NOVEL T CELL RECEPTORS AND IMMUNE THERAPY USING THE SAME

Abstract

The present invention relates to antigen recognizing constructs against a tumor associated antigen (TAA) derived from the target protein DDB1 and CUL4 associated factor 4-like 2 (DCAF4L2). The invention in particular provides novel T cell receptor (TCR) based molecules which are selective and specific for the TAA of the invention. The TCR of the invention, and TAA binding fragments derived therefrom, are of use for the diagnosis, treatment and prevention of TAA expressing cancerous diseases. Further provided are nucleic acids encoding the antigen recognizing constructs of the invention, vectors comprising these nucleic acids, recombinant cells expressing the antigen recognizing constructs and pharmaceutical compositions comprising the compounds of the invention.

Description

CROSS REFERENCE TO RELATED APPLICATIONS

[0001] This application is a continuation of U.S. patent application Ser. No. 16/025,434, filed 2 Jul. 2018, which is a continuation of U.S. patent application Ser. No. 15/835,095, filed 7 Dec. 2017, now U.S. Pat. No. 10,527,623, issued 7 Jan. 2020, which claims priority to of U.S. Provisional Application Ser. No. 62/431,580, filed 8 Dec. 2016, and German Application No. 102016123859.7, filed 8 Dec. 2016. The contents of each of these applications are hereby incorporated by reference in their entirety.

[0002] This application is also related to PCT/EP2017/081893, filed 8 Dec. 2017, the content of which is incorporated herein by reference in its entirety.

REFERENCE TO SEQUENCE LISTING SUBMITTED AS A COMPLIANT ASCII TEXT FILE (.txt)

[0003] Pursuant to the EFS-Web legal framework and 37 CFR .sctn..sctn. 1.821-825 (see MPEP .sctn. 2442.03(a)), a Sequence Listing in the form of an ASCII-compliant text file (entitled "3000058-005003_Sequence_Listing_ST25.txt" created on 23 Mar. 2020, and 49,920 bytes in size) is submitted concurrently with the instant application, and the entire contents of the Sequence Listing are incorporated herein by reference.

BACKGROUND

Field of the Invention

[0004] The present invention relates to antigen recognizing constructs against a tumor associated antigen (TAA) derived from the target protein DDB1 and CUL4 associated factor 4-like 2 (DCAF4L2). The invention in particular provides novel T cell receptor (TCR) based molecules which are selective and specific for the TAA of the invention. The TCR of the invention, and TAA binding fragments derived therefrom, are of use for the diagnosis, treatment and prevention of TAA expressing cancerous diseases. Further provided are nucleic acids encoding the antigen recognizing constructs of the invention, vectors comprising these nucleic acids, recombinant cells expressing the antigen recognizing constructs and pharmaceutical compositions comprising the compounds of the invention.

Description of Related Art

[0005] T-cell based immunotherapy targets represent peptide epitopes derived from tumor-associated or tumor-specific proteins, which are presented by molecules of the major histocompatibility complex (MHC). These tumor associated antigens (TAAs) can be peptides derived from all protein classes, such as enzymes, receptors, transcription factors, etc. which are expressed and, as compared to unaltered cells of the same origin, usually up-regulated in cells of the respective tumor.

[0006] Specific elements of the cellular immune response are capable of selectively recognizing and destroying tumor cells. The isolation of T-cells from tumor-infiltrating cell populations or from peripheral blood suggests that such cells play an important role in natural immune defense against cancer. CD8-positive T-cells in particular, which recognize class I molecules of the major histocompatibility complex (MHC)-bearing peptides of usually 8 to 10 amino acid residues derived from proteins or defective ribosomal products (DRiPs) located in the cytosol, play an important role in this response. The MHC-molecules of the human are also designated as human leukocyte-antigens (HLA).

[0007] There are two classes of MHC-molecules, MHC class I and MHC class II. Complexes of peptide and MHC class I are recognized by CD8-positive T-cells bearing the appropriate T-cell receptor (TCR), whereas complexes of peptide and MHC class II molecules are recognized by CD4-positive-helper-T-cells bearing the appropriate TCR. Since both types of response, CD8 and CD4 dependent, contribute jointly and synergistically to the anti-tumor effect, the identification and characterization of tumor-associated antigens and corresponding T cell receptors is important in the development of cancer immunotherapies such as vaccines and cell therapies.

[0008] In the MHC class I dependent immune reaction, peptides not only have to be able to bind to certain MHC class I molecules expressed by tumor cells, they subsequently also have to be recognized by T-cells bearing specific T-cell receptors (TCR). Therefore, TAAs are a starting point for the development of a T-cell based therapy including but not limited to tumor vaccines and cell therapies.

[0009] Approximately 90 percent of peripheral blood T cells express a TCR consisting of an .alpha. polypeptide and a .beta. polypeptide. Beside .alpha..beta. T cells, a small percentage of T cells (about 5% of total T cells) have been shown to express a TCR consisting of a .gamma. polypeptide and a .delta. polypeptide. .gamma..delta. T cells are found at their highest abundance in the gut mucosa, within a population of lymphocytes known as intraepithelial lymphocytes (IELs). The antigenic molecules that activate .gamma..delta. T cells are still widely unknown. However, .gamma..delta. T cells are not MHC restricted and seem to be able to recognize whole proteins rather than requiring peptides to be presented by MHC molecules on antigen presenting cells, although some recognize MHC class IB molecules. Human V.gamma.9/V.delta.2 T cells, which constitute the major .gamma..delta. T cell population in peripheral blood, are unique in that they specifically and rapidly respond to a small non-peptidic microbial metabolite, HMB-PP, an isopentenyl pyrophosphate precursor.

[0010] The chains of the T cell antigen receptor of a T cell clone are each composed of a unique combination of domains designated variable (V), [diversity (D),] joining (J), and constant (C). In each T cell clone, the combination of V, D and J domains of both the alpha and the beta chains or of both the delta and gamma chains participates in antigen recognition in a manner which is uniquely characteristic of that T cell clone and defines a unique binding site, also known as the idiotype of the T cell clone. In contrast, the C domain does not participate in antigen binding.

[0011] A TCR is a heterodimeric cell surface protein of the immunoglobulin super-family, which is associated with invariant proteins of the CD3 complex involved in mediating signal transduction. TCRs exist in .alpha..beta. and .gamma..delta. forms, which are structurally similar but have quite distinct anatomical locations and probably functions. The extracellular portion of native heterodimeric .alpha..beta.TCR and .gamma..delta. TCR each contain two polypeptides, each of which has a membrane-proximal constant domain, and a membrane-distal variable domain. Each of the constant and variable domains includes an intra-chain disulfide bond. The variable domains contain the highly polymorphic loops analogous to the complementarity determining regions (CDRs) of antibodies. The use of TCR gene therapy overcomes a number of current hurdles. It allows equipping patients' own T cells with desired specificities and generation of sufficient numbers of T cells in a short period of time, avoiding their exhaustion. The TCR will be transduced into central memory T cells or T cells with stem cell characteristics, which may ensure better persistence and function upon transfer. TCR-engineered T cells will be infused into cancer patients rendered lymphopenic by chemotherapy or irradiation, allowing efficient engraftment but inhibiting immune suppression.

[0012] The gene DCAF4L2 encodes for DDB1 and CUL4 associated factor 4-like 2. The specific function of this protein remains to be elucidated; nevertheless, the DCAF4L2 gene was shown to be associated with optic disc morphology and cleft lip development Springelkamp H, et al. Meta-analysis of Genome-Wide Association Studies Identifies Novel Loci Associated With Optic Disc Morphology. Genet Epidemiol. 2015 March; 39(3):207-16. Beaty T H et al. Confirming genes influencing risk to cleft lip with/without cleft palate in a case-parent trio study. Hum Genet. 2013 July; 132(7):771-81).

[0013] While advances have been made in the development of molecular-targeting drugs for cancer therapy, there remains a need in the art to develop new anti-cancer agents that specifically target molecules highly specific to cancer cells. The present description addresses that need by providing novel TCRs targeting a TAA-epitope derived from DCAF4L2, respective recombinant TCR constructs, nucleic acids, vectors and host cells that specifically bind TAA epitope(s) as disclosed; and methods of using such molecules in the treatment of cancer.

SUMMARY

[0014] The object of the invention is solved in a first aspect thereof by an antigen recognizing construct comprising at least one complementary determining region (CDR) 3 having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or preferably 100% sequence identity to an amino acid sequence selected from SEQ ID Nos. 3, 9, 15, 21, 27 and 33.

[0015] The antigen recognizing constructs according to the present invention recognize and specifically recognize the epitope of the invention comprising or consisting of the amino acid sequence "ILQDGQFLV" (one-letter code) according to SEQ ID NO: 49, herein designated as "DCAF4L2-001" or sometimes only "peptide" or "epitope" of the invention. The peptide is preferably recognized when bound to MHC. US 2016-0280738 A1 (herewith incorporated in its entirety) discloses the DCAF4L2-001 peptide, and uses thereof).

BRIEF DESCRIPTION OF THE DRAWINGS

[0016] The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.

[0017] FIGS. 1-13 depict embodiments of the disclosure as disclosed herein.

DETAILED DESCRIPTION OF A PREFERRED EMBODIMENT

[0018] In some embodiments (see also below) the antigen recognizing construct of the invention specifically binds to a TAA-peptide-HLA molecule complex, wherein the TAA peptide comprises, or alternatively consists of, a variant of the TAA which is at least 66%, preferably at least 77%, and more preferably at least 88% homologous (preferably at least 77% or at least 88% identical) to the amino acid sequence of the TAA of the invention according to SEQ ID NO: 49, wherein said variant binds to an HLA class I or class II molecule and/or induces T-cells cross-reacting with said peptide, or a pharmaceutically acceptable salt thereof, wherein said peptide is not the underlying full-length polypeptide.

[0019] As used herein, the terms "identical" or percent "identity", when used anywhere herein in the context of two or more nucleic acid or protein/polypeptide sequences, refer to two or more sequences or subsequences that are the same or have (or have at least) a specified percentage of amino acid residues or nucleotides that are the same (i.e., at, or at least, about 60% identity, preferably at, or at least, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93% or 94%, identity, and more preferably at, or at least, about 95%, 96%, 97%, 98%, 99%, or higher identity over a specified region--preferably over their full length sequences--, when compared and aligned for maximum correspondence over the comparison window or designated region) as measured using a sequence comparison algorithms, or by manual alignment and visual inspection (see, e.g., NCBI web site). In a particular embodiment, for example when comparing the protein or nucleic acid sequence of an antigen recognizing construct of the invention to another protein/gene, the percentage identity can be determined by the Blast searches supported at the Human Olfactory Data Explorer (eg, https://genome.weizmann.ac.il/cgi-bin/horde/blastHorde.pl); in particular for amino acid identity, those using BLASTP 2.2.28+ with the following parameters: Matrix: BLOSUM62; Gap Penalties: Existence: 11, Extension: 1; Neighboring words threshold: 11; Window for multiple hits: 40.

[0020] In the context of the present invention it shall be understood that any embodiments referred to as "comprising" certain features of the invention, shall be understood to include in some more preferred embodiments the more restricted description of "consisting of" or "consisting essentially of" the very same features of the present invention.

[0021] In another additional or alternative embodiment, the antigen recognizing construct may further comprise a CDR1 and/or a CDR2 domain sequence. Within the variable domain, CDR1 and CDR2 are found in the variable (V) region of a polypeptide chain, and CDR3 includes some of V, all of diversity (D) and joining (J) regions. CDR3 is the most variable and is the main CDR responsible for specifically and selectively recognizing an antigen. CDR1 and CDR2 sequences may be selected from a CDR sequence of a human variable chain allele.

[0022] Native alpha-beta heterodimeric TCRs have an alpha chain and a beta chain. Each chain comprises variable, joining and constant regions, and the beta chain also usually contains a short diversity region between the variable and joining regions, but this diversity region is often considered as part of the joining region. Each variable region comprises three CDRs (Complementarity Determining Regions) embedded in a framework sequence, one being the hypervariable region named CDR3. There are several types of alpha chain variable (V.alpha.) regions and several types of beta chain variable (V.beta.) regions distinguished by their framework, CDR1 and CDR2 sequences, and by a partly defined CDR3 sequence. The V.alpha. types are referred to in IMGT nomenclature by a unique TRAV number, V.beta. types are referred to by a unique TRBV number. For more information on immunoglobulin antibody and TCR genes see the international ImMunoGeneTics information System.RTM., Lefranc M-P et al (Nucleic Acids Res. 2015 January; 43 (Database issue):D413-22; and www.imgt.org).

[0023] Therefore, in one additional or alternative embodiment the antigen recognizing construct of the invention comprises CDR1, CDR2 and CDR3 sequences in a combination as provided in table 1 herein below, which display the respective variable chain allele together with the CDR3 sequence. Therefore, preferred are antigen recognizing constructs of the invention which comprise at least one, preferably, all three CDR sequences CDR1, CDR2 and CDR3. Preferably, an antigen recognizing construct of the invention comprises the respective CDR1 to CDR3 of one individual herein disclosed TCR variable region of the invention (see table 1 herein below and the example section).

[0024] The term "specificity" or "antigen specificity" or "specific for" a given antigen, as used herein means that the antigen recognizing construct can specifically bind to said antigen, preferably a TAA antigen, more preferably with high avidity, when said antigen is presented by HLA, preferably by HLA A2. For example, a TCR, as antigen recognizing construct, may be considered to have "antigenic specificity" for the TAA, if T cells expressing the TCR secrete at least 200 pg/ml or more (e.g., 250 pg/ml or more, 300 pg/ml or more, 400 pg/ml or more, 500 pg/ml or more, 600 pg/ml or more, 700 pg/ml or more, 1000 pg ml or more, 2,000 pg/ml or more, 2,500 pg/ml or more, 5,000 pg/ml or more) of interferon .gamma. (IFN-.gamma.) upon co-culture with target cells pulsed with a low concentration of a TAA antigen, such as the TAA epitopes and antigens provided herein below (e.g., about 10-11 mol/l, 10-10 mol/l, 10-9 mol/l, 10-8 mol/l, 10-7 mol/l, 10-6 mol/l, 10-5 mol/l). Alternatively, or additionally, a TCR may be considered to have "antigenic specificity" for the TAA, if T cells expressing the TCR secrete at least twice as much IFN-.gamma. as the untransduced background level of IFN-.gamma. upon co-culture with target cells pulsed with a low concentration of the TAA antigens. Such a "specificity" as described above can--for example--be analyzed with an ELISA.

[0025] In one alternative or additional embodiment of the invention, the antigen recognizing construct selectively binds to a TAA derived antigenic peptide; preferably wherein the TAA antigenic peptide is a protein epitope or peptide having an amino acid sequence shown in SEQ ID NO: 49 or a variant thereof, wherein the variant is an amino acid deletion, addition, insertion or substitution of not more than three, preferably two and most preferably not more than one amino acid position. The antigen recognizing construct may selectively bind to modified versions (variants) of the TAA peptide DCAF4L2-001_A1 to A9 (as shown in SEQ ID NOs: 50 to 58) and DCAF4L2-001_T1 to T9 (as shown in SEQ ID NOs: 70 to 78). In contrast, the antigen recognizing construct does not bind to peptides with similar sequence to DCAF4L2-001 (as shown in SEQ ID NOs: 59 to 68).

[0026] The term "selectivity" or "selective recognizing/binding" is understood to refer to the property of an antigen recognizing construct, such as a TCR or antibody, to selectively recognize or bind to preferably only one specific epitope and preferably shows no or substantially no cross-reactivity to another epitope. Preferably "selectivity" or "selective recognizing/binding" means that the antigen recognizing construct (e.g. a TCR) selectively recognizes or binds to preferably only one specific epitope and preferably shows no or substantially no cross-reactivity to another epitope, wherein said epitope is unique for one protein, such that the antigen recognizing construct shows no or substantially no cross-reactivity to another epitope and another protein.

[0027] The antigen recognizing construct according to the invention is preferably selected from an antibody, or derivative or fragment thereof, or a T cell receptor (TCR), or derivative or fragment thereof. A derivative or fragment of an antibody or TCR of the invention shall preferably retain the antigen binding/recognizing ability of the parent molecule, in particular its specificity and/or selectivity as explained above. Such binding functionality may be retained by the presence of a CDR3 region as defined herein.

[0028] In an embodiment of the invention, the inventive TCRs are able to recognize TAA antigens in a major histocompatibility complex (MHC) class I-dependent manner. "MHC class I-dependent manner," as used herein, means that the TCR elicits an immune response upon binding to TAA antigens within the context of an MHC class I molecule. The MHC class I molecule can be any MHC class I molecule known in the art, e.g., HLA-A molecules. In a preferred embodiment of the invention, the MHC class I molecule is an HLA-A2 molecule.

[0029] The invention provides both single chain antigen recognizing construct and double chain recognizing constructs.

[0030] In an embodiment, the TCR alpha variable domain has at least one mutation relative to a TCR alpha domain shown in Table 1; and/or the TCR beta variable domain has at least one mutation relative to a TCR alpha domain shown in Table 1. In an embodiment, a TCR comprising at least one mutation in the TCR alpha variable domain and/or TCR beta variable domain has a binding affinity for, and/or a binding half-life for, an TAA peptide-HLA molecule complex, which is at least double that of a TCR comprising the unmutated TCR alpha domain and/or unmutated TCR beta variable domain.

[0031] The TCR alpha chains of the present description may further comprise a TCR alpha transmembrane domain and/or a TCR alpha intracellular domain. The TCR beta chains of the present description may further comprise a TCR beta transmembrane domain and/or a TCR beta intracellular domain.

[0032] The invention in particular provides a TCR as antigen recognizing construct, or fragment or derivative thereof. The TCR preferably is of human, which is understood as being generated from a human TCR locus and therefore comprising human TCR sequences. Furthermore, the TCR of the invention may be characterized in that it is of human origin and specifically recognizes a TAA antigen of the invention.

[0033] Another embodiment of the invention additionally or alternatively provides the antigen recognizing construct described above, which induces an immune response, preferably wherein the immune response is characterized by an increase in interferon (IFN) .gamma. levels.

[0034] TCRs of the invention may be provided as single chain .alpha. or .beta., or .gamma. and .delta., molecules, or alternatively as double chain constructs composed of both the .alpha. and .beta. chain, or .gamma. and .delta. chain.

[0035] The antigen recognizing construct of the invention may comprise a TCR .alpha. or .gamma. chain; and/or a TCR .beta. or .delta. chain; wherein the TCR .alpha. or .gamma. chain comprises a CDR3 having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID Nos. 3, 15, and 27, and/or wherein the TCR .beta. or .delta. chain comprises a CDR3 having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID Nos. 9, 21, and 33.

[0036] Most preferably, in some additional embodiments, wherein the disclosure refers to antigen recognizing constructs comprising any one, two or all of the CDR1 to CDR3 regions of the herein disclosed TCR chains (see Table 1), such antigen recognizing constructs may be preferred, which comprise the respective CDR sequence of the invention with not more than three, two, and preferably only one, modified amino acid residues. A modified amino acid residue may be selected from an amino acid insertion, deletion or substitution. Most preferred is that the three, two, preferably only one modified amino acid residue is the first or last amino acid residue of the respective CDR sequence. If the modification is a substitution then it is preferable in some embodiments that the substitution is a conservative amino acid substitution.

