Patent application title: ALS INHIBITOR HERBICIDE TOLERANT BETA VULGARIS MUTANTS
Inventors:
IPC8 Class: AC12N1501FI
USPC Class:
1 1
Class name:
Publication date: 2021-02-25
Patent application number: 20210054360
Abstract:
The present invention relates to an ALS inhibitor herbicide tolerant Beta
vulgaris plant and parts thereof comprising a mutation of an endogenous
acetolactate synthase (ALS) gene, wherein the ALS gene encodes an ALS
polypeptide containing an amino acid different from tryptophan at a
position 569 of the ALS polypeptide.Claims:
1. An ALS inhibitor herbicide tolerant Beta vulgaris plant and parts
thereof comprising a mutation of an endogenous acetolactate synthase
(ALS) gene, wherein the ALS gene encodes an ALS polypeptide containing an
amino acid different from tryptophan at a position 569 of the ALS
polypeptide.
2. The Beta vulgaris plant and parts thereof according to claim 1, in which the ALS polypeptide has at position 569 the amino acid alanine, glycine, isoleucine, leucine, methionine, phenylalanine, proline, valine, or arginine instead of the naturally encoded amino acid tryptophan.
3. The Beta vulgaris plant and parts thereof according to claim 1, wherein the ALS gene encodes an ALS polypeptide containing an amino acid different from tryptophan at a position 569 of the ALS polypeptide sequence as set forth in SEQ ID NO: 2.
4. The Beta vulgaris plant and parts thereof according to claim 1, in which the amino acid is leucine and in which the endogenous ALS gene is identical to the nucleotide sequence defined by SEQ ID NO: 3.
5. The Beta vulgaris plant and parts thereof according to claim 1, which are tolerant to one or more ALS-inhibitor herbicides belonging to the group consisting of sulfonylurea herbicides, sulfonylaminocarbonyltriazolinone herbicides, imidazolinone herbicides, triazolopyrimidine herbicides, and pyrimidinyl(thio)benzoate herbicides.
6. The Beta vulgaris plant and parts thereof according to claim 1, which are homozygous for the mutation of the endogenous acetolactate synthase (ALS) gene.
7. The parts of the Beta vulgaris plant according to claim 1, wherein the parts are organs, tissues, and cells of the plant, and preferably seeds.
8. Method for the manufacture of the Beta vulgaris plant and the parts thereof of claim 1, comprising the following steps: (a) exposing calli from B. vulgaris, to about 10.sup.-7 M-10.sup.-9 M of an ALS inhibitor herbicide, preferably foramsulfuron; (b) selecting cell colonies which can grow in the presence of up to 3.times.10.sup.-6 M of an ALS inhibitor herbicide, preferably foramsulfuron; (c) regenerating shoots in presence of an ALS inhibitor herbicide, preferably foramsulfuron; (d) selecting regenerated plantlets with an ALS inhibitor herbicide, preferably foramsulfuron, iodosulfuron-methyl-sodium and/or a mixture of both, wherein the dose of foramsulfuron is preferably equivalent to 7-70 g a.i./ha and the dose of iodosulfuron-methyl-sodium is preferably equivalent to 1-10 g a.i./ha.
Description:
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a continuation of U.S. patent application Ser. No. 13/821,969, filed 8 Mar. 2013, which is a National Stage entry of International Application No. PCT/EP2011/067925, filed 13 Oct. 2011, which claims priority to U.S. Provisional Application No. 61/394,463, filed 19 Oct. 2010 and European Application No. 10187751.2, filed 15 Oct. 2010. The disclosure of the priority applications are incorporated in their entirety herein by reference.
REFERENCE TO SEQUENCE LISTING SUBMITTED AS A COMPLIANT ASCII TEXT FILE (.TXT)
[0002] Pursuant to the EFS-Web legal framework and 37 CFR .sctn..sctn. 1.821-825 (see MPEP .sctn. 2442.03(a)), a Sequence Listing in the form of an ASCII-compliant text file (entitled "Sequence_Listing_2923343-035001_ST25.txt" created on 3 Nov. 2020, and 26,010 bytes in size) is submitted concurrently with the instant application, and the entire contents of the Sequence Listing are incorporated herein by reference.
DESCRIPTION OF RELATED ART
[0003] The present invention relates to ALS inhibitor herbicide tolerant Beta vulgaris plants and parts thereof as well as a method for their manufacture.
[0004] Cultivated forms of Beta vulgaris (as defined in Ford-Lloyd (2005) Sources of genetic variation, Genus Beta. In: Biancardi E, Campbell L G, Skaracis G N, De Biaggi M (eds) Genetics and Breeding of Sugar Beet. Science Publishers, Enfield (NH), USA, pp. 25-33) are important agricultural crops in temperate and subtropical regions. For example, about 20% of the world sugar production is based on sugar beet. Because beet seedlings and juvenile plants during their first 6-8 weeks of their life are susceptible for strong competition caused by fast growing weeds, which outcompete the young crop plants, reliable weed control measures are imperative in these crop areas.
[0005] Since more than 40 years, herbicides are the preferred tools to control weeds in cultured beets. The products used for this purpose, like phenmedipham, desmediphan and metamitron allow to suppress the growth of weeds in beet fields without damaging the crop. Nevertheless under adverse environmental conditions the efficacy of these products leaves room for improvements, especially if noxious weeds like Chenopodium album, Amaranthus retroflexus and/or Tripleurospermum inodorata germinate over an extended period of time.
[0006] Innovative herbicidal active ingredients are highly desirable in order to improve the weed control options in beet. Such compounds should act against a broad weed spectrum, preferably from weed germination until full development of the weed plants, without affecting the beet crop irrespective of its developmental stage. Via the classical herbicide screening approach no selective herbicidal active ingredient was discovered for beet during the past decades which fulfils all these stringent properties in an agronomically superior way.
[0007] Some chemicals inhibit the enzyme "acetohydroxyacid synthase" (AHAS), also known as "acetolactate synthase" (ALS [EC 4.1.3.18]). ALS is the site of action of five structurally diverse herbicide families belonging to the class of ALS inhibitor herbicides, like (a) sulfonylurea herbicides (Beyer E. M et al. (1988), Sulfonylureas in Herbicides: Chemistry, Degradation, and Mode of Action; Marcel Dekker, New York, 1988, 117-189), (b) sulfonylaminocarbonyltriazolinone herbicides (Pontzen, R., Pflanz.-Nachrichten Bayer, 2002, 55, 37-52), (c) imidazolinone herbicides (Shaner, D. L., et al., Plant Physiol., 1984, 76, 545-546; Shaner, D. L., and O'Connor, S. L. (Eds.) The Imidazolinone Herbicides, CRC Press, Boca Raton, Fla., 1991), (d) triazolopyrimidine herbicides (Kleschick, W. A. et al., Agric. Food Chem., 1992, 40, 1083-1085), and (e) pyrimidinyl(thio)benzoate herbicides (Shimizu, T. J., Pestic. Sci., 1997, 22, 245-256; Shimizu, T. et al., Acetolactate Syntehase Inhibitors in Herbicide Classes in Development, Boger, P., Wakabayashi, K., Hirai, K., (Eds.), Springer Verlag, Berlin, 2002, 1-41).
[0008] ALS is involved in the conversion of two pyruvate molecules to an acetolactate molecule and carbon dioxide. The reaction uses thyamine pyrophosphate in order to link the two pyruvate molecules. The resulting product of this reaction, acetolactate, eventually becomes valine, leucine and isoleucine (Singh (1999) "Biosynthesis of valine, leucine and isoleucine", in Plant Amino Acids, Singh, B. K., ed., Marcel Dekker Inc. New York, N.Y., pp. 227-247).
[0009] Inhibitors of the ALS interrupt the biosynthesis of valine, leucine and isoleucine in plants. The consequence is an immediate depletion of the respective amino acid pools causing a stop of protein biosynthesis leading to a cessation of plant growth and eventually the plant dies, or--at least--is damaged.
[0010] ALS inhibitor herbicides are widely used in modern agriculture due to their effectiveness at moderate application rates and relative non-toxicity in animals. By inhibiting ALS activity, these families of herbicides prevent further growth and development of susceptible plants including many weed species. In order to provide plants with an increased tolerance to even high concentrations of ALS inhibitor herbicides that may be required for sufficient weed control, additional ALS-inhibiting herbicide-resistant breeding lines and varieties of crop plants, as well as methods and compositions for the production and use of ALS inhibiting herbicide-resistant breeding lines and varieties, are needed.
[0011] A broad variety of ALS inhibitor herbicides enable a farmer to control a wide range of weed species independently of their growth stages, but these highly efficient herbicides cannot be used in beet because conventional beet plants/commercial beet varieties are highly susceptible against these ALS inhibitor herbicides. Nevertheless, these ALS inhibitor herbicides show an excellent herbicidal activity against broadleaf and grass weed species. The first herbicides having the mode of action of inhibiting the ALS were developed for their use in agriculture already 30 years ago. Nowadays, active ingredients of this class of herbicides exhibit a strong weed control and are widely used in maize and cereals as well as in dicotyledonous crops, except beet.
[0012] The only ALS inhibitor herbicide that is known today to be applied in post-emergent application schemes in beet is Debut. This herbicide (containing triflusulfuron-methyl as the active ingredient plus specific formulation compounds) is degraded by beets before it can inhibit the beet endogenous ALS enzyme but it has severe gaps in weed control in beet growing areas.
[0013] Since ALS inhibitor herbicides were introduced into agriculture it was observed that susceptible plant species, including naturally occurring weeds, occasionally develop spontaneous tolerance to this class of herbicides. Single base pair substitutions at specific sites of the ALS gene usually lead to more or less resistant ALS enzyme variants which show different levels of inhibition by the ALS inhibitor herbicides.
[0014] Plants conferring mutant ALS alleles therefore show different levels of tolerance to ALS inhibitor herbicides, depending on the chemical structure of the ALS inhibitor herbicide and the site of the point mutation in the ALS gene.
[0015] For example, Hattori et al. (1995), Mol. Gen. Genet. 246: 419-425, describes a single mutation in the Trp 557 codon in a Brassica napus cell line (according to the numbering of the Arabidopsis thaliana sequence that is used in the literature in order to compare all ALS/AHAS mutants this refers to position "574")--which equals position 569 of the beet ALS sequence. These authors observed resistance to several members of sub-classes of ALS inhibitor herbicides, like sulfonylureas, imidazolinones and triazolopyrimidines.
[0016] Beet mutants were described conferring a point mutation in the Ala 122 codon which led to a certain tolerance to the ALS inhibitor herbicide subclass of imidazolinones (WO 98/02526) but which is not sufficient for weed control in agricultural application schemes. No cross-tolerance to other ALS inhibitor herbicide classes were described by employing this mutant. Furthermore, beet plants conferring a second point mutation in the Pro 197 codon showed a moderate tolerance to ALS inhibitor herbicides belonging to members of the subclass of sulfonylurea herbicides. Also double mutants of these two were described (WO 98/02527). However, none of these mutants were used for the market introduction of beet varieties because the level of herbicide tolerance to ALS inhibitor herbicides was not sufficiently high in these mutants to be exploited agronomically.
[0017] Stougaard et al. (1990), J. Cell Biochem., Suppl. 14E, 310 describe the isolation of ALS mutants in a tetraploid sugar beet cell culture. Two different ALS genes (ALS I and ALS II) were isolated which differed at amino acid position 37 only. Mutant 1 contained in its ALS I gene 2 mutations, while mutant 2 contained 3 mutations in its ALS II gene. After the mutations were separated to resolve which mutation would confer resistance against an ALS inhibitor, it was revealed that ALS synthesized from a recombinant E. coli was herbicide resistant if it contained a point mutation in the Trp 574 codon (according to the numbering of the Arabidopsis thaliana sequence that is used in the literature in order to compare all ALS mutants)--which equals position 569 of the beet ALS sequence, leading to a replacement of the amino acid "Trp" by the amino acid "Leu". Stougaard et al did not show in sugar beet that the mutation at position 569 of any of the sugar beet ALS genes is sufficient in order to obtain an acceptable level of tolerance to ALS inhibitor herbicides. Moreover, Stougaard et al did not regenerate or handle sugar beet plants comprising a mutation, including Trp->Leu mutation at position 569 of sugar beet ALS.
[0018] Knowing this, Stougaard et al. constructed plant transformation vectors containing different ALS genes for use in plant transformation. However, up to now, no further data--especially not concerning the effects of the application of ALS inhibitor herbicides to plants and/or agricultural areas comprising this mutation in Beta vulgaris plants have been disclosed by these or other authors either in genetically engineered or mutant plants over more than 20 years, thereafter.
[0019] WO 99/57965 generally describes sulfonylurea resistant sugar beet plants and methods for obtaining them by EMS (Ethylmethanesulfonate) mutagenesis. However, apart from the research that is required to obtain such mutants, this publication does neither provide such plants, nor describes any specific location in the ALS gene that may be relevant for obtaining ALS inhibitor herbicide tolerant mutants, nor discloses any correlated agronomical use of such. Furthermore, there is a strong likelihood that--by employing such strong mutagenic compound like EMS--various further mutations may occur elsewhere in the genome and which might lead to disadvantages up to non-fertility and/or growth retardation of such obtained plants. Moreover, due to its chemical interaction with the DNA, the EMS application may have gaps of inducing specific mutations, like converting the triplet TGG into TTG, because EMS always converts a guanosine into an adenosine.
[0020] In some weed species as Amaranthus, the Trp 574 Leu mutation could be detected in plant populations which were repeatedly exposed to ALS inhibitor herbicides. These Trp 574 Leu mutants show a high level of tolerance to several chemical classes of ALS inhibitor herbicides, like those selected from the group consisting of sulfonylureas and sulfonylaminocarbonyltriazolinones.
[0021] WO 2008/124495 discloses ALS double and triple mutants. According to WO 2009/046334, specific mutations in the ALS gene were provided. However, agronomically exploitable herbicide tolerant Beta vulgaris mutants containing such mutations according to WO 2009/046334 have not been obtained so far.
