phe 1580 1585 1590Gln Phe Tyr Lys Val Arg Glu Ile Asn Asn Tyr His His Ala His 1595 1600 1605Asp Ala Tyr Leu Asn Ala Val Val Gly Thr Ala Leu Ile Lys Lys 1610 1615 1620Tyr Pro Lys Leu Glu Ser Glu Phe Val Tyr Gly Asp Tyr Lys Val 1625 1630 1635Tyr Asp Val Arg Lys Met Ile Ala Lys Ser Glu Gln Glu Ile Gly 1640 1645 1650Lys Ala Thr Ala Lys Tyr Phe Phe Tyr Ser Asn Ile Met Asn Phe 1655 1660 1665Phe Lys Thr Glu Ile Thr Leu Ala Asn Gly Glu Ile Arg Lys Arg 1670 1675 1680Pro Leu Ile Glu Thr Asn Gly Glu Thr Gly Glu Ile Val Trp Asp 1685 1690 1695Lys Gly Arg Asp Phe Ala Thr Val Arg Lys Val Leu Ser Met Pro 1700 1705 1710Gln Val Asn Ile Val Lys Lys Thr Glu Val Gln Thr Gly Gly Phe 1715 1720 1725Ser Lys Glu Ser Ile Leu Pro Lys Arg Asn Ser Asp Lys Leu Ile 1730 1735 1740Ala Arg Lys Lys Asp Trp Asp Pro Lys Lys Tyr Gly Gly Phe Asp 1745 1750 1755Ser Pro Thr Val Ala Tyr Ser Val Leu Val Val Ala Lys Val Glu 1760 1765 1770Lys Gly Lys Ser Lys Lys Leu Lys Ser Val Lys Glu Leu Leu Gly 1775 1780 1785Ile Thr Ile Met Glu Arg Ser Ser Phe Glu Lys Asn Pro Ile Asp 1790 1795 1800Phe Leu Glu Ala Lys Gly Tyr Lys Glu Val Lys Lys Asp Leu Ile 1805 1810 1815Ile Lys Leu Pro Lys Tyr Ser Leu Phe Glu Leu Glu Asn Gly Arg 1820 1825 1830Lys Arg Met Leu Ala Ser Ala Gly Glu Leu Gln Lys Gly Asn Glu 1835 1840 1845Leu Ala Leu Pro Ser Lys Tyr Val Asn Phe Leu Tyr Leu Ala Ser 1850 1855 1860His Tyr Glu Lys Leu Lys Gly Ser Pro Glu Asp Asn Glu Gln Lys 1865 1870 1875Gln Leu Phe Val Glu Gln His Lys His Tyr Leu Asp Glu Ile Ile 1880 1885 1890Glu Gln Ile Ser Glu Phe Ser Lys Arg Val Ile Leu Ala Asp Ala 1895 1900 1905Asn Leu Asp Lys Val Leu Ser Ala Tyr Asn Lys His Arg Asp Lys 1910 1915 1920Pro Ile Arg Glu Gln Ala Glu Asn Ile Ile His Leu Phe Thr Leu 1925 1930 1935Thr Asn Leu Gly Ala Pro Ala Ala Phe Lys Tyr Phe Asp Thr Thr 1940 1945 1950Ile Asp Arg Lys Arg Tyr Thr Ser Thr Lys Glu Val Leu Asp Ala 1955 1960 1965Thr Leu Ile His Gln Ser Ile Thr Gly Leu Tyr Glu Thr Arg Ile 1970 1975 1980Asp Leu Ser Gln Leu Gly Gly Asp Ala Tyr Pro Tyr Asp Val Pro 1985 1990 1995Asp Tyr Ala Ser Leu Gly Ser Gly Ser Pro Lys Lys Lys Arg Lys 2000 2005 2010Val Glu Asp Pro Lys Lys Lys Arg Lys Val Asp Gly Ile Gly Ser 2015 2020 2025Gly Ser Asn Gly Ser Ser Gly Ser Ser Glu Leu Ile Lys Glu Asn 2030 2035 2040Met His Met Lys Leu Tyr Met Glu Gly Thr Val Asp Asn His His 2045 2050 2055Phe Lys Cys Thr Ser Glu Gly Glu Gly Lys Pro Tyr Glu Gly Thr 2060 2065 2070Gln Thr Met Arg Ile Lys Val Val Glu Gly Gly Pro Leu Pro Phe 2075 2080 2085Ala Phe Asp Ile Leu Ala Thr Ser Phe Leu Tyr Gly Ser Lys Thr 2090 2095 2100Phe Ile Asn His Thr Gln Gly Ile Pro Asp Phe Phe Lys Gln Ser 2105 2110 2115Phe Pro Glu Gly Phe Thr Trp Glu Arg Val Thr Thr Tyr Glu Asp 2120 2125 2130Gly Gly Val Leu Thr Ala Thr Gln Asp Thr Ser Leu Gln Asp Gly 2135 2140 2145Cys Leu Ile Tyr Asn Val Lys Ile Arg Gly Val Asn Phe Thr Ser 2150 2155 2160Asn Gly Pro Val Met Gln Lys Lys Thr Leu Gly Trp Glu Ala Phe 2165 2170 2175Thr Glu Thr Leu Tyr Pro Ala Asp Gly Gly Leu Glu Gly Arg Asn 2180 2185 2190Asp Met Ala Leu Lys Leu Val Gly Gly Ser His Leu Ile Ala Asn 2195 2200 2205Ile Lys Thr Thr Tyr Arg Ser Lys Lys Pro Ala Lys Asn Leu Lys 2210 2215 2220Met Pro Gly Val Tyr Tyr Val Asp Tyr Arg Leu Glu Arg Ile Lys 2225 2230 2235Glu Ala Asn Asn Glu Thr Tyr Val Glu Gln His Glu Val Ala Val 2240 2245 2250Ala Arg Tyr Cys Asp Leu Pro Ser Lys Leu Gly His Lys Leu Asn 2255 2260 2265Gly Gly Gly Gly Gly Met Asp Ala Lys Ser Leu Thr Ala Trp Ser 2270 2275 2280Arg Thr Leu Val Thr Phe Lys Asp Val Phe Val Asp Phe Thr Arg 2285 2290 2295Glu Glu Trp Lys Leu Leu Asp Thr Ala Gln Gln Ile Val Tyr Arg 2300 2305 2310Asn Val Met Leu Glu Asn Tyr Lys Asn Leu Val Ser Leu Gly Tyr 2315 2320 2325Gln Leu Thr Lys Pro Asp Val Ile Leu Arg Leu Glu Lys Gly Glu 2330 2335 2340Glu Pro 23451671PRTArtificial sequenceSynthetic polypeptide 16Asp Ala Lys Ser Leu Thr Ala Trp Ser Arg Thr Leu Val Thr Phe Lys1 5 10 15Asp Val Phe Val Asp Phe Thr Arg Glu Glu Trp Lys Leu Leu Asp Thr 20 25 30Ala Gln Gln Ile Val Tyr Arg Asn Val Met Leu Glu Asn Tyr Lys Asn 35 40 45Leu Val Ser Leu Gly Tyr Gln Leu Thr Lys Pro Asp Val Ile Leu Arg 50 55 60Leu Glu Lys Gly Glu Glu Pro65 70177PRTArtificial sequenceSynthetic polypeptide 17Gly Gly Ser Gly Gly Gly Ser1 5183PRTArtificial sequenceSynthetic polypeptide 18Ser Gly Ser11917PRTArtificial sequenceSynthetic polypeptide 19Glu Ala Ser Gly Ser Gly Arg Ala Ser Pro Gly Ile Pro Gly Ser Thr1 5 10 15Arg204PRTArtificial sequenceSynthetic polypeptide 20Ser Arg Ala Asp1213PRTArtificial sequenceSynthetic polypeptide 21Gly Ser Gly1223PRTArtificial sequenceSynthetic polypeptide 22Ser Pro Gly1231368PRTArtificial sequenceSynthetic polypeptide 23Met Asp Lys Lys Tyr Ser Ile Gly Leu Ala Ile Gly Thr Asn Ser Val1 5 10 15Gly Trp Ala Val Ile Thr Asp Glu Tyr Lys Val Pro Ser Lys Lys Phe 20 25 30Lys Val Leu Gly Asn Thr Asp Arg His Ser Ile Lys Lys Asn Leu Ile 35 40 45Gly Ala Leu Leu Phe Asp Ser Gly Glu Thr Ala Glu Ala Thr Arg Leu 50 55 60Lys Arg Thr Ala Arg Arg Arg Tyr Thr Arg Arg Lys Asn Arg Ile Cys65 70 75 80Tyr Leu Gln Glu Ile Phe Ser Asn Glu Met Ala Lys Val Asp Asp Ser 85 90 95Phe Phe His Arg Leu Glu Glu Ser Phe Leu Val Glu Glu Asp Lys Lys 100 105 110His Glu Arg His Pro Ile Phe Gly Asn Ile Val Asp Glu Val Ala Tyr 115 120 125His Glu Lys Tyr Pro Thr Ile Tyr His Leu Arg Lys Lys Leu Val Asp 130 135 140Ser Thr Asp Lys Ala Asp Leu Arg Leu Ile Tyr Leu Ala Leu Ala His145 150 155 160Met Ile Lys Phe Arg Gly His Phe Leu Ile Glu Gly Asp Leu Asn Pro 165 170 