[0037] If the antigen recognizing construct of the invention is composed of at least two amino acid chains, such as a double chain TCR, or antigen binding fragment thereof, the antigen recognizing construct may comprises in a first polypeptide chain the amino acid sequence according to SEQ ID NO: 3, and in a second polypeptide chain the amino acid sequence according to SEQ ID NO: 9; or in a first polypeptide chain the amino acid sequence according to SEQ ID NO: 15, and in a second polypeptide chain the amino acid sequence according to SEQ ID NO: 21; or in a first polypeptide chain the amino acid sequence according to SEQ ID NO: 27, and in a second polypeptide chain the amino acid sequence according to SEQ ID NO: 33. Any one of the aforementioned double chain TCR, or antigen binding fragments thereof, are preferred TCR of the present invention. In some embodiments, the CDR3 of the double chain TCR of the invention may be mutated. Mutations of the CDR3 sequences of SEQ ID NOs: 9 to 28 as provided above preferably include a substitution, deletion, addition, or insertion of not more than three, preferably two, and most preferably not more than one amino acid residue. In some embodiments, the first polypeptide chain may be a TCR .alpha. or .gamma. chain, and the second polypeptide chain may be a TCR .beta. or .delta. chain. Preferred is the combination of an .alpha..beta. or .gamma..delta. TCR.

[0038] The TCR, or the antigen binding fragment thereof, is in some embodiments composed of a TCR .alpha. and a TCR .beta. chain, or .gamma. and .delta. chain. Such a double chain TCR comprises within each chain variable regions, and the variable regions each comprise one CDR1, one CDR2 and one CDR3 sequence. The TCRs comprises the CDR1 to CDR3 sequences as comprised in the variable chain amino acid sequence of SEQ ID NO: 4 and SEQ ID NO: 10 (R36P3F9), or SEQ ID NO: 16 and SEQ ID NO: 22 (R52P2G11); or SEQ ID NO: 28 and SEQ ID NO: 34 (R53P2A9).

[0039] Some embodiments of the invention pertain to a TCR, or a fragment thereof, composed of a TCR .alpha. and a TCR .beta. chain, wherein said TCR comprises the variable region sequences having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or preferably 100% sequence identity to the amino acid sequence selected from the .alpha. and .beta. chain according to SEQ ID NO: 4 and 10 respectively, or 16 and 22 respectively; or 28 and 34 respectively.

[0040] The inventive TCRs may further comprise a constant region derived from any suitable species, such as any mammal, e.g., human, rat, monkey, rabbit, donkey, or mouse. In an embodiment of the invention, the inventive TCRs further comprise a human constant region. In some preferred embodiments, the constant region of the TCR of the invention may be slightly modified, for example, by the introduction of heterologous sequences, preferably mouse sequences, which may increase TCR expression and stability.

[0041] Some embodiments of the invention pertain to a TCR, or a fragment thereof, composed of a TCR .alpha. and a TCR .beta. chain, wherein said TCR comprises the constant region having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or preferably 100% sequence identity to an amino acid sequence selected from of the .alpha. and .beta. chain according to SEQ ID NO: 5 and 11 respectively, or 17 and 23 respectively; or 29 and 35 respectively.

[0042] The TCR .alpha. or .gamma. chain of the invention may further comprise a CDR1 having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID Nos. 1, 13, and 25; and/or a CDR2 having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID Nos. 2, 14, and 26.

[0043] According to the invention the TCR .beta. or .delta. chain may further comprise a CDR1 having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID Nos. 7, 19, and 31; and/or a CDR2 having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID Nos. 8, 20, and 32.

[0044] The antigen recognizing construct may in a further embodiment comprise a binding fragment of a TCR, and wherein said binding fragment comprises CDR1 to CDR3, optionally selected from the CDR1 to CDR3 sequences having the amino acid sequences of SEQ ID Nos. 1, 2, 3, or 7, 8, 9 or 13, 14, 15, or 19, 20, 21, or 25, 26, 27 or 31, 32, 33.

[0045] In further embodiments of the invention the antigen recognizing construct as described herein elsewhere is a TCR, or a fragment thereof, composed of at least one TCR .alpha. and one TCR .beta. chain sequence, wherein said TCR .alpha. chain sequence comprises the CDR1 to CDR3 sequences having the amino acid sequences of SEQ ID NO: 1 to 3, and said TCR .beta. chain sequence comprises the CDR1 to CDR3 sequences having the amino acid sequences of SEQ ID NO: 7 to 9; or wherein said TCR .alpha. chain sequence comprises the CDR1 to CDR3 sequences having the amino acid sequences of SEQ ID NO: 13 to 15, and said TCR .beta. chain sequence comprises the CDR1 to CDR3 sequences having the amino acid sequences of SEQ ID NO: 19 to 21; or wherein said TCR .alpha. chain sequence comprises the CDR1 to CDR3 sequences having the amino acid sequences of SEQ ID NO: 25 to 27, and said TCR .beta. chain sequence comprises the CDR1 to CDR3 sequences having the amino acid sequences of SEQ ID NO: 31 to 33.

[0046] In further embodiments of the invention the antigen recognizing construct as described herein before is a TCR, or a fragment thereof, comprising at least one TCR .alpha. and one TCR .beta. chain sequence, wherein said TCR .alpha. chain sequence comprises a variable region sequence having the amino acid sequence of SEQ ID No. 4, and wherein said TCR .beta. chain sequence comprises a variable region sequence having the amino acid sequence of SEQ ID No. 10; or wherein said TCR .alpha. chain sequence comprises a variable region sequence having the amino acid sequence of SEQ ID No. 16, and wherein said TCR .beta. chain sequence comprises a variable region sequence having the amino acid sequence of SEQ ID No. 22; or wherein said TCR .alpha. chain sequence comprises a variable region sequence having the amino acid sequence of SEQ ID No. 28, and wherein said TCR .beta. chain sequence comprises a variable region sequence having the amino acid sequence of SEQ ID No. 34.

[0047] In further embodiments of the invention the antigen recognizing construct as described herein before is a TCR, or a fragment thereof, further comprising a TCR constant region having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID Nos. 5, 11, 17, 23, 29 and 35, preferably wherein the TCR is composed of at least one TCR .alpha. and one TCR .beta. chain sequence, wherein the TCR .alpha. chain sequence comprises a constant region having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID Nos. 5, 17, and 29.

[0048] Also disclosed are antigen recognizing constructs as described herein before comprising a first TCR chain having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID No. 6, and a second TCR chain having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID No. 12. The invention also provides TCRs comprising a first TCR chain having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID No. 18, and a second TCR chain having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID No. 24. In further embodiments the invention provides antigen recognizing constructs which are TCR and comprise a first TCR chain having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID No. 30, and a second TCR chain having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID No. 36.

[0049] As used herein, the term "murine" or "human," when referring to an antigen recognizing construct, or a TCR, or any component of a TCR described herein (e.g., complementarity determining region (CDR), variable region, constant region, .alpha. chain, and/or .beta. chain), means a TCR (or component thereof), which is derived from a mouse or a human unrearranged TCR locus, respectively.

[0050] In an embodiment of the invention, chimeric TCR are provided, wherein the TCR chains comprise sequences from multiple species. Preferably, a TCR of the invention may comprise an .alpha. chain comprising a human variable region of an .alpha. chain and, for example, a murine constant region of a murine TCR .alpha. chain.

[0051] In one embodiment, the TCR of the invention is a human TCR comprising human variable regions according to the above embodiments and human constant regions.

[0052] In some embodiments the antigen recognizing construct is murinized or humanized. These terms are used when amino acid sequences from a foreign species are introduced into a construct of the invention. Murinization may replace the human TCRalpha and TCRbeta constant regions by their murine counterparts or may introduce essential murine (amino acid) residues into the sequence that mediate an enhanced functional effect. In humanized sequences the murine sequence is modified by introducing human counterparts or residues.

[0053] The TCR of the invention may be modified in order to avoid mispairing of the TCR chains. The term "mispairing" shall relate to the incorrect pairing between a TCR chain of a TCR .alpha./.gamma. or .beta./.delta. transgene of the invention and an endogenous TCR .alpha./.gamma. or .beta./.delta. chain, respectively, and results in diluted cell surface expression of the transgenic TCR.alpha..beta./.gamma..delta. heterodimer, which reduces the functional avidity of the modified T cells. Preferably, Q at position 44 in the TCR variable domain according to the IMGT numbering is substituted by another amino acid in one or both chains of the TCR of the invention. The substitution is preferably selected from the group consisting of R, D, E, K, I, W and V.

[0054] The TCR of the invention may be provided as a single chain TCR (scTCR). A scTCR can comprise a polypeptide of a variable region of a first TCR chain (e.g., an alpha chain) and a polypeptide of an entire (full-length) second TCR chain (e.g., a beta chain), or vice versa. Furthermore, the scTCR can optionally comprise one or more linkers which join the two or more polypeptides together. The linker can be, for instance, a peptide, which joins together two single chains, as described herein. Also provided is such a scTCR of the invention, which is fused to a human cytokine, such as IL-2, IL-7 or IL-15.

[0055] The antigen recognizing construct according to the invention can also be provided in the form of a multimeric complex, comprising at least two scTCR molecules, wherein said scTCR molecules are each fused to at least one biotin moiety, or other interconnecting molecule/linker, and wherein said scTCRs are interconnected by biotin-streptavidin interaction to allow the formation of said multimeric complex. Similar approaches known in the art for the generation of multimeric TCR are also possible and included in this disclosure. Also provided are multimeric complexes of a higher order, comprising more than two scTCR of the invention.

[0056] For the purposes of the present invention, a TCR is a moiety having at least one TCR alpha or gamma and/or TCR beta or delta variable domain. Generally, they comprise both a TCR alpha variable domain and a TCR beta variable domain, alternatively both a TCR gamma variable domain and a TCR delta variable domain. They may be .alpha..beta./.gamma..delta. heterodimers or may be in single chain format. For use in adoptive therapy, an .alpha..beta. or .gamma..delta. heterodimeric TCR may, for example, be transfected as full length chains having both cytoplasmic and transmembrane domains. If desired, an introduced disulfide bond between residues of the respective constant domains may be present.

[0057] In a preferred embodiment, the antigen recognizing construct is a human TCR, or fragment or derivative thereof. A human TCR or fragment or derivative thereof is a TCR, which comprises over 50% of the corresponding human TCR sequence. Preferably, only a small part of the TCR sequence is of artificial origin or derived from other species. It is known, however, that chimeric TCRs, e.g. derived from human origin with murine sequences in the constant domains, are advantageous. Particularly preferred are, therefore, TCRs in accordance with the present invention, which contains murine sequences in the extracellular part of their constant domains.

[0058] Thus, it is also preferred that the inventive antigen recognizing construct is able to recognize its antigen in a human leucocyte antigen (HLA) dependent manner, preferably in a HLA-A02 dependent manner. The term "HLA dependent manner" in the context of the present invention means that the antigen recognizing construct binds to the antigen only in the event that the antigenic peptide is presented by said HLA.

[0059] The antigen recognizing construct in accordance with the invention in one embodiment preferably induces an immune response, preferably wherein the immune response is characterized by the increase in interferon (IFN) .gamma. levels.

[0060] Also provided by the invention is a polypeptide comprising a functional portion of any of the TCRs (or functional variants thereof) described herein, for examples, of any one of the TCRs selected from R36P3F9, R52P2G11 and R53P2A9, as provided in the example section and table 1. The term "polypeptide" as used herein includes oligopeptides and refers to a single chain of amino acids connected by one or more peptide bonds. With respect to the inventive polypeptides, the functional portion can be any portion comprising contiguous amino acids of the TCR (or functional variant thereof), of which it is a part, provided that the functional portion specifically binds to the TAA antigen derived peptide DCAF4L2-001 (SEQ ID NOs: 49, and variants in SEQ ID NOs: 50 to 58). The term "functional portion" when used in reference to a TCR (or functional variant thereof) refers to any part or fragment of the TCR (or functional variant thereof) of the invention, which part or fragment retains the biological activity of the TCR (or functional variant thereof), of which it is a part (the parent TCR or parent functional variant thereof). Functional portions encompass, for example, those parts of a TCR (or functional variant thereof) that retain the ability to specifically bind to the TAA antigen (in an HLA dependent manner), or detect, treat, or prevent cancer, to a similar extent, the same extent, or to a higher extent, as the parent TCR (or functional variant thereof). In reference to the parent TCR (or functional variant thereof), the functional portion can comprise, for instance, about 10%, 25%, 30%, 50%, 68%, 80%, 90%, 95%, or more, of the parent TCR variable sequences (or functional variant thereof).

[0061] The functional portion can comprise additional amino acids at the amino or carboxy terminus of the portion, or at both termini, in which additional amino acids are not found in the amino acid sequence of the parent TCR or functional variant thereof. Desirably, the additional amino acids do not interfere with the biological function of the functional portion, e.g., specifically binding to the TAA antigens; and/or having the ability to detect cancer, treat or prevent cancer, etc. More desirably, the additional amino acids enhance the biological activity, as compared to the biological activity of the parent TCR or functional variant thereof.

[0062] The polypeptide can comprise a functional portion of either or both of the .alpha. and .beta. chains of the TCRs or functional variant thereof of the invention, such as a functional portion comprising one of more of CDR1, CDR2, and (preferably) CDR3 of the variable region(s) of the .alpha. chain and/or .beta. chain of a TCR or functional variant thereof of the invention. In an embodiment of the invention, the polypeptide can comprise a functional portion comprising the amino acid sequence of SEQ ID NO: 3, 9, 15, 21, 27, and 33 (CDR3 of the variable regions of the TCR of the invention), or a combination thereof. In an embodiment of the invention, the inventive polypeptide can comprise, for instance, the variable region of the inventive TCR or functional variant thereof comprising a combination of the CDR regions set forth above. In this regard, the polypeptide can comprise the amino acid sequence of any of SEQ ID NO: 4, 10, 16, 22, 28, and 34 (the variable regions of an .alpha. or .beta. chain of the TCR of the invention).

[0063] In some instances, the construct of the invention may comprise one or two polypeptide chains comprising a sequence according to any of the SEQ ID NO: 1 to 36 (CDR sequences, constant and variable regions and full length sequences), or functional fragments thereof, and further comprise(s) other amino acid sequences, e.g., an amino acid sequence encoding an immunoglobulin or a portion thereof, then the inventive protein can be a fusion protein. In this regard, the invention also provides a fusion protein comprising at least one of the inventive polypeptides described herein along with at least one other polypeptide. The other polypeptide can exist as a separate polypeptide of the fusion protein, or can exist as a polypeptide, which is expressed in frame (in tandem) with one of the inventive polypeptides described herein. The other polypeptide may include any peptidic or proteinaceous molecule, or a portion thereof, including, but not limited to an immunoglobulin, CD3, CD4, CD8, an MHC molecule, a CD1 molecule, e.g., CD1a, CD1b, CD1c, CD1d, etc.

[0064] The fusion protein can comprise one or more copies of the inventive polypeptide and/or one or more copies of the other polypeptide. For instance, the fusion protein can comprise 1, 2, 3, 4, 5, or more, copies of the inventive polypeptide and/or of the other polypeptide. Suitable methods of making fusion proteins are known in the art, and include, for example, recombinant methods. In some embodiments of the invention, the TCRs (and functional portions and functional variants thereof), polypeptides, and proteins of the invention may be expressed as a single protein comprising a linker peptide linking the .alpha. chain and the .beta. chain, and linking the .gamma. chain and the .delta. chain. In this regard, the TCRs (and functional variants and functional portions thereof), polypeptides, and proteins of the invention comprising the amino acid sequences of the variable regions of the TCR of the invention and may further comprise a linker peptide. The linker peptide may advantageously facilitate the expression of a recombinant TCR (including functional portions and functional variants thereof), polypeptide, and/or protein in a host cell. The linker peptide may comprise any suitable amino acid sequence. Linker sequences for single chain TCR constructs are well known in the art. Such a single chain construct may further comprise one, or two, constant domain sequences. Upon expression of the construct including the linker peptide by a host cell, the linker peptide may also be cleaved, resulting in separated .alpha. and .beta. chains, and separated .gamma. and .delta. chain.

[0065] As already mentioned above, the binding functionality of the TCR of the invention may be provided in the framework of an antibody. For example, CDR sequences of the TCR of the invention, possibly including additional 3, 2 or 1 N and/or C terminal framework residues, may be directly grafted into an antibody variable heavy/light chain sequence. The term "antibody" in its various grammatical forms is used herein to refer to immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, i.e., molecules that contain an antigen-binding site or a paratope. Such molecules are also referred to as "antigen binding fragments" of immunoglobulin molecules. The invention further provides an antibody, or antigen binding portion thereof, which specifically binds to the antigens described herein. The antibody can be any type of immunoglobulin that is known in the art. For instance, the antibody can be of any isotype, e.g., IgA, IgD, IgE, IgG, IgM, etc. The antibody can be monoclonal or polyclonal. The antibody can be a naturally-occurring antibody, e.g., an antibody isolated and/or purified from a mammal, e.g., mouse, rabbit, goat, horse, chicken, hamster, human, etc. Alternatively, the antibody can be a genetically-engineered antibody, e.g., a humanized antibody or a chimeric antibody. The antibody can be in monomeric or polymeric form.

[0066] The term "antibody" includes, but is not limited to, genetically engineered or otherwise modified forms of immunoglobulins, such as intrabodies, chimeric antibodies, fully human antibodies, humanized antibodies (e.g. generated by "CDR-grafting"), antibody fragments, and heteroconjugate antibodies (e.g., bispecific antibodies, diabodies, triabodies, tetra-bodies, etc.). The term "antibody" includes cys-diabodies and minibodies. Thus, each and every embodiment provided herein in regard to "antibodies", or "antibody like constructs" is also envisioned as, bi-specific antibodies, diabodies, scFv fragments, chimeric antibody receptor (CAR) constructs, diabody and/or minibody embodiments, unless explicitly denoted otherwise. The term "antibody" includes a polypeptide of the immunoglobulin family or a polypeptide comprising fragments of an immunoglobulin that is capable of non-covalently, reversibly, and in a specific manner binding a corresponding antigen, preferably the TAA of the invention, as disclosed herein. An exemplary antibody structural unit comprises a tetramer. In some embodiments, a full length antibody can be composed of two identical pairs of polypeptide chains, each pair having one "light" and one "heavy" chain (connected through a disulfide bond). Antibody structure and isotypes are well known to the skilled artisan (for example from Janeway's Immunobiology, 9th edition, 2016).

[0067] The recognized immunoglobulin genes of mammals include the kappa, lambda, alpha, gamma, delta, epsilon, and mu constant region genes, as well as the myriad immunoglobulin variable region genes (for more information on immunoglobulin genes see the international Im-MunoGeneTics information System.RTM., Lefranc M-P et al, Nucleic Acids Res. 2015 January; 43 (Database issue): D413-22; and w ww.imgt.org). For full-length chains, the light chains are classified as either kappa or lambda. For full-length chains, the heavy chains are classified as gamma, mu, alpha, delta, or epsilon, which in turn define the immunoglobulin classes, IgG, IgM, IgA, IgD, and IgE, respectively. The N-terminus of each chain defines a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition. The terms variable light chain (VL) and variable heavy chain (VH) refer to these regions of light and heavy chains respectively. As used in this invention, an "antibody" encompasses all variations of antibody and fragments thereof. Thus, within the scope of this concept are full length antibodies, chimeric antibodies, humanized antibodies, single chain antibodies (scFv), Fab, Fab', and multimeric versions of these fragments (e.g., F(ab')2) with the same, essentially the same or similar binding specificity. In some embodiments, the anti-body binds specifically to a peptide TAA of the invention. Preferred antigen recognizing constructs according to the invention include an antibody heavy chain, preferably the variable domain thereof, or an antigen binding fragment thereof, and/or an antibody light chain, preferably the variable domain thereof, or an antigen binding fragment thereof. Similarly, disulfide-stabilized variable region fragments (dsFv) can be prepared by recombinant DNA technology, antibody fragments of the invention, however, are not limited to these exemplary types of antibody fragments. Also, the antibody, or antigen binding portion thereof, can be modified to comprise a detectable label, such as, for instance, a radioisotope, a fluorophore (e.g., fluorescein isothiocyanate (FITC), phycoerythrin (PE)), an enzyme (e.g., alkaline phosphatase, horseradish peroxidase), and element particles (e.g., gold particles). In some instances, the TCR CDR3 sequence may be slightly modified, but preferably by not more than 3 amino acid residues, preferably only two and most preferably only one amino acid position, as compared to the CDR3 sequences provided in SEQ ID Nos: 3, 9, 15, 21, 27, and 33. Preferably, the antibodies comprise the CDR3, preferably all of CDR1 to CDR3 regions in the combination, as indicated for the TCR of the invention in table 1, in each case independently, optionally with not more than three or two, preferably one, amino acid substitution(s), insertion(s) and/or deletion(s) compared to these sequences.