[0022] Moreover, in view of the fact that, for example, sugar beet accounts for about 20% of the world sugar production, it would also be highly desirable to have available sugar beet plants which have a growth advantage versus highly potent weeds. It would thus be highly desirable to have available, with respect to the ALS gene, non-transgenic Beta vulgaris plants including sugar beet plants which are tolerant to ALS inhibitor herbicides. Hence, there is a need for such non-transgenic Beta vulgaris plants, in particular sugar beet plants which are tolerant to ALS inhibitor herbicides at an agronomically exploitable level of ALS inhibitor herbicides.
[0023] Thus, the technical problem is to comply with this need.
SUMMARY
[0024] The present invention addresses this need and thus provides as a solution to the technical problem an ALS inhibitor herbicide tolerant Beta vulgaris plant and parts thereof comprising a mutation of an endogenous acetolactate synthase (ALS) gene, wherein the ALS gene encodes an ALS polypeptide containing an amino acid different from tryptophan at a position 569 of the ALS polypeptide.
DETAILED DESCRIPTION OF A PREFERRED EMBODIMENT
[0025] Seeds according to present invention have been deposited with the NCIMB, Aberdeen, UK, under Number NCIMB 41705 on Mar. 12, 2010.
[0026] By applying various breeding methods, high yielding commercial varieties highly competitive in all specific markets with the add-on of a robust ALS inhibitor herbicide tolerance can be developed subsequently by using the originally obtained mutant plants.
[0027] It must be noted that as used herein, the singular forms "a", "an", and "the", include plural references unless the context clearly indicates otherwise. Thus, for example, reference to "a reagent" includes one or more of such different reagents and reference to "the method" includes reference to equivalent steps and methods known to those of ordinary skill in the art that could be modified or substituted for the methods described herein.
[0028] All publications and patents cited in this disclosure are incorporated by reference in their entirety. To the extent the material incorporated by reference contradicts or is inconsistent with this specification, the specification will supersede any such material.
[0029] Unless otherwise indicated, the term "at least" preceding a series of elements is to be understood to refer to every element in the series. Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the present invention.
[0030] Throughout this specification and the claims which follow, unless the context requires otherwise, the word "comprise", and variations such as "comprises" and "comprising", will be understood to imply the inclusion of a stated integer or step or group of integers or steps but not the exclusion of any other integer or step or group of integer or step. The word "comprise" and its variations on the one side and "contain" and its analogous variations on the other side can be used interchangeably without a preference to any of them.
[0031] In the present invention, beet plants were obtained which comprise an altered endogenous ALS gene (also referred to as "AHAS" gene), carrying a point mutation in the Trp 569 codon (in relation to the Beta vulgaris ALS amino acid reference sequence shown in SEQ ID NO: 2; this equals position 574 of the referenced Arabidopsis thaliana sequence as shown in SEQ ID NO: 6) and which point mutation was obtained by several circles of selection on specifically elected ALS inhibitor herbicides.
[0032] Due to the fact that the B. vulgaris plants of the present invention were obtained by isolating spontaneous mutant plant cells, which were directly regenerated to fully fertile beet plants having a point mutation as described herein in more detail. These plants are non-transgenic as far as the ALS gene is concerned.
[0033] Moreover, the plants of the present invention themselves as well as their offspring are fertile and thus useful for breeding purposes without any further manipulation that may cause stress induced further alterations of the genetic background. Such plants obtained according to the selection procedure applied herein can directly be employed in order to generate beet varieties and/or hybrids conferring agronomically useful levels of tolerance to ALS inhibitor herbicides, thus allowing innovative weed control measures in beet growing areas.
[0034] When used herein, the term "transgenic" means that a gene--which can be of the same or a different species--has been introduced via an appropriate biological carrier, like Agrobacterium tumefaciens or by any other physical means, like protoplast transformation or particle bombardment, into a plant and which gene is able to be expressed in the new host environment, namely the genetically modified organism (GMO).
[0035] In accordance to the before definition, the term "non-transgenic" means exactly the contrary, i.e. that no introduction of the respective gene has occurred via an appropriate biological carrier or by any other physical means. However, a mutated gene can be transferred through pollination, either naturally or via a breeding process to produce another non-transgenic plant concerning this specific gene.
[0036] An "endogenous" gene means a gene of a plant which has not been introduced into the plant by genetic engineering techniques.
[0037] The term "sequence" when used herein relates to nucleotide sequence(s), polynucleotide(s), nucleic acid sequence(s), nucleic acid(s), nucleic acid molecule, peptides, polypeptides and proteins, depending on the context in which the term "sequence" is used.
[0038] The terms "nucleotide sequence(s)", "polynucleotide(s)", "nucleic acid sequence(s)", "nucleic acid(s)", "nucleic acid molecule" are used interchangeably herein and refer to nucleotides, either ribonucleotides or deoxyribonucleotides or a combination of both, in a polymeric unbranched form of any length. Nucleic acid sequences include DNA, cDNA, genomic DNA, RNA, synthetic forms and mixed polymers, both sense and antisense strands, or may contain non-natural or derivatized nucleotide bases, as will be readily appreciated by those skilled in the art.
[0039] When used herein, the term "polypeptide" or "protein" (both terms are used interchangeably herein) means a peptide, a protein, or a polypeptide which encompasses amino acid chains of a given length, wherein the amino acid residues are linked by covalent peptide bonds. However, peptidomimetics of such proteins/polypeptides wherein amino acid(s) and/or peptide bond(s) have been replaced by functional analogs are also encompassed by the invention as well as other than the 20 gene-encoded amino acids, such as selenocysteine. Peptides, oligopeptides and proteins may be termed polypeptides. The term polypeptide also refers to, and does not exclude, modifications of the polypeptide, e.g., glycosylation, acetylation, phosphorylation and the like. Such modifications are well described in basic texts and in more detailed monographs, as well as in the research literature. The polypeptide (or protein) that is preferably meant herein is the B. vulgaris ALS polypeptide (or ALS protein) [SEQ ID NO: 2].
[0040] Amino acid substitutions encompass amino acid alterations in which an amino acid is replaced with a different naturally-occurring amino acid residue. Such substitutions may be classified as "conservative`, in which an amino acid residue contained in the wild-type ALS protein is replaced with another naturally-occurring amino acid of similar character, for example GlyAla. ValIleLeu, AspGlu, LysArg, AsnGln or PheTrpTyr. Substitutions encompassed by the present invention may also be "non-conservative", in which an amino acid residue which is present in the wild-type ALS protein is substituted with an amino acid with different properties, such as a naturally-occurring amino acid from a different group (e.g. substituting a charged or hydrophobic amino acid with alanine. "Similar amino acids", as used herein, refers to amino acids that have similar amino acid side chains, i.e. amino acids that have polar, non-polar or practically neutral side chains. "Non-similar amino acids", as used herein, refers to amino acids that have different amino acid side chains, for example an amino acid with a polar side chain is non-similar to an amino acid with a non-polar side chain. Polar side chains usually tend to be present on the surface of a protein where they can interact with the aqueous environment found in cells ("hydrophilic" amino acids). On the other hand, "non-polar" amino acids tend to reside within the center of the protein where they can interact with similar non-polar neighbours ("hydrophobic" amino acids"). Examples of amino acids that have polar side chains are arginine, asparagine, aspartate, cysteine, glutamine, glutamate, histidine, lysine, serine, and threonine (all hydrophilic, except for cysteine which is hydrophobic). Examples of amino acids that have non-polar side chains are alanine, glycine, isoleucine, leucine, methionine, phenylalanine, proline, and tryptophan (all hydrophobic, except for glycine which is neutral).
[0041] Generally, the skilled person knows, because of his common general knowledge and the context when the terms ALS, ALSL, AHAS or AHASL are used, as to whether the nucleotide sequence or nucleic acid, or the amino acid sequence or polypeptide, respectively, is meant.
[0042] The term "gene" when used herein refers to a polymeric form of nucleotides of any length, either ribonucleotides or desoxyribonucleotides. The term includes double- and single-stranded DNA and RNA. It also includes known types of modifications, for example, methylation, "caps", substitutions of one or more of the naturally occurring nucleotides with an analog. Preferably, a gene comprises a coding sequence encoding the herein defined polypeptide. A "coding sequence" is a nucleotide sequence which is transcribed into mRNA and/or translated into a polypeptide when placed or being under the control of appropriate regulatory sequences. The boundaries of the coding sequence are determined by a translation start codon at the 5'-terminus and a translation stop codon at the 3'-terminus. A coding sequence can include, but is not limited to mRNA, cDNA, recombinant nucleic acid sequences or genomic DNA, while introns may be present as well under certain circumstances. When used herein the term "Beta vulgaris" is abbreviated as "B. vulgaris".
[0043] Furthermore, the term "beet" is used herein. Said three terms are interchangeably used and should be understood to fully comprise the cultivated forms of Beta vulgaris as defined in Ford-Lloyd (2005) Sources of genetic variation, Genus Beta. In: Biancardi E, Campbell L G, Skaracis G N, De Biaggi M (eds) Genetics and Breeding of Sugar Beet. Science Publishers, Enfield (NH), USA, pp 25-33. Similarly, for example, the term "Arabidopsis thaliana" is abbreviated as "A. thaliana". Both terms are interchangeably used herein.
[0044] The term "position" when used in accordance with the present invention means the position of either an amino acid within an amino acid sequence depicted herein or the position of a nucleotide within a nucleotide sequence depicted herein. The term "corresponding" as used herein also includes that a position is not only determined by the number of the preceding nucleotides/amino acids.
[0045] The position of a given nucleotide in accordance with the present invention which may be substituted may vary due to deletions or additional nucleotides elsewhere in the ALS 5'-untranslated region (UTR) including the promoter and/or any other regulatory sequences or gene (including exons and introns). Similarly, the position of a given amino acid in accordance with the present invention which may be substituted may vary due to deletion or addition of amino acids elsewhere in the ALS polypeptide.
[0046] Thus, under a "corresponding position" in accordance with the present invention it is to be understood that nucleotides/amino acids may differ in the indicated number but may still have similar neighbouring nucleotides/amino acids. Said nucleotides/amino acids which may be exchanged, deleted or added are also comprised by the term "corresponding position".
[0047] In order to determine whether a nucleotide residue or amino acid residue in a given ALS nucleotide/amino acid sequence corresponds to a certain position in the nucleotide sequence of SEQ ID NO: 1 or the amino acid sequence of SEQ ID NO: 2, the skilled person can use means and methods well-known in the art, e.g., alignments, either manually or by using computer programs such as BLAST (Altschul et al. (1990), Journal of Molecular Biology, 215, 403-410), which stands for Basic Local Alignment Search Tool or ClustalW (Thompson et al. (1994), Nucleic Acid Res., 22, 4673-4680) or any other suitable program which is suitable to generate sequence alignments.
[0048] SEQ ID NO: 1 is the nucleotide sequence encoding Beta vulgaris wild type ALS. SEQ ID NO: 2 is the Beta vulgaris amino acid sequence derived from SEQ ID NO: 1. Accordingly, the codon at position 1705-1707 of the nucleotide sequence of SEQ ID NO: 1 encodes the amino acid at position 569 (i.e. the amino acid "Trp" according to the three letter code or "W" according to the one letter code) of SEQ ID NO: 2.
[0049] In the alternative to determine whether a nucleotide residue or amino acid residue in a given ALS nucleotide/amino acid sequence corresponds to a certain position in the nucleotide sequence of SEQ ID NO: 1, the nucleotide sequence encoding A. thaliana wild type ALS shown in SEQ ID NO: 5 can be used. SEQ ID NO: 6 is the A. thaliana amino acid sequence derived from SEQ ID NO: 5.
[0050] Accordingly, the codon at position 1720-1722 of the nucleotide sequence of SEQ ID NO: 5 encodes the amino acid at position 574 (i,e, the amino acid "Trp" according to the three letter code or "W" according to the one letter code) of SEQ ID NO. 6.
[0051] If the A. thaliana wild type ALS nucleotide sequence shown in SEQ ID NO: 5 is used as reference sequence (as it is done in most of the relevant literature and, therefore, is used to enable an easier comparison to such known sequences), the codon encoding an amino acid different from tryptophan is at a position corresponding to position 1720-1722 of the nucleotide sequence of the A. thaliana ALS gene shown in SEQ ID NO: 5.
[0052] However, SEQ ID NO: 1 is preferred as the reference nucleotide sequence and SEQ ID NO: 2 is preferred as the reference amino acid sequence in all of the subsequent disclosures.
[0053] The following table provides an overview on the reference sequences used herein when the position of the point mutation in a nucleotide sequence or the substitution in an amino acid sequence is determined:
TABLE-US-00001 SEQ ID NO: Type of Sequence Species 1 nucleotide sequence B. vulgaris 2 amino acid sequence B. vulgaris 3 nucleotide sequence B. vulgaris (mutated) 4 amino acid sequence B. vulgaris (mutated) 5 nucleotide sequence A. thaliana 6 amino acid sequence A. thaliana
[0054] Thus, in any event, the equivalent position could still be determined through alignment with a reference sequence, such as SEQ ID NO: 1 or 5 (nucleotide sequence) or SEQ ID NO: 2 or 6 (amino acid sequence).
[0055] In view of the difference between the B. vulgaris wild-type ALS gene and the ALS gene comprised by a B. vulgaris plant of the present invention, the ALS gene (or polynucleotide or nucleotide sequence) comprised by a B. vulgaris plant of the present invention may also be regarded as a "mutant ALS gene", "mutant ALS allele", "mutant ALS polynucleotide" or the like. Thus, throughout the specification, the terms "mutant allele", "mutant ALS allele", "mutant ALS gene" or "mutant ALS polynucleotide" are used interchangeably.
[0056] Unless indicated otherwise herein, these terms refer to a nucleotide sequence that comprises a codon encoding an amino acid different from tryptophan at a position corresponding to position 1705-1707 of the nucleotide sequence of the B. vulgaris ALS gene shown in SEQ ID NO: 1. When set in relation to the A. thaliana reference sequence shown in SEQ ID NO: 5, the position of the codon is 1720-1722.
[0057] Likewise, these terms refer to a nucleotide sequence that encodes an ALS protein having at a position corresponding to position 569 of the amino acid sequence of the Beta vulgaris ALS protein shown in SEQ ID NO: 2 an amino acid different from tryptophan. When set in relation to the A. thaliana reference sequence shown in SEQ ID NO: 6, the position is 574.