175Asp Asn Ser Asp Val Asp Lys Leu Phe Ile Gln Leu Val Gln Thr Tyr 180 185 190Asn Gln Leu Phe Glu Glu Asn Pro Ile Asn Ala Ser Gly Val Asp Ala 195 200 205Lys Ala Ile Leu Ser Ala Arg Leu Ser Lys Ser Arg Arg Leu Glu Asn 210 215 220Leu Ile Ala Gln Leu Pro Gly Glu Lys Lys Asn Gly Leu Phe Gly Asn225 230 235 240Leu Ile Ala Leu Ser Leu Gly Leu Thr Pro Asn Phe Lys Ser Asn Phe 245 250 255Asp Leu Ala Glu Asp Ala Lys Leu Gln Leu Ser Lys Asp Thr Tyr Asp 260 265 270Asp Asp Leu Asp Asn Leu Leu Ala Gln Ile Gly Asp Gln Tyr Ala Asp 275 280 285Leu Phe Leu Ala Ala Lys Asn Leu Ser Asp Ala Ile Leu Leu Ser Asp 290 295 300Ile Leu Arg Val Asn Thr Glu Ile Thr Lys Ala Pro Leu Ser Ala Ser305 310 315 320Met Ile Lys Arg Tyr Asp Glu His His Gln Asp Leu Thr Leu Leu Lys 325 330 335Ala Leu Val Arg Gln Gln Leu Pro Glu Lys Tyr Lys Glu Ile Phe Phe 340 345 350Asp Gln Ser Lys Asn Gly Tyr Ala Gly Tyr Ile Asp Gly Gly Ala Ser 355 360 365Gln Glu Glu Phe Tyr Lys Phe Ile Lys Pro Ile Leu Glu Lys Met Asp 370 375 380Gly Thr Glu Glu Leu Leu Val Lys Leu Asn Arg Glu Asp Leu Leu Arg385 390 395 400Lys Gln Arg Thr Phe Asp Asn Gly Ser Ile Pro His Gln Ile His Leu 405 410 415Gly Glu Leu His Ala Ile Leu Arg Arg Gln Glu Asp Phe Tyr Pro Phe 420 425 430Leu Lys Asp Asn Arg Glu Lys Ile Glu Lys Ile Leu Thr Phe Arg Ile 435 440 445Pro Tyr Tyr Val Gly Pro Leu Ala Arg Gly Asn Ser Arg Phe Ala Trp 450 455 460Met Thr Arg Lys Ser Glu Glu Thr Ile Thr Pro Trp Asn Phe Glu Glu465 470 475 480Val Val Asp Lys Gly Ala Ser Ala Gln Ser Phe Ile Glu Arg Met Thr 485 490 495Asn Phe Asp Lys Asn Leu Pro Asn Glu Lys Val Leu Pro Lys His Ser 500 505 510Leu Leu Tyr Glu Tyr Phe Thr Val Tyr Asn Glu Leu Thr Lys Val Lys 515 520 525Tyr Val Thr Glu Gly Met Arg Lys Pro Ala Phe Leu Ser Gly Glu Gln 530 535 540Lys Lys Ala Ile Val Asp Leu Leu Phe Lys Thr Asn Arg Lys Val Thr545 550 555 560Val Lys Gln Leu Lys Glu Asp Tyr Phe Lys Lys Ile Glu Cys Phe Asp 565 570 575Ser Val Glu Ile Ser Gly Val Glu Asp Arg Phe Asn Ala Ser Leu Gly 580 585 590Thr Tyr His Asp Leu Leu Lys Ile Ile Lys Asp Lys Asp Phe Leu Asp 595 600 605Asn Glu Glu Asn Glu Asp Ile Leu Glu Asp Ile Val Leu Thr Leu Thr 610 615 620Leu Phe Glu Asp Arg Glu Met Ile Glu Glu Arg Leu Lys Thr Tyr Ala625 630 635 640His Leu Phe Asp Asp Lys Val Met Lys Gln Leu Lys Arg Arg Arg Tyr 645 650 655Thr Gly Trp Gly Arg Leu Ser Arg Lys Leu Ile Asn Gly Ile Arg Asp 660 665 670Lys Gln Ser Gly Lys Thr Ile Leu Asp Phe Leu Lys Ser Asp Gly Phe 675 680 685Ala Asn Arg Asn Phe Met Gln Leu Ile His Asp Asp Ser Leu Thr Phe 690 695 700Lys Glu Asp Ile Gln Lys Ala Gln Val Ser Gly Gln Gly Asp Ser Leu705 710 715 720His Glu His Ile Ala Asn Leu Ala Gly Ser Pro Ala Ile Lys Lys Gly 725 730 735Ile Leu Gln Thr Val Lys Val Val Asp Glu Leu Val Lys Val Met Gly 740 745 750Arg His Lys Pro Glu Asn Ile Val Ile Glu Met Ala Arg Glu Asn Gln 755 760 765Thr Thr Gln Lys Gly Gln Lys Asn Ser Arg Glu Arg Met Lys Arg Ile 770 775 780Glu Glu Gly Ile Lys Glu Leu Gly Ser Gln Ile Leu Lys Glu His Pro785 790 795 800Val Glu Asn Thr Gln Leu Gln Asn Glu Lys Leu Tyr Leu Tyr Tyr Leu 805 810 815Gln Asn Gly Arg Asp Met Tyr Val Asp Gln Glu Leu Asp Ile Asn Arg 820 825 830Leu Ser Asp Tyr Asp Val Asp Ala Ile Val Pro Gln Ser Phe Leu Lys 835 840 845Asp Asp Ser Ile Asp Asn Lys Val Leu Thr Arg Ser Asp Lys Asn Arg 850 855 860Gly Lys Ser Asp Asn Val Pro Ser Glu Glu Val Val Lys Lys Met Lys865 870 875 880Asn Tyr Trp Arg Gln Leu Leu Asn Ala Lys Leu Ile Thr Gln Arg Lys 885 890 895Phe Asp Asn Leu Thr Lys Ala Glu Arg Gly Gly Leu Ser Glu Leu Asp 900 905 910Lys Ala Gly Phe Ile Lys Arg Gln Leu Val Glu Thr Arg Gln Ile Thr 915 920 925Lys His Val Ala Gln Ile Leu Asp Ser Arg Met Asn Thr Lys Tyr Asp 930 935 940Glu Asn Asp Lys Leu Ile Arg Glu Val Lys Val Ile Thr Leu Lys Ser945 950 955 960Lys Leu Val Ser Asp Phe Arg Lys Asp Phe Gln Phe Tyr Lys Val Arg 965 970 975Glu Ile Asn Asn Tyr His His Ala His Asp Ala Tyr Leu Asn Ala Val 980 985 990Val Gly Thr Ala Leu Ile Lys Lys Tyr Pro Lys Leu Glu Ser Glu Phe 995 1000 1005Val Tyr Gly Asp Tyr Lys Val Tyr Asp Val Arg Lys Met Ile Ala 1010 1015 1020Lys Ser Glu Gln Glu Ile Gly Lys Ala Thr Ala Lys Tyr Phe Phe 1025 1030 1035Tyr Ser Asn Ile Met Asn Phe Phe Lys Thr Glu Ile Thr Leu Ala 1040 1045 1050Asn Gly Glu Ile Arg Lys Arg Pro Leu Ile Glu Thr Asn Gly Glu 1055 1060 1065Thr Gly Glu Ile Val Trp Asp Lys Gly Arg Asp Phe Ala Thr Val 1070 1075 1080Arg Lys Val Leu Ser Met Pro Gln Val Asn Ile Val Lys Lys Thr 1085 1090 1095Glu Val Gln Thr Gly Gly Phe Ser Lys Glu Ser Ile Leu Pro Lys 1100 1105 1110Arg Asn Ser Asp Lys Leu Ile Ala Arg Lys Lys Asp Trp Asp Pro 1115 1120 1125Lys Lys Tyr Gly Gly Phe Asp Ser Pro Thr Val Ala Tyr Ser Val 1130 1135 1140Leu Val Val Ala Lys Val Glu Lys Gly Lys Ser Lys Lys Leu Lys 1145 1150 1155Ser Val Lys Glu Leu Leu Gly Ile Thr Ile Met Glu Arg Ser Ser 1160 1165 1170Phe Glu Lys Asn Pro Ile Asp Phe Leu Glu Ala Lys Gly Tyr Lys 1175 1180 1185Glu Val Lys Lys Asp Leu Ile Ile Lys Leu Pro Lys Tyr Ser Leu 1190 1195 1200Phe Glu Leu Glu Asn Gly Arg Lys Arg Met Leu Ala Ser Ala Gly 1205 1210 1215Glu Leu Gln Lys Gly Asn Glu Leu Ala Leu Pro Ser Lys Tyr Val 1220 1225 1230Asn Phe Leu Tyr Leu Ala Ser His Tyr Glu Lys Leu Lys Gly Ser 1235 1240 1245Pro Glu Asp Asn Glu Gln Lys Gln Leu Phe Val Glu Gln His Lys 1250 1255 1260His Tyr Leu Asp Glu Ile Ile Glu Gln Ile Ser Glu Phe Ser Lys 1265 1270 1275Arg Val Ile Leu Ala Asp Ala Asn Leu Asp Lys Val Leu Ser Ala 1280 1285 1290Tyr Asn Lys His Arg Asp Lys Pro Ile Arg Glu Gln Ala Glu Asn 1295 1300 1305Ile