[0068] Suitable methods of making antibodies are known in the art. For instance, standard hybridoma methods are described in, e.g., Kohler and Milstein, Eur. J. Immunol, 5, 51 1-519 (1976), Harlow and Lane (eds.), Antibodies: A Laboratory Manual, CSH Press (1988), and C. A. Janeway et al. (eds.), Immunobiology, 8 Ed., Garland Publishing, New York, N.Y. (2011)). Alternatively, other methods, such as EBV-hybridoma methods (Haskard and Archer, J. Immunol. Methods, 74(2), 361-67 (1984), and Roder et al, Methods Enzymol, 121, 140-67 (1986)), and bacteriophage vector expression systems (see, e.g., Huse et al., Science, 246, 1275-81 (1989)) are known in the art. Further, methods of producing antibodies in non-human animals are described in, e.g., U.S. Pat. Nos. 5,545,806, 5,569,825, and 5,714,352, and U.S. Patent Application Publication No. 2002/0197266.

[0069] Some embodiments of the invention also pertain to TCRs, or functional fragments and polypeptides thereof, which are soluble TCRs. As used herein, the term "soluble T-cell receptor" refers to heterodimeric truncated variants of native TCRs, which comprise extracellular portions of the TCR .alpha.-chain and .beta.-chain, for example linked by a disulfide bond, but which lack the transmembrane and cytosolic domains of the native protein. The terms "soluble T-cell receptor .alpha.-chain sequence and soluble T-cell receptor .beta.-chain sequence" refer to TCR .alpha.-chain and .beta.-chain sequences that lack the transmembrane and cytosolic domains. The sequence (amino acid or nucleic acid) of the soluble TCR .alpha.-chain and .beta.-chains may be identical to the corresponding sequences in a native TCR or may comprise variant soluble TCR .alpha.-chain and .beta.-chain sequences, as compared to the corresponding native TCR sequences. The term "soluble T-cell receptor" as used herein encompasses soluble TCRs with variant or non-variant soluble TCR .alpha.-chain and .beta.-chain sequences. The variations may be in the variable or constant regions of the soluble TCR .alpha.-chain and .beta.-chain sequences and can include, but are not limited to, amino acid deletion, insertion, substitution mutations as well as changes to the nucleic acid sequence, which do not alter the amino acid sequence. Soluble TCR of the invention in any case retain the binding functionality of their parent molecules.

[0070] The above problem is further solved by a nucleic acid encoding for an antigen recognizing construct of the invention, or any of the aforementioned protein or polypeptide constructs. The nucleic acid preferably (a) has a strand encoding for an antigen recognizing construct according to the invention; (b) has a strand complementary to the strand in (a); or (c) has a strand that hybridizes under stringent conditions with a molecule as described in (a) or (b). Stringent conditions are known to the person of skill in the art, specifically from Sambrook et al, "Molecular Cloning". In addition to that, the nucleic acid optionally has further sequences, which are necessary for expressing the nucleic acid sequence corresponding to the protein, specifically for expression in a mammalian/human cell. The nucleic acid used can be contained in a vector suitable for allowing expression of the nucleic acid sequence corresponding to the peptide in a cell. However, the nucleic acids can also be used to transform an antigen-presenting cell, which may not be restricted to classical antigen-presenting cells, such as dendritic cells, in such a way that they themselves produce the corresponding proteins on their cellular surface.

[0071] In some embodiments, the polypeptides of the antigen recognizing constructs can be encoded by nucleic acids and expressed in vivo or in vitro. Thus, in some embodiments, a nucleic acid encoding an antigen recognizing construct is provided. In some embodiments, the nucleic acid encodes one part or monomer of an antigen recognizing construct of the invention (for example one of two chains of a TCR of the invention), and/or another nucleic acid encodes another part or monomer of an antigen recognizing construct of the invention (for example the other of two chains of the TCR). In some embodiments, the nucleic acid encodes two or more antigen recognizing construct polypeptide chains, for example, at least 2 TCR chains. Nucleic acids encoding multiple antigen recognizing construct chains can include nucleic acid cleavage sites between at least two chain sequences, can encode transcription or translation start site between two or more chains sequences, and/or can encode proteolytic target sites between two or more antigen recognizing construct chains.

[0072] By "nucleic acid" as used herein includes "polynucleotide," "oligonucleotide," and "nucleic acid molecule," and generally means a polymer of DNA or RNA, which can be single-stranded or double-stranded, synthesized or obtained (e.g., isolated and/or purified) from natural sources, which can contain natural, non-natural or altered nucleotides, and can contain a natural, non-natural or altered internucleotide linkage, such as a phosphoroamidate linkage or a phosphorothioate linkage, instead of the phosphodiester found between the nucleotides of an unmodified oligonucleotide.

[0073] Preferably, the nucleic acids of the invention are recombinant. As used herein, the term "recombinant" refers to (i) molecules that are constructed outside living cells by joining natural or synthetic nucleic acid segments to nucleic acid molecules that can replicate in a living cell, or (ii) molecules that result from the replication of those described in (i) above. For purposes herein, the replication can be in vitro replication or in vivo replication. The nucleic acid can comprise any nucleotide sequence, which encodes any of the TCRs, polypeptides, or proteins, or functional portions or functional variants thereof described herein.

[0074] Furthermore, the invention provides a vector comprising a nucleic acid in accordance to the invention as described above. Desirably, the vector is an expression vector or a recombinant expression vector. The term "recombinant expression vector" refers in context of the present invention to a nucleic acid construct that allows for the expression of an mRNA, protein or polypeptide in a suitable host cell. The recombinant expression vector of the invention can be any suitable recombinant expression vector, and can be used to transform or transfect any suitable host. Suitable vectors include those designed for propagation and expansion or for expression or both, such as plasmids and viruses. Examples of animal expression vectors include pEUK-CI, pMAM, and pMAMneo. Preferably, the recombinant expression vector is a viral vector, e.g., a retroviral vector. The recombinant expression vector comprises regulatory sequences, such as transcription and translation initiation and termination codons, which are specific to the type of host cell (e.g., bacterium, fungus, plant, or animal), into which the vector is to be introduced and in which the expression of the nucleic acid of the invention may be performed. Furthermore, the vector of the invention may include one or more marker genes, which allow for selection of transformed or transfected hosts. The recombinant expression vector can comprise a native or normative promoter operably linked to the nucleotide sequence encoding the constructs of the invention, or to the nucleotide sequence, which is complementary to or which hybridizes to the nucleotide sequence encoding the constructs of the invention. The selections of promoters include, e.g., strong, weak, inducible, tissue-specific and developmental-specific promoters. The promoter can be a non-viral promoter or a viral promoter. The inventive recombinant expression vectors can be designed for either transient expression, for stable expression, or for both. Also, the recombinant expression vectors can be made for constitutive expression or for inducible expression.

[0075] The invention also pertains to a host cell comprising an antigen recognizing construct in accordance with the invention. Specifically, the host cell of the invention comprises a nucleic acid, or a vector as described herein above. The host cell can be a eukaryotic cell, e.g., plant, animal, fungi, or algae, or can be a prokaryotic cell, e.g., bacteria or protozoa. The host cell can be a cultured cell or a primary cell, i.e., isolated directly from an organism, e.g., a human. The host cell can be an adherent cell or a suspended cell, i.e., a cell that grows in suspension. For purposes of producing a recombinant TCR, polypeptide, or protein, the host cell is preferably a mammalian cell. Most preferably, the host cell is a human cell. While the host cell can be of any cell type, can originate from any type of tissue, and can be of any developmental stage, the host cell preferably is a peripheral blood leukocyte (PBL) or a peripheral blood mononuclear cell (PBMC). More preferably, the host cell is a T cell. The T cell can be any T cell, such as a cultured T cell, e.g., a primary T cell, or a T cell from a cultured T cell line, e.g., Jurkat, SupT1, etc., or a T cell obtained from a mammal, preferably a T cell or T cell precursor from a human patient. If obtained from a mammal, the T cell can be obtained from numerous sources, including but not limited to blood, bone marrow, lymph node, the thymus, or other tissues or fluids. T cells can also be enriched for or purified. Preferably, the T cell is a human T cell. More preferably, the T cell is a T cell isolated from a human. The T cell can be any type of T cell and can be of any developmental stage, including but not limited to, CD4-positive and/or CD8-positive, CD4-positive helper T cells, e.g., Th1 and Th2 cells, CD8-positive T cells (e.g., cytotoxic T cells), tumor infiltrating cells (TILs), memory T cells, naive T cells, and the like. Preferably, the T cell is a CD8-positive T cell or a CD4-positive T cell.

[0076] Preferably, the host cell of the invention is a lymphocyte, preferably, a T lymphocyte, such as a CD4-positive or CD8-positive T-cell. The host cell furthermore preferably is a tumor reactive T cell specific for TAA expressing tumor cells.

[0077] The object of the invention is also solved by a method of manufacturing a TAA specific antigen recognizing construct, or of a TAA specific antigen recognizing construct expressing cell line, comprising

[0078] a) Providing a suitable host cell,

[0079] b) Providing a genetic construct comprising a coding sequence encoding for an antigen recognizing construct according to the herein disclosed invention,

[0080] c) Introducing into said suitable host cell said genetic construct, and

[0081] d) Expressing said genetic construct by said suitable host cell.

[0082] The method may further comprise a step of cell surface presentation of said antigen recognizing construct on said suitable host cell.

[0083] In other preferred embodiments, the genetic construct is an expression construct comprising a promoter sequence operably linked to said coding sequence.

[0084] Preferably, said antigen recognizing construct is of mammalian origin, preferably of human origin. The preferred suitable host cell for use in the method of the invention is a mammalian cell, such as a human cell, in particular a human T lymphocyte. T cells for use in the invention are described in detail herein above.

[0085] Also encompassed by the invention are embodiments, wherein said antigen recognizing construct is a modified TCR, wherein said modification is the addition of functional domains, such as a label or a therapeutically active substance. Furthermore, encompassed are TCR having alternative domains, such as an alternative membrane anchor domain instead of the endogenous transmembrane region.

[0086] Desirably, the transfection system for introducing the genetic construct into said suitable host cell is a retroviral vector system. Such systems are well known to the skilled artisan.

[0087] Also comprised by the present invention is in one embodiment the additional method step of isolation and purification of the antigen recognizing construct from the cell and, optionally, the reconstitution of the translated antigen recognizing construct-fragments in a T-cell.

[0088] In an alternative aspect of the invention a T-cell is provided obtained or obtainable by a method for the production of a T cell receptor (TCR), which is specific for tumorous cells and has high avidity as described herein above. Such a T cell is depending on the host cell used in the method of the invention, for example, a human or non-human T-cell, preferably a human TCR.

[0089] The term "isolated" as used herein in the context of a polypeptide, such as an antigen recognizing construct (an example of which could be an antibody), refers to a polypeptide that is purified from proteins or polypeptides or other contaminants that would interfere with its therapeutic, diagnostic, prophylactic, research or other use. An antigen recognizing construct according to the invention may be a recombinant, synthetic or modified (non-natural) antigen binding construct. The term "isolated" as used herein in the context of a nucleic acid or cells refers to a nucleic acid or cells that is/are purified from DNA, RNA, proteins or polypeptides or other contaminants (such as other cells) that would interfere with its therapeutic, diagnostic, prophylactic, research or other use, or it refers to a recombinant, synthetic or modified (non-natural) nucleic acid. In this context, a "recombinant" protein/polypeptide or nucleic acid is one made using recombinant techniques. Methods and techniques for the production of recombinant nucleic acids and proteins are well known in the art.

[0090] One further aspect of the present invention relates to the herein disclosed antigen recognizing constructs, nucleic acids, vectors, pharmaceutical compositions and/or host cell for use in medicine. The use in medicine in one preferred embodiment includes the use in the diagnosis, prevention and/or treatment of a tumor disease, such as a malignant or benign tumor disease. The tumor disease is, for example, a tumor disease characterized by the expression of the TAA, in a cancer or tumor cell of said tumor disease.

[0091] With respect to the above mentioned medical applications of the antigen recognizing constructs and other materials derived therefrom, pertaining thereto or encoding the same, in accordance of the present disclosure, the to be treated and/or to be diagnosed diseases can be any proliferative disorder, preferably characterized by the expression of the TAA or TAA epitope sequence of the invention, for example any cancer, including any of acute lymphocytic cancer, acute myeloid leukemia, alveolar rhabdomyosarcoma, bone cancer, brain cancer, breast cancer, cancer of the anus, anal canal, or anorectum, cancer of the eye, cancer of the intrahepatic bile duct, cancer of the joints, cancer of the neck, gallbladder, or pleura, cancer of the nose, nasal cavity, or middle ear, cancer of the oral cavity, cancer of the vagina, cancer of the vulva, chronic lymphocytic leukemia, chronic myeloid cancer, colon cancer, esophageal cancer, cervical cancer, gastrointestinal carcinoid tumor, glioma, Hodgkin lymphoma, hypopharynx cancer, kidney cancer, larynx cancer, liver cancer, lung cancer, malignant mesothelioma, melanoma, multiple myeloma, nasopharynx cancer, non-Hodgkin lymphoma, cancer of the oropharynx, ovarian cancer, cancer of the penis, pancreatic cancer, peritoneum, omentum, and mesentery cancer, pharynx cancer, prostate cancer, rectal cancer, renal cancer, skin cancer, small intestine cancer, soft tissue cancer, stomach cancer, testicular cancer, thyroid cancer, cancer of the uterus, ureter cancer, and urinary bladder cancer. A preferred cancer is cancer is cancer of the uterine cervix, oropharynx, anus, anal canal, anorectum, vagina, vulva, or penis. A particularly preferred cancer is a TAA positive (i.e. DCAF4L2-001-peptide presenting) cancer, including preferably gastrointestinal and gastric cancer.

[0092] The constructs, proteins, TCRs antibodies, polypeptides and nucleic acids of the invention are in particular for use in immune therapy, preferably, in adoptive T cell therapy. The administration of the compounds of the invention can, for example, involve the infusion of T cells of the invention into said patient. Preferably, such T cells are autologous T cells of the patient and in vitro transduced with a nucleic acid or antigen recognizing construct of the present invention.

[0093] The inventive antigen recognizing constructs, TCRs, polypeptides, proteins (including functional variants thereof), nucleic acids, recombinant expression vectors, host cells (including populations thereof), and antibodies (including antigen binding portions thereof), all of which are collectively referred to as "inventive TCR materials" hereinafter, can be formulated into a composition, such as a pharmaceutical composition. In this regard, the invention provides a pharmaceutical composition comprising any of the antigen recognizing constructs, TCRs, polypeptides, proteins, functional portions, functional variants, nucleic acids, expression vectors, host cells (including populations thereof), and antibodies (including antigen binding portions thereof) described herein, and a pharmaceutically acceptable carrier, excipient and/or stabilizer. The inventive pharmaceutical compositions containing any of the inventive TCR materials can comprise more than one inventive TCR material, e.g., a polypeptide and a nucleic acid, or two or more different TCRs (including functional portions and functional variants thereof). Alternatively, the pharmaceutical composition can comprise an inventive TCR material in combination with another pharmaceutically active agent(s) or drug(s), such as chemotherapeutic agents, e.g., asparaginase, busulfan, carboplatin, cisplatin, daunorubicin, doxorubicin, fluorouracil, gemcitabine, hydroxyurea, methotrexate, paclitaxel, rituximab, vinblastine, vincristine, etc. Preferably, the carrier is a pharmaceutically acceptable carrier. With respect to pharmaceutical compositions, the carrier can be any of those conventionally used for the particular inventive TCR material under consideration. Such pharmaceutically acceptable carriers are well-known to those skilled in the art and are readily available to the public. It is preferred that the pharmaceutically acceptable carrier be one, which has no detrimental side effects or toxicity under the conditions of use.

[0094] Thus also provided is a pharmaceutical composition, comprising any of the herein described products of the invention and TCR materials of the invention, specifically any proteins, nucleic acids or host cells. In a preferred embodiment the pharmaceutical composition is for immune therapy, preferably adoptive cell therapy.

[0095] Preferably, the inventive TCR material is administered by injection, e.g., intravenously. When the inventive TCR material is a host cell expressing the inventive TCR (or functional variant thereof), the pharmaceutically acceptable carrier for the cells for injection may include any isotonic carrier such as, for example, normal saline (about 0.90% w/v of NaCl in water, about 300 mOsm/L NaCl in water, or about 9.0 g NaCl per liter of water), NORMOSOL R electrolyte solution (Abbott, Chicago, Ill.), PLASMA-LYTE A (Baxter, Deerfield, Ill.), about 5% dextrose in water, or Ringer's lactate. In an embodiment, the pharmaceutically acceptable carrier is supplemented with human serum albumen.

[0096] For purposes of the invention, the amount or dose (e.g., numbers of cells when the inventive TCR material is one or more cells) of the inventive TCR material administered may be sufficient to affect, e.g., a therapeutic or prophylactic response, in the subject or animal over a reasonable time frame. For example, the dose of the inventive TCR material should be sufficient to bind to a cancer antigen, or detect, treat or prevent cancer in a period of from about 2 hours or longer, e.g., 12 to 24 or more hours, from the time of administration. In certain embodiments, the time period could be even longer. The dose will be determined by the efficacy of the particular inventive TCR material and the condition of the animal (e.g., human), as well as the body weight of the animal (e.g., human) to be treated.

[0097] It is contemplated that the inventive pharmaceutical compositions, antigen recognizing constructs, TCRs (including functional variants thereof), polypeptides, proteins, nucleic acids, recombinant expression vectors, host cells, or populations of cells can be used in methods of treating or preventing cancer, or TAA-positive premalignancy. The inventive TCRs (and functional variants thereof) are believed to bind specifically to the TAA of the invention, such that the TCR (or related inventive polypeptide or protein and functional variants thereof), when expressed by or on a cell, such as a T cell, is able to mediate an immune response against a target cell expressing the TAA of the invention, preferably presenting TAA peptides via MHC I or II on the surface of said target cell. In this regard, the invention provides a method of treating or preventing a condition, in particular cancer, in a mammal, comprising administering to the mammal any of the pharmaceutical compositions, antigen recognizing constructs, in particular TCRs (and functional variants thereof), polypeptides, or proteins described herein, any nucleic acid or recombinant expression vector comprising a nucleotide sequence encoding any of the TCRs (and functional variants thereof), polypeptides, proteins described herein, or any host cell or population of cells comprising a nucleic acid or recombinant vector, which encodes any of the constructs of the invention (and functional variants thereof), polypeptides, or proteins described herein, in an amount effective to treat or prevent the condition in the mammal, wherein the condition is preferably cancer, such as a cancer expressing the TAA of the invention.

[0098] Examples of pharmaceutically acceptable carriers or diluents useful in the present invention include stabilizers such as SPGA, carbohydrates (e.g. sorbitol, mannitol, starch, sucrose, glucose, dextran), proteins such as albumin or casein, protein containing agents such as bovine serum or skimmed milk and buffers (e.g. phosphate buffer).