[0058] An "amino acid different from tryptophan" (indicated by "Trp" in the three letter code or "W" in the equivalently used one letter code) includes any naturally-occurring amino acid different from tryptophan. These naturally-occurring amino acids include alanine (A), arginine (R), asparagine (N), aspartate (D), cysteine (C), glutamine (Q), glutamate (E), glycine (G), histidine (H), isoleucine (I), leucine (L), lysine (K), methionine (M), phenylalanine (F), proline (P), serine (S), threonine (T), tyrosine (Y) or valine (V).
[0059] However, preferably, the amino acid different from tryptophan (belonging to the group of neutral-polar amino acids) is an amino acid with physico-chemical properties different from tryptophan, i.e. belonging to any of the amino acids showing neutral-nonpolar, acidic, or basic properties. More preferably, the amino acid different from tryptophan is selected from the group consisting of alanine, glycine, isoleucine, leucine, methionine, phenylalanine, proline, valine, and arginine. Even more preferably, said amino acid is a neutral-nonpolar amino acid such as alanine, glycine, isoleucine, leucine, methionine, phenylalanine, proline or valine. Particularly preferred said amino acid is alanine, glycine, isoleucine, leucine, valine. Even more preferred is glycine and leucine. Most preferably, it is leucine.
[0060] In contrast, unless indicated otherwise, the terms "wild-type allele," "wild-type ALS allele", "wild-type ALS gene" or "wild-type ALS polynucleotide" refer to a nucleotide sequence that encodes an ALS protein that lacks the W569 substitution in relation to SEQ ID NO: 2 (or W574 substitution in relation to SEQ ID NO: 6). These terms also refer to a nucleotide sequence comprising at a position corresponding to position 1705-1707 of the nucleotide sequence of the B. vulgaris ALS gene shown in SEQ ID NO: 1, a codon encoding an amino acid different from tryptophan.
[0061] Such a "wild-type allele", "wild-type ALS allele", "wild-type ALS gene" or "wild-type ALS polynucleotide" may, or may not, comprise mutations, other than the mutation that causes the W569 substitution.
[0062] In essence, as regards the ALS gene, the only difference between a wild-type B. vulgaris plant and the B. vulgaris plant of the present invention is preferably (and specifically) that at a position as specified herein (in particular at a position corresponding to position 1705-1707 of the nucleotide sequence of the B. vulgaris ALS gene shown in SEQ ID NO: 1), the B. vulgaris plant of the present invention comprises a codon encoding an amino acid different from tryptophan, preferably the codon encodes an amino acid as specified herein elsewhere. However, as mentioned above, further differences such as additional mutations may be present between wild-type and the mutant ALS allele as specified herein. Yet, these further differences are not relevant as long as the difference explained before is present.
[0063] Consequently, the W569 substitution (or W574 substitution when the A. thaliana ALS amino acid sequence of SEQ ID NO: 6 is used as reference) is a result of an alteration of the codon at a position corresponding to position 1705-1707 of the nucleotide sequence shown in SEQ ID NO: 1 (or at a position corresponding to position 1720-1722 of the nucleotide sequence shown in SEQ ID NO: 5, respectively).
[0064] Preferably, the substitution at position 569 is a W-+L substitution, wherein "L" is encoded by any of the codons "CTT", "CTC", "CTA", "CTG", "TTA" or "TTG".
[0065] Most preferably, the substitution at position 569 is a W.fwdarw.L substitution, because of a transversion of the "G" nucleotide at a position corresponding to position 1706 of the nucleotide sequence shown in SEQ ID NO: 1 (or at a position corresponding to position 1721 of the nucleotide sequence shown in SEQ ID NO: 5, respectively), to a "T" nucleotide. Accordingly, the codon at a position corresponding to position 1705-1707 of the nucleotide sequence shown in SEQ ID NO: 1 (or at a position corresponding to position 1720-1722 of the nucleotide sequence shown in SEQ ID NO: 5, respectively) is changed from "TGG" to "TTG". While the codon "TGG" encodes tryptophan, the codon "TTG" encodes leucine.
[0066] Hence, in the most preferred embodiment, the present invention provides a Beta vulgaris plant comprising in the nucleotide sequence of the endogenous ALS gene, the codon TTG (encoding leucine) at a position corresponding to position 1705-1707 of the nucleotide sequence of the B. vulgaris ALS mutant gene shown in SEQ ID NO: 1, said nucleotide sequence comprising (or less preferably consisting of) SEQ ID NO: 3.
[0067] The B. vulgaris plants encoding an ALS polypeptide having at a position corresponding to position 569 of the amino acid sequence of the Beta vulgaris ALS protein shown in SEQ ID NO: 2 an amino acid different from tryptophan, preferably comprise in the nucleotide sequence of the endogenous ALS gene a codon encoding an amino acid different from tryptophan at a position corresponding to position 1705-1707 of the nucleotide sequence of the B. vulgaris ALS gene shown in SEQ ID NO: 1.
[0068] The term B. vulgaris "ALS" or "AHAS" gene also includes B. vulgaris nucleotide sequences which are at least 90, 95, 97, 98, or 99% identical to the B. vulgaris ALS nucleotide sequence of SEQ ID NO: 1 or 3, wherein these 60, 70, 80, 90, 95, 97, 98, or 99% identical nucleotide sequences comprise at a position corresponding to position 1705-1707 of the nucleotide sequence of SEQ ID NO: 1 a codon encoding an amino acid different from tryptophan.
[0069] Likewise, these at least 90, 95, 97, 98, or 99% identical nucleotide sequences encode an ALS polypeptide comprising at a position corresponding to position 569 of SEQ ID NO: 2 an amino acid different from tryptophan. Said identical nucleotide sequences encode an ALS protein which retains the activity as described herein, more preferably the thus-encoded ALS polypeptide is tolerant to one or more ALS inhibitor herbicides as described herein. Said term also includes allelic variants and homologs encoding an ALS polypeptide which is preferably tolerant to one or more ALS inhibitor herbicides as described herein.
[0070] In order to determine whether a nucleic acid sequence has a certain degree of identity to the nucleotide sequences of the present invention, the skilled person can use means and methods well-known in the art, e.g., alignments, either manually or by using computer programs such as those mentioned further down below in connection with the definition of the term "hybridization" and degrees of homology.
[0071] For example, BLAST, which stands for Basic Local Alignment Search Tool (Altschul, Nucl. Acids Res. 25 (1997), 3389-3402; Altschul, J. Mol. Evol. 36 (1993), 290-300; Altschul, J. Mol. Biol. 215 (1990), 403-410), can be used to search for local sequence alignments. BLAST produces alignments of both nucleotide and amino acid sequences to determine sequence similarity. Because of the local nature of the alignments, BLAST is especially useful in determining exact matches or in identifying similar sequences. The fundamental unit of BLAST algorithm output is the High-scoring Segment Pair (HSP). An HSP consists of two sequence fragments of arbitrary but equal lengths whose alignment is locally maximal and for which the alignment score meets or exceeds a threshold or cutoff score set by the user. The BLAST approach is to look for HSPs between a query sequence and a database sequence, to evaluate the statistical significance of any matches found, and to report only those matches which satisfy the user-selected threshold of significance. The parameter E establishes the statistically significant threshold for reporting database sequence matches. E is interpreted as the upper bound of the expected frequency of chance occurrence of an HSP (or set of HSPs) within the context of the entire database search. Any database sequence whose match satisfies E is reported in the program output.
[0072] Analogous computer techniques using BLAST (Altschul (1997), loc. cit.; Altschul (1993), loc. cit.; Altschul (1990), loc. cit.) are used to search for identical or related molecules in nucleotide databases such as GenBank or EMBL. This analysis is much faster than multiple membrane-based hybridizations. In addition, the sensitivity of the computer search can be modified to determine whether any particular match is categorized as exact or similar. The basis of the search is the product score which is defined as:
% sequence identity .times. % maximum BLAST score 100 ##EQU00001##
and it takes into account both the degree of similarity between two sequences and the length of the sequence match. For example, with a product score of 40, the match will be exact within a 1-2% error; and at 70, the match will be exact. Similar molecules are usually identified by selecting those which show product scores between 15 and 40, although lower scores may identify related molecules.
[0073] The term B. vulgaris "ALS" or "AHAS" polypeptide also includes amino acid sequences which are at least 90, 95, 97, 98, or 99% identical to the ALS amino acid sequence of SEQ ID NO: 2 or 4, wherein these at least 90, 95, 97, 98, or 99% identical amino acid sequences comprising at a position corresponding to position 569 of SEQ ID NO: 2 an amino acid different from tryptophan. Said identical amino acid sequences retain the activity of ALS as described herein, more preferably the ALS polypeptide is tolerant to ALS inhibitor herbicides as described herein. ALS activity, if required, can be measured in accordance with the assay described in Singh (1991), Proc. Natl. Acad. Sci. 88:4572-4576.
[0074] However, the ALS nucleotide sequences referred to herein encoding an ALS polypeptide preferably confer tolerance to one or more ALS inhibitor herbicides (or, vice versa, less sensitivity to an ALS inhibitor herbicide) as described herein. This is because of the point mutation leading to an amino acid substitution as described herein.
[0075] Accordingly, tolerance to an ALS inhibitor herbicide (or, vice versa, less sensitivity to an ALS inhibitor herbicide) can be measured by comparison of ALS activity obtained from cell extracts from plants containing the mutated ALS sequence and from plants lacking the mutated ALS sequence in the presence of an ALS-inhibitor herbicide, like it is described in Singh et al (1988) [J. Chromatogr., 444, 251-261].
[0076] However, a more preferred activity assay for the ALS polypeptide encoded by a nucleotide sequence comprising a codon encoding an amino acid different from tryptophan at a position corresponding to position 1705-1707 of the nucleotide sequence of the B. vulgaris ALS gene shown in SEQ ID NO: 1 can be done as follows:
[0077] The coding sequence of a Beta vulgaris wild-type and a mutant B. vulgaris plant is cloned into, for example, Novagen pET-32a(+) vectors and the vectors are transformed into, for example, Escherichia coli AD494 according to the instructions of the manufacturer. Bacteria are preferably grown at 37.degree. C. in medium under selection pressure such as in LB-medium containing 100 mg/l carbenicillin and 25 mg/l kanamycin, are induced with, for example, 1 mM isopropyl-s-D-thiogalactopyranoside at an OD.sub.600 of preferably about 0.6, cultivated for about 16 hours at preferably 18.degree. C. and harvested by centrifugation. Bacterial pellets are resuspended in 100 mM sodium phosphate buffer pH 7.0 containing 0.1 mM thiamine-pyrophosphate, 1 mM MgCl.sub.2, and 1 .mu.M FAD at a concentration of 1 gram wet weight per 25 ml of buffer and disrupted by sonification. The crude protein extract obtained after centrifugation is used for ALS activity measurements.
[0078] ALS assays are then carried out in, for example, 96-well microtiter plates using a modification of the procedure described by Ray (1984), Plant Physiol., 75, 827-831. The reaction mixture contains preferably 20 mM potassium phosphate buffer pH 7.0, 20 mM sodium pyruvate, 0.45 mM thiamine-pyrophosphate, 0.45 mM MgCl.sub.2, 9 .mu.M FAD, ALS enzyme and various concentrations of ALS inhibitors in a final volume of about 90 .mu.l.
[0079] Assays are initiated by adding enzyme and terminated after preferably 75 min incubation at 30.degree. C. by the addition of 40 .mu.l 0.5 M H.sub.2SO.sub.4. After about 60 min at room temperature about 80 .mu.l of a solution of 1.4% .alpha.-naphthol and 0.14% creatine in 0.7 M NaOH is added and after an additional about 45 min incubation at room temperature the absorbance is determined at 540 nm. pI50-values for inhibition of ALS were determined as described by Ray (1984)), Plant Physiol., 75, 827-831, using the XLFit Excel add-in version 4.3.1 curve fitting program of ID Business Solutions Limited, Guildford, UK.
[0080] When plants are used, ALS activity is preferably determined in cell extracts or leaf extracts of wild type and B. vulgaris cell extracts or leaf extracts of the obtained mutant in the presence of various concentrations of ALS-inhibitor herbicides, preferably sulfonylurea herbicides or sulfonylamino-carbonyltriazolinone herbicides, more preferably in the presence of various concentrations of the ALS inhibitor herbicide "foramsulfuron". ALS is thus preferably extracted from sugar beet leaves or sugar beet tissue cultures as described by Ray (1984) in Plant Physiol 75:827-831.
[0081] It is preferred that the B. vulgaris plants of the present invention are less sensitive to an ALS inhibitor, more preferably it is at least 100 times less sensitive, more preferably, 500 times, even more preferably 1000 times and most preferably less than 2000 times. Less sensitive when used herein may, vice versa, be seen as "more tolerable" or "more resistant". Similarly, "more tolerable" or "more resistant" may, vice versa, be seen as "less sensitive".
[0082] For example, the B. vulgaris plants of the present invention and in particular the B. vulgaris plant described in the appended Examples are/is at least 2000 times less sensitive to the ALS inhibitor herbicide foramsulfuron (a member of the ALS inhibitor subclass "sulfonylurea herbicides") compared to the wild type enzyme.
[0083] Preferably, the B. vulgaris plants of the present invention are less sensitive to various members of ALS inhibitor herbicides, like sulfonylurea herbicides, sulfonylamino-carbonyltriazolinone herbicides, and imidazolinone herbicides. Sulfonylurea herbicides and sulfonylaminocarbonyltriazolinone herbicides against which said plants are less sensitive are preferably selected. In a particular preferred embodiment, the B. vulgaris plants of the present invention are less sensitive to the ALS inhibitor herbicide formasulfuron (sulfonylurea herbicide) either alone or in combination with one or more further ALS inhibitor herbicides either from the subclass of the sulfonyurea-herbicides or any other sub-class of the ALS inhibitor herbicides.
[0084] Hence, the B. vulgaris plants of the present invention which are preferably less sensitive to an ALS inhibitor herbicide can likewise also be characterized to be "more tolerant" to an ALS inhibitor" (i.e. an ALS inhibitor tolerant plant).