Ile His Leu Phe Thr Leu Thr Asn Leu Gly Ala Pro Ala Ala 1310 1315 1320Phe Lys Tyr Phe Asp Thr Thr Ile Asp Arg Lys Arg Tyr Thr Ser 1325 1330 1335Thr Lys Glu Val Leu Asp Ala Thr Leu Ile His Gln Ser Ile Thr 1340 1345 1350Gly Leu Tyr Glu Thr Arg Ile Asp Leu Ser Gln Leu Gly Gly Asp 1355 1360 1365249PRTArtificial sequenceSynthetic polypeptide 24Tyr Pro Tyr Asp Val Pro Asp Tyr Ala1 5257PRTArtificial sequenceSynthetic polypeptide 25Pro Lys Lys Lys Arg Lys Val1 526301PRTArtificial sequenceSynthetic polypeptide 26Asn His Asp Gln Glu Phe Asp Pro Pro Lys Val Tyr Pro Pro Val Pro1 5 10 15Ala Glu Lys Arg Lys Pro Ile Arg Val Leu Ser Leu Phe Asp Gly Ile 20 25 30Ala Thr Gly Leu Leu Val Leu Lys Asp Leu Gly Ile Gln Val Asp Arg 35 40 45Tyr Ile Ala Ser Glu Val Cys Glu Asp Ser Ile Thr Val Gly Met Val 50 55 60Arg His Gln Gly Lys Ile Met Tyr Val Gly Asp Val Arg Ser Val Thr65 70 75 80Gln Lys His Ile Gln Glu Trp Gly Pro Phe Asp Leu Val Ile Gly Gly 85 90 95Ser Pro Cys Asn Asp Leu Ser Ile Val Asn Pro Ala Arg Lys Gly Leu 100 105 110Tyr Glu Gly Thr Gly Arg Leu Phe Phe Glu Phe Tyr Arg Leu Leu His 115 120 125Asp Ala Arg Pro Lys Glu Gly Asp Asp Arg Pro Phe Phe Trp Leu Phe 130 135 140Glu Asn Val Val Ala Met Gly Val Ser Asp Lys Arg Asp Ile Ser Arg145 150 155 160Phe Leu Glu Ser Asn Pro Val Met Ile Asp Ala Lys Glu Val Ser Ala 165 170 175Ala His Arg Ala Arg Tyr Phe Trp Gly Asn Leu Pro Gly Met Asn Arg 180 185 190Pro Leu Ala Ser Thr Val Asn Asp Lys Leu Glu Leu Gln Glu Cys Leu 195 200 205Glu His Gly Arg Ile Ala Lys Phe Ser Lys Val Arg Thr Ile Thr Thr 210 215 220Arg Ser Asn Ser Ile Lys Gln Gly Lys Asp Gln His Phe Pro Val Phe225 230 235 240Met Asn Glu Lys Glu Asp Ile Leu Trp Cys Thr Glu Met Glu Arg Val 245 250 255Phe Gly Phe Pro Val His Tyr Thr Asp Val Ser Asn Met Ser Arg Leu 260 265 270Ala Arg Gln Arg Leu Leu Gly Arg Ser Trp Ser Val Pro Val Ile Arg 275 280 285His Leu Phe Ala Pro Leu Lys Glu Tyr Phe Ala Cys Val 290 295 3002727PRTArtificial sequenceSynthetic polypeptide 27Ser Ser Gly Asn Ser Asn Ala Asn Ser Arg Gly Pro Ser Phe Ser Ser1 5 10 15Gly Leu Val Pro Leu Ser Leu Arg Gly Ser His 20 2528215PRTArtificial sequenceSynthetic polypeptide 28Met Gly Pro Met Glu Ile Tyr Lys Thr Val Ser Ala Trp Lys Arg Gln1 5 10 15Pro Val Arg Val Leu Ser Leu Phe Arg Asn Ile Asp Lys Val Leu Lys 20 25 30Ser Leu Gly Phe Leu Glu Ser Gly Ser Gly Ser Gly Gly Gly Thr Leu 35 40 45Lys Tyr Val Glu Asp Val Thr Asn Val Val Arg Arg Asp Val Glu Lys 50 55 60Trp Gly Pro Phe Asp Leu Val Tyr Gly Ser Thr Gln Pro Leu Gly Ser65 70 75 80Ser Cys Asp Arg Cys Pro Gly Trp Tyr Met Phe Gln Phe His Arg Ile 85 90 95Leu Gln Tyr Ala Leu Pro Arg Gln Glu Ser Gln Arg Pro Phe Phe Trp 100 105 110Ile Phe Met Asp Asn Leu Leu Leu Thr Glu Asp Asp Gln Glu Thr Thr 115 120 125Thr Arg Phe Leu Gln Thr Glu Ala Val Thr Leu Gln Asp Val Arg Gly 130 135 140Arg Asp Tyr Gln Asn Ala Met Arg Val Trp Ser Asn Ile Pro Gly Leu145 150 155 160Lys Ser Lys His Ala Pro Leu Thr Pro Lys Glu Glu Glu Tyr Leu Gln 165 170 175Ala Gln Val Arg Ser Arg Ser Lys Leu Asp Ala Pro Lys Val Asp Leu 180 185 190Leu Val Lys Asn Cys Leu Leu Pro Leu Arg Glu Tyr Phe Lys Tyr Phe 195 200 205Ser Gln Asn Ser Leu Pro Leu 210 2152919PRTArtificial sequenceSynthetic polypeptide 29Ala Thr Asn Phe Ser Leu Leu Lys Gln Ala Gly Asp Val Glu Glu Asn1 5 10 15Pro Gly Pro30232PRTArtificial sequenceSynthetic polypeptide 30Ser Glu Leu Ile Lys Glu Asn Met His Met Lys Leu Tyr Met Glu Gly1 5 10 15Thr Val Asp Asn His His Phe Lys Cys Thr Ser Glu Gly Glu Gly Lys 20 25 30Pro Tyr Glu Gly Thr Gln Thr Met Arg Ile Lys Val Val Glu Gly Gly 35 40 45Pro Leu Pro Phe Ala Phe Asp Ile Leu Ala Thr Ser Phe Leu Tyr Gly 50 55 60Ser Lys Thr Phe Ile Asn His Thr Gln Gly Ile Pro Asp Phe Phe Lys65 70 75 80Gln Ser Phe Pro Glu Gly Phe Thr Trp Glu Arg Val Thr Thr Tyr Glu 85 90 95Asp Gly Gly Val Leu Thr Ala Thr Gln Asp Thr Ser Leu Gln Asp Gly 100 105 110Cys Leu Ile Tyr Asn Val Lys Ile Arg Gly Val Asn Phe Thr Ser Asn 115 120 125Gly Pro Val Met Gln Lys Lys Thr Leu Gly Trp Glu Ala Phe Thr Glu 130 135 140Thr Leu Tyr Pro Ala Asp Gly Gly Leu Glu Gly Arg Asn Asp Met Ala145 150 155 160Leu Lys Leu Val Gly Gly Ser His Leu Ile Ala Asn Ile Lys Thr Thr 165 170 175Tyr Arg Ser Lys Lys Pro Ala Lys Asn Leu Lys Met Pro Gly Val Tyr 180 185 190Tyr Val Asp Tyr Arg Leu Glu Arg Ile Lys Glu Ala Asn Asn Glu Thr 195 200 205Tyr Val Glu Gln His Glu Val Ala Val Ala Arg Tyr Cys Asp Leu Pro 210 215 220Ser Lys Leu Gly His Lys Leu Asn225 2303116PRTArtificial sequenceSynthetic polypeptide 31Ser Gly Ser Glu Thr Pro Gly Thr Ser Glu Ser Ala Thr Pro Glu Ser1 5 10 153280PRTArtificial sequenceSynthetic polypeptide 32Gly Gly Pro Ser Ser Gly Ala Pro Pro Pro Ser Gly Gly Ser Pro Ala1 5 10 15Gly Ser Pro Thr Ser Thr Glu Glu Gly Thr Ser Glu Ser Ala Thr Pro 20 25 30Glu Ser Gly Pro Gly Thr Ser Thr Glu Pro Ser Glu Gly Ser Ala Pro 35 40 45Gly Ser Pro Ala Gly Ser Pro Thr Ser Thr Glu Glu Gly Thr Ser Thr 50 55 60Glu Pro Ser Glu Gly Ser Ala Pro Gly Thr Ser Thr Glu Pro Ser Glu65 70 75 8033543PRTArtificial sequenceSynthetic polypeptide 33Asn His Asp Gln Glu Phe Asp Pro Pro Lys Val Tyr Pro Pro Val Pro1 5 10 15Ala Glu Lys Arg Lys Pro Ile Arg Val Leu Ser Leu Phe Asp Gly Ile 20 25 30Ala Thr Gly Leu Leu Val Leu Lys Asp Leu Gly Ile Gln Val Asp Arg 35 40 45Tyr Ile Ala Ser Glu Val Cys Glu Asp Ser Ile Thr Val Gly Met Val 50 55 60Arg His Gln Gly Lys Ile Met Tyr Val Gly Asp Val Arg Ser Val Thr65 70 75 80Gln Lys His Ile Gln Glu Trp Gly Pro Phe Asp Leu Val Ile Gly Gly 85 90 95Ser Pro Cys Asn Asp Leu Ser Ile Val Asn Pro Ala Arg Lys Gly Leu 100 105 110Tyr Glu Gly Thr Gly Arg Leu Phe Phe Glu Phe Tyr Arg Leu Leu His 115 120 125Asp Ala Arg Pro Lys Glu Gly Asp Asp Arg Pro Phe Phe Trp Leu Phe 130 135 140Glu Asn Val Val Ala Met Gly Val Ser Asp Lys Arg Asp Ile Ser Arg145 150 155 160Phe Leu Glu Ser Asn Pro Val Met Ile Asp Ala Lys Glu Val Ser Ala 165 170 175Ala His Arg Ala Arg Tyr Phe Trp Gly Asn Leu Pro Gly Met Asn Arg 180 185 190Pro Leu Ala Ser Thr Val