[0099] The terms "treat," and "prevent" as well as words stemming therefrom, as used herein, do not necessarily imply 100% or complete treatment or prevention. Rather, there are varying degrees of treatment or prevention of which one of ordinary skill in the art recognizes as having a potential benefit or therapeutic effect. In this respect, the inventive methods can provide any amount of any level of treatment or prevention of a condition in a mammal. Furthermore, the treatment or prevention provided by the inventive method can include treatment or prevention of one or more conditions or symptoms of the condition, e.g., cancer, being treated or prevented. For example, treatment or prevention can include promoting the regression of a tumor. Also, for purposes herein, "prevention" can encompass delaying the onset of the condition, or a symptom or condition thereof.

[0100] The present invention also relates to a method of treating cancer comprising administering a TCR, a nucleic acid, or a host cell of the present description in combination with at least one chemotherapeutic agent and/or radiation therapy.

[0101] Another aspect of the invention further pertains to a method for detecting a TAA protein, or a complex of MHC and the TAA protein (protein epitope of the TAA), in a (biological) sample--such as one obtained from a subject or patient--comprising contacting the sample with an antigen recognizing construct specifically binding to said TAA peptide, or to the TAA peptide/MHC complex, and detecting the binding between said antigen recognizing construct and said TAA peptide, or to the TAA peptide/MHC complex. In some embodiments, the antigen recognizing construct is a TCR or antibody, or similar constructs, or preferably the antigen recognizing construct according to the herein described invention. In some embodiments, the (biological) sample is a sample of a tumour or a cancer (such as one of those described elsewhere herein) for example a sample comprising tumour or cancer cells.

[0102] Also provided is a method of treating cancer in a subject in need thereof, comprising:

[0103] a) isolating a cell from said subject;

[0104] b) transforming the cell with at least one vector encoding an antigen recognizing construct of the present invention to produce a transformed cell;

[0105] c) expanding the transformed cell to produce a plurality of transformed cells; and

[0106] d) administering the plurality of transformed cells to said subject.

[0107] Also provided is a method of treating cancer in a subject in need thereof, comprising:

[0108] a) isolating a cell from a healthy donor;

[0109] b) transforming the cell with a vector encoding an antigen recognizing construct of the present invention to produce a transformed cell;

[0110] c) expanding the transformed cell to produce a plurality of transformed cells; and

[0111] d) administering the plurality of transformed cells to said subject.

[0112] Also provided is a method of treating cancer in a subject in need thereof, wherein the TCR of any of the description, the nucleic acid of the description, the expression vector of the description, the host cell of the description or the pharmaceutical composition of the description is administered in at least two administrations separated by at least 24 hours.

[0113] Also provided is a method of treating cancer in a subject in need thereof, wherein the TCR of any of the description, the nucleic acid of the description, the expression vector of the description, the host cell of the description or the pharmaceutical composition of the description is administered to the subject over a period of days, weeks or months.

[0114] Also provided is a method of treating cancer in a subject in need thereof, wherein the TCR of any of the description, the nucleic acid of the description, the expression vector of the description, the host cell of the description or the pharmaceutical composition of the description is administered by local infusion. Preferably, the local infusion is administered by an infusion pump and/or a catheter system. More preferably, said local infusion is into a solid tumor, a blood vessel that feeds a solid tumor, and/or the area surrounding a solid tumor.

[0115] Also provided is a method of treating cancer in a subject in need thereof, wherein the TCR of the description, the nucleic acid of the description, the expression vector of the description, the host cell of the description or the pharmaceutical composition of the description is administered in a dose of about 10.sup.4 to about 10.sup.10 cells per dose.

[0116] Also provided is a method of detecting cancer in a biological sample comprising:

[0117] a) contacting the biological sample with an antigen recognizing construct (e.g. TCT) of the present description;

[0118] b) detecting binding of the antigen recognizing construct (e.g. TCR) to the biological sample.

[0119] In some embodiments, the method of detecting cancer is carried out in vitro, in vivo or in situ.

[0120] Also provided is a method of detecting the presence of a condition in a mammal. The method comprises (i) contacting a sample comprising one or more cells from the mammal with any of the inventive TCRs (and functional variants thereof), polypeptides, proteins, nucleic acids, recombinant expression vectors, host cells, populations of cells, antibodies, or antigen binding portions thereof, or pharmaceutical compositions described herein, thereby forming a complex, and detecting the complex, wherein detection of the complex is indicative of the presence of the condition in the mammal, wherein the condition is cancer, such as a TAA expressing malignancy.

[0121] With respect to the inventive method of detecting a condition in a mammal, the sample of cells can be a sample comprising whole cells, lysates thereof, or a fraction of the whole cell lysates, e.g., a nuclear or cytoplasmic fraction, a whole protein fraction, or a nucleic acid fraction.

[0122] For purposes of the inventive detecting method, the contacting can take place in vitro or in vivo with respect to the mammal. Preferably, the contacting is in vitro.

[0123] Also, detection of the complex can occur through any number of ways known in the art. For instance, the inventive antigen recognizing constructs (and functional variants thereof), polypeptides, proteins, nucleic acids, recombinant expression vectors, host cells, populations of cells, or antibodies or TCRs, or antigen binding portions thereof, described herein, can be labeled with a detectable label such as, for instance, a radioisotope, a fluorophore (e.g., fluorescein isothiocyanate (FITC), phycoerythrin (PE)), an enzyme (e.g., alkaline phosphatase, horseradish peroxidase), and element particles (e.g., gold particles).

[0124] For purposes of the inventive methods, wherein host cells or populations of cells are administered, the cells can be cells that are allogeneic or autologous to the mammal. Preferably, the cells are autologous to the mammal.

[0125] With respect to the above mentioned medical applications of the TCR material of the invention, the to be treated and/or diagnosed cancer can be any cancer, including any of acute lymphocytic cancer, acute myeloid leukemia, alveolar rhabdomyosarcoma, bone cancer, brain cancer, breast cancer, cancer of the anus, anal canal, or anorectum, cancer of the eye, cancer of the intrahepatic bile duct, cancer of the joints, cancer of the neck, gallbladder, or pleura, cancer of the nose, nasal cavity, or middle ear, cancer of the oral cavity, cancer of the vagina, cancer of the vulva, chronic lymphocytic leukemia, chronic myeloid cancer, colon cancer, esophageal cancer, cervical cancer, gastrointestinal carcinoid tumor, glioma, Hodgkin lymphoma, hypopharynx cancer, kidney cancer, larynx cancer, liver cancer, lung cancer, malignant mesothelioma, melanoma, multiple myeloma, nasopharynx cancer, non-Hodgkin lymphoma, cancer of the oropharynx, ovarian cancer, cancer of the penis, pancreatic cancer, peritoneum, omentum, and mesentery cancer, pharynx cancer, prostate cancer, rectal cancer, renal cancer, skin cancer, small intestine cancer, soft tissue cancer, stomach cancer, testicular cancer, thyroid cancer, cancer of the uterus, ureter cancer, and urinary bladder cancer. A preferred cancer is cancer is cancer of the uterine cervix, oropharynx, anus, anal canal, anorectum, vagina, vulva, or penis. A particularly preferred cancer is a TAA positive cancer, such as colon cancer, rectal cancer, gastrointestinal or gastric cancer.

[0126] In general, the invention provides a method for treating a subject suffering from a tumor or tumor disease comprising the administration of the antigen recognizing constructs, nucleic acids, vectors, pharmaceutical compositions and/or host cell as disclosed by the present invention. Preferably the subject is a subject in need of such a treatment. The subject in preferred embodiments is a mammalian subject, preferably a human patient, suffering from a tumor or tumor disease, which is TAA-positive.

[0127] In view of the disclosure herein it will be appreciated that the invention furthermore pertains to the following items:

[0128] Item 1: An antigen recognizing construct comprising at least one complementary determining region (CDR) 3 having at least 50% sequence identity to an amino acid sequence selected from SEQ ID NOs. 3, 9, 15, 21, 27 and 33.

[0129] Item 2: The antigen recognizing construct according to item 1, wherein said antigen recognizing construct is capable of specifically and/or selectively binding to a TAA of the invention antigenic peptide.

[0130] Item 3: The antigen recognizing construct according to item 1 or 2, wherein the antigen recognizing construct is an antibody, or derivative or fragment thereof, or a T cell receptor (TCR), or a derivative or fragment thereof.

[0131] Item 4: The antigen recognizing construct according to any one of items 1 to 3, wherein said antigen recognizing construct binds to a human leucocyte antigen (HLA) presented TAA antigenic peptide, wherein said HLA is optionally type A2.

[0132] Item 5: The antigen recognizing construct according to any one of items 1 to 4, wherein the construct specifically and/or selectively binds to an epitope comprising or consisting of the amino acid sequence selected from SEQ ID NOs: 49, and 50 to 57.

[0133] Item 6: The antigen recognizing construct according to any one of items 1 to 5, wherein the construct is an .alpha./.beta.-TCR, or fragment or derivative thereof, or the construct is a .gamma./.delta.-TCR, or a fragment or derivative thereof.

[0134] Item 7: The antigen recognizing construct according to any one of items 1 to 6, characterized in that the construct is of human origin and specifically and/or selectively recognizes a TAA antigenic peptide.

[0135] Item 8: The antigen recognizing construct according to any one of items 1 to 7, wherein said antigen recognizing construct is capable of inducing an immune response in a subject, optionally wherein the immune response is characterized by an increase in interferon (IFN) .gamma. levels.

[0136] Item 9: The antigen recognizing construct according to any one of items 1 to 8, comprising a TCR .alpha. or .gamma. chain; and/or a TCR .beta. or .delta. chain; wherein the TCR .alpha. or .gamma. chain comprises a CDR3 having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID Nos. 3, 15, and 27, and/or wherein the TCR .beta. or .delta. chain comprises a CDR3 having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID Nos. 9, 21, and 33.

[0137] Item 10: The antigen recognizing construct according to item 9, wherein the TCR .alpha. or .gamma. chain further comprises a CDR1 having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID Nos. 1, 13, and 25; and/or a CDR2 having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID Nos. 2, 14, and 26.

[0138] Item 11: The antigen recognizing construct according to item 9 or 10, wherein the TCR .beta. or .delta. chain further comprises a CDR1 having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID Nos. 7, 19, and 31; and/or a CDR2 having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID Nos. 8, 20, and 32.

[0139] Item 12: The antigen recognizing construct according to any of items 1 to 11, comprising a TCR variable chain region having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID Nos. 4, 10, 16, 22, 28, and 34.

[0140] Item 13: The antigen recognizing construct according to any of items 1 to 12, wherein the construct is humanized, chimerized and/or murinized.

[0141] Item 14: The antigen recognizing construct according to any of items 1 to 13, comprising a binding fragment of a TCR, and wherein said binding fragment comprises CDR1 to CDR3 optionally selected from the CDR1 to CDR3 sequences having the amino acid sequences of SEQ ID Nos. 1, 2, 3, or 7, 8, 9 or 13, 14, 15, or 19, 20, 21, or 25, 26, 27 or 31, 32, 33.

[0142] Item 15: The antigen recognizing construct according to any of items 1 to 14, wherein the construct is a TCR, or a fragment thereof, composed of at least one TCR .alpha. and one TCR .beta. chain sequence, wherein said TCR .alpha. chain sequence comprises the CDR1 to CDR3 sequences having the amino acid sequences of SEQ ID NO: 1 to 3, and said TCR .beta. chain sequence comprises the CDR1 to CDR3 sequences having the amino acid sequences of SEQ ID NO: 7 to 9; or wherein said TCR .alpha. chain sequence comprises the CDR1 to CDR3 sequences having the amino acid sequences of SEQ ID NO: 13 to 15, and said TCR .beta. chain sequence comprises the CDR1 to CDR3 sequences having the amino acid sequences of SEQ ID NO: 19 to 21; or wherein said TCR .alpha. chain sequence comprises the CDR1 to CDR3 sequences having the amino acid sequences of SEQ ID NO: 25 to 27, and said TCR .beta. chain sequence comprises the CDR1 to CDR3 sequences having the amino acid sequences of SEQ ID NO: 31 to 33.

[0143] Item 16: The antigen recognizing construct according to any of items 1 to 15, wherein the construct is a TCR, or a fragment thereof, comprising at least one TCR .alpha. and one TCR .beta. chain sequence, wherein said TCR .alpha. chain sequence comprises a variable region sequence having the amino acid sequence of SEQ ID No. 4, and wherein said TCR .beta. chain sequence comprises a variable region sequence having the amino acid sequence of SEQ ID No. 10; or wherein said TCR .alpha. chain sequence comprises a variable region sequence having the amino acid sequence of SEQ ID No. 16, and wherein said TCR .beta. chain sequence comprises a variable region sequence having the amino acid sequence of SEQ ID No. 22; or wherein said TCR .alpha. chain sequence comprises a variable region sequence having the amino acid sequence of SEQ ID No. 28, and wherein said TCR .beta. chain sequence comprises a variable region sequence having the amino acid sequence of SEQ ID No. 34.

[0144] Item 17: The antigen recognizing construct according to any of items 1 to 16, wherein the construct is a TCR, or a fragment thereof, further comprising a TCR constant region having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID Nos. 5, 11, 17, 23, 29 and 35, preferably wherein the TCR is composed of at least one TCR .alpha. and one TCR .beta. chain sequence, wherein the TCR .alpha. chain sequence comprises a constant region having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID Nos. 5, 17, and 29.

[0145] Item 18: The antigen recognizing construct according to any of items 1 to 17, comprising a first TCR chain having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID No. 6, and a second TCR chain having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID No. 12.

[0146] Item 19: The antigen recognizing construct according to any of items 1 to 17, comprising a first TCR chain having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID No. 18, and a second TCR chain having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID No. 24.

[0147] Item 20: The antigen recognizing construct according to any of items 1 to 17, comprising a first TCR chain having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID No. 30, and a second TCR chain having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID No. 36.

[0148] Item 21: A nucleic acid encoding for an antigen recognizing construct according to any one of items 1 to 20.

[0149] Item 22: A vector comprising a nucleic acid according to item 21.

[0150] Item 23: A host cell comprising an antigen recognizing construct according to any one of items 1 to 20, or a nucleic acid according to item 21, or a vector according to item 22.

[0151] Item 24: The host cell according to item 23, wherein the cell is a lymphocyte, preferably a T lymphocyte or T lymphocyte progenitor, more preferably a CD4 or CD8 positive T-cell.

[0152] Item 25: A pharmaceutical composition comprising the antigen recognizing construct according to any of items 1 to 20, or the nucleic acid according to item 21, or the vector according to item 22, or the host cell according to item 23 or 24, and a pharmaceutical acceptable carrier, stabilizer and/or excipient.

[0153] Item 26: The antigen recognizing construct according to any one of items 1 to 20, or a nucleic acid according to item 21, or a vector according to item 22, or a host cell according to item 23 or 24, or the pharmaceutical composition according to item 25, for use in medicine.

[0154] Item 27: The antigen recognizing construct, or the nucleic acid, or the vector, or the host cell, or the pharmaceutical composition, for use according to item 26, for use in the diagnosis, prevention, and/or treatment of a proliferative disease, wherein the disease comprises a malignant or benign tumor disease.

[0155] Item 28: The antigen recognizing construct, or the nucleic acid, or the vector, or the host cell, or the pharmaceutical composition, for use according to item 27, wherein the tumor disease is characterized by the expression of TAA in a tumor cell of the tumor disease.

[0156] Item 29: The antigen recognizing construct, or the nucleic acid, or the vector, or the host cell, or the pharmaceutical composition, for use according to any one of items 26 to 28, wherein the use in medicine is a use in immune therapy optionally comprising an adoptive cell transfer, wherein the immune therapy comprises adoptive autologous or heterologous T-cell therapy.

[0157] Item 30: A method of manufacturing a TAA specific antigen recognizing construct expressing cell line, comprising

[0158] a. providing a suitable host cell,

[0159] b. providing a genetic construct comprising a coding sequence encoding the antigen recognizing construct according to any of items 1 to 20,

[0160] c. introducing into said suitable host cell said genetic construct,

[0161] d. expressing said genetic construct by said suitable host cell.

[0162] Item 31: The method according to item 30, further comprising cell surface presentation of said antigen recognizing construct.

[0163] Item 32: The method according to item 30 or 31, wherein the genetic construct is an expression construct comprising a promoter sequence operably linked to said coding sequence.

[0164] Item 33: The method according to any one of items 30 to 32, wherein said antigen recognizing construct is of mammalian origin, preferably of human origin.

[0165] Item 34: The method according to any one of items 30 to 33, wherein said suitable host cell is a mammalian cell, optionally selected from a human cell or a human T lymphocyte.

[0166] Item 35: The method according to any of items 30 to 34, wherein said antigen recognizing construct is a modified TCR, wherein said modification comprises addition of a functional domain comprising a label, or an alternative domain comprising a membrane anchor domain.

[0167] Item 36: The method according to item 35, wherein said antigen recognizing construct is an alpha/beta TCR, gamma/delta TCR, or a single chain TCR (scTCR).

[0168] Item 37: The method according to any of items 30 to 36, wherein said genetic construct is introduced into said suitable host cell by retroviral transfection.

[0169] Item 38: The method according to any of items 30 to 37, further comprising the isolation and purification of the antigen recognizing construct from the suitable host cell and, optionally, reconstitution of the antigen recognizing construct in a T-cell.

[0170] Item 39: A method of treating cancer comprising administering to a subject in need thereof the TCR, the nucleic acid or the expression vector, the host cell, and/or the pharmaceutical composition of any of the above items.

[0171] Item 40: The method of item 39, wherein the TCR is expressed on the surface of a host cell.

[0172] Item 41: The method of item 40, wherein the host cell is selected from the group consisting of a T cell or T cell progenitor.

[0173] Item 42: The method of item 41, wherein the T cell or T cell progenitor is autologous.

[0174] Item 43: The method of item 42, wherein the T cell or T cell progenitor is allogeneic.

[0175] Item 44: The method of item 43, wherein the TCR is conjugated to a therapeutically active agent.

[0176] Item 45: The method of item 44, wherein the therapeutically active agent is selected from the group consisting of a radionuclide, a chemotherapeutic agent and a toxin.

[0177] Item 46: The method of any of items 39 to 45, wherein the cancer is non-small cell lung cancer, small cell lung cancer, renal cell cancer, brain cancer, gastric cancer, colorectal cancer, hepatocellular cancer, head and neck cancer, pancreatic cancer, prostate cancer, leukemia, breast cancer, Merkel cell carcinoma, melanoma, ovarian cancer, urinary bladder cancer, uterine cancer, gallbladder and bile duct cancer, esophageal cancer, or a combination thereof.

[0178] Item 47: The method of any of items 39 to 46, further comprising administering to the subject at least one chemotherapeutic agent.

[0179] Item 48: The method of any of items 46 to 47, further comprising administering radiation therapy to the subject.

[0180] Item 49: A method of treating cancer in a subject in need thereof, comprising:

[0181] a) isolating a cell from said subject;

[0182] b) transforming the cell with a vector encoding the TCR of any of the items above to produce a transformed cell;

[0183] c) expanding the transformed cell to produce a plurality of transformed cells; and

[0184] d) administering the plurality of transformed cells to said subject.

[0185] Item 50: The method of Item 49, wherein the cell is selected from a T cell or a T cell progenitor.

[0186] Item 51: A method of treating cancer in a subject in need thereof, comprising:

[0187] a) isolating a cell from a healthy donor;

[0188] b) transforming the cell with a vector encoding the TCR of any of the items above to produce a transformed cell;

[0189] c) expanding the transformed cell to produce a plurality of transformed cells; and

[0190] d) administering the plurality of transformed cells to said subject.

[0191] Item 52: The method of Item 51, wherein the cell is selected from a T cell or a T cell progenitor.