[0085] Thus, an "ALS inhibitor tolerant" plant refers to a plant, in particular a B. vulgaris plant that is more tolerant to at least one ALS inhibitor herbicide at a level that would normally inhibit the growth of a normal or wild-type plant, preferably the ALS inhibitor herbicide controls a normal or wild-type plant. Said normal or wild-type plant does not comprise in the nucleotide sequence of any allele of the endogenous ALS gene, a codon encoding an amino acid different from tryptophan at a position corresponding to position 1705-1707 of the nucleotide sequence of the B. vulgaris ALS gene shown in SEQ ID NO: 1.
[0086] Said nucleotide sequence may generally also be characterized to be an "ALS inhibitor herbicide tolerant" nucleotide sequence. By "ALS inhibitor herbicide tolerant nucleotide sequence" is intended a nucleic acid molecule comprising a nucleotide sequence comprising at least the mutation that results in a codon encoding an amino acid different from tryptophan relative to an ALS protein which does not have at a position corresponding to position 569 of the amino acid sequence of the B. vulgaris ALS protein shown in SEQ ID NO: 2 an amino acid different from tryptophan, wherein said at least one mutation results in the expression of a less sensitive to an ALS inhibitor herbicide ALS protein.
[0087] By "herbicide-tolerant ALS protein", it is intended that such an ALS protein displays higher ALS activity, relative to the ALS activity of a wild-type ALS protein, in the presence of at least one ALS inhibitor herbicide that is known to interfere with ALS activity and at a concentration or level of said herbicide that is known to inhibit the ALS activity of the wild-type ALS protein.
[0088] Similarly, the terms "ALS-inhibitor herbicide(s)" or simply "ALS-inhibitor(s)" are used interchangeably. As used herein, an "ALS-inhibitor herbicide" or an "ALS inhibitor" is not meant to be limited to single herbicide that interferes with the activity of the ALS enzyme. Thus, unless otherwise stated or evident from the context, an "ALS-inhibitor herbicide" or an "ALS inhibitor" can be a one herbicide or a mixture of two, three, four, or more herbicides known in the art, preferably as specified herein, each of which interferes with the activity of the ALS enzyme.
[0089] Surprisingly, it was found that even the single point mutation according to the present invention confers agronomically useful and stable levels of ALS inhibitor herbicide tolerance in B. vulgaris plants as well as in their offsprings, particularly, if homozygocity is established. Compared to herbicide tolerant Beta vulgaris plants of the same genetic background in which such mutation is only heterozygously present, the herbicide tolerant Beta vulgaris plants which are homozygous for the mutation revealed a better agronomical level of ALS inhibitor herbicide tolerance.
[0090] Therefore, present invention relates to an ALS inhibitor herbicide tolerant Beta vulgaris plant having a mutation of the endogenous acetolactate synthase (ALS) gene, wherein the ALS gene encodes an ALS polypeptide containing an amino acid different from tryptophan at a position 569 of the ALS polypeptide. The respective mutation can be heterozygously present, and can preferably be the sole mutation of the ALS gene. More preferably, the respective mutation can be homozygously present, and most preferably, the respective mutation is homozygously present as the sole mutation of the endogenous ALS gene.
[0091] It could also not be expected that only one single mutation of an ALS gene in Beta vulgaris would be sufficient, since, for example, WO 2010/037061 teaches that double or triple mutants in the ALS gene are necessary to confer the agromically useful ALS-inhibitor herbicide tolerance.
[0092] Therefore, B. vulgaris plants and parts thereof which are heterozygous for the mutation are less preferred, but are still covered by the present invention and may be sufficient for certain application schemes and/or certain environment conditions. Also covered by the present invention are plants containing at least in one allele of the endogenous ALS gene, a codon encoding an amino acid different from tryptophan, preferably leucine at a position corresponding to position 1705-1707 of the nucleotide sequence of the B. vulgaris ALS gene shown in SEQ ID NO: 1, and containing one (in case of diploidy) or more further alleles (in case of polyploidy) having one or more further mutations in the endogenous ALS gene.
[0093] Accordingly, when used herein the term "heterozygous" or "heterozygously" means that a plant of the present invention has different alleles at a particular locus, in particular at the ALS gene locus.
[0094] "Homozygous" or "homozygously" indicates that a plant of the present invention has two copies of the same allele on different DNA strands, in particular at the ALS gene locus.
[0095] As used herein unless clearly indicated otherwise, the term "plant" intended to mean a plant at any developmental stage.
[0096] It is preferred that the Beta vulgaris plant of the present invention is orthoploid or anorthoploid. An orthoploid plant may preferably be haploid, diploid, tetraploid, hexaploid, octaploid, decaploid or dodecaploid, while an anorthoploid plant may preferably be triploid or pentaploid.
[0097] Parts of plants may be attached to or separate from a whole intact plant. Such parts of a plant include, but are not limited to, organs, tissues, and cells of a plant, and preferably seeds.
[0098] Accordingly, the B. vulgaris plant of the present invention is non-transgenic as regards an endogenous ALS gene. Of course, foreign genes can be transferred to the plant either by genetic engineering or by conventional methods such as crossing. Said genes can be genes conferring herbicide tolerances, preferably conferring herbicide tolerances different from ALS inhibitor herbicide tolerances, genes improving yield, genes improving resistances to biological organisms, and/or genes concerning content modifications.
[0099] In a further aspect, the present invention relates to a method for the manufacture of the Beta vulgaris plant and the parts thereof, comprising the following steps:
[0100] (a) exposing calli, preferably from sugar beet, to about 10.sup.7 M-10.sup.-9 M of an ALS inhibitor herbicide, preferably foramsulfuron;
[0101] (b) selecting cell colonies which can grow in the presence of up to 3.times.10.sup.-6 M of an ALS inhibitor herbicide, preferably foramsulfuron [CAS RN 173159-57-4];
[0102] (c) regenerating shoots in presence of an ALS inhibitor herbicide, preferably foramsulfuron;
[0103] (d) selecting regenerated plantlets with an ALS inhibitor herbicide, preferably foramsulfuron, iodosulfuron-methyl-sodium [CAS RN 144550-36-7] and/or a mixture of both, wherein the dose of foramsulfuron is preferably equivalent to 7-70 g a.i./ha and the dose of iodosulfuron-methyl-sodium is preferably equivalent to 1-10 g a.i./ha.
[0104] In a further aspect, the regenerated plantlets obtained according to the processes (a) to (d) above, can be employed for further manufacture of Beta vulgaris plants by applying the following steps (e) to (m):
[0105] (e) vegetative micropropagation of individual plantlets of step (d) to rescue different positive variants by establishing a cell line (clone) of each ALS inhibitor herbicide tolerant plantlet;
[0106] (f) longterm storage of each established clone in the vegetative state;
[0107] (g) transfer of cloned plants of each clone from the long term storage into the greenhouse;
[0108] (h) vernalisation and adaptation in vernalisation chambers to induce flowering;
[0109] (i) transfer of vernalised plants to growth rooms (controlled temperature and light);
[0110] (j) select best pollen shedding plants of best flowering clones for crossing with emasculated plants of an elite but ALS inhibitor herbicide sensitive line to overcome the negative impact of somaclonal variation on the generative fertility (male and female) of plantlets of step (d);
[0111] (k) backcross to elite line until fertility is restored and finally self heterozygous plants to reach the homozygous state;
[0112] (l) produce testcrosses with an ALS inhibitor herbicide-sensitive partner and selfed seed of each backcrossed line for field evaluations;
[0113] (m) applying agronomically relevant dose rates of different ALS inhibitor herbicides to select the best performing line, preferably in its homozygous state.
[0114] The lines obtained according to above steps (a) to (m) form the basis for the development of commercial varieties following procedures known in the breeding community supported by molecular breeding techniques (like marker assisted breeding or marker assisted selection) for speeding up the processes and to secure the correct selection of plants to either obtain the mutation in its homozygous form or in case of containing one or more mutations at various locations of the ALS encoding endogenous gene to perform the correct selection of heterozygous plants that do contain at least at one of the alleles the W569 mutation according to present invention. (For review, see Bertrand C. Y. et al. (2008), Phil. Trans. R. Soc, B., 363, 557-572) Calli are obtained by means and methods commonly known in the art, for example, as described in the appended Examples.
[0115] Seeds obtained under step (m), above, have been deposited with the NCIMB, Aberdeen, UK, under Number NCIMB 41705.
[0116] In a further aspect, the present invention relates to a method for producing an herbicide tolerant Beta vulgaris plant and parts thereof comprising (i) a mutation of an endogenous acetolactate synthase (ALS) gene, wherein the ALS gene encodes an ALS polypeptide containing an amino acid different from tryptophan at a position 569 of the ALS polypeptide, and (ii) an additional mutation in the endogenous ALS gene, comprising the following steps:
[0117] (a) producing an ALS inhibitor herbicide tolerant Beta vulgaris plant comprising a mutation of an endogenous acetolactate synthase (ALS) gene, wherein the ALS gene encodes an ALS polypeptide containing an amino acid different from tryptophan at a position 569 of the ALS polypeptide (parent A);
[0118] (b) crossing parent A with a Beta vulgaris plant (parent B) containing one or more further mutations in the endogenous ALS gene at positions differing from amino acid position 569;
[0119] (c) obtaining a Beta vulgaris progeny that is heterozygous for the ALS gene mutation of amino acid position 569 and to one or more of any further ALS gene mutations encoded by parent B;
[0120] (d) wherein the breeding process is controlled by
[0121] (i) the application of marker assisted breeding and/or microsequencing techniques, and/or
[0122] (ii) the application of agronomically relevant doses of one or more ALS inhibitor herbicides to which the generated progeny according to step (c) are tolerant.
[0123] Accordingly, it is envisaged that the present invention also relates to B. vulgaris plants obtainable by the aforementioned methods of manufacture.
[0124] In a non-limiting example, sugar beet plants of the present invention were obtained by performing the following non-limiting protocol. Without being bound by theory, the same protocol may be used for obtaining B. vulgaris plants other than sugar beet.
[0125] Sugar beet cell cultures were initiated from seedlings of a diploid sugar beet genotype 7T9044 (as, for example, described by Alexander Dovzhenko, PhD Thesis, Title: "Towards plastid transformation in rapeseed (Brassica napus L.) and sugarbeet (Beta vulgaris L.)", Ludwig-Maximilians-Universitat Munchen, Germany, 2001). Sugar beet seeds were immersed for 60 seconds in 70% ethanol, then rinsed twice in sterile water with 0.01% detergent and then incubated for 1-4 hours in 1% NaOCl bleach. Thereafter the seeds were washed 3 times with sterile H.sub.2O and the seeds were stored in sterile water overnight at 4.degree. C. The embryos were then isolated using forceps and scalpel.
[0126] The freshly prepared embryos were immersed in 0.5% NaOCl for 30 min and then washed 3 times in sterile water. After the last washing step they were placed on hormone free MS agar medium (Murashige and Skoog (1962), Physiol. Plantarum, 15, 473-497). Those embryos which developed into sterile seedlings were used for the initiation of regenerable sugar beet cell cultures.
[0127] Cotyledons as well as hypocotyls were cut into 2-5 mm long segments and then cultivated on agar (0.8%) solidified MS medium containing either 1 mg/l Benzylaminopurine (BAP) or 0.25 mg/l Thidiazuron (TDZ). 4 weeks later the developing shoot cultures were transferred onto fresh agar medium of the same composition and then sub-cultured in monthly intervals. The cultures were kept at 25.degree. C. under dim light at a 12 h/12 h light/dark cycle.
[0128] After 7-10 subcultures the shoot cultures which were grown on the thidiazuron containing medium formed a distinct callus type, which was fast growing, soft and friable. The colour of this callus type was yellowish to light green. Some of these friable calli consistently produced chlorophyll containing shoot primordia from embryo-like structures. These fast growing regenerable calli were used for the selection of ALS-inhibitor herbicide tolerant sugar beet mutants.
[0129] When this callus type was exposed to 10.sup.-9 M of the sulfonylurea foramsulfuron (CAS RN 173159-57-4), the cells survived, but produced less than 50% of the biomass of their siblings on medium devoid of the inhibitor. On medium containing 3.times.10.sup.-8 M foramsulfuron no growth was detectable. For large scale mutant selection experiments 10.sup.-7 M foramsulfuron was chosen. Surviving and growing cell colonies were numbered and transferred after 4-6 weeks onto fresh medium containing 3.times.10.sup.-7 M of the inhibitor. One of these cell colonies was able to grow not only at this concentration of the inhibitor but even in presence of 3.times.10.sup.-6 M of foramsulfuron. From this clone (SB574TL), shoots were regenerated in presence of the ALS-inhibitor herbicide and then the shoots were transferred to MS medium containing 0.05 mg/l Naphthalene acetic acid (NAA).
[0130] Within 4-12 weeks the shoots formed roots and then they were transferred into sterile plant containers filled with wet, sterilized perlite, watered with half strength MS inorganic ingredients. Alternatively the plantlets were transferred directly from the agar solidified medium in a perlite containing soil mixture in the greenhouse. During the first 10-15 days after transfer into soil containing substrate the plants were kept in an environment with high air humidity. During and after they were weaned to normal greenhouse air humidity regimes the plants were kept in the greenhouse under artificial light (12 h) at 20+-3.degree. C./15+-2.degree. C. day/night temperatures.
[0131] 3-5 weeks later, the regenerated plants from the above obtained foramsulfuron tolerant cell culture (SB574TL) as well as from the wild type cell cultures were treated with foramsulfuron, iodosulfuron-methyl-sodium (CAS RN 144550-3-7) and a mixture of both active ingredients. The herbicide doses tested were equivalent to 7-70 g a.i./ha for foramsulfuron and 1-10 g a.i./ha for iodosulfuron-methyl-sodium. Regenerated plants from this tolerant cell line tolerated even the highest herbicide doses (foramsulfuron, iodosulfuron-methyl-sodium and their mixtures in the ratio 7:1 whereas even the lowest doses killed the wild type plants.
[0132] Offsprings were tested as follows (in a non-limiting way):
[0133] Based on SB574TL, F2 and F3 seeds of experimental hybrids conferring the resistance allele in the heterozygous state as well as F4-F6 seeds conferring the mutant allele in the homozygous state were sown in the field and treated with foramsulfuron, iodosulfuron-methyl-sodium as well as with mixtures of both ALS inhibitor herbicides when the plants developed 3-5 rosette leaves. The homozygous seedlings tolerated mixtures of 35 g foramsulfuron/ha+7 g iodosulfuron-methyl-sodium/ha without growth retardation or any signs of visible damage. In several cases, heterozygous lines showed signs of retarded growth and some leaf chlorosis at these rates, but they recovered within 3-5 weeks, whereas the conventional sugar beet seedlings were killed by the ALS inhibitor herbicides.