Asn Asp Lys Leu Glu Leu Gln Glu Cys Leu 195 200 205Glu His Gly Arg Ile Ala Lys Phe Ser Lys Val Arg Thr Ile Thr Thr 210 215 220Arg Ser Asn Ser Ile Lys Gln Gly Lys Asp Gln His Phe Pro Val Phe225 230 235 240Met Asn Glu Lys Glu Asp Ile Leu Trp Cys Thr Glu Met Glu Arg Val 245 250 255Phe Gly Phe Pro Val His Tyr Thr Asp Val Ser Asn Met Ser Arg Leu 260 265 270Ala Arg Gln Arg Leu Leu Gly Arg Ser Trp Ser Val Pro Val Ile Arg 275 280 285His Leu Phe Ala Pro Leu Lys Glu Tyr Phe Ala Cys Val Ser Ser Gly 290 295 300Asn Ser Asn Ala Asn Ser Arg Gly Pro Ser Phe Ser Ser Gly Leu Val305 310 315 320Pro Leu Ser Leu Arg Gly Ser His Met Gly Pro Met Glu Ile Tyr Lys 325 330 335Thr Val Ser Ala Trp Lys Arg Gln Pro Val Arg Val Leu Ser Leu Phe 340 345 350Arg Asn Ile Asp Lys Val Leu Lys Ser Leu Gly Phe Leu Glu Ser Gly 355 360 365Ser Gly Ser Gly Gly Gly Thr Leu Lys Tyr Val Glu Asp Val Thr Asn 370 375 380Val Val Arg Arg Asp Val Glu Lys Trp Gly Pro Phe Asp Leu Val Tyr385 390 395 400Gly Ser Thr Gln Pro Leu Gly Ser Ser Cys Asp Arg Cys Pro Gly Trp 405 410 415Tyr Met Phe Gln Phe His Arg Ile Leu Gln Tyr Ala Leu Pro Arg Gln 420 425 430Glu Ser Gln Arg Pro Phe Phe Trp Ile Phe Met Asp Asn Leu Leu Leu 435 440 445Thr Glu Asp Asp Gln Glu Thr Thr Thr Arg Phe Leu Gln Thr Glu Ala 450 455 460Val Thr Leu Gln Asp Val Arg Gly Arg Asp Tyr Gln Asn Ala Met Arg465 470 475 480Val Trp Ser Asn Ile Pro Gly Leu Lys Ser Lys His Ala Pro Leu Thr 485 490 495Pro Lys Glu Glu Glu Tyr Leu Gln Ala Gln Val Arg Ser Arg Ser Lys 500 505 510Leu Asp Ala Pro Lys Val Asp Leu Leu Val Lys Asn Cys Leu Leu Pro 515 520 525Leu Arg Glu Tyr Phe Lys Tyr Phe Ser Gln Asn Ser Leu Pro Leu 530 535 540341307PRTArtificial sequenceSynthetic polypeptide 34Met Thr Gln Phe Glu Gly Phe Thr Asn Leu Tyr Gln Val Ser Lys Thr1 5 10 15Leu Arg Phe Glu Leu Ile Pro Gln Gly Lys Thr Leu Lys His Ile Gln 20 25 30Glu Gln Gly Phe Ile Glu Glu Asp Lys Ala Arg Asn Asp His Tyr Lys 35 40 45Glu Leu Lys Pro Ile Ile Asp Arg Ile Tyr Lys Thr Tyr Ala Asp Gln 50 55 60Cys Leu Gln Leu Val Gln Leu Asp Trp Glu Asn Leu Ser Ala Ala Ile65 70 75 80Asp Ser Tyr Arg Lys Glu Lys Thr Glu Glu Thr Arg Asn Ala Leu Ile 85 90 95Glu Glu Gln Ala Thr Tyr Arg Asn Ala Ile His Asp Tyr Phe Ile Gly 100 105 110Arg Thr Asp Asn Leu Thr Asp Ala Ile Asn Lys Arg His Ala Glu Ile 115 120 125Tyr Lys Gly Leu Phe Lys Ala Glu Leu Phe Asn Gly Lys Val Leu Lys 130 135 140Gln Leu Gly Thr Val Thr Thr Thr Glu His Glu Asn Ala Leu Leu Arg145 150 155 160Ser Phe Asp Lys Phe Thr Thr Tyr Phe Ser Gly Phe Tyr Glu Asn Arg 165 170 175Lys Asn Val Phe Ser Ala Glu Asp Ile Ser Thr Ala Ile Pro His Arg 180 185 190Ile Val Gln Asp Asn Phe Pro Lys Phe Lys Glu Asn Cys His Ile Phe 195 200 205Thr Arg Leu Ile Thr Ala Val Pro Ser Leu Arg Glu His Phe Glu Asn 210 215 220Val Lys Lys Ala Ile Gly Ile Phe Val Ser Thr Ser Ile Glu Glu Val225 230 235 240Phe Ser Phe Pro Phe Tyr Asn Gln Leu Leu Thr Gln Thr Gln Ile Asp 245 250 255Leu Tyr Asn Gln Leu Leu Gly Gly Ile Ser Arg Glu Ala Gly Thr Glu 260 265 270Lys Ile Lys Gly Leu Asn Glu Val Leu Asn Leu Ala Ile Gln Lys Asn 275 280 285Asp Glu Thr Ala His Ile Ile Ala Ser Leu Pro His Arg Phe Ile Pro 290 295 300Leu Phe Lys Gln Ile Leu Ser Asp Arg Asn Thr Leu Ser Phe Ile Leu305 310 315 320Glu Glu Phe Lys Ser Asp Glu Glu Val Ile Gln Ser Phe Cys Lys Tyr 325 330 335Lys Thr Leu Leu Arg Asn Glu Asn Val Leu Glu Thr Ala Glu Ala Leu 340 345 350Phe Asn Glu Leu Asn Ser Ile Asp Leu Thr His Ile Phe Ile Ser His 355 360 365Lys Lys Leu Glu Thr Ile Ser Ser Ala Leu Cys Asp His Trp Asp Thr 370 375 380Leu Arg Asn Ala Leu Tyr Glu Arg Arg Ile Ser Glu Leu Thr Gly Lys385 390 395 400Ile Thr Lys Ser Ala Lys Glu Lys Val Gln Arg Ser Leu Lys His Glu 405 410 415Asp Ile Asn Leu Gln Glu Ile Ile Ser Ala Ala Gly Lys Glu Leu Ser 420 425 430Glu Ala Phe Lys Gln Lys Thr Ser Glu Ile Leu Ser His Ala His Ala 435 440 445Ala Leu Asp Gln Pro Leu Pro Thr Thr Leu Lys Lys Gln Glu Glu Lys 450 455 460Glu Ile Leu Lys Ser Gln Leu Asp Ser Leu Leu Gly Leu Tyr His Leu465 470 475 480Leu Asp Trp Phe Ala Val Asp Glu Ser Asn Glu Val Asp Pro Glu Phe 485 490 495Ser Ala Arg Leu Thr Gly Ile Lys Leu Glu Met Glu Pro Ser Leu Ser 500 505 510Phe Tyr Asn Lys Ala Arg Asn Tyr Ala Thr Lys Lys Pro Tyr Ser Val 515 520 525Glu Lys Phe Lys Leu Asn Phe Gln Met Pro Thr Leu Ala Ser Gly Trp 530 535 540Asp Val Asn Lys Glu Lys Asn Asn Gly Ala Ile Leu Phe Val Lys Asn545 550 555 560Gly Leu Tyr Tyr Leu Gly Ile Met Pro Lys Gln Lys Gly Arg Tyr Lys 565 570 575Ala Leu Ser Phe Glu Pro Thr Glu Lys Thr Ser Glu Gly Phe Asp Lys 580 585 590Met Tyr Tyr Asp Tyr Phe Pro Asp Ala Ala Lys Met Ile Pro Lys Cys 595 600 605Ser Thr Gln Leu Lys Ala Val Thr Ala His Phe Gln Thr His Thr Thr 610 615 620Pro Ile Leu Leu Ser Asn Asn Phe Ile Glu Pro Leu Glu Ile Thr Lys625 630 635 640Glu Ile Tyr Asp Leu Asn Asn Pro Glu Lys Glu Pro Lys Lys Phe Gln 645 650 655Thr Ala Tyr Ala Lys Lys Thr Gly Asp Gln Lys Gly Tyr Arg Glu Ala 660 665 670Leu Cys Lys Trp Ile Asp Phe Thr Arg Asp Phe Leu Ser Lys Tyr Thr 675 680 685Lys Thr Thr Ser Ile Asp Leu Ser Ser Leu Arg Pro Ser Ser Gln Tyr 690 695 700Lys Asp Leu Gly Glu Tyr Tyr Ala Glu Leu Asn Pro Leu Leu Tyr His705 710 715 720Ile Ser Phe Gln Arg Ile Ala Glu Lys Glu Ile Met Asp Ala Val Glu 725 730 735Thr Gly Lys Leu Tyr Leu Phe Gln Ile Tyr Asn Lys Asp Phe Ala Lys 740 745 750Gly His His Gly Lys Pro Asn Leu His Thr Leu Tyr Trp Thr Gly Leu 755 760 765Phe Ser Pro Glu Asn Leu Ala Lys Thr Ser Ile Lys Leu Asn Gly Gln 770 775 780Ala Glu Leu Phe Tyr Arg Pro Lys Ser Arg Met Lys Arg Met Ala His785 790 795 800Arg Leu Gly Glu Lys Met Leu Asn Lys Lys Leu Lys Asp Gln Lys Thr 805 810 815Pro Ile Pro Asp Thr Leu Tyr Gln Glu Leu Tyr Asp Tyr Val Asn His 820 825 830Arg Leu Ser His Asp Leu Ser Asp Glu Ala Arg Ala Leu Leu Pro Asn 835 840 845Val Ile Thr Lys Glu Val Ser His Glu Ile Ile Lys Asp Arg Arg Phe 850 855 860Thr Ser Asp Lys Phe Phe Phe His Val Pro Ile Thr Leu Asn Tyr Gln865 870 875 880Ala Ala Asn Ser Pro Ser Lys Phe Asn Gln Arg Val Asn Ala Tyr Leu