[0192] The present invention will now be further described in the following examples with reference to the accompanying figures and sequences, nevertheless, without being limited thereto. For the purposes of the present invention, all references as cited herein are incorporated by reference in their entireties. In the Figures and Sequences:

[0193] FIG. 1: IFN.gamma. release from CD8+ T-cells electroporated with alpha and beta chain RNA of TCR R36P3F9 (Table 1) after co-incubation with T2 target cells loaded with the DCAF4L2-001 peptide (SEQ ID NO:49) or various DCAF4L2-001 alanine-substitution variants at positions 1-9 of SEQ ID NO:1 (SEQ ID NOs: 50-58) or control peptide NYESO1-001 (SEQ ID NO: 69). IFN.gamma. release data were obtained with CD8+ T-cells derived from two different healthy donors. RNA electroporated CD8+ T-cells alone or in co-incubation with unloaded target cells served as controls.

[0194] FIG. 2: IFN.gamma. release from CD8+ T-cells electroporated with alpha and beta chain RNA of TCR R52P2G11 (Table 1) after co-incubation with T2 target cells loaded with DCAF4L2-001 peptide (SEQ ID NO: 49) or various DCAF4L2-001 alanine-substitution variants at positions 1-9 of SEQ ID NO:1 (SEQ ID NOs: 50 to 58) or control peptide NYESO1-001 (SEQ ID NO: 69). IFN.gamma. release data were obtained with CD8+ T-cells derived from two different healthy donors. RNA electroporated CD8+ T-cells alone or in co-incubation with unloaded target cells served as controls.

[0195] FIG. 3: IFN.gamma. release from CD8+ T-cells electroporated with alpha and beta chain RNA of TCR R53P2A9 (Table 1) after co-incubation with T2 target cells loaded with DCAF4L2-001 peptide (SEQ ID NO: 49) or various DCAF4L2-001 alanine-substitution variants at positions 1-9 of SEQ ID NO:1 (SEQ ID NOs: 50 to 58) or control peptide NYESO1-001 (SEQ ID NO: 69). IFN.gamma. release data were obtained with CD8+ T-cells derived from two different healthy donors. RNA electroporated CD8+ T-cells alone or in co-incubation with unloaded target cells served as controls.

[0196] FIG. 4: IFN.gamma. release from CD8+ T-cells electroporated with alpha and beta chain RNA of TCRs R36P3F9 after co-incubation with T2 target cells loaded with DCAF4L2-001 peptide (SEQ ID NO:49) or homologous but unrelated peptide GRB14-002 (SEQ ID NO:59), SNR-004 (SEQ ID NO:60), WRN-002 (SEQ ID NO:61), MUC-009 (SEQ ID NO:62), GSTA4-001 (SEQ ID NO:63), PFN1-001 (SEQ ID NO:64), VPS39-001 (SEQ ID NO:65), AHR-002 (SEQ ID NO:66), KCM-001 (SEQ ID NO:67) or VPS51-001 (SEQ ID NO:68) or control peptide NYESO1-001 (SEQ ID NO:69). IFN.gamma. release data were obtained with CD8+ T-cells derived from two different healthy donors. RNA electroporated CD8+ T-cells alone or in co-incubation with unloaded target cells served as controls.

[0197] FIG. 5: IFN.gamma. release from CD8+ T-cells electroporated with alpha and beta chain RNA of TCRs R52P2G11 after co-incubation with T2 target cells loaded with DCAF4L2-001 peptide (SEQ ID NO:49) or homologous but unrelated peptide GRB14-002 (SEQ ID NO:59), SNR-004 (SEQ ID NO:60), WRN-002 (SEQ ID NO:61), MUC-009 (SEQ ID NO:62), GSTA4-001 (SEQ ID NO:63), PFN1-001 (SEQ ID NO:64), VPS39-001 (SEQ ID NO:65), AHR-002 (SEQ ID NO:66), KCM-001 (SEQ ID NO:67) or VPS51-001 (SEQ ID NO:68) or control peptide NYESO1-001 (SEQ ID NO:69). IFN.gamma. release data were obtained with CD8+ T-cells derived from two different healthy donors. RNA electroporated CD8+ T-cells alone or in co-incubation with unloaded target cells served as controls.

[0198] FIG. 6: IFN.gamma. release from CD8+ T-cells electroporated with alpha and beta chain RNA of TCRs R53P2A9 after co-incubation with T2 target cells loaded with DCAF4L2-001 peptide (SEQ ID NO:49) or homologous but unrelated peptide GRB14-002 (SEQ ID NO:59), SNR-004 (SEQ ID NO:60), WRN-002 (SEQ ID NO:61), MUC-009 (SEQ ID NO:62), GSTA4-001 (SEQ ID NO:63), PFN1-001 (SEQ ID NO:64), VPS39-001 (SEQ ID NO:65), AHR-002 (SEQ ID NO:66), KCM-001 (SEQ ID NO:67) or VPS51-001 (SEQ ID NO:68) or control peptide NYESO1-001 (SEQ ID NO:69). IFN.gamma. release data were obtained with CD8+ T-cells derived from two different healthy donors. RNA electroporated CD8+ T-cells alone or in co-incubation with unloaded target cells served as controls.

[0199] FIG. 7: HLA-A*02/DCAF4L2-001 tetramer or HLA-A*02/NYESO1-001 tetramer staining, respectively, of CD8+ T-cells electroporated with alpha and beta chain RNA of TCRs R52P2G11 and R53P2A9, respectively. CD8+ T-cells electroporated with RNA of 1G4 TCR that specifically binds to HLA-A*02/NYESO1-001 complex and mock electroporated CD8+ T-cells served as controls.

[0200] FIG. 8: IFN.gamma. release from CD8+ T-cells electroporated with alpha and beta chain RNA of TCR R52P2G11 (Table 1) after co-incubation with T2 target cells loaded with DCAF4L2-001 peptide (SEQ ID NO:49) in various peptide loading concentrations from 10 .mu.M to 10 pM. IFN.gamma. release data were obtained with CD8+ T-cells derived from two different healthy donors. RNA electroporated CD8+ T-cells alone or in co-incubation with unloaded target cells served as controls. Donor 1(TCRA-0006) is shown on the left Y-axis, donor 2 (TCRA-0007) on the right Y-axis, respectively.

[0201] FIG. 9: IFN.gamma. release from CD8+ T-cells electroporated with alpha and beta chain RNA of TCR R53P2A9 (Table 1) after co-incubation with T2 target cells loaded with DCAF4L2-001 peptide (SEQ ID NO:49) in various peptide loading concentrations from 10 .mu.M to 10 pM. IFN.gamma. release data were obtained with CD8+ T-cells derived from two different healthy donors. RNA electroporated CD8+ T-cells alone or in co-incubation with unloaded target cells served as controls. Donor 1(TCRA-0006) is shown on the left Y-axis, donor 2 (TCRA-0007) on the right Y-axis, respectively.

[0202] FIG. 10: IFN.gamma. release from CD8+ T-cells electroporated with alpha and beta chain RNA of TCR R36P3F9 (Table 1) after co-incubation with T2 target cells loaded with DCAF4L2-001 peptide (SEQ ID NO:49) in various peptide loading concentrations from 10 .mu.M to 10 pM. RNA electroporated CD8+ T-cells alone or in co-incubation with unloaded target cells served as controls.

[0203] FIG. 11: IFN.gamma. release from CD8+ T-cells electroporated with alpha and beta chain RNA of TCR R52P2G11 (Table 1) after co-incubation with T2 target cells loaded with DCAF4L2-001 peptide (SEQ ID NO: 49) or various DCAF4L2-001 threonine-substitution variants at positions 1-9 of SEQ ID NO:1 (SEQ ID NOs: 70 to 78) or control peptide NYESO1-001 (SEQ ID NO: 69). IFN.gamma. release data were obtained with CD8+ T-cells derived from two different healthy donors. RNA electroporated CD8+ T-cells alone or in co-incubation with unloaded target cells served as controls.

[0204] FIG. 12: IFN.gamma. release from CD8+ T-cells electroporated with alpha and beta chain RNA of TCR R53P2A9 (Table 1) after co-incubation with T2 target cells loaded with DCAF4L2-001 peptide (SEQ ID NO: 49) or various DCAF4L2-001 threonine-substitution variants at positions 1-9 of SEQ ID NO:1 (SEQ ID NOs: 70 to 78) or control peptide NYESO1-001 (SEQ ID NO: 69). IFN.gamma. release data were obtained with CD8+ T-cells derived from two different healthy donors. RNA electroporated CD8+ T-cells alone or in co-incubation with unloaded target cells served as controls.

[0205] FIG. 13: Effect on tumor growth (A, B, C, D) and IFN.gamma. release (E, F) of T-cells after lentiviral transduction with different constructs containing alpha and beta chain of TCR R52P2G11 or R53P2A9 to assess TCR-mediated recognition of endogenously processed and presented DCAF4L2-001 in DCAF4L2-expressing A375 cells (B, D, F). Target-negative A375 cells served as control (A, C, E). Data shown from 2 Donors; 141540 (A, B, E, F) and 105 (C, D, E, F).

TABLE-US-00001 TABLE 1 TCR sequences of the invention SEQ ID TCR NO: name Chain Region Sequence 1 R36P3F9 alpha CDR1 TSINN 2 R36P3F9 alpha CDR2 IRS 3 R36P3F9 alpha CDR3 CATVSNYQLIW 4 R36P3F9 alpha variable METLLGVSLVILWLQLARVNSQQGEED domain PQALSIQEGENATMNCSYKTSINNLQW YRQNSGRGLVHLILIRSNEREKHSGRLR VTLDTSKKSSSLLITASRAADTASYFCAT VSNYQLIWGAGTKLIIKP 5 R36P3F9 alpha constant DIQNPDPAVYQLRDSKSSDKSVCLFTDF domain DSQTNVSQSKDSDVYITDKTVLDMRSM DFKSNSAVAWSNKSDFACANAFNNSIIP EDTFFPSPESSCDVKLVEKSFETDTNLN FQNLSVIGFRILLLKVAGFNLLMTLRLWS S 6 R36P3F9 alpha full-length METLLGVSLVILWLQLARVNSQQGEED PQALSIQEGENATMNCSYKTSINNLQW YRQNSGRGLVHLILIRSNEREKHSGRLR VTLDTSKKSSSLLITASRAADTASYFCAT VSNYQLIWGAGTKLIIKPDIQNPDPAVYQ LRDSKSSDKSVCLFTDFDSQTNVSQSK DSDVYITDKTVLDMRSMDFKSNSAVAW SNKSDFACANAFNNSIIPEDTFFPSPES SCDVKLVEKSFETDTNLNFQNLSVIGFRI LLLKVAGFNLLMTLRLWSS 7 R36P3F9 beta CDR1 MNHEY 8 R36P3F9 beta CDR2 SMNVEV 9 R36P3F9 beta CDR3 CASSSTSGGLSGETQYF 10 R36P3F9 beta variable MGPQLLGYVVLCLLGAGPLEAQVTQNP domain RYLITVTGKKLTVTCSQNMNHEYMSWY RQDPGLGLRQIYYSMNVEVTDKGDVPE GYKVSRKEKRNFPLILESPSPNQTSLYF CASSSTSGGLSGETQYFGPGTRLLVL 11 R36P3F9 beta constant EDLKNVFPPEVAVFEPSEAEISHTQKAT domain LVCLATGFYPDHVELSWWVNGKEVHS GVSTDPQPLKEQPALNDSRYCLSSRLR VSATFWQNPRNHFRCQVQFYGLSEND EWTQDRAKPVTQIVSAEAWGRADCGF TSESYQQGVLSATILYEILLGKATLYAVL VSALVLMAMVKRKDSRG 12 R36P3F9 beta full-length MGPQLLGYVVLCLLGAGPLEAQVTQNPRYLIT VTGKKLTVTCSQNMNHEYMSWY RQDPGLGLRQIYYSMNVEVTDKGDVPE GYKVSRKEKRNFPLILESPSPNQTSLYF CASSSTSGGLSGETQYFGPGTRLLVLE DLKNVFPPEVAVFEPSEAEISHTQKATL VCLATGFYPDHVELSWWVNGKEVHSG VSTDPQPLKEQPALNDSRYCLSSRLRV SATFWQNPRNHFRCQVQFYGLSENDE WTQDRAKPVTQIVSAEAWGRADCGFT SESYQQGVLSATILYEILLGKATLYAVLV SALVLMAMVKRKDSRG 13 R52P2G11 alpha CDR1 VSPFSN 14 R52P2G11 alpha CDR2 MTF 15 R52P2G11 alpha CDR3 CVVSAYGKLQF 16 R52P2G11 alpha variable MKKHLTTFLVILWLYFYRGNGKNQVEQ domain SPQSLIILEGKNCTLQCNYTVSPFSNLR WYKQDTGRGPVSLTIMTFSENTKSNGR YTATLDADTKQSSLHITASQLSDSASYIC VVSAYGKLQFGAGTQVVVTP 17 R52P2G11 alpha constant DIQNPDPAVYQLRDSKSSDKSVCLFTDF domain DSQTNVSQSKDSDVYITDKTVLDMRSM DFKSNSAVAWSNKSDFACANAFNNSIIP EDTFFPSPESSCDVKLVEKSFETDTNLN FQNLSVIGFRILLLKVAGFNLLMTLRLWS S 18 R52P2G11 alpha full-length MKKHLTTFLVILWLYFYRGNGKNQVEQ SPQSLIILEGKNCTLQCNYTVSPFSNLR WYKQDTGRGPVSLTIMTFSENTKSNGR YTATLDADTKQSSLHITASQLSDSASYIC VVSAYGKLQFGAGTQVVVTPDIQNPDP AVYQLRDSKSSDKSVCLFTDFDSQTNV SQSKDSDVYITDKTVLDMRSMDFKSNS AVAWSNKSDFACANAFNNSIIPEDTFFP SPESSCDVKLVEKSFETDTNLNFQNLSV IGFRILLLKVAGFNLLMTLRLWSS 19 R52P2G11 beta CDR1 SGHNS 20 R52P2G11 beta CDR2 FNNNVP 21 R52P2G11 beta CDR3 CASSLGSPDGNQPQHF 22 R52P2G11 beta variable MDSWTFCCVSLCILVAKHTDAGVIQSPR domain HEVTEMGQEVTLRCKPISGHNSLFWYR QTMMRGLELLIYFNNNVPIDDSGMPED RFSAKMPNASFSTLKIQPSEPRDSAVYF CASSLGSPDGNQPQHFGDGTRLSIL 23 R52P2G11 beta constant EDLNKVFPPEVAVFEPSEAEISHTQKAT domain LVCLATGFFPDHVELSWWVNGKEVHS GVSTDPQPLKEQPALNDSRYCLSSRLR VSATFWQNPRNHFRCQVQFYGLSEND EWTQDRAKPVTQIVSAEAWGRADCGF TSVSYQQGVLSATILYEILLGKATLYAVL VSALVLMAMVKRKDF 24 R52P2G11 beta full-length MDSWTFCCVSLCILVAKHTDAGVIQSPR HEVTEMGQEVTLRCKPISGHNSLFWYR QTMMRGLELLIYFNNNVPIDDSGMPED RFSAKMPNASFSTLKIQPSEPRDSAVYF CASSLGSPDGNQPQHFGDGTRLSILED LNKVFPPEVAVFEPSEAEISHTQKATLV CLATGFFPDHVELSWWVNGKEVHSGV STDPQPLKEQPALNDSRYCLSSRLRVS ATFWQNPRNHFRCQVQFYGLSENDEW TQDRAKPVTQIVSAEAWGRADCGFTSV SYQQGVLSATILYEILLGKATLYAVLVSA LVLMAMVKRKDF 25 R53P2A9 alpha CDR1 TSESDYY 26 R53P2A9 alpha CDR2 QEAY 27 R53P2A9 alpha CDR3 CAYNSYAGGTSYGKLTF 28 R53P2A9 alpha variable MACPGFLWALVISTCLEFSMAQTVTQS domain QPEMSVQEAETVTLSCTYDTSESDYYL FWYKQPPSRQMILVIRQEAYKQQNATE NRFSVNFQKAAKSFSLKISDSQLGDAA MYFCAYNSYAGGTSYGKLTFGQGTILT VHP 29 R53P2A9 alpha constant NIQNPDPAVYQLRDSKSSDKSVCLFTDF domain DSQTNVSQSKDSDVYITDKTVLDMRSM DFKSNSAVAWSNKSDFACANAFNNSIIP EDTFFPSPESSCDVKLVEKSFETDTNLN FQNLSVIGFRILLLKVAGFNLLMTLRLWS S 30 R53P2A9 alpha full-length MACPGFLWALVISTCLEFSMAQTVTQS QPEMSVQEAETVTLSCTYDTSESDYYL FWYKQPPSRQMILVIRQEAYKQQNATE NRFSVNFQKAAKSFSLKISDSQLGDAA MYFCAYNSYAGGTSYGKLTFGQGTILT VHPNIQNPDPAVYQLRDSKSSDKSVCL FTDFDSQTNVSQSKDSDVYITDKTVLD MRSMDFKSNSAVAWSNKSDFACANAF NNSIIPEDTFFPSPESSCDVKLVEKSFET DTNLNFQNLSVIGFRILLLKVAGFNLLMT LRLWSS 31 R53P2A9 beta CDR1 SGHKS 32 R53P2A9 beta CDR2 YYEKEE 33 R53P2A9 beta CDR3 CASSLDGTSEQYF 34 R53P2A9 beta variable MGPGLLCWVLLCLLGAGPVDAGVTQSP domain THLIKTRGQQVTLRCSPISGHKSVSWY QQVLGQGPQFIFQYYEKEERGRGNFPD RFSARQFPNYSSELNVNALLLGDSALYL CASSLDGTSEQYFGPGTRLTVT 35 R53P2A9 beta constant EDLKNVFPPEVAVFEPSEAEISHTQKAT domain LVCLATGFYPDHVELSWWVNGKEVHS GVSTDPQPLKEQPALNDSRYCLSSRLR VSATFWQNPRNHFRCQVQFYGLSEND EWTQDRAKPVTQIVSAEAWGRADCGF TSESYQQGVLSATILYEILLGKATLYAVL VSALVLMAMVKRKDSRG 36 R53P2A9 beta full-length MGPGLLCWVLLCLLGAGPVDAGVTQSP THLIKTRGQQVTLRCSPISGHKSVSWY QQVLGQGPQFIFQYYEKEERGRGNFPD RFSARQFPNYSSELNVNALLLGDSALYL CASSLDGTSEQYFGPGTRLTVTEDLKN VFPPEVAVFEPSEAEISHTQKATLVCLA TGFYPDHVELSWWVNGKEVHSGVSTD PQPLKEQPALNDSRYCLSSRLRVSATF WQNPRNHFRCQVQFYGLSENDEWTQ DRAKPVTQIVSAEAWGRADCGFTSESY QQGVLSATILYEILLGKATLYAVLVSALV LMAMVKRKDSRG 37 1G4 alpha CDR1 DSAIYN 38 1G4 alpha CDR2 IQS 39 1G4 alpha CDR3 CAVRPTSGGSYIPTF 40 1G4 alpha variable METLLGLLILWLQLQWVSSKQEVTQIPA domain ALSVPEGENLVLNCSFTDSAIYNLQWFR QDPGKGLTSLLLIQSSQREQTSGRLNA SLDKSSGRSTLYIAASQPGDSATYLCAV RPTSGGSYIPTFGRGTSLIVHP 41 1G4 alpha constant YIQNPDPAVYQLRDSKSSDKSVCLFTDF domain DSQTNVSQSKDSDVYITDKTVLDMRSM DFKSNSAVAWSNKSDFACANAFNNSIIP EDTFFPSPESSCDVKLVEKSFETDTNLN FQNLSVIGFRILLLKVAGFNLLMTLRLWS S 42 1G4 alpha full-length METLLGLLILWLQLQWVSSKQEVTQIPA ALSVPEGENLVLNCSFTDSAIYNLQWFR QDPGKGLTSLLLIQSSQREQTSGRLNA SLDKSSGRSTLYIAASQPGDSATYLCAV RPTSGGSYIPTFGRGTSLIVHPYIQNPD PAVYQLRDSKSSDKSVCLFTDFDSQTN VSQSKDSDVYITDKTVLDMRSMDFKSN SAVAWSNKSDFACANAFNNSIIPEDTFF PSPESSCDVKLVEKSFETDTNLNFQNLS VIGFRILLLKVAGFNLLMTLRLWSS 43 1G4 beta CDR1 MNHEY 44 1G4 beta CDR2 SVGAGI 45 1G4 beta CDR3 CASSYVGNTGELFF 46 1G4 beta variable MSIGLLCCAALSLLWAGPVNAGVTQTP domain KFQVLKTGQSMTLQCAQDMNHEYMSW YRQDPGMGLRLIHYSVGAGITDQGEVP NGYNVSRSTTEDFPLRLLSAAPSQTSV YFCASSYVGNTGELFFGEGSRLTVL 47 1G4 beta constant EDLKNVFPPEVAVFEPSEAEISHTQKAT domain LVCLATGFYPDHVELSWWVNGKEVHS GVSTDPQPLKEQPALNDSRYCLSSRLR VSATFWQNPRNHFRCQVQFYGLSEND EWTQDRAKPVTQIVSAEAWGRADCGF TSESYQQGVLSATILYEILLGKATLYAVL VSALVLMAMVKRKDSRG 48 1G4 beta full-length MSIGLLCCAALSLLWAGPVNAGVTQTP KFQVLKTGQSMTLQCAQDMNHEYMSW