[0134] The ALS mutants were characterized as follows:
[0135] Extraction and nucleic acid sequence analysis of the obtained mutant was performed by LGC Genomics GmbH, Berlin, Germany according to amended standard protocols.
[0136] The nucleic acid sequence obtained from the sugar beet mutant SB574TL is shown in SEQ ID NO: 3. SEQ ID NO: 4 represents the corresponding amino acid sequence, whereas SEQ ID NO: 1 was obtained after sequencing the wild type sugar beet plant that was taken as the starting material. SEQ ID NO: 2 represents the corresponding amino acid sequence of the wild type sugar beet.
[0137] Comparison of all these sequences shows up that there is only the mutation at position 574 but no other change took place at any other part of this endogenous ALS gene.
TABLE-US-00002 (1) SEQ ID No 1 ATGGCGGCTACCTTCACAAACCCAACATTTTCCCCTTCCTCAACTCCATTAACCAAAACC (1) SEQ ID No 3 ATGGCGGCTACCTTCACAAACCCAACATTTTCCCCTTCCTCAACTCCATTAACCAAAACC (61) SEQ ID No 1 CTAAAATCCCAATCTTCCATCTCTTCAACCCTCCCCTTTTCCACCCCTCCCAAAACCCCA (61) SEQ ID No 3 CTAAAATCCCAATCTTCCATCTCTTCAACCCTCCCCTTTTCCACCCCTCCCAAAACCCCA (121) SEQ ID No 1 ACTCCACTCTTTCACCGTCCCCTCCAAATCTCATCCTCCCAATCCCACAAATCATCCGCC (121) SEQ ID No 3 ACTCCACTCTTTCACCGTCCCCTCCAAATCTCATCCTCCCAATCCCACAAATCATCCGCC (181) SEQ ID No 1 ATTAAAACACAAACTCAAGCACCTTCTTCTCCAGCTATTGAAGATTCATCTTTCGTTTCT (181) SEQ ID No 3 ATTAAAACACAAACTCAAGCACCTTCTTCTCCAGCTATTGAAGATTCATCTTTCGTTTCT (241) SEQ ID No 1 CGATTTGGCCCTGATGAACCCAGAAAAGGGTCCGATGTCCTCGTTGAAGCTCTTGAGCGT (241) SEQ ID No 3 CGATTTGGCCCTGATGAACCCAGAAAAGGGTCCGATGTCCTCGTTGAAGCTGTTGAGCGT (301) SEQ ID No 1 GAAGGTGTTACCAATGTGTTTGCTTACCCTGGTGGTGCATCTATGGAAATCCACCAAGCT (301) SEQ ID No 3 GAAGGTGTTACCAATGTGTTTGCTTACCCTGGTGGTGCATCTATGGAAATCCACCAAGCT (361) SEQ ID No 1 CTCACACGCTCTAAAACCATCCGCAATGTCCTCCCTCGCCATGAACAAGGCGGGGTTTTC (361) SEQ ID No 3 CTCACACGCTCTAAAACCATCCGCAATGTCCTCCCTCGCCATGAACAAGGCGGGGTTTTC (421) SEQ ID No 1 GCCGCCGAGGGATATGCTAGAGCTACTGGAAAGGTTGGTGTCTGCATTGCGACTTCTGGT (421) SEQ ID No 3 GCCGCCGAGGGATATGCTAGAGCTACTGGAAAGGTTGGTGTCTGCATTGCGACTTCTGGT (481) SEQ ID No 1 CCTGGTGCTACCAACCTCGTATCAGGTCTTGCTGACGCTCTCCTTGATTCTGTCCCTCTT (481) SEQ ID No 3 CCTGGTGCTACCAACCTCGTATCAGGTCTTGCTGACGCTCTCCTTGATTCTGTCCCTCTT (541) SEQ ID No 1 GTTGCCATCACTGGCCAAGTTCCACGCCGTATGATTGGCACTGATGCTTTTCAGGAGACT (541) SEQ ID No 3 GTTGCCATCACTGGCCAAGTTCCACGCCGTATGATTGGCACTGATGCTTTTCAGGAGACT (601) SEQ ID No 1 CCAATTGTTGAGGTGACTTAGGTCTATTACTAAGCATAATTATTTAGTTTTGGATGTAGAG (601) SEQ ID No 3 CCAATTGTTGAGGTGACAAGGTCTATTAGTAAGCATAATTATTTAGTTTTGGATGTAGAG (661) SEQ ID No 1 GATATTCCTAGAATTGTTAAGGAAGCCTTTTTTTTAGCTAATTCTGGTAGGCCTGGACCT (661) SEQ ID No 3 GATATTCCTAGAATTGTTAAGGAAGCCTTTTTTTTAGCTAATTCTGGTAGGCCTGGACCT (721) SEQ ID No 1 GTTTTGATTGATCTTCCTAAAGATATTCAGCAGCAATTGGTTGTTCCTGATTGGGATAGG (721) SEQ ID No 3 GTTTTGATTGATCTTCCTAAAGATATTCAGCAGCAATTGGTTGTTCCTGATTGGGATAGG (781) SEQ ID No 1 CCTTTTAAGTTGGGTGGGTATATGTCTAGGCTGCCAAAGTCCAAGTTTTCGAGAATGAG (781) SEQ ID No 3 CCTTTTAAGTTGGGTGGGTATATGTCTAGGCTGCCAAAGTCCAAGTTTTCGACGAATGAG (841) SEQ ID No 1 GTTGGACTTCTTGAGCAGATTGTGAGTTGATGAGTGAGTCGAAGLAAGCCTGTCTTGTAT (841) SEQ ID No 3 GTTGGACTTCTTGAGCAGATTGTGAGTTGATGAGTGAGTCGAAGLAAGCCTGTCTTGTAT (901) SEQ ID No 1 GTGGGAGGTGGGTGTTTGAATTCTAGTGAGGAGTTGAGGAGATTTGTTGAGTTGACAGGG (901) SEQ ID No 3 GTGGGAGGTGGGTGTTTGAATTCTAGTGAGGAGTTGAGGAGATTTGTTGAGTTGACAGGG (961) SEQ ID No 1 ATTCCGGTGGCTAGTACTTTGATGGGGTTGGGGTCTTACCCTTGTAATGATGAACTGTCT (961) SEQ ID No 3 ATTCCGGTGGCTAGTACTTTGATGGGGTTGGGGTCTTACCCTTGTAATGATGAACTGTCT (1021) SEQ ID No 1 CTTCATATGTTGGGGATGCACGGGACTGTTTATGCCAATTATGCGGTGGATAAGGCGGAT (1021) SEQ ID No 3 CTTCATATGTTGGGGATGCACGGGACTGTTTATGCCAATTATGCGGTGGATAAGGCGGAT (1081) SEQ ID No 1 TTGTTGCTTGCTTTCGGGGTTAGGTTTGATGATCGTGTGACCGGGAAGCTCGAGGCGTTT (1081) SEQ ID No 3 TTGTTGCTTGCTTTCGGGGTTAGGTTTGATGATCGTGTGAGCGGGAAGCTCGAGGCGTTT (1141) SEQ ID No 1 GCTAGCCGTGCTAAGATTGTGCATATTGATATTGACTCTGCTGAGATTGGGAAGAACAAG (1141) SEQ ID No 3 GCTAGCCGTGCTAAGATTGTGCATATTGATATTGACTCTGCTGAGATTGGGAAGAACAAG (1201) SEQ ID No 1 CAGCCCCATGTGTCCATTTGTGCTGATGTTAAATTGGCATTGCGGGGTATGAATAAGATT (1201) SEQ ID No 3 CAGCCCCATGTGTCCATTTGTGCTGATGTTAAATTGGCATTGCGGGGTATGAATAAGATT (1261) SEQ ID No 1 CTGGAGTCTAGAATAGGGAAGCTGAATTTGGATTTCTCCAAGTGGAGAGAAGAATTAGGT (1261) SEQ ID No 3 CTGGAGTCTAGAATAGGGAAGCTGAATTTGGATTTCTCCAAGTGGAGAGAAaAATTAGGT (1321) SEQ ID No 1 GAGCAGAAGAAGGAATTCCCACTGAGTTTTAAGACATTTGGGGATGCAATTCCTCCACAA (1321) SEQ ID No 3 GAGCAGAAGAAGGAATTCCCACTGAGTTTTAAGACATTTGGGGATGCAATTCCTCCACAA (1381) SEQ ID No 1 TATGCCATTCAGGTGCTTGATGAGTTGACCAATGGTAATGCTATTATAAGTACTGGTGTT (1381) SEQ ID No 3 TATGCCATTCAGGTGCTTGATGAGTTGACCAATGGTAATGCTATTATAAGTACTGGTGTT (1441) SEQ ID No 1 GGGCAGCACCAAATCTGGGCTGCGCAGCATTAAAAGTACAGAAACCCTCGCCAATGGCTG (1441) SEQ ID No 3 GGGCAGCACCAAATGTGGGCTGCGCAGCATTAAAAGTACAGAAACCCTCGCCAATGGCTG (1501) SEQ ID No 1 ACCTCTGGTGGGTTGGGGGCTATGGGGTTTGGGCTACCAGCCGCCATTGGAGCTGCAGTT (1501) SEQ ID No 3 ACCTCTGGTGGGTTGGGGGCTATGGGGTTTGGGCTACCAGCCGCCATTGGAGCTGCAGTT (1561) SEQ ID No 1 GCTCGACCAGATGCAGTGGTTGTCGATATTGATGGGGATGGCACTTTTATTATGAATGTT (1561) SEQ ID No 3 GCTCGACCAGATGCAGTGGTTGTCGATATTGATGGGGATGGCAGTTTTATTATGAATGTT (1621) SEQ ID No 1 CAAGAGTTGGCTACAATTAGGGTGGAAAATCTCCCAGTTAAGATAATGCTGCTAAACAAT (1621) SEQ ID No 3 CAAGAGTTGGCTACAATTAGGGTGGAAAATCTCCCAGTTAAGATAATGCTGCTAAACAAT (1681) SEQ ID No 1 CAACATTTAGGTATGGTTGTCCAATGGGAAGATAGGTTCTATAAAGCTAACCGGGCACAT (1681) SEQ ID No 3 CAACATTTAGGTATGGTTGTCCAATTGGAAGATAGGTTCTATAAAGCTAACCGGGCACAT (1741) SEQ ID No 1 ACATACCTTGGAAACCCTTCCAAATCTGCTGATATCTTCCCTGATATGCTCAAATTCGCT (1741) SEQ ID No 3 ACATACCTTGGAAACCCTTCCAAATCTGCTGATATCTTCCCTGATATGCTCAAATTCGCT (1801) SEQ ID No 1 GAGGCATGTGATATTCCTTCTGCCCGTGTTAGCAACGTGGCTGATTTGAGGGCCGCCATT (1801) SEQ ID No 3 GAGGCATGTGATATTCCTTCTGCCCGTGTTAGCAACGTGGCTGATTTGAGGGCCGCCATT (1861) SEQ ID No 1
CAAACAATGTTGGATACTCCAGGGCCGTACCTGCTCGATGTGATTGTACCGCATCAAGAG (1861) SEQ ID No 3 CAAACAATGTTGGATACTCCAGGGCCGTACCTGCTCGATGTGATTGTACCGCATCAAGAG (1921) SEQ ID No 1 CATGTGTTGCCTATGATTCCAAGTGGTGCCGGTTTCAAGGATACCATTACAGAGGGTGAT (1921) SEQ ID No 3 CATGTGTTGCCTATGATTCCAAGTGGTGCCGGTTTCAAGGATACCATTACAGAGGGTGAT (1981) SEQ ID No 1 GGAAGAACCTCTTATTGA (1981) SEQ ID No 3 GGAAGAACCTCTTATTGA (1) SEQ ID No. 2 MAATFTNPTFSPSSTPLTHTLKSQSSISSTLPFSTPPKTPTPLFHRPLQISSSQSHKSSA (1) SEQ ID No. 4 MAATFTNPTFSPSSTPLTHTLKSQSSISSTLPFSTPPKTPTPLFHRPLQISSSQSHKSSA (61) SEQ ID No. 2 IKTQTQAPSSPAIEDSSFVSRFGPDEPRKGSDVLVEALEREGVTNVFAYPGGASMEIHQA (61) SEQ ID No. 4 IKTQTQAPSSPAIEDSSFVSRFGPDEFRKGSDVLVEALEREGVTNVFAYPGGASMEIHQA (121) SEQ ID No. 2 LTRSKTIRNVLPRHEQGGVFAAEGYARATGKVGVCIATSGPGATNLVSGLADALLDSVPL (121) SEQ ID No. 4 LTRSKTIRNVLPRHEQGGVFAAEGYARATGKVGVCIATSGPGATNLVSGLADALLDSVPL (181) SEQ ID No. 2 VAITGQVPRRMIGTDAFQETPIVEVTRSITKHNYLVLDVEDIPRIVKEAFFLANSGRPGP (181) SEQ ID No. 4 VAITGQVPRRMIGTDAFQETPIVEVTRSITKHNYLVLDVEDIPRIVKEAFFLANSGRPGP (241) SEQ ID No. 2 VLIDLPKDIQQQLVVPDWDRPFKLGGYMSRLPKSKFSTNEVGLLEQIVRLMSESKKPVLY (241) SEQ ID No. 4 VLIDLPKDIQQQLVVPDWDRPFKLGGYMSRLPKSKFSTNEVGLLEQIVRLMSESKKPVLY (301) SEQ ID No. 2 VGGGCLNSSEELRRFVELTGIPVASTLMGLGSYPCNDELSLHMLGMHGTVYANYAVDKAD (301) SEQ ID No. 4 VGGGCLNSSEELRRFVELTGIPVASTLMGLGSYPCNDELSLHMLGMHGTVYANYAVDKAD (361) SEQ ID No. 2 LLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKQPKVSICADVKLALRGMNKI (361) SEQ ID No. 4 LLLAFGVRFDDRVTGKLEAFASPAKIVHIDIDSAEIGKNKQPHVSICADVKLALRGMNKI (421) SEQ ID No. 2 LESRIGKLNLDFSKWREELGEQKKEFPLSFKTFGDAIPPQYAIQVLDELTNGNAIISTGV (421) SEQ ID No. 4 LESRIGKLNLDFSKWRESLGEQKKEFPLSFKTFGDAIPPQYAIQVLDELTNGNAIISTGV (481) SEQ ID No. 2 GQHQMWAAQHYKYRNPRQWLTSGGLGAMGFGLPAAIGAAVARPDAVVVDIDGDGSFIMNV (481) SEQ ID No. 4 GQHQMWAAQKYKYRNPRQWLT3GGLGAMGFGLPAAIGAAVARPDAVVVDIDGDGSFIMNV (541) SEQ ID No. 2 QELATIRVENLFVKIMLLNNQHLGMVVQWEDRFYKANRAHTYLGNPSKSADIFFDMLKFA (541) SEQ ID No. 4 QELATIRVENLFVKIMLLNNQHLGMVVQLEDRFYKANRAHTYLGNPSKSADIFFDMLKFA (601) SEQ ID No. 2 EACDIPSARVSNVADLRAAIQTMLDTPGPYLLDVIVPHQEHVLPMIPSGAGFKDTITEGD (601) SEQ ID No. 4 EACDIPSARVSNVADLRAAIQTMLDTPGPYLLDVIVPHQEHVLPMIPSGAGFKDTITEGD (661) SEQ ID No. 2 GRTSY- (661) SEQ ID No. 4 GRTSY-
[0138] Yet, it is generally preferred that the B. vulgaris plants of the present invention and parts thereof are agronomically exploitable. "Agronomically exploitable" means that the B. vulgaris plants and parts thereof are useful for agronomical purposes. For example, the B. vulgaris plants should serve for the purpose of being useful for sugar production, bio fuel production (such as biogas, biobutanol), ethanol production, betaine and/or uridine production. The term "agronomically exploitable" when used herein also includes that the B. vulgaris plants of the present invention are preferably less sensitive against an ALS-inhibitor herbicide, more preferably it is at least 100 times less sensitive, more preferably, 500 times, even more preferably 1000 times and most preferably less than 2000 times. The ALS inhibitor herbicide is one or more described herein, preferably it is foramsulfuron either alone or in combination with one or more further ALS-inhibitor herbicide(s) either from the sub-class of the sulfonyurea herbicides or any other sub-class of the ALS-inhibitor herbicides, most preferably it is foramsulfuron in combination with a further sulfonylurea herbicide and/or an ALS-inhibitor of the sulfonylaminocarbonyltriazolinone herbicide sub-class.