885 890 895Lys Glu His Pro Glu Thr Pro Ile Ile Gly Ile Asp Arg Gly Glu Arg 900 905 910Asn Leu Ile Tyr Ile Thr Val Ile Asp Ser Thr Gly Lys Ile Leu Glu 915 920 925Gln Arg Ser Leu Asn Thr Ile Gln Gln Phe Asp Tyr Gln Lys Lys Leu 930 935 940Asp Asn Arg Glu Lys Glu Arg Val Ala Ala Arg Gln Ala Trp Ser Val945 950 955 960Val Gly Thr Ile Lys Asp Leu Lys Gln Gly Tyr Leu Ser Gln Val Ile 965 970 975His Glu Ile Val Asp Leu Met Ile His Tyr Gln Ala Val Val Val Leu 980 985 990Ala Asn Leu Asn Phe Gly Phe Lys Ser Lys Arg Thr Gly Ile Ala Glu 995 1000 1005Lys Ala Val Tyr Gln Gln Phe Glu Lys Met Leu Ile Asp Lys Leu 1010 1015 1020Asn Cys Leu Val Leu Lys Asp Tyr Pro Ala Glu Lys Val Gly Gly 1025 1030 1035Val Leu Asn Pro Tyr Gln Leu Thr Asp Gln Phe Thr Ser Phe Ala 1040 1045 1050Lys Met Gly Thr Gln Ser Gly Phe Leu Phe Tyr Val Pro Ala Pro 1055 1060 1065Tyr Thr Ser Lys Ile Asp Pro Leu Thr Gly Phe Val Asp Pro Phe 1070 1075 1080Val Trp Lys Thr Ile Lys Asn His Glu Ser Arg Lys His Phe Leu 1085 1090 1095Glu Gly Phe Asp Phe Leu His Tyr Asp Val Lys Thr Gly Asp Phe 1100 1105 1110Ile Leu His Phe Lys Met Asn Arg Asn Leu Ser Phe Gln Arg Gly 1115 1120 1125Leu Pro Gly Phe Met Pro Ala Trp Asp Ile Val Phe Glu Lys Asn 1130 1135 1140Glu Thr Gln Phe Asp Ala Lys Gly Thr Pro Phe Ile Ala Gly Lys 1145 1150 1155Arg Ile Val Pro Val Ile Glu Asn His Arg Phe Thr Gly Arg Tyr 1160 1165 1170Arg Asp Leu Tyr Pro Ala Asn Glu Leu Ile Ala Leu Leu Glu Glu 1175 1180 1185Lys Gly Ile Val Phe Arg Asp Gly Ser Asn Ile Leu Pro Lys Leu 1190 1195 1200Leu Glu Asn Asp Asp Ser His Ala Ile Asp Thr Met Val Ala Leu 1205 1210 1215Ile Arg Ser Val Leu Gln Met Arg Asn Ser Asn Ala Ala Thr Gly 1220 1225 1230Glu Asp Tyr Ile Asn Ser Pro Val Arg Asp Leu Asn Gly Val Cys 1235 1240 1245Phe Asp Ser Arg Phe Gln Asn Pro Glu Trp Pro Met Asp Ala Asp 1250 1255 1260Ala Asn Gly Ala Tyr His Ile Ala Leu Lys Gly Gln Leu Leu Leu 1265 1270 1275Asn His Leu Lys Glu Ser Lys Asp Leu Lys Leu Gln Asn Gly Ile 1280 1285 1290Ser Asn Gln Asp Trp Leu Ala Tyr Ile Gln Glu Leu Arg Asn 1295 1300 1305351228PRTArtificial sequenceSynthetic polypeptide 35Met Ser Lys Leu Glu Lys Phe Thr Asn Cys Tyr Ser Leu Ser Lys Thr1 5 10 15Leu Arg Phe Lys Ala Ile Pro Val Gly Lys Thr Gln Glu Asn Ile Asp 20 25 30Asn Lys Arg Leu Leu Val Glu Asp Glu Lys Arg Ala Glu Asp Tyr Lys 35 40 45Gly Val Lys Lys Leu Leu Asp Arg Tyr Tyr Leu Ser Phe Ile Asn Asp 50 55 60Val Leu His Ser Ile Lys Leu Lys Asn Leu Asn Asn Tyr Ile Ser Leu65 70 75 80Phe Arg Lys Lys Thr Arg Thr Glu Lys Glu Asn Lys Glu Leu Glu Asn 85 90 95Leu Glu Ile Asn Leu Arg Lys Glu Ile Ala Lys Ala Phe Lys Gly Asn 100 105 110Glu Gly Tyr Lys Ser Leu Phe Lys Lys Asp Ile Ile Glu Thr Ile Leu 115 120 125Pro Glu Phe Leu Asp Asp Lys Asp Glu Ile Ala Leu Val Asn Ser Phe 130 135 140Asn Gly Phe Thr Thr Ala Phe Thr Gly Phe Phe Asp Asn Arg Glu Asn145 150 155 160Met Phe Ser Glu Glu Ala Lys Ser Thr Ser Ile Ala Phe Arg Cys Ile 165 170 175Asn Glu Asn Leu Thr Arg Tyr Ile Ser Asn Met Asp Ile Phe Glu Lys 180 185 190Val Asp Ala Ile Phe Asp Lys His Glu Val Gln Glu Ile Lys Glu Lys 195 200 205Ile Leu Asn Ser Asp Tyr Asp Val Glu Asp Phe Phe Glu Gly Glu Phe 210 215 220Phe Asn Phe Val Leu Thr Gln Glu Gly Ile Asp Val Tyr Asn Ala Ile225 230 235 240Ile Gly Gly Phe Val Thr Glu Ser Gly Glu Lys Ile Lys Gly Leu Asn 245 250 255Glu Tyr Ile Asn Leu Tyr Asn Gln Lys Thr Lys Gln Lys Leu Pro Lys 260 265 270Phe Lys Pro Leu Tyr Lys Gln Val Leu Ser Asp Arg Glu Ser Leu Ser 275 280 285Phe Tyr Gly Glu Gly Tyr Thr Ser Asp Glu Glu Val Leu Glu Val Phe 290 295 300Arg Asn Thr Leu Asn Lys Asn Ser Glu Ile Phe Ser Ser Ile Lys Lys305 310 315 320Leu Glu Lys Leu Phe Lys Asn Phe Asp Glu Tyr Ser Ser Ala Gly Ile 325 330 335Phe Val Lys Asn Gly Pro Ala Ile Ser Thr Ile Ser Lys Asp Ile Phe 340 345 350Gly Glu Trp Asn Val Ile Arg Asp Lys Trp Asn Ala Glu Tyr Asp Asp 355 360 365Ile His Leu Lys Lys Lys Ala Val Val Thr Glu Lys Tyr Glu Asp Asp 370 375 380Arg Arg Lys Ser Phe Lys Lys Ile Gly Ser Phe Ser Leu Glu Gln Leu385 390 395 400Gln Glu Tyr Ala Asp Ala Asp Leu Ser Val Val Glu Lys Leu Lys Glu 405 410 415Ile Ile Ile Gln Lys Val Asp Glu Ile Tyr Lys Val Tyr Gly Ser Ser 420 425 430Glu Lys Leu Phe Asp Ala Asp Phe Val Leu Glu Lys Ser Leu Lys Lys 435 440 445Asn Asp Ala Val Val Ala Ile Met Lys Asp Leu Leu Asp Ser Val Lys 450 455 460Ser Phe Glu Asn Tyr Ile Lys Ala Phe Phe Gly Glu Gly Lys Glu Thr465 470 475 480Asn Arg Asp Glu Ser Phe Tyr Gly Asp Phe Val Leu Ala Tyr Asp Ile 485 490 495Leu Leu Lys Val Asp His Ile Tyr Asp Ala Ile Arg Asn Tyr Val Thr 500 505 510Gln Lys Pro Tyr Ser Lys Asp Lys Phe Lys Leu Tyr Phe Gln Asn Pro 515 520 525Gln Phe Met Gly Gly Trp Asp Lys Asp Lys Glu Thr Asp Tyr Arg Ala 530 535 540Thr Ile Leu Arg Tyr Gly Ser Lys Tyr Tyr Leu Ala Ile Met Asp Lys545 550 555 560Lys Tyr Ala Lys Cys Leu Gln Lys Ile Asp Lys Asp Asp Val Asn Gly 565 570 575Asn Tyr Glu Lys Ile Asn Tyr Lys Leu Leu Pro Gly Pro Asn Lys Met 580 585 590Leu Pro Lys Val Phe Phe Ser Lys Lys Trp Met Ala Tyr Tyr Asn Pro 595 600 605Ser Glu Asp Ile Gln Lys Ile Tyr Lys Asn Gly Thr Phe Lys Lys Gly 610 615 620Asp Met Phe Asn Leu Asn Asp Cys His Lys Leu Ile Asp Phe Phe Lys625 630 635 640Asp Ser Ile Ser Arg Tyr Pro Lys Trp Ser Asn Ala Tyr Asp Phe Asn 645 650 655Phe Ser Glu Thr Glu Lys Tyr Lys Asp Ile Ala Gly Phe Tyr Arg Glu 660 665 670Val Glu Glu Gln Gly Tyr Lys Val Ser Phe Glu Ser Ala Ser Lys Lys 675 680 685Glu Val Asp Lys Leu Val Glu Glu Gly Lys Leu Tyr Met Phe Gln Ile 690 695 700Tyr Asn Lys Asp Phe Ser Asp Lys Ser His Gly Thr Pro Asn Leu His705 710 715 720Thr Met Tyr Phe Lys Leu Leu Phe Asp Glu Asn Asn His Gly Gln Ile 725 730 735Arg Leu Ser Gly Gly Ala Glu Leu Phe Met Arg Arg Ala Ser Leu Lys 740 745 750Lys Glu Glu Leu Val Val His Pro Ala Asn Ser Pro Ile Ala Asn Lys 755 760 765Asn Pro Asp Asn Pro Lys Lys Thr Thr Thr Leu Ser Tyr Asp Val Tyr 770 775 780Lys Asp Lys Arg Phe Ser Glu Asp Gln Tyr Glu Leu His Ile Pro Ile785 790 795 800Ala Ile Asn Lys Cys Pro Lys Asn Ile Phe