YRQDPGMGLRLIHYSVGAGITDQGEVP NGYNVSRSTTEDFPLRLLSAAPSQTSV YFCASSYVGNTGELFFGEGSRLTVLED LKNVFPPEVAVFEPSEAEISHTQKATLV CLATGFYPDHVELSWWVNGKEVHSGV STDPQPLKEQPALNDSRYCLSSRLRVS ATFWQNPRNHFRCQVQFYGLSENDEW TQDRAKPVTQIVSAEAWGRADCGFTSE SYQQGVLSATILYEILLGKATLYAVLVSA LVLMAMVKRKDSRG

TABLE-US-00002 TABLE 2 Peptide sequences of the invention and related sequences SEQ ID Peptide Code Sequence NO: DCAF4L2-001 ILQDGQFLV 49 DCAF4L2-001_A1 ALQDGQFLV 50 DCAF4L2-001_A2 IAQDGQFLV 51 DCAF4L2-001_A3 ILADGQFLV 52 DCAF4L2-001_A4 ILQAGQFLV 53 DCAF4L2-001_A5 ILQDAQFLV 54 DCAF4L2-001_A6 ILQDGAFLV 55 DCAF4L2-001_A7 ILQDGQALV 56 DCAF4L2-001_A8 ILQDGQFAV 57 DCAF4L2-001_A9 ILQDGQFLA 58 GRB14-002 GLVDGVFLV 59 SNR-004 ILQDGRIFI 60 WRN-002 ILQDLQPFL 61 MUC-009 ILQEGTFKA 62 GSTA4-001 KLQDGNHLL 63 PFN1-001 LLQDGEFSM 64 VPS39-001 LLQDKQFEL 65 AHR-002 NLQEGEFLL 66 KCM-001 TLQNSQFLL 67 VPS51-001 TLTDEQFLV 68 NYESO1-001 SLLMWITQV 69 DCAF4L2-001_T1 TLQDGQFLV 70 DCAF4L2-001_T2 ITQDGQFLV 71 DCAF4L2-001_T3 ILTDGQFLV 72 DCAF4L2-001_T4 ILQTGQFLV 73 DCAF4L2-001_T5 ILQDTQFLV 74 DCAF4L2-001_T6 ILQDGTFLV 75 DCAF4L2-001_T7 ILQDGQTLV 76 DCAF4L2-001_T8 ILQDGQFTV 77 DCAF4L2-001_T9 ILQDGQFLT 78

EXAMPLES

[0206] Background

[0207] Three DCAF4L2-001-specific TCRs (R36P3F9, R52P2G11 and R53P2A9, see Table 1), each encoding tumor specific TCR-alpha and TCR-beta chains, were isolated and amplified from T-cells of healthy donors. Cells from healthy donors were in vitro stimulated according to a method previously described (Walter et al., 2003 J Immunol., November 15; 171(10):4974-8) and target-specific cells were single-cell sorted using HLA-A*02 multimers and then used for subsequent TCR isolation. TCR sequences were isolated via 5' RACE by standard methods as described by e.g. Molecular Cloning a laboratory manual fourth edition by Green and Sambrook. The alpha and beta variable regions of TCRs R36P3F9, R52P2G11 and R53P2A9 were sequenced and expression constructs were generated by gene synthesis for further functional characterization. R36P3F9 is derived from HLA-A*02 positive donor and R52P2G11 and R53P2A9 are derived from a HLA-A*02 negative donor (allo-reactive setting).

[0208] TCRs of interest were expressed in human T cells by transduction e.g. through mRNA electroporation or lentiviral transduction. For lentiviral transduction, PBMC were thawed and rested overnight, and then activated using immobilized antibodies. Activated cells were transduced using a lentiviral vector encoding the DCAF4L2-specific TCR and expanded in the presence of cytokines. T cells were harvested and concentrated by centrifugation, then cryopreserved.

[0209] The T cells were assessed for IFN-.gamma. release after co-culture with different target cells, such as T2 cells loaded with different peptides. Efficacy of CD8+ T cells expressing TCRs R52P2G11 and R53P2A9 was determined by e.g. T cell activation studies (IFN.gamma. release) or killing assays using DCAF4L2-transduced A375 tumor cell line as target cells compared to non-modified A375 cells.

Example 1: T-Cell Receptor R36P3F9

[0210] TCR R36P3F9 (SEQ ID NO:1-12) is restricted towards HLA-A*02-presented DCAF4L2-001 (see FIG. 4).

[0211] R36P3F9 specifically recognizes DCAF4L2-001 as human primary CD8+ T-cells re-expressing this TCR release IFN.gamma. upon co-incubation with HLA-A*02+ target cells loaded either with DCAF4L2-001 peptide or alanine substitution variants of DCAF4L2-001 (FIG. 1). TCR R36P3F9 does specifically recognize DCAF4L2-001, but not different peptides showing high degree of sequence similarity to DCAF4L2-001 (FIG. 4). NYESO1-001 peptide is used as negative control.

[0212] Target peptide titration analysis for R36P3F9 (FIG. 10) showed an EC50 in the range of 3.6 nM.

Example 2: T-Cell Receptor R52P2G11

[0213] TCR R52P2G11 (SEQ ID NO: 13-24) is restricted towards HLA-A*02-presented DCAF4L2-001 (see FIG. 5).

[0214] R52P2G11 specifically recognizes DCAF4L2-001 as human primary CD8+ T-cells re-expressing this TCR release IFN.gamma. upon co-incubation with HLA-A*02+ target cells loaded either with DCAF4L2-001 peptide or alanine and threonine substitution variants of DCAF4L2-001 (FIGS. 2 and 11). TCR R52P2G11 does specifically recognize DCAF4L2-001, but not different peptides showing high degree of sequence similarity to DCAF4L2-001 (FIG. 5). NYESO1-001 peptide is used as negative control.

[0215] Re-expression of R52P2G11 leads to selective binding of HLA-A*02/DCAF4L2-001 tetramers but not HLA-A*02/NYESO1-001 tetramers in human primary CD8+ T-cells (FIG. 7). Re-expression of the NYESO1-001-specific TCR 1G4 and mock expression are used as control.

[0216] Target peptide titration analysis for R52P2G11 (FIG. 8) showed an EC50 in the range of .about.8.5 nM.

[0217] Re-expression of R52P2G11 in human primary CD8+ T-cells leads to selective recognition of DCAF4L2-transduced A375 tumor cell line, but not non-modified A375 cells (FIG. 13). Non-transduced T cells are used as control. T-cell activation upon co-culture with cell lines expressing HLA-A*02 and DCAF4L2-001 reflects the recognition of endogenously presented target pHLA by TCRs R52P2G11 (FIG. 13).

Example 3: T-Cell Receptor R53P2A9

[0218] TCR R53P2A9 (SEQ ID NO: 25-36) is restricted towards HLA-A*02-presented DCAF4L2-001 (see FIG. 6 above).

[0219] R53P2A9 specifically recognizes DCAF4L2-001 as human primary CD8+ T-cells re-expressing this TCR release IFN.gamma. upon co-incubation with HLA-A*02+ target cells loaded either with DCAF4L2-001 peptide or alanine and threonine substitution variants of DCAF4L2-001 (FIGS. 3 and 12). TCR R53P2A9 does specifically recognize DCAF4L2-001, but not different peptides showing high degree of sequence similarity to DCAF4L2-001 (FIG. 6). NYESO1-001 peptide is used as negative control.

[0220] Re-expression of R53P2A9 leads to selective binding of HLA-A*02/DCAF4L2-001 tetramers but not HLA-A*02/NYESO1-001 tetramers in human primary CD8+ T-cells (FIG. 7). Re-expression of the NYESO1-001-specific TCR 1G4 and mock expression are used as control.

[0221] Target peptide titration analysis for R53P2A9 (FIG. 9) showed an EC50 in the range of .about.11.8 nM.

[0222] Re-expression of R53P2A9 in human primary CD8+ T-cells led to selective recognition of DCAF4L2-transduced A375 tumor cell line, but not non-modified A375 cells (FIG. 13). Non-transduced cells are used as control. T-cell activation upon co-culture with cell lines expressing HLA-A*02 and DCAF4L2-001 reflects the recognition of endogenously processed target pH LA by TCRs R53P2A9 (FIG. 13).

Sequence CWU 1

1

7815PRTHomo sapiens 1Thr Ser Ile Asn Asn1 523PRTHomo sapiens 2Ile Arg Ser1311PRTHomo sapiens 3Cys Ala Thr Val Ser Asn Tyr Gln Leu Ile Trp1 5 104129PRTHomo sapiens 4Met Glu Thr Leu Leu Gly Val Ser Leu Val Ile Leu Trp Leu Gln Leu1 5 10 15Ala Arg Val Asn Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser 20 25 30Ile Gln Glu Gly Glu Asn Ala Thr Met Asn Cys Ser Tyr Lys Thr Ser 35 40 45Ile Asn Asn Leu Gln Trp Tyr Arg Gln Asn Ser Gly Arg Gly Leu Val 50 55 60His Leu Ile Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg65 70 75 80Leu Arg Val Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Leu Ile 85 90 95Thr Ala Ser Arg Ala Ala Asp Thr Ala Ser Tyr Phe Cys Ala Thr Val 100 105 110Ser Asn Tyr Gln Leu Ile Trp Gly Ala Gly Thr Lys Leu Ile Ile Lys 115 120 125Pro5141PRTHomo sapiens 5Asp Ile Gln Asn Pro Asp Pro Ala Val Tyr Gln Leu Arg Asp Ser Lys1 5 10 15Ser Ser Asp Lys Ser Val Cys Leu Phe Thr Asp Phe Asp Ser Gln Thr 20 25 30Asn Val Ser Gln Ser Lys Asp Ser Asp Val Tyr Ile Thr Asp Lys Thr 35 40 45Val Leu Asp Met Arg Ser Met Asp Phe Lys Ser Asn Ser Ala Val Ala 50 55 60Trp Ser Asn Lys Ser Asp Phe Ala Cys Ala Asn Ala Phe Asn Asn Ser65 70 75 80Ile Ile Pro Glu Asp Thr Phe Phe Pro Ser Pro Glu Ser Ser Cys Asp 85 90 95Val Lys Leu Val Glu Lys Ser Phe Glu Thr Asp Thr Asn Leu Asn Phe 100 105 110Gln Asn Leu Ser Val Ile Gly Phe Arg Ile Leu Leu Leu Lys Val Ala 115 120 125Gly Phe Asn Leu Leu Met Thr Leu Arg Leu Trp Ser Ser 130 135 1406270PRTHomo sapiens 6Met Glu Thr Leu Leu Gly Val Ser Leu Val Ile Leu Trp Leu Gln Leu1 5 10 15Ala Arg Val Asn Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser 20 25 30Ile Gln Glu Gly Glu Asn Ala Thr Met Asn Cys Ser Tyr Lys Thr Ser 35 40 45Ile Asn Asn Leu Gln Trp Tyr Arg Gln Asn Ser Gly Arg Gly Leu Val 50 55 60His Leu Ile Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg65 70 75 80Leu Arg Val Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Leu Ile 85 90 95Thr Ala Ser Arg Ala Ala Asp Thr Ala Ser Tyr Phe Cys Ala Thr Val 100 105 110Ser Asn Tyr Gln Leu Ile Trp Gly Ala Gly Thr Lys Leu Ile Ile Lys 115 120 125Pro Asp Ile Gln Asn Pro Asp Pro Ala Val Tyr Gln Leu Arg Asp Ser 130 135 140Lys Ser Ser Asp Lys Ser Val Cys Leu Phe Thr Asp Phe Asp Ser Gln145 150 155 160Thr Asn Val Ser Gln Ser Lys Asp Ser Asp Val Tyr Ile Thr Asp Lys 165 170 175Thr Val Leu Asp Met Arg Ser Met Asp Phe Lys Ser Asn Ser Ala Val 180 185 190Ala Trp Ser Asn Lys Ser Asp Phe Ala Cys Ala Asn Ala Phe Asn Asn 195 200 205Ser Ile Ile Pro Glu Asp Thr Phe Phe Pro Ser Pro Glu Ser Ser Cys 210 215 220Asp Val Lys Leu Val Glu Lys Ser Phe Glu Thr Asp Thr Asn Leu Asn225 230 235 240Phe Gln Asn Leu Ser Val Ile Gly Phe Arg Ile Leu Leu Leu Lys Val 245 250 255Ala Gly Phe Asn Leu Leu Met Thr Leu Arg Leu Trp Ser Ser 260 265 27075PRTHomo sapiens 7Met Asn His Glu Tyr1 586PRTHomo sapiens 8Ser Met Asn Val Glu Val1 5917PRTHomo sapiens 9Cys Ala Ser Ser Ser Thr Ser Gly Gly Leu Ser Gly Glu Thr Gln Tyr1 5 10 15Phe10135PRTHomo sapiens 10Met Gly Pro Gln Leu Leu Gly Tyr Val Val Leu Cys Leu Leu Gly Ala1 5 10 15Gly Pro Leu Glu Ala Gln Val Thr Gln Asn Pro Arg Tyr Leu Ile Thr 20 25 30Val Thr Gly Lys Lys Leu Thr Val Thr Cys Ser Gln Asn Met Asn His 35 40 45Glu Tyr Met Ser Trp Tyr Arg Gln Asp Pro Gly Leu Gly Leu Arg Gln 50 55 60Ile Tyr Tyr Ser Met Asn Val Glu Val Thr Asp Lys Gly Asp Val Pro65 70 75 80Glu Gly Tyr Lys Val Ser Arg Lys Glu Lys Arg Asn Phe Pro Leu Ile 85 90 95Leu Glu Ser Pro Ser Pro Asn Gln Thr Ser Leu Tyr Phe Cys Ala Ser 100 105 110Ser Ser Thr Ser Gly Gly Leu Ser Gly Glu Thr Gln Tyr Phe Gly Pro 115 120 125Gly Thr Arg Leu Leu Val Leu 130 13511179PRTHomo sapiens 11Glu Asp Leu Lys Asn Val Phe Pro Pro Glu Val Ala Val Phe Glu Pro1 5 10 15Ser Glu Ala Glu Ile Ser His Thr Gln Lys Ala Thr Leu Val Cys Leu 20 25 30Ala Thr Gly Phe Tyr Pro Asp His Val Glu Leu Ser Trp Trp Val Asn 35 40 45Gly Lys Glu Val His Ser Gly Val Ser Thr Asp Pro Gln Pro Leu Lys 50 55 60Glu Gln Pro Ala Leu Asn Asp Ser Arg Tyr Cys Leu Ser Ser Arg Leu65 70 75 80Arg Val Ser Ala Thr Phe Trp Gln Asn Pro Arg Asn His Phe Arg Cys 85 90 95Gln Val Gln Phe Tyr Gly Leu Ser Glu Asn Asp Glu Trp Thr Gln Asp 100 105 110Arg Ala Lys Pro Val Thr Gln Ile Val Ser Ala Glu Ala Trp Gly Arg 115 120 125Ala Asp Cys Gly Phe Thr Ser Glu Ser Tyr Gln Gln Gly Val Leu Ser 130 135 140Ala Thr Ile Leu Tyr Glu Ile Leu Leu Gly Lys Ala Thr Leu Tyr Ala145 150 155 160Val Leu Val Ser Ala Leu Val Leu Met Ala Met Val Lys Arg Lys Asp 165 170 175Ser Arg Gly12314PRTHomo sapiens 12Met Gly Pro Gln Leu Leu Gly Tyr Val Val Leu Cys Leu Leu Gly Ala1 5 10 15Gly Pro Leu Glu Ala Gln Val Thr Gln Asn Pro Arg Tyr Leu Ile Thr 20 25 30Val Thr Gly Lys Lys Leu Thr Val Thr Cys Ser Gln Asn Met Asn His 35 40 45Glu Tyr Met Ser Trp Tyr Arg Gln Asp Pro Gly Leu Gly Leu Arg Gln 50 55 60Ile Tyr Tyr Ser Met Asn Val Glu Val Thr Asp Lys Gly Asp Val Pro65 70 75 80Glu Gly Tyr Lys Val Ser Arg Lys Glu Lys Arg Asn Phe Pro Leu Ile 85 90 95Leu Glu Ser Pro Ser Pro Asn Gln Thr Ser Leu Tyr Phe Cys Ala Ser 100 105 110Ser Ser Thr Ser Gly Gly Leu Ser Gly Glu Thr Gln Tyr Phe Gly Pro 115 120 125Gly Thr Arg Leu Leu Val Leu Glu Asp Leu Lys Asn Val Phe Pro Pro 130 135 140Glu Val Ala Val Phe Glu Pro Ser Glu Ala Glu Ile Ser His Thr Gln145 150 155 160Lys Ala Thr Leu Val Cys Leu Ala Thr Gly Phe Tyr Pro Asp His Val 165 170 175Glu Leu Ser Trp Trp Val Asn Gly Lys Glu Val His Ser Gly Val Ser 180 185 190Thr Asp Pro Gln Pro Leu Lys Glu Gln Pro Ala Leu Asn Asp Ser Arg 195 200 205Tyr Cys Leu Ser Ser Arg Leu Arg Val Ser Ala Thr Phe Trp Gln Asn 210 215 220Pro Arg Asn His Phe Arg Cys Gln Val Gln Phe Tyr Gly Leu Ser Glu225 230 235 240Asn Asp Glu Trp Thr Gln Asp Arg Ala Lys Pro Val Thr Gln Ile Val 245 250 255Ser Ala Glu Ala Trp Gly Arg Ala Asp Cys Gly Phe Thr Ser Glu Ser 260 265 270Tyr Gln Gln Gly Val Leu Ser Ala Thr Ile Leu Tyr Glu Ile Leu Leu 275 280 285Gly Lys Ala Thr Leu Tyr Ala Val Leu Val Ser Ala Leu Val Leu Met 290 295 300Ala Met Val Lys Arg Lys Asp Ser Arg Gly305 310136PRTHomo sapiens 13Val Ser Pro Phe Ser Asn1 5143PRTHomo sapiens 14Met Thr Phe11511PRTHomo sapiens 15Cys Val Val Ser Ala Tyr Gly Lys Leu Gln Phe1 5 1016131PRTHomo sapiens 16Met Lys Lys His Leu Thr Thr Phe Leu Val Ile Leu Trp Leu Tyr Phe1 5 10 15Tyr Arg Gly Asn Gly Lys Asn Gln Val Glu Gln Ser Pro Gln Ser Leu 20 25 30Ile Ile Leu Glu Gly Lys Asn Cys Thr Leu Gln Cys Asn Tyr Thr Val 35 40 45Ser Pro Phe Ser Asn Leu Arg Trp Tyr Lys Gln Asp Thr Gly Arg Gly 50 55 60Pro Val Ser Leu Thr Ile Met Thr Phe Ser Glu Asn Thr Lys Ser Asn65 70 75 80Gly Arg Tyr Thr Ala Thr Leu Asp Ala Asp Thr Lys Gln Ser Ser Leu 85 90 95His Ile Thr Ala Ser Gln Leu Ser Asp Ser Ala Ser Tyr Ile Cys Val 100 105 110Val Ser Ala Tyr Gly Lys Leu Gln Phe Gly Ala Gly Thr Gln Val Val 115 120 125Val Thr Pro 13017141PRTHomo sapiens 17Asp Ile Gln Asn Pro Asp Pro Ala Val Tyr Gln Leu Arg Asp Ser Lys1 5 10 15Ser Ser Asp Lys Ser Val Cys Leu Phe Thr Asp Phe Asp Ser Gln Thr 20 25 30Asn Val Ser Gln Ser Lys Asp Ser Asp Val Tyr Ile Thr Asp Lys Thr 35 40 45Val Leu Asp Met Arg Ser Met Asp Phe Lys Ser Asn Ser Ala Val Ala 50 55 60Trp Ser Asn Lys Ser Asp Phe Ala Cys Ala Asn Ala Phe Asn Asn Ser65 70 75 80Ile Ile Pro Glu Asp Thr Phe Phe Pro Ser Pro Glu Ser Ser Cys Asp 85 90 95Val Lys Leu Val Glu Lys Ser Phe Glu Thr Asp Thr Asn Leu Asn Phe 100 105 110Gln Asn Leu Ser Val Ile Gly Phe Arg Ile Leu Leu Leu Lys Val Ala 115 120 125Gly Phe Asn Leu Leu Met Thr Leu Arg Leu Trp Ser Ser 130 135 14018272PRTHomo sapiens 18Met Lys Lys His Leu Thr Thr Phe Leu Val Ile Leu Trp Leu Tyr Phe1 5 10 15Tyr Arg Gly Asn Gly Lys Asn Gln Val Glu Gln Ser Pro Gln Ser Leu 20 25 30Ile Ile Leu Glu Gly Lys Asn Cys Thr Leu Gln Cys Asn Tyr Thr Val 35 40 45Ser Pro Phe Ser Asn Leu Arg Trp Tyr Lys Gln Asp Thr Gly Arg Gly 50 55 60Pro Val Ser Leu Thr Ile Met Thr Phe Ser Glu Asn Thr Lys Ser Asn65 70 75 80Gly Arg Tyr Thr Ala Thr Leu Asp Ala Asp Thr Lys Gln Ser Ser Leu 85 90 95His Ile Thr Ala Ser Gln Leu Ser Asp Ser Ala Ser Tyr Ile Cys Val 100 105 110Val Ser Ala Tyr Gly Lys Leu Gln Phe Gly Ala Gly Thr Gln Val Val 115 120 125Val Thr Pro Asp Ile Gln Asn Pro Asp Pro Ala Val Tyr Gln Leu Arg 130 135 140Asp Ser Lys Ser Ser Asp Lys Ser Val Cys Leu Phe Thr Asp Phe Asp145 150 155 160Ser Gln Thr Asn Val Ser Gln Ser Lys Asp Ser Asp Val Tyr Ile Thr 165 170 175Asp Lys Thr Val Leu Asp Met Arg Ser Met Asp Phe Lys Ser Asn Ser 180 185 190Ala Val Ala Trp Ser Asn Lys Ser Asp Phe Ala Cys Ala Asn Ala Phe 195 200 205Asn Asn Ser Ile Ile Pro Glu Asp Thr Phe Phe Pro Ser Pro Glu Ser 210 215 220Ser Cys Asp Val Lys Leu Val Glu Lys Ser Phe Glu Thr Asp Thr Asn225 230 235 240Leu Asn Phe Gln Asn Leu Ser Val Ile Gly Phe Arg Ile Leu Leu Leu 245 250 255Lys Val Ala Gly Phe Asn Leu Leu Met Thr Leu Arg Leu Trp Ser Ser 260 265 270195PRTHomo sapiens 19Ser Gly His Asn Ser1 5206PRTHomo sapiens 20Phe Asn Asn Asn Val Pro1 52116PRTHomo sapiens 21Cys Ala Ser Ser Leu Gly Ser Pro Asp Gly Asn Gln Pro Gln His Phe1 5 10 1522135PRTHomo sapiens 22Met Asp Ser Trp Thr Phe Cys Cys Val Ser Leu Cys Ile Leu Val Ala1 5 10 15Lys His Thr Asp Ala Gly Val Ile Gln Ser Pro Arg His Glu Val Thr 20 25 30Glu Met Gly Gln Glu Val Thr Leu Arg Cys Lys Pro Ile Ser Gly His 35 40 45Asn Ser Leu Phe Trp Tyr Arg Gln Thr Met Met Arg Gly Leu Glu Leu 50 55 60Leu Ile Tyr Phe Asn Asn Asn Val Pro Ile Asp Asp Ser Gly Met Pro65 70 75 80Glu Asp Arg Phe Ser Ala Lys Met Pro Asn Ala Ser Phe Ser Thr Leu 85 90 95Lys Ile Gln Pro Ser Glu Pro Arg Asp Ser Ala Val Tyr Phe Cys Ala 100 105 110Ser Ser Leu Gly Ser Pro Asp Gly Asn Gln Pro Gln His Phe Gly Asp 115 120 125Gly Thr Arg Leu Ser Ile Leu 130 13523177PRTHomo sapiens 23Glu Asp Leu Asn Lys Val Phe Pro Pro Glu Val Ala Val Phe Glu Pro1 5 10 15Ser Glu Ala Glu Ile Ser His Thr Gln Lys Ala Thr Leu Val Cys Leu 20 25 30Ala Thr Gly Phe Phe Pro Asp His Val Glu Leu Ser Trp Trp Val Asn 35 40 45Gly Lys Glu Val His Ser Gly Val Ser Thr Asp Pro Gln Pro Leu Lys 50 55 60Glu Gln Pro Ala Leu Asn Asp Ser Arg Tyr Cys Leu Ser Ser Arg Leu65 70 75 80Arg Val Ser Ala Thr Phe Trp Gln Asn Pro Arg Asn His Phe Arg Cys 85 90 95Gln Val Gln Phe Tyr Gly Leu Ser Glu Asn Asp Glu Trp Thr Gln Asp 100 105 110Arg Ala Lys Pro Val Thr Gln Ile Val Ser Ala Glu Ala Trp Gly Arg 115 120 125Ala Asp Cys Gly Phe Thr Ser Val Ser Tyr Gln Gln Gly Val Leu Ser 130 135 140Ala Thr Ile Leu Tyr Glu Ile Leu Leu Gly Lys Ala Thr Leu Tyr Ala145 150 155 160Val Leu Val Ser Ala Leu Val Leu Met Ala Met Val Lys Arg Lys Asp 165 170 175Phe24312PRTHomo sapiens 24Met Asp Ser Trp Thr Phe Cys Cys Val Ser Leu Cys Ile Leu Val Ala1 5 10 15Lys His Thr Asp Ala Gly Val Ile Gln Ser Pro Arg His Glu Val Thr 20 25 30Glu Met Gly Gln Glu Val Thr Leu Arg Cys Lys Pro Ile Ser Gly His 35 40 45Asn Ser Leu Phe Trp Tyr Arg Gln Thr Met Met Arg Gly Leu Glu Leu 50 55 60Leu Ile Tyr Phe Asn Asn Asn Val Pro Ile Asp Asp Ser Gly Met Pro65 70 75 80Glu Asp Arg Phe Ser Ala Lys Met Pro Asn Ala Ser Phe Ser Thr Leu 85 90 95Lys Ile Gln Pro Ser Glu Pro Arg Asp Ser Ala Val Tyr Phe Cys Ala 100 105 110Ser Ser Leu Gly Ser Pro Asp Gly Asn Gln Pro Gln His Phe Gly Asp 115 120 125Gly Thr Arg Leu Ser Ile Leu Glu Asp Leu Asn Lys Val Phe Pro Pro 130 135 140Glu Val Ala Val Phe Glu Pro Ser Glu Ala Glu Ile Ser His Thr Gln145 150 155 160Lys Ala Thr Leu Val Cys Leu Ala Thr Gly Phe Phe Pro Asp His Val 165 170 175Glu Leu Ser Trp Trp Val Asn Gly Lys Glu Val His Ser Gly Val Ser 180 185 190Thr Asp Pro Gln Pro Leu Lys Glu Gln Pro Ala Leu Asn Asp Ser Arg 195 200 205Tyr Cys Leu Ser Ser Arg Leu Arg Val Ser Ala Thr Phe Trp Gln Asn 210 215 220Pro Arg Asn His Phe Arg Cys Gln Val Gln Phe Tyr Gly Leu Ser Glu225 230 235 240Asn Asp Glu Trp Thr Gln Asp Arg Ala Lys Pro Val Thr Gln Ile Val 245 250 255Ser Ala Glu Ala Trp Gly Arg Ala Asp Cys Gly Phe Thr Ser Val Ser 260 265 270Tyr Gln Gln Gly Val Leu Ser Ala Thr Ile Leu Tyr Glu Ile Leu Leu 275 280 285Gly Lys Ala Thr Leu Tyr Ala Val Leu Val Ser Ala