[0139] Preferably, agronomically exploitable B. vulgaris plants, most preferably sugar beet plants, of the present invention are fully fertile, more preferably have wild-type fertility. Fertility is of utmost importance for a B. vulgaris plant of the present invention in order to be agronomically exploitable.
[0140] An example for an agronomically exploitable B. vulgaris plant is sugar beet. A sugar beet plant of the present invention when cultivated in an area of one hectare yields (about 80,000 to 90,000 sugar beets) should preferably serve for the production of at least 4 tons of sugar.
[0141] Alternatively, a sugar beet plant of the present invention should preferably contain a sugar content between 15-20%, preferably at least 17% so as to be agronomically exploitable. Thus, sugar beet plants that contain a sugar content between 15-20%, preferably at least 17% are a preferred embodiment of the present invention.
[0142] Plants of the present invention can be identified using any genotypic analysis method. Genotypic evaluation of the plants includes using techniques such as Isozyme Electrophoresis, Restriction Fragment Length Polymorphisms (RFLPs), Randomly Amplified Polymorphic DNAs (RAPDs), Arbitrarily Primed Polymerase Chain Reaction (AP-PCR), Allele-specific PCR (AS-PCR), DNA Amplification Fingerprinting (DAF), Sequence Characterized Amplified Regions (SCARs), Amplified Fragment Length Polymorphisms (AFLPs), Simple Sequence Repeats (SSRs) which are also referred to as "Microsatellites". Additional compositions and methods for analyzing the genotype of the plants provided herein include those methods disclosed in U.S. Publication No. 2004/0171027, U.S. Publication No. 2005/02080506, and U.S. Publication No. 2005/0283858.
[0143] Another aspect of the present invention is the use of the Beta vulgaris plant described herein and/or the harvestable parts or propagation material described herein for the manufacture/breeding of Beta vulgaris plants. Methods for the manufacture/breeding of B. vulgaris plants are described herein elsewhere. Such manufacture/breeding methods may be used to generate B. vulgaris plants of the present invention further comprising novel plant traits such as stress-resistance, like but not limited to drought, heat, cold, or salt stress and the like.
[0144] In a still further aspect, the present invention envisages the use of the herbicide tolerant Beta vulgaris plant described herein and/or harvestable parts or propagation material derived thereof in a screening method for the selection of ALS inhibitor herbicides.
[0145] A better understanding of the present invention and of its many advantages will be had from the following examples, offered for illustrative purposes only, and are not intended to limit the scope of the present invention in any way.
Example 1: Mutant Isolation
[0146] Sugar beet cell cultures were initiated from seedlings of a diploid sugar beet genotype 7T9044 (as, for example, described by Alexander Dovzhenko, PhD Thesis, Title: "Towards plastid transformation in rapeseed (Brassica napus L.) and sugarbeet (Beta vulgaris L.)", Ludwig-Maximilians-Universitat Munchen, Germany, 2001).
[0147] Sugar beet seeds were immersed for 60 seconds in 70% ethanol, then rinsed twice in sterile water with 0.01% detergent and then incubated for 1-4 hours in 1% NaOCl bleach. Thereafter the seeds were washed 3 times with sterile H.sub.2O and the seeds were stored in sterile H.sub.2O overnight at 4.degree. C. The embryos were then isolated using forceps and scalpel.
[0148] The freshly prepared embryos were immersed in 0.5% NaOCl for 30 min and then washed 3 times in sterile H.sub.2O. After the last washing step they were placed on hormone free MS agar medium (Murashige and Skoog (1962), Physiol. Plantarum, 15, 473-497). Those embryos which developed into sterile seedlings were used for the initiation of regenerable sugar beet cell cultures.
[0149] Cotyledons as well as hypocotyls were cut into 2-5 mm long segments and then cultivated on agar (0.8%) solidified MS agar medium containing either 1 mg/l Benzylaminopurin (BAP) or 0.25 mg/l Thidiazuron (TDZ). 4 weeks later the developing shoot cultures were transferred onto fresh MS agar medium of the same composition and then sub-cultured in monthly intervals. The cultures were kept at 25.degree. C. under dim light at a 12 h/12 h light/dark cycle.
[0150] After 7-10 days, subcultures the shoot cultures which were grown on the thidiazuron containing medium formed a distinct callus type, which was fast growing, soft and friable. The colour of this callus type was yellowish to light green. Some of these friable calli consistently produced chlorophyll containing shoot primordia from embryo-like structures. These fast growing regenerable calli were used for the selection of ALS inhibitor herbicide tolerant sugar beet mutants.
[0151] When this callus type was exposed to 10.sup.-9 M of the ALS inhibitor herbicide foramsulfuron (belonging to the sulfonylurea subclass, see above), the cells survived, but produced less than 50% of the biomass of their siblings on medium devoid of the inhibitor. On medium containing 3.times.10.sup.-8 M foramsulfuron no growth was detectable. For large scale mutant selection experiments, 10.sup.-7 M foramsulfuron was chosen. Surviving and growing cell colonies were numbered and transferred after 4-6 weeks onto fresh medium containing 3.times.10.sup.-7 M of the inhibitor. One of these cell colonies was able to grow not only at this concentration of the inhibitor but even in presence of 3.times.10.sup.-8 M of foramsulfuron.
[0152] From this clone (SB574TL), shoots were regenerated in presence of the ALS inhibitor herbicide, and then the shoots were transferred to MS medium containing 0.05 mg/l naphthalene acetic acid (NAA).
[0153] Within 4-12 weeks the shoots formed roots and then they were transferred into sterile plant containers filled with wet, sterilized perlite, watered with half strength MS inorganic ingredients. Alternatively the plantlets were transferred directly from the agar solidified medium in a perlite containing soil mixture in the greenhouse. During the first 10-15 days after transfer into soil containing substrate the plants were kept in an environment with high air humidity. During and after they were weaned to normal greenhouse air humidity regimes the plants were kept in the greenhouse under artificial light (12 h) at 20+-3.degree. C./15+-2.degree. C. day/night temperatures. 3-5 weeks later, the regenerated plants from the above obtained foramsulfuron tolerant cell culture (SB574TL) as well as from the wild type cell cultures were treated with foramsulfuron, iodosulfuron-methyl-sodium (CAS RN 144550-3-7) and a mixture of both active ingredients. The herbicide doses tested were equivalent to 7-70 g a.i./ha for foramsulfuron and 1-10 g a.i./ha for iodosulfuron-methyl-sodium. Regenerated plants from this tolerant cell line tolerated even the highest herbicide doses (foramsulfuron, iodosulfuron-methyl-sodium and their mixtures in the ratio 7:1 whereas even the lowest doses killed the wild type plants.
Example 2: Test of Offsprings
[0154] Based on SB574TL, F2 and F3 seeds of experimental hybrids conferring the resistance allele in the heterozygous state as well as F4-F6 seeds conferring the mutant allele in the homozygous state were sown in the field and treated with foramsulfuron, iodosulfuron-methyl-sodium as well as with mixtures of both ALS inhibitor herbicides when the plants developed 3-5 rosette leaves. The homozygous seedlings tolerated mixtures of 35 g foramsulfuron/ha+7 g iodosulfuron-methyl-sodium/ha without growth retardation or any signs of visible damage. Heterozygous lines showed signs of retarded growth and some leaf chlorosis at these rates, but they recovered within 3-5 weeks, whereas the conventional sugar beet seedlings were killed by the ALS inhibitor herbicides.
Example 3: Molecular Characterization of the Obtained Sugar Beet Mutant (SB574TL)
[0155] Extraction and nucleic acid sequence analysis of the obtained mutant was performed by LGC Genomics GmbH, Berlin, Germany according to amended standard protocols.
[0156] The nucleic acid sequence obtained from the sugar beet mutant SB574TL is shown under SEQ ID NO: 3 with SEQ ID NO: 4 representing the corresponding amino acid sequence, whereas SEQ ID NO: 1 was obtained after sequencing the wild type sugar beet plant that was taken as the starting material. SEQ ID NO: 2 represents the corresponding amino acid sequence of the wild type sugar beet.
[0157] Comparison of all these sequences clearly show up that there is only one mutation at position 569 but no other change took place at any other part of this endogenous ALS gene of this sugar beet plant material.
Example 4: Enzyme Activity Measurements
[0158] The coding sequences of Beta vulgaris wild-type and W574L-mutant (SB574TL) ALS gene were cloned into Novagen pET-32a(+) vectors and the vectors transformed into Escherichia coli AD494 according to the instructions of the manufacturer. Bacteria were grown at 37.degree. C. in LB-medium (Luria-Broth-medium) containing 100 mg/l carbenicillin and 25 mg/l kanamycin, induced with 1 mM isopropyl-b-D-thiogalactopyranoside at an OD.sub.600 of 0.6, cultivated for 16 hours at 18.degree. C. and harvested by centrifugation. Bacterial pellets were resuspended in 100 mM sodium phosphate buffer pH 7.0 containing 0.1 mM thiamine-pyrophosphate, 1 mM MgCl.sub.2, and 1 .mu.M FAD at a concentration of 1 gram wet weight per 25 ml of buffer and disrupted by sonification. The crude protein extract obtained after centrifugation was used for ALS activity measurements.
[0159] ALS assays were carried out in 96-well microtiter plates using a modification of the procedure described by Ray (1984). The reaction mixture contained 20 mM potassium phosphate buffer pH 7.0, 20 mM sodium pyruvate, 0.45 mM thiamine-pyrophosphate, 0.45 mM MgCl.sub.2, 9 .mu.M FAD, ALS enzyme and various concentrations of ALS inhibitors in a final volume of 90 .mu.l. Assays were initiated by adding enzyme and terminated after 75 min incubation at 30.degree. C. by the addition of 40 .mu.l 0.5 M H.sub.2SO.sub.4. After 60 min at room temperature 80 .mu.l of a solution of 1.4% a-naphthol and 0.14% creatine in 0.7 M NaOH was added and after an additional 45 min incubation at room temperature the absorbance was determined at 540 nm. pI50-values for inhibition of ALS were determined as described by Ray (1984), using the XLFit Excel add-in version 4.3.1 curve fitting program of ID Business Solutions Limited.
[0160] In total, the mutant enzyme was at least 2000 times less sensitive against the ALS inhibitor foramsulfuron than the wild type enzyme.
Example 5: Enzyme Activity Measurements (from Plants)
[0161] ALS was extracted from sugar beet leaves or sugar beet tissue cultures as described by Ray (1984), Plant Physiol 75:827-831.
[0162] ALS activity was determined in leaf extracts of wild type and sugar beets and leaf extracts of the obtained SB574TL in presence of various concentrations of foramsulfuron as described in Example 4.
[0163] In total, the mutant enzyme was at least 2000 times less sensitive against the ALS inhibitor foramsulfuron than the wild type enzyme.
Example 6 Field Trials by Employing Homozygous ALS Inhibitor Herbicide Tolerant Sugar Beet Plants
[0164] Based on SB574TL, F4-F6 seeds conferring the mutant allele of the endogenous ALS gene in the homozygous state were applied for further testing Plant seeds of the homozygous SB574TL mutant plants and those of the traditional variety KLARINA (commonly available ALS inhibitor sensitive reference sugar beet varieties, not having the respective mutation at position 569 in its ALS protein.) were sown in the field and grew up to various growth stages according to the BBCH standard (as defined in the monographie "Entwicklungsstadien mono- und dikotyler Pflanzen", 2nd edition, 2001, ed. Uwe Meier, Biologische Bundesanstalt for Land und Forstwirtschaft).
[0165] Afterwards the plants were treated with the respective ALS inhibitor herbicides as specified in Tables 1 below and which identical to those being employed during the selection procedure.