Lys Ile Asn Thr Glu Val 805 810 815Arg Val Leu Leu Lys His Asp Asp Asn Pro Tyr Val Ile Gly Ile Ala 820 825 830Arg Gly Glu Arg Asn Leu Leu Tyr Ile Val Val Val Asp Gly Lys Gly 835 840 845Asn Ile Val Glu Gln Tyr Ser Leu Asn Glu Ile Ile Asn Asn Phe Asn 850 855 860Gly Ile Arg Ile Lys Thr Asp Tyr His Ser Leu Leu Asp Lys Lys Glu865 870 875 880Lys Glu Arg Phe Glu Ala Arg Gln Asn Trp Thr Ser Ile Glu Asn Ile 885 890 895Lys Glu Leu Lys Ala Gly Tyr Ile Ser Gln Val Val His Lys Ile Cys 900 905 910Glu Leu Val Glu Lys Tyr Asp Ala Val Ile Ala Leu Ala Asp Leu Asn 915 920 925Ser Gly Phe Lys Asn Ser Arg Val Lys Val Glu Lys Gln Val Tyr Gln 930 935 940Lys Phe Glu Lys Met Leu Ile Asp Lys Leu Asn Tyr Met Val Asp Lys945 950 955 960Lys Ser Asn Pro Cys Ala Thr Gly Gly Ala Leu Lys Gly Tyr Gln Ile 965 970 975Thr Asn Lys Phe Glu Ser Phe Lys Ser Met Ser Thr Gln Asn Gly Phe 980 985 990Ile Phe Tyr Ile Pro Ala Trp Leu Thr Ser Lys Ile Asp Pro Ser Thr 995 1000 1005Gly Phe Val Asn Leu Leu Lys Thr Lys Tyr Thr Ser Ile Ala Asp 1010 1015 1020Ser Lys Lys Phe Ile Ser Ser Phe Asp Arg Ile Met Tyr Val Pro 1025 1030 1035Glu Glu Asp Leu Phe Glu Phe Ala Leu Asp Tyr Lys Asn Phe Ser 1040 1045 1050Arg Thr Asp Ala Asp Tyr Ile Lys Lys Trp Lys Leu Tyr Ser Tyr 1055 1060 1065Gly Asn Arg Ile Arg Ile Phe Arg Asn Pro Lys Lys Asn Asn Val 1070 1075 1080Phe Asp Trp Glu Glu Val Cys Leu Thr Ser Ala Tyr Lys Glu Leu 1085 1090 1095Phe Asn Lys Tyr Gly Ile Asn Tyr Gln Gln Gly Asp Ile Arg Ala 1100 1105 1110Leu Leu Cys Glu Gln Ser Asp Lys Ala Phe Tyr Ser Ser Phe Met 1115 1120 1125Ala Leu Met Ser Leu Met Leu Gln Met Arg Asn Ser Ile Thr Gly 1130 1135 1140Arg Thr Asp Val Asp Phe Leu Ile Ser Pro Val Lys Asn Ser Asp 1145 1150 1155Gly Ile Phe Tyr Asp Ser Arg Asn Tyr Glu Ala Gln Glu Asn Ala 1160 1165 1170Ile Leu Pro Lys Asn Ala Asp Ala Asn Gly Ala Tyr Asn Ile Ala 1175 1180 1185Arg Lys Val Leu Trp Ala Ile Gly Gln Phe Lys Lys Ala Glu Asp 1190 1195 1200Glu Lys Leu Asp Lys Val Lys Ile Ala Ile Ser Asn Lys Glu Trp 1205 1210 1215Leu Glu Tyr Ala Gln Thr Ser Val Lys His 1220 1225361314PRTArtificial sequenceSynthetic polypeptide 36Met Tyr Pro Tyr Asp Val Pro Asp Tyr Ala Ser Gly Ser Gly Met Ser1 5 10 15Ile Tyr Gln Glu Phe Val Asn Lys Tyr Ser Leu Ser Lys Thr Leu Arg 20 25 30Phe Glu Leu Ile Pro Gln Gly Lys Thr Leu Glu Asn Ile Lys Ala Arg 35 40 45Gly Leu Ile Leu Asp Asp Glu Lys Arg Ala Lys Asp Tyr Lys Lys Ala 50 55 60Lys Gln Ile Ile Asp Lys Tyr His Gln Phe Phe Ile Glu Glu Ile Leu65 70 75 80Ser Ser Val Cys Ile Ser Glu Asp Leu Leu Gln Asn Tyr Ser Asp Val 85 90 95Tyr Phe Lys Leu Lys Lys Ser Asp Asp Asp Asn Leu Gln Lys Asp Phe 100 105 110Lys Ser Ala Lys Asp Thr Ile Lys Lys Gln Ile Ser Glu Tyr Ile Lys 115 120 125Asp Ser Glu Lys Phe Lys Asn Leu Phe Asn Gln Asn Leu Ile Asp Ala 130 135 140Lys Lys Gly Gln Glu Ser Asp Leu Ile Leu Trp Leu Lys Gln Ser Lys145 150 155 160Asp Asn Gly Ile Glu Leu Phe Lys Ala Asn Ser Asp Ile Thr Asp Ile 165 170 175Asp Glu Ala Leu Glu Ile Ile Lys Ser Phe Lys Gly Trp Thr Thr Tyr 180 185 190Phe Lys Gly Phe His Glu Asn Arg Lys Asn Val Tyr Ser Ser Asn Asp 195 200 205Ile Pro Thr Ser Ile Ile Tyr Arg Ile Val Asp Asp Asn Leu Pro Lys 210 215 220Phe Leu Glu Asn Lys Ala Lys Tyr Glu Ser Leu Lys Asp Lys Ala Pro225 230 235 240Glu Ala Ile Asn Tyr Glu Gln Ile Lys Lys Asp Leu Ala Glu Glu Leu 245 250 255Thr Phe Asp Ile Asp Tyr Lys Thr Ser Glu Val Asn Gln Arg Val Phe 260 265 270Ser Leu Asp Glu Val Phe Glu Ile Ala Asn Phe Asn Asn Tyr Leu Asn 275 280 285Gln Ser Gly Ile Thr Lys Phe Asn Thr Ile Ile Gly Gly Lys Phe Val 290 295 300Asn Gly Glu Asn Thr Lys Arg Lys Gly Ile Asn Glu Tyr Ile Asn Leu305 310 315 320Tyr Ser Gln Gln Ile Asn Asp Lys Thr Leu Lys Lys Tyr Lys Met Ser 325 330 335Val Leu Phe Lys Gln Ile Leu Ser Asp Thr Glu Ser Lys Ser Phe Val 340 345 350Ile Asp Lys Leu Glu Asp Asp Ser Asp Val Val Thr Thr Met Gln Ser 355 360 365Phe Tyr Glu Gln Ile Ala Ala Phe Lys Thr Val Glu Glu Lys Ser Ile 370 375 380Lys Glu Thr Leu Ser Leu Leu Phe Asp Asp Leu Lys Ala Gln Lys Leu385 390 395 400Asp Leu Ser Lys Ile Tyr Phe Lys Asn Asp Lys Ser Leu Thr Asp Leu 405 410 415Ser Gln Gln Val Phe Asp Asp Tyr Ser Val Ile Gly Thr Ala Val Leu 420 425 430Glu Tyr Ile Thr Gln Gln Ile Ala Pro Lys Asn Leu Asp Asn Pro Ser 435 440 445Lys Lys Glu Gln Glu Leu Ile Ala Lys Lys Thr Glu Lys Ala Lys Tyr 450 455 460Leu Ser Leu Glu Thr Ile Lys Leu Ala Leu Glu Glu Phe Asn Lys His465 470 475 480Arg Asp Ile Asp Lys Gln Cys Arg Phe Glu Glu Ile Leu Ala Asn Phe 485 490 495Ala Ala Ile Pro Met Ile Phe Asp Glu Ile Ala Gln Asn Lys Asp Asn 500 505 510Leu Ala Gln Ile Ser Ile Lys Tyr Gln Asn Gln Gly Lys Lys Asp Leu 515 520 525Leu Gln Ala Ser Ala Glu Asp Asp Val Lys Ala Ile Lys Asp Leu Leu 530 535 540Asp Gln Thr Asn Asn Leu Leu His Lys Leu Lys Ile Phe His Ile Ser545 550 555 560Gln Ser Glu Asp Lys Ala Asn Ile Leu Asp Lys Asp Glu His Phe Tyr 565 570 575Leu Val Phe Glu Glu Cys Tyr Phe Glu Leu Ala Asn Ile Val Pro Leu 580 585 590Tyr Asn Lys Ile Arg Asn Tyr Ile Thr Gln Lys Pro Tyr Ser Asp Glu 595 600 605Lys Phe Lys Leu Asn Phe Glu Asn Ser Thr Leu Ala Asn Gly Trp Asp 610 615 620Lys Asn Lys Glu Pro Asp Asn Thr Ala Ile Leu Phe Ile Lys Asp Asp625 630 635 640Lys Tyr Tyr Leu Gly Val Met Asn Lys Lys Asn Asn Lys Ile Phe Asp 645 650 655Asp Lys Ala Ile Lys Glu Asn Lys Gly Glu Gly Tyr Lys Lys Ile Val 660 665 670Tyr Lys Leu Leu Pro Gly Ala Asn Lys Met Leu Pro Lys Val Phe Phe 675 680 685Ser Ala Lys Ser Ile Lys Phe Tyr Asn Pro Ser Glu Asp Ile Leu Arg 690 695 700Ile Arg Asn His Ser Thr His Thr Lys Asn Gly Ser Pro Gln Lys Gly705 710 715 720Tyr Glu Lys Phe Glu Phe Asn Ile Glu Asp Cys Arg Lys Phe Ile Asp 725 730 735Phe Tyr Lys Gln Ser Ile Ser Lys His Pro Glu Trp Lys Asp Phe Gly 740 745 750Phe Arg Phe Ser Asp Thr Gln Arg Tyr Asn Ser Ile Asp Glu Phe Tyr 755 760 765Arg Glu Val Glu Asn Gln Gly Tyr Lys Leu Thr Phe Glu Asn Ile Ser 770 775 780Glu Ser Tyr Ile Asp Ser Val Val Asn Gln Gly Lys Leu Tyr Leu Phe785 790 795 800Gln Ile Tyr Asn Lys Asp Phe

Ser Ala Tyr Ser Lys Gly Arg Pro Asn 805 810 815Leu His Thr Leu Tyr Trp Lys Ala Leu Phe Asp Glu Arg Asn Leu Gln 820 825 830Asp Val Val Tyr Lys Leu Asn Gly Glu Ala Glu Leu Phe Tyr Arg Lys 835 840 845Gln Ser Ile Pro Lys Lys Ile Thr His Pro Ala Lys Glu Ala Ile Ala 850 855 860Asn Lys Asn Lys Asp Asn Pro Lys Lys Glu Ser Val Phe Glu Tyr Asp865 870 875 880Leu Ile Lys Asp Lys Arg Phe Thr Glu Asp Lys Phe Phe Phe His Cys 885 890 895Pro Ile Thr Ile Asn Phe Lys Ser Ser Gly Ala Asn Lys Phe Asn Asp 900 905 910Glu Ile Asn Leu Leu Leu Lys Glu Lys Ala Asn Asp Val His Ile Leu 915 920 925Ser Ile Ala Arg Gly Glu Arg His Leu Ala Tyr Tyr Thr Leu Val Asp 930 935 940Gly Lys Gly Asn Ile Ile Lys Gln Asp Thr Phe Asn Ile Ile Gly Asn945 950 955 960Asp Arg Met Lys Thr Asn Tyr His Asp Lys Leu Ala Ala Ile Glu Lys 965 970 975Asp Arg Asp Ser Ala Arg Lys Asp Trp Lys Lys Ile Asn Asn Ile Lys 980 985 990Glu Met Lys Glu Gly Tyr Leu Ser Gln Val Val His Glu Ile Ala Lys 995 1000 1005Leu Val Ile Glu Tyr Asn Ala Ile Val Val Phe Glu Asp Leu Asn 1010 1015 1020Phe Gly Phe Lys Arg Gly Arg Phe Lys Val Glu Lys Gln Val Tyr 1025 1030 1035Gln Lys Leu Glu Lys Met Leu Ile Glu Lys Leu Asn Tyr Leu Val 1040 1045 1050Phe Lys Asp Asn Glu Phe Asp Lys Thr Gly Gly Val Leu Arg Ala 1055 1060 1065Tyr Gln Leu Thr Ala Pro Phe Glu Thr Phe Lys Lys Met Gly Lys 1070 1075 1080Gln Thr Gly Ile Ile Tyr Tyr Val Pro Ala Gly Phe Thr Ser Lys 1085 1090 1095Ile Cys Pro Val Thr Gly Phe Val Asn Gln Leu Tyr Pro Lys Tyr 1100 1105 1110Glu Ser Val Ser Lys Ser Gln Glu Phe Phe Ser Lys Phe Asp Lys 1115 1120 1125Ile Cys Tyr Asn Leu Asp Lys Gly Tyr Phe Glu Phe Ser Phe Asp 1130 1135 1140Tyr Lys Asn Phe Gly Asp Lys Ala Ala Lys Gly Lys Trp Thr Ile 1145 1150 1155Ala Ser Phe Gly Ser Arg Leu Ile Asn Phe Arg Asn Ser Asp Lys 1160 1165 1170Asn His Asn Trp Asp Thr Arg Glu Val Tyr Pro Thr Lys Glu Leu 1175 1180 1185Glu Lys Leu Leu Lys Asp Tyr Ser Ile Glu Tyr Gly His Gly Glu 1190 1195 1200Cys Ile Lys Ala Ala Ile Cys Gly Glu Ser Asp Lys Lys Phe Phe 1205 1210 1215Ala Lys Leu Thr Ser Val Leu Asn Thr Ile Leu Gln Met Arg Asn 1220 1225 1230Ser Lys Thr Gly Thr Glu Leu Asp Tyr Leu Ile Ser Pro Val Ala 1235 1240 1245Asp Val Asn Gly Asn Phe Phe Asp Ser Arg Gln Ala Pro Lys Asn 1250 1255 1260Met Pro Gln Asp Ala Asp Ala Asn Gly Ala Tyr His Ile Gly Leu 1265 1270 1275Lys Gly Leu Met Leu Leu Gly Arg Ile Lys Asn Asn Gln Glu Gly 1280 1285 1290Lys Lys Leu Asn Leu Val Ile Lys Asn Glu Glu Tyr Phe Glu Phe 1295 1300 1305Val Gln Asn Arg Asn Asn 13103719DNAArtificial sequenceSynthetic polynucleotide 37actgcggaaa tttgagcgt 193819DNAArtificial sequenceSynthetic polynucleotide 38acgctcaaat ttccgcagt 193919DNAArtificial sequenceSynthetic polynucleotide 39aggcaatggc tgcacatgc 194019DNAArtificial sequenceSynthetic polynucleotide 40gcatgtgcag ccattgcct 194119DNAArtificial sequenceSynthetic polynucleotide 41gacgcttggt tctgaggag 194219DNAArtificial sequenceSynthetic polynucleotide 42ctcctcagaa ccaagcgtc 194319DNAArtificial sequenceSynthetic polynucleotide 43tccggaaacg cattcctct 194419DNAArtificial sequenceSynthetic polynucleotide 44agaggaatgc gtttccgga 194519DNAArtificial sequenceSynthetic polynucleotide 45ccgcgtcagc ccggcccgg 194619DNAArtificial sequenceSynthetic polynucleotide 46ccgggccggg ctgacgcgg 194719DNAArtificial sequenceSynthetic polynucleotide 47cgactcccgc tgggcctct 194819DNAArtificial sequenceSynthetic polynucleotide 48agaggcccag cgggagtcg 194919DNAArtificial sequenceSynthetic polynucleotide 49ccgttgcgcg ctcgctctc 195019DNAArtificial sequenceSynthetic polynucleotide 50gagagcgagc gcgcaacgg 195119DNAArtificial sequenceSynthetic polynucleotide 51ccgcgcatcc tgccaggcc 195219DNAArtificial sequenceSynthetic polynucleotide 52ggcctggcag gatgcgcgg 195319DNAArtificial sequenceSynthetic polynucleotide 53ccaacttggc gcgtttcgg 195419DNAArtificial sequenceSynthetic polynucleotide 54ccgaaacgcg ccaagttgg 195519DNAArtificial sequenceSynthetic polynucleotide 55accacgcgtc cgagtccgg 195619DNAArtificial sequenceSynthetic polynucleotide 56ccggactcgg acgcgtggt 195719DNAArtificial sequenceSynthetic polynucleotide 57tgctcattgt ccctggaca 195819DNAArtificial sequenceSynthetic polynucleotide 58tgtccaggga caatgagca 195919DNAArtificial sequenceSynthetic polynucleotide 59ggacaccctg ctcattgtc 196019DNAArtificial sequenceSynthetic polynucleotide 60gacaatgagc agggtgtcc 196119DNAArtificial sequenceSynthetic polynucleotide 61accggcagcc tgcgcgtcc 196219DNAArtificial sequenceSynthetic polynucleotide 62ggacgcgcag gctgccggt 196319DNAArtificial sequenceSynthetic polynucleotide 63cgatgggcac ccactgctc 196419DNAArtificial sequenceSynthetic polynucleotide 64gagcagtggg tgcccatcg 196519DNAArtificial sequenceSynthetic polynucleotide 65ccttcacgtg gacgcgcag 196619DNAArtificial sequenceSynthetic polynucleotide 66ctgcgcgtcc acgtgaagg 196719DNAArtificial sequenceSynthetic polynucleotide 67cgtgaaggtg gaagccttc 196819DNAArtificial sequenceSynthetic polynucleotide 68gaaggcttcc accttcacg 196919DNAArtificial sequenceSynthetic polynucleotide 69ctccttggtc aggcgccgg 197019DNAArtificial sequenceSynthetic polynucleotide 70ccggcgcctg accaaggag 197119DNAArtificial sequenceSynthetic polynucleotide 71tggtcaggcg ccggttccg 197219DNAArtificial sequenceSynthetic polynucleotide 72cggaaccggc gcctgacca 197319DNAArtificial sequenceSynthetic polynucleotide 73tagaggtcgc cttctcctc 197419DNAArtificial sequenceSynthetic polynucleotide 74gaggagaagg cgacctcta 197519DNAArtificial sequenceSynthetic polynucleotide 75cgacgctcgg gtcgcggtg 197619DNAArtificial sequenceSynthetic polynucleotide 76caccgcgacc cgagcgtcg 197719DNAArtificial sequenceSynthetic polynucleotide 77atgctgtcgc cgcgcgggg 197819DNAArtificial sequenceSynthetic polynucleotide 78ccccgcgcgg cgacagcat 197919DNAArtificial sequenceSynthetic polynucleotide 79ctcaccctca ccggagcca 198019DNAArtificial sequenceSynthetic polynucleotide 80tggctccggt gagggtgag 198119DNAArtificial sequenceSynthetic polynucleotide 81ccgcaaactt tactcctta 198219DNAArtificial sequenceSynthetic polynucleotide 82taaggagtaa agtttgcgg 198319DNAArtificial sequenceSynthetic polynucleotide 83ctcctaagat tggcttcac 198419DNAArtificial sequenceSynthetic polynucleotide 84gtgaagccaa tcttaggag 198519DNAArtificial sequenceSynthetic polynucleotide 85ccggagccac tcctaagat 198619DNAArtificial sequenceSynthetic polynucleotide 86atcttaggag tggctccgg 198719DNAArtificial sequenceSynthetic polynucleotide 87ttctctaccc tacgtctca 198819DNAArtificial sequenceSynthetic polynucleotide 88tgagacgtag ggtagagaa 198919DNAArtificial sequenceSynthetic polynucleotide 89tacgtctcat tctccgcaa 199019DNAArtificial sequenceSynthetic polynucleotide 90ttgcggagaa tgagacgta 199119DNAArtificial sequenceSynthetic polynucleotide 91gctaggcctc cagcccttc 199219DNAArtificial sequenceSynthetic polynucleotide 92gaagggctgg aggcctagc 199319DNAArtificial sequenceSynthetic polynucleotide 93acaggtggcg ccgcaactt 199419DNAArtificial sequenceSynthetic polynucleotide 94aagttgcggc gccacctgt 199519DNAArtificial sequenceSynthetic polynucleotide 95agccggaggc gcgagagtc 199619DNAArtificial sequenceSynthetic polynucleotide 96gactctcgcg cctccggct 19