Leu Val Leu Met 290 295 300Ala Met Val Lys Arg Lys Asp Phe305 310257PRTHomo sapiens 25Thr Ser Glu Ser Asp Tyr Tyr1 5264PRTHomo sapiens 26Gln Glu Ala Tyr12717PRTHomo sapiens 27Cys Ala Tyr Asn Ser Tyr Ala Gly Gly Thr Ser Tyr Gly Lys Leu Thr1 5 10 15Phe28138PRTHomo sapiens 28Met Ala Cys Pro Gly Phe Leu Trp Ala Leu Val Ile Ser Thr Cys Leu1 5 10 15Glu Phe Ser Met Ala Gln Thr Val Thr Gln Ser Gln Pro Glu Met Ser 20 25 30Val Gln Glu Ala Glu Thr Val Thr Leu Ser Cys Thr Tyr Asp Thr Ser 35 40 45Glu Ser Asp Tyr Tyr Leu Phe Trp Tyr Lys Gln Pro Pro Ser Arg Gln 50 55 60Met Ile Leu Val Ile Arg Gln Glu Ala Tyr Lys Gln Gln Asn Ala Thr65 70 75 80Glu Asn Arg Phe Ser Val Asn Phe Gln Lys Ala Ala Lys Ser Phe Ser 85 90 95Leu Lys Ile Ser Asp Ser Gln Leu Gly Asp Ala Ala Met Tyr Phe Cys 100 105 110Ala Tyr Asn Ser Tyr Ala Gly Gly Thr Ser Tyr Gly Lys Leu Thr Phe 115 120 125Gly Gln Gly Thr Ile Leu Thr Val His Pro 130 13529141PRTHomo sapiens 29Asn Ile Gln Asn Pro Asp Pro Ala Val Tyr Gln Leu Arg Asp Ser Lys1 5 10 15Ser Ser Asp Lys Ser Val Cys Leu Phe Thr Asp Phe Asp Ser Gln Thr 20 25 30Asn Val Ser Gln Ser Lys Asp Ser Asp Val Tyr Ile Thr Asp Lys Thr 35 40 45Val Leu Asp Met Arg Ser Met Asp Phe Lys Ser Asn Ser Ala Val Ala 50 55 60Trp Ser Asn Lys Ser Asp Phe Ala Cys Ala Asn Ala Phe Asn Asn Ser65 70 75 80Ile Ile Pro Glu Asp Thr Phe Phe Pro Ser Pro Glu Ser Ser Cys Asp 85 90 95Val Lys Leu Val Glu Lys Ser Phe Glu Thr Asp Thr Asn Leu Asn Phe 100 105 110Gln Asn Leu Ser Val Ile Gly Phe Arg Ile Leu Leu Leu Lys Val Ala 115 120 125Gly Phe Asn Leu Leu Met Thr Leu Arg Leu Trp Ser Ser 130 135 14030279PRTHomo sapiens 30Met Ala Cys Pro Gly Phe Leu Trp Ala Leu Val Ile Ser Thr Cys Leu1 5 10 15Glu Phe Ser Met Ala Gln Thr Val Thr Gln Ser Gln Pro Glu Met Ser 20 25 30Val Gln Glu Ala Glu Thr Val Thr Leu Ser Cys Thr Tyr Asp Thr Ser 35 40 45Glu Ser Asp Tyr Tyr Leu Phe Trp Tyr Lys Gln Pro Pro Ser Arg Gln 50 55 60Met Ile Leu Val Ile Arg Gln Glu Ala Tyr Lys Gln Gln Asn Ala Thr65 70 75 80Glu Asn Arg Phe Ser Val Asn Phe Gln Lys Ala Ala Lys Ser Phe Ser 85 90 95Leu Lys Ile Ser Asp Ser Gln Leu Gly Asp Ala Ala Met Tyr Phe Cys 100 105 110Ala Tyr Asn Ser Tyr Ala Gly Gly Thr Ser Tyr Gly Lys Leu Thr Phe 115 120 125Gly Gln Gly Thr Ile Leu Thr Val His Pro Asn Ile Gln Asn Pro Asp 130 135 140Pro Ala Val Tyr Gln Leu Arg Asp Ser Lys Ser Ser Asp Lys Ser Val145 150 155 160Cys Leu Phe Thr Asp Phe Asp Ser Gln Thr Asn Val Ser Gln Ser Lys 165 170 175Asp Ser Asp Val Tyr Ile Thr Asp Lys Thr Val Leu Asp Met Arg Ser 180 185 190Met Asp Phe Lys Ser Asn Ser Ala Val Ala Trp Ser Asn Lys Ser Asp 195 200 205Phe Ala Cys Ala Asn Ala Phe Asn Asn Ser Ile Ile Pro Glu Asp Thr 210 215 220Phe Phe Pro Ser Pro Glu Ser Ser Cys Asp Val Lys Leu Val Glu Lys225 230 235 240Ser Phe Glu Thr Asp Thr Asn Leu Asn Phe Gln Asn Leu Ser Val Ile 245 250 255Gly Phe Arg Ile Leu Leu Leu Lys Val Ala Gly Phe Asn Leu Leu Met 260 265 270Thr Leu Arg Leu Trp Ser Ser 275315PRTHomo sapiens 31Ser Gly His Lys Ser1 5326PRTHomo sapiens 32Tyr Tyr Glu Lys Glu Glu1 53313PRTHomo sapiens 33Cys Ala Ser Ser Leu Asp Gly Thr Ser Glu Gln Tyr Phe1 5 1034131PRTHomo sapiens 34Met Gly Pro Gly Leu Leu Cys Trp Val Leu Leu Cys Leu Leu Gly Ala1 5 10 15Gly Pro Val Asp Ala Gly Val Thr Gln Ser Pro Thr His Leu Ile Lys 20 25 30Thr Arg Gly Gln Gln Val Thr Leu Arg Cys Ser Pro Ile Ser Gly His 35 40 45Lys Ser Val Ser Trp Tyr Gln Gln Val Leu Gly Gln Gly Pro Gln Phe 50 55 60Ile Phe Gln Tyr Tyr Glu Lys Glu Glu Arg Gly Arg Gly Asn Phe Pro65 70 75 80Asp Arg Phe Ser Ala Arg Gln Phe Pro Asn Tyr Ser Ser Glu Leu Asn 85 90 95Val Asn Ala Leu Leu Leu Gly Asp Ser Ala Leu Tyr Leu Cys Ala Ser 100 105 110Ser Leu Asp Gly Thr Ser Glu Gln Tyr Phe Gly Pro Gly Thr Arg Leu 115 120 125Thr Val Thr 13035179PRTHomo sapiens 35Glu Asp Leu Lys Asn Val Phe Pro Pro Glu Val Ala Val Phe Glu Pro1 5 10 15Ser Glu Ala Glu Ile Ser His Thr Gln Lys Ala Thr Leu Val Cys Leu 20 25 30Ala Thr Gly Phe Tyr Pro Asp His Val Glu Leu Ser Trp Trp Val Asn 35 40 45Gly Lys Glu Val His Ser Gly Val Ser Thr Asp Pro Gln Pro Leu Lys 50 55 60Glu Gln Pro Ala Leu Asn Asp Ser Arg Tyr Cys Leu Ser Ser Arg Leu65 70 75 80Arg Val Ser Ala Thr Phe Trp Gln Asn Pro Arg Asn His Phe Arg Cys 85 90 95Gln Val Gln Phe Tyr Gly Leu Ser Glu Asn Asp Glu Trp Thr Gln Asp 100 105 110Arg Ala Lys Pro Val Thr Gln Ile Val Ser Ala Glu Ala Trp Gly Arg 115 120 125Ala Asp Cys Gly Phe Thr Ser Glu Ser Tyr Gln Gln Gly Val Leu Ser 130 135 140Ala Thr Ile Leu Tyr Glu Ile Leu Leu Gly Lys Ala Thr Leu Tyr Ala145 150 155 160Val Leu Val Ser Ala Leu Val Leu Met Ala Met Val Lys Arg Lys Asp 165 170 175Ser Arg Gly36310PRTHomo sapiens 36Met Gly Pro Gly Leu Leu Cys Trp Val Leu Leu Cys Leu Leu Gly Ala1 5 10 15Gly Pro Val Asp Ala Gly Val Thr Gln Ser Pro Thr His Leu Ile Lys 20 25 30Thr Arg Gly Gln Gln Val Thr Leu Arg Cys Ser Pro Ile Ser Gly His 35 40 45Lys Ser Val Ser Trp Tyr Gln Gln Val Leu Gly Gln Gly Pro Gln Phe 50 55 60Ile Phe Gln Tyr Tyr Glu Lys Glu Glu Arg Gly Arg Gly Asn Phe Pro65 70 75 80Asp Arg Phe Ser Ala Arg Gln Phe Pro Asn Tyr Ser Ser Glu Leu Asn 85 90 95Val Asn Ala Leu Leu Leu Gly Asp Ser Ala Leu Tyr Leu Cys Ala Ser 100 105 110Ser Leu Asp Gly Thr Ser Glu Gln Tyr Phe Gly Pro Gly Thr Arg Leu 115 120 125Thr Val Thr Glu Asp Leu Lys Asn Val Phe Pro Pro Glu Val Ala Val 130 135 140Phe Glu Pro Ser Glu Ala Glu Ile Ser His Thr Gln Lys Ala Thr Leu145 150 155 160Val Cys Leu Ala Thr Gly Phe Tyr Pro Asp His Val Glu Leu Ser Trp 165 170 175Trp Val Asn Gly Lys Glu Val His Ser Gly Val Ser Thr Asp Pro Gln 180 185 190Pro Leu Lys Glu Gln Pro Ala Leu Asn Asp Ser Arg Tyr Cys Leu Ser 195 200 205Ser Arg Leu Arg Val Ser Ala Thr Phe Trp Gln Asn Pro Arg Asn His 210 215 220Phe Arg Cys Gln Val Gln Phe Tyr Gly Leu Ser Glu Asn Asp Glu Trp225 230 235 240Thr Gln Asp Arg Ala Lys Pro Val Thr Gln Ile Val Ser Ala Glu Ala 245 250 255Trp Gly Arg Ala Asp Cys Gly Phe Thr Ser Glu Ser Tyr Gln Gln Gly 260 265 270Val Leu Ser Ala Thr Ile Leu Tyr Glu Ile Leu Leu Gly Lys Ala Thr 275 280 285Leu Tyr Ala Val Leu Val Ser Ala Leu Val Leu Met Ala Met Val Lys 290 295 300Arg Lys Asp Ser Arg Gly305 310376PRTHomo sapiens 37Asp Ser Ala Ile Tyr Asn1 5383PRTHomo sapiens 38Ile Gln Ser13915PRTHomo sapiens 39Cys Ala Val Arg Pro Thr Ser Gly Gly Ser Tyr Ile Pro Thr Phe1 5 10 1540133PRTHomo sapiens 40Met Glu Thr Leu Leu Gly Leu Leu Ile Leu Trp Leu Gln Leu Gln Trp1 5 10 15Val Ser Ser Lys Gln Glu Val Thr Gln Ile Pro Ala Ala Leu Ser Val 20 25 30Pro Glu Gly Glu Asn Leu Val Leu Asn Cys Ser Phe Thr Asp Ser Ala 35 40 45Ile Tyr Asn Leu Gln Trp Phe Arg Gln Asp Pro Gly Lys Gly Leu Thr 50 55 60Ser Leu Leu Leu Ile Gln Ser Ser Gln Arg Glu Gln Thr Ser Gly Arg65 70 75 80Leu Asn Ala Ser Leu Asp Lys Ser Ser Gly Arg Ser Thr Leu Tyr Ile 85 90 95Ala Ala Ser Gln Pro Gly Asp Ser Ala Thr Tyr Leu Cys Ala Val Arg 100 105 110Pro Thr Ser Gly Gly Ser Tyr Ile Pro Thr Phe Gly Arg Gly Thr Ser 115 120 125Leu Ile Val His Pro 13041141PRTHomo sapiens 41Tyr Ile Gln Asn Pro Asp Pro Ala Val Tyr Gln Leu Arg Asp Ser Lys1 5 10 15Ser Ser Asp Lys Ser Val Cys Leu Phe Thr Asp Phe Asp Ser Gln Thr 20 25 30Asn Val Ser Gln Ser Lys Asp Ser Asp Val Tyr Ile Thr Asp Lys Thr 35 40 45Val Leu Asp Met Arg Ser Met Asp Phe Lys Ser Asn Ser Ala Val Ala 50 55 60Trp Ser Asn Lys Ser Asp Phe Ala Cys Ala Asn Ala Phe Asn Asn Ser65 70 75 80Ile Ile Pro Glu Asp Thr Phe Phe Pro Ser Pro Glu Ser Ser Cys Asp 85 90 95Val Lys Leu Val Glu Lys Ser Phe Glu Thr Asp Thr Asn Leu Asn Phe 100 105 110Gln Asn Leu Ser Val Ile Gly Phe Arg Ile Leu Leu Leu Lys Val Ala 115 120 125Gly Phe Asn Leu Leu Met Thr Leu Arg Leu Trp Ser Ser 130 135 14042274PRTHomo sapiens 42Met Glu Thr Leu Leu Gly Leu Leu Ile Leu Trp Leu Gln Leu Gln Trp1 5 10 15Val Ser Ser Lys Gln Glu Val Thr Gln Ile Pro Ala Ala Leu Ser Val 20 25 30Pro Glu Gly Glu Asn Leu Val Leu Asn Cys Ser Phe Thr Asp Ser Ala 35 40 45Ile Tyr Asn Leu Gln Trp Phe Arg Gln Asp Pro Gly Lys Gly Leu Thr 50 55 60Ser Leu Leu Leu Ile Gln Ser Ser Gln Arg Glu Gln Thr Ser Gly Arg65 70 75 80Leu Asn Ala Ser Leu Asp Lys Ser Ser Gly Arg Ser Thr Leu Tyr Ile 85 90 95Ala Ala Ser Gln Pro Gly Asp Ser Ala Thr Tyr Leu Cys Ala Val Arg 100 105 110Pro Thr Ser Gly Gly Ser Tyr Ile Pro Thr Phe Gly Arg Gly Thr Ser 115 120 125Leu Ile Val His Pro Tyr Ile Gln Asn Pro Asp Pro Ala Val Tyr Gln 130 135 140Leu Arg Asp Ser Lys Ser Ser Asp Lys Ser Val Cys Leu Phe Thr Asp145 150 155 160Phe Asp Ser Gln Thr Asn Val Ser Gln Ser Lys Asp Ser Asp Val Tyr 165 170 175Ile Thr Asp Lys Thr Val Leu Asp Met Arg Ser Met Asp Phe Lys Ser 180 185 190Asn Ser Ala Val Ala Trp Ser Asn Lys Ser Asp Phe Ala Cys Ala Asn 195 200 205Ala Phe Asn Asn Ser Ile Ile Pro Glu Asp Thr Phe Phe Pro Ser Pro 210 215 220Glu Ser Ser Cys Asp Val Lys Leu Val Glu Lys Ser Phe Glu Thr Asp225 230 235 240Thr Asn Leu Asn Phe Gln Asn Leu Ser Val Ile Gly Phe Arg Ile Leu 245 250 255Leu Leu Lys Val Ala Gly Phe Asn Leu Leu Met Thr Leu Arg Leu Trp 260 265 270Ser Ser435PRTHomo sapiens 43Met Asn His Glu Tyr1 5446PRTHomo sapiens 44Ser Val Gly Ala Gly Ile1 54514PRTHomo sapiens 45Cys Ala Ser Ser Tyr Val Gly Asn Thr Gly Glu Leu Phe Phe1 5 1046132PRTHomo sapiens 46Met Ser Ile Gly Leu Leu Cys Cys Ala Ala Leu Ser Leu Leu Trp Ala1 5 10 15Gly Pro Val Asn Ala Gly Val Thr Gln Thr Pro Lys Phe Gln Val Leu 20 25 30Lys Thr Gly Gln Ser Met Thr Leu Gln Cys Ala Gln Asp Met Asn His 35 40 45Glu Tyr Met Ser Trp Tyr Arg Gln Asp Pro Gly Met Gly Leu Arg Leu 50 55 60Ile His Tyr Ser Val Gly Ala Gly Ile Thr Asp Gln Gly Glu Val Pro65 70 75 80Asn Gly Tyr Asn Val Ser Arg Ser Thr Thr Glu Asp Phe Pro Leu Arg 85 90 95Leu Leu Ser Ala Ala Pro Ser Gln Thr Ser Val Tyr Phe Cys Ala Ser 100 105 110Ser Tyr Val Gly Asn Thr Gly Glu Leu Phe Phe Gly Glu Gly Ser Arg 115 120 125Leu Thr Val Leu 13047179PRTHomo sapiens 47Glu Asp Leu Lys Asn Val Phe Pro Pro Glu Val Ala Val Phe Glu Pro1 5 10 15Ser Glu Ala Glu Ile Ser His Thr Gln Lys Ala Thr Leu Val Cys Leu 20 25 30Ala Thr Gly Phe Tyr Pro Asp His Val Glu Leu Ser Trp Trp Val Asn 35 40 45Gly Lys Glu Val His Ser Gly Val Ser Thr Asp Pro Gln Pro Leu Lys 50 55 60Glu Gln Pro Ala Leu Asn Asp Ser Arg Tyr Cys Leu Ser Ser Arg Leu65 70 75 80Arg Val Ser Ala Thr Phe Trp Gln Asn Pro Arg Asn His Phe Arg Cys 85 90 95Gln Val Gln Phe Tyr Gly Leu Ser Glu Asn Asp Glu Trp Thr Gln Asp 100 105 110Arg Ala Lys Pro Val Thr Gln Ile Val Ser Ala Glu Ala Trp Gly Arg 115 120 125Ala Asp Cys Gly Phe Thr Ser Glu Ser Tyr Gln Gln Gly Val Leu Ser 130 135 140Ala Thr Ile Leu Tyr Glu Ile Leu Leu Gly Lys Ala Thr Leu Tyr Ala145 150 155 160Val Leu Val Ser Ala Leu Val Leu Met Ala Met Val Lys Arg Lys Asp 165 170 175Ser Arg Gly48311PRTHomo sapiens 48Met Ser Ile Gly Leu Leu Cys Cys Ala Ala Leu Ser Leu Leu Trp Ala1 5 10 15Gly Pro Val Asn Ala Gly Val Thr Gln Thr Pro Lys Phe Gln Val Leu 20 25 30Lys Thr Gly Gln Ser Met Thr Leu Gln Cys Ala Gln Asp Met Asn His 35 40 45Glu Tyr Met Ser Trp Tyr Arg Gln Asp Pro Gly Met Gly Leu Arg Leu 50 55 60Ile His Tyr Ser Val Gly Ala Gly Ile Thr Asp Gln Gly Glu Val Pro65 70 75 80Asn Gly Tyr Asn Val Ser Arg Ser Thr Thr Glu Asp Phe Pro Leu Arg 85 90 95Leu Leu Ser Ala Ala Pro Ser Gln Thr Ser Val Tyr Phe Cys Ala Ser 100 105 110Ser Tyr Val Gly Asn Thr Gly Glu Leu Phe Phe Gly Glu Gly Ser Arg 115 120 125Leu Thr Val Leu Glu Asp Leu Lys Asn Val Phe Pro Pro Glu Val Ala 130 135 140Val Phe Glu Pro Ser Glu Ala Glu Ile Ser His Thr Gln Lys Ala Thr145 150 155 160Leu Val Cys Leu Ala Thr Gly Phe Tyr Pro Asp His Val Glu Leu Ser 165 170 175Trp Trp Val Asn Gly Lys Glu Val His Ser Gly Val Ser Thr Asp Pro 180 185 190Gln Pro Leu Lys Glu Gln Pro Ala Leu Asn Asp Ser Arg Tyr Cys Leu 195 200 205Ser Ser Arg Leu Arg Val Ser Ala Thr Phe Trp Gln Asn Pro Arg Asn 210 215 220His Phe Arg Cys Gln Val Gln Phe Tyr Gly Leu Ser Glu Asn Asp Glu225 230 235 240Trp Thr Gln Asp Arg Ala Lys Pro Val Thr Gln Ile Val Ser Ala Glu 245 250 255Ala Trp Gly Arg Ala Asp Cys Gly Phe Thr Ser Glu Ser Tyr Gln Gln 260 265