[0166] The water quantity applied in the various applications equaled 200 l/ha. At 8, 14, and 28 days (as indicated in Table 1) after application (DAA) of the respective ALS inhibitor herbicide(s), the damages (phytotoxicity/phyto) on the different sugar beet plants were scored according to the scale from 0% to 100%. In this context, "0%" means "no phytotoxicity/phyto" and "100%" means plants were completely killed.
TABLE-US-00003 TABLE 1 SB574TL SB574TL SB574TL Variety based sugar based sugar based sugar characteristic KLARINA beet KLARINA beet KLARINA beet Stage of BBCH 14 BBCH 14 BBCH 14 BBCH 14 BBCH 14 BBCH 14 application Rating % phyto % phyto % phyto % phyto % phyto % phyto Application- 8 days 8 days 14 days 14 days 28 days 28 days Assessment interval Active substance gai/ha Foramsulfuron 25 85 0 83 0 86 0 g/ha Foramsulfuron 50 90 0 92 0 94 0 g/ha Iodosulfuron- 7 90 0 97 0 100 0 methyl-sodium g/ha
Sequence CWU
1
1
611998DNABeta vulgaris 1atggcggcta ccttcacaaa cccaacattt tccccttcct
caactccatt aaccaaaacc 60ctaaaatccc aatcttccat ctcttcaacc ctcccctttt
ccacccctcc caaaacccca 120actccactct ttcaccgtcc cctccaaatc tcatcctccc
aatcccacaa atcatccgcc 180attaaaacac aaactcaagc accttcttct ccagctattg
aagattcatc tttcgtttct 240cgatttggcc ctgatgaacc cagaaaaggg tccgatgtcc
tcgttgaagc tcttgagcgt 300gaaggtgtta ccaatgtgtt tgcttaccct ggtggtgcat
ctatggaaat ccaccaagct 360ctcacacgct ctaaaaccat ccgcaatgtc ctccctcgcc
atgaacaagg cggggttttc 420gccgccgagg gatatgctag agctactgga aaggttggtg
tctgcattgc gacttctggt 480cctggtgcta ccaacctcgt atcaggtctt gctgacgctc
tccttgattc tgtccctctt 540gttgccatca ctggccaagt tccacgccgt atgattggca
ctgatgcttt tcaggagact 600ccaattgttg aggtgacaag gtctattact aagcataatt
atttagtttt ggatgtagag 660gatattccta gaattgttaa ggaagccttt tttttagcta
attctggtag gcctggacct 720gttttgattg atcttcctaa agatattcag cagcaattgg
ttgttcctga ttgggatagg 780ccttttaagt tgggtgggta tatgtctagg ctgccaaagt
ccaagttttc gacgaatgag 840gttggacttc ttgagcagat tgtgaggttg atgagtgagt
cgaagaagcc tgtcttgtat 900gtgggaggtg ggtgtttgaa ttctagtgag gagttgagga
gatttgttga gttgacaggg 960attccggtgg ctagtacttt gatggggttg gggtcttacc
cttgtaatga tgaactgtct 1020cttcatatgt tggggatgca cgggactgtt tatgccaatt
atgcggtgga taaggcggat 1080ttgttgcttg ctttcggggt taggtttgat gatcgtgtga
ccgggaagct cgaggcgttt 1140gctagccgtg ctaagattgt gcatattgat attgactctg
ctgagattgg gaagaacaag 1200cagccccatg tgtccatttg tgctgatgtt aaattggcat
tgcggggtat gaataagatt 1260ctggagtcta gaatagggaa gctgaatttg gatttctcca
agtggagaga agaattaggt 1320gagcagaaga aggaattccc actgagtttt aagacatttg
gggatgcaat tcctccacaa 1380tatgccattc aggtgcttga tgagttgacc aatggtaatg
ctattataag tactggtgtt 1440gggcagcacc aaatgtgggc tgcgcagcat tacaagtaca
gaaaccctcg ccaatggctg 1500acctctggtg ggttgggggc tatggggttt gggctaccag
ccgccattgg agctgcagtt 1560gctcgaccag atgcagtggt tgtcgatatt gatggggatg
gcagttttat tatgaatgtt 1620caagagttgg ctacaattag ggtggaaaat ctcccagtta
agataatgct gctaaacaat 1680caacatttag gtatggttgt ccaatgggaa gataggttct
ataaagctaa ccgggcacat 1740acataccttg gaaacccttc caaatctgct gatatcttcc
ctgatatgct caaattcgct 1800gaggcatgtg atattccttc tgcccgtgtt agcaacgtgg
ctgatttgag ggccgccatt 1860caaacaatgt tggatactcc agggccgtac ctgctcgatg
tgattgtacc gcatcaagag 1920catgtgttgc ctatgattcc aagtggtgcc ggtttcaagg
ataccattac agagggtgat 1980ggaagaacct cttattga
19982665PRTBeta vulgaris 2Met Ala Ala Thr Phe Thr
Asn Pro Thr Phe Ser Pro Ser Ser Thr Pro1 5
10 15Leu Thr Lys Thr Leu Lys Ser Gln Ser Ser Ile Ser
Ser Thr Leu Pro 20 25 30Phe
Ser Thr Pro Pro Lys Thr Pro Thr Pro Leu Phe His Arg Pro Leu 35
40 45Gln Ile Ser Ser Ser Gln Ser His Lys
Ser Ser Ala Ile Lys Thr Gln 50 55
60Thr Gln Ala Pro Ser Ser Pro Ala Ile Glu Asp Ser Ser Phe Val Ser65
70 75 80Arg Phe Gly Pro Asp
Glu Pro Arg Lys Gly Ser Asp Val Leu Val Glu 85
90 95Ala Leu Glu Arg Glu Gly Val Thr Asn Val Phe
Ala Tyr Pro Gly Gly 100 105
110Ala Ser Met Glu Ile His Gln Ala Leu Thr Arg Ser Lys Thr Ile Arg
115 120 125Asn Val Leu Pro Arg His Glu
Gln Gly Gly Val Phe Ala Ala Glu Gly 130 135
140Tyr Ala Arg Ala Thr Gly Lys Val Gly Val Cys Ile Ala Thr Ser
Gly145 150 155 160Pro Gly
Ala Thr Asn Leu Val Ser Gly Leu Ala Asp Ala Leu Leu Asp
165 170 175Ser Val Pro Leu Val Ala Ile
Thr Gly Gln Val Pro Arg Arg Met Ile 180 185
190Gly Thr Asp Ala Phe Gln Glu Thr Pro Ile Val Glu Val Thr
Arg Ser 195 200 205Ile Thr Lys His
Asn Tyr Leu Val Leu Asp Val Glu Asp Ile Pro Arg 210
215 220Ile Val Lys Glu Ala Phe Phe Leu Ala Asn Ser Gly
Arg Pro Gly Pro225 230 235
240Val Leu Ile Asp Leu Pro Lys Asp Ile Gln Gln Gln Leu Val Val Pro
245 250 255Asp Trp Asp Arg Pro
Phe Lys Leu Gly Gly Tyr Met Ser Arg Leu Pro 260
265 270Lys Ser Lys Phe Ser Thr Asn Glu Val Gly Leu Leu
Glu Gln Ile Val 275 280 285Arg Leu
Met Ser Glu Ser Lys Lys Pro Val Leu Tyr Val Gly Gly Gly 290
295 300Cys Leu Asn Ser Ser Glu Glu Leu Arg Arg Phe
Val Glu Leu Thr Gly305 310 315
320Ile Pro Val Ala Ser Thr Leu Met Gly Leu Gly Ser Tyr Pro Cys Asn
325 330 335Asp Glu Leu Ser
Leu His Met Leu Gly Met His Gly Thr Val Tyr Ala 340
345 350Asn Tyr Ala Val Asp Lys Ala Asp Leu Leu Leu
Ala Phe Gly Val Arg 355 360 365Phe
Asp Asp Arg Val Thr Gly Lys Leu Glu Ala Phe Ala Ser Arg Ala 370
375 380Lys Ile Val His Ile Asp Ile Asp Ser Ala
Glu Ile Gly Lys Asn Lys385 390 395
400Gln Pro His Val Ser Ile Cys Ala Asp Val Lys Leu Ala Leu Arg
Gly 405 410 415Met Asn Lys
Ile Leu Glu Ser Arg Ile Gly Lys Leu Asn Leu Asp Phe 420
425 430Ser Lys Trp Arg Glu Glu Leu Gly Glu Gln
Lys Lys Glu Phe Pro Leu 435 440
445Ser Phe Lys Thr Phe Gly Asp Ala Ile Pro Pro Gln Tyr Ala Ile Gln 450
455 460Val Leu Asp Glu Leu Thr Asn Gly
Asn Ala Ile Ile Ser Thr Gly Val465 470
475 480Gly Gln His Gln Met Trp Ala Ala Gln His Tyr Lys
Tyr Arg Asn Pro 485 490
495Arg Gln Trp Leu Thr Ser Gly Gly Leu Gly Ala Met Gly Phe Gly Leu
500 505 510Pro Ala Ala Ile Gly Ala
Ala Val Ala Arg Pro Asp Ala Val Val Val 515 520
525Asp Ile Asp Gly Asp Gly Ser Phe Ile Met Asn Val Gln Glu
Leu Ala 530 535 540Thr Ile Arg Val Glu
Asn Leu Pro Val Lys Ile Met Leu Leu Asn Asn545 550
555 560Gln His Leu Gly Met Val Val Gln Trp Glu
Asp Arg Phe Tyr Lys Ala 565 570
575Asn Arg Ala His Thr Tyr Leu Gly Asn Pro Ser Lys Ser Ala Asp Ile
580 585 590Phe Pro Asp Met Leu
Lys Phe Ala Glu Ala Cys Asp Ile Pro Ser Ala 595
600 605Arg Val Ser Asn Val Ala Asp Leu Arg Ala Ala Ile
Gln Thr Met Leu 610 615 620Asp Thr Pro
Gly Pro Tyr Leu Leu Asp Val Ile Val Pro His Gln Glu625
630 635 640His Val Leu Pro Met Ile Pro
Ser Gly Ala Gly Phe Lys Asp Thr Ile 645
650 655Thr Glu Gly Asp Gly Arg Thr Ser Tyr 660
66531998DNABeta
vulgarismutation(1706)..(1706)Substitution of a Guanosine by a Thymidine
3atggcggcta ccttcacaaa cccaacattt tccccttcct caactccatt aaccaaaacc
60ctaaaatccc aatcttccat ctcttcaacc ctcccctttt ccacccctcc caaaacccca
120actccactct ttcaccgtcc cctccaaatc tcatcctccc aatcccacaa atcatccgcc
180attaaaacac aaactcaagc accttcttct ccagctattg aagattcatc tttcgtttct
240cgatttggcc ctgatgaacc cagaaaaggg tccgatgtcc tcgttgaagc tcttgagcgt
300gaaggtgtta ccaatgtgtt tgcttaccct ggtggtgcat ctatggaaat ccaccaagct
360ctcacacgct ctaaaaccat ccgcaatgtc ctccctcgcc atgaacaagg cggggttttc
420gccgccgagg gatatgctag agctactgga aaggttggtg tctgcattgc gacttctggt
480cctggtgcta ccaacctcgt atcaggtctt gctgacgctc tccttgattc tgtccctctt
540gttgccatca ctggccaagt tccacgccgt atgattggca ctgatgcttt tcaggagact
600ccaattgttg aggtgacaag gtctattact aagcataatt atttagtttt ggatgtagag
660gatattccta gaattgttaa ggaagccttt tttttagcta attctggtag gcctggacct
720gttttgattg atcttcctaa agatattcag cagcaattgg ttgttcctga ttgggatagg
780ccttttaagt tgggtgggta tatgtctagg ctgccaaagt ccaagttttc gacgaatgag
840gttggacttc ttgagcagat tgtgaggttg atgagtgagt cgaagaagcc tgtcttgtat
900gtgggaggtg ggtgtttgaa ttctagtgag gagttgagga gatttgttga gttgacaggg
960attccggtgg ctagtacttt gatggggttg gggtcttacc cttgtaatga tgaactgtct
1020cttcatatgt tggggatgca cgggactgtt tatgccaatt atgcggtgga taaggcggat
1080ttgttgcttg ctttcggggt taggtttgat gatcgtgtga ccgggaagct cgaggcgttt
1140gctagccgtg ctaagattgt gcatattgat attgactctg ctgagattgg gaagaacaag
1200cagccccatg tgtccatttg tgctgatgtt aaattggcat tgcggggtat gaataagatt
1260ctggagtcta gaatagggaa gctgaatttg gatttctcca agtggagaga agaattaggt
1320gagcagaaga aggaattccc actgagtttt aagacatttg gggatgcaat tcctccacaa
1380tatgccattc aggtgcttga tgagttgacc aatggtaatg ctattataag tactggtgtt
1440gggcagcacc aaatgtgggc tgcgcagcat tacaagtaca gaaaccctcg ccaatggctg
1500acctctggtg ggttgggggc tatggggttt gggctaccag ccgccattgg agctgcagtt
1560gctcgaccag atgcagtggt tgtcgatatt gatggggatg gcagttttat tatgaatgtt
1620caagagttgg ctacaattag ggtggaaaat ctcccagtta agataatgct gctaaacaat
1680caacatttag gtatggttgt ccaattggaa gataggttct ataaagctaa ccgggcacat
1740acataccttg gaaacccttc caaatctgct gatatcttcc ctgatatgct caaattcgct
1800gaggcatgtg atattccttc tgcccgtgtt agcaacgtgg ctgatttgag ggccgccatt
1860caaacaatgt tggatactcc agggccgtac ctgctcgatg tgattgtacc gcatcaagag
1920catgtgttgc ctatgattcc aagtggtgcc ggtttcaagg ataccattac agagggtgat
1980ggaagaacct cttattga