Claims

1. A fusion protein comprising a nuclease-deficient RNA-guided DNA endonuclease enzyme, a Kruppel associated box domain, and a DNA methyltransferase domain.

2. The fusion protein of claim 1, wherein the nuclease-deficient RNA-guided DNA endonuclease enzyme is dCas9, ddCpf1, a nuclease-deficient Cas9 variant, or a nuclease-deficient Class II CRISPR endonuclease.

3. The fusion protein of claim 1, wherein the DNA methyltransferase domain is a Dnmt3A-3L domain.

4. The fusion protein of claim 1, wherein the fusion protein comprises, from N-terminus to C-terminus, the DNA methyltransferase domain, the nuclease-deficient RNA-guided DNA endonuclease enzyme, and the Kruppel associated box domain.

5. The fusion protein of claim 4, wherein the nuclease-deficient RNA-guided DNA endonuclease enzyme is dCas9 and the DNA methyltransferase domain is a Dnmt3A-3L domain; wherein the dCas9 is covalently linked to the Dnmt3A-3L domain via an XTEN linker and wherein the Dnmt3A-3L domain is covalently linked to the Kruppel associated box domain via an XTEN linker.

6. The fusion protein of claim 1, wherein the fusion protein comprises, from N-terminus to C-terminus, the Kruppel associated box, the nuclease-deficient RNA-guided DNA endonuclease enzyme, and the DNA methyltransferase domain.

7. The fusion protein of claim 6, wherein the nuclease-deficient RNA-guided DNA endonuclease enzyme is dCas9 and the DNA methyltransferase domain is a Dnmt3A-3L domain.

8. The fusion protein of claim 7, wherein the dCas9 is covalently linked to the Dnmt3A-3L domain via a XTEN linker and wherein the Kruppel associated box domain is covalently linked to the dCas9 via a XTEN linker.

9. The fusion protein of claim 1, wherein the nuclease-deficient RNA-guided DNA endonuclease enzyme is covalently linked to the Kruppel associated box domain via a peptide linker.

10. The fusion protein of claim 1, wherein the nuclease-deficient RNA-guided DNA endonuclease enzyme is covalently linked to the DNA methyltransferase domain via a peptide linker.

11. The fusion protein of claim 1, wherein the Kruppel associated box domain is covalently linked to the DNA methyltransferase domain via an XTEN linker.

12. The fusion protein of claim 11, wherein the XTEN linker comprises about 16 to 80 amino acid residues.

13. The fusion protein of claim 1, further comprising a nuclear localization signal peptide.

14. The fusion protein of claim 1, wherein the fusion protein comprises the amino acid sequence of SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 12, 13, 14, or 15.

15. A nucleic acid sequence encoding the fusion protein of claim 1.

16. A complex comprising: (i) a fusion protein of claim 1; and (ii) a polynucleotide comprising: (a) a DNA-targeting sequence that is complementary to a target polynucleotide sequence; and (b) a binding sequence for the nuclease-deficient RNA-guided DNA endonuclease enzyme, wherein the nuclease-deficient RNA-guided DNA endonuclease enzyme is bound to the polynucleotide via the binding sequence.

17. A vector comprising a nucleic acid sequence encoding the fusion protein of claim 1.

18. A cell comprising the fusion protein of claim 1.

19. A method of silencing a target nucleic acid sequence in a cell, comprising: (i) delivering a first polynucleotide encoding a fusion protein of claim 1 to a cell containing the target nucleic acid; and (ii) delivering to the cell a second polynucleotide comprising: (a) a DNA-targeting sequence that is complementary to the target nucleic acid sequence; and (b) a binding sequence for the nuclease-deficient RNA-guide DNA endonuclease enzyme.

20. A method of silencing a target nucleic acid sequence in a cell, the method comprising delivering a complex to a cell containing the target nucleic acid; wherein the complex comprises: (i) a fusion protein of claim 1; and (ii) a polynucleotide comprising: (a) a DNA-targeting sequence that is complementary to a target polynucleotide sequence; and (b) a binding sequence for the nuclease-deficient RNA-guided DNA endonuclease enzyme, wherein the nuclease-deficient RNA-guided DNA endonuclease enzyme is bound to the polynucleotide via the binding sequence.