270Gly Val Leu Ser Ala Thr Ile Leu Tyr Glu Ile Leu Leu Gly Lys Ala 275 280 285Thr Leu Tyr Ala Val Leu Val Ser Ala Leu Val Leu Met Ala Met Val 290 295 300Lys Arg Lys Asp Ser Arg Gly305 310499PRTHomo sapiens 49Ile Leu Gln Asp Gly Gln Phe Leu Val1 5509PRTHomo sapiens 50Ala Leu Gln Asp Gly Gln Phe Leu Val1 5519PRTHomo sapiens 51Ile Ala Gln Asp Gly Gln Phe Leu Val1 5529PRTHomo sapiens 52Ile Leu Ala Asp Gly Gln Phe Leu Val1 5539PRTHomo sapiens 53Ile Leu Gln Ala Gly Gln Phe Leu Val1 5549PRTHomo sapiens 54Ile Leu Gln Asp Ala Gln Phe Leu Val1 5559PRTHomo sapiens 55Ile Leu Gln Asp Gly Ala Phe Leu Val1 5569PRTHomo sapiens 56Ile Leu Gln Asp Gly Gln Ala Leu Val1 5579PRTHomo sapiens 57Ile Leu Gln Asp Gly Gln Phe Ala Val1 5589PRTHomo sapiens 58Ile Leu Gln Asp Gly Gln Phe Leu Ala1 5599PRTHomo sapiens 59Gly Leu Val Asp Gly Val Phe Leu Val1 5609PRTHomo sapiens 60Ile Leu Gln Asp Gly Arg Ile Phe Ile1 5619PRTHomo sapiens 61Ile Leu Gln Asp Leu Gln Pro Phe Leu1 5629PRTHomo sapiens 62Ile Leu Gln Glu Gly Thr Phe Lys Ala1 5639PRTHomo sapiens 63Lys Leu Gln Asp Gly Asn His Leu Leu1 5649PRTHomo sapiens 64Leu Leu Gln Asp Gly Glu Phe Ser Met1 5659PRTHomo sapiens 65Leu Leu Gln Asp Lys Gln Phe Glu Leu1 5669PRTHomo sapiens 66Asn Leu Gln Glu Gly Glu Phe Leu Leu1 5679PRTHomo sapiens 67Thr Leu Gln Asn Ser Gln Phe Leu Leu1 5689PRTHomo sapiens 68Thr Leu Thr Asp Glu Gln Phe Leu Val1 5699PRTHomo sapiens 69Ser Leu Leu Met Trp Ile Thr Gln Val1 5709PRTHomo sapiens 70Thr Leu Gln Asp Gly Gln Phe Leu Val1 5719PRTHomo sapiens 71Ile Thr Gln Asp Gly Gln Phe Leu Val1 5729PRTHomo sapiens 72Ile Leu Thr Asp Gly Gln Phe Leu Val1 5739PRTHomo sapiens 73Ile Leu Gln Thr Gly Gln Phe Leu Val1 5749PRTHomo sapiens 74Ile Leu Gln Asp Thr Gln Phe Leu Val1 5759PRTHomo sapiens 75Ile Leu Gln Asp Gly Thr Phe Leu Val1 5769PRTHomo sapiens 76Ile Leu Gln Asp Gly Gln Thr Leu Val1 5779PRTHomo sapiens 77Ile Leu Gln Asp Gly Gln Phe Thr Val1 5789PRTHomo sapiens 78Ile Leu Gln Asp Gly Gln Phe Leu Thr1 5

Claims

1. A soluble antigen recognizing construct, comprising SEQ ID NO: 25, SEQ ID NO: 27, SEQ ID NO: 31, and SEQ ID NO: 33, wherein each of SEQ ID NO: 25, SEQ ID NO: 27, SEQ ID NO: 31, and SEQ ID NO: 33 comprises at most one conservative amino acid substitution.

2. The soluble antigen recognizing construct of claim 1, wherein the soluble antigen recognizing construct binds to a peptide of SEQ ID NO: 49 in a complex with an MHC class I molecule.

3. The soluble antigen recognizing construct of claim 1, wherein the soluble antigen recognizing construct does not selectively bind any of similar DCAF4L2-001 peptides set forth in SEQ ID NO: 59 to 68.

4. The soluble antigen recognizing construct of claim 1, further comprising SEQ ID NO: 26 and SEQ ID NO: 32.

5. The soluble antigen recognizing construct of claim 1, wherein the soluble antigen recognizing construct comprises a CDR1.alpha. chain comprising SEQ ID NO: 25, a CDR2.alpha. chain comprising SEQ ID NO: 26, a CDR3.alpha. chain comprising SEQ ID NO: 27, a CDR1.beta. chain comprising SEQ ID NO: 31, a CDR2.beta. chain comprising SEQ ID NO: 32, and a CDR3.beta. chain comprising SEQ ID NO: 33, wherein each of SEQ ID NOs: 25 and 31 comprise at most one conservative amino acid substitution.

6. The soluble antigen recognizing construct of claim 1, wherein the soluble antigen recognizing construct comprises a CDR1.alpha. chain comprising SEQ ID NO: 25, a CDR2.alpha. chain comprising SEQ ID NO: 26, a CDR3.alpha. chain comprising SEQ ID NO: 27, a CDR1.beta. chain comprising SEQ ID NO: 31, a CDR2.beta. chain comprising SEQ ID NO: 32, and a CDR3.beta. chain comprising SEQ ID NO: 33, wherein each of SEQ ID NOs: 26 and 32 comprise at most one conservative amino acid substitution.

7. The soluble antigen recognizing construct of claim 1, wherein the soluble antigen recognizing construct comprises a CDR1.alpha. chain comprising SEQ ID NO: 25, a CDR2.alpha. chain comprising SEQ ID NO: 26, a CDR3.alpha. chain comprising SEQ ID NO: 27, a CDR1.beta. chain comprising SEQ ID NO: 31, a CDR2.beta. chain comprising SEQ ID NO: 32, and a CDR3.beta. chain comprising SEQ ID NO: 33, wherein each of SEQ ID NOs: 27 and 33 comprises at most one conservative amino acid substitution.

8. The soluble antigen recognizing construct of claim 1, wherein the soluble antigen recognizing construct comprises a CDR1.alpha. chain consisting of SEQ ID NO: 25, a CDR2.alpha. chain consisting of SEQ ID NO: 26, a CDR3.alpha. chain comprising SEQ ID NO: 27, a CDR1.beta. chain consisting of SEQ ID NO: 31, a CDR2.beta. chain consisting of SEQ ID NO: 32, and a CDR3.beta. chain comprising SEQ ID NO: 33.

9. The soluble antigen recognizing construct of claim 1, wherein the soluble antigen recognizing construct comprises a CDR1.alpha. chain comprising SEQ ID NO: 25, a CDR2.alpha. chain consisting of SEQ ID NO: 26, a CDR3.alpha. chain comprising SEQ ID NO: 27, a CDR1.beta. chain comprising SEQ ID NO: 31, a CDR2.beta. chain consisting of SEQ ID NO: 32, and a CDR3.beta. chain comprising SEQ ID NO: 33.

10. The soluble antigen recognizing construct of claim 1, wherein the soluble antigen recognizing construct comprises a CDR1.alpha. chain consisting of SEQ ID NO: 25, a CDR2.alpha. chain comprising SEQ ID NO: 26, a CDR3.alpha. chain consisting of SEQ ID NO: 27, a CDR1.beta. chain consisting of SEQ ID NO: 31, a CDR2.beta. chain comprising SEQ ID NO: 32, and a CDR3.beta. chain consisting of SEQ ID NO: 33.

11. The soluble antigen recognizing construct of claim 1, wherein the soluble antigen recognizing construct comprises a CDR1.alpha. chain comprising SEQ ID NO: 25, a CDR2.alpha. chain comprising SEQ ID NO: 26, a CDR3.alpha. chain consisting of SEQ ID NO: 27, a CDR1.beta. chain comprising SEQ ID NO: 31, a CDR2.beta. chain comprising SEQ ID NO: 32, and a CDR3.beta. chain consisting of SEQ ID NO: 33.

12. The soluble antigen recognizing construct of claim 1, wherein the soluble antigen recognizing construct comprises a CDR1.alpha. chain consisting of SEQ ID NO: 25, a CDR2.alpha. chain consisting of SEQ ID NO: 26, a CDR3.alpha. chain consisting of SEQ ID NO: 27, a CDR1.beta. chain consisting of SEQ ID NO: 31, a CDR2.beta. chain consisting of SEQ ID NO: 32, and a CDR3.beta. chain consisting of SEQ ID NO: 33.

13. The soluble antigen recognizing construct of claim 1, wherein the soluble antigen recognizing construct is an antibody or derivative or fragment thereof, or an .alpha..beta.-T cell receptor (TCR) or a derivative or fragment thereof, or a .gamma..delta. TCR or a derivative or fragment thereof.

14. The soluble antigen recognizing construct of claim 12, wherein the antibody is a bispecific antibody.

15. The soluble antigen recognizing construct of claim 1, comprising a TCR variable chain region having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 28 or SEQ ID NO: 34.

16. The soluble antigen recognizing construct of claim 1, comprising a TCR variable chain region comprising the amino acid sequence of SEQ ID NO: 28 or SEQ ID NO: 34.

17. A nucleic acid encoding the soluble antigen recognizing construct of claim 1.

18. An expression vector comprising the nucleic acid of claim 17 operably linked to at least one promoter sequence.

19. A host cell transformed with the expression vector of claim 18.

20. A pharmaceutical composition comprising the soluble antigen recognizing construct of claim 1.