19984665PRTBeta vulgarisMISC_FEATURE(569)..(569)Substitution of a
Tryptophan by a Leucine 4Met Ala Ala Thr Phe Thr Asn Pro Thr Phe Ser Pro
Ser Ser Thr Pro1 5 10
15Leu Thr Lys Thr Leu Lys Ser Gln Ser Ser Ile Ser Ser Thr Leu Pro
20 25 30Phe Ser Thr Pro Pro Lys Thr
Pro Thr Pro Leu Phe His Arg Pro Leu 35 40
45Gln Ile Ser Ser Ser Gln Ser His Lys Ser Ser Ala Ile Lys Thr
Gln 50 55 60Thr Gln Ala Pro Ser Ser
Pro Ala Ile Glu Asp Ser Ser Phe Val Ser65 70
75 80Arg Phe Gly Pro Asp Glu Pro Arg Lys Gly Ser
Asp Val Leu Val Glu 85 90
95Ala Leu Glu Arg Glu Gly Val Thr Asn Val Phe Ala Tyr Pro Gly Gly
100 105 110Ala Ser Met Glu Ile His
Gln Ala Leu Thr Arg Ser Lys Thr Ile Arg 115 120
125Asn Val Leu Pro Arg His Glu Gln Gly Gly Val Phe Ala Ala
Glu Gly 130 135 140Tyr Ala Arg Ala Thr
Gly Lys Val Gly Val Cys Ile Ala Thr Ser Gly145 150
155 160Pro Gly Ala Thr Asn Leu Val Ser Gly Leu
Ala Asp Ala Leu Leu Asp 165 170
175Ser Val Pro Leu Val Ala Ile Thr Gly Gln Val Pro Arg Arg Met Ile
180 185 190Gly Thr Asp Ala Phe
Gln Glu Thr Pro Ile Val Glu Val Thr Arg Ser 195
200 205Ile Thr Lys His Asn Tyr Leu Val Leu Asp Val Glu
Asp Ile Pro Arg 210 215 220Ile Val Lys
Glu Ala Phe Phe Leu Ala Asn Ser Gly Arg Pro Gly Pro225
230 235 240Val Leu Ile Asp Leu Pro Lys
Asp Ile Gln Gln Gln Leu Val Val Pro 245
250 255Asp Trp Asp Arg Pro Phe Lys Leu Gly Gly Tyr Met
Ser Arg Leu Pro 260 265 270Lys
Ser Lys Phe Ser Thr Asn Glu Val Gly Leu Leu Glu Gln Ile Val 275
280 285Arg Leu Met Ser Glu Ser Lys Lys Pro
Val Leu Tyr Val Gly Gly Gly 290 295
300Cys Leu Asn Ser Ser Glu Glu Leu Arg Arg Phe Val Glu Leu Thr Gly305
310 315 320Ile Pro Val Ala
Ser Thr Leu Met Gly Leu Gly Ser Tyr Pro Cys Asn 325
330 335Asp Glu Leu Ser Leu His Met Leu Gly Met
His Gly Thr Val Tyr Ala 340 345
350Asn Tyr Ala Val Asp Lys Ala Asp Leu Leu Leu Ala Phe Gly Val Arg
355 360 365Phe Asp Asp Arg Val Thr Gly
Lys Leu Glu Ala Phe Ala Ser Arg Ala 370 375
380Lys Ile Val His Ile Asp Ile Asp Ser Ala Glu Ile Gly Lys Asn
Lys385 390 395 400Gln Pro
His Val Ser Ile Cys Ala Asp Val Lys Leu Ala Leu Arg Gly
405 410 415Met Asn Lys Ile Leu Glu Ser
Arg Ile Gly Lys Leu Asn Leu Asp Phe 420 425
430Ser Lys Trp Arg Glu Glu Leu Gly Glu Gln Lys Lys Glu Phe
Pro Leu 435 440 445Ser Phe Lys Thr
Phe Gly Asp Ala Ile Pro Pro Gln Tyr Ala Ile Gln 450
455 460Val Leu Asp Glu Leu Thr Asn Gly Asn Ala Ile Ile
Ser Thr Gly Val465 470 475
480Gly Gln His Gln Met Trp Ala Ala Gln His Tyr Lys Tyr Arg Asn Pro
485 490 495Arg Gln Trp Leu Thr
Ser Gly Gly Leu Gly Ala Met Gly Phe Gly Leu 500
505 510Pro Ala Ala Ile Gly Ala Ala Val Ala Arg Pro Asp
Ala Val Val Val 515 520 525Asp Ile
Asp Gly Asp Gly Ser Phe Ile Met Asn Val Gln Glu Leu Ala 530
535 540Thr Ile Arg Val Glu Asn Leu Pro Val Lys Ile
Met Leu Leu Asn Asn545 550 555
560Gln His Leu Gly Met Val Val Gln Leu Glu Asp Arg Phe Tyr Lys Ala
565 570 575Asn Arg Ala His
Thr Tyr Leu Gly Asn Pro Ser Lys Ser Ala Asp Ile 580
585 590Phe Pro Asp Met Leu Lys Phe Ala Glu Ala Cys
Asp Ile Pro Ser Ala 595 600 605Arg
Val Ser Asn Val Ala Asp Leu Arg Ala Ala Ile Gln Thr Met Leu 610
615 620Asp Thr Pro Gly Pro Tyr Leu Leu Asp Val
Ile Val Pro His Gln Glu625 630 635
640His Val Leu Pro Met Ile Pro Ser Gly Ala Gly Phe Lys Asp Thr
Ile 645 650 655Thr Glu Gly
Asp Gly Arg Thr Ser Tyr 660
66552013DNAArabidopsis thaliana 5atggcggcgg caacaacaac aacaacaaca
tcttcttcga tctccttctc caccaaacca 60tctccttcct cctccaaatc accattacca
atctccagat tctccctccc attctcccta 120aaccccaaca aatcatcctc ctcctcccgc
cgccgcggta tcaaatccag ctctccctcc 180tccatctccg ccgtgctcaa cacaaccacc
aatgtcacaa ccactccctc tccaaccaaa 240cctaccaaac ccgaaacatt catctcccga
ttcgctccag atcaaccccg caaaggcgct 300gatatcctcg tcgaagcttt agaacgtcaa
ggcgtagaaa ccgtattcgc ttaccctgga 360ggtgcatcaa tggagattca ccaagcctta
acccgctctt cctcaatccg taacgtcctt 420cctcgtcacg aacaaggagg tgtattcgca
gcagaaggat acgctcgatc ctcaggtaaa 480ccaggtatct gtatagccac ttcaggtccc
ggagctacaa atctcgttag cggattagcc 540gatgcgttgt tagatagtgt tcctcttgta
gcaatcacag gacaagtccc tcgtcgtatg 600attggtacag atgcgtttca agagactccg
attgttgagg taacgcgttc gattacgaag 660cataactatc ttgtgatgga tgttgaagat
atccctagga ttattgagga agctttcttt 720ttagctactt ctggtagacc tggacctgtt
ttggttgatg ttcctaaaga tattcaacaa 780cagcttgcga ttcctaattg ggaacaggct
atgagattac ctggttatat gtctaggatg 840cctaaacctc cggaagattc tcatttggag
cagattgtta ggttgatttc tgagtctaag 900aagcctgtgt tgtatgttgg tggtggttgt
ttgaattcta gcgatgaatt gggtaggttt 960gttgagctta cggggatccc tgttgcgagt
acgttgatgg ggctgggatc ttatccttgt 1020gatgatgagt tgtcgttaca tatgcttgga
atgcatggga cggtgtatgc gaattacgct 1080gtggagcata gtgatttgtt gttggcgttt
ggggtgaggt ttgatgatcg cgtcacgggt 1140aagcttgagg cttttgctag tagggctaag
attgttcata ttgatattga ctctgctgag 1200attgggaaga ataagactcc tcatgtgtct
gtgtgtggtg atgtcaagct ggctttgcaa 1260gggatgaata aggttcttga gaaccgagct
gaggagctta agcttgattt tggagtttgg 1320aggaatgagt tgaacgtaca gaaacagaag
tttccgttga gctttaagac gtttggggaa 1380gctattcctc cacagtatgc gattaaggtc
cttgatgagt tgactgatgg aaaagccata 1440ataagtactg gtgtcgggca acatcaaatg
tgggcggcgc agttctacaa ttacaagaag 1500ccaaggcagt ggctatcatc aggaggcctt
ggagctatgg gttttggact tcctgctgcc 1560attggagcgt ctgttgctaa ccctgatgca
atagttgtgg atattgacgg agatggaagc 1620tttataatga atgtgcaaga gctggccaca
atccgtgtag agcaacttcc agtgaagata 1680ctcttattaa acaaccagca tcttggcatg
gttatgcaat gggaagatcg gttctacaag 1740gctaaccgag ctcacacatt tctcggggat
ccggctcagg aggacgagat attcccgaac 1800atgttgctgt ttgcagcagc ttgcgggatt
ccagcggcga gggtgacaaa gaaagcagat 1860ctccgagaag ctattcagac aatgctggat
acaccaggac cttacctgtt ggatgtgatt 1920tgtccgcacc aagaacatgt gttgccgatg
atcccgagtg gtggcacttt caacgatgtc 1980ataacggaag gagatggccg gattaaatac
tga 20136670PRTArabidopsis thaliana 6Met
Ala Ala Ala Thr Thr Thr Thr Thr Thr Ser Ser Ser Ile Ser Phe1
5 10 15Ser Thr Lys Pro Ser Pro Ser
Ser Ser Lys Ser Pro Leu Pro Ile Ser 20 25
30Arg Phe Ser Leu Pro Phe Ser Leu Asn Pro Asn Lys Ser Ser
Ser Ser 35 40 45Ser Arg Arg Arg
Gly Ile Lys Ser Ser Ser Pro Ser Ser Ile Ser Ala 50 55
60Val Leu Asn Thr Thr Thr Asn Val Thr Thr Thr Pro Ser
Pro Thr Lys65 70 75
80Pro Thr Lys Pro Glu Thr Phe Ile Ser Arg Phe Ala Pro Asp Gln Pro
85 90 95Arg Lys Gly Ala Asp Ile
Leu Val Glu Ala Leu Glu Arg Gln Gly Val 100
105 110Glu Thr Val Phe Ala Tyr Pro Gly Gly Ala Ser Met
Glu Ile His Gln 115 120 125Ala Leu
Thr Arg Ser Ser Ser Ile Arg Asn Val Leu Pro Arg His Glu 130
135 140Gln Gly Gly Val Phe Ala Ala Glu Gly Tyr Ala
Arg Ser Ser Gly Lys145 150 155
160Pro Gly Ile Cys Ile Ala Thr Ser Gly Pro Gly Ala Thr Asn Leu Val
165 170 175Ser Gly Leu Ala
Asp Ala Leu Leu Asp Ser Val Pro Leu Val Ala Ile 180
185 190Thr Gly Gln Val Pro Arg Arg Met Ile Gly Thr
Asp Ala Phe Gln Glu 195 200 205Thr
Pro Ile Val Glu Val Thr Arg Ser Ile Thr Lys His Asn Tyr Leu 210
215 220Val Met Asp Val Glu Asp Ile Pro Arg Ile
Ile Glu Glu Ala Phe Phe225 230 235
240Leu Ala Thr Ser Gly Arg Pro Gly Pro Val Leu Val Asp Val Pro
Lys 245 250 255Asp Ile Gln
Gln Gln Leu Ala Ile Pro Asn Trp Glu Gln Ala Met Arg 260
265 270Leu Pro Gly Tyr Met Ser Arg Met Pro Lys
Pro Pro Glu Asp Ser His 275 280
285Leu Glu Gln Ile Val Arg Leu Ile Ser Glu Ser Lys Lys Pro Val Leu 290
295 300Tyr Val Gly Gly Gly Cys Leu Asn
Ser Ser Asp Glu Leu Gly Arg Phe305 310
315 320Val Glu Leu Thr Gly Ile Pro Val Ala Ser Thr Leu
Met Gly Leu Gly 325 330
335Ser Tyr Pro Cys Asp Asp Glu Leu Ser Leu His Met Leu Gly Met His
340 345 350Gly Thr Val Tyr Ala Asn
Tyr Ala Val Glu His Ser Asp Leu Leu Leu 355 360
365Ala Phe Gly Val Arg Phe Asp Asp Arg Val Thr Gly Lys Leu
Glu Ala 370 375 380Phe Ala Ser Arg Ala
Lys Ile Val His Ile Asp Ile Asp Ser Ala Glu385 390
395 400Ile Gly Lys Asn Lys Thr Pro His Val Ser
Val Cys Gly Asp Val Lys 405 410
415Leu Ala Leu Gln Gly Met Asn Lys Val Leu Glu Asn Arg Ala Glu Glu
420 425 430Leu Lys Leu Asp Phe
Gly Val Trp Arg Asn Glu Leu Asn Val Gln Lys 435
440 445Gln Lys Phe Pro Leu Ser Phe Lys Thr Phe Gly Glu
Ala Ile Pro Pro 450 455 460Gln Tyr Ala
Ile Lys Val Leu Asp Glu Leu Thr Asp Gly Lys Ala Ile465
470 475 480Ile Ser Thr Gly Val Gly Gln
His Gln Met Trp Ala Ala Gln Phe Tyr 485
490 495Asn Tyr Lys Lys Pro Arg Gln Trp Leu Ser Ser Gly
Gly Leu Gly Ala 500 505 510Met
Gly Phe Gly Leu Pro Ala Ala Ile Gly Ala Ser Val Ala Asn Pro 515
520 525Asp Ala Ile Val Val Asp Ile Asp Gly
Asp Gly Ser Phe Ile Met Asn 530 535
540Val Gln Glu Leu Ala Thr Ile Arg Val Glu Asn Leu Pro Val Lys Val545
550 555 560Leu Leu Leu Asn
Asn Gln His Leu Gly Met Val Met Gln Trp Glu Asp 565
570 575Arg Phe Tyr Lys Ala Asn Arg Ala His Thr
Phe Leu Gly Asp Pro Ala 580 585
590Gln Glu Asp Glu Ile Phe Pro Asn Met Leu Leu Phe Ala Ala Ala Cys
595 600 605Gly Ile Pro Ala Ala Arg Val
Thr Lys Lys Ala Asp Leu Arg Glu Ala 610 615
620Ile Gln Thr Met Leu Asp Thr Pro Gly Pro Tyr Leu Leu Asp Val
Ile625 630 635 640Cys Pro
His Gln Glu His Val Leu Pro Met Ile Pro Asn Gly Gly Thr
645 650 655Phe Asn Asp Val Ile Thr Glu
Gly Asp Gly Arg Ile Lys Tyr 660 665
670
User Contributions:
Comment about this patent or add new information about this topic: