Patents - stay tuned to the technology

Inventors list

Assignees list

Classification tree browser

Top 100 Inventors

Top 100 Assignees

Patent application title: INNOVATIVE DISCOVERY OF THERAPEUTIC, DIAGNOSTIC, AND ANTIBODY COMPOSITIONS RELATED TO PROTEIN FRAGMENTS OF ALANYL TRNA SYNTHETASES

Inventors:
IPC8 Class: AC07K1640FI
USPC Class: 1 1
Class name:
Publication date: 2020-07-16
Patent application number: 20200223942



Abstract:

Provided are compositions comprising newly identified protein fragments of aminoacyl-tRNA synthetases, polynucleotides that encode them and complements thereof, related agents, and methods of use thereof in diagnostic, drug discovery, research, and therapeutic applications.

Claims:

1-125. (canceled)

126. A therapeutic composition, comprising an isolated aminoacyl-tRNA synthetase (AARS) polypeptide that is at least 80%, 85%, 90%, 95%, 98%, or 100% identical to a sequence in any of Table(s) 1-9, wherein the polypeptide has a solubility of at least about 5 mg/mL, and wherein the composition has a purity of at least about 95% on a protein basis and less than about 10 EU endotoxin/mg protein.

127. The therapeutic composition of claim 126, wherein the AARS polypeptide has an extracellular signaling activity.

128. The therapeutic composition of claim 126, wherein the AARS polypeptide consists of an amino acid sequence set forth in any of Table(s) 1-9 or differs from an amino acid sequence set forth in any of Table(s) 1-9 by substitution, deletion, and/or addition of about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or 11 amino acids.

129. The therapeutic composition of claim 126, wherein the AARS polypeptide is fused to a heterologous polypeptide.

130. The therapeutic composition of claim 126, wherein at least one moiety or a solid substrate is covalently or non-covalently attached to said polypeptide.

131. An isolated aminoacyl-tRNA synthetase (AARS) polypeptide that is at least 80%, 85%, 90%, 95%, 98%, or 100% identical to an amino acid sequence set forth in any of Table(s) 1-9.

132. The isolated AARS polypeptide of claim 131, wherein the AARS polypeptide is fused to a heterologous polypeptide.

133. A system, comprising an AARS polypeptide of claim 131, and an element selected from the group consisting of: (i) a binding partner that binds to the AARS polypeptide; (ii) an engineered population of cells in which at least one cell comprises a polynucleotide encoding said AARS polypeptide, wherein the cells are capable of growing in a serum-free medium; (iii) a cell that comprises a cell-surface receptor or an extracellular portion thereof that binds to the polypeptide, and a molecule of less than about 2000 daltons, or a second polypeptide, which modulates binding or interaction of the AARS polypeptide and the extracellular receptor; (iv) a cell that comprises a cell-surface receptor or an extracellular portion thereof that specifically binds to the AARS polypeptide, wherein the cell comprises an indicator molecule that allows detection of a change in the levels or activity of the cell-surface receptor or extracellular portion thereof; and (v) an engineered population of cells in which at least one cell comprises a polynucleotide encoding said AARS polypeptide, at least about 10 liters of a serum-free growth medium, and a sterile container.

134. A method of determining presence or levels of an AARS polypeptide or a polynucleotide that encodes the AARS polypeptide in a sample, comprising: (a) contacting the sample with one or more binding agents or antibodies or antigen-binding fragments thereof that specifically bind to an AARS polypeptide of claim 131, detecting the presence or absence of the binding agent, and thereby determining the presence or levels of the AARS polypeptide; (b) analyzing the sample with a detector that is capable of specifically identifying an AARS polypeptide of claim 131, and thereby determining the presence or levels of the AARS polypeptide; (c) contacting the sample with one or more oligonucleotides that specifically hybridize to polynucleotide that encodes an AARS polypeptide of claim 131, detecting the presence or absence of the oligonucleotides in the sample, and thereby determining the presence or levels of the polynucleotide; or (d) contacting the sample with at least two oligonucleotides that specifically amplify a polynucleotide that encodes an AARS polypeptide of claim 131, performing an amplification reaction, detecting the presence or absence of an amplified product, and thereby determining presence or levels of the polynucleotide.

135. A method of modulating a cellular activity of a cell, or protein, comprising contacting the cell or protein with an AARS polypeptide claim 131, or a composition comprising a pharmaceutically-acceptable carrier and said AARS polypeptide.

136. The method of claim 135, wherein the cell or protein is in a subject having a disease or disorder optionally mediated by the dysregulation of the expression, activity or spatiotemporal location of a tRNA synthetase, comprising administering the AARS polypeptide or the composition to the subject.

137. A composition, comprising (a) a binding agent or an antibody or antigen binding fragment thereof that exhibits binding specificity for an AARS polypeptide of claim 131, or (b) an isolated polynucleotide that encodes an AARS polypeptide of claim 131.

138. A method of identifying a compound that specifically binds to an AARS polypeptide of claim 131, comprising a) combining the AARS polypeptide or its cellular binding partner or both with at least one test compound under suitable conditions, and b) detecting binding of the AARS polypeptide to the test compound, thereby identifying a compound that specifically binds to the AARS polypeptide.

Description:

CROSS-REFERENCE TO RELATED APPLICATIONS

[0001] This application is a Continuation of U.S. application Ser. No. 15/076,297, filed Mar. 21, 2016; which is a Continuation of U.S. application Ser. No. 14/620,817, filed Feb. 12, 2015, now U.S. Pat. No. 9,320,782, issued Apr. 26, 2016; which is a Continuation of Ser. No. 13/643,753, filed May 31, 2013, now U.S. Pat. No. 8,993,723, issued Mar. 31, 2015; which is a U.S. National Phase Application of International Patent Application No. PCT/US2011/034387, filed Apr. 28, 2011, which claims the benefit under 35 U.S.C. .sctn. 119(e) of U.S. provisional patent application No. 61/329,048, filed Apr. 28, 2010, U.S. provisional patent application No. 61/328,867, filed Apr. 28, 2010, and U.S. provisional patent application No. 61/328,871, filed Apr. 28, 2010, the entire contents of each of which, are incorporated herein by reference.

STATEMENT REGARDING SEQUENCE LISTING

[0002] The Sequence Listing associated with this application is provided in text format in lieu of a paper copy, and is hereby incorporated by reference into the specification. The name of the text file containing the Sequence Listing is ATYR_026_04US_ST25.txt. The text file is about 296 KB, was created on Nov. 20, 2019, and is being submitted electronically via EFS-Web.

TECHNICAL FIELD

[0003] The present invention relates generally to compositions comprising newly identified protein fragments of aminoacyl-tRNA synthetases and other proteins, polynucleotides that encode them and complements thereof, related agents, and methods of use thereof in diagnostic, drug discovery, research, and therapeutic applications.

BACKGROUND

[0004] For over four decades, aminoacyl-tRNA synthetases (AARSs) were thought of as essential housekeeping proteins that catalyze the aminoacylation of tRNA molecules as part of the decoding of genetic information during the process of protein translation. AARSs have been extensively studied in this respect, and many of their full-length sequences were cloned for sequence analysis and to provide a rich source of biochemical experimentation. Some fragments of AARSs, and other proteins, however, possess unexpected activities not associated with aminoacylation, including extracellular signaling activities that modulate pathways beyond protein translation. Generally, these unexpected activities are not observed in the context of the full-length or parental protein sequences; instead, they are observed following removal or resection of AARS protein fragments from their parental sequences, or by expressing and sufficiently purifying fragment AARS sequences and then testing for novel, non-synthetase related activities.

[0005] While the full-length sequences of AARS have been known for some time, no systematic experimental analysis has been conducted to elucidate such AARS protein fragments, or protein fragments from related or associated proteins, or to evaluate the potential role of the full length AARS proteins for novel biological activities outside of the context of amino acid synthesis." In portions of this specification, such AARS protein fragments, AARS domains, or AARS alternative splice variants are referred to herein as "resectins". In its broadest context, the term "resectin" refers to a portion of a protein which has been excised or restricted (either by means of proteolysis, alternative splicing, mutagenesis, or recombinant genetic engineering) from the context of its native full-length or parental protein sequence, which often otherwise masks its novel biological activities. Likewise, no systematic experimental analysis has been conducted to explore the use of such resectins as biotherapeutic agents, diagnostic agents, or drug targets in the treatment of various medical conditions, or their potential association with human diseases. As essential housekeeping genes with a known function in mammals that is critical to life, AARSs were neither considered as drug targets in mammals, nor were they parsed out by standard genomic sequencing, bioinformatic, or similar efforts to identify resectins having non-synthetase activities. Standard biochemical research efforts have similarly been directed away from characterizing the biological properties of AARS resectins and their potential therapeutic and diagnostic relevance, mainly due to the previously understood role of their corresponding full-length parental AARSs.

BRIEF DESCRIPTION OF THE DRAWINGS

[0006] FIGS. 1A-1C show the domain structure of the Alanyl aminoacyl tRNA synthetase overlaid with the relative positions and sizes of the N-terminal AARS polypeptides shown schematically. FIG. 1A representing fragments identified from mass spectrometry analysis, FIG. 1B representing the fragments identified from deep sequencing of transcriptomes, and FIG. 1C representing fragments identified from bioinformatics analysis.

[0007] FIGS. 2A-2C shows the domain structure of the Alanyl aminoacyl tRNA synthetase overlaid with the relative positions and sizes of the C-terminal AARS polypeptides shown schematically. FIG. 2A representing fragments identified from mass spectrometry analysis, FIG. 2B representing the fragments identified from deep sequencing of transcriptomes, and FIG. 2C representing fragments identified from bioinformatics analysis.

[0008] FIG. 3 shows the domain structure of the Alanyl aminoacyl tRNA synthetase overlaid schematically with the relative positions and sizes of the Internal AARS polypeptides identified from bioinformatics analysis.

BRIEF SUMMARY OF THE INVENTION

[0009] Embodiments of the present invention relate generally to the discovery of protein fragments of aminoacyl-tRNA synthetases (AARSs), which possess non-canonical biological activities, such as extracellular signaling activities, and/or other characteristics of therapeutic and diagnostic relevance. The AARSs are universal and essential elements of the protein synthesis machinery found in all organisms, but human AARSs and their associated proteins have naturally-occurring resected variants, with potent cell signaling activities that contribute to normal functioning of humans. The activities of these protein fragments are distinct from the protein synthesis activities commonly known for AARSs, and the present invention includes the discovery and development of these resected proteins as new biotherapeutic agents, new discovery research reagents, and as new antigens/targets for directed biologics and diagnostic agents that can be used to potentially treat or diagnose a wide variety of human diseases, such as inflammatory, hematological, neurodegenerative, autoimmune, hematopoietic, cardiovascular, and metabolic diseases or disorders.

[0010] The AARS protein fragment(s) of the present invention may therefore be referred to as "resectins," or alternatively as "appendacrines." As noted above, the term "resectin" derives from the process of excising or resecting a given AARS protein fragment from the context of its full-length parent AARS sequence, which typically masks its non-canonical activities. In certain instances, the AARS protein fragments and polynucleotides of the present invention were identified through the occurrence of this resection process, whether naturally-occurring (e.g., proteolytic, splice variant), artificially-induced, or predicted. The term "appendacrine" derives from a combination of "append" (from Latin--appender) and to "separate" or "discern" (from Greek--crines)," and also reflects the separation of one or more appended domains of the AARS protein fragments from their corresponding full-length or parent AARS sequences.

[0011] Although a few AARS fragments have been previously shown to have non-synthetase activities, the expression, isolation, purification, and characterization of such fragments for biotherapeutic, discovery, or diagnostic utility is limited, and persons skilled in the art would not have readily appreciated such activities to associate with each member of the entire family of AARSs, or with alternative fragments. Here, a methodical approach was utilized to discover and verify AARS protein fragments for the 20 mitochondrial and 20 cytosolic AARSs (and associated proteins) for biotherapeutic discovery and diagnostic utility. For instance, certain of the present AARS protein fragment(s) and polynucleotides that encode them are identified from biological samples using mass spectrometry (MS), mainly to identify proteolytic fragments, and others were identified by deep sequencing techniques, mainly to identify splice variants. Other AARS protein fragment(s) are identified using in silico predictions of amino acid sequences, such as by computationally comparing synthetases from humans and lower organisms along with key demarcations (e.g., protease sites); this approach utilized sequence analysis of the full-length AARS based on specific criteria to discern proteolytic fragments and functional domains possessing non-canonical biological activities.

[0012] Novel resectins of the AARSs are unexpected, and their differential expression is also unexpected. Specific resections are typically seen under different treatments (e.g., from cells grown in media with or without serum), at different stages of growth (e.g., adult brain vs. fetal brain) and for different tissue types (e.g., pancreas vs. liver). The pattern of expression is not the same for all aminoacyl tRNA synthetases despite the fact that the canonical functions for all aminoacyl tRNA synthetases are needed in the same cell locations and in relatively proportional amounts. One would not expect the levels of an aminoacyl tRNA synthetase activity to increase without an increase in the amounts of other aminoacyl tRNA synthetase activities at the same time. The mass spectrometry and deep sequencing data indicates that aminoacyl tRNA synthetase resectins do have varying levels and do occur in different sites and at different stages

[0013] In addition, AARS protein fragments can be expressed and purified to sufficiently high purity to discern their biological properties. Previously, fragments were often not of sufficient purity, folding, and stability to enable proper biological characterization of non-synthetase activities. Cell based assays, for instance, are used in conjunction with sufficiently pure, stable, soluble and folded resectins to reveal their important biotherapeutic, discovery or diagnostic activities.

[0014] In particular, embodiments of the present invention relate to protein fragments of Alanyl tRNA synthetases, related agents and compositions of biotherapeutic, discovery, or diagnostic utility, and methods of use thereof. The compositions of the present invention are useful in a variety of diagnostic, drug discovery, and therapeutic applications, as described herein. Preferably, the AARS proteins and fragments are purified and stored in suitable condition to the extent required for such biotherapeutic, discovery, or diagnostic uses.

[0015] Certain embodiments include compositions, comprising an isolated aminoacyl-tRNA synthetase (AARS) protein fragment of at least about 100, 90, 80, 70, 60, 50 or 40 amino acids that comprises an amino acid sequence as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, and has a solubility of at least about 5 mg/ml, and wherein the composition has a purity of at least about 95% on a protein basis, and less than about 10 EU/mg protein endotoxin. In one aspect, the composition is a therapeutic composition. In specific embodiments, the composition is substantially serum free. In some embodiments the AARS protein fragment comprises a non-canonical activity. In some embodiments, the non-canonical biological activity is selected from modulation of extracellular signaling, modulation of cell proliferation, modulation of cell differentiation, modulation of gene transcription, modulation of cytokine production or activity, modulation of cytokine receptor activity, and modulation of inflammation. In some embodiments, the AARS protein fragment has an EC.sub.50 of less than about 1 nM, about 5 nM, about 10 nM, about 50 nM, about 100 nM or about 200 nM for a cell-based non-canonical biological activity.

[0016] In certain embodiments the AARS protein fragment is fused to a heterologous polypeptide. In some embodiments, the AARS fusion protein substantially retains a non-canonical activity of the AARS protein fragment. In some embodiments, the AARS fusion protein suppresses a non-canonical activity of the AARS protein fragment. In some embodiments, the heterologous polypeptide is attached to the N-terminus of the AARS protein fragment. In some embodiments, the heterologous polypeptide is attached to the C-terminus of the AARS protein fragment. In one aspect of any of these embodiments the heterologous polypeptide is selected from the group consisting of purification tags, epitope tags, targeting sequences, signal peptides, membrane translocating sequences, and PK modifiers.

[0017] In certain embodiments, the composition comprises an AARS protein fragment at a concentration of least about 10 mg/mL. In certain embodiments the composition comprises an AARS protein fragment which is at least 90% monodisperse. In certain embodiments the composition comprises less than about 3% high molecular weight aggregated proteins. In certain embodiments the composition exhibits less than 3% aggregation when stored at a concentration of at least 10 mg/mL in PBS for one week at 4.degree. C. In certain embodiments the composition exhibits less than 3% aggregation when stored at a concentration of at least 10 mg/mL in PBS for one week at room temperature.

[0018] Various assays for measuring such features of resectins are described herein and may be used to define aspects of the invention. In certain aspects, these features will be preferable for biotherapeutic utility of the AARS protein fragments described herein.

[0019] Certain embodiments include compositions, comprising an isolated aminoacyl-tRNA synthetase (AARS) protein fragment of at least 100 amino acids that differs from an amino acid sequence set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9 by substitution, deletion, and/or addition of about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acids, wherein the altered protein fragment substantially retains a non-canonical activity of the unaltered protein, or has a dominant negative phenotype in relation to the non-canonical activity, wherein the protein fragment has a solubility of at least about 5 mg/ml, and wherein the composition has a purity of at least about 95% on a protein basis and less than about 10 EU/mg protein endotoxin. In specific embodiments, the composition is substantially serum free.

[0020] Other embodiments include compositions, comprising an isolated antibody that specifically binds to an isolated aminoacyl-tRNA synthetase (AARS) protein fragment as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, wherein affinity of the antibody for the AARS protein fragment is about 10.times. stronger than its affinity for a corresponding full-length AARS polypeptide. One of the surprising aspects of the present invention includes certain resectins possessing "new" surfaces accessible to antibody or other directed biologics, whereas the full length AARS "hides" or covers these surfaces with other sequences or adjacent domains. The process of resecting can also create greater aqueous accessibility for revealing previously unidentified biological activities. Some embodiments include compositions, comprising an isolated antibody that specifically binds to an isolated aminoacyl-tRNA synthetase (AARS) protein fragment as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, wherein the antibody has an affinity of at least about 10 nM for the AARS protein fragment, and an affinity of at least about 100 nM for a corresponding full-length AARS polypeptide. In some embodiments, the antibody binds to an epitope located within an AARS polypeptide unique splice junction as set forth in any of Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, or to an amino acid sequence C-terminal of this splice site. In certain embodiments, the antibody antagonizes the non-canonical activity of the AARS protein fragment. Such antagonists may optionally bind the corresponding parental or full-length AARS.

[0021] Other aspects relate to bioassay systems, comprising a substantially pure aminoacyl-tRNA synthetase (AARS) protein fragment of at least 100 amino acids that comprises an amino acid sequence as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, and a binding partner that binds to the AARS protein fragment. In one aspect, the binding partner is selected from the group consisting of a cellular surface receptor protein, nucleic acid, lipid membrane, cell regulatory protein, enzyme, and transcription factor. Optionally, such a receptor may be part of a cell, preferably a cell relevant to the revealed biology of the resectin.

[0022] Certain embodiments include cellular compositions, comprising an isolated aminoacyl-tRNA synthetase (AARS) protein fragment of at least 100 amino acids that comprises an amino acid sequence as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, and an engineered population of cells in which at least one cell comprises a polynucleotide encoding said AARS protein fragment. In one aspect, the cells are capable of growing in a serum free medium.

[0023] Also included are detection systems, comprising a substantially pure aminoacyl-tRNA synthetase (AARS) protein fragment of at least 50 or 100 amino acids that comprises an amino acid sequence as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, a cell that comprises a cell-surface receptor or an extracellular portion thereof that binds to the protein fragment, and a molecule of less than about 2000 daltons, or a second polypeptide, which modulates binding or interaction between the AARS protein fragment and the extracellular receptor.

[0024] Particular embodiments include diagnostic systems, comprising a substantially pure aminoacyl-tRNA synthetase (AARS) protein fragment of at least 100 amino acids that comprises an amino acid sequence as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, and a cell that comprises a cell-surface receptor or an extracellular portion thereof that binds to the AARS protein fragment, wherein the system or cell comprises an indicator molecule that allows detection of a change in the levels or activity of the cell-surface receptor or extracellular portion thereof.

[0025] Certain embodiments include cellular growth devices, comprising an isolated aminoacyl-tRNA synthetase (AARS) protein fragment of at least 100 amino acids that comprises an amino acid sequence as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, an engineered population of cells in which at least one cell comprises a polynucleotide encoding said AARS protein fragment, at least about 10 liters of serum-free cell media, and a sterile container. In specific embodiments, the cells utilized for any of the methods or compositions described herein are capable of growing in serum-free media, optionally with an antibiotic and an inducer.

[0026] Some embodiments relate to antisense or RNA interference (RNAi) agents, comprising a sequence that is targeted against a unique splice junction of an AARS splice variant as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9.

[0027] Also included are therapeutic compositions, comprising an isolated aminoacyl-tRNA synthetase (AARS) protein fragment of at least 100 amino acids that comprises an amino acid sequence as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, wherein the protein fragment specifically binds to a binding partner and has a solubility of at least about 5 mg/ml, and wherein the composition has a purity of at least about 95% on a protein basis. In some aspects, the composition may have less than 10 EU endotoxin/mg protein.

[0028] Also included are compositions, comprising an isolated aminoacyl-tRNA synthetase (AARS) protein fragment of at least 100 amino acids that is at least 80%, 85%, 90%, 95%, 98%, or 100% identical to an amino acid sequence set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, wherein the protein fragment has a solubility of at least about 5 mg/ml, and wherein the composition has a purity of at least about 95% on a protein basis and less than 10 EU endotoxin/mg protein. In any of these embodiments, the compositions may comprise an AARS protein fragment that is at least about 50%, about 60%, about 70%, about 80%, about 90% or about 95% monodisperse with respect to its apparent molecular mass. In another aspect of any of these embodiments, the compositions comprise less than about 10% (on a protein basis) high molecular weight aggregated proteins, or less than about 5% high molecular weight aggregated proteins, or less than about 4% high molecular weight aggregated proteins, or less than about 3% high molecular weight aggregated proteins, or less than 2% high molecular weight aggregated proteins, or less than about 1% high molecular weight aggregated proteins.

[0029] In another aspect of any of these embodiments, the compositions exhibits less than about 10% aggregation when stored at a concentration of at least 10 mg/mL in PBS for one week at 4.degree. C., or less than about 5% aggregation when stored at a concentration of at least 10 mg/mL in PBS for one week at 4.degree. C., or less than about 3% aggregation when stored at a concentration of at least 10 mg/mL in PBS for one week at 4.degree. C., or less than about 2% aggregation when stored at a concentration of at least 10 mg/mL in PBS for one week at 4.degree. C., or less than about 1% aggregation when stored at a concentration of at least 10 mg/mL in PBS for one week at 4.degree. C.

[0030] Certain embodiments include compositions, comprising a substantially pure aminoacyl-tRNA synthetase (AARS) protein fragment of at least 100 amino acids that comprises an amino acid sequence as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, and at least one covalently or non-covalently moiety attached thereto. In some embodiments, the moiety is a detectable label. In some embodiments, the moiety is a water soluble polymer. In some embodiments, the moiety is PEG. In one aspect of any of these embodiments, the moiety is attached to the N-terminus of the protein fragment. In one aspect of any of these embodiments, the moiety is attached to the C-terminus of the protein fragment.

[0031] Particular embodiments include compositions, comprising a solid substrate attached to an isolated aminoacyl-tRNA synthetase (AARS) protein fragment of at least 100 amino acids that comprises an amino acid sequence as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, or a biologically active fragment or variant thereof, wherein the protein fragment has a solubility of at least about 5 mg/ml, and the composition has a purity of at least about 95% on a protein basis.

[0032] Also included are compositions, comprising a binding agent that specifically binds to an isolated aminoacyl-tRNA synthetase (AARS) protein fragment as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, wherein the binding agent has an affinity of at least about 1 nM for the protein fragment. In one aspect, the binding agent binds to an epitope located within an AARS polypeptide unique splice junction as set forth in any of Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, or to an amino acid sequence C-terminal of this splice site. In some embodiments, the binding agent antagonizes a non-canonical activity of the AARS polypeptide.

[0033] Certain embodiments include isolated aminoacyl-tRNA synthetase (AARS) polypeptides, comprising an amino acid sequence of an AARS protein fragment as described herein, an amino acid sequence encoded by an AARS polynucleotide as described herein, or a variant or fragment thereof. Certain AARS polypeptides comprise an amino acid sequence that is at least 80%, 85%, 90%, 95%, 98%, or 100% identical to an AARS reference sequence as disclosed in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, or Table E2. Certain AARS polypeptides consist essentially of an amino acid sequence that is at least 80%, 85%, 90%, 95%, 98%, or 100% identical to an AARS reference sequence as disclosed in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, or Table E2. In certain embodiments, the polypeptide comprises a non-canonical biological activity. In specific embodiments, the non-canonical biological activity is selected from modulation of cell signaling (e.g., extracellular signaling), modulation of cell proliferation, modulation of cell migration, modulation of cell differentiation, modulation of apoptosis or cell death, modulation of angiogenesis, modulation of cell binding, modulation of cellular metabolism, modulation of cellular uptake, modulation of gene transcription, or secretion, modulation of cytokine production or activity, modulation of cytokine receptor activity, and modulation of inflammation.

[0034] Other aspects include antibodies and other binding agents that exhibit binding specificity for an isolated AARS polypeptide as described herein, a binding partner of the AARS polypeptide, or the complex of both. In some embodiments, the affinity of the antibody or binding agent for the AARS polypeptide is about 10.times. stronger than its affinity for a corresponding full-length AARS polypeptide. In specific embodiments, the binding agent is selected from a peptide, peptide mimetic, an adnectin, an aptamer, and a small molecule. In certain embodiments, the antibody or binding agent antagonizes a non-canonical activity of the AARS polypeptide. In other embodiments, the antibody or binding agent agonizes a non-canonical activity of the AARS polypeptide.

[0035] Certain embodiments include isolated aminoacyl-tRNA synthetase (AARS) polynucleotides, comprising a nucleotide sequence of an AARS polynucleotide as described herein, a nucleotide sequence that encodes an AARS protein fragment as described herein, or a variant, a fragment, or a complement thereof. Certain AARS polynucleotides comprise a nucleotide sequence that is at least 80%, 85%, 90%, 95%, 98%, or 100% identical to an AARS reference polynucleotide, or a complement thereof, as disclosed in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, or Table E2. In some embodiments, the nucleotide sequence is codon optimized for bacterial expression. In one aspect, the nucleotide sequence is at least 80% identical a polynucleotide sequence disclosed in Table E2.

[0036] Specific AARS polynucleotides consist essentially of a nucleotide sequence that is at least 80%, 85%, 90%, 95%, 98%, or 100% identical to an AARS reference polynucleotide, or a complement thereof, as disclosed in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, or Table E2. Other AARS polynucleotides comprise or consist essentially of a nucleotide sequence that specifically hybridizes to an AARS reference polynucleotide, as disclosed in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, or Table E2. In certain embodiments, the polynucleotide is selected from a primer, a probe, and an antisense oligonucleotide. In specific embodiments, the primer, probe, or antisense oligonucleotide is targeted to a specific or unique splice junction, and/or sequence 3' of this splice site within an AARS polynucleotide.

[0037] Certain embodiments include methods of determining presence or levels of an AARS protein fragment in a sample, comprising contacting the sample with one or more binding agents that specifically bind to an AARS protein fragment as described herein, detecting the presence or absence of the binding agent, and thereby determining the presence or levels of the AARS protein fragment. Other embodiments include methods of determining presence or levels of an AARS protein fragment in a sample, comprising analyzing the sample with a detector that is capable of specifically identifying a protein fragment as described herein, and thereby determining the presence or levels of the AARS protein fragment. In specific embodiments, the detector is a mass spectrometer (MS), a flow cytometer, a protein imaging device, an enzyme-linked immunosorbent assays (ELISA), or a protein microarray. Certain embodiments comprise comparing the presence or levels of the AARS protein fragment to a control sample or a predetermined value. Certain embodiments comprise characterizing the state of the sample to distinguish it from the control. In specific embodiments, the sample and control comprise a cell or tissue, and the method comprises distinguishing between cells or tissues of different species, cells of different tissues or organs, cells at different cellular developmental states, cells at different cellular differentiation states, cells at different physiological states, or healthy and diseased cells. For instance, selected resectins may be more abundant under conditions such as stress or insult.

[0038] Certain embodiments include discovery methods of, and related compositions for, identifying a compound that specifically binds to an aminoacyl-tRNA synthetase (AARS) polypeptide as described herein, or one or more of its cellular binding partners, comprising a) combining the AARS polypeptide or its cellular binding partner or both with at least one test compound under suitable conditions, and b) detecting binding of the AARS polypeptide or its cellular binding partner or both to the test compound, thereby identifying a compound that specifically binds to the AARS polypeptide or its cellular binding partner or both. In certain embodiments, the test compound is a polypeptide or peptide, an antibody or antigen-binding fragment thereof, a peptide mimetic, or a small molecule. In certain embodiments, the test compound agonizes a non-canonical biological activity of the AARS polypeptide or its cellular binding partner. In other embodiments, the test compound antagonizes a non-canonical biological activity of the AARS polypeptide or its cellular binding partner. Certain embodiments include a compound identified by the above-method, such as an agonist (e.g., small molecule, peptide).

[0039] Certain embodiments include methods of determining presence or levels of a polynucleotide sequence of an AARS splice variant in a sample, comprising contacting the sample with one or more oligonucleotides that specifically hybridize to an AARS polynucleotide as described herein, detecting the presence or absence of the oligonucleotides in the sample, and thereby determining the presence or levels of the polynucleotide sequence of the AARS splice variant. Other embodiments include methods of determining presence or levels of a polynucleotide sequence of an AARS splice variant in a sample, comprising contacting the sample with at least two oligonucleotides that specifically amplify an AARS polynucleotide as described herein, performing an amplification reaction, detecting the presence or absence of an amplified product, and thereby determining presence or levels of the polynucleotide sequence of the AARS splice variant. In specific embodiments, the oligonucleotide(s) specifically hybridize to or specifically amplify a splice junction that is unique to the AARS splice variant. Certain embodiments include comparing the presence or levels of the AARS protein fragment or splice variant to a control sample or a predetermined value. Certain embodiments include characterizing the state of the sample to distinguish it from the control. In specific embodiments, the sample and control comprise a cell or tissue, and the method comprises distinguishing between cells or tissues of different species, cells of different tissues or organs, cells at different cellular developmental states, cells at different cellular differentiation states, or healthy and diseased cells.

[0040] Some embodiments include pharmaceutical compositions, comprising an AARS polynucleotide described herein, an AARS polypeptide described herein, a binding agent as described herein, or a compound identified by the above-method or described herein, and a pharmaceutically acceptable excipient or carrier.

[0041] Certain embodiments include methods of modulating a cellular activity of a cell, comprising contacting the cell with an AARS polynucleotide described herein, an AARS polypeptide described herein, a binding agent described herein, a compound of the above-method or described herein, or a pharmaceutical composition described herein. In specific embodiments, the cellular activity is selected from cell proliferation, cell migration, cell differentiation, apoptosis or cell death, cell signaling, angiogenesis, cell binding, cellular uptake, cell secretion, metabolism, cytokine production or activity, cytokine receptor activity, gene transcription, and inflammation. In one aspect, the cell is selected from the group consisting of pre-adipocytes, bone marrow, neutrophils, blood cells, hepatocytes, astrocytes, mesenchymal stem cells, and skeletal muscle cells.

[0042] In certain embodiments, the cell is in a subject. Certain embodiments comprise treating the subject, wherein the subject has a condition associated with a neoplastic disease, an immune system disease or condition, an infectious disease, a metabolic disease, an inflammatory disorder, neuronal/neurological disease, a muscular/cardiovascular disease, a disease associated with aberrant hematopoiesis, a disease associated with aberrant angiogenesis, or a disease associated with aberrant cell survival.

[0043] Also included are processes for manufacturing a pharmaceutical compound, comprising: a) performing an in vitro screen of one or more candidate compounds in the presence an AARS protein fragment of at least 100 amino acids that comprises an amino acid sequence as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, to identify a compound that specifically binds to the AARS protein fragment; b) performing a cell-based or biochemical or receptor assay with the compound identified in step a), to identify a compound that modulates one or more non-canonical activities of the AARS protein fragment; c) optionally assessing the structure-activity relationship (SAR) of the compound identified in step b), to correlate its structure with modulation of the non-canonical activity, and optionally derivatizing the compound to alter its ability to modulate the non-canonical activity; and d) producing sufficient amounts of the compound identified in step b), or the derivatized compound in step c), for use in humans, thereby manufacturing the pharmaceutical compound.

[0044] Other embodiments include processes for manufacturing a pharmaceutical compound, comprising: a) performing an in vitro screen of one or more candidate compounds in the presence a cell-surface receptor or an extracellular portion thereof that specifically binds to an AARS protein fragment of Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, to identify a compound that specifically binds to the cell-surface receptor or extracellular portion thereof; b) performing a cell-based or biochemical or receptor assay with the compound identified in step a), to identify a compound that modulates one or more non-canonical activities of the AARS protein fragment; c) optionally assessing the structure-activity relationship (SAR) of the compound identified in step b), to correlate its structure with modulation of the non-canonical activity, and optionally derivatizing the compound to alter its ability to modulate the non-canonical activity; and d) producing sufficient amounts of the compound identified in step b), or the derivatized compound in step c), for use in humans, thereby manufacturing the pharmaceutical compound.

[0045] Some embodiments include a cellular composition, comprising an engineered population of cells in which at least one cell comprises a polynucleotide encoding a heterologous full length aminoacyl-tRNA synthetase (AARS) protein, wherein the cells are capable of growing in a serum-free medium. In one aspect, the full length aminoacyl-tRNA synthetase (AARS) protein comprises a heterologous purification or epitope tag to facilitate purification of an AARS protein fragment. In another aspect, the full length aminoacyl-tRNA synthetase (AARS) protein comprises a heterologous proteolysis site to enable production of the AARS protein fragment upon cleavage.

[0046] Some embodiments include a method for producing an AARS polypeptide as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, or Table E2 in situ within a cell, comprising; i) expressing a heterologous full length aminoacyl-tRNA synthetase (AARS) protein within the cell, wherein the cell comprises a protease capable of cleaving the heterologous full length aminoacyl-tRNA synthetase (AARS) protein to produce the AARS polypeptide.

[0047] Some embodiments include a method for producing an AARS polypeptide as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, or Table E2 comprising contacting an isolated full length aminoacyl-tRNA synthetase (AARS) protein with a protease that is capable of cleaving the full length aminoacyl-tRNA synthetase (AARS) protein and producing an AARS polypeptide.

[0048] Some embodiments include an engineered full length aminoacyl-tRNA synthetase (AARS) protein comprising a heterologous proteolysis site to enable the proteolytic generation of an AARS protein fragment as set forth in any of Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9 or Table E2.

[0049] Some embodiments include a composition, comprising an isolated full length aminoacyl-tRNA synthetase protein, wherein the composition has a purity of at least about 95% on a protein basis, less than about 10 EU endotoxin/mg protein, and is substantially serum free. In one aspect, the full length aminoacyl-tRNA synthetase protein is present at a concentration of at least 10 mg/mL, and is at least 90% monodisperse.

[0050] A further embodiment includes a method of treating a disease or disorder mediated by the dysregulation of the expression, activity or spatiotemporal location of a tRNA synthetase via the administration of an AARS protein fragment, or nucleic acid encoding the ARRS protein fragment, as set forth in any of Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, or Table E2. In one aspect of this embodiment, the disease is selected cancer, neuropathy, diabetes, and inflammatory disorders.

DETAILED DESCRIPTION OF THE INVENTION

TABLE-US-00001

[0051] TABLE OF CONTENTS I. OVERVIEW 15 II. DEFINITIONS 15 III. PURIFIED AARS PROTEIN FRAGMENTS 28 AND VARIANTS IV. AARS POLYNUCLEOTIDES 87 V. ANTIBODIES 99 VI. ANTIBODY ALTERNATIVES AND OTHER 104 BINDING AGENTS VII. BIOASSAYS AND ANALYTICAL ASSAYS 109 VIII. EXPRESSION AND PURIFICATION SYSTEMS 111 IX. DIAGNOSTIC METHODS AND COMPOSITIONS 124 X. ANTISENSE AND RNAI AGENTS 139 A. ANTISENSE AGENTS 140 B. RNA INTERFERENCE AGENTS 148 XI. DRUG DISCOVERY 156 XII. METHODS OF USE 164 XIII. PHARMACEUTICAL FORMULATIONS, 168 ADMINISTRATION AND KITS XIV. EXAMPLES 177

I. Overview

[0052] The current invention is directed, at least in part, to the discovery of novel AARS polypeptides, and methods for their preparation and use, that represent the transformation of native wild type proteins into new forms that exhibit markedly different characteristics compared to the naturally occurring full length Alanyl tRNA synthetase genes. Such AARS polypeptides were identified based on extensive sequence, and mass spectrum analysis of expressed Alanyl tRNA synthetase in different tissues, followed by the systematic production and testing of each potential AARS polypeptide to identify protein sequences that represent stable and soluble protein domains which exhibit novel biological activities.

[0053] Based on this analysis at least two novel families of AARS polypeptides derived from Alanyl tRNA synthetase have been identified.

[0054] In one aspect, such Alanyl tRNA synthetase derived AARS polypeptides comprise polypeptide sequences comprising approximately the first 400 to 530 amino acids of Alanyl tRNA synthetase.

[0055] In a second aspect, such Alanyl tRNA synthetase derived AARS polypeptides comprise polypeptide sequences comprising approximately the last 221 to 210 amino acids of Alanyl tRNA synthetase.

[0056] These new AARS polypeptide families represent novel, previously unknown protein products which exhibit inter alia i) novel biological activity, ii) favorable protein stability and aggregation characteristics, and iii) the ability to expressed and produced at high level in prokaryotic expression systems, which are materially different from the intact wild type protein.

II. Definitions

[0057] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by those of ordinary skill in the art to which the invention belongs. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, preferred methods and materials are described. For the purposes of the present invention, the following terms are defined below.

[0058] The articles "a" and "an" are used herein to refer to one or to more than one (i.e., to at least one) of the grammatical object of the article. By way of example, "an element" means one element or more than one element.

[0059] By "about" is meant a quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length that varies by as much as 30, 25, 20, 25, 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1% to a reference quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length.

[0060] An "agonist" refers to a molecule that intensifies or mimics an activity. For example, a non-canonical biological activity of an AARS, or another protein. Agonists may include proteins, nucleic acids, carbohydrates, small molecules, or any other compound or composition that modulates the activity of an AARS either by directly interacting with the AARS or its binding partner, or by acting on components of the biological pathway in which the AARS participates. Included are partial and full agonists.

[0061] As used herein, the term "amino acid" is intended to mean both naturally occurring and non-naturally occurring amino acids as well as amino acid analogs and mimetics. Naturally occurring amino acids include the 20 (L)-amino acids utilized during protein biosynthesis as well as others such as 4-hydroxyproline, hydroxylysine, desmosine, isodesmosine, homocysteine, citrulline and ornithine, for example. Non-naturally occurring amino acids include, for example, (D)-amino acids, norleucine, norvaline, p-fluorophenylalanine, ethionine and the like, which are known to a person skilled in the art. Amino acid analogs include modified forms of naturally and non-naturally occurring amino acids. Such modifications can include, for example, substitution or replacement of chemical groups and moieties on the amino acid or by derivitization of the amino acid. Amino acid mimetics include, for example, organic structures which exhibit functionally similar properties such as charge and charge spacing characteristic of the reference amino acid. For example, an organic structure which mimics Arginine (Arg or R) would have a positive charge moiety located in similar molecular space and having the same degree of mobility as the e-amino group of the side chain of the naturally occurring Arg amino acid. Mimetics also include constrained structures so as to maintain optimal spacing and charge interactions of the amino acid or of the amino acid functional groups. Those skilled in the art know or can determine what structures constitute functionally equivalent amino acid analogs and amino acid mimetics.

[0062] In certain aspects, the use of non-natural amino acids can be utilized to modify (e.g., increase) a selected non-canonical activity of an AARS protein fragment, or to alter the in vivo or in vitro half-life of the protein. Non-natural amino acids can also be used to facilitate (selective) chemical modifications (e.g., pegylation) of an AARS protein. For instance, certain non-natural amino acids allow selective attachment of polymers such as PEG to a given protein, and thereby improve their pharmacokinetic properties.

[0063] Specific examples of amino acid analogs and mimetics can be found described in, for example, Roberts and Vellaccio, The Peptides: Analysis, Synthesis, Biology, Eds. Gross and Meinhofer, Vol. 5, p. 341, Academic Press, Inc., New York, N.Y. (1983), the entire volume of which is incorporated herein by reference. Other examples include peralkylated amino acids, particularly permethylated amino acids. See, for example, Combinatorial Chemistry, Eds. Wilson and Czarnik, Ch. 11, p. 235, John Wiley & Sons Inc., New York, N.Y. (1997), the entire book of which is incorporated herein by reference. Yet other examples include amino acids whose amide portion (and, therefore, the amide backbone of the resulting peptide) has been replaced, for example, by a sugar ring, steroid, benzodiazepine or carbo cycle. See, for instance, Burger's Medicinal Chemistry and Drug Discovery, Ed. Manfred E. Wolff, Ch. 15, pp. 619-620, John Wiley & Sons Inc., New York, N.Y. (1995), the entire book of which is incorporated herein by reference. Methods for synthesizing peptides, polypeptides, peptidomimetics and proteins are well known in the art (see, for example, U.S. Pat. No. 5,420,109; M. Bodanzsky, Principles of Peptide Synthesis (1st ed. & 2d rev. ed.), Springer-Verlag, New York, N.Y. (1984 & 1993), see Chapter 7; Stewart and Young, Solid Phase Peptide Synthesis, (2d ed.), Pierce Chemical Co., Rockford, Ill. (1984), each of which is incorporated herein by reference). Accordingly, the AARS polypeptides of the present invention may be composed of naturally occurring and non-naturally occurring amino acids as well as amino acid analogs and mimetics.

[0064] The term "antagonist" refers to a molecule that reduces or attenuates an activity. For example, a non-canonical biological activity of an AARS, or another protein. Antagonists may include proteins such as antibodies, nucleic acids, carbohydrates, small molecules, or any other compound or composition that modulates the activity of an AARS or its binding partner, either by directly interacting with the AARS or its binding partner or by acting on components of the biological pathway in which the AARS participates. Included are partial and full antagonists.

[0065] The term "aminoacyl-tRNA synthetase" (AARS) refers generally to enzymes that in their natural or wild-type form are capable of catalyzing the esterification of a specific amino acid or its precursor to one of all its compatible cognate tRNAs to form an aminoacyl-tRNA. In this "canonical" activity, aminoacyl-tRNA synthetases catalyze a two-step reaction: first, they activate their respective amino acid by forming an aminoacyl-adenylate, in which the carboxyl of the amino acid is linked in to the alpha-phosphate of ATP by displacing pyrophosphate, and then, when the correct tRNA is bound, the aminoacyl group of the aminoacyl-adenylate is transferred to the 2' or 3' terminal OH of the tRNA.

[0066] Class I aminoacyl-tRNA synthetases typically have two highly conserved sequence motifs. These enzymes aminoacylate at the 2'-OH of an adenosine nucleotide, and are usually monomeric or dimeric. Class II aminoacyl-tRNA synthetases typically have three highly conserved sequence motifs. These enzymes aminoacylate at the 3'-OH of the same adenosine, and are usually dimeric or tetrameric. The active sites of class II enzymes are mainly made up of a seven-stranded anti-parallel .beta.-sheet flanked by .alpha.-helices. Although phenylalanine-tRNA synthetase is class II, it aminoacylates at the 2'-OH.

[0067] AARS polypeptides include sources of mitochondrial and cytoplasmic forms of tyrosyl-tRNA synthetase (TyrRS), a tryptophanyl-tRNA synthetase (TrpRS), a glutaminyl-tRNA synthetase (GlnRS), a glycyl-tRNA synthetase (GlyRS), a histidyl-tRNA synthetase (HisRS), a seryl-tRNA synthetase (SerRS), a phenylalanyl-tRNA synthetase (PheRS), an alanyl-tRNA synthetase (AlaRS), an asparaginyl-tRNA synthetase (AsnRS), an aspartyl-tRNA synthetase (AspRS), a cysteinyl-tRNA synthetase (CysRS), a glutamyl-tRNA synthetase (GluRS), a prolyl-tRNA synthetase (ProRS), an arginyl-tRNA synthetase (ArgRS), an isoleucyl-tRNA synthetase (IleRS), a leucyl-tRNA synthetase (LeuRS), a lysyl-tRNA synthetase (LysRS), a threonyl-tRNA synthetase (ThrRS), a methionyl-tRNA synthetases (MetRS), or a valyl-tRNA synthetase (ValRS). The wild-type or parental sequences of these AARS polypeptides are known in the art.

[0068] By "coding sequence" is meant any nucleic acid sequence that contributes to the code for the polypeptide product of a gene. By contrast, the term "non-coding sequence" refers to any nucleic acid sequence that does not contribute to the code for the polypeptide product of a gene.

[0069] Throughout this specification, unless the context requires otherwise, the words "comprise," "comprises," and "comprising" will be understood to imply the inclusion of a stated step or element or group of steps or elements but not the exclusion of any other step or element or group of steps or elements.

[0070] By "consisting of" is meant including, and limited to, whatever follows the phrase "consisting of" Thus, the phrase "consisting of" indicates that the listed elements are required or mandatory, and that no other elements may be present. By "consisting essentially of" is meant including any elements listed after the phrase, and limited to other elements that do not interfere with or contribute to the activity or action specified in the disclosure for the listed elements. Thus, the phrase "consisting essentially of" indicates that the listed elements are required or mandatory, but that other elements are optional and may or may not be present depending upon whether or not they materially affect the activity or action of the listed elements.

[0071] The recitation "endotoxin free" or "substantially endotoxin free" relates generally to compositions, solvents, and/or vessels that contain at most trace amounts (e.g., amounts having no clinically adverse physiological effects to a subject) of endotoxin, and preferably undetectable amounts of endotoxin. Endotoxins are toxins associated with certain bacteria, typically gram-negative bacteria, although endotoxins may be found in gram-positive bacteria, such as Listeria monocytogenes. The most prevalent endotoxins are lipopolysaccharides (LPS) or lipo-oligo-saccharides (LOS) found in the outer membrane of various Gram-negative bacteria, and which represent a central pathogenic feature in the ability of these bacteria to cause disease. Small amounts of endotoxin in humans may produce fever, a lowering of the blood pressure, and activation of inflammation and coagulation, among other adverse physiological effects.

[0072] Therefore, in pharmaceutical production of AARS polypeptides, it is often desirable to remove most or all traces of endotoxin from drug products and/or drug containers, because even small amounts may cause adverse effects in humans. A depyrogenation oven may be used for this purpose, as temperatures in excess of 300.degree. C. are typically required to break down most endotoxins. For instance, based on primary packaging material such as syringes or vials, the combination of a glass temperature of 250.degree. C. and a holding time of 30 minutes is often sufficient to achieve a 3 log reduction in endotoxin levels. Other methods of removing endotoxins are contemplated, including, for example, chromatography and filtration methods, as described herein and known in the art. Also included are methods of producing AARS polypeptides in, and isolating them from, eukaryotic cells such as mammalian cells, to reduce if not eliminate the risk of endotoxins being present in a composition of the invention. Preferred are methods of producing AARS polypeptides in and isolating them from serum free cells. Such compositions comprising AARS polypeptides, represent new formulations which exhibit novel and new biological and therapeutic characteristics not found in AARS polypeptide compositions contaminated with serum or endotoxin which have the potential to bind to and alter the novel biological properties of the AARS polypeptides.

[0073] Endotoxins can be detected using routine techniques known in the art. For example, the Limulus Ameobocyte Lysate assay, which utilizes blood from the horseshoe crab, is a very sensitive assay for detecting presence of endotoxin, and reagents, kits and instrumentation for the detection of endotoxin based on this assay are commercially available, for example from the Lonza Group. In this test, very low levels of LPS can cause detectable coagulation of the limulus lysate due a powerful enzymatic cascade that amplifies this reaction. Endotoxins can also be quantitated by enzyme-linked immunosorbent assay (ELISA). To be substantially endotoxin free, endotoxin levels may be less than about 0.001, 0.005, 0.01, 0.02, 0.03, 0.04, 0.05, 0.06, 0.08, 0.09, 0.1, 0.5, 1.0, 1.5, 2, 2.5, 3, 4, 5, 6, 7, 8, 9, or 10 EU/mg of protein. Typically, 1 ng lipopolysaccharide (LPS) corresponds to about 1-10 EU.

[0074] In certain embodiments, the "purity" of any given agent (e.g., AARS protein fragment) in a composition may be specifically defined. For instance, certain compositions may comprise an agent that is at least 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% pure, including all decimals in between, as measured, for example and by no means limiting, by high pressure liquid chromatography (HPLC), a well-known form of column chromatography used frequently in biochemistry and analytical chemistry to separate, identify, and quantify compounds.

[0075] As used herein, the terms "function" and "functional" and the like refer to a biological, enzymatic, or therapeutic function.

[0076] By "gene" is meant a unit of inheritance that may occupy a specific locus on a chromosome and consists of transcriptional and/or translational regulatory sequences and/or a coding region and/or non-translated sequences (i.e., introns, 5' and 3' untranslated sequences).

[0077] "Homology" refers to the percentage number of amino acids that are identical or constitute conservative substitutions. Homology may be determined using sequence comparison programs such as GAP (Deveraux et al., 1984, Nucleic Acids Research 12, 387-395), which is incorporated herein by reference. In this way sequences of a similar or substantially different length to those cited herein could be compared by insertion of gaps into the alignment, such gaps being determined, for example, by the comparison algorithm used by GAP.

[0078] The term "host cell" includes an individual cell or cell culture that can be or has been a recipient of any recombinant vector(s), isolated polynucleotide, or polypeptide of the invention. Host cells include progeny of a single host cell, and the progeny may not necessarily be completely identical (in morphology or in total DNA complement) to the original parent cell due to natural, accidental, or deliberate mutation and/or change. A host cell includes cells transfected or infected in vivo or in vitro with a recombinant vector or a polynucleotide of the invention. A host cell which comprises a recombinant vector of the invention is a recombinant host cell.

[0079] By "isolated" is meant material that is substantially or essentially free from components that normally accompany it in its native state. For example, an "isolated polynucleotide," as used herein, includes a polynucleotide that has been purified from the sequences that flank it in its naturally-occurring state, e.g., a DNA fragment which has been removed from the sequences that are normally adjacent to the fragment. Alternatively, an "isolated peptide" or an "isolated polypeptide" and the like, as used herein, includes the in vitro isolation and/or purification of a peptide or polypeptide molecule from its natural cellular environment, and from association with other components of the cell; i.e., it is not significantly associated with in vivo substances.

[0080] The term "mRNA" or sometimes refer by "mRNA transcripts" as used herein, include, but not limited to pre-mRNA transcript(s), transcript processing intermediates, mature mRNA(s) ready for translation and transcripts of the gene or genes, or nucleic acids derived from the mRNA transcript(s). Transcript processing may include splicing, editing and degradation. As used herein, a nucleic acid derived from an mRNA transcript refers to a nucleic acid for whose synthesis the mRNA transcript or a subsequence thereof has ultimately served as a template. A cDNA reverse transcribed from an mRNA, an RNA transcribed from that cDNA, a DNA amplified from the cDNA, an RNA transcribed from the amplified DNA, etc., are all derived from the mRNA transcript and detection of such derived products is indicative of the presence and/or abundance of the original transcript in a sample. Thus, mRNA derived samples include, but are not limited to, mRNA transcripts of the gene or genes, cDNA reverse transcribed from the mRNA, cRNA transcribed from the cDNA, DNA amplified from the genes, RNA transcribed from amplified DNA, and the like.

[0081] "Non-canonical" activity as used herein, refers generally to either i) a new activity possessed by an AARS polypeptide of the invention that is not possessed to any significant degree by the intact native full length parental protein, or ii) an activity that was possessed by the by the intact native full length parental protein, where the AARS polypeptide either exhibits a significantly higher (i.e. at least 20% greater) specific activity compared to the intact native full length parental protein, or exhibits the activity in a new context; for example by isolating the activity from other activities possessed by the intact native full length parental protein. In the case of AARS polypeptides, non-limiting examples of non-canonical activities include extracellular signaling, RNA-binding, amino acid-binding, modulation of cell proliferation, modulation of cell migration, modulation of cell differentiation (e.g., hematopoiesis, neurogenesis, myogenesis, osteogenesis, and adipogenesis), modulation of gene transcription, modulation of apoptosis or other forms of cell death, modulation of cell signaling, modulation of cellular uptake, or secretion, modulation of angiogenesis, modulation of cell binding, modulation of cellular metabolism, modulation of cytokine production or activity, modulation of cytokine receptor activity, modulation of inflammation, and the like.

[0082] The term "half maximal effective concentration" or "EC.sub.50" refers to the concentration of an AARS protein fragment, antibody or other agent described herein at which it induces a response halfway between the baseline and maximum after some specified exposure time; the EC.sub.50 of a graded dose response curve therefore represents the concentration of a compound at which 50% of its maximal effect is observed. In certain embodiments, the EC.sub.50 of an agent provided herein is indicated in relation to a "non-canonical" activity, as noted above. EC.sub.50 also represents the plasma concentration required for obtaining 50% of a maximum effect in vivo. Similarly, the "EC.sub.90" refers to the concentration of an agent or composition at which 90% of its maximal effect is observed. The "EC.sub.90" can be calculated from the "EC.sub.50" and the Hill slope, or it can be determined from the data directly, using routine knowledge in the art. In some embodiments, the EC.sub.50 of an AARS protein fragment, antibody, or other agent is less than about 0.01, 0.05, 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 40, 50, 60, 70, 80, 90, or 100 nM. Preferably, biotherapeutic composition will have an EC.sub.50 value of about 1 nM or less.

[0083] The term "modulating" includes "increasing" or "stimulating," as well as "decreasing" or "reducing," typically in a statistically significant or a physiologically significant amount as compared to a control. Accordingly a "modulator" may be an agonist, an antagonist, or any mixture thereof depending upon the conditions used. An "increased" or "enhanced" amount is typically a "statistically significant" amount, and may include an increase that is 1.1, 1.2, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30 or more times (e.g., 500, 1000 times) (including all integers and decimal points in between and above 1, e.g., 1.5, 1.6, 1.7, 1.8, etc.) the amount produced by no composition (the absence of an agent or compound) or a control composition. A "decreased" or reduced amount is typically a "statistically significant" amount, and may include a 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100% decrease in the amount produced by no composition (the absence of an agent or compound) or a control composition, including all integers in between. As one non-limiting example, a control in comparing canonical and non-canonical activities could include the AARS protein fragment of interest compared to its corresponding full-length AARS, or a fragment AARS having comparable canonical activity to its corresponding full-length AARS. Other examples of "statistically significant" amounts are described herein.

[0084] By "obtained from" is meant that a sample such as, for example, a polynucleotide extract or polypeptide extract is isolated from, or derived from, a particular source of the subject. For example, the extract can be obtained from a tissue or a biological fluid isolated directly from the subject. "Derived" or "obtained from" can also refer to the source of a polypeptide or polynucleotide sequence. For instance, an AARS sequence of the present invention may be "derived" from the sequence information of an AARS proteolytic fragment or AARS splice variant, or a portion thereof, whether naturally-occurring or artificially generated, and may thus comprise, consist essentially of, or consist of that sequence.

[0085] The terms "polypeptide" and "protein" are used interchangeably herein to refer to a polymer of amino acid residues and to variants and synthetic and naturally occurring analogues of the same. Thus, these terms apply to amino acid polymers in which one or more amino acid residues are synthetic non-naturally occurring amino acids, such as a chemical analogue of a corresponding naturally occurring amino acid, as well as to naturally-occurring amino acid polymers and naturally occurring chemical derivatives thereof. Such derivatives include, for example, post-translational modifications and degradation products including pyroglutamyl, iso-aspartyl, proteolytic, phosphorylated, glycosylated, oxidatized, isomerized, and deaminated variants of the AARS reference fragment.

[0086] The recitations "sequence identity" or, for example, comprising a "sequence 50% identical to," as used herein, refer to the extent that sequences are identical on a nucleotide-by-nucleotide basis or an amino acid-by-amino acid basis over a window of comparison. Thus, a "percentage of sequence identity" may be calculated by comparing two optimally aligned sequences over the window of comparison, determining the number of positions at which the identical nucleic acid base (e.g., A, T, C, G, I) or the identical amino acid residue (e.g., Ala, Pro, Ser, Thr, Gly, Val, Leu, Ile, Phe, Tyr, Trp, Lys, Arg, His, Asp, Glu, Asn, Gln, Cys and Met) occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison (i.e., the window size), and multiplying the result by 100 to yield the percentage of sequence identity.

[0087] Terms used to describe sequence relationships between two or more polynucleotides or polypeptides include "reference sequence," "comparison window," "sequence identity," "percentage of sequence identity" and "substantial identity." A "reference sequence" is at least 12 but frequently 15 to 18 and often at least 25 monomer units, inclusive of nucleotides and amino acid residues, in length. Because two polynucleotides may each comprise (1) a sequence (i.e., only a portion of the complete polynucleotide sequence) that is similar between the two polynucleotides, and (2) a sequence that is divergent between the two polynucleotides, sequence comparisons between two (or more) polynucleotides are typically performed by comparing sequences of the two polynucleotides over a "comparison window" to identify and compare local regions of sequence similarity. A "comparison window" refers to a conceptual segment of at least 6 contiguous positions, usually about 50 to about 100, more usually about 100 to about 150 in which a sequence is compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. The comparison window may comprise additions or deletions (i.e., gaps) of about 20% or less as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. Optimal alignment of sequences for aligning a comparison window may be conducted by computerized implementations of algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package Release 7.0, Genetics Computer Group, 575 Science Drive Madison, Wis., USA) or by inspection and the best alignment (i.e., resulting in the highest percentage homology over the comparison window) generated by any of the various methods selected. Reference also may be made to the BLAST family of programs as for example disclosed by Altschul et al., 1997, Nucl. Acids Res. 25:3389. A detailed discussion of sequence analysis can be found in Unit 19.3 of Ausubel et al., "Current Protocols in Molecular Biology," John Wiley & Sons Inc, 1994-1998, Chapter 15.

[0088] Calculations of sequence similarity or sequence identity between sequences (the terms are used interchangeably herein) are performed as follows. To determine the percent identity of two amino acid sequences, or of two nucleic acid sequences, the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes). In certain embodiments, the length of a reference sequence aligned for comparison purposes is at least 30%, preferably at least 40%, more preferably at least 50%, 60%, and even more preferably at least 70%, 80%, 90%, 100% of the length of the reference sequence. The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position.

[0089] The percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.

[0090] The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. In a preferred embodiment, the percent identity between two amino acid sequences is determined using the Needleman and Wunsch, (1970, J. Mol. Biol. 48: 444-453) algorithm which has been incorporated into the GAP program in the GCG software package (available at http://www.gcg.com), using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6. In yet another preferred embodiment, the percent identity between two nucleotide sequences is determined using the GAP program in the GCG software package (available at http://www.gcg.com), using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6. A particularly preferred set of parameters (and the one that should be used unless otherwise specified) are a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frame shift gap penalty of 5.

[0091] The percent identity between two amino acid or nucleotide sequences can be determined using the algorithm of E. Meyers and W. Miller (1989, Cabios, 4: 11-17) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.

[0092] The nucleic acid and protein sequences described herein can be used as a "query sequence" to perform a search against public databases to, for example, identify other family members or related sequences. Such searches can be performed using the NBLAST and XBLAST programs (version 2.0) of Altschul, et al., (1990, J. Mol. Biol, 215: 403-10). BLAST nucleotide searches can be performed with the NBLAST program, score=100, wordlength=12 to obtain nucleotide sequences homologous to nucleic acid molecules of the invention. BLAST protein searches can be performed with the XBLAST program, score=50, wordlength=3 to obtain amino acid sequences homologous to protein molecules of the invention. To obtain gapped alignments for comparison purposes, Gapped BLAST can be utilized as described in Altschul et al., (1997, Nucleic Acids Res, 25: 3389-3402). When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs (e.g., XBLAST and NBLAST) can be used.

[0093] The term "solubility" refers to the property of an agent provided herein to dissolve in a liquid solvent and form a homogeneous solution. Solubility is typically expressed as a concentration, either by mass of solute per unit volume of solvent (g of solute per kg of solvent, g per dL (100 mL), mg/ml, etc.), molarity, molality, mole fraction or other similar descriptions of concentration. The maximum equilibrium amount of solute that can dissolve per amount of solvent is the solubility of that solute in that solvent under the specified conditions, including temperature, pressure, pH, and the nature of the solvent. In certain embodiments, solubility is measured at physiological pH. In certain embodiments, solubility is measured in water or a physiological buffer such as PBS. In certain embodiments, solubility is measured in a biological fluid (solvent) such as blood or serum. In certain embodiments, the temperature can be about room temperature (e.g., about 20, 21, 22, 23, 24, 25.degree. C.) or about body temperature (37.degree. C.). In certain embodiments, an agent such as an AARS protein fragment has a solubility of at least about 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, or 30 mg/ml at room temperature or at 37.degree. C.

[0094] A "splice junction" as used herein includes the region in a mature mRNA transcript or the encoded polypeptide where the 3' end of a first exon joins with the 5' end of a second exon. The size of the region may vary, and may include 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100 or more (including all integers in between) nucleotide or amino acid residues on either side of the exact residues where the 3' end of one exon joins with the 5' end of another exon. An "exon" refers to a nucleic acid sequence that is represented in the mature form of an RNA molecule after either portions of a precursor RNA (introns) have been removed by cis-splicing or two or more precursor RNA molecules have been ligated by trans-splicing. The mature RNA molecule can be a messenger RNA or a functional form of a non-coding RNA such as rRNA or tRNA. Depending on the context, an exon can refer to the sequence in the DNA or its RNA transcript. An "intron" refers to a non-coding nucleic acid region within a gene, which is not translated into a protein. Non-coding intronic sections are transcribed to precursor mRNA (pre-mRNA) and some other RNAs (such as long noncoding RNAs), and subsequently removed by splicing during the processing to mature RNA.

[0095] A "splice variant" refers to a mature mRNA and its encoded protein that are produced by alternative splicing, a process by which the exons of the RNA (a primary gene transcript or pre-mRNA) are reconnected in multiple ways during RNA splicing. The resulting different mRNAs may be translated into different protein isoforms, allowing a single gene to code for multiple proteins.

[0096] A "subject," as used herein, includes any animal that exhibits a symptom, or is at risk for exhibiting a symptom, which can be treated or diagnosed with an AARS polynucleotide or polypeptide of the invention. Also included are subjects for which it is desirable to profile levels of AARS polypeptides and/or polynucleotides of the invention, for diagnostic or other purposes. Suitable subjects (patients) include laboratory animals (such as mouse, rat, rabbit, or guinea pig), farm animals, and domestic animals or pets (such as a cat or dog). Non-human primates and, preferably, human patients, are included.

[0097] "Treatment" or "treating," as used herein, includes any desirable effect on the symptoms or pathology of a disease or condition that can be effected by the non-canonical activities of an AARS polynucleotide or polypeptide, as described herein, and may include even minimal changes or improvements in one or more measurable markers of the disease or condition being treated. Also included are treatments that relate to non-AARS therapies, in which an AARS sequence described herein provides a clinical marker of treatment. "Treatment" or "treating" does not necessarily indicate complete eradication or cure of the disease or condition, or associated symptoms thereof. The subject receiving this treatment is any subject in need thereof. Exemplary markers of clinical improvement will be apparent to persons skilled in the art.

[0098] The practice of the present invention will employ, unless indicated specifically to the contrary, conventional methods of molecular biology and recombinant DNA techniques within the skill of the art, many of which are described below for the purpose of illustration. Such techniques are explained fully in the literature. See, e.g., Sambrook, et al., Molecular Cloning: A Laboratory Manual (3rd Edition, 2001); DNA Cloning: A Practical Approach, vol. I & II (D. Glover, ed.); Oligonucleotide Synthesis (N. Gait, ed., 1984); Oligonucleotide Synthesis: Methods and Applications (P. Herdewijn, ed., 2004); Nucleic Acid Hybridization (B. Hames & S. Higgins, eds., 1985); Nucleic Acid Hybridization: Modern Applications (Buzdin and Lukyanov, eds., 2009); Transcription and Translation (B. Hames & S. Higgins, eds., 1984); Animal Cell Culture (R. Freshney, ed., 1986); Freshney, R.I. (2005) Culture of Animal Cells, a Manual of Basic Technique, 5th Ed. Hoboken N.J., John Wiley & Sons; B. Perbal, A Practical Guide to Molecular Cloning (3rd Edition 2010); Farrell, R., RNA Methodologies: A Laboratory Guide for Isolation and Characterization (3rd Edition 2005), Methods of Enzymology: DNA Structure Part A: Synthesis and Physical Analysis of DNA Methods in Enzymology, Academic Press; Using Antibodies: A Laboratory Manual: Portable Protocol NO. I by Edward Harlow, David Lane, Ed Harlow (1999, Cold Spring Harbor Laboratory Press, ISBN 0-87969-544-7); Antibodies: A Laboratory Manual by Ed Harlow (Editor), David Lane (Editor) (1988, Cold Spring Harbor Laboratory Press, ISBN 0-87969-3,4-2), 1855. Handbook of Drug Screening, edited by Ramakrishna Seethala, Prabhavathi B. Fernandes (2001, New York, N.Y., Marcel Dekker, ISBN 0-8247-0562-9); and Lab Ref: A Handbook of Recipes, Reagents, and Other Reference Tools for Use at the Bench, Edited Jane Roskams and Linda Rodgers, (2002, Cold Spring Harbor Laboratory, ISBN 0-87969-630-3).

[0099] All publications, patents and patent applications cited herein are hereby incorporated by reference in their entirety.

III. Purified AARS Protein Fragments and Variants for Therapeutics and Other Applications

[0100] Surprisingly, and unlike their full-length parental sequences that are known only for their aminoacylation-activities, it has been found that AARS fragments possess biological activities important for biotherapeutic, discovery and diagnostic applications. Embodiments of the present invention therefore include full length proteins, mature protein isoforms and protein fragments of aminoacyl-tRNA synthetases (AARS), in addition to biologically active variants and fragments thereof. In certain embodiments, the proteins and fragments may arise through endogenous proteolysis, in vitro proteolysis, splice variation, or in silico prediction, among other mechanisms. The AARS protein fragments described herein, and variants thereof, may possess at least one "non-canonical" biological activity. The AARS protein fragment(s) of the present invention are also referred to herein as "AARS polypeptides" or "AARS reference polypeptides." In certain embodiments, the AARS polypeptides provided herein comprise or consist essentially of all or a portion of the AARS polypeptide "reference sequence(s)" as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9 below, which represent the amino acid sequence(s) of various fragments of Alanyl tRNA synthetases. Mouse and human AARS protein sequences are highly related, typically differing by no more than a few amino acids within an entire sequence, a particular domain, or a particular protein fragment.

TABLE-US-00002 TABLE 1A N-terminal AARS Polypeptides: (Tables 1, 2 & 3) N-terminal AARS polypeptides identified by MS Type/ species/ Amino acid and Nucleic Acid SEQ. Name Residues Sequences ID. NO. AlaRS1.sup.N1 Protein/ MDSTLTASEIRQRFIDFFKRNEHTYVHSSATIP SEQ. ID. Human/ LDDPTLLFANAGMNQFKPIFLNTIDPSHPMAK NO. 12 1-401 LSRAANTQKCIRAGGKHNDLDDVGKDVYHH TFFEMLGSWSFGDYFKELACKMALELLTQEF GIPIERLYVTYFGGDEAAGLEADLECKQIWQN LGLDDTKILPGNMKDNFWEMGDTGPCGPCS EIHYDRIGGRDAAHLVNQDDPNVLEIWNLVFI QYNREADGILKPLPKKSIDTGMGLERLVSVLQ NKMSNYDTDLFVPYFEAIQKGTGARPYTGKV GAEDADGIDMAYRVLADHARTITVALADGG RPDNTGRGYVLRRILRRAVRYAHEKLNASRG FFATLVDVVVQSLGDAFPELKKDPDMVKDII NEEEVQFLKTLSRGRRILDRKIQSLG AlaRS1.sup.N1 DNA/ ATGGACTCTACTCTAACAGCAAGTGAAATC SEQ. ID. Human/ CGGCAGCGATTTATAGATTTCTTCAAGAGG NO. 13 AACGAGCATACGTATGTTCACTCGTCTGCC ACCATCCCATTGGATGACCCCACTTTGCTCT TTGCCAATGCAGGCATGAACCAGTTTAAAC CCATTTTCCTGAACACAATTGACCCATCTCA CCCCATGGCAAAGCTGAGCAGAGCTGCCAA TACCCAGAAGTGCATCCGGGCTGGGGGCAA ACATAATGACCTGGACGATGTGGGCAAGGA TGTCTATCATCACACCTTCTTCGAGATGCTG GGCTCTTGGTCTTTTGGAGATTACTTTAAGG AATTGGCATGTAAGATGGCTCTGGAACTCC TCACCCAAGAGTTTGGCATTCCCATTGAAA GACTTTATGTTACTTACTTTGGCGGGGATGA AGCAGCTGGCTTAGAAGCAGATCTGGAATG CAAACAGATCTGGCAAAATTTGGGGCTGGA TGACACCAAAATCCTCCCAGGCAACATGAA GGATAACTTCTGGGAGATGGGTGACACGGG CCCCTGTGGTCCTTGCAGTGAGATCCACTA CGACCGGATTGGTGGTCGGGACGCCGCACA TCTTGTCAACCAGGACGACCCTAATGTGCT GGAGATCTGGAACCTTGTGTTCATCCAGTA TAACAGGGAAGCTGATGGCATTCTGAAACC TCTTCCCAAGAAAAGCATTGACACAGGGAT GGGCCTGGAACGACTGGTATCTGTGCTGCA GAATAAGATGTCCAACTATGACACTGACCT TTTTGTCCCTTACTTTGAAGCCATTCAGAAG GGCACAGGTGCCCGACCATACACTGGGAA AGTTGGTGCTGAGGATGCCGATGGGATTGA CATGGCCTACCGGGTGCTGGCTGACCACGC TCGGACCATCACTGTGGCACTGGCTGATGG TGGCCGGCCTGACAACACAGGGCGTGGATA TGTGTTGAGACGGATTCTCCGCCGAGCTGT CCGATACGCCCATGAAAAGCTCAATGCCAG CAGGGGCTTCTTTGCTACGTTAGTGGATGTT GTCGTCCAGTCCCTGGGAGATGCATTTCCT GAGCTGAAGAAGGACCCAGACATGGTGAA GGACATCATTAATGAAGAAGAGGTGCAGTT TCTCAAGACTCTCAGCAGAGGGCGTCGCAT CCTGGACAGGAAAATTCAGAGCCTGGGA AlaRS1.sup.N5 Protein/ MDSTLTASEIRQRFIDFFKRNEHTYVHSSATIP SEQ. ID. Human/ LDDPTLLFANAGMNQFKPIFLNTIDPSHPMAK NO. 14 1-756 LSRAANTQKCIRAGGKHNDLDDVGKDVYHH TFFEMLGSWSFGDYFKELACKMALELLTQEF GIPIERLYVTYFGGDEAAGLEADLECKQIWQN LGLDDTKILPGNMKDNFWEMGDTGPCGPCS EIHYDRIGGRDAAHLVNQDDPNVLEIWNLVFI QYNREADGILKPLPKKSIDTGMGLERLVSVLQ NKMSNYDTDLFVPYFEAIQKGTGARPYTGKV GAEDADGIDMAYRVLADHARTITVALADGG RPDNTGRGYVLRRILRRAVRYAHEKLNASRG FFATLVDVVVQSLGDAFPELKKDPDMVKDII NEEEVQFLKTLSRGRRILDRKIQSLGDSKTIPG DTAWLLYDTYGFPVDLTGLIAEEKGLVVDM DGFEEERKLAQLKSQGKGAGGEDLIMLDIYAI EELRARGLEVTDDSPKYNYHLDSSGSYVFEN TVATVMALRREKMFVEEVSTGQECGVVLDK TCFYAEQGGQIYDEGYLVKVDDSSEDKTEFT VKNAQVRGGYVLHIGTIYGDLKVGDQVWLFI DEPRRRPIMSNHTATHILNFALRSVLGEADQK GSLVAPDRLRFDFTAKGAMSTQQIKKAEEIA NEMIEAAKAVYTQDCPLAAAKAIQGLRAVFD ETYPDPVRVVSIGVPVSELLDDPSGPAGSLTS VEFCGGTHLRNSSHAGAFVIVTEEAIAKGIRRI VAVT AlaRS1.sup.N5 DNA/ ATGGACTCTACTCTAACAGCAAGTGAAATC SEQ. ID. Human CGGCAGCGATTTATAGATTTCTTCAAGAGG NO. 15 AACGAGCATACGTATGTTCACTCGTCTGCC ACCATCCCATTGGATGACCCCACTTTGCTCT TTGCCAATGCAGGCATGAACCAGTTTAAAC CCATTTTCCTGAACACAATTGACCCATCTCA CCCCATGGCAAAGCTGAGCAGAGCTGCCAA TACCCAGAAGTGCATCCGGGCTGGGGGCAA ACATAATGACCTGGACGATGTGGGCAAGGA TGTCTATCATCACACCTTCTTCGAGATGCTG GGCTCTTGGTCTTTTGGAGATTACTTTAAGG AATTGGCATGTAAGATGGCTCTGGAACTCC TCACCCAAGAGTTTGGCATTCCCATTGAAA GACTTTATGTTACTTACTTTGGCGGGGATGA AGCAGCTGGCTTAGAAGCAGATCTGGAATG CAAACAGATCTGGCAAAATTTGGGGCTGGA TGACACCAAAATCCTCCCAGGCAACATGAA GGATAACTTCTGGGAGATGGGTGACACGGG CCCCTGTGGTCCTTGCAGTGAGATCCACTA CGACCGGATTGGTGGTCGGGACGCCGCACA TCTTGTCAACCAGGACGACCCTAATGTGCT GGAGATCTGGAACCTTGTGTTCATCCAGTA TAACAGGGAAGCTGATGGCATTCTGAAACC TCTTCCCAAGAAAAGCATTGACACAGGGAT GGGCCTGGAACGACTGGTATCTGTGCTGCA GAATAAGATGTCCAACTATGACACTGACCT TTTTGTCCCTTACTTTGAAGCCATTCAGAAG GGCACAGGTGCCCGACCATACACTGGGAA AGTTGGTGCTGAGGATGCCGATGGGATTGA CATGGCCTACCGGGTGCTGGCTGACCACGC TCGGACCATCACTGTGGCACTGGCTGATGG TGGCCGGCCTGACAACACAGGGCGTGGATA TGTGTTGAGACGGATTCTCCGCCGAGCTGT CCGATACGCCCATGAAAAGCTCAATGCCAG CAGGGGCTTCTTTGCTACGTTAGTGGATGTT GTCGTCCAGTCCCTGGGAGATGCATTTCCT GAGCTGAAGAAGGACCCAGACATGGTGAA GGACATCATTAATGAAGAAGAGGTGCAGTT TCTCAAGACTCTCAGCAGAGGGCGTCGCAT CCTGGACAGGAAAATTCAGAGCCTGGGAG ACAGCAAGACCATTCCCGGAGACACTGCTT GGCTCCTCTATGACACCTATGGGTTTCCAGT GGATCTGACTGGACTGATTGCTGAAGAGAA GGGCCTGGTGGTAGACATGGATGGCTTTGA AGAGGAGAGGAAACTGGCCCAGCTGAAAT CACAGGGCAAGGGAGCTGGTGGGGAAGAC CTCATTATGCTGGACATTTACGCTATCGAA GAGCTCCGGGCACGGGGTCTGGAGGTCACA GATGATTCCCCAAAGTACAATTACCATTTG GACTCCAGTGGTAGCTATGTATTTGAGAAC ACAGTGGCTACGGTGATGGCTCTGCGCAGG GAGAAGATGTTCGTGGAAGAGGTGTCCACA GGCCAGGAGTGTGGAGTGGTGCTGGACAA GACCTGTTTCTATGCTGAGCAAGGAGGCCA GATCTATGACGAAGGCTACCTGGTGAAGGT GGATGACAGCAGTGAAGATAAAACAGAGT TTACAGTGAAGAATGCTCAGGTCCGAGGAG GGTATGTGCTACACATTGGAACCATCTACG GTGACCTGAAAGTGGGGGATCAGGTCTGGC TGTTTATTGATGAGCCCCGACGAAGACCCA TCATGAGCAACCACACAGCTACGCACATTC TGAACTTCGCCCTGCGCTCAGTGCTTGGGG AAGCTGACCAGAAAGGCTCATTGGTTGCTC CTGACCGCCTCAGATTTGACTTTACTGCCA AGGGAGCCATGTCCACCCAACAGATCAAG AAGGCTGAAGAGATTGCTAATGAGATGATT GAGGCAGCCAAGGCCGTCTATACCCAGGAT TGCCCCCTGGCAGCAGCGAAAGCCATCCAG GGCCTACGGGCTGTGTTTGATGAGACCTAT CCTGACCCTGTGCGAGTCGTCTCCATTGGG GTCCCGGTGTCCGAGTTGCTGGATGACCCC TCTGGGCCTGCTGGCTCCCTGACTTCTGTTG AGTTCTGTGGGGGAACGCACCTGCGGAACT CGAGTCATGCAGGAGCTTTTGTGATCGTGA CGGAAGAAGCCATTGCCAAGGGTATCCGG AGGATTGTGGCTGTCACA

TABLE-US-00003 TABLE 1B AlaRS1.sup.N1 Mass spec peptides detected and inferred linking peptides Type/ SEQ.ID. species Sequence NO. Protein/ LYVTYFGGDEAAGLEPDLECR SEQ.ID. mouse NO. 16 Protein/ QIWQNLGLDEARILPGNMKDNFWEMGDTG SEQ.ID. mouse PCGPCSEIHYDRIGGRDAAHLVNQDDPNV NO. 17 LEIWNLVFIQYNRESDGVLKPLPKKSIDT GMGLERLVSVLQNKMSNYDTDLFMPYFEA IQKGTGARPYTGKVGAEDADGIDMAYRVL ADHAR Protein/ TITVALADGGRPDNTGR SEQ.ID. mouse NO. 18 Protein/ GYVLRRILRRAVRYSHEKLNASRGFFATL SEQ.ID. mouse VDVVVQSLGDAFPELKKDPEMVK NO. 19 Protein/ DIINEEEVQFLK SEQ.ID. mouse NO. 20

TABLE-US-00004 TABLE 1C AlaRS1.sup.N1 Concatenated sequences based on mass spec peptides detected Type/ SEQ.ID. species Sequence NO. Protein/ LYVTYFGGDEAAGLEPDLECRQIWQNLGL SEQ.ID. mouse DEARILPGNMKDNFWEMGDTGPCGPCSEI NO. 21 HYDRIGGRDAAHLVNQDDPNVLEIWNLVF IQYNRESDGVLKPLPKKSIDTGMGLERLV SVLQNKMSNYDTDLFMPYFEAIQKGTGAR PYTGKVGAEDADGIDMAYRVLADHARTIT VALADGGRPDNTGRGYVLRRILRRAVRYS HEKLNASRGFFATLVDVVVQSLGDAFPEL KKDPEMVKDIINEEEVQFLK

TABLE-US-00005 TABLE 1D AlaRS1.sup.N5 Mass spec peptides detected and inferred linking peptides Type/ SEQ.ID. species Sequence NO. Protein/ MALELLTQEFGIPVER SEQ.ID. mouse NO. 22 Protein/ LYVTYFGGDEAAGLEPDLECRQIWQNLGL SEQ.ID. mouse DEAR NO. 23 Protein/ ILPGNMKDNFWEMGDTGPCGPCSEIHYDR SEQ.ID. mouse IGGRDAAHLVNQDDPNVLEIWNLVFIQYN NO. 24 RESDGVLKPLPKKSIDTGMGLERLVSVLQ NK Protein/ MSNYDTDLFMPYFEAIQK SEQ.ID. mouse NO. 25 Protein/ GTGARPYTGKVGAEDADGIDMAYRVLADH SEQ.ID. mouse AR NO. 26 Protein/ TITVALADGGRPDNTGR SEQ.ID. mouse NO. 27 Protein/ GYVLRRILRRAVRYSHEKLNASRGFFATL SEQ.ID. mouse VDVVVQSLGDAFPELKKDPEMVK NO. 28 Protein/ DIINEEEVQFLK SEQ.ID. mouse NO. 29 Protein/ TLSRGRRILDRKIQSLGDCK SEQ.ID. mouse NO. 30 Protein/ TIPGDTAWLLYDTYGFPVDLTGLIAEEK SEQ.ID. mouse NO. 31 Protein/ GLVVDMNGFEEERRLAQLKSQGK SEQ.ID. mouse NO. 32 Protein/ GAGDEDLIMLDIYAIEELR SEQ.ID. mouse NO. 33 Protein/ AKGLEATDDSPKYNYQSDSSGSYVFECTV SEQ.ID. mouse ATVLALRREK NO. 34 Protein/ MFVDEVVTGQECGVVLDK SEQ.ID. mouse NO. 35 Protein/ TCFYAEQGGQIYDEGYLVK SEQ.ID. mouse NO. 36 Protein/ VDDSSEDKTEFTVK SEQ.ID. mouse NO. 37 Protein/ NAQVRGGYVLHIGTIYGNLKVGDQVRLFI SEQ.ID. mouse DEPRRRPVMSNHTATHILNFALRSVLGEA NO. 38 DQKGSLVAPDRLRFDFTAKGAMSTQQIK Protein/ KAEEIVNGMIEAAKPVYTQDCPLAAAK SEQ.ID. mouse NO. 39

TABLE-US-00006 TABLE 1E AlaRS1.sup.N5 Concatenated sequences based on mass spec peptides detected Type/ SEQ.ID. species Sequence NO. Protein/ MALELLTQEFGIPVERLYVTYFGGDEAAG SEQ.ID. mouse LEPDLECRQIWQNLGLDEARILPGNMKDN NO. 40 FWEMGDTGPCGPCSEIHYDRIGGRDAAHL VNQDDPNVLEIWNLVFIQYNRESDGVLKP LPKKSIDTGMGLERLVSVLQNKMSNYDTD LFMPYFEAIQKGTGARPYTGKVGAEDADG IDMAYRVLADHARTITVALADGGRPDNTG RGYVLRRILRRAVRYSHEKLNASRGFFAT LVDVVVQSLGDAFPELKKDPEMVKDIINE EEVQFLKTLSRGRRILDRKIQSLGDCKTI PGDTAWLLYDTYGFPVDLTGLIAEEKGLV VDMNGFEEERRLAQLKSQGKGAGDEDLIM LDIYAIEELRAKGLEATDDSPKYNYQSDS SGSYVFECTVATVLALRREKMFVDEVVTG QECGVVLDKTCFYAEQGGQIYDEGYLVKV DDSSEDKTEFTVKNAQVRGGYVLHIGTIY GNLKVGDQVRLFIDEPRRRPVMSNHTATH ILNFALRSVLGEADQKGSLVAPDRLRFDF TAKGAMSTQQIKKAEEIVNGMIEAAKPVY TQDCPLAAAK

TABLE-US-00007 TABLE 2 N-terminal AARS polypeptides and alternative transcripts identified by Deep Sequencing Type/ species/ Amino acid and SEQ.ID. Name Residues Nucleic Acid Sequences NO. AlaRS1.sup.N4 Protein/ MDSTLTASEIRQRFIDFFKRNE SEQ.ID. Human/ HTYVHSSATIPLDDPTLLFANA NO. 41 1-224 + GMNQFKPIFLNTIDPSHPMAKL 51 SRAANTQKCIRAGGKHNDLDDV GKDVYHHTFFEMLGSWSFGDYF KELACKMALELLTQEFGIPIER LYVTYFGGDEAAGLEADLECKQ IWQNLGLDDTKILPGNMKDNFW EMGDTGPCGPCSEIHYDRIGGR DAAHLVNQDDPNVLEIWNLVFI QYNRAQVPDHTLGKLVLRMPMG LTWPTGCWLTTLGPSLWHWLMV AGLTTQGVDMC AlaRS1.sup.N4 DNA/ ATGGACTCTACTCTAACAGCAA SEQ.ID. Human/ GTGAAATCCGGCAGCGATTTAT NO. 42 AGATTTCTTCAAGAGGAACGAG CATACGTATGTTCACTCGTCTG CCACCATCCCATTGGATGACCC CACTTTGCTCTTTGCCAATGCA GGCATGAACCAGTTTAAACCCA TTTTCCTGAACACAATTGACCC ATCTCACCCCATGGCAAAGCTG AGCAGAGCTGCCAATACCCAGA AGTGCATCCGGGCTGGGGGCAA ACATAATGACCTGGACGATGTG GGCAAGGATGTCTATCATCACA CCTTCTTCGAGATGCTGGGCTC TTGGTCTTTTGGAGATTACTTT AAGGAATTGGCATGTAAGATGG CTCTGGAACTCCTCACCCAAGA GTTTGGCATTCCCATTGAAAGA CTTTATGTTACTTACTTTGGCG GGGATGAAGCAGCTGGCTTAGA AGCAGATCTGGAATGCAAACAG ATCTGGCAAAATTTGGGGCTGG ATGACACCAAAATCCTCCCAGG CAACATGAAGGATAACTTCTGG GAGATGGGTGACACGGGCCCCT GTGGTCCTTGCAGTGAGATCCA CTACGACCGGATTGGTGGTCGG GACGCCGCACATCTTGTCAACC AGGACGACCCTAATGTGCTGGA GATCTGGAACCTTGTGTTCATC CAGTATAACAGGGCACAGGTGC CCGACCATACACTGGGAAAGTT GGTGCTGAGGATGCCGATGGGA TTGACATGGCCTACCGGGTGCT GGCTGACCACGCTCGGACCATC ACTGTGGCACTGGCTGATGGTG GCCGGCCTGACAACACAGGGCG TGGATATGTGTTGA AlaRS1.sup.N6 Protein/ MDSTLTASEIRQRFIDFFKRNE SEQ.ID. Human/ HTYVHSSATIPLDDPTLLFANA NO. 43 1-497 + GMNQFKPIFLNTIDPSHPMAKL 24 SRAANTQKCIRAGGKHNDLDDV GKDVYHHTFFEMLGSWSFGDYF KELACKMALELLTQEFGIPIER LYVTYFGGDEAAGLEADLECKQ IWQNLGLDDTKILPGNMKDNFW EMGDTGPCGPCSEIHYDRIGGR DAAHLVNQDDPNVLEIWNLVFI QYNREADGILKPLPKKSIDTGM GLERLVSVLQNKMSNYDTDLFV PYFEAIQKGTGARPYTGKVGAE DADGIDMAYRVLADHARTITVA LADGGRPDNTGRGYVLRRILRR AVRYAHEKLNASRGFFATLVDV VVQSLGDAFPELKKDPDMVKDI INEEEVQFLKTLSRGRRILDRK IQSLGDSKTIPGDTAWLLYDTY GFPVDLTGLIAEEKGLVVDMDG FEEERKLAQLKSQGKGAGGEDL IMLDIYAIEELRARGLEVTDDS PKYNYHLDSSGSYENRVYSEEC SGPRRVCATHWNHLR AlaRS1.sup.N6 DNA/ ATGGACTCTACTCTAACAGCAA SEQ.ID. Human/ GTGAAATCCGGCAGCGATTTAT NO. 44 AGATTTCTTCAAGAGGAACGAG CATACGTATGTTCACTCGTCTG CCACCATCCCATTGGATGACCC CACTTTGCTCTTTGCCAATGCA GGCATGAACCAGTTTAAACCCA TTTTCCTGAACACAATTGACCC ATCTCACCCCATGGCAAAGCTG AGCAGAGCTGCCAATACCCAGA AGTGCATCCGGGCTGGGGGCAA ACATAATGACCTGGACGATGTG GGCAAGGATGTCTATCATCACA CCTTCTTCGAGATGCTGGGCTC TTGGTCTTTTGGAGATTACTTT AAGGAATTGGCATGTAAGATGG CTCTGGAACTCCTCACCCAAGA GTTTGGCATTCCCATTGAAAGA CTTTATGTTACTTACTTTGGCG GGGATGAAGCAGCTGGCTTAGA AGCAGATCTGGAATGCAAACAG ATCTGGCAAAATTTGGGGCTGG ATGACACCAAAATCCTCCCAGG CAACATGAAGGATAACTTCTGG GAGATGGGTGACACGGGCCCCT GTGGTCCTTGCAGTGAGATCCA CTACGACCGGATTGGTGGTCGG GACGCCGCACATCTTGTCAACC AGGACGACCCTAATGTGCTGGA GATCTGGAACCTTGTGTTCATC CAGTATAACAGGGAAGCTGATG GCATTCTGAAACCTCTTCCCAA GAAAAGCATTGACACAGGGATG GGCCTGGAACGACTGGTATCTG TGCTGCAGAATAAGATGTCCAA CTATGACACTGACCTTTTTGTC CCTTACTTTGAAGCCATTCAGA AGGGCACAGGTGCCCGACCATA CACTGGGAAAGTTGGTGCTGAG GATGCCGATGGGATTGACATGG CCTACCGGGTGCTGGCTGACCA CGCTCGGACCATCACTGTGGCA CTGGCTGATGGTGGCCGGCCTG ACAACACAGGGCGTGGATATGT GTTGAGACGGATTCTCCGCCGA GCTGTCCGATACGCCCATGAAA AGCTCAATGCCAGCAGGGGCTT CTTTGCTACGTTAGTGGATGTT GTCGTCCAGTCCCTGGGAGATG CATTTCCTGAGCTGAAGAAGGA CCCAGACATGGTGAAGGACATC ATTAATGAAGAAGAGGTGCAGT TTCTCAAGACTCTCAGCAGAGG GCGTCGCATCCTGGACAGGAAA ATTCAGAGCCTGGGAGACAGCA AGACCATTCCCGGAGACACTGC TTGGCTCCTCTATGACACCTAT GGGTTTCCAGTGGATCTGACTG GACTGATTGCTGAAGAGAAGGG CCTGGTGGTAGACATGGATGGC TTTGAAGAGGAGAGGAAACTGG CCCAGCTGAAATCACAGGGCAA GGGAGCTGGTGGGGAAGACCTC ATTATGCTGGACATTTACGCTA TCGAAGAGCTCCGGGCACGGGG TCTGGAGGTCACAGATGATTCC CCAAAGTACAATTACCATTTGG ACTCCAGTGGTAGCTATGAAAA CAGAGTTTACAGTGAAGAATGC TCAGGTCCGAGGAGGGTATGTG CTACACATTGGAACCATCTACG GTGA AlaRS1.sup.N7 Protein/ MDSTLTASEIRQRFIDFFKRNE SEQ.ID. Human/ HTYVHSSATIPLDDPTLLFANA NO. 45 1-595 + GMNQFKPIFLNTIDPSHPMAKL 70 SRAANTQKCIRAGGKHNDLDDV GKDVYHHTFFEMLGSWSFGDYF KELACKMALELLTQEFGIPIER LYVTYFGGDEAAGLEADLECKQ IWQNLGLDDTKILPGNMKDNFW EMGDTGPCGPCSEIHYDRIGGR DAAHLVNQDDPNVLEIWNLVFI QYNREADGILKPLPKKSIDTGM GLERLVSVLQNKMSNYDTDLFV PYFEAIQKGTGARPYTGKVGAE DADGIDMAYRVLADHARTITVA LADGGRPDNTGRGYVLRRILRR AVRYAHEKLNASRGFFATLVDV VVQSLGDAFPELKKDPDMVKDI INEEEVQFLKTLSRGRRILDRK IQSLGDSKTIPGDTAWLLYDTY GFPVDLTGLIAEEKGLVVDMDG FEEERKLAQLKSQGKGAGGEDL IMLDIYAIEELRARGLEVTDDS PKYNYHLDSSGSYVFENTVATV MALRREKMFVEEVSTGQECGVV LDKTCFYAEQGGQIYDEGYLVK VDDSSEDKTEFTVKNAQVRGGY VLHIGTIYGDLKVGDQVWLFID EAPAELESCRSFCDRDGRSHCQ GYPEDCGCHRCRGPEGPQESRE LEEMSLCHGSQSEGSDCSKQGC AEGDR AlaRS1.sup.N7 DNA/ ATGGACTCTACTCTAACAGCAA SEQ.ID. Human/ GTGAAATCCGGCAGCGATTTAT NO. 46 AGATTTCTTCAAGAGGAACGAG CATACGTATGTTCACTCGTCTG CCACCATCCCATTGGATGACCC CACTTTGCTCTTTGCCAATGCA GGCATGAACCAGTTTAAACCCA TTTTCCTGAACACAATTGACCC ATCTCACCCCATGGCAAAGCTG AGCAGAGCTGCCAATACCCAGA AGTGCATCCGGGCTGGGGGCAA ACATAATGACCTGGACGATGTG GGCAAGGATGTCTATCATCACA CCTTCTTCGAGATGCTGGGCTC TTGGTCTTTTGGAGATTACTTT AAGGAATTGGCATGTAAGATGG CTCTGGAACTCCTCACCCAAGA GTTTGGCATTCCCATTGAAAGA CTTTATGTTACTTACTTTGGCG GGGATGAAGCAGCTGGCTTAGA AGCAGATCTGGAATGCAAACAG ATCTGGCAAAATTTGGGGCTGG ATGACACCAAAATCCTCCCAGG CAACATGAAGGATAACTTCTGG GAGATGGGTGACACGGGCCCCT GTGGTCCTTGCAGTGAGATCCA CTACGACCGGATTGGTGGTCGG GACGCCGCACATCTTGTCAACC AGGACGACCCTAATGTGCTGGA GATCTGGAACCTTGTGTTCATC CAGTATAACAGGGAAGCTGATG GCATTCTGAAACCTCTTCCCAA GAAAAGCATTGACACAGGGATG GGCCTGGAACGACTGGTATCTG TGCTGCAGAATAAGATGTCCAA CTATGACACTGACCTTTTTGTC CCTTACTTTGAAGCCATTCAGA AGGGCACAGGTGCCCGACCATA CACTGGGAAAGTTGGTGCTGAG GATGCCGATGGGATTGACATGG CCTACCGGGTGCTGGCTGACCA CGCTCGGACCATCACTGTGGCA CTGGCTGATGGTGGCCGGCCTG ACAACACAGGGCGTGGATATGT GTTGAGACGGATTCTCCGCCGA GCTGTCCGATACGCCCATGAAA AGCTCAATGCCAGCAGGGGCTT CTTTGCTACGTTAGTGGATGTT GTCGTCCAGTCCCTGGGAGATG CATTTCCTGAGCTGAAGAAGGA CCCAGACATGGTGAAGGACATC ATTAATGAAGAAGAGGTGCAGT TTCTCAAGACTCTCAGCAGAGG GCGTCGCATCCTGGACAGGAAA ATTCAGAGCCTGGGAGACAGCA AGACCATTCCCGGAGACACTGC TTGGCTCCTCTATGACACCTAT GGGTTTCCAGTGGATCTGACTG GACTGATTGCTGAAGAGAAGGG

CCTGGTGGTAGACATGGATGGC TTTGAAGAGGAGAGGAAACTGG CCCAGCTGAAATCACAGGGCAA GGGAGCTGGTGGGGAAGACCTC ATTATGCTGGACATTTACGCTA TCGAAGAGCTCCGGGCACGGGG TCTGGAGGTCACAGATGATTCC CCAAAGTACAATTACCATTTGG ACTCCAGTGGTAGCTATGTATT TGAGAACACAGTGGCTACGGTG ATGGCTCTGCGCAGGGAGAAGA TGTTCGTGGAAGAGGTGTCCAC AGGCCAGGAGTGTGGAGTGGTG CTGGACAAGACCTGTTTCTATG CTGAGCAAGGAGGCCAGATCTA TGACGAAGGCTACCTGGTGAAG GTGGATGACAGCAGTGAAGATA AAACAGAGTTTACAGTGAAGAA TGCTCAGGTCCGAGGAGGGTAT GTGCTACACATTGGAACCATCT ACGGTGACCTGAAAGTGGGGGA TCAGGTCTGGCTGTTTATTGAT GAGGCACCTGCGGAACTCGAGT CATGCAGGAGCTTTTGTGATCG TGACGGAAGAAGCCATTGCCAA GGGTATCCGGAGGATTGTGGCT GTCACAGGTGCCGAGGCCCAGA AGGCCCTCAGGAAAGCAGAGAG CTTGAAGAAATGTCTCTCTGTC ATGGAAGCCAAAGTGAAGGCTC AGACTGCTCCAAACAAGGATGT GCAGAGGGAGATCGCTGA AlaRS1.sup.N8 Protein/ MDSTLTASEIRQRFIDFFKRNE SEQ.ID. Human/ HTYVHSSATIPLDDPTLLFANA NO. 47 1-321 + GMNQFKPIFLNTIDPSHPMAKL 6 SRAANTQKCIRAGGKHNDLDDV GKDVYHHTFFEMLGSWSFGDYF KELACKMALELLTQEFGIPIER LYVTYFGGDEAAGLEADLECKQ IWQNLGLDDTKILPGNMKDNFW EMGDTGPCGPCSEIHYDRIGGR DAAHLVNQDDPNVLEIWNLVFI QYNREADGILKPLPKKSIDTGM GLERLVSVLQNKMSNYDTDLFV PYFEAIQKGTGARPYTGKVGAE DADGIDMAYRVLADHARTITVA LADGGRPDNTGRGEMHFLS AlaRS1.sup.N8 DNA/ ATGGACTCTACTCTAACAGCAA SEQ.ID. Human/ GTGAAATCCGGCAGCGATTTAT NO. 48 AGATTTCTTCAAGAGGAACGAG CATACGTATGTTCACTCGTCTG CCACCATCCCATTGGATGACCC CACTTTGCTCTTTGCCAATGCA GGCATGAACCAGTTTAAACCCA TTTTCCTGAACACAATTGACCC ATCTCACCCCATGGCAAAGCTG AGCAGAGCTGCCAATACCCAGA AGTGCATCCGGGCTGGGGGCAA ACATAATGACCTGGACGATGTG GGCAAGGATGTCTATCATCACA CCTTCTTCGAGATGCTGGGCTC TTGGTCTTTTGGAGATTACTTT AAGGAATTGGCATGTAAGATGG CTCTGGAACTCCTCACCCAAGA GTTTGGCATTCCCATTGAAAGA CTTTATGTTACTTACTTTGGCG GGGATGAAGCAGCTGGCTTAGA AGCAGATCTGGAATGCAAACAG ATCTGGCAAAATTTGGGGCTGG ATGACACCAAAATCCTCCCAGG CAACATGAAGGATAACTTCTGG GAGATGGGTGACACGGGCCCCT GTGGTCCTTGCAGTGAGATCCA CTACGACCGGATTGGTGGTCGG GACGCCGCACATCTTGTCAACC AGGACGACCCTAATGTGCTGGA GATCTGGAACCTTGTGTTCATC CAGTATAACAGGGAAGCTGATG GCATTCTGAAACCTCTTCCCAA GAAAAGCATTGACACAGGGATG GGCCTGGAACGACTGGTATCTG TGCTGCAGAATAAGATGTCCAA CTATGACACTGACCTTTTTGTC CCTTACTTTGAAGCCATTCAGA AGGGCACAGGTGCCCGACCATA CACTGGGAAAGTTGGTGCTGAG GATGCCGATGGGATTGACATGG CCTACCGGGTGCTGGCTGACCA CGCTCGGACCATCACTGTGGCA CTGGCTGATGGTGGCCGGCCTG ACAACACAGGGCGTGGGGAGAT GCATTTCCTGAGCTGA

TABLE-US-00008 TABLE 2B AARS polypeptides unique splice junctions Amino acid and Nucleic Acid Sequences in the vicinity of the Human Human SEQ. Type/ unique splice fetal Adult ID. Name species junction brain brain NO. A1- DNA/ ACCTTGTGTTCATC 2 0 SEQ. AS01 Human/ CAGTATAACAG|GG ID. CACAGGTGCCCGAC NO. CATACACTG 49 Protein/ LVFIQYNRAQVPDH SEQ. Human/ TL ID. NO. 50 A1- DNA/ CATTTGGACTCCAG 650 86 SEQ. AS04 Human/ TGGTAGCTATG|AA ID. AACAGAGTTTACAG NO. TGAAGAATG 51 Protein/ HLDSSGSYENRVYS SEQ. Human/ EE ID. NO. 52 A1- DNA/ TCAGGTCTGGCTGT 0 15 SEQ. AS06 Human/ TTATTGATGAG|GC ID. ACCTGCGGAACTCG NO. AGTCATGCA 53 Protein/ QVWLFIDEAPAELE SEQ. Human/ SC ID. NO. 54 A1- DNA/ GCCGGCCTGACAAC SEQ. AS07 Human/ ACAGGGCGTGG|GG ID. AGATGCATTTCCTG NO. AGCTGAAGA 55 Protein/ RPDNTGRGEMHFLS SEQ. Human/ ID. NO. 56

TABLE-US-00009 TABLE 3 N-terminal AARS polypeptides and nucleic acids identified by Bioinformatics Type/ species/ Amino acid and SEQ.ID. Name Residues Nucleic Acid Sequences NO. AlaRS1.sup.N2 Protein/ MDSTLTASEIRQRFIDFFKRNE SEQ.ID. Human/ HTYVHSSATIPLDDPTLLFANA NO. 57 1-286 GMNQFKPIFLNTIDPSHPMAKL SRAANTQKCIRAGGKHNDLDDV GKDVYHHTFFEMLGSWSFGDYF KELACKMALELLTQEFGIPIER LYVTYFGGDEAAGLEADLECKQ IWQNLGLDDTKILPGNMKDNFW EMGDTGPCGPCSEIHYDRIGGR DAAHLVNQDDPNVLEIWNLVFI QYNREADGILKPLPKKSIDTGM GLERLVSVLQNKMSNYDTDLFV PYFEAIQKGTGARPYTGKVGAE AlaRS1.sup.N2 DNA/ ATGGACTCTACTCTAACAGCAA SEQ.ID. Human/ GTGAAATCCGGCAGCGATTTAT NO. 58 AGATTTCTTCAAGAGGAACGAG CATACGTATGTTCACTCGTCTG CCACCATCCCATTGGATGACCC CACTTTGCTCTTTGCCAATGCA GGCATGAACCAGTTTAAACCCA TTTTCCTGAACACAATTGACCC ATCTCACCCCATGGCAAAGCTG AGCAGAGCTGCCAATACCCAGA AGTGCATCCGGGCTGGGGGCAA ACATAATGACCTGGACGATGTG GGCAAGGATGTCTATCATCACA CCTTCTTCGAGATGCTGGGCTC TTGGTCTTTTGGAGATTACTTT AAGGAATTGGCATGTAAGATGG CTCTGGAACTCCTCACCCAAGA GTTTGGCATTCCCATTGAAAGA CTTTATGTTACTTACTTTGGCG GGGATGAAGCAGCTGGCTTAGA AGCAGATCTGGAATGCAAACAG ATCTGGCAAAATTTGGGGCTGG ATGACACCAAAATCCTCCCAGG CAACATGAAGGATAACTTCTGG GAGATGGGTGACACGGGCCCCT GTGGTCCTTGCAGTGAGATCCA CTACGACCGGATTGGTGGTCGG GACGCCGCACATCTTGTCAACC AGGACGACCCTAATGTGCTGGA GATCTGGAACCTTGTGTTCATC CAGTATAACAGGGAAGCTGATG GCATTCTGAAACCTCTTCCCAA GAAAAGCATTGACACAGGGATG GGCCTGGAACGACTGGTATCTG TGCTGCAGAATAAGATGTCCAA CTATGACACTGACCTTTTTGTC CCTTACTTTGAAGCCATTCAGA AGGGCACAGGTGCCCGACCATA CACTGGGAAAGTTGGTGCTGAG AlaRS1.sup.N3 Protein/ MDSTLTASEIRQRFIDFFKRNE SEQ.ID. Human/ HTYVHSSATIPLDDPTLLFANA NO. 59 1-488 GMNQFKPIFLNTIDPSHPMAKL SRAANTQKCIRAGGKHNDLDDV GKDVYHHTFFEMLGSWSFGDYF KELACKMALELLTQEFGIPIER LYVTYFGGDEAAGLEADLECKQ IWQNLGLDDTKILPGNMKDNFW EMGDTGPCGPCSEIHYDRIGGR DAAHLVNQDDPNVLEIWNLVFI QYNREADGILKPLPKKSIDTGM GLERLVSVLQNKMSNYDTDLFV PYFEAIQKGTGARPYTGKVGAE DADGIDMAYRVLADHARTITVA LADGGRPDNTGRGYVLRRILRR AVRYAHEKLNASRGFFATLVDV VVQSLGDAFPELKKDPDMVKDI INEEEVQFLKTLSRGRRILDRK IQSLGDSKTIPGDTAWLLYDTY GFPVDLTGLIAEEKGLVVDMDG FEEERKLAQLKSQGKGAGGEDL IMLDIYAIEELRARGLEVTDDS PKYN AlaRS1.sup.N3 DNA/ ATGGACTCTACTCTAACAGCAA SEQ.ID. Human/ GTGAAATCCGGCAGCGATTTAT NO. 60 AGATTTCTTCAAGAGGAACGAG CATACGTATGTTCACTCGTCTG CCACCATCCCATTGGATGACCC CACTTTGCTCTTTGCCAATGCA GGCATGAACCAGTTTAAACCCA TTTTCCTGAACACAATTGACCC ATCTCACCCCATGGCAAAGCTG AGCAGAGCTGCCAATACCCAGA AGTGCATCCGGGCTGGGGGCAA ACATAATGACCTGGACGATGTG GGCAAGGATGTCTATCATCACA CCTTCTTCGAGATGCTGGGCTC TTGGTCTTTTGGAGATTACTTT AAGGAATTGGCATGTAAGATGG CTCTGGAACTCCTCACCCAAGA GTTTGGCATTCCCATTGAAAGA CTTTATGTTACTTACTTTGGCG GGGATGAAGCAGCTGGCTTAGA AGCAGATCTGGAATGCAAACAG ATCTGGCAAAATTTGGGGCTGG ATGACACCAAAATCCTCCCAGG CAACATGAAGGATAACTTCTGG GAGATGGGTGACACGGGCCCCT GTGGTCCTTGCAGTGAGATCCA CTACGACCGGATTGGTGGTCGG GACGCCGCACATCTTGTCAACC AGGACGACCCTAATGTGCTGGA GATCTGGAACCTTGTGTTCATC CAGTATAACAGGGAAGCTGATG GCATTCTGAAACCTCTTCCCAA GAAAAGCATTGACACAGGGATG GGCCTGGAACGACTGGTATCTG TGCTGCAGAATAAGATGTCCAA CTATGACACTGACCTTTTTGTC CCTTACTTTGAAGCCATTCAGA AGGGCACAGGTGCCCGACCATA CACTGGGAAAGTTGGTGCTGAG GATGCCGATGGGATTGACATGG CCTACCGGGTGCTGGCTGACCA CGCTCGGACCATCACTGTGGCA CTGGCTGATGGTGGCCGGCCTG ACAACACAGGGCGTGGATATGT GTTGAGACGGATTCTCCGCCGA GCTGTCCGATACGCCCATGAAA AGCTCAATGCCAGCAGGGGCTT CTTTGCTACGTTAGTGGATGTT GTCGTCCAGTCCCTGGGAGATG CATTTCCTGAGCTGAAGAAGGA CCCAGACATGGTGAAGGACATC ATTAATGAAGAAGAGGTGCAGT TTCTCAAGACTCTCAGCAGAGG GCGTCGCATCCTGGACAGGAAA ATTCAGAGCCTGGGAGACAGCA AGACCATTCCCGGAGACACTGC TTGGCTCCTCTATGACACCTAT GGGTTTCCAGTGGATCTGACTG GACTGATTGCTGAAGAGAAGGG CCTGGTGGTAGACATGGATGGC TTTGAAGAGGAGAGGAAACTGG CCCAGCTGAAATCACAGGGCAA GGGAGCTGGTGGGGAAGACCTC ATTATGCTGGACATTTACGCTA TCGAAGAGCTCCGGGCACGGGG TCTGGAGGTCACAGATGATTCC CCAAAGTACAAT

C-Terminal AARS Polypeptides: (Tables 4, 5 & 6)

TABLE-US-00010

[0101] TABLE 4A C-terminal AARS polypeptides identified by MS Type/ species/ Amino acid and SEQ.ID. Name Residues Nucleic Acid Sequences NO. AlaRS1.sup.C1 Protein/ RGLEVTDDSPKYNYHLDSSGSY SEQ.ID. Human/ VFENTVATVMALRREKMFVEEV NO. 79 476-968 STGQECGVVLDKTCFYAEQGGQ IYDEGYLVKVDDSSEDKTEFTV KNAQVRGGYVLHIGTIYGDLKV GDQVWLFIDEPRRRPIMSNHTA THILNFALRSVLGEADQKGSLV APDRLRFDFTAKGAMSTQQIKK AEEIANEMIEAAKAVYTQDCPL AAAKAIQGLRAVFDETYPDPVR VVSIGVPVSELLDDPSGPAGSL TSVEFCGGTHLRNSSHAGAFVI VTEEAIAKGIRRIVAVTGAEAQ KALRKAESLKKCLSVMEAKVKA QTAPNKDVQREIADLGEALATA VIPQWQKDELRETLKSLKKVMD DLDRASKADVQKRVLEKTKQFI DSNPNQPLVILEMESGASAKAL NEALKLFKMHSPQTSAMLFTVD NEAGKITCLCQVPQNAANRGLK ASEWVQQVSGLMDGKGGGKDVS AQATGKNVGCLQEALQLATSFA QLRLGDVKN AlaRS1.sup.C1 DNA/ CGGGGTCTGGAGGTCACAGATG SEQ.ID. Human ATTCCCCAAAGTACAATTACCA NO. 80 TTTGGACTCCAGTGGTAGCTAT GTATTTGAGAACACAGTGGCTA CGGTGATGGCTCTGCGCAGGGA GAAGATGTTCGTGGAAGAGGTG TCCACAGGCCAGGAGTGTGGAG TGGTGCTGGACAAGACCTGTTT CTATGCTGAGCAAGGAGGCCAG ATCTATGACGAAGGCTACCTGG TGAAGGTGGATGACAGCAGTGA AGATAAAACAGAGTTTACAGTG AAGAATGCTCAGGTCCGAGGAG GGTATGTGCTACACATTGGAAC CATCTACGGTGACCTGAAAGTG GGGGATCAGGTCTGGCTGTTTA TTGATGAGCCCCGACGAAGACC CATCATGAGCAACCACACAGCT ACGCACATTCTGAACTTCGCCC TGCGCTCAGTGCTTGGGGAAGC TGACCAGAAAGGCTCATTGGTT GCTCCTGACCGCCTCAGATTTG ACTTTACTGCCAAGGGAGCCAT GTCCACCCAACAGATCAAGAAG GCTGAAGAGATTGCTAATGAGA TGATTGAGGCAGCCAAGGCCGT CTATACCCAGGATTGCCCCCTG GCAGCAGCGAAAGCCATCCAGG GCCTACGGGCTGTGTTTGATGA GACCTATCCTGACCCTGTGCGA GTCGTCTCCATTGGGGTCCCGG TGTCCGAGTTGCTGGATGACCC CTCTGGGCCTGCTGGCTCCCTG ACTTCTGTTGAGTTCTGTGGGG GAACGCACCTGCGGAACTCGAG TCATGCAGGAGCTTTTGTGATC GTGACGGAAGAAGCCATTGCCA AGGGTATCCGGAGGATTGTGGC TGTCACAGGTGCCGAGGCCCAG AAGGCCCTCAGGAAAGCAGAGA GCTTGAAGAAATGTCTCTCTGT CATGGAAGCCAAAGTGAAGGCT CAGACTGCTCCAAACAAGGATG TGCAGAGGGAGATCGCTGACCT TGGAGAGGCCCTGGCCACTGCA GTCATCCCCCAGTGGCAGAAGG ATGAATTGCGGGAGACTCTCAA ATCCCTAAAGAAGGTCATGGAT GACTTGGACCGAGCCAGCAAAG CCGATGTCCAGAAACGAGTGTT AGAGAAGACGAAGCAGTTCATC GACAGCAACCCCAACCAGCCTC TTGTCATCCTGGAGATGGAGAG CGGCGCCTCAGCCAAGGCCCTG AATGAAGCCTTGAAGCTCTTCA AGATGCACTCCCCTCAGACTTC TGCCATGCTCTTCACGGTGGAC AATGAGGCTGGCAAGATCACGT GCCTGTGTCAAGTTCCCCAGAA TGCAGCCAATCGGGGCTTAAAA GCCAGCGAGTGGGTGCAGCAGG TGTCAGGCTTGATGGACGGTAA AGGTGGTGGCAAGGATGTGTCT GCACAGGCCACAGGCAAGAACG TTGGCTGCCTGCAGGAGGCGCT GCAGCTGGCCACTTCCTTCGCC CAGCTGCGCCTCGGGGATGTAA AGAACTGA AlaRS1.sup.C2 Protein/ AEAQKALRKAESLKKCLSVMEA SEQ.ID. Human/ KVKAQTAPNKDVQREIADLGEA NO. 81 758-968 LATAVIPQWQKDELRETLKSLK KVMDDLDRASKADVQKRVLEKT KQFIDSNPNQPLVILEMESGAS AKALNEALKLFKMHSPQTSAML FTVDNEAGKITCLCQVPQNAAN RGLKASEWVQQVSGLMDGKGGG KDVSAQATGKNVGCLQEALQLA TSFAQLRLGDVKN AlaRS1.sup.C2 DNA/ GCCGAGGCCCAGAAGGCCCTCA SEQ.ID. Human GGAAAGCAGAGAGCTTGAAGAA NO. 82 ATGTCTCTCTGTCATGGAAGCC AAAGTGAAGGCTCAGACTGCTC CAAACAAGGATGTGCAGAGGGA GATCGCTGACCTTGGAGAGGCC CTGGCCACTGCAGTCATCCCCC AGTGGCAGAAGGATGAATTGCG GGAGACTCTCAAATCCCTAAAG AAGGTCATGGATGACTTGGACC GAGCCAGCAAAGCCGATGTCCA GAAACGAGTGTTAGAGAAGACG AAGCAGTTCATCGACAGCAACC CCAACCAGCCTCTTGTCATCCT GGAGATGGAGAGCGGCGCCTCA GCCAAGGCCCTGAATGAAGCCT TGAAGCTCTTCAAGATGCACTC CCCTCAGACTTCTGCCATGCTC TTCACGGTGGACAATGAGGCTG GCAAGATCACGTGCCTGTGTCA AGTTCCCCAGAATGCAGCCAAT CGGGGCTTAAAAGCCAGCGAGT GGGTGCAGCAGGTGTCAGGCTT GATGGACGGTAAAGGTGGTGGC AAGGATGTGTCTGCACAGGCCA CAGGCAAGAACGTTGGCTGCCT GCAGGAGGCGCTGCAGCTGGCC ACTTCCTTCGCCCAGCTGCGCC TCGGGGATGTAAAGAACTGA AlaRS1.sup.C3 Protein/ QVWLFIDEPRRRPIMSNHTATH SEQ.ID. Human/ ILNFALRSVLGEADQKGSLVAP NO. 83 588-968 DRLRFDFTAKGAMSTQQIKKAE EIANEMIEAAKAVYTQDCPLAA AKAIQGLRAVFDETYPDPVRVV SIGVPVSELLDDPSGPAGSLTS VEFCGGTHLRNSSHAGAFVIVT EEAIAKGIRRIVAVTGAEAQKA LRKAESLKKCLSVMEAKVKAQT APNKDVQREIADLGEALATAVI PQWQKDELRETLKSLKKVMDDL DRASKADVQKRVLEKTKQFIDS NPNQPLVILEMESGASAKALNE ALKLFKMHSPQTSAMLFTVDNE AGKITCLCQVPQNAANRGLKAS EWVQQVSGLMDGKGGGKDVSAQ ATGKNVGCLQEALQLATSFAQL RLGDVKN AlaRS1.sup.C3 DNA/ CAGGTCTGGCTGTTTATTGATG SEQ.ID. Human AGCCCCGACGAAGACCCATCAT NO. 84 GAGCAACCACACAGCTACGCAC ATTCTGAACTTCGCCCTGCGCT CAGTGCTTGGGGAAGCTGACCA GAAAGGCTCATTGGTTGCTCCT GACCGCCTCAGATTTGACTTTA CTGCCAAGGGAGCCATGTCCAC CCAACAGATCAAGAAGGCTGAA GAGATTGCTAATGAGATGATTG AGGCAGCCAAGGCCGTCTATAC CCAGGATTGCCCCCTGGCAGCA GCGAAAGCCATCCAGGGCCTAC GGGCTGTGTTTGATGAGACCTA TCCTGACCCTGTGCGAGTCGTC TCCATTGGGGTCCCGGTGTCCG AGTTGCTGGATGACCCCTCTGG GCCTGCTGGCTCCCTGACTTCT GTTGAGTTCTGTGGGGGAACGC ACCTGCGGAACTCGAGTCATGC AGGAGCTTTTGTGATCGTGACG GAAGAAGCCATTGCCAAGGGTA TCCGGAGGATTGTGGCTGTCAC AGGTGCCGAGGCCCAGAAGGCC CTCAGGAAAGCAGAGAGCTTGA AGAAATGTCTCTCTGTCATGGA AGCCAAAGTGAAGGCTCAGACT GCTCCAAACAAGGATGTGCAGA GGGAGATCGCTGACCTTGGAGA GGCCCTGGCCACTGCAGTCATC CCCCAGTGGCAGAAGGATGAAT TGCGGGAGACTCTCAAATCCCT AAAGAAGGTCATGGATGACTTG GACCGAGCCAGCAAAGCCGATG TCCAGAAACGAGTGTTAGAGAA GACGAAGCAGTTCATCGACAGC AACCCCAACCAGCCTCTTGTCA TCCTGGAGATGGAGAGCGGCGC CTCAGCCAAGGCCCTGAATGAA GCCTTGAAGCTCTTCAAGATGC ACTCCCCTCAGACTTCTGCCAT GCTCTTCACGGTGGACAATGAG GCTGGCAAGATCACGTGCCTGT GTCAAGTTCCCCAGAATGCAGC CAATCGGGGCTTAAAAGCCAGC GAGTGGGTGCAGCAGGTGTCAG GCTTGATGGACGGTAAAGGTGG TGGCAAGGATGTGTCTGCACAG GCCACAGGCAAGAACGTTGGCT GCCTGCAGGAGGCGCTGCAGCT GGCCACTTCCTTCGCCCAGCTG CGCCTCGGGGATGTAAAGAACT GA

TABLE-US-00011 TABLE 4B AlaRS1.sup.C1 Mass spec peptides detected and inferred linking peptides Type/ SEQ.ID. species Sequence NO. Protein/ TCFYAEQGGQIYDEGYLVK SEQ.ID. mouse NO. 85 Protein/ VDDSSEDKTEFTVKNAQVRGGYVLHIGTI SEQ.ID. mouse YGNLKVGDQVRLFIDEPRRRPVMSNHTAT NO. 86 HILNFALRSVLGEADQKGSLVAPDRLRFD FTAKGAMSTQQIKKAEEIVNGMIEAAKPV YTQDCPLAAAKAIQGLRAVFDETYPDPVR VVSIGVPVSELLDDPCGPAGSLTSVEFCG GTHLRNSSHAGAFVIVTEEAIAKGIRRIV AVTGAEAQKALRKSETLKKSLSAMEAKVK AQTAPNKDVQR Protein/ EIADLGEALATAVIPQWQK SEQ.ID. mouse NO. 87 Protein/ MFVDEVVTGQECGVVLDK SEQ.ID. mouse NO. 88 Protein/ TCFYAEQGGQIYDEGYLVK SEQ.ID. mouse NO. 89 Protein/ VDDSSEDKTEFTVK SEQ.ID. mouse NO. 90 Protein/ YNYQSDSSGSYVFECTVATVLALR SEQ.ID. mouse NO. 91 Protein/ REKMFVDEVVTGQECGVVLDK SEQ.ID. mouse NO. 92 Protein/ TCFYAEQGGQIYDEGYLVK SEQ.ID. mouse NO. 93 Protein/ VDDSSEDKTEFTVKNAQVRGGYVLHIGTI SEQ.ID. mouse YGNLKVGDQVRLFIDEPRRRPVMSNHTAT NO. 94 HILNFALRSVLGEADQKGSLVAPDRLRFD FTAKGAMSTQQIKKAEEIVNGMIEAAKPV YTQDCPLAAAKAIQGLRAVFDETYPDPVR VVSIGVPVSELLDDPCGPAGSLTSVEFCG GTHLRNSSHAGAFVIVTEEAIAKGIRRIV AVTGAEAQKALRKSETLKKSLSAMEAKVK AQTAPNKDVQREIADLGEALATAVIPQWQ KDEQRETLKSLKKVMDDLDRASKADVQKR VLEKTKQLIDSNPNQPLVILEMESGASAK ALNEALKLFKTHSPQTSAMLFTVDNEAGK ITCLCQVPQNAANRGLK Protein/ ASEWVQQVSGLMDGK SEQ.ID. mouse NO. 95 Protein/ VDDSSEDKTEFTVK SEQ.ID. mouse NO. 96 Protein/ NAQVRGGYVLHIGTIYGNLKVGDQVRLFI SEQ.ID. mouse DEPRRRPVMSNHTATHILNFALRSVLGEA NO. 97 DQKGSLVAPDRLRFDFTAKGAMSTQQIKK AEEIVNGMIEAAKPVYTQDCPLAAAKAIQ GLRAVFDETYPDPVRVVSIGVPVSELLDD PCGPAGSLTSVEFCGGTHLRNSSHAGAFV IVTEEAIAKGIRRIVAVTGAEAQKALRKS ETLKKSLSAMEAKVKAQTAPNKDVQR Protein/ EIADLGEALATAVIPQWQK SEQ.ID. mouse NO. 98 Protein/ DEQRETLKSLKKVMDDLDRASKADVQKRV SEQ.ID. mouse LEKTKQLIDSNPNQPLVILEMESGASAKA NO. 99 LNEALKLFK Protein/ THSPQTSAMLFTVDNEAGK SEQ.ID. mouse NO. 100 Protein/ ITCLCQVPQNAANR SEQ.ID. mouse NO. 101 Protein/ GLK SEQ.ID. mouse NO. 102 Protein/ ASEWVQQVSGLMDGK SEQ.ID. mouse NO. 103

TABLE-US-00012 TABLE 4C AlaRS1.sup.C1 Concatenated sequences based on mass spec peptides detected Type/ SEQ.ID. species Sequence NO. Protein/ TCFYAEQGGQIYDEGYLVKVDDSSEDKTE SEQ. ID. mouse FTVKNAQVRGGYVLHIGTIYGNLKVGDQV NO. 104 RLFIDEPRRRPVMSNHTATHILNFALRSV LGEADQKGSLVAPDRLRFDFTAKGAMSTQ QIKKAEEIVNGMIEAAKPVYTQDCPLAAA KAIQGLRAVFDETYPDPVRVVSIGVPVSE LLDDPCGPAGSLTSVEFCGGTHLRNSSHA GAFVIVTEEAIAKGIRRIVAVTGAEAQKA LRKSETLKKSLSAMEAKVKAQTAPNKDVQ REIADLGEALATAVIPQWQK Protein/ MFVDEVVTGQECGVVLDKTCFYAEQGGQI SEQ. ID. mouse YDEGYLVKVDDSSEDKTEFTVK NO. 105 Protein/ YNYQSDSSGSYVFECTVATVLALRREKMF SEQ. ID. mouse VDEVVTGQECGVVLDKTCFYAEQGGQIYD NO. 106 EGYLVKVDDSSEDKTEFTVKNAQVRGGYV LHIGTIYGNLKVGDQVRLFIDEPRRRPVM SNHTATHILNFALRSVLGEADQKGSLVAP DRLRFDFTAKGAMSTQQIKKAEEIVNGMI EAAKPVYTQDCPLAAAKAIQGLRAVFDET YPDPVRVVSIGVPVSELLDDPCGPAGSLT SVEFCGGTHLRNSSHAGAFVIVTEEAIAK GIRRIVAVTGAEAQKALRKSETLKKSLSA MEAKVKAQTAPNKDVQREIADLGEALATA VIPQWQKDEQRETLKSLKKVMDDLDRASK ADVQKRVLEKTKQLIDSNPNQPLVILEME SGASAKALNEALKLFKTHSPQTSAMLFTV DNEAGKITCLCQVPQNAANRGLKASEWVQ QVSGLMDGK Protein/ VDDSSEDKTEFTVKNAQVRGGYVLHIGTI SEQ. ID. mouse YGNLKVGDQVRLFIDEPRRRPVMSNHTAT NO. 107 HILNFALRSVLGEADQKGSLVAPDRLRFD FTAKGAMSTQQIKKAEEIVNGMIEAAKPV YTQDCPLAAAKAIQGLRAVFDETYPDPVR VVSIGVPVSELLDDPCGPAGSLTSVEFCG GTHLRNSSHAGAFVIVTEEAIAKGIRRIV AVTGAEAQKALRKSETLKKSLSAMEAKVK AQTAPNKDVQREIADLGEALATAVIPQWQ KDEQRETLKSLKKVMDDLDRASKADVQKR VLEKTKQLIDSNPNQPLVILEMESGASAK ALNEALKLFKTHSPQTSAMLFTVDNEAGK ITCLCQVPQNAANRGLKASEWVQQVSGLM DGK

TABLE-US-00013 TABLE 4D AlaRS1.sup.C2 Mass spec peptides detected and inferred linking peptides Type/ SEQ.ID. species Sequence NO. Protein/ DMSAQATGKNVGCLQEALQLATSFAQLR SEQ.ID. mouse NO. 108 Protein/ DMSAQATGK SEQ.ID. mouse NO. 109 Protein/ NVGCLQEALQLATSFAQLR SEQ.ID. mouse NO. 110

TABLE-US-00014 TABLE 4E AlaRS1.sup.C2 Concatenated sequences based on mass spec peptides detected Type/ SEQ.ID. species Sequence NO. Protein/ MFVDEVVTGQECGVVLDKTCFYAEQGGQI SEQ.ID. mouse YDEGYLVKVDDSSEDKTEFTVK NO. 111

TABLE-US-00015 TABLE 4F AlaRS1.sup.C3 Mass spec peptides detected and inferred linking peptides Type/ SEQ.ID. species Sequence NO. Protein/ EIADLGEALATAVIPQWQK SEQ.ID. mouse NO. 112 Protein/ DEQRETLKSLKKVMDDLDRASKADVQKRV SEQ.ID. mouse LEKTKQLIDSNPNQPLVILEMESGASAKA NO. 113 LNEALKLFKTHSPQTSAMLFTVDNEAGK Protein/ ITCLCQVPQNAANR SEQ.ID. mouse NO. 114

TABLE-US-00016 TABLE 4G AlaRS1.sup.C3 Concatenated sequences based on mass spec peptides detected Type/ SEQ.ID. species Sequence NO. Protein/ EIADLGEALATAVIPQWQKDEQRETLKSL SEQ.ID. mouse KKVMDDLDRASKADVQKRVLEKTKQLIDS NO. 115 NPNQPLVILEMESGASAKALNEALKLFKT HSPQTSAMLFTVDNEAGKITCLCQVPQNA ANR

TABLE-US-00017 TABLE 5A C-terminal AARS polypeptides and alternative transcripts identified by Deep Sequencing Type/ species/ Amino acid and SEQ.ID. Name Residues Nucleic Acid Sequences NO. AlaRS1.sup.C8 Protein/ MAYRVLADHARTITVALADGGRPDNTGRG SEQ.ID. Human/ YVLRRILRRAVRYAHEKLNASRGFFATLVD NO. 116 293-968 VVVQSLGDAFPELKKDPDMVKDIINEEEVQ FLKTLSRGRRILDRKIQSLGDSKTIPGDTAW LLYDTYGFPVDLTGLIAEEKGLVVDMDGFE EERKLAQLKSQGKGAGGEDLIMLDIYAIEEL RARGLEVTDDSPKYNYHLDSSGSYVFENTV ATVMALRREKMFVEEVSTGQECGVVLDKT CFYAEQGGQIYDEGYLVKVDDSSEDKTEFT VKNAQVRGGYVLHIGTIYGDLKVGDQVWL FIDEPRRRPIMSNHTATHILNFALRSVLGEA DQKGSLVAPDRLRFDFTAKGAMSTQQIKKA EEIANEMIEAAKAVYTQDCPLAAAKAIQGL RAVFDETYPDPVRVVSIGVPVSELLDDPSGP AGSLTSVEFCGGTHLRNSSHAGAFVIVTEEA IAKGIRRIVAVTGAEAQKALRKAESLKKCLS VMEAKVKAQTAPNKDVQREIADLGEALAT AVIPQWQKDELRETLKSLKKVMDDLDRAS KADVQKRVLEKTKQFIDSNPNQPLVILEME SGASAKALNEALKLFKMHSPQTSAMLFTVD NEAGKITCLCQVPQNAANRGLKASEWVQQ VSGLMDGKGGGKDVSAQATGKNVGCLQE ALQLATSFAQLRLGDVKN AlaRS1.sup.C8 DNA/ ATGGCCTACCGGGTGCTGGCTGACCACGC SEQ.ID. Human/ TCGGACCATCACTGTGGCACTGGCTGATG NO. 117 GTGGCCGGCCTGACAACACAGGGCGTGG ATATGTGTTGAGACGGATTCTCCGCCGAG CTGTCCGATACGCCCATGAAAAGCTCAAT GCCAGCAGGGGCTTCTTTGCTACGTTAGT GGATGTTGTCGTCCAGTCCCTGGGAGATG CATTTCCTGAGCTGAAGAAGGACCCAGAC ATGGTGAAGGACATCATTAATGAAGAAG AGGTGCAGTTTCTCAAGACTCTCAGCAGA GGGCGTCGCATCCTGGACAGGAAAATTCA GAGCCTGGGAGACAGCAAGACCATTCCC GGAGACACTGCTTGGCTCCTCTATGACAC CTATGGGTTTCCAGTGGATCTGACTGGAC TGATTGCTGAAGAGAAGGGCCTGGTGGTA GACATGGATGGCTTTGAAGAGGAGAGGA AACTGGCCCAGCTGAAATCACAGGGCAA GGGAGCTGGTGGGGAAGACCTCATTATGC TGGACATTTACGCTATCGAAGAGCTCCGG GCACGGGGTCTGGAGGTCACAGATGATTC CCCAAAGTACAATTACCATTTGGACTCCA GTGGTAGCTATGTATTTGAGAACACAGTG GCTACGGTGATGGCTCTGCGCAGGGAGAA GATGTTCGTGGAAGAGGTGTCCACAGGCC AGGAGTGTGGAGTGGTGCTGGACAAGAC CTGTTTCTATGCTGAGCAAGGAGGCCAGA TCTATGACGAAGGCTACCTGGTGAAGGTG GATGACAGCAGTGAAGATAAAACAGAGT TTACAGTGAAGAATGCTCAGGTCCGAGGA GGGTATGTGCTACACATTGGAACCATCTA CGGTGACCTGAAAGTGGGGGATCAGGTCT GGCTGTTTATTGATGAGCCCCGACGAAGA CCCATCATGAGCAACCACACAGCTACGCA CATTCTGAACTTCGCCCTGCGCTCAGTGCT TGGGGAAGCTGACCAGAAAGGCTCATTG GTTGCTCCTGACCGCCTCAGATTTGACTTT ACTGCCAAGGGAGCCATGTCCACCCAACA GATCAAGAAGGCTGAAGAGATTGCTAAT GAGATGATTGAGGCAGCCAAGGCCGTCTA TACCCAGGATTGCCCCCTGGCAGCAGCGA AAGCCATCCAGGGCCTACGGGCTGTGTTT GATGAGACCTATCCTGACCCTGTGCGAGT CGTCTCCATTGGGGTCCCGGTGTCCGAGT TGCTGGATGACCCCTCTGGGCCTGCTGGC TCCCTGACTTCTGTTGAGTTCTGTGGGGG AACGCACCTGCGGAACTCGAGTCATGCAG GAGCTTTTGTGATCGTGACGGAAGAAGCC ATTGCCAAGGGTATCCGGAGGATTGTGGC TGTCACAGGTGCCGAGGCCCAGAAGGCCC TCAGGAAAGCAGAGAGCTTGAAGAAATG TCTCTCTGTCATGGAAGCCAAAGTGAAGG CTCAGACTGCTCCAAACAAGGATGTGCAG AGGGAGATCGCTGACCTTGGAGAGGCCCT GGCCACTGCAGTCATCCCCCAGTGGCAGA AGGATGAATTGCGGGAGACTCTCAAATCC CTAAAGAAGGTCATGGATGACTTGGACCG AGCCAGCAAAGCCGATGTCCAGAAACGA GTGTTAGAGAAGACGAAGCAGTTCATCGA CAGCAACCCCAACCAGCCTCTTGTCATCC TGGAGATGGAGAGCGGCGCCTCAGCCAA GGCCCTGAATGAAGCCTTGAAGCTCTTCA AGATGCACTCCCCTCAGACTTCTGCCATG CTCTTCACGGTGGACAATGAGGCTGGCAA GATCACGTGCCTGTGTCAAGTTCCCCAGA ATGCAGCCAATCGGGGCTTAAAAGCCAGC GAGTGGGTGCAGCAGGTGTCAGGCTTGAT GGACGGTAAAGGTGGTGGCAAGGATGTG TCTGCACAGGCCACAGGCAAGAACGTTGG CTGCCTGCAGGAGGCGCTGCAGCTGGCCA CTTCCTTCGCCCAGCTGCGCCTCGGGGAT GTAAAGAACTGA AlaRS1.sup.C9 Protein/ MDSTLTASEIRQRFIDFFKRNEHTYVHSSATI SEQ.ID. Human/ PLDDPTLLFANAGMNQLKSQGKGAGGEDLI NO. 118 1-48 + MLDIYAIEELRARGLEVTDDSPKYNYHLDS 450-968 SGSYVFENTVATVMALRREKMFVEEVSTG QECGVVLDKTCFYAEQGGQIYDEGYLVKV DDSSEDKTEFTVKNAQVRGGYVLHIGTIYG DLKVGDQVWLFIDEPRRRPIMSNHTATHIL NFALRSVLGEADQKGSLVAPDRLRFDFTAK GAMSTQQIKKAEEIANEMIEAAKAVYTQDC PLAAAKAIQGLRAVFDETYPDPVRVVSIGVP VSELLDDPSGPAGSLTSVEFCGGTHLRNSSH AGAFVIVTEEAIAKGIRRIVAVTGAEAQKAL RKAESLKKCLSVMEAKVKAQTAPNKDVQR EIADLGEALATAVIPQWQKDELRETLKSLK KVMDDLDRASKADVQKRVLEKTKQFIDSN PNQPLVILEMESGASAKALNEALKLFKMHS PQTSAMLFTVDNEAGKITCLCQVPQNAANR GLKASEWVQQVSGLMDGKGGGKDVSAQA TGKNVGCLQEALQLATSFAQLRLGDVKN AlaRS1.sup.C9 DNA/ ATGGACTCTACTCTAACAGCAAGTGAAAT SEQ.ID. Human/ CCGGCAGCGATTTATAGATTTCTTCAAGA NO. 119 GGAACGAGCATACGTATGTTCACTCGTCT GCCACCATCCCATTGGATGACCCCACTTT GCTCTTTGCCAATGCAGGCATGAACCAGC TGAAATCACAGGGCAAGGGAGCTGGTGG GGAAGACCTCATTATGCTGGACATTTACG CTATCGAAGAGCTCCGGGCACGGGGTCTG GAGGTCACAGATGATTCCCCAAAGTACAA TTACCATTTGGACTCCAGTGGTAGCTATG TATTTGAGAACACAGTGGCTACGGTGATG GCTCTGCGCAGGGAGAAGATGTTCGTGGA AGAGGTGTCCACAGGCCAGGAGTGTGGA GTGGTGCTGGACAAGACCTGTTTCTATGC TGAGCAAGGAGGCCAGATCTATGACGAA GGCTACCTGGTGAAGGTGGATGACAGCA GTGAAGATAAAACAGAGTTTACAGTGAA GAATGCTCAGGTCCGAGGAGGGTATGTGC TACACATTGGAACCATCTACGGTGACCTG AAAGTGGGGGATCAGGTCTGGCTGTTTAT TGATGAGCCCCGACGAAGACCCATCATGA GCAACCACACAGCTACGCACATTCTGAAC TTCGCCCTGCGCTCAGTGCTTGGGGAAGC TGACCAGAAAGGCTCATTGGTTGCTCCTG ACCGCCTCAGATTTGACTTTACTGCCAAG GGAGCCATGTCCACCCAACAGATCAAGA AGGCTGAAGAGATTGCTAATGAGATGATT GAGGCAGCCAAGGCCGTCTATACCCAGG ATTGCCCCCTGGCAGCAGCGAAAGCCATC CAGGGCCTACGGGCTGTGTTTGATGAGAC CTATCCTGACCCTGTGCGAGTCGTCTCCAT TGGGGTCCCGGTGTCCGAGTTGCTGGATG ACCCCTCTGGGCCTGCTGGCTCCCTGACTT CTGTTGAGTTCTGTGGGGGAACGCACCTG CGGAACTCGAGTCATGCAGGAGCTTTTGT GATCGTGACGGAAGAAGCCATTGCCAAG GGTATCCGGAGGATTGTGGCTGTCACAGG TGCCGAGGCCCAGAAGGCCCTCAGGAAA GCAGAGAGCTTGAAGAAATGTCTCTCTGT CATGGAAGCCAAAGTGAAGGCTCAGACT GCTCCAAACAAGGATGTGCAGAGGGAGA TCGCTGACCTTGGAGAGGCCCTGGCCACT GCAGTCATCCCCCAGTGGCAGAAGGATGA ATTGCGGGAGACTCTCAAATCCCTAAAGA AGGTCATGGATGACTTGGACCGAGCCAGC AAAGCCGATGTCCAGAAACGAGTGTTAG AGAAGACGAAGCAGTTCATCGACAGCAA CCCCAACCAGCCTCTTGTCATCCTGGAGA TGGAGAGCGGCGCCTCAGCCAAGGCCCTG AATGAAGCCTTGAAGCTCTTCAAGATGCA CTCCCCTCAGACTTCTGCCATGCTCTTCAC GGTGGACAATGAGGCTGGCAAGATCACG TGCCTGTGTCAAGTTCCCCAGAATGCAGC CAATCGGGGCTTAAAAGCCAGCGAGTGG GTGCAGCAGGTGTCAGGCTTGATGGACGG TAAAGGTGGTGGCAAGGATGTGTCTGCAC AGGCCACAGGCAAGAACGTTGGCTGCCTG CAGGAGGCGCTGCAGCTGGCCACTTCCTT CGCCCAGCTGCGCCTCGGGGATGTAAAGA ACTGA AlaRS1.sup.C10 Protein/ MDSTLTASEIRQRFIDFFKRNEHTYVHSSATI SEQ.ID. Human/ PLDDPTLLFANAGMNQFKPIFLNTIDPSHPM NO. 120 1-407 + AKLSRAANTQKCIRAGGKHNDLDDVGKDV 498-968 YHHTFFEMLGSWSFGDYFKELACKMALEL LTQEFGIPIERLYVTYFGGDEAAGLEADLEC KQIWQNLGLDDTKILPGNMKDNFWEMGDT GPCGPCSEIHYDRIGGRDAAHLVNQDDPNV LEIWNLVFIQYNREADGILKPLPKKSIDTGM GLERLVSVLQNKMSNYDTDLFVPYFEAIQK GTGARPYTGKVGAEDADGIDMAYRVLADH ARTITVALADGGRPDNTGRGYVLRRILRRA VRYAHEKLNASRGFFATLVDVVVQSLGDA FPELKKDPDMVKDIINEEEVQFLKTLSRGRR ILDRKIQSLGDSKTIPVFENTVATVMALRRE KMFVEEVSTGQECGVVLDKTCFYAEQGGQI YDEGYLVKVDDSSEDKTEFTVKNAQVRGG YVLHIGTIYGDLKVGDQVWLFIDEPRRRPIM SNHTATHILNFALRSVLGEADQKGSLVAPD RLRFDFTAKGAMSTQQIKKAEEIANEMIEA AKAVYTQDCPLAAAKAIQGLRAVFDETYP DPVRVVSIGVPVSELLDDPSGPAGSLTSVEF CGGTHLRNSSHAGAFVIVTEEAIAKGIRRIV AVTGAEAQKALRKAESLKKCLSVMEAKVK AQTAPNKDVQREIADLGEALATAVIPQWQK DELRETLKSLKKVMDDLDRASKADVQKRV LEKTKQFIDSNPNQPLVILEMESGASAKALN EALKLFKMHSPQTSAMLFTVDNEAGKITCL CQVPQNAANRGLKASEWVQQVSGLMDGK GGGKDVSAQATGKNVGCLQEALQLATSFA QLRLGDVKN AlaRS1.sup.C10 DNA/ ATGGACTCTACTCTAACAGCAAGTGAAAT SEQ.ID. Human/ CCGGCAGCGATTTATAGATTTCTTCAAGA NO. 121 GGAACGAGCATACGTATGTTCACTCGTCT GCCACCATCCCATTGGATGACCCCACTTT GCTCTTTGCCAATGCAGGCATGAACCAGT TTAAACCCATTTTCCTGAACACAATTGAC CCATCTCACCCCATGGCAAAGCTGAGCAG AGCTGCCAATACCCAGAAGTGCATCCGGG CTGGGGGCAAACATAATGACCTGGACGAT GTGGGCAAGGATGTCTATCATCACACCTT CTTCGAGATGCTGGGCTCTTGGTCTTTTGG AGATTACTTTAAGGAATTGGCATGTAAGA TGGCTCTGGAACTCCTCACCCAAGAGTTT GGCATTCCCATTGAAAGACTTTATGTTAC TTACTTTGGCGGGGATGAAGCAGCTGGCT TAGAAGCAGATCTGGAATGCAAACAGAT CTGGCAAAATTTGGGGCTGGATGACACCA AAATCCTCCCAGGCAACATGAAGGATAAC TTCTGGGAGATGGGTGACACGGGCCCCTG TGGTCCTTGCAGTGAGATCCACTACGACC GGATTGGTGGTCGGGACGCCGCACATCTT GTCAACCAGGACGACCCTAATGTGCTGGA GATCTGGAACCTTGTGTTCATCCAGTATA ACAGGGAAGCTGATGGCATTCTGAAACCT CTTCCCAAGAAAAGCATTGACACAGGGAT GGGCCTGGAACGACTGGTATCTGTGCTGC AGAATAAGATGTCCAACTATGACACTGAC CTTTTTGTCCCTTACTTTGAAGCCATTCAG AAGGGCACAGGTGCCCGACCATACACTG GGAAAGTTGGTGCTGAGGATGCCGATGG GATTGACATGGCCTACCGGGTGCTGGCTG ACCACGCTCGGACCATCACTGTGGCACTG GCTGATGGTGGCCGGCCTGACAACACAGG GCGTGGATATGTGTTGAGACGGATTCTCC

GCCGAGCTGTCCGATACGCCCATGAAAAG CTCAATGCCAGCAGGGGCTTCTTTGCTAC GTTAGTGGATGTTGTCGTCCAGTCCCTGG GAGATGCATTTCCTGAGCTGAAGAAGGAC CCAGACATGGTGAAGGACATCATTAATGA AGAAGAGGTGCAGTTTCTCAAGACTCTCA GCAGAGGGCGTCGCATCCTGGACAGGAA AATTCAGAGCCTGGGAGACAGCAAGACC ATTCCCGTATTTGAGAACACAGTGGCTAC GGTGATGGCTCTGCGCAGGGAGAAGATGT TCGTGGAAGAGGTGTCCACAGGCCAGGA GTGTGGAGTGGTGCTGGACAAGACCTGTT TCTATGCTGAGCAAGGAGGCCAGATCTAT GACGAAGGCTACCTGGTGAAGGTGGATG ACAGCAGTGAAGATAAAACAGAGTTTAC AGTGAAGAATGCTCAGGTCCGAGGAGGG TATGTGCTACACATTGGAACCATCTACGG TGACCTGAAAGTGGGGGATCAGGTCTGGC TGTTTATTGATGAGCCCCGACGAAGACCC ATCATGAGCAACCACACAGCTACGCACAT TCTGAACTTCGCCCTGCGCTCAGTGCTTG GGGAAGCTGACCAGAAAGGCTCATTGGTT GCTCCTGACCGCCTCAGATTTGACTTTACT GCCAAGGGAGCCATGTCCACCCAACAGAT CAAGAAGGCTGAAGAGATTGCTAATGAG ATGATTGAGGCAGCCAAGGCCGTCTATAC CCAGGATTGCCCCCTGGCAGCAGCGAAAG CCATCCAGGGCCTACGGGCTGTGTTTGAT GAGACCTATCCTGACCCTGTGCGAGTCGT CTCCATTGGGGTCCCGGTGTCCGAGTTGC TGGATGACCCCTCTGGGCCTGCTGGCTCC CTGACTTCTGTTGAGTTCTGTGGGGGAAC GCACCTGCGGAACTCGAGTCATGCAGGAG CTTTTGTGATCGTGACGGAAGAAGCCATT GCCAAGGGTATCCGGAGGATTGTGGCTGT CACAGGTGCCGAGGCCCAGAAGGCCCTC AGGAAAGCAGAGAGCTTGAAGAAATGTC TCTCTGTCATGGAAGCCAAAGTGAAGGCT CAGACTGCTCCAAACAAGGATGTGCAGA GGGAGATCGCTGACCTTGGAGAGGCCCTG GCCACTGCAGTCATCCCCCAGTGGCAGAA GGATGAATTGCGGGAGACTCTCAAATCCC TAAAGAAGGTCATGGATGACTTGGACCGA GCCAGCAAAGCCGATGTCCAGAAACGAG TGTTAGAGAAGACGAAGCAGTTCATCGAC AGCAACCCCAACCAGCCTCTTGTCATCCT GGAGATGGAGAGCGGCGCCTCAGCCAAG GCCCTGAATGAAGCCTTGAAGCTCTTCAA GATGCACTCCCCTCAGACTTCTGCCATGC TCTTCACGGTGGACAATGAGGCTGGCAAG ATCACGTGCCTGTGTCAAGTTCCCCAGAA TGCAGCCAATCGGGGCTTAAAAGCCAGCG AGTGGGTGCAGCAGGTGTCAGGCTTGATG GACGGTAAAGGTGGTGGCAAGGATGTGT CTGCACAGGCCACAGGCAAGAACGTTGG CTGCCTGCAGGAGGCGCTGCAGCTGGCCA CTTCCTTCGCCCAGCTGCGCCTCGGGGAT GTAAAGAACTGA AlaRS1.sup.C11 Protein/ MIPQSTITIWTPVVAMKTEFTVKNAQVRGG SEQ.ID. Human/ YVLHIGTIYGDLKVGDQVWLFIDEPRRRPIM NO. 122 16 aa + SNHTATHILNFALRSVLGEADQKGSLVAPD 558-968 RLRFDFTAKGAMSTQQIKKAEEIANEMIEA AKAVYTQDCPLAAAKAIQGLRAVFDETYP DPVRVVSIGVPVSELLDDPSGPAGSLTSVEF CGGTHLRNSSHAGAFVIVTEEAIAKGIRRIV AVTGAEAQKALRKAESLKKCLSVMEAKVK AQTAPNKDVQREIADLGEALATAVIPQWQK DELRETLKSLKKVMDDLDRASKADVQKRV LEKTKQFIDSNPNQPLVILEMESGASAKALN EALKLFKMHSPQTSAMLFTVDNEAGKITCL CQVPQNAANRGLKASEWVQQVSGLMDGK GGGKDVSAQATGKNVGCLQEALQLATSFA QLRLGDVKN AlaRS1.sup.C11 DNA/ ATGATTCCCCAAAGTACAATTACCATTTG SEQ.ID. Human/ GACTCCAGTGGTAGCTATGAAAACAGAGT NO. 123 TTACAGTGAAGAATGCTCAGGTCCGAGGA GGGTATGTGCTACACATTGGAACCATCTA CGGTGACCTGAAAGTGGGGGATCAGGTCT GGCTGTTTATTGATGAGCCCCGACGAAGA CCCATCATGAGCAACCACACAGCTACGCA CATTCTGAACTTCGCCCTGCGCTCAGTGCT TGGGGAAGCTGACCAGAAAGGCTCATTG GTTGCTCCTGACCGCCTCAGATTTGACTTT ACTGCCAAGGGAGCCATGTCCACCCAACA GATCAAGAAGGCTGAAGAGATTGCTAAT GAGATGATTGAGGCAGCCAAGGCCGTCTA TACCCAGGATTGCCCCCTGGCAGCAGCGA AAGCCATCCAGGGCCTACGGGCTGTGTTT GATGAGACCTATCCTGACCCTGTGCGAGT CGTCTCCATTGGGGTCCCGGTGTCCGAGT TGCTGGATGACCCCTCTGGGCCTGCTGGC TCCCTGACTTCTGTTGAGTTCTGTGGGGG AACGCACCTGCGGAACTCGAGTCATGCAG GAGCTTTTGTGATCGTGACGGAAGAAGCC ATTGCCAAGGGTATCCGGAGGATTGTGGC TGTCACAGGTGCCGAGGCCCAGAAGGCCC TCAGGAAAGCAGAGAGCTTGAAGAAATG TCTCTCTGTCATGGAAGCCAAAGTGAAGG CTCAGACTGCTCCAAACAAGGATGTGCAG AGGGAGATCGCTGACCTTGGAGAGGCCCT GGCCACTGCAGTCATCCCCCAGTGGCAGA AGGATGAATTGCGGGAGACTCTCAAATCC CTAAAGAAGGTCATGGATGACTTGGACCG AGCCAGCAAAGCCGATGTCCAGAAACGA GTGTTAGAGAAGACGAAGCAGTTCATCGA CAGCAACCCCAACCAGCCTCTTGTCATCC TGGAGATGGAGAGCGGCGCCTCAGCCAA GGCCCTGAATGAAGCCTTGAAGCTCTTCA AGATGCACTCCCCTCAGACTTCTGCCATG CTCTTCACGGTGGACAATGAGGCTGGCAA GATCACGTGCCTGTGTCAAGTTCCCCAGA ATGCAGCCAATCGGGGCTTAAAAGCCAGC GAGTGGGTGCAGCAGGTGTCAGGCTTGAT GGACGGTAAAGGTGGTGGCAAGGATGTG TCTGCACAGGCCACAGGCAAGAACGTTGG CTGCCTGCAGGAGGCGCTGCAGCTGGCCA CTTCCTTCGCCCAGCTGCGCCTCGGGGAT GTAAAGAACTGA AlaRS1.sup.C12 Protein/ MRHLRNSSHAGAFVIVTEEATAKGIRRIVAV SEQ.ID. Human/ TGAEAQKALRKAESLKKCLSVMEAKVKAQ NO. 124 2 aa + TAPNKDVQREIADLGEALATAVIPQWQKDE 727-968 LRETLKSLKKVMDDLDRASKADVQKRVLE KTKQFIDSNPNQPLVILEMESGASAKALNEA LKLFKMHSPQTSAMLFTVDNEAGKITCLCQ VPQNAANRGLKASEWVQQVSGLMDGKGG GKDVSAQATGKNVGCLQEALQLATSFAQL RLGDVKN AlaRS1.sup.C12 DNA/ ATGAGGCACCTGCGGAACTCGAGTCATGC SEQ.ID. Human/ AGGAGCTTTTGTGATCGTGACGGAAGAAG NO. 125 CCATTGCCAAGGGTATCCGGAGGATTGTG GCTGTCACAGGTGCCGAGGCCCAGAAGG CCCTCAGGAAAGCAGAGAGCTTGAAGAA ATGTCTCTCTGTCATGGAAGCCAAAGTGA AGGCTCAGACTGCTCCAAACAAGGATGTG CAGAGGGAGATCGCTGACCTTGGAGAGG CCCTGGCCACTGCAGTCATCCCCCAGTGG CAGAAGGATGAATTGCGGGAGACTCTCA AATCCCTAAAGAAGGTCATGGATGACTTG GACCGAGCCAGCAAAGCCGATGTCCAGA AACGAGTGTTAGAGAAGACGAAGCAGTT CATCGACAGCAACCCCAACCAGCCTCTTG TCATCCTGGAGATGGAGAGCGGCGCCTCA GCCAAGGCCCTGAATGAAGCCTTGAAGCT CTTCAAGATGCACTCCCCTCAGACTTCTG CCATGCTCTTCACGGTGGACAATGAGGCT GGCAAGATCACGTGCCTGTGTCAAGTTCC CCAGAATGCAGCCAATCGGGGCTTAAAA GCCAGCGAGTGGGTGCAGCAGGTGTCAG GCTTGATGGACGGTAAAGGTGGTGGCAA GGATGTGTCTGCACAGGCCACAGGCAAG AACGTTGGCTGCCTGCAGGAGGCGCTGCA GCTGGCCACTTCCTTCGCCCAGCTGCGCC TCGGGGATGTAAAGAACTGA AlaRS1.sup.C13 Protein/ MVKDIINEEEVQFLKTLSRGRRILDRKIQSL SEQ.ID. Human/ GDSKTIPGDTAWLLYDTYGFPVDLTGLIAEE NO. 126 370-968 KGLVVDMDGFEEERKLAQLKSQGKGAGGE DLIMLDIYAIEELRARGLEVTDDSPKYNYHL DSSGSYVFENTVATVMALRREKMFVEEVST GQECGVVLDKTCFYAEQGGQIYDEGYLVK VDDSSEDKTEFTVKNAQVRGGYVLHIGTIY GDLKVGDQVWLFIDEPRRRPIMSNHTATHI LNFALRSVLGEADQKGSLVAPDRLRFDFTA KGAMSTQQIKKAEEIANEMIEAAKAVYTQD CPLAAAKAIQGLRAVFDETYPDPVRVVSIG VPVSELLDDPSGPAGSLTSVEFCGGTHLRNS SHAGAFVIVTEEAIAKGIRRIVAVTGAEAQK ALRKAESLKKCLSVMEAKVKAQTAPNKDV QREIADLGEALATAVIPQWQKDELRETLKS LKKVMDDLDRASKADVQKRVLEKTKQFID SNPNQPLVILEMESGASAKALNEALKLFKM HSPQTSAMLFTVDNEAGKITCLCQVPQNAA NRGLKASEWVQQVSGLMDGKGGGKDVSA QATGKNVGCLQEALQLATSFAQLRLGDVK N AlaRS1.sup.C13 DNA/ ATGGTGAAGGACATCATTAATGAAGAAG SEQ.ID. Human/ AGGTGCAGTTTCTCAAGACTCTCAGCAGA NO. 127 GGGCGTCGCATCCTGGACAGGAAAATTCA GAGCCTGGGAGACAGCAAGACCATTCCC GGAGACACTGCTTGGCTCCTCTATGACAC CTATGGGTTTCCAGTGGATCTGACTGGAC TGATTGCTGAAGAGAAGGGCCTGGTGGTA GACATGGATGGCTTTGAAGAGGAGAGGA AACTGGCCCAGCTGAAATCACAGGGCAA GGGAGCTGGTGGGGAAGACCTCATTATGC TGGACATTTACGCTATCGAAGAGCTCCGG GCACGGGGTCTGGAGGTCACAGATGATTC CCCAAAGTACAATTACCATTTGGACTCCA GTGGTAGCTATGTATTTGAGAACACAGTG GCTACGGTGATGGCTCTGCGCAGGGAGAA GATGTTCGTGGAAGAGGTGTCCACAGGCC AGGAGTGTGGAGTGGTGCTGGACAAGAC CTGTTTCTATGCTGAGCAAGGAGGCCAGA TCTATGACGAAGGCTACCTGGTGAAGGTG GATGACAGCAGTGAAGATAAAACAGAGT TTACAGTGAAGAATGCTCAGGTCCGAGGA GGGTATGTGCTACACATTGGAACCATCTA CGGTGACCTGAAAGTGGGGGATCAGGTCT GGCTGTTTATTGATGAGCCCCGACGAAGA CCCATCATGAGCAACCACACAGCTACGCA CATTCTGAACTTCGCCCTGCGCTCAGTGCT TGGGGAAGCTGACCAGAAAGGCTCATTG GTTGCTCCTGACCGCCTCAGATTTGACTTT ACTGCCAAGGGAGCCATGTCCACCCAACA GATCAAGAAGGCTGAAGAGATTGCTAAT GAGATGATTGAGGCAGCCAAGGCCGTCTA TACCCAGGATTGCCCCCTGGCAGCAGCGA AAGCCATCCAGGGCCTACGGGCTGTGTTT GATGAGACCTATCCTGACCCTGTGCGAGT CGTCTCCATTGGGGTCCCGGTGTCCGAGT TGCTGGATGACCCCTCTGGGCCTGCTGGC TCCCTGACTTCTGTTGAGTTCTGTGGGGG AACGCACCTGCGGAACTCGAGTCATGCAG GAGCTTTTGTGATCGTGACGGAAGAAGCC ATTGCCAAGGGTATCCGGAGGATTGTGGC TGTCACAGGTGCCGAGGCCCAGAAGGCCC TCAGGAAAGCAGAGAGCTTGAAGAAATG TCTCTCTGTCATGGAAGCCAAAGTGAAGG CTCAGACTGCTCCAAACAAGGATGTGCAG AGGGAGATCGCTGACCTTGGAGAGGCCCT GGCCACTGCAGTCATCCCCCAGTGGCAGA AGGATGAATTGCGGGAGACTCTCAAATCC CTAAAGAAGGTCATGGATGACTTGGACCG AGCCAGCAAAGCCGATGTCCAGAAACGA GTGTTAGAGAAGACGAAGCAGTTCATCGA CAGCAACCCCAACCAGCCTCTTGTCATCC TGGAGATGGAGAGCGGCGCCTCAGCCAA GGCCCTGAATGAAGCCTTGAAGCTCTTCA AGATGCACTCCCCTCAGACTTCTGCCATG CTCTTCACGGTGGACAATGAGGCTGGCAA GATCACGTGCCTGTGTCAAGTTCCCCAGA ATGCAGCCAATCGGGGCTTAAAAGCCAGC GAGTGGGTGCAGCAGGTGTCAGGCTTGAT GGACGGTAAAGGTGGTGGCAAGGATGTG TCTGCACAGGCCACAGGCAAGAACGTTGG CTGCCTGCAGGAGGCGCTGCAGCTGGCCA CTTCCTTCGCCCAGCTGCGCCTCGGGGAT GTAAAGAACTGA

TABLE-US-00018 TABLE 5B AARS polypeptides unique splice junctions Amino acid and Nucleic Acid Sequences in the vicinity of the Human Human Type/ unique splice fetal Adult SEQ. ID. Name species junction brain brain NO. A1- DNA/ ACCTTGTGTTCATCC 1 0 SEQ. ID. AS01 Human/ AGTATAACAG|GGCA NO. 128 CAGGTGCCCGACCAT ACACTG Protein/ N/A Human/ A1- DNA/ CTTTGCCAATGCAGG SEQ. ID. AS02 Human/ CATGAACCAG|CTGA NO. 129 AATCACAGGGCAAGG GAGCTG Protein/ FANAGMNQLKSQGKG SEQ. ID. Human/ A NO. 130 A1- DNA/ CTGGGAGACAGCAAG 1,415 397 SEQ. ID. AS03 Human/ ACCATTCCCG|TATT NO. 131 TGAGAACACAGTGGC TACGGT Protein/ LGDSKTIPVFENTVA SEQ. ID. Human/ T NO. 132 A1- DNA/ CATTTGGACTCCAGT SEQ. ID. AS04 Human/ GGTAGCTATG|AAAA NO. 133 CAGAGTTTACAGTGA AGAATG Protein/ IWTPVVAMKTEFTVK SEQ. ID. Human/ N NO. 134 A1- DNA TCAGGTCTGGCTGTT SEQ. ID. AS06 Human/ TATTGATGAG|GCAC NO. 135 CTGCGGAACTCGAGT CATGCA Protein/ MRHLRNSSHA SEQ. ID. Human/ NO. 136 A1- DNA/ GCCGGCCTGACAACA SEQ. ID. AS07 Human/ CAGGGCGTGG|GGAG NO. 137 ATGCATTTCCTGAGC TGAAGA Protein/ N/A Human/

TABLE-US-00019 TABLE 6 C-terminal AARS polypeptides identified by Bioinformatics Type/ species/ Amino acid and Nucleic Acid SEQ. ID. Name Residues Sequences NO. AlaRS1.sup.C4 Protein/ MIEAAKAVYTQDCPLAAAKAIQGLRAVFDE SEQ. ID. Human/ TYPDPVRVVSIGVPVSELLDDPSGPAGSLTSV NO. 138 659-968 EFCGGTHLRNSSHAGAFVIVTEEAIAKGIRRI VAVTGAEAQKALRKAESLKKCLSVMEAKV KAQTAPNKDVQREIADLGEALATAVIPQWQ KDELRETLKSLKKVMDDLDRASKADVQKR VLEKTKQFIDSNPNQPLVILEMESGASAKAL NEALKLFKMHSPQTSAMLFTVDNEAGKITCL CQVPQNAANRGLKASEWVQQVSGLMDGKG GGKDVSAQATGKNVGCLQEALQLATSFAQL RLGDVKN AlaRS1.sup.C4 DNA/ ATGATTGAGGCAGCCAAGGCCGTCTATAC SEQ. ID. Human/ CCAGGATTGCCCCCTGGCAGCAGCGAAAG NO. 139 CCATCCAGGGCCTACGGGCTGTGTTTGATG AGACCTATCCTGACCCTGTGCGAGTCGTCT CCATTGGGGTCCCGGTGTCCGAGTTGCTGG ATGACCCCTCTGGGCCTGCTGGCTCCCTGA CTTCTGTTGAGTTCTGTGGGGGAACGCACC TGCGGAACTCGAGTCATGCAGGAGCTTTTG TGATCGTGACGGAAGAAGCCATTGCCAAG GGTATCCGGAGGATTGTGGCTGTCACAGG TGCCGAGGCCCAGAAGGCCCTCAGGAAAG CAGAGAGCTTGAAGAAATGTCTCTCTGTCA TGGAAGCCAAAGTGAAGGCTCAGACTGCT CCAAACAAGGATGTGCAGAGGGAGATCGC TGACCTTGGAGAGGCCCTGGCCACTGCAG TCATCCCCCAGTGGCAGAAGGATGAATTG CGGGAGACTCTCAAATCCCTAAAGAAGGT CATGGATGACTTGGACCGAGCCAGCAAAG CCGATGTCCAGAAACGAGTGTTAGAGAAG ACGAAGCAGTTCATCGACAGCAACCCCAA CCAGCCTCTTGTCATCCTGGAGATGGAGAG CGGCGCCTCAGCCAAGGCCCTGAATGAAG CCTTGAAGCTCTTCAAGATGCACTCCCCTC AGACTTCTGCCATGCTCTTCACGGTGGACA ATGAGGCTGGCAAGATCACGTGCCTGTGT CAAGTTCCCCAGAATGCAGCCAATCGGGG CTTAAAAGCCAGCGAGTGGGTGCAGCAGG TGTCAGGCTTGATGGACGGTAAAGGTGGT GGCAAGGATGTGTCTGCACAGGCCACAGG CAAGAACGTTGGCTGCCTGCAGGAGGCGC TGCAGCTGGCCACTTCCTTCGCCCAGCTGC GCCTCGGGGATGTAAAGAACTGA AlaRS1.sup.C5 Protein/ PDPVRVVSIGVPVSELLDDPSGPAGSLTSVEF SEQ. ID. Human/ CGGTHLRNSSHAGAFVIVTEEAIAKGIRRIVA NO. 140 691-968 VTGAEAQKALRKAESLKKCLSVMEAKVKA QTAPNKDVQREIADLGEALATAVIPQWQKD ELRETLKSLKKVMDDLDRASKADVQKRVLE KTKQFIDSNPNQPLVILEMESGASAKALNEA LKLFKMHSPQTSAMLFTVDNEAGKITCLCQ VPQNAANRGLKASEWVQQVSGLMDGKGGG KDVSAQATGKNVGCLQEALQLATSFAQLRL GDVKN AlaRS1.sup.C5 DNA/ CCTGACCCTGTGCGAGTCGTCTCCATTGGG SEQ. ID. Human/ GTCCCGGTGTCCGAGTTGCTGGATGACCCC NO. 141 TCTGGGCCTGCTGGCTCCCTGACTTCTGTT GAGTTCTGTGGGGGAACGCACCTGCGGAA CTCGAGTCATGCAGGAGCTTTTGTGATCGT GACGGAAGAAGCCATTGCCAAGGGTATCC GGAGGATTGTGGCTGTCACAGGTGCCGAG GCCCAGAAGGCCCTCAGGAAAGCAGAGAG CTTGAAGAAATGTCTCTCTGTCATGGAAGC CAAAGTGAAGGCTCAGACTGCTCCAAACA AGGATGTGCAGAGGGAGATCGCTGACCTT GGAGAGGCCCTGGCCACTGCAGTCATCCC CCAGTGGCAGAAGGATGAATTGCGGGAGA CTCTCAAATCCCTAAAGAAGGTCATGGAT GACTTGGACCGAGCCAGCAAAGCCGATGT CCAGAAACGAGTGTTAGAGAAGACGAAGC AGTTCATCGACAGCAACCCCAACCAGCCT CTTGTCATCCTGGAGATGGAGAGCGGCGC CTCAGCCAAGGCCCTGAATGAAGCCTTGA AGCTCTTCAAGATGCACTCCCCTCAGACTT CTGCCATGCTCTTCACGGTGGACAATGAGG CTGGCAAGATCACGTGCCTGTGTCAAGTTC CCCAGAATGCAGCCAATCGGGGCTTAAAA GCCAGCGAGTGGGTGCAGCAGGTGTCAGG CTTGATGGACGGTAAAGGTGGTGGCAAGG ATGTGTCTGCACAGGCCACAGGCAAGAAC GTTGGCTGCCTGCAGGAGGCGCTGCAGCT GGCCACTTCCTTCGCCCAGCTGCGCCTCGG GGATGTAAAGAACTGA AlaRS1.sup.C6 Protein/ KGIRRIVAVTGAEAQKALRKAESLKKCLSV SEQ. ID. Human/ MEAKVKAQTAPNKDVQREIADLGEALATAV NO. 142 747-968 IPQWQKDELRETLKSLKKVMDDLDRASKAD VQKRVLEKTKQFIDSNPNQPLVILEMESGAS AKALNEALKLFKMHSPQTSAMLFTVDNEAG KITCLCQVPQNAANRGLKASEWVQQVSGLM DGKGGGKDVSAQATGKNVGCLQEALQLAT SFAQLRLGDVKN AlaRS1.sup.C6 DNA/ AAGGGTATCCGGAGGATTGTGGCTGTCAC SEQ. ID. Human/ AGGTGCCGAGGCCCAGAAGGCCCTCAGGA NO. 143 AAGCAGAGAGCTTGAAGAAATGTCTCTCT GTCATGGAAGCCAAAGTGAAGGCTCAGAC TGCTCCAAACAAGGATGTGCAGAGGGAGA TCGCTGACCTTGGAGAGGCCCTGGCCACTG CAGTCATCCCCCAGTGGCAGAAGGATGAA TTGCGGGAGACTCTCAAATCCCTAAAGAA GGTCATGGATGACTTGGACCGAGCCAGCA AAGCCGATGTCCAGAAACGAGTGTTAGAG AAGACGAAGCAGTTCATCGACAGCAACCC CAACCAGCCTCTTGTCATCCTGGAGATGGA GAGCGGCGCCTCAGCCAAGGCCCTGAATG AAGCCTTGAAGCTCTTCAAGATGCACTCCC CTCAGACTTCTGCCATGCTCTTCACGGTGG ACAATGAGGCTGGCAAGATCACGTGCCTG TGTCAAGTTCCCCAGAATGCAGCCAATCG GGGCTTAAAAGCCAGCGAGTGGGTGCAGC AGGTGTCAGGCTTGATGGACGGTAAAGGT GGTGGCAAGGATGTGTCTGCACAGGCCAC AGGCAAGAACGTTGGCTGCCTGCAGGAGG CGCTGCAGCTGGCCACTTCCTTCGCCCAGC TGCGCCTCGGGGATGTAAAGAACTGA AlaRS1.sup.C7 Protein/ PLVILEMESGASAKALNEALKLFKMHSPQTS SEQ. ID. Human/ AMLFTVDNEAGKITCLCQVPQNAANRGLKA NO. 144 856-968 SEWVQQVSGLMDGKGGGKDVSAQATGKN VGCLQEALQLATSFAQLRLGDVKN AlaRS1.sup.C7 DNA/ CCTCTTGTCATCCTGGAGATGGAGAGCGGC SEQ. ID. Human/ GCCTCAGCCAAGGCCCTGAATGAAGCCTT NO. 145 GAAGCTCTTCAAGATGCACTCCCCTCAGAC TTCTGCCATGCTCTTCACGGTGGACAATGA GGCTGGCAAGATCACGTGCCTGTGTCAAG TTCCCCAGAATGCAGCCAATCGGGGCTTA AAAGCCAGCGAGTGGGTGCAGCAGGTGTC AGGCTTGATGGACGGTAAAGGTGGTGGCA AGGATGTGTCTGCACAGGCCACAGGCAAG AACGTTGGCTGCCTGCAGGAGGCGCTGCA GCTGGCCACTTCCTTCGCCCAGCTGCGCCT CGGGGATGTAAAGAACTGA

Internal AARS Polypeptides: (Tables 7, 8 & 9)

TABLE-US-00020

[0102] TABLE 7A AARS polypeptides identified by MS Name Type/species/Residues Amino acid and Nucleic Acid Sequences SEQ. ID. NO.

TABLE-US-00021 TABLE 7B Mass spec peptides detected and inferred linking peptides Type/species Sequence SEQ. ID. NO.

TABLE-US-00022 TABLE 7C Concatenated sequences based on mass spec peptides detected Type/species Sequence SEQ. ID. NO.

TABLE-US-00023 TABLE 8 AARS polypeptides and alternative transcripts identified by Deep Sequencing Name Type/species/ Amino acid and Nucleic SEQ. ID. NO. Residues Acid Sequences

TABLE-US-00024 TABLE 8B AARS polypeptides unique splice junctions Name Type/ Amino acid and Nucleic Acid SEQ. ID. NO. species Sequences in the vicinity of the unique splice junction

TABLE-US-00025 TABLE 9 AARS polypeptides identified by Bioinformatics Type/ species/ SEQ.ID. Name Residues Amino acid and Nucleic Acid Sequences NO. AlaRS1.sup.I1 Protein/ RGLEVTDDSPKYNYHLDSSGSYVFENTVATVMALRR SEQ. ID. Human/ EKMFVEEVSTGQECGVVLDKTCFYAEQGGQIYDEGY NO. 177 476-749 LVKVDDSSEDKTEFTVKNAQVRGGYVLHIGTIYGDLK VGDQVWLFIDEPRRRPIMSNHTATHILNFALRSVLGEA DQKGSLVAPDRLRFDFTAKGAMSTQQIKKAEEIANEM IEAAKAVYTQDCPLAAAKAIQGLRAVFDETYPDPVRV VSIGVPVSELLDDPSGPAGSLTSVEFCGGTHLRNSSHA GAFVIVTEEAIAKGI AlaRS1.sup.I1 DNA/ CGGGGTCTGGAGGTCACAGATGATTCCCC SEQ. ID. Human/ AAAGTACAATTACCATTTGGACTCCAGTGG NO. 178 TAGCTATGTATTTGAGAACACAGTGGCTAC GGTGATGGCTCTGCGCAGGGAGAAGATGT TCGTGGAAGAGGTGTCCACAGGCCAGGAG TGTGGAGTGGTGCTGGACAAGACCTGTTTC TATGCTGAGCAAGGAGGCCAGATCTATGA CGAAGGCTACCTGGTGAAGGTGGATGACA GCAGTGAAGATAAAACAGAGTTTACAGTG AAGAATGCTCAGGTCCGAGGAGGGTATGT GCTACACATTGGAACCATCTACGGTGACCT GAAAGTGGGGGATCAGGTCTGGCTGTTTA TTGATGAGCCCCGACGAAGACCCATCATG AGCAACCACACAGCTACGCACATTCTGAA CTTCGCCCTGCGCTCAGTGCTTGGGGAAGC TGACCAGAAAGGCTCATTGGTTGCTCCTGA CCGCCTCAGATTTGACTTTACTGCCAAGGG AGCCATGTCCACCCAACAGATCAAGAAGG CTGAAGAGATTGCTAATGAGATGATTGAG GCAGCCAAGGCCGTCTATACCCAGGATTG CCCCCTGGCAGCAGCGAAAGCCATCCAGG GCCTACGGGCTGTGTTTGATGAGACCTATC CTGACCCTGTGCGAGTCGTCTCCATTGGGG TCCCGGTGTCCGAGTTGCTGGATGACCCCT CTGGGCCTGCTGGCTCCCTGACTTCTGTTG AGTTCTGTGGGGGAACGCACCTGCGGAAC TCGAGTCATGCAGGAGCTTTTGTGATCGTG ACGGAAGAAGCCATTGCCAAGGGTATC

[0103] "Protein fragments," or the amino acid sequence of protein fragments, such as proteolytic fragments or splice variant fragments, can be characterized, identified, or derived according to a variety of techniques. For instance, splice variants can be identified by techniques such as deep sequencing (see, e.g., Xing et al., RNA. 14:1470-1479, 2008; and Zhang et al., Genome Research. 17:503-509, 2007). As a further example, protein fragments such as proteolytic fragments can be identified in vitro, such as by incubating full-length or other AARS polypeptides with selected proteases, or they can be identified endogenously (e.g., in vivo). In certain embodiments, protein fragments such as endogenous proteolytic fragments can be generated or identified, for instance, by recombinantly expressing full-length or other AARS polypeptides in a selected microorganism or eukaryotic cell that has been either modified to contain one or more selected proteases, or that naturally contains one or more proteases that are capable of acting on a selected AARS polypeptide, and isolating and characterizing the endogenously produced protein fragments therefrom.

[0104] In certain embodiments, protein fragments such as endogenous (e.g., naturally-occurring) proteolytic fragments can be generated or identified, for instance, from various cellular fractions (e.g., cytosolic, membrane, nuclear) and/or growth medium of various cell-types, including, for example, immune cells such as monocytes, dendritic cells, macrophages (e.g., RAW 264.7 macrophages), neutrophils, eosinophils, basophils, and lymphocytes, such as B-cells and T-cells (e.g., CD4+ helper and CD8+ killer cells), including primary T-cells and T-cell lines such as Jurkat T-cells, as well as natural killer (NK) cells.

[0105] In certain embodiments, protein fragments such as endogenous proteolytic fragments, however generated, can be identified by techniques such as mass-spectrometry, or equivalent techniques. Once an in vitro or endogenously identified protein fragment has been generated or identified, it can be mapped or sequenced, and, for example, cloned into an expression vector for recombinant production, or produced synthetically.

[0106] A wide variety of proteases can be used to produce, identify, derive, or characterize the sequence of AARS protein fragments such as proteolytic fragments. Generally, proteases are usually classified according to three major criteria: (i) the reaction catalyzed, (ii) the chemical nature of the catalytic site, and (iii) the evolutionary relationship, as revealed by the structure. General examples of proteases or proteinases, as classified by mechanism of catalysis, include aspartic proteases, serine proteases, cysteine proteases, and metalloproteases.

[0107] Most aspartic proteases belong to the pepsin family. This family includes digestive enzymes, such as pepsin and chymosin, as well as lysosomal cathepsins D and processing enzymes such as renin, and certain fungal proteases (e.g., penicillopepsin, rhizopuspepsin, endothiapepsin). A second family of aspartic proteases includes viral proteinases such as the protease from the AIDS virus (HIV), also called retropepsin.

[0108] Serine proteases include two distinct families. First, the chymotrypsin family, which includes the mammalian enzymes such as chymotrypsin, trypsin, elastase, and kallikrein, and second, the substilisin family, which includes the bacterial enzymes such as subtilisin. The general 3D structure between these two families is different, but they have the same active site geometry, and catalysis proceeds via the same mechanism. The serine proteases exhibit different substrate specificities, differences which relate mainly to amino acid substitutions in the various enzyme subsites (substrate residue interacting sites). Some serine proteases have an extended interaction site with the substrate whereas others have a specificity that is restricted to the P1 substrate residue.

[0109] The cysteine protease family includes the plant proteases such as papain, actinidin, and bromelain, several mammalian lysosomal cathepsins, the cytosolic calpains (calcium-activated), as well as several parasitic proteases (e.g., Trypanosoma, Schistosoma). Papain is the archetype and the best studied member of the family. Recent elucidation of the X-ray structure of the Interleukin-1-beta Converting Enzyme has revealed a novel type of fold for cysteine proteinases.

[0110] The metalloproteases are one of the older classes of proteases, found in bacteria, fungi, and higher organisms. They differ widely in their sequences and their 3D structures, but the great majority of enzymes contain a zinc atom that is catalytically active. In some cases, zinc may be replaced by another metal such as cobalt or nickel without loss of proteolytic activity. Bacterial thermolysin has been well characterized and its crystallographic structure indicates that zinc is bound by two histidines and one glutamic acid. Many metalloproteases contain the sequence motif HEXXH, which provides two histidine ligands for the zinc. The third ligand is either a glutamic acid (thermolysin, neprilysin, alanyl aminopeptidase) or a histidine (astacin, serralysin).

[0111] Illustrative proteases include, for example, achromopeptidase, aminopeptidase, ancrod, angiotensin converting enzyme, bromelain, calpain, calpain I, calpain II, carboxypeptidase A, carboxypeptidase B, carboxypeptidase G, carboxypeptidase P, carboxypeptidase W, carboxypeptidase Y, caspase 1, caspase 2, caspase 3, caspase 4, caspase 5, caspase 6, caspase 7, caspase 8, caspase 9, caspase 10, caspase 11, caspase 12, caspase 13, cathepsin B, cathepsin C, cathepsin D, cathepsin E, cathepsin G, cathepsin H, cathepsin L, chymopapain, chymase, chymotrypsin, clostripain, collagenase, complement C1r, complement C1s, complement Factor D, complement factor I, cucumisin, dipeptidyl peptidase IV, elastase (leukocyte), elastase (pancreatic), endoproteinase Arg-C, endoproteinase Asp-N, endoproteinase Glu-C, endoproteinase Lys-C, enterokinase, factor Xa, ficin, furin, granzyme A, granzyme B, HIV Protease, IGase, kallikrein tissue, leucine aminopeptidase (general), leucine aminopeptidase (cytosol), leucine aminopeptidase (microsomal), matrix metalloprotease, methionine aminopeptidase, neutrase, papain, pepsin, plasmin, prolidase, pronase E, prostate specific antigen, protease alkalophilic from Streptomyces griseus, protease from Aspergillus, protease from Aspergillus saitoi, protease from Aspergillus sojae, protease (B. licheniformis) (alkaline or alcalase), protease from Bacillus polymyxa, protease from Bacillus sp, protease from Rhizopus sp., protease S, proteasomes, proteinase from Aspergillus oryzae, proteinase 3, proteinase A, proteinase K, protein C, pyroglutamate aminopeptidase, rennin, rennin, streptokinase, subtilisin, thermolysin, thrombin, tissue plasminogen activator, trypsin, tryptase and urokinase.

[0112] Certain embodiments relate to isolated AARS polypeptides, comprising, consisting essentially of, or consisting of amino acid sequences that have been derived from endogenous, naturally-occurring AARS polypeptide fragments, and pharmaceutical compositions comprising said fragments, and methods of use thereof. These and related embodiments can be generated or identified in vivo, ex vivo, and/or in vitro. In certain preferred in vitro embodiments, AARS proteolytic fragments are generated or identified by incubating an AARS polypeptide, such as a full-length AARS polypeptide, with one or more isolated human proteases, mainly those proteases that are endogenous or natural to humans, such as elastase and others described herein and known in the art. Other embodiments relate to isolated AARS polypeptides, comprising, consisting essentially of, or consisting of amino acid sequences that have been derived from endogenous, naturally-occurring AARS splice variants, and pharmaceutical compositions comprising said fragments, and methods of use thereof. Essentially, AARS protein fragment can be isolated from samples that have been exposed to proteases, whether in vivo or in vitro.

[0113] In certain embodiments, AARS protein fragments can be identified by techniques such as mass-spectrometry, or equivalent techniques. Merely by way of illustration and not limitation, in certain embodiments the proteomes from various cell types, tissues, or body fluids from a variety of physiological states (e.g., hypoxia, diet, age, disease) or fractions thereof may be separated by 1D SDS-PAGE and the gel lanes cut into bands at fixed intervals; after which the bands may be optionally digested with an appropriate protease, such as trypsin, to release the peptides, which may then be analyzed by 1D reverse phase LC-MS/MS. The resulting proteomic data may be integrated into so-called peptographs, which plot, in the left panel, sequence coverage for a given protein in the horizontal dimension (N to C terminus, left to right) versus SDS-PAGE migration in the vertical dimension (high to low molecular weight, top to bottom). The specific peptide fragments can then be sequenced or mapped. In certain embodiments, the AARS reference fragment may be characterized by its unique molecular weight, as compared, for example, to the molecular weight of the corresponding full-length AARS.

[0114] As noted above, embodiments of the present invention include the AARS polypeptides set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9. Also included are "variants" of the AARS reference polypeptides. The recitation polypeptide "variant" refers to polypeptides that are distinguished from a reference AARS polypeptide by the addition, deletion, and/or substitution of at least one amino acid residue, and which typically retain (e.g., mimic) or modulate (e.g., antagonize) one or more non-canonical activities of a reference AARS polypeptide.

[0115] Moreover human Alanyl tRNA synthetases include several hundred highly related polymorphic forms, and these are known in the art to be at least partially functionally interchangeable. It would thus be a routine matter to select a naturally occurring variant of Alanyl tRNA synthetase, including, for example the single nucleotide polymorphic forms listed in Table A to create an AARS polypeptide containing one or more amino acid changes based on the sequence of any of the homologues, orthologs, and naturally-occurring isoforms of human as well as other species of Alanyl tRNA synthetase.

TABLE-US-00026 TABLE A Human Alanyl tRNA synthetase SNPs Gene Bank Gene Bank Accession Nucleotide Accession Nucleotide Number change Number change rs118124510 A/G rs11385686 -/T rs118089442 C/G rs11379998 -/A rs118024420 G/T rs10536509 -/CT rs118023366 A/G rs9931779 C/T rs117953939 A/C rs9922969 A/G rs117946875 C/G rs9673840 G/T rs117874802 C/T rs8063749 C/T rs117857165 A/G rs8062865 A/G rs117758610 C/T rs8062097 C/T rs117724995 C/T rs8060812 A/G rs117721378 A/G rs8057463 A/T rs117690614 C/T rs8056196 A/C rs117626545 A/T rs8056048 A/G rs117598688 A/G rs8054995 G/T rs117478137 A/C rs8046786 C/T rs117391661 A/G rs8046662 A/G rs117349252 C/T rs8045571 A/G rs117345088 A/C rs7205918 C/T rs117312086 A/C rs7202056 A/C rs117253324 C/T rs7198871 A/G rs117204433 C/T rs7193598 C/T rs117174836 A/C rs7192000 C/T rs117108016 C/T rs7190921 C/G rs117057627 C/T rs7186104 C/T rs117030089 A/G rs7186024 A/G rs116941916 G/T rs7185665 A/C rs116861081 C/T rs7184495 C/T rs116764273 G/T rs6499309 A/G rs116762869 G/T rs4985408 A/C rs116712553 A/G rs4985407 A/G rs116553521 G/T rs4081753 A/C/G rs116544164 A/G rs2070203 C/T rs116399415 C/T rs1183292 A/G rs116369869 A/G rs1179964 A/G rs116309532 C/G rs1179963 A/G rs116297318 A/G rs1179962 C/T rs115882953 G/T rs1143506 A/G rs115433323 C/T rs34538071 A/G rs115307561 C/G rs34511567 -/C rs115160127 G/T rs34472677 C/T rs115134263 C/G rs34369477 -/A rs114823713 C/T rs34363830 -/G rs114598544 A/C rs34306553 C/G rs114595840 A/T rs34299014 -/A rs114572751 C/T rs34296479 -/G rs114525231 A/T rs34268796 -/A rs114484755 A/G rs34129241 -/T rs114349195 A/G rs34087264 A/G rs114327666 A/G rs28579865 A/G rs114266345 A/G rs28515500 A/G rs114248390 C/T rs16970361 C/G rs114213309 A/C rs16970307 C/T rs114121156 A/G rs16970302 G/T rs114103198 C/G rs13338059 A/G rs114025877 A/C rs13332867 A/G rs113960057 A/C rs13332726 C/G rs113902056 G/T rs12924911 A/C rs113824201 A/G rs12598140 A/C rs113812226 A/G rs12445696 C/T rs113737430 C/T rs12445694 C/T rs113726987 A/G rs12149776 A/G rs113691826 A/G rs12149660 A/G rs113645277 A/G rs12149282 C/T rs113610820 A/G rs12149011 A/G rs113518696 G/T rs11862188 C/T rs113516046 C/T rs11862150 C/T rs113473235 A/T rs11862053 G/T rs113447635 A/C rs11648189 A/G rs113436178 C/T rs11643367 A/G rs113435697 C/T rs11537667 A/G rs113403017 C/G rs11537665 C/T rs113366691 A/G rs11537664 C/T rs113339156 A/G rs11537663 A/T rs113285988 A/G rs11432931 -/T rs113279975 A/G rs11432930 -/C rs113242213 A/G rs11418378 -/G rs113207374 C/T rs57438636 -/A/AA rs113142906 -/T rs57281906 C/G rs113041194 -/CTGGGC rs57241744 C/T rs113030826 A/G rs56833219 C/T rs112984536 C/T rs56734965 -/A rs112790341 C/G rs56394253 -- rs112778140 -/G rs56389123 G/T rs112717253 C/T rs56115411 A/C rs112620320 A/T rs55936739 C/T rs112579905 A/G rs55819743 A/G rs112509050 C/T rs55805938 C/T rs112411203 A/G rs55790133 A/C rs112393101 C/T rs55683684 C/T rs112303399 A/G rs55657328 A/C rs112174725 A/T rs55649889 -/AA rs112146705 C/T rs36046810 -/A rs112129984 G/T rs36016919 -/T rs112061695 C/T rs36016621 -/C rs112055531 A/G rs35986765 G/T rs112053092 C/T rs35769308 C/G rs112043250 A/G rs35744709 A/T rs111980438 C/T rs35734224 -/A rs111942451 A/G rs35687595 -/G rs111938682 C/G rs35628195 -/TT rs111906601 A/G rs35564585 -/A rs111864362 A/G rs35442003 -/T rs111848470 C/T rs35421372 -/A rs111783220 G/T rs35286903 -/G rs111776118 -/A rs35259849 -/T rs111756183 A/G rs35168298 -/A rs111719142 G/T rs35133764 G/T rs111698902 A/G rs35093895 -/T rs111695190 C/T rs35052297 -/G rs111624368 C/T rs34979457 -/G rs111620465 A/G rs34927148 -/A rs111602240 G/T rs34846578 -/CT rs111598897 A/G rs34829782 -/C rs111583584 A/G rs34656219 -/G rs111567777 G/T rs34642380 -/AA rs111539662 -/A rs71151180 -/TTTTTTTTTTT TTT rs111461416 C/T rs71151179 -/A rs111435738 A/G rs67463183 -/A rs111426337 A/T rs67413523 -/TG/TGTGTGTG TG rs111421609 A/G rs67270571 (LARGE- DELETION)/-

rs111412304 A/T rs67219164 -/GCTGGATTTTC TGATGG rs111338842 A/G rs67112563 -/AG rs111333360 C/T rs66627085 A/C rs111315764 A/G rs66625764 -/CA rs80257731 C/G rs62049422 A/C rs80256286 A/G rs62049421 A/T rs80228853 A/C rs62049420 A/C rs80222640 A/G rs62049419 G/T rs80200401 A/C rs62049418 A/T rs80166718 A/G rs61594809 C/T rs80140241 G/T rs61172065 C/T rs80062047 C/G rs60903849 A/G rs79944605 G/T rs60853195 A/G rs79879166 C/T rs60567469 A/G rs79809458 A/G rs60502803 -/TTTTTT rs79785372 A/G rs60445375 -/CTGGGC rs79355112 -/AGAAAAAA rs60426209 C/T AAAAAAAAAA AAAAA rs79296187 C/T rs60103946 A/G rs79277862 A/C rs59869320 C/T rs79100623 A/T rs59612351 A/G rs111906601 A/G rs59384897 G/T rs111864362 A/G rs59002209 -/AA rs111848470 C/T rs58575154 A/G rs111783220 G/T rs58467558 C/G rs111776118 -/A rs58131227 A/G rs111756183 A/G rs57976512 -/A rs111719142 G/T rs57940453 A/G rs111698902 A/G rs57936835 -/CACACACA rs111695190 C/T rs57607171 C/T rs111624368 C/T rs57444625 -/A rs111620465 A/G rs1049384 C/T rs111602240 G/T rs775208 C/T rs111598897 A/G rs775205 G/T rs111583584 A/G rs775204 C/T rs111567777 G/T rs74570457 A/C rs111539662 -/A rs74508832 C/T rs111461416 C/T rs74446936 A/G rs111435738 A/G rs74218028 A/G rs111426337 A/T rs74024189 A/G rs111421609 A/G rs74024188 A/C rs111412304 A/T rs74024187 C/T rs111338842 A/G rs74024186 C/T rs111333360 C/T rs74024185 C/T rs111315764 A/G rs74024184 A/G rs80257731 C/G rs74024183 C/T rs80256286 A/G rs74024182 A/G rs80228853 A/C rs74024180 C/T rs80222640 A/G rs73575193 C/T rs80200401 A/C rs73575188 C/T rs80166718 A/G rs72790626 C/G rs80140241 G/T rs72790624 G/T rs80062047 C/G rs72427279 -/G rs79944605 G/T rs72289034 -/GCCCATCAGAAA ATCCA rs79879166 C/T rs72275659 -/AAAAAAAAAAAA AAAAAA rs79809458 A/G rs72253030 -/TTTTTT rs79785372 A/G rs72251314 -/CACACACA rs79355112 -/AGAAAAAA rs72185281 -/T AAAAAAAAAA AAAAA rs79296187 C/T rs72183811 -/ACACACAC rs79277862 A/C rs72172097 -/ACACACAC rs79100623 A/T rs72095566 -/T rs79053418 A/G rs71943340 -/ACACACAC rs79022911 C/T rs71935559 -/A rs79010592 G/T rs71928705 -/AC rs78893985 A/G rs71912498 -/TT rs78862566 A/G rs71847937 -/AA rs78835148 A/G rs71455236 C/T rs78771134 A/T rs71455235 C/G rs78570051 A/C rs71385652 CA/TG rs78523270 A/G rs71385651 -/AA rs78479085 C/T rs71227275 rs78344434 A/G rs71151181 -/T rs78325403 A/C rs775203 A/G rs78298397 A/C rs775202 C/T rs78271061 A/C rs775201 C/T rs78093603 A/C rs775200 C/T rs77982431 A/C rs775199 A/G rs77814513 A/G rs775198 A/G rs77790607 C/T rs775197 C/G rs77753666 G/T rs77749002 G/T rs77543430 G/T rs77279473 C/T rs77154298 A/C rs77145843 A/G rs76884167 A/G rs76856995 A/T rs76775711 C/T rs76596965 G/T rs76446904 C/G rs76379088 A/G rs76305777 A/C rs76247508 G/T rs76088863 C/G rs75989036 C/G rs75949713 A/G rs75942139 A/C rs75881159 A/C rs75655605 C/G rs75604742 A/C rs75500409 A/C rs75414419 A/G rs75209821 A/G rs75117375 A/G rs75106906 A/C rs75055059 A/C rs75033663 G/T rs75029357 C/G rs74845494 C/T rs74835675 C/T rs74817799 C/T rs74733646 A/T rs74732192 A/G

[0116] In certain embodiments, a polypeptide variant is distinguished from a reference polypeptide by one or more substitutions, which may be conservative or non-conservative, as described herein and known in the art. In certain embodiments, the polypeptide variant comprises conservative substitutions and, in this regard, it is well understood in the art that some amino acids may be changed to others with broadly similar properties without changing the nature of the activity of the polypeptide.

[0117] In certain embodiments, a variant polypeptide includes an amino acid sequence having at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or more sequence identity or similarity to a corresponding sequence of an AARS reference polypeptide, as described herein, and substantially retains the non-canonical activity of that reference polypeptide. Also included are sequences differing from the reference AARS sequences by the addition, deletion, or substitution of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150 or more amino acids but which retain the properties of the reference AARS polypeptide. In certain embodiments, the amino acid additions or deletions occur at the C-terminal end and/or the N-terminal end of the AARS reference polypeptide. In certain embodiments, the amino acid additions include 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 30, 40, 50 or more wild-type residues (i.e., from the corresponding full-length AARS polypeptide) that are proximal to the C-terminal end and/or the N-terminal end of the AARS reference polypeptide.

[0118] In certain embodiments, variant polypeptides differ from the corresponding AARS reference sequences by at least 1% but less than 20%, 15%, 10% or 5% of the residues. (If this comparison requires alignment, the sequences should be aligned for maximum similarity. "Looped" out sequences from deletions or insertions, or mismatches, are considered differences.) The differences are, suitably, differences or changes at a non-essential residue or a conservative substitution. In certain embodiments, the molecular weight of a variant AARS polypeptide differs from that of the AARS reference polypeptide by about 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, or more.

[0119] Also included are biologically active "fragments" of the AARS reference polypeptides, i.e., biologically active fragments of the AARS protein fragments. Representative biologically active fragments generally participate in an interaction, e.g., an intramolecular or an inter-molecular interaction. An inter-molecular interaction can be a specific binding interaction or an enzymatic interaction. An inter-molecular interaction can be between an AARS polypeptide and a cellular binding partner, such as a cellular receptor or other host molecule that participates in the non-canonical activity of the AARS polypeptide. In some embodiments, AARS proteins, variants, and biologically active fragments thereof, bind to one or more cellular binding partners with an affinity of at least about 0.01, 0.05, 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 40, or 50 nM. The binding affinity of an AARS protein fragment for a selected cellular binding partner, particularly a binding partner that participates in a non-canonical activity, is typically stronger than that of the AARS protein fragment's corresponding full-length AARS polypeptide, by at least about 1.5.times., 2.times., 2.5.times., 3.times., 3.5.times., 4.times., 4.5.times., 5.times., 6.times., 7.times., 8.times., 9.times., 10.times., 15.times., 20.times., 25.times., 30.times., 40.times., 50.times., 60.times., 70.times., 80.times., 90.times., 100.times., 200.times., 300.times., 400.times., 500.times., 600.times., 700.times., 800.times., 900.times., 1000.times. or more (including all integers in between). The binding affinity of an AARS protein fragment for a binding partner that participates in at least one canonical activity of an AARS is typically weaker than that of the AARS protein fragment's corresponding full-length AARS polypeptide, by at least about 1.5.times., 2.times., 2.5.times., 3.times., 3.5.times., 4.times., 4.5.times., 5.times., 6.times., 7.times., 8.times., 9.times., 10.times., 15.times., 20.times., 25.times., 30.times., 40.times., 50.times., 60.times., 70.times., 80.times., 90.times., 100.times., 200.times., 300.times., 400.times., 500.times., 600.times., 700.times., 800.times., 900.times., 1000.times. or more.

[0120] Typically, biologically active fragments comprise a domain or motif with at least one activity of an AARS reference polypeptide and may include one or more (and in some cases all) of the various active domains, and include fragments having a non-canonical activity. In some cases, biologically active fragments of an AARS polypeptide have a biological activity that is unique to the particular, truncated fragment, such that the full-length AARS polypeptide may not have that activity. In certain cases, the biological activity may be revealed by separating the biologically active AARS polypeptide fragment from the other full-length AARS polypeptide sequences, or by altering certain residues of the full-length AARS wild-type polypeptide sequence to unmask the biologically active domains.

[0121] A biologically active fragment of an AARS reference polypeptide can be a polypeptide fragment which is, for example, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 220, 240, 260, 280, 300, 320, 340, 360, 380, 400, 450, 500, 550, 600, 650, 700, 750 or more contiguous or non-contiguous amino acids, including all integers (e.g., 101, 102, 103) and ranges (e.g., 50-100, 50-150, 50-200) in between, of the amino acid sequences set forth in any one of the AARS reference polypeptides described herein, but typically exclude the full-length AARS. In certain embodiments, a biologically active fragment comprises a non-canonical activity-related sequence, domain, or motif. In certain embodiments, the C-terminal or N-terminal region of any AARS reference polypeptide may be truncated by about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, or 700 or more amino acids, or by about 10-50, 20-50, 50-100, 100-150, 150-200, 200-250, 250-300, 300-350, 350-400, 400-450, 450-500, 500-550, 550-600, 600-650, 650-700 or more amino acids, including all integers and ranges in between (e.g., 101, 102, 103, 104, 105), so long as the truncated AARS polypeptide retains the non-canonical activity of the reference polypeptide. Typically, the biologically-active fragment has no less than about 1%, about 5%, about 10%, about 25%, or about 50% of an activity of the biologically-active (i.e., non-canonical activity) AARS reference polypeptide from which it is derived. Exemplary methods for measuring such non-canonical activities are described in the Examples.

[0122] As noted above, an AARS polypeptide may be altered in various ways including amino acid substitutions, deletions, truncations, and insertions. Methods for such manipulations are generally known in the art. For example, amino acid sequence variants of an AARS reference polypeptide can be prepared by mutations in the DNA. Methods for mutagenesis and nucleotide sequence alterations are well known in the art. See, for example, Kunkel (1985, Proc. Natl. Acad. Sci. USA. 82: 488-492), Kunkel et al., (1987, Methods in Enzymol, 154: 367-382), U.S. Pat. No. 4,873,192, Watson, J. D. et al., ("Molecular Biology of the Gene", Fourth Edition, Benjamin/Cummings, Menlo Park, Calif., 1987) and the references cited therein. Guidance as to appropriate amino acid substitutions that do not affect biological activity of the protein of interest may be found in the model of Dayhoff et al., (1978) Atlas of Protein Sequence and Structure (Natl. Biomed. Res. Found., Washington, D.C.).

[0123] Similarly it is within the skill in the art to address and/or mitigate immunogenicity concerns if they arise using an AARS polypeptide, e.g., by the use of automated computer recognition programs to identify potential T cell epitopes, and directed evolution approaches to identify less immunogenic forms.

[0124] Methods for screening gene products of combinatorial libraries made by point mutations or truncation, and for screening cDNA libraries for gene products having a selected property are known in the art. Such methods are adaptable for rapid screening of the gene libraries generated by combinatorial mutagenesis of AARS polypeptides. Recursive ensemble mutagenesis (REM), a technique which enhances the frequency of functional mutants in the libraries, can be used in combination with the screening assays to identify AARS polypeptide variants (Arkin and Yourvan (1992) Proc. Natl. Acad. Sci. USA 89: 7811-7815; Delgrave et al., (1993) Protein Engineering, 6: 327-331). Conservative substitutions, such as exchanging one amino acid with another having similar properties, may be desirable as discussed in more detail below.

[0125] Biologically active truncated and/or variant AARS polypeptides may contain conservative amino acid substitutions at various locations along their sequence, as compared to a reference AARS amino acid residue. Additionally, naturally occurring variants of AARS proteins have been sequenced, and are known in the art to be at least partially functionally interchangeable. It would thus be a routine matter to select an amino acid position to introduce a conservative, or non conservative mutation into an AARS polypeptide based on naturally occurring sequence variation among the known AARS protein homologues, orthologs, and naturally-occurring isoforms of human as well as other species of an AARS protein.

[0126] A "conservative amino acid substitution" is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art, which can be generally sub-classified as follows:

[0127] Acidic: The residue has a negative charge due to loss of H ion at physiological pH and the residue is attracted by aqueous solution so as to seek the surface positions in the conformation of a peptide in which it is contained when the peptide is in aqueous medium at physiological pH. Amino acids having an acidic side chain include glutamic acid and aspartic acid.

[0128] Basic: The residue has a positive charge due to association with H ion at physiological pH or within one or two pH units thereof (e.g., histidine) and the residue is attracted by aqueous solution so as to seek the surface positions in the conformation of a peptide in which it is contained when the peptide is in aqueous medium at physiological pH. Amino acids having a basic side chain include arginine, lysine and histidine.

[0129] Charged: The residues are charged at physiological pH and, therefore, include amino acids having acidic or basic side chains (i.e., glutamic acid, aspartic acid, arginine, lysine and histidine).

[0130] Hydrophobic: The residues are not charged at physiological pH and the residue is repelled by aqueous solution so as to seek the inner positions in the conformation of a peptide in which it is contained when the peptide is in aqueous medium. Amino acids having a hydrophobic side chain include tyrosine, valine, isoleucine, leucine, methionine, phenylalanine and tryptophan.

[0131] Neutral/polar: The residues are not charged at physiological pH, but the residue is not sufficiently repelled by aqueous solutions so that it would seek inner positions in the conformation of a peptide in which it is contained when the peptide is in aqueous medium. Amino acids having a neutral/polar side chain include asparagine, glutamine, cysteine, histidine, serine and threonine.

[0132] This description also characterizes certain amino acids as "small" since their side chains are not sufficiently large, even if polar groups are lacking, to confer hydrophobicity. With the exception of proline, "small" amino acids are those with four carbons or less when at least one polar group is on the side chain and three carbons or less when not. Amino acids having a small side chain include glycine, serine, alanine and threonine. The gene-encoded secondary amino acid proline is a special case due to its known effects on the secondary conformation of peptide chains. The structure of proline differs from all the other naturally-occurring amino acids in that its side chain is bonded to the nitrogen of the .alpha.-amino group, as well as the .alpha.-carbon. Several amino acid similarity matrices are known in the art (see e.g., PAM120 matrix and PAM250 matrix as disclosed for example by Dayhoff et al., 1978, A model of evolutionary change in proteins). Matrices for determining distance relationships In M. O. Dayhoff, (ed.), Atlas of protein sequence and structure, Vol. 5, pp. 345-358, National Biomedical Research Foundation, Washington D.C.; and by Gonnet et al., (Science, 256: 14430-1445, 1992), however, include proline in the same group as glycine, serine, alanine and threonine. Accordingly, for the purposes of the present invention, proline is classified as a "small" amino acid.

[0133] The degree of attraction or repulsion required for classification as polar or nonpolar is arbitrary and, therefore, amino acids specifically contemplated by the invention have been classified as one or the other. Most amino acids not specifically named can be classified on the basis of known behavior.

[0134] Amino acid residues can be further sub-classified as cyclic or non-cyclic, and aromatic or non-aromatic, self-explanatory classifications with respect to the side-chain substituent groups of the residues, and as small or large. The residue is considered small if it contains a total of four carbon atoms or less, inclusive of the carboxyl carbon, provided an additional polar substituent is present; three or less if not. Small residues are, of course, always non-aromatic. Dependent on their structural properties, amino acid residues may fall in two or more classes. For the naturally-occurring protein amino acids, sub-classification according to this scheme is presented in Table B.

TABLE-US-00027 TABLE B Amino acid sub-classification Sub-classes Amino acids Acidic Aspartic acid, Glutamic acid Basic Noncyclic: Arginine, Lysine; Cyclic: Histidine Charged Aspartic acid, Glutamic acid, Arginine, Lysine, Histidine Small Glycine, Serine, Alanine, Threonine, Proline Polar/neutral Asparagine, Histidine, Glutamine, Cysteine, Serine, Threonine Polar/large Asparagine, Glutamine Hydrophobic Tyrosine, Valine, Isoleucine, Leucine, Methionine, Phenylalanine, Tryptophan Aromatic Tryptophan, Tyrosine, Phenylalanine Residues that influence Glycine and Proline chain orientation

[0135] Conservative amino acid substitution also includes groupings based on side chains. For example, a group of amino acids having aliphatic side chains is glycine, alanine, valine, leucine, and isoleucine; a group of amino acids having aliphatic-hydroxyl side chains is serine and threonine; a group of amino acids having amide-containing side chains is asparagine and glutamine; a group of amino acids having aromatic side chains is phenylalanine, tyrosine, and tryptophan; a group of amino acids having basic side chains is lysine, arginine, and histidine; and a group of amino acids having sulphur-containing side chains is cysteine and methionine. For example, it is reasonable to expect that replacement of a leucine with an isoleucine or valine, an aspartate with a glutamate, a threonine with a serine, or a similar replacement of an amino acid with a structurally related amino acid will not have a major effect on the properties of the resulting variant polypeptide. Whether an amino acid change results in a functional truncated and/or variant AARS polypeptide can readily be determined by assaying its non-canonical activity, as described herein. Conservative substitutions are shown in Table C under the heading of exemplary substitutions. Amino acid substitutions falling within the scope of the invention, are, in general, accomplished by selecting substitutions that do not differ significantly in their effect on maintaining (a) the structure of the peptide backbone in the area of the substitution, (b) the charge or hydrophobicity of the molecule at the target site, (c) the bulk of the side chain, or (d) the biological function. After the substitutions are introduced, the variants are screened for biological activity.

TABLE-US-00028 TABLE C Exemplary Amino Acid Substitutions Original Exemplary Preferred Residue Substitutions Substitutions Ala Val, Leu, Ile Val Arg Lys, Gln, Asn Lys Asn Gln, His, Lys, Arg Gln Asp Glu Glu Cys Ser Ser Gln Asn, His, Lys, Asn Glu Asp, Lys Asp Gly Pro Pro His Asn, Gln, Lys, Arg Arg Ile Leu, Val, Met, Ala, Phe, Norleu Leu Leu Norleu, Ile, Val, Met, Ala, Phe Ile Lys Arg, Gln, Asn Arg Met Leu, Ile, Phe Leu Phe Leu, Val, Ile, Ala Leu Pro Gly Gly Ser Thr Thr Thr Ser Ser Trp Tyr Tyr Tyr Trp, Phe, Thr, Ser Phe Val Ile, Leu, Met, Phe, Ala, Norleu Leu

[0136] Alternatively, similar amino acids for making conservative substitutions can be grouped into three categories based on the identity of the side chains. The first group includes glutamic acid, aspartic acid, arginine, lysine, histidine, which all have charged side chains; the second group includes glycine, serine, threonine, cysteine, tyrosine, glutamine, asparagine; and the third group includes leucine, isoleucine, valine, alanine, proline, phenylalanine, tryptophan, methionine, as described in Zubay, G., Biochemistry, third edition, Wm.C. Brown Publishers (1993).

[0137] Thus, a predicted non-essential amino acid residue in a truncated and/or variant AARS polypeptide is typically replaced with another amino acid residue from the same side chain family. Alternatively, mutations can be introduced randomly along all or part of an AARS coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for an activity of the parent polypeptide to identify mutants which retain that activity. Following mutagenesis of the coding sequences, the encoded peptide can be expressed recombinantly and the activity of the peptide can be determined. A "non-essential" amino acid residue is a residue that can be altered from the reference sequence of an embodiment polypeptide without abolishing or substantially altering one or more of its activities. Suitably, the alteration does not substantially abolish one of these activities, for example, the activity is at least 20%, 40%, 60%, 70% or 80% 100%, 500%, 1000% or more of the reference AARS sequence. An "essential" amino acid residue is a residue that, when altered from the reference sequence of an AARS polypeptide, results in abolition of an activity of the parent molecule such that less than 20% of the reference activity is present. For example, such essential amino acid residues include those that are conserved in AARS polypeptides across different species, including those sequences that are conserved in the active binding site(s) or motif(s) of AARS polypeptides from various sources.

[0138] In general, polypeptides and fusion polypeptides (as well as their encoding polynucleotides) are isolated. An "isolated" polypeptide or polynucleotide is one that is removed from its original environment. For example, a naturally-occurring protein is isolated if it is separated from some or all of the coexisting materials in the natural system. Preferably, such polypeptides are at least about 90% pure, more preferably at least about 95% pure and most preferably at least about 99% pure. A polynucleotide is considered to be isolated if, for example, it is cloned into a vector that is not a part of the natural environment.

[0139] Certain embodiments also encompass dimers of AARS polypeptides. Dimers may include, for example, homodimers between two identical AARS polypeptides, heterodimers between two different AARS polypeptides (e.g., a full-length YRS polypeptide and a truncated YRS polypeptide; a truncated YRS polypeptide and a truncated WRS polypeptide), and/or heterodimers between an AARS polypeptide and a heterologous polypeptide. Certain heterodimers, such as those between an AARS polypeptide and a heterologous polypeptide, may be bi-functional, as described herein.

[0140] Also included are monomers of AARS polypeptides, including isolated AARS polypeptides monomers that do not substantially dimerize with a second AARS polypeptide, whether due to one or more substitutions, truncations, deletions, additions, chemical modifications, or a combination of these alterations. In certain embodiments, monomeric AARS polypeptides possess biological activities, including non-canonical activities, which are not possessed by dimeric or multimeric AARS polypeptide complexes.

[0141] Certain embodiments of the present invention also contemplate the use of modified AARS polypeptides, including modifications that improved the desired characteristics of an AARS polypeptide, as described herein. Modifications of AARS polypeptides of the invention include chemical and/or enzymatic derivatizations at one or more constituent amino acid, including side chain modifications, backbone modifications, and N- and C-terminal modifications including acetylation, hydroxylation, methylation, amidation, and the attachment of carbohydrate or lipid moieties, cofactors, and the like. Exemplary modifications also include pegylation of an AARS polypeptide (see, e.g., Veronese and Harris, Advanced Drug Delivery Reviews 54: 453-456, 2002; and Pasut et al., Expert Opinion. Ther. Patents 14(6) 859-894 2004, both herein incorporated by reference).

[0142] PEG is a well-known polymer having the properties of solubility in water and in many organic solvents, lack of toxicity, and lack of immunogenicity. It is also clear, colorless, odorless, and chemically stable. For these reasons and others, PEG has been selected as the preferred polymer for attachment, but it has been employed solely for purposes of illustration and not limitation. Similar products may be obtained with other water-soluble polymers, including without limitation; polyvinyl alcohol, other poly(alkylene oxides) such as poly(propylene glycol) and the like, poly(oxyethylated polyols) such as poly(oxyethylated glycerol) and the like, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl purrolidone, poly-1,3-dioxolane, poly-1,3,6-trioxane, ethylene/maleic anhydride, and polyaminoacids. One skilled in the art will be able to select the desired polymer based on the desired dosage, circulation time, resistance to proteolysis, and other considerations.

[0143] In particular a wide variety of PEG derivatives are both available and suitable for use in the preparation of PEG-conjugates. For example, NOF Corp.'s PEG reagents sold under the trademark SUNBRIGHT.RTM. Series provides numerous PEG derivatives, including methoxypolyethylene glycols and activated PEG derivatives such as methoxy-PEG amines, maleimides, N-hydroxysuccinimide esters, and carboxylic acids, for coupling by various methods to the N-terminal, C-terminal or any internal amino acid of the AARS polypeptide. Nektar Therapeutics' Advanced PEGylation technology also offers diverse PEG-coupling technologies to potentially improve the safety and efficacy of an AARS polypeptide based therapeutic.

[0144] A search of patents, published patent applications, and related publications will also provide those skilled in the art reading this disclosure with significant possible PEG-coupling technologies and PEG-derivatives. For example, U.S. Pat. Nos. 6,436,386; 5,932,462; 5,900,461; 5,824,784; and 4,904,584; the contents of which are incorporated by reference in their entirety, describe such technologies and derivatives, and methods for their manufacture.

[0145] In certain aspects, chemoselective ligation technology may be utilized to modify AARS polypeptides of the invention, such as by attaching polymers in a site-specific and controlled manner. Such technology typically relies on the incorporation of chemoselective anchors into the protein backbone by either chemical or recombinant means, and subsequent modification with a polymer carrying a complementary linker. As a result, the assembly process and the covalent structure of the resulting protein-polymer conjugate may be controlled, enabling the rational optimization of drug properties, such as efficacy and pharmacokinetic properties (see, e.g., Kochendoerfer, Current Opinion in Chemical Biology 9:555-560, 2005).

[0146] In other embodiments, fusion proteins of AARS polypeptide to other proteins are also included, and these fusion proteins may increase the AARS polypeptide's biological activity, secretion, targeting, biological life, ability to penetrate cellular membranes, or the blood brain barrier, or pharmacokinetic properties. Examples of fusion proteins that improve pharmacokinetic properties ("PK modifiers") include without limitation, fusions to human albumin (Osborn et al.: Eur. J. Pharmacol. 456(1-3): 149-158, (2002)), antibody Fc domains, poly Glu or poly Asp sequences, and transferrin. Additionally, fusion with conformationally disordered polypeptide sequences composed of the amino acids Pro, Ala, and Ser (`PASylation`) or hydroxyethyl starch (sold under the trademark HESYLATION.RTM.) provides a simple way to increase the hydrodynamic volume of the AARS polypeptide. This additional extension adopts a bulky random structure, which significantly increases the size of the resulting fusion protein. By this means the typically rapid clearance of smaller AARS polypeptides via kidney filtration is retarded by several orders of magnitude. Additionally use of Ig G fusion proteins has also been shown to enable some fusion protein proteins to penetrate the blood brain barrier (Fu et al., (2010) Brain Res. 1352:208-13).

[0147] Examples of fusion proteins that improve penetration across cellular membranes include fusions to membrane translocating sequences. In this context, the term "membrane translocating sequences" refers to naturally occurring and synthetic amino acid sequences that are capable of membrane translocation across a cellular membrane. Representative membrane translocating sequences include those based on the naturally occurring membrane translocating sequences derived from the Tat protein, and homeotic transcription protein Antennapedia, as well as synthetic membrane translocating sequences based in whole or part on poly Arginine and Lysine resides. Representative membrane translocating sequences include for example those disclosed in the following patents, U.S. Pat. Nos. 5,652,122; 5,670,617; 5,674,980; 5,747,641; 5,804,604; 6,316,003; 7,585,834; 7,312,244; 7,279,502; 7,229,961; 7,169,814; 7,453,011; 7,235,695; 6,982,351; 6,605,115; 7,306,784; 7,306,783; 6,589,503; 6,348,185; 6,881,825; 7,431,915; WO0074701A2; WO2007111993A2; WO2007106554A2; WO02069930A1; WO03049772A2; WO03106491A2; and WO2008063113A1.

[0148] It will be appreciated that a flexible molecular linker (or spacer) optionally may be interposed between, and covalently join, the AARS polypeptide and any of the fusion proteins disclosed herein.

[0149] Additionally in some embodiments, the AARS polypeptide can include synthetic, or naturally occurring secretion signal sequences, derived from other well characterized secreted proteins. In some embodiments such proteins, may be processed by proteolytic cleavage to form the AARS polypeptide in situ. Such fusions proteins include for example fusions of AARS polypeptide to ubiquitin to provide a new N-terminal amino acid, or the use of a secretion signal to mediate high level secretion of the AARS polypeptide into the extracellular medium, or N, or C-terminal epitope tags to improve purification or detection.

[0150] The AARS polypeptides described herein may be prepared by any suitable procedure known to those of skill in the art, such as by recombinant techniques. In addition to recombinant production methods, polypeptides of the invention may be produced by direct peptide synthesis using solid-phase techniques (Merrifield, J. Am. Chem. Soc. 85:2149-2154 (1963)). Protein synthesis may be performed using manual techniques or by automation. Automated synthesis may be achieved, for example, using Applied Biosystems 431A Peptide Synthesizer (Perkin Elmer). Alternatively, various fragments may be chemically synthesized separately and combined using chemical methods to produce the desired molecule.

IV. AARS Polynucleotides

[0151] Embodiments of the present invention include polynucleotides that encode one or more newly identified protein fragments of an aminoacyl-tRNA synthetase (AARS), in addition to complements, variants, and fragments thereof. In certain embodiments, an AARS polynucleotide encodes all or a portion of the AARS polypeptide reference sequence(s) as set forth in Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9, which represent splice variants, proteolytic fragments, or other type of fragments of Alanyl tRNA synthetase. Certain embodiments include polynucleotides, encoding polypeptides or proteins that comprise the sequence of one or more splice junctions of those splice variants, in addition to complements, variants, and fragments thereof. In certain embodiments, typically due to the singular nature of a selected AARS splice variant, which combines exons in a new or exceptional way, the AARS polynucleotide references sequences comprise a unique or exceptional splice junction. Certain embodiments exclude a corresponding full-length AARS polynucleotide.

[0152] Also included within the AARS polynucleotides of the present invention are primers, probes, antisense oligonucleotides, and RNA interference agents that comprise all or a portion of these reference polynucleotides, which are complementary to all or a portion of these reference polynucleotides, or which specifically hybridize to these reference polynucleotides, as described herein.

[0153] The term "polynucleotide" or "nucleic acid" as used herein designates mRNA, RNA, cRNA, cDNA or DNA. The term typically refers to polymeric form of nucleotides of at least 10 bases in length, either ribonucleotides or deoxynucleotides or a modified form of either type of nucleotide. The term includes single and double stranded forms of DNA. The terms "DNA" and "polynucleotide" and "nucleic acid" refer to a DNA molecule that has been isolated free of total genomic DNA of a particular species. Therefore, an isolated DNA segment encoding a polypeptide refers to a DNA segment that contains one or more coding sequences yet is substantially isolated away from, or purified free from, total genomic DNA of the species from which the DNA segment is obtained. Also included are non-coding polynucleotides (e.g., primers, probes, oligonucleotides), which do not encode an AARS polypeptide. Included within the terms "DNA segment" and "polynucleotide" are DNA segments and smaller fragments of such segments, and also recombinant vectors, including, for example, plasmids, cosmids, phagemids, phage, viruses, and the like.

[0154] Additional coding or non-coding sequences may, but need not, be present within a polynucleotide of the present invention, and a polynucleotide may, but need not, be linked to other molecules and/or support materials. Hence, the polynucleotides of the present invention, regardless of the length of the coding sequence itself, may be combined with other DNA sequences, such as promoters, polyadenylation signals, additional restriction enzyme sites, multiple cloning sites, other coding segments, and the like, such that their overall length may vary considerably.

[0155] It is therefore contemplated that a polynucleotide fragment of almost any length may be employed; with the total length preferably being limited by the ease of preparation and use in the intended recombinant DNA protocol. Included are polynucleotides of about 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 41, 43, 44, 45, 46, 47, 48, 49, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 220, 240, 260, 270, 280, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1100, 1200, 1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, 2100, 2200, 2300, 2400, 2500, 2600, 2700, 2800, 2900, 3000 or more (including all integers in between) bases in length, including any portion or fragment (e.g., greater than about 6, 7, 8, 9, or 10 nucleotides in length) of an AARS reference polynucleotide (e.g., base number X-Y, in which X is about 1-3000 or more and Y is about 10-3000 or more), or its complement.

[0156] Embodiments of the present invention also include "variants" of the AARS reference polynucleotide sequences. Polynucleotide "variants" may contain one or more substitutions, additions, deletions and/or insertions in relation to a reference polynucleotide. Generally, variants of an AARS reference polynucleotide sequence may have at least about 30%, 40% 50%, 55%, 60%, 65%, 70%, generally at least about 75%, 80%, 85%, desirably about 90% to 95% or more, and more suitably about 98% or more sequence identity to that particular nucleotide sequence as determined by sequence alignment programs described elsewhere herein using default parameters. In certain embodiments, variants may differ from a reference sequence by about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 41, 43, 44, 45, 46, 47, 48, 49, 50, 60, 70, 80, 90, 100 (including all integers in between) or more bases. In certain embodiments, such as when the polynucleotide variant encodes an AARS polypeptide having a non-canonical activity, the desired activity of the encoded AARS polypeptide is not substantially diminished relative to the unmodified polypeptide. The effect on the activity of the encoded polypeptide may generally be assessed as described herein.

[0157] Certain embodiments include polynucleotides that hybridize to a reference AARS polynucleotide sequence, or to their complements, under stringency conditions described below. As used herein, the term "hybridizes under low stringency, medium stringency, high stringency, or very high stringency conditions" describes conditions for hybridization and washing. Guidance for performing hybridization reactions can be found in Ausubel et al., (1998, supra), Sections 6.3.1-6.3.6. Aqueous and non-aqueous methods are described in that reference and either can be used.

[0158] Reference herein to low stringency conditions include and encompass from at least about 1% v/v to at least about 15% v/v formamide and from at least about 1 M to at least about 2 M salt for hybridization at 42.degree. C., and at least about 1 M to at least about 2 M salt for washing at 42.degree. C. Low stringency conditions also may include 1% Bovine Serum Albumin (BSA), 1 mM EDTA, 0.5 M NaHPO.sub.4 (pH 7.2), 7% SDS for hybridization at 65.degree. C., and (i) 2.times.SSC, 0.1% SDS; or (ii) 0.5% BSA, 1 mM EDTA, 40 mM NaHPO.sub.4 (pH 7.2), 5% SDS for washing at room temperature. One embodiment of low stringency conditions includes hybridization in 6.times. sodium chloride/sodium citrate (SSC) at about 45.degree. C., followed by two washes in 0.2.times.SSC, 0.1% SDS at least at 50.degree. C. (the temperature of the washes can be increased to 55.degree. C. for low stringency conditions).

[0159] Medium stringency conditions include and encompass from at least about 16% v/v to at least about 30% v/v formamide and from at least about 0.5 M to at least about 0.9 M salt for hybridization at 42.degree. C., and at least about 0.1 M to at least about 0.2 M salt for washing at 55.degree. C. Medium stringency conditions also may include 1% Bovine Serum Albumin (BSA), 1 mM EDTA, 0.5 M NaHPO.sub.4 (pH 7.2), 7% SDS for hybridization at 65.degree. C., and (i) 2.times.SSC, 0.1% SDS; or (ii) 0.5% BSA, 1 mM EDTA, 40 mM NaHPO.sub.4 (pH 7.2), 5% SDS for washing at 60-65.degree. C. One embodiment of medium stringency conditions includes hybridizing in 6.times.SSC at about 45.degree. C., followed by one or more washes in 0.2.times.SSC, 0.1% SDS at 60.degree. C. High stringency conditions include and encompass from at least about 31% v/v to at least about 50% v/v formamide and from about 0.01 M to about 0.15 M salt for hybridization at 42.degree. C., and about 0.01 M to about 0.02 M salt for washing at 55.degree. C.

[0160] High stringency conditions also may include 1% BSA, 1 mM EDTA, 0.5 M NaHPO.sub.4 (pH 7.2), 7% SDS for hybridization at 65.degree. C., and (i) 0.2.times.SSC, 0.1% SDS; or (ii) 0.5% BSA, 1 mM EDTA, 40 mM NaHPO.sub.4 (pH 7.2), 1% SDS for washing at a temperature in excess of 65.degree. C. One embodiment of high stringency conditions includes hybridizing in 6.times.SSC at about 45.degree. C., followed by one or more washes in 0.2.times.SSC, 0.1% SDS at 65.degree. C. One embodiment of very high stringency conditions includes hybridizing in 0.5 M sodium phosphate, 7% SDS at 65.degree. C., followed by one or more washes in 0.2.times.SSC, 1% SDS at 65.degree. C.

[0161] Other stringency conditions are well known in the art and a skilled artisan will recognize that various factors can be manipulated to optimize the specificity of the hybridization. Optimization of the stringency of the final washes can serve to ensure a high degree of hybridization. For detailed examples, see Ausubel et al., supra at pages 2.10.1 to 2.10.16 and Sambrook et al. (1989, supra) at sections 1.101 to 1.104.

[0162] While stringent washes are typically carried out at temperatures from about 42.degree. C. to 68.degree. C., one skilled in the art will appreciate that other temperatures may be suitable for stringent conditions. Maximum hybridization rate typically occurs at about 20.degree. C. to 25.degree. C. below the T.sub.m for formation of a DNA-DNA hybrid. It is well known in the art that the T.sub.m is the melting temperature, or temperature at which two complementary polynucleotide sequences dissociate. Methods for estimating T.sub.m are well known in the art (see Ausubel et al., supra at page 2.10.8).

[0163] In general, the T.sub.m of a perfectly matched duplex of DNA may be predicted as an approximation by the formula: T.sub.m=81.5+16.6 (log.sub.10 M)+0.41 (% G+C)-0.63 (% formamide)-(600/length) wherein: M is the concentration of Na.sup.+, preferably in the range of 0.01 molar to 0.4 molar; % G+C is the sum of guanosine and cytosine bases as a percentage of the total number of bases, within the range between 30% and 75% G+C; % formamide is the percent formamide concentration by volume; length is the number of base pairs in the DNA duplex. The T.sub.m of a duplex DNA decreases by approximately 1.degree. C. with every increase of 1% in the number of randomly mismatched base pairs. Washing is generally carried out at T.sub.m--15.degree. C. for high stringency, or T.sub.m--30.degree. C. for moderate stringency.

[0164] In one example of a hybridization procedure, a membrane (e.g., a nitrocellulose membrane or a nylon membrane) containing immobilized DNA is hybridized overnight at 42.degree. C. in a hybridization buffer (50% deionized formamide, 5.times.SSC, 5.times.Denhardt's solution (0.1% ficoll, 0.1% polyvinylpyrollidone and 0.1% bovine serum albumin), 0.1% SDS and 200 mg/mL denatured salmon sperm DNA) containing a labeled probe. The membrane is then subjected to two sequential medium stringency washes (i.e., 2.times.SSC, 0.1% SDS for 15 min at 45.degree. C., followed by 2.times.SSC, 0.1% SDS for 15 min at 50.degree. C.), followed by two sequential higher stringency washes (i.e., 0.2.times.SSC, 0.1% SDS for 12 min at 55.degree. C. followed by 0.2.times.SSC and 0.1% SDS solution for 12 min at 65-68.degree. C.

[0165] As noted above, certain embodiments relate to AARS polynucleotides that encode an AARS polypeptide. Among other uses, these embodiments may be utilized to recombinantly produce a desired AARS polypeptide or variant thereof, or to express the AARS polypeptide in a selected cell or subject. It will be appreciated by those of ordinary skill in the art that, as a result of the degeneracy of the genetic code, there are many nucleotide sequences that encode a polypeptide as described herein. Some of these polynucleotides may bear minimal homology to the nucleotide sequence of any native gene. Nonetheless, polynucleotides that vary due to differences in codon usage are specifically contemplated by the present invention, for example polynucleotides that are optimized for human and/or primate codon selection.

[0166] Therefore, multiple polynucleotides can encode the AARS polypeptides of the invention. Moreover, the polynucleotide sequence can be manipulated for various reasons. Examples include but are not limited to the incorporation of preferred codons to enhance the expression of the polynucleotide in various organisms (see generally Nakamura et al., Nuc. Acid. Res. (2000) 28 (1): 292). In addition, silent mutations can be incorporated in order to introduce, or eliminate restriction sites, decrease the density of CpG dinucleotide motifs (see for example, Kameda et al., Biochem. Biophys. Res. Commun. (2006) 349(4): 1269-1277) or reduce the ability of single stranded sequences to form stem-loop structures: (see, e.g., Zuker M., Nucl. Acid Res. (2003); 31(13): 3406-3415). In addition, mammalian expression can be further optimized by including a Kozak consensus sequence [i.e., (a/g)cc(a/g)ccATGg] at the start codon. Kozak consensus sequences useful for this purpose are known in the art (Mantyh et al. PNAS 92: 2662-2666 (1995); Mantyh et al. Prot. Exp. & Purif. 6,124 (1995)).

[0167] The polynucleotides of the present invention, regardless of the length of the coding sequence itself, may be combined with other DNA sequences, such as promoters, polyadenylation signals, additional restriction enzyme sites, multiple cloning sites, other coding segments, and the like, such that their overall length may vary considerably. It is therefore contemplated that a polynucleotide fragment of almost any length may be employed; with the total length preferably being limited by the ease of preparation and use in the intended recombinant DNA protocol.

[0168] Polynucleotides and fusions thereof may be prepared, manipulated and/or expressed using any of a variety of well established techniques known and available in the art. For example, polynucleotide sequences which encode polypeptides of the invention, or fusion proteins or functional equivalents thereof, may be used in recombinant DNA molecules to direct expression of an AARS polypeptide in appropriate host cells. Due to the inherent degeneracy of the genetic code, other DNA sequences that encode substantially the same or a functionally equivalent amino acid sequence may be produced and these sequences may be used to clone and express a given polypeptide.

[0169] As will be understood by those of skill in the art, it may be advantageous in some instances to produce polypeptide-encoding nucleotide sequences possessing non-naturally occurring codons. For example, codons preferred by a particular prokaryotic or eukaryotic host can be selected to increase the rate of protein expression or to produce a recombinant RNA transcript having desirable properties, such as a half-life which is longer than that of a transcript generated from the naturally occurring sequence. Such polynucleotides are commonly referred to as "codon-optimized." Any of the polynucleotides described herein may be utilized in a codon-optimized form. In certain embodiments, a polynucleotide can be codon optimized for use in specific bacteria such as E. coli or yeast such as S. cerevisiae (see, e.g., Burgess-Brown et al., Protein Expr Purif. 59:94-102, 2008; Ermolaeva M D (2001) Curr. Iss. Mol. Biol. 3 (4) 91-7; Welch et al., PLoS ONE 4(9): e7007 doi:10.1371/journal.pone.0007002).

[0170] Moreover, the polynucleotide sequences of the present invention can be engineered using methods generally known in the art in order to alter polypeptide encoding sequences for a variety of reasons, including but not limited to, alterations which modify the cloning, processing, expression and/or activity of the gene product.

[0171] According to another aspect of the invention, polynucleotides encoding polypeptides of the invention may be delivered to a subject in vivo, e.g., using gene therapy techniques. Gene therapy refers generally to the transfer of heterologous nucleic acids to the certain cells, target cells, of a mammal, particularly a human, with a disorder or conditions for which such therapy is sought. The nucleic acid is introduced into the selected target cells in a manner such that the heterologous DNA is expressed and a therapeutic product encoded thereby is produced.

[0172] Various viral vectors that can be utilized for gene therapy as taught herein include adenovirus, herpes virus, vaccinia, adeno-associated virus (AAV), or, preferably, an RNA virus such as a retrovirus. Preferably, the retroviral vector is a derivative of a murine or avian retrovirus, or is a lentiviral vector. The preferred retroviral vector is a lentiviral vector. Examples of retroviral vectors in which a single foreign gene can be inserted include, but are not limited to: Moloney murine leukemia virus (MoMuLV), Harvey murine sarcoma virus (HaMuSV), murine mammary tumor virus (MuMTV), SIV, BIV, HIV and Rous Sarcoma Virus (RSV). A number of additional retroviral vectors can incorporate multiple genes. All of these vectors can transfer or incorporate a gene for a selectable marker so that transduced cells can be identified and generated. By inserting a zinc finger derived-DNA binding polypeptide sequence of interest into the viral vector, along with another gene that encodes the ligand for a receptor on a specific target cell, for example, the vector may be made target specific. Retroviral vectors can be made target specific by inserting, for example, a polynucleotide encoding a protein (dimer). Illustrative targeting may be accomplished by using an antibody to target the retroviral vector. Those of skill in the art will know of, or can readily ascertain without undue experimentation, specific polynucleotide sequences which can be inserted into the retroviral genome to allow target specific delivery of the retroviral vector containing the zinc finger-nucleotide binding protein polynucleotide.

[0173] Since recombinant retroviruses are defective, they require assistance in order to produce infectious vector particles. This assistance can be provided, for example, by using helper cell lines that contain plasmids encoding all of the structural genes of the retrovirus under the control of regulatory sequences within the LTR. These plasmids are missing a nucleotide sequence which enables the packaging mechanism to recognize an RNA transcript for encapsulation. Helper cell lines which have deletions of the packaging signal include but are not limited to PSI.2, PA317 and PA12, for example. These cell lines produce empty virions, since no genome is packaged. If a retroviral vector is introduced into such cells in which the packaging signal is intact, but the structural genes are replaced by other genes of interest, the vector can be packaged and vector virion produced. The vector virions produced by this method can then be used to infect a tissue cell line, such as NIH 3T3 cells, to produce large quantities of chimeric retroviral virions.

[0174] "Non-viral" delivery techniques for gene therapy can also be used including, for example, DNA-ligand complexes, adenovirus-ligand-DNA complexes, direct injection of DNA, CaPO.sub.4 precipitation, gene gun techniques, electroporation, liposomes, lipofection, and the like. Any of these methods are widely available to one skilled in the art and would be suitable for use in the present invention. Other suitable methods are available to one skilled in the art, and it is to be understood that the present invention can be accomplished using any of the available methods of transfection. Lipofection can be accomplished by encapsulating an isolated DNA molecule within a liposomal particle and contacting the liposomal particle with the cell membrane of the target cell. Liposomes are self-assembling, colloidal particles in which a lipid bilayer, composed of amphiphilic molecules such as phosphatidyl serine or phosphatidyl choline, encapsulates a portion of the surrounding media such that the lipid bilayer surrounds a hydrophilic interior. Unilammellar or multilammellar liposomes can be constructed such that the interior contains a desired chemical, drug, or, as in the instant invention, an isolated DNA molecule.

[0175] In another aspect, polynucleotides encoding polypeptides of the invention may be used to express and delivery an AARS polypeptide via cell therapy. Accordingly in another aspect, the current invention includes a cell therapy for treating a disease or disorder, comprising administering a host cell expressing, or capable of expressing, an AARS polypeptide.

[0176] Cell therapy involves the administration of cells which have been selected, multiplied and pharmacologically treated or altered (i.e. genetically modified) outside of the body (Bordignon, C. et al, Cell Therapy: Achievements and Perspectives (1999), Haematologica, 84, pp. 1110-1149). Such host cells include for example, primary cells, including macrophages, and stem cells which have been genetically modified to express an AARS polypeptide. The aim of cell therapy is to replace, repair or enhance the biological function of damaged tissues or organs.

[0177] The use of transplanted cells has been investigated for the treatment of numerous endocrine disorders such as anemia and dwarfism, hematological disorders, kidney and liver failure, pituitary and CNS deficiencies and diabetes mellitus (Uludag et al., Technology of Mammalian Cell Encapsulation (2000), Advanced Drug Delivery Reviews, 42, pp. 29-64). Transplanted cells may function by releasing bioactive compounds such as an AARS polypeptide of the invention, to replace endogenous AARS polypeptides which are absent or produced in insufficient quantities in an effected system.

[0178] Embodiments of the present invention also include oligonucleotides, whether for detection, amplification, antisense therapies, or other purpose. For these and related purposes, the term "oligonucleotide" or "oligo" or "oligomer" is intended to encompass a singular "oligonucleotide" as well as plural "oligonucleotides," and refers to any polymer of two or more of nucleotides, nucleosides, nucleobases or related compounds used as a reagent in the amplification methods of the present invention, as well as subsequent detection methods. The oligonucleotide may be DNA and/or RNA and/or analogs thereof.

[0179] The term oligonucleotide does not necessarily denote any particular function to the reagent, rather, it is used generically to cover all such reagents described herein. An oligonucleotide may serve various different functions, e.g., it may function as a primer if it is capable of hybridizing to a complementary strand and can further be extended in the presence of a nucleic acid polymerase, it may provide a promoter if it contains a sequence recognized by an RNA polymerase and allows for transcription, and it may function to prevent hybridization or impede primer extension if appropriately situated and/or modified. An oligonucleotide may also function as a probe, or an antisense agent. An oligonucleotide can be virtually any length, limited only by its specific function, e.g., in an amplification reaction, in detecting an amplification product of the amplification reaction, or in an antisense or RNA interference application. Any of the oligonucleotides described herein can be used as a primer, a probe, an antisense oligomer, or an RNA interference agent.

[0180] The term "primer" as used herein refers to a single-stranded oligonucleotide capable of acting as a point of initiation for template-directed DNA synthesis under suitable conditions defined, for example, by buffer and temperature, in the presence of four different nucleoside triphosphates and an agent for polymerization, such as a DNA or RNA polymerase or reverse transcriptase. The length of the primer, in any given case, depends on, for example, the intended use of the primer, and generally ranges from about 15 to 30 nucleotides, although shorter and longer primers may be used. Short primer molecules generally require cooler temperatures to form sufficiently stable hybrid complexes with the template. A primer need not reflect the exact sequence of the template but must be sufficiently complementary to hybridize with such template. The primer site is the area of the template to which a primer hybridizes. The primer pair is a set of primers including a 5' upstream primer that hybridizes with the 5' end of the sequence to be amplified and a 3' downstream primer that hybridizes with the complement of the 3' end of the sequence to be amplified.

[0181] The term "probe" as used herein includes a surface-immobilized or soluble but capable of being immobilized molecule that can be recognized by a particular target. See, e.g., U.S. Pat. No. 6,582,908 for an example of arrays having all possible combinations of probes with 10, 12, and more bases. Probes and primers as used herein typically comprise at least 10-15 contiguous nucleotides of a known sequence. In order to enhance specificity, longer probes and primers may also be employed, such as probes and primers that comprise at least 20, 25, 30, 40, 50, 60, 70, 80, 90, 100, or at least 150 nucleotides of an AARS reference sequence or its complement. Probes and primers may be considerably longer than these examples, and it is understood that any length supported by the knowledge in the art and the specification, including the tables, figures, and Sequence Listing, may be used.

[0182] Methods for preparing and using probes and primers are described in the references, for example Sambrook, J. et al. (1989) Molecular Cloning: A Laboratory Manual, 2.sup.nd ed., vol. 1-3, Cold Spring Harbor Press, Plainview N.Y.; Ausubel, F. M. et al. (1987) Current Protocols in Molecular Biology, Greene Publ. Assoc. & Wiley-Intersciences, New York N.Y.; Innis, M. et al. (1990) PCR Protocols. A Guide to Methods and Applications, Academic Press, San Diego Calif. PCR primer pairs can be derived from a known sequence, for example, by using computer programs intended for that purpose such as Primer (Version 0.5, 1991, Whitehead Institute for Biomedical Research, Cambridge Mass.).

[0183] Oligonucleotides for use as primers or probes may be selected using software known in the art. For example, OLIGO 4.06 software is useful for the selection of PCR primer pairs of up to 100 nucleotides each, and for the analysis of oligonucleotides and larger polynucleotides of up to 5,000 nucleotides from an input polynucleotide sequence of up to 32 kilobases. Similar primer selection programs have incorporated additional features for expanded capabilities. For example, the PrimOU primer selection program (available to the public from the Genome Center at University of Texas South West Medical Center, Dallas Tex.) is capable of choosing specific primers from megabase sequences and is thus useful for designing primers on a genome-wide scope.

[0184] The Primer3 primer selection program (available to the public from the Whitehead Institute/MIT Center for Genome Research, Cambridge Mass.) allows the user to input a "mispriming library," in which sequences to avoid as primer binding sites are user-specified. Primer3 is useful, in particular, for the selection of oligonucleotides for microarrays. (The source code for the latter two primer selection programs may also be obtained from their respective sources and modified to meet the user's specific needs.) The PrimeGen program (available to the public from the UK Human Genome Mapping Project Resource Centre, Cambridge UK) designs primers based on multiple sequence alignments, thereby allowing selection of primers that hybridize to either the most conserved or least conserved regions of aligned nucleic acid sequences. Hence, this program is useful for identification of both unique and conserved oligonucleotides and polynucleotide fragments. The oligonucleotides and polynucleotide fragments identified by any of the above selection methods are useful in hybridization technologies, for example, as PCR or sequencing primers, microarray elements, or specific probes to identify fully or partially complementary polynucleotides in a sample of nucleic acids. Methods of oligonucleotide selection are not limited to those described herein.

[0185] In certain embodiments, oligonucleotides can be prepared by stepwise solid-phase synthesis, employing methods detailed in the references cited above, and below with respect to the synthesis of oligonucleotides having a mixture or uncharged and cationic backbone linkages. In some cases, it may be desirable to add additional chemical moieties to the oligonucleotide, e.g., to enhance pharmacokinetics or to facilitate capture or detection of the compound. Such a moiety may be covalently attached, typically to a terminus of the oligomer, according to standard synthetic methods. For example, addition of a polyethyleneglycol moiety or other hydrophilic polymer, e.g., one having 10-100 monomeric subunits, may be useful in enhancing solubility. One or more charged groups, e.g., anionic charged groups such as an organic acid, may enhance cell uptake.

[0186] A variety of detectable molecules may be used to render an oligonucleotide, or protein detectable, such as a radioisotopes, fluorochromes, dyes, enzymes, nanoparticles, chemiluminescent markers, biotin, or other monomer known in the art that can be detected directly (e.g., by light emission) or indirectly (e.g., by binding of a fluorescently-labeled antibody).

[0187] Radioisotopes provide examples of detectable molecules that can be utilized in certain aspects of the present invention. Several radioisotopes can be used as detectable molecules for labeling nucleotides or proteins, including, for example, .sup.32P, .sup.33P, .sup.35S, .sup.3H, and .sup.125I. These radioisotopes have different half-lives, types of decay, and levels of energy which can be tailored to match the needs of a particular protocol. For example, .sup.3H is a low energy emitter which results in low background levels, however this low energy also results in long time periods for autoradiography. Radioactively labeled ribonucleotides, deoxyribonucleotides and amino acids are commercially available. Nucleotides are available that are radioactively labeled at the first, or .alpha., phosphate group, or the third, or .gamma., phosphate group. For example, both [.alpha.-.sup.32P] dATP and [.gamma.-.sup.32P] dATP are commercially available. In addition, different specific activities for radioactively labeled nucleotides are also available commercially and can be tailored for different protocols.

[0188] Other examples of detectable molecules that can be utilized to detect an oligonucleotide include fluorophores. Several fluorophores can be used for labeling nucleotides including, for example, fluorescein, tetramethylrhodamine, Texas Red, and a number of others (e.g., Haugland, Handbook of Fluorescent Probes--9th Ed., 2002, Molec. Probes, Inc., Eugene Oreg.; Haugland, The Handbook: A Guide to Fluorescent Probes and Labeling Technologies--10th Ed., 2005, Invitrogen, Carlsbad, Calif.).

[0189] As one example, oligonucleotides may be fluorescently labeled during chemical synthesis, since incorporation of amines or thiols during nucleotide synthesis permit addition of fluorophores. Fluorescently labeled nucleotides are commercially available. For example, uridine and deoxyuridine triphosphates are available that are conjugated to ten different fluorophores that cover the spectrum. Fluorescent dyes that can be bound directly to nucleotides can also be utilized as detectable molecules. For example, FAM, JOE, TAMRA, and ROX are amine reactive fluorescent dyes that have been attached to nucleotides and are used in automated DNA sequencing. These fluorescently labeled nucleotides, for example, ROX-ddATP, ROX-ddCTP, ROX-ddGTP and ROX-ddUTP, are commercially available.

[0190] Non-radioactive and non-fluorescent detectable molecules are also available. As noted above, biotin can be attached directly to nucleotides and detected by specific and high affinity binding to avidin or streptavidin which has been chemically coupled to an enzyme catalyzing a colorimetric reaction (such as phosphatase, luciferase, or peroxidase). Digoxigenin labeled nucleotides can also similarly be used for non-isotopic detection of nucleic acids. Biotinylated and digoxigenin-labeled nucleotides are commercially available.

[0191] Very small particles, termed nanoparticles, also can be used to label oligonucleotide probes. These particles range from 1-1000 nm in size and include diverse chemical structures such as gold and silver particles and quantum dots. When irradiated with angled incident white light, silver or gold nanoparticles ranging from 40-120 nm will scatter monochromatic light with high intensity. The wavelength of the scattered light is dependent on the size of the particle. Four to five different particles in close proximity will each scatter monochromatic light, which when superimposed will give a specific, unique color. The particles are being manufactured by companies such as Genicon Sciences (Carlsbad, Calif.). Derivatized silver or gold particles can be attached to a broad array of molecules including, proteins, antibodies, small molecules, receptor ligands, and nucleic acids. For example, the surface of the particle can be chemically derivatized to allow attachment to a nucleotide.

[0192] Other types of nanoparticles that can be used for detection of a detectable molecule include quantum dots. Quantum dots are fluorescing crystals 1-5 nm in diameter that are excitable by light over a large range of wavelengths. Upon excitation by light having an appropriate wavelength, these crystals emit light, such as monochromatic light, with a wavelength dependent on their chemical composition and size. Quantum dots such as CdSe, ZnSe, InP, or InAs possess unique optical properties; these and similar quantum dots are available from a number of commercial sources (e.g., NN-Labs, Fayetteville, Ark.; Ocean Nanotech, Fayetteville, Ark.; Nanoco Technologies, Manchester, UK; Sigma-Aldrich, St. Louis, Mo.).

[0193] Many dozens of classes of particles can be created according to the number of size classes of the quantum dot crystals. The size classes of the crystals are created either 1) by tight control of crystal formation parameters to create each desired size class of particle, or 2) by creation of batches of crystals under loosely controlled crystal formation parameters, followed by sorting according to desired size and/or emission wavelengths. Two examples of references in which quantum dots are embedded within intrinsic silicon epitaxial layers of semiconductor light emitting/detecting devices are U.S. Pat. Nos. 5,293,050 and 5,354,707 to Chapple Sokol, et al.

[0194] In certain embodiments, oligonucleotide primers or probes may be labeled with one or more light-emitting or otherwise detectable dyes. The light emitted by the dyes can be visible light or invisible light, such as ultraviolet or infrared light. In exemplary embodiments, the dye may be a fluorescence resonance energy transfer (FRET) dye; a xanthene dye, such as fluorescein and rhodamine; a dye that has an amino group in the alpha or beta position (such as a naphthylamine dye, 1-dimethylaminonaphthyl-5-sulfonate, 1-anilino-8-naphthalende sulfonate and 2-p-touidinyl-6-naphthalene sulfonate); a dye that has 3-phenyl-7-isocyanatocoumarin; an acridine, such as 9-isothiocyanatoacridine and acridine orange; a pyrene, a bensoxadiazole and a stilbene; a dye that has 3-( -carboxypentyl)-3'-ethyl-5,5'-dimethyloxacarbocyanine (CYA); 6-carboxy fluorescein (FAM); 5&6-carboxyrhodamine-110 (R110); 6-carboxyrhodamine-6G (R6G); N,N,N',N'-tetramethyl-6-carboxyrhodamine (TAMRA); 6-carboxy-X-rhodamine (ROX); 6-carboxy-4',5'-dichloro-2',7'-dimethoxyfluorescein (JOE); ALEXA FLUOR.TM.; Cy2; Texas Red and Rhodamine Red; 6-carboxy-2',4,7,7'-tetrachlorofluorescein (TET); 6-carboxy-2',4,4',5',7,7'-hexachlorofluorescein (HEX); 5-carboxy-2',4',5',7'-tetrachlorofluorescein (ZOE); NAN; NED; Cy3; Cy3.5; Cy5; Cy5.5; Cy7; and Cy7.5; IR800CW, ICG, Alexa Fluor 350; Alexa Fluor 488; Alexa Fluor 532; Alexa Fluor 546; Alexa Fluor 568; Alexa Fluor 594; Alexa Fluor 647; Alexa Fluor 680, or Alexa Fluor 750.

[0195] The AARS polynucleotides and oligonucleotides of the present invention can be used in any of the therapeutic, diagnostic, research, or drug discovery compositions and methods described herein.

V. Antibodies

[0196] According to another aspect, the present invention further provides antibodies that exhibit binding specificity for an AARS polypeptide, or its native cellular binding partner (i.e. cellular receptor, lipid, carbohydrate, protein, or nucleic acid binding partner), or complex thereof, and methods of using same. The term antibody includes the various variations of the same, such as FABs, human antibodies, modified human antibodies, single chains, nonhuman antibodies, and other derivatives of the immunoglobulin fold that underlie immune system ligands for antigens, as described herein and known in the art. Antibodies can be used in any of the therapeutic, diagnostic, drug discovery, or protein expression/purification methods and compositions provided herein.

[0197] Certain antibodies of the present invention differ from certain previously made antibodies because they can distinguish between the AARS protein fragments of Table(s) 1-3, or Table(s) 4-6, or Table(s) 7-9 and their corresponding full-length AARS, typically by binding with greater affinity to the AARS protein fragments than to the corresponding full-length AARS. Generally, such antibodies may bind to unique sequences or structures generated or revealed by splice variations, proteolysis, or other cellular processing that generates an AARS protein fragment of the invention (e.g., post translational processing, including but not limited to phosphorylation and other modifications that change protein structure). In some aspects the antibodies may bind to sequences around a unique splice junction (for example to one or more regions of at least 5 contiguous amino acids selected from the splice junction sequences listed in Tables 2B, 5B, or 8B, or alternatively to any amino acid sequence C-terminal of this splice site, for example as listed in Tables 2B, 5B, or 8B. For example, such antibodies may have binding specificity to one or more non-solvent exposed faces that are exposed in the AARS protein fragment but not in the full-length AARS, or sequences that are not found or are otherwise inaccessible in the full-length AARS. Antibodies may also bind to unique three-dimensional structures that result from differences in folding between the AARS protein fragment and the full-length AARS. Such differences in folding may be localized (e.g., to a specific domain or region) or globalized. As one example, folding of AARS protein fragments may generate unique continuous or discontinuous epitopes that are not found in the corresponding or parent AARS. Examples also include antibodies that specifically bind to N- or C-termini generated by splice variations, proteolysis, or other cellular processing; such termini may be unique compared to the full-length AARS or may not be exposed for antibody binding in the full-length versions due to their termini being completely or partially buried in the overall structure of the larger AARS parent molecule.

[0198] In some embodiments, antibodies provided herein do not form aggregates, have a desired solubility, and/or have an immunogenicity profile that is suitable for use in humans, as described herein and known in the art. Also included are antibodies that are suitable for production work, such as to purify the AARS protein fragments described herein. Preferably, active antibodies can be concentrated to at least about 10 mg/ml and optional formulated for biotherapeutic uses.

[0199] In certain embodiments, antibodies are effective for modulating one or more of the non-canonical activities mediated by an AARS polypeptide of the invention. In certain embodiments, for example, the antibody is one that binds to an AARS polypeptide and/or its binding partner, inhibits their ability to interact with each other, and/or antagonizes the non-canonical activity of the AARS polypeptide. In certain embodiments, for example, the antibody binds to the cellular binding partner of an AARS polypeptide, and mimics the AARS polypeptide activity, such as by increasing or agonizing the non-canonical activity mediated by the AARS polypeptide. Accordingly, antibodies may be used to diagnose, treat, or prevent diseases, disorders or other conditions that are mediated by an AARS polypeptide of the invention, such as by antagonizing or agonizing its activity partially or fully.

[0200] An antibody, or antigen-binding fragment thereof, is said to "specifically bind," "immunologically bind," and/or is "immunologically reactive" to a polypeptide of the invention if it reacts at a detectable level (within, for example, an ELISA assay) with the polypeptide, and does not react detectably in a statistically significant manner with unrelated polypeptides under similar conditions. In certain instances, a binding agent does not significantly interact with a full-length version of the AARS polypeptide.

[0201] Immunological binding, as used in this context, generally refers to the non-covalent interactions of the type which occur between an immunoglobulin molecule and an antigen for which the immunoglobulin is specific. The strength, or affinity of binding such as immunological binding interactions can be expressed in terms of the dissociation constant (K.sub.d) of the interaction, wherein a smaller K.sub.d represents a greater affinity. Immunological binding properties of selected polypeptides can be quantified using methods well known in the art. See, e.g., Davies et al. (1990) Annual Rev. Biochem. 59:439-473. In certain illustrative embodiments, an antibody has an affinity for an AARS protein fragment of at least about 0.01, 0.05, 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 40, or 50 nM. In certain embodiments, the affinity of the antibody for an AARS protein fragment is stronger than its affinity for a corresponding full-length AARS polypeptide, typically by about 1.5.times., 2.times., 2.5.times., 3.times., 3.5.times., 4.times., 4.5.times., 5.times., 6.times., 7.times., 8.times., 9.times., 10.times., 15.times., 20.times., 25.times., 30.times., 40.times., 50.times., 60.times., 70.times., 80.times., 90.times., 100.times., 200.times., 300.times., 400.times., 500.times., 600.times., 700.times., 800.times., 900.times., 1000.times. or more (including all integers in between). In certain embodiments, an antibody as an affinity for a corresponding full-length AARS protein of at least about 0.05, 0.1, 0.25, 0.5, 0.75, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 .mu.M. In certain embodiments, an antibody binds weakly or substantially undetectably to a full-length AARS protein.

[0202] An "antigen-binding site," or "binding portion" of an antibody, refers to the part of the immunoglobulin molecule that participates in antigen binding. The antigen binding site is formed by amino acid residues of the N-terminal variable ("V") regions of the heavy ("H") and light ("L") chains. Three highly divergent stretches within the V regions of the heavy and light chains are referred to as "hypervariable regions" which are interposed between more conserved flanking stretches known as "framework regions," or "FRs". Thus the term "FR" refers to amino acid sequences which are naturally found between and adjacent to hypervariable regions in immunoglobulins. In an antibody molecule, the three hypervariable regions of a light chain and the three hypervariable regions of a heavy chain are disposed relative to each other in three dimensional space to form an antigen-binding surface. The antigen-binding surface is complementary to the three-dimensional surface of a bound antigen, and the three hypervariable regions of each of the heavy and light chains are referred to as "complementarity-determining regions," or "CDRs."

[0203] Antibodies may be prepared by any of a variety of techniques known to those of ordinary skill in the art. See, e.g., Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, 1988. Monoclonal antibodies specific for a polypeptide of interest may be prepared, for example, using the technique of Kohler and Milstein, Eur. J. Immunol. 6:511-519, 1976, and improvements thereto. Also included are methods that utilize transgenic animals such as mice to express human antibodies. See, e.g., Neuberger et al., Nature Biotechnology 14:826, 1996; Lonberg et al., Handbook of Experimental Pharmacology 113:49-101, 1994; and Lonberg et al., Internal Review of Immunology 13:65-93, 1995. Particular examples include the VELOCIMMUNE.RTM. platform by REGERNEREX.RTM. (see, e.g., U.S. Pat. No. 6,596,541). Antibodies can also be generated or identified by the use of phage display or yeast display libraries (see, e.g., U.S. Pat. No. 7,244,592; Chao et al., Nature Protocols. 1:755-768, 2006). Non-limiting examples of available libraries include cloned or synthetic libraries, such as the Human Combinatorial Antibody Library (HuCAL), in which the structural diversity of the human antibody repertoire is represented by seven heavy chain and seven light chain variable region genes. The combination of these genes gives rise to 49 frameworks in the master library. By superimposing highly variable genetic cassettes (CDRs=complementarity determining regions) on these frameworks, the vast human antibody repertoire can be reproduced. Also included are human libraries designed with human-donor-sourced fragments encoding a light-chain variable region, a heavy-chain CDR-3, synthetic DNA encoding diversity in heavy-chain CDR-1, and synthetic DNA encoding diversity in heavy-chain CDR-2. Other libraries suitable for use will be apparent to persons skilled in the art. The polypeptides of this invention may be used in the purification process in, for example, an affinity chromatography step.

[0204] An "Fv" fragment can be produced by preferential proteolytic cleavage of an IgM, and on rare occasions IgG or IgA immunoglobulin molecule. Fv fragments are, however, more commonly derived using recombinant techniques known in the art. The Fv fragment includes a non-covalent V.sub.H::V.sub.L heterodimer including an antigen-binding site which retains much of the antigen recognition and binding capabilities of the native antibody molecule. See, e.g., Inbar et al. (1972) Proc. Nat. Acad. Sci. USA 69:2659-2662; Hochman et al. (1976) Biochem 15:2706-2710; and Ehrlich et al. (1980) Biochem 19:4091-4096.

[0205] A single chain Fv ("sFv") polypeptide is a covalently linked V.sub.H::V.sub.L heterodimer which is expressed from a gene fusion including V.sub.H- and V.sub.L-encoding genes linked by a peptide-encoding linker. Huston et al. (1988) PNAS USA. 85(16):5879-5883. A number of methods have been described to discern chemical structures for converting the naturally aggregated--but chemically separated--light and heavy polypeptide chains from an antibody V region into an sFv molecule which will fold into a three dimensional structure substantially similar to the structure of an antigen-binding site. See, e.g., U.S. Pat. Nos. 5,091,513 and 5,132,405, to Huston et al.; and U.S. Pat. No. 4,946,778, to Ladner et al.

[0206] Each of the above-described molecules includes a heavy chain and a light chain CDR set, respectively interposed between a heavy chain and a light chain FR set which provide support to the CDRS and define the spatial relationship of the CDRs relative to each other. As used herein, the term "CDR set" refers to the three hypervariable regions of a heavy or light chain V region. Proceeding from the N-terminus of a heavy or light chain, these regions are denoted as "CDR1," "CDR2," and "CDR3" respectively. An antigen-binding site, therefore, includes six CDRs, comprising the CDR set from each of a heavy and a light chain V region. A polypeptide comprising a single CDR, (e.g., a CDR1, CDR2 or CDR3) is referred to herein as a "molecular recognition unit." Crystallographic analysis of a number of antigen-antibody complexes has demonstrated that the amino acid residues of CDRs form extensive contact with bound antigen, wherein the most extensive antigen contact is with the heavy chain CDR3. Thus, the molecular recognition units are primarily responsible for the specificity of an antigen-binding site.

[0207] As used herein, the term "FR set" refers to the four flanking amino acid sequences which frame the CDRs of a CDR set of a heavy or light chain V region. Some FR residues may contact bound antigen; however, FRs are primarily responsible for folding the V region into the antigen-binding site, particularly the FR residues directly adjacent to the CDRS. Within FRs, certain amino residues and certain structural features are very highly conserved. In this regard, all V region sequences contain an internal disulfide loop of around 90 amino acid residues. When the V regions fold into a binding-site, the CDRs are displayed as projecting loop motifs which form an antigen-binding surface. It is generally recognized that there are conserved structural regions of FRs which influence the folded shape of the CDR loops into certain "canonical" structures--regardless of the precise CDR amino acid sequence. Further, certain FR residues are known to participate in non-covalent interdomain contacts which stabilize the interaction of the antibody heavy and light chains.

[0208] Certain embodiments include single domain antibody (sdAbs or "nanobodies"), which refer to an antibody fragment consisting of a single monomeric variable antibody domain (see, e.g., U.S. Pat. Nos. 5,840,526; 5,874,541; 6,005,079, 6,765,087, 5,800,988; 5,874,541; and 6,015,695). Such sdABs typically have a molecular weight of about 12-15 kDa. In certain aspects, sdABs and other antibody molecules can be derived or isolated from the unique heavy-chain antibodies of immunized camels and llamas, often referred to as camelids. See, e.g., Conrath et al., JBC. 276:7346-7350, 2001.

[0209] A number of "humanized" antibody molecules comprising an antigen-binding site derived from a non-human immunoglobulin have been described, including chimeric antibodies having rodent V regions and their associated CDRs fused to human constant domains (Winter et al. (1991) Nature 349:293-299; Lobuglio et al. (1989) Proc. Nat. Acad. Sci. USA 86:4220-4224; Shaw et al. (1987) J Immunol. 138:4534-4538; and Brown et al. (1987) Cancer Res. 47:3577-3583), rodent CDRs grafted into a human supporting FR prior to fusion with an appropriate human antibody constant domain (Riechmann et al. (1988) Nature 332:323-327; Verhoeyen et al. (1988) Science 239:1534-1536; and Jones et al. (1986) Nature 321:522-525), and rodent CDRs supported by recombinantly veneered rodent FRs (European Patent Publication No. 519,596, published Dec. 23, 1992). These "humanized" molecules are designed to minimize unwanted immunological response toward rodent antihuman antibody molecules which limits the duration and effectiveness of therapeutic applications of those moieties in human recipients. See, e.g., U.S. Pat. Nos. 5,530,101; 5,585,089; 5,693,762; 6,180,370; and 7,022,500.

[0210] The antibodies of the present invention can be used in any of the therapeutic, diagnostic, drug discovery, protein purification, and analytical methods and compositions described herein.

VI. Antibody Alternatives and Other Binding Agents

[0211] According to another aspect, the present invention further provides antibody alternatives or other binding agents, such as soluble receptors, adnectins, peptides, peptide mimetics, small molecules, aptamers, etc., that exhibit binding specificity for an AARS polypeptide or its cellular binding partner as disclosed herein, or to a portion, variant or derivative thereof, and compositions and methods of using same. Binding agents can be used in any of the therapeutic, diagnostic, drug discovery, or protein expression/purification, and analytical methods and compositions described herein. Biologic-based binding agents such as adnectins, soluble receptors, avimers, and trinectins are particularly useful.

[0212] In certain embodiments, such binding agents are effective for modulating one or more of the non-canonical activities mediated by an AARS polypeptide of the invention. In some embodiments, for example, the binding agent is one that binds to an AARS polypeptide and/or its binding partner, inhibits their ability to interact with each other, and/or antagonizes the non-canonical activity of the AARS polypeptide. In certain embodiments, for example, the binding agent binds to the cellular binding partner of an AARS polypeptide, and mimics the AARS polypeptide activity, such as by increasing or agonizing the non-canonical activity mediated by the AARS polypeptide. Accordingly, such binding agents may be used to diagnose, treat, or prevent diseases, disorders or other conditions that are mediated by an AARS polypeptide of the invention, such as by antagonizing or agonizing its activity partially or fully.

[0213] A binding agent is said to "specifically bind" to an AARS polypeptide of the invention, or its cellular binding partner, if it reacts at a detectable level (within, for example, an ELISA assay) with the polypeptide or its cellular binding partner, and does not react detectably in a statistically significant manner with unrelated polypeptides under similar conditions. In certain instances, a binding agent does not significantly interact with a full-length version of the AARS polypeptide. In certain illustrative embodiments, a binding agent has an affinity for an AARS protein fragment or its cellular binding partner of at least about 0.01, 0.05, 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 40, or 50 nM. In certain embodiments, the affinity of the binding agent for an AARS protein fragment is stronger than its affinity for a corresponding full-length AARS polypeptide, typically by about 1.5.times., 2.times., 2.5.times., 3.times., 3.5.times., 4.times., 4.5.times., 5.times., 6.times., 7.times., 8.times., 9.times., 10.times., 15.times., 20.times., 25.times., 30.times., 40.times., 50.times., 60.times., 70.times., 80.times., 90.times., 100.times., 200.times., 300.times., 400.times., 500.times., 600.times., 700.times., 800.times., 900.times., 1000.times. or more (including all integers in between). In certain embodiments, a binding agent has an affinity for a corresponding full-length AARS protein of at least about 0.5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 .mu.M.

[0214] As noted above, "peptides" are included as binding agents. The term peptide typically refers to a polymer of amino acid residues and to variants and synthetic analogues of the same. In certain embodiments, the term "peptide" refers to relatively short polypeptides, including peptides that consist of about 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, or 50 amino acids, including all integers and ranges (e.g., 5-10, 8-12, 10-15) in between, and interact with an AARS polypeptide, its cellular binding partner, or both. Peptides can be composed of naturally-occurring amino acids and/or non-naturally occurring amino acids, as described herein.

[0215] In addition to peptides consisting only of naturally-occurring amino acids, peptidomimetics or peptide analogs are also provided. Peptide analogs are commonly used in the pharmaceutical industry as non-peptide drugs with properties analogous to those of the template peptide. These types of non-peptide compound are termed "peptide mimetics" or "peptidomimetics" (Luthman, et al., A Textbook of Drug Design and Development, 14:386-406, 2nd Ed., Harwood Academic Publishers (1996); Joachim Grante, Angew. Chem. Int. Ed. Engl., 33:1699-1720 (1994); Fauchere, J., Adv. Drug Res., 15:29 (1986); Veber and Freidinger TINS, p. 392 (1985); and Evans, et al., J. Med. Chem. 30:229 (1987)). A peptidomimetic is a molecule that mimics the biological activity of a peptide but is no longer peptidic in chemical nature. Peptidomimetic compounds are known in the art and are described, for example, in U.S. Pat. No. 6,245,886.

[0216] The present invention also includes peptoids. Peptoid derivatives of peptides represent another form of modified peptides that retain the important structural determinants for biological activity, yet eliminate the peptide bonds, thereby conferring resistance to proteolysis (Simon, et al., PNAS USA. 89:9367-9371, 1992). Peptoids are oligomers of N-substituted glycines. A number of N-alkyl groups have been described, each corresponding to the side chain of a natural amino acid. The peptidomimetics of the present invention include compounds in which at least one amino acid, a few amino acids or all amino acid residues are replaced by the corresponding N-substituted glycines. Peptoid libraries are described, for example, in U.S. Pat. No. 5,811,387.

[0217] A binding agent may also include one or more small molecules. A "small molecule" refers to an organic compound that is of synthetic or biological origin (biomolecule), but is typically not a polymer. Organic compounds refer to a large class of chemical compounds whose molecules contain carbon, typically excluding those that contain only carbonates, simple oxides of carbon, or cyanides. A "biomolecule" refers generally to an organic molecule that is produced by a living organism, including large polymeric molecules (biopolymers) such as peptides, polysaccharides, and nucleic acids as well, and small molecules such as primary secondary metabolites, lipids, phospholipids, glycolipids, sterols, glycerolipids, vitamins, and hormones. A "polymer" refers generally to a large molecule or macromolecule composed of repeating structural units, which are typically connected by covalent chemical bond.

[0218] In certain embodiments, a small molecule has a molecular weight of less than 1000-2000 Daltons, typically between about 300 and 700 Daltons, and including about 50, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 500, 650, 600, 750, 700, 850, 800, 950, 1000 or 2000 Daltons. Small molecule libraries are described elsewhere herein.

[0219] Aptamers are also included as binding agents (see, e.g., Ellington et al., Nature. 346, 818-22, 1990; and Tuerk et al., Science. 249, 505-10, 1990). Examples of aptamers included nucleic acid aptamers (e.g., DNA aptamers, RNA aptamers) and peptide aptamers. Nucleic acid aptamers refer generally to nucleic acid species that have been engineered through repeated rounds of in vitro selection or equivalent method, such as SELEX (systematic evolution of ligands by exponential enrichment), to bind to various molecular targets such as small molecules, proteins, nucleic acids, and even cells, tissues and organisms. See, e.g., U.S. Pat. Nos. 6,376,190; and 6,387,620. Hence, included are nucleic acid aptamers that bind to the AARS polypeptides described herein and/or their cellular binding partners.

[0220] Peptide aptamers typically include a variable peptide loop attached at both ends to a protein scaffold, a double structural constraint that typically increases the binding affinity of the peptide aptamer to levels comparable to that of an antibody's (e.g., in the nanomolar range). In certain embodiments, the variable loop length may be composed of about 10-20 amino acids (including all integers in between), and the scaffold may include any protein that has good solubility and compacity properties. Certain exemplary embodiments may utilize the bacterial protein Thioredoxin-A as a scaffold protein, the variable loop being inserted within the reducing active site (-Cys-Gly-Pro-Cys-loop in the wild protein), with the two cysteines lateral chains being able to form a disulfide bridge. Methods for identifying peptide aptamers are described, for example, in U.S. Application No. 2003/0108532. Hence, included are peptide aptamers that bind to the AARS polypeptides described herein and/or their cellular binding partners. Peptide aptamer selection can be performed using different systems known in the art, including the yeast two-hybrid system.

[0221] Also included are ADNECTINS.TM., AVIMERS.TM., anaphones and anticalins that specifically bind to an AARS protein fragment of the invention. ADNECTINS.TM. refer to a class of targeted biologics derived from human fibronectin, an abundant extracellular protein that naturally binds to other proteins. See, e.g., U.S. Application Nos. 2007/0082365; 2008/0139791; and 2008/0220049. ADNECTINS.TM. typically consists of a natural fibronectin backbone, as well as the multiple targeting domains of a specific portion of human fibronectin. The targeting domains can be engineered to enable an ADNECTIN.TM. to specifically recognize a therapeutic target of interest, such as an AARS protein fragment of the invention.

[0222] AVIMERS.TM. refer to multimeric binding proteins or peptides engineered using in vitro exon shuffling and phage display. Multiple binding domains are linked, resulting in greater affinity and specificity compared to single epitope immunoglobulin domains. See, e.g., Silverman et al., Nature Biotechnology. 23:1556-1561, 2005; U.S. Pat. No. 7,166,697; and U.S. Application Nos. 2004/0175756, 2005/0048512, 2005/0053973, 2005/0089932 and 2005/0221384.

[0223] Also included are designed ankyrin repeat proteins (DARPins), which include a class of non-immunoglobulin proteins that can offer advantages over antibodies for target binding in drug discovery and drug development. Among other uses, DARPins are ideally suited for in vivo imaging or delivery of toxins or other therapeutic payloads because of their favorable molecular properties, including small size and high stability. The low-cost production in bacteria and the rapid generation of many target-specific DARPins make the DARPin approach useful for drug discovery. Additionally, DARPins can be easily generated in multispecific formats, offering the potential to target an effector DARPin to a specific organ or to target multiple receptors with one molecule composed of several DARPins. See, e.g., Stumpp et al., Curr Opin Drug Discov Devel. 10:153-159, 2007; U.S. Application No. 2009/0082274; and PCT/EP2001/10454.

[0224] Certain embodiments include "monobodies," which typically utilize the 10th fibronectin type III domain of human fibronectin (FNfn10) as a scaffold to display multiple surface loops for target binding. FNfn10 is a small (94 residues) protein with a .beta.-sandwich structure similar to the immunoglobulin fold. It is highly stable without disulfide bonds or metal ions, and it can be expressed in the correctly folded form at a high level in bacteria. The FNfn10 scaffold is compatible with virtually any display technologies. See, e.g., Batori et al., Protein Eng. 15:1015-20, 2002; and Wojcik et al., Nat Struct Mol Biol., 2010; and U.S. Pat. No. 6,673,901.

[0225] Anticalins refer to a class of antibody mimetics, which are typically synthesized from human lipocalins, a family of binding proteins with a hypervariable loop region supported by a structurally rigid framework. See, e.g., U.S. Application No. 2006/0058510. Anticalins typically have a size of about 20 kDa. Anticalins can be characterized by a barrel structure formed by eight antiparallel .beta.-strands (a stable .beta.-barrel scaffold) that are pairwise connected by four peptide loops and an attached .alpha.-helix. In certain aspects, conformational deviations to achieve specific binding are made in the hypervariable loop region(s). See, e.g., Skerra, FEBS 1 275:2677-83, 2008, herein incorporated by reference.

VII. Bioassays and Analytical Assays for Drug Release Assays and Product Specifications, Diagnostics, and Reagents

[0226] Also included are bioassays that relate to the AARS protein fragments and related agents as therapeutic and diagnostic reagents. Examples include bioassays and analytical assays that measure purity, biological activity, affinity, solubility, pH, endotoxin levels, among others, many of which are described herein. Also included are assays that establish dose response curves and/or provide one or more bases for comparison between different batches of agents. Batch comparisons can be based on any one or more of chemical characterization, biological characterization, and clinical characterization. For protein agents, also included are methods of evaluating the potency, stability, pharmacokinetics, and immunogenicity of a selected agent. Among other uses, these and other methods can be used for lot releasing testing of biologic or chemical agents, including the AARS protein fragments, antibodies, binding agents, polynucleotides such as antisense agents and vectors, and others described herein.

[0227] Certain embodiments include the use of bioaffinity assays. Such assays can be used to assess the binding affinity, for example, between an AARS protein fragment and a cellular binding partner, or between an AARS protein fragment and an antibody. Binding affinity can also be measured between an AARS protein fragment and an alternate binding agent such as a candidate or lead test compound (e.g., small molecule modulator of an AARS), or between an AARS cellular binding partner and a candidate or lead test compound. Certain exemplary binding affinity assays may utilize ELISA assays, as described herein and known in the art. Certain assays utilize high-performance receptor binding chromatography (see, e.g., Roswall et al., Biologicals. 24:25-39, 1996). Other exemplary binding affinity assays may utilize surface plasmon resonance (SPR)-based technologies. Examples include BIACore technologies, certain of which integrate SPR technology with a microfluidics system to monitor molecular interactions in real time at concentrations ranging from pM to mM. Also included are KinExa.TM. assays, which provide accurate measurements of binding specificity, binding affinity, and binding kinetics/rate constants.

[0228] Certain embodiments relate to immunoassays for evaluating or optimizing the immunogenicity of protein agents. Examples include ex vivo human cellular assays and in vitro immuno-enzymatic assays to provide useful information on the immunogenic potential of a therapeutic protein. Ex vivo cell-response assays can be used, for example, to reproduce the cellular co-operation between antigen-presenting cells (APCs) and T-cells, and thereby measure T-cells activation after contact with a protein of interest. Certain in vitro enzymatic assays may utilize a collection of recombinant HLA-DR molecules that cover a significant portion of a relevant human population, and may include automated immuno-enzymatic assays for testing the binding of peptides (stemming from the fragmentation of the therapeutic protein) with the HLA-DR molecules. Also included are methods of reducing the immunogenicity of a selected protein, such as by using these and related methods to identify and then remove or alter one or more T-cell epitopes from a protein agent.

[0229] Also included are biological release assays (e.g., cell-based assays) for measuring parameters such as specific biological activities, including non-canonical biological activities, and cytotoxicity. Certain specific biological assays include, for example, cell-based assays that utilize a cellular binding partner (e.g., cell-surface receptor) of a selected AARS protein fragment, which is functionally coupled to a readout, such as a fluorescent or luminescent indicator of a non-canonical biological activity, as described herein. For instance, specific embodiments include a cell that comprises a cell-surface receptor or an extracellular portion thereof that binds to an AARS protein fragment, wherein the cell comprises a detector or readout. Also included are in vivo biological assays to characterize the pharmacokinetics of an agent, such as an AARS polypeptide or antibody, typically utilizing engineered mice or other mammal (see, e.g., Lee et al., The Journal of Pharmacology. 281:1431-1439, 1997). Examples of cytotoxicity-based biological assays include release assays (e.g., chromium or europium release assays to measure apoptosis; see, e.g., von Zons et al., Clin Diagn Lab Immunol.4:202-207, 1997), among others, which can assess the cytotoxicity of AARS protein fragments, whether for establishing dose response curves, batch testing, or other properties related to approval by various regulatory agencies, such as the Food and Drug Administration (FDA).

[0230] Such assays can be used, for example, to develop a dose response curve for a selected AARS protein fragment or other agent, and/or to compare the dose response curve of different batches of proteins or other agents. A dose-response curve is an X-Y graph that relates the magnitude of a stressor to the response of a receptor; the response may be a physiological or biochemical response, such as a non-canonical biological activity in a cell in vitro or in a cell or tissue in vivo, a therapeutically effective amount as measured in vivo (e.g., as measured by EC.sub.50), or death, whether measured in vitro or in vivo (e.g., cell death, organismal death). Death is usually indicated as an LD.sub.50, a statistically-derived dose that is lethal to 50% of a modeled population, though it can be indicated by LC.sub.01 (lethal dose for 1% of the animal test population), LC.sub.100 (lethal dose for 100% of the animal test population), or LC.sub.LO (lowest dose causing lethality). Almost any desired effect or endpoint can be characterized in this manner.

[0231] The measured dose of a response curve is typically plotted on the X axis and the response is plotted on the Y axis. More typically, the logarithm of the dose is plotted on the X axis, most often generating a sigmoidal curve with the steepest portion in the middle. The No Observable Effect Level (NOEL) refers to the lowest experimental dose for which no measurable effect is observed, and the threshold dose refers to the first point along the graph that indicates a response above zero. As a general rule, stronger drugs generate steeper dose response curves. For many drugs, the desired effects are found at doses slightly greater than the threshold dose, often because lower doses are relatively ineffective and higher doses lead to undesired side effects. For in vivo generated dose response curves, a curve can be characterized by values such as .mu.g/kg, mg/kg, or g/kg of body-weight, if desired.

[0232] For batch comparisons, it can be useful to calculate the coefficient of variation (CV) between different dose response curves of different batches (e.g., between different batches of AARS protein fragments, antibodies, or other agents), in part because the CV allows comparison between data sets with different units or different means. For instance, in certain exemplary embodiments, two or three or more different batches of AARS protein fragments or other agents have a CV between them of less than about 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, or 1% for a 4, 5, 6, 7, or 8 point dose curve. In certain embodiments, the dose response curve is measured in a cell-based assay, and its readout relates to an increase or a decrease in a selected non-canonical activity of the AARS protein fragment. In certain embodiments, the dose response curve is measured in a cell release assay or animal model (e.g., mouse model), and its readout relates to cell death or animal death. Other variations will be apparent to persons skilled in the art.

VIII. Expression and Purification Systems

[0233] Embodiments of the present invention include methods and related compositions for expressing and purifying the AARS protein fragments or other polypeptide-based agents of the invention. Such recombinant AARS polypeptides can be conveniently prepared using standard protocols as described for example in Sambrook, et al., (1989, supra), in particular Sections 16 and 17; Ausubel et al., (1994, supra), in particular Chapters 10 and 16; and Coligan et al., Current Protocols in Protein Science (John Wiley & Sons, Inc. 1995-1997), in particular Chapters 1, 5 and 6. As one general example, AARS polypeptides may be prepared by a procedure including one or more of the steps of: (a) preparing a construct comprising a polynucleotide sequence that encodes a AARS polypeptide and that is operably linked to a regulatory element; (b) introducing the construct into a host cell; (c) culturing the host cell to express the AARS polypeptide; and (d) isolating the AARS polypeptide from the host cell.

[0234] AARS polynucleotides are described elsewhere herein. In order to express a desired polypeptide, a nucleotide sequence encoding the polypeptide, or a functional equivalent, may be inserted into appropriate expression vector, i.e., a vector which contains the necessary elements for the transcription and translation of the inserted coding sequence. Methods which are well known to those skilled in the art may be used to construct expression vectors containing sequences encoding a polypeptide of interest and appropriate transcriptional and translational control elements. These methods include in vitro recombinant DNA techniques, synthetic techniques, and in vivo genetic recombination. Such techniques are described in Sambrook et al., Molecular Cloning, A Laboratory Manual (1989), and Ausubel et al., Current Protocols in Molecular Biology (1989).

[0235] A variety of expression vector/host systems are known and may be utilized to contain and express polynucleotide sequences. These include, but are not limited to, microorganisms such as bacteria transformed with recombinant bacteriophage, plasmid, or cosmid DNA expression vectors; yeast transformed with yeast expression vectors; insect cell systems infected with virus expression vectors (e.g., baculovirus); plant cell systems transformed with virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or with bacterial expression vectors (e.g., Ti or pBR322 plasmids); or animal cell systems, including mammalian cell and more specifically human cell systems.

[0236] The "control elements" or "regulatory sequences" present in an expression vector are those non-translated regions of the vector--enhancers, promoters, 5' and 3' untranslated regions--which interact with host cellular proteins to carry out transcription and translation. Such elements may vary in their strength and specificity. Depending on the vector system and host utilized, any number of suitable transcription and translation elements, including constitutive and inducible promoters, may be used. For example, when cloning in bacterial systems, inducible promoters such as the hybrid lacZ promoter of the PBLUESCRIPT phagemid (Stratagene, La Jolla, Calif.) or PSPORT1 plasmid (Gibco BRL, Gaithersburg, Md.) and the like may be used. In mammalian cell systems, promoters from mammalian genes or from mammalian viruses are generally preferred. If it is necessary to generate a cell line that contains multiple copies of the sequence encoding a polypeptide, vectors based on SV40 or EBV may be advantageously used with an appropriate selectable marker.

[0237] In bacterial systems, a number of expression vectors may be selected depending upon the use intended for the expressed polypeptide. For example, when large quantities are needed, vectors which direct high level expression of fusion proteins that are readily purified may be used. Such vectors include, but are not limited to, the multifunctional E. coli cloning and expression vectors such as BLUESCRIPT (Stratagene), in which the sequence encoding the polypeptide of interest may be ligated into the vector in frame with sequences for the amino-terminal Met and the subsequent 7 residues of .beta.-galactosidase so that a hybrid protein is produced; pIN vectors (Van Heeke & Schuster, J. Biol. Chem. 264:5503 5509 (1989)); and the like. pGEX Vectors (Promega, Madison, Wis.) may also be used to express foreign polypeptides as fusion proteins with glutathione S-transferase (GST). In general, such fusion proteins are soluble and can easily be purified from lysed cells by adsorption to glutathione-agarose beads followed by elution in the presence of free glutathione. Proteins made in such systems may be designed to include heparin, thrombin, or factor XA protease cleavage sites so that the cloned polypeptide of interest can be released from the GST moiety at will.

[0238] Certain embodiments may employ E. coli-based expression systems (see, e.g., Structural Genomics Consortium et al., Nature Methods. 5:135-146, 2008). These and related embodiments may rely partially or totally on ligation-independent cloning (LIC) to produce a suitable expression vector. In specific embodiments, protein expression may be controlled by a T7 RNA polymerase (e.g., pET vector series). These and related embodiments may utilize the expression host strain BL21(DE3), a XDE3 lysogen of BL21 that supports T7-mediated expression and is deficient in lon and ompT proteases for improved target protein stability. Also included are expression host strains carrying plasmids encoding tRNAs rarely used in E. coli, such as Rosetta.TM. (DE3) and Rosetta 2 (DE3) strains. Cell lysis and sample handling may also be improved using reagents sold under the trademarks BENZONASE.RTM. nuclease and BUGBUSTER.RTM. Protein Extraction Reagent. For cell culture, auto-inducing media can improve the efficiency of many expression systems, including high-throughput expression systems. Media of this type (e.g., Overnight Express.TM. Autoinduction System) gradually elicit protein expression through metabolic shift without the addition of artificial inducing agents such as IPTG. Particular embodiments employ hexahistidine tags (such as those sold under the trademark HIS.cndot.TAG.RTM. fusions), followed by immobilized metal affinity chromatography (IMAC) purification, or related techniques. In certain aspects, however, clinical grade proteins can be isolated from E. coli inclusion bodies, without or without the use of affinity tags (see, e.g., Shimp et al., Protein Expr Purif. 50:58-67, 2006). As a further example, certain embodiments may employ a cold-shock induced E. coli high-yield production system, because over-expression of proteins in Escherichia coli at low temperature improves their solubility and stability (see, e.g., Qing et al., Nature Biotechnology. 22:877-882, 2004).

[0239] Also included are high-density bacterial fermentation systems. For example, high cell density cultivation of Ralstonia eutropha allows protein production at cell densities of over 150 g/L, and the expression of recombinant proteins at titers exceeding 10 g/L.

[0240] In the yeast Saccharomyces cerevisiae, a number of vectors containing constitutive or inducible promoters such as alpha factor, alcohol oxidase, and PGH may be used. For reviews, see Ausubel et al. (supra) and Grant et al., Methods Enzymol. 153:516-544 (1987). Also included are Pichia pandoris expression systems (see, e.g., Li et al., Nature Biotechnology. 24, 210-215, 2006; and Hamilton et al., Science, 301:1244, 2003). Certain embodiments include yeast systems that are engineered to selectively glycosylate proteins, including yeast that have humanized N-glycosylation pathways, among others (see, e.g., Hamilton et al., Science. 313:1441-1443, 2006; Wildt et al., Nature Reviews Microbiol. 3:119-28, 2005; and Gerngross et al., Nature-Biotechnology. 22:1409-1414, 2004; U.S. Pat. Nos. 7,629,163; 7,326,681; and 7,029,872). Merely by way of example, recombinant yeast cultures can be grown in Fernbach Flasks or 15 L, SOL, 100 L, and 200 L fermentors, among others.

[0241] In cases where plant expression vectors are used, the expression of sequences encoding polypeptides may be driven by any of a number of promoters. For example, viral promoters such as the 35S and 19S promoters of CaMV may be used alone or in combination with the omega leader sequence from TMV (Takamatsu, EMBO J. 6:307-311 (1987)). Alternatively, plant promoters such as the small subunit of RUBISCO or heat shock promoters may be used (Coruzzi et al., EMBO J. 3:1671-1680 (1984); Broglie et al., Science 224:838-843 (1984); and Winter et al., Results Probl. Cell Differ. 17:85-105 (1991)). These constructs can be introduced into plant cells by direct DNA transformation or pathogen-mediated transfection. Such techniques are described in a number of generally available reviews (see, e.g., Hobbs in McGraw Hill, Yearbook of Science and Technology, pp. 191-196 (1992)).

[0242] An insect system may also be used to express a polypeptide of interest. For example, in one such system, Autographa californica nuclear polyhedrosis virus (AcNPV) is used as a vector to express foreign genes in Spodoptera frugiperda cells or in Trichoplusia cells. The sequences encoding the polypeptide may be cloned into a non-essential region of the virus, such as the polyhedrin gene, and placed under control of the polyhedrin promoter. Successful insertion of the polypeptide-encoding sequence will render the polyhedrin gene inactive and produce recombinant virus lacking coat protein. The recombinant viruses may then be used to infect, for example, S. frugiperda cells or Trichoplusia larvae in which the polypeptide of interest may be expressed (Engelhard et al., Proc. Natl. Acad. Sci. U.S.A. 91:3224-3227 (1994)). Also included are baculovirus expression systems, including those that utilize SF9, SF21, and Tni cells (see, e.g., Murphy and Piwnica-Worms, Curr Protoc Protein Sci. Chapter 5:Unit 5.4, 2001). Insect systems can provide post-translation modifications that are similar to mammalian systems.

[0243] In mammalian host cells, a number of viral-based expression systems are generally available. For example, in cases where an adenovirus is used as an expression vector, sequences encoding a polypeptide of interest may be ligated into an adenovirus transcription/translation complex consisting of the late promoter and tripartite leader sequence. Insertion in a non-essential E1 or E3 region of the viral genome may be used to obtain a viable virus which is capable of expressing the polypeptide in infected host cells (Logan & Shenk, Proc. Natl. Acad. Sci. U.S.A. 81:3655-3659 (1984)). In addition, transcription enhancers, such as the Rous sarcoma virus (RSV) enhancer, may be used to increase expression in mammalian host cells.

[0244] Examples of useful mammalian host cell lines include monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells sub-cloned for growth in suspension culture, Graham et al., J. Gen Virol. 36:59 (1977)); baby hamster kidney cells (BHK, ATCC CCL 10); mouse sertoli cells (TM4, Mather, Biol. Reprod. 23:243-251 (1980)); monkey kidney cells (CV1 ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC CRL-1587); human cervical carcinoma cells (HELA, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (BRL 3A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065); mouse mammary tumor (MMT 060562, ATCC CCL51); TR1 cells (Mather et al., Annals N.Y. Acad. Sci. 383:44-68 (1982)); MRC 5 cells; FS4 cells; and a human hepatoma line (Hep G2). Other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including DHFR-CHO cells (Urlaub et al., PNAS USA 77:4216 (1980)); and myeloma cell lines such as NSO and Sp2/0. For a review of certain mammalian host cell lines suitable for antibody production, see, e.g., Yazaki and Wu, Methods in Molecular Biology, Vol. 248 (B. K. C Lo, ed., Humana Press, Totowa, N.J., 2003), pp. 255-268. Certain preferred mammalian cell expression systems include CHO and HEK293-cell based expression systems. Mammalian expression systems can utilize attached cell lines, for example, in T-flasks, roller bottles, or cell factories, or suspension cultures, for example, in 1 L and 5 L spinners, 5 L, 14 L, 40 L, 100 L and 200 L stir tank bioreactors, or 20/50 L and 100/200 L WAVE bioreactors, among others known in the art.

[0245] Also included is cell-free expression of proteins. These and related embodiments typically utilize purified RNA polymerase, ribosomes, tRNA and ribonucleotides; these reagents may be produced by extraction from cells or from a cell-based expression system.

[0246] Specific initiation signals may also be used to achieve more efficient translation of sequences encoding a polypeptide of interest. Such signals include the ATG initiation codon and adjacent sequences. In cases where sequences encoding the polypeptide, its initiation codon, and upstream sequences are inserted into the appropriate expression vector, no additional transcriptional or translational control signals may be needed. However, in cases where only coding sequence, or a portion thereof, is inserted, exogenous translational control signals including the ATG initiation codon should be provided. Furthermore, the initiation codon should be in the correct reading frame to ensure translation of the entire insert. Exogenous translational elements and initiation codons may be of various origins, both natural and synthetic. The efficiency of expression may be enhanced by the inclusion of enhancers which are appropriate for the particular cell system which is used, such as those described in the literature (Scharf et al., Results Probl. Cell Differ. 20:125-162 (1994)).

[0247] In addition, a host cell strain may be chosen for its ability to modulate the expression of the inserted sequences or to process the expressed protein in the desired fashion. Such modifications of the polypeptide include, but are not limited to, post-translational modifications such as acetylation, carboxylation, glycosylation, phosphorylation, lipidation, and acylation. Post-translational processing which cleaves a "prepro" form of the protein may also be used to facilitate correct insertion, folding and/or function. Different host cells such as yeast, CHO, HeLa, MDCK, HEK293, and W138, in addition to bacterial cells, which have or even lack specific cellular machinery and characteristic mechanisms for such post-translational activities, may be chosen to ensure the correct modification and processing of the foreign protein.

[0248] For long-term, high-yield production of recombinant proteins, stable expression is generally preferred. For example, cell lines which stably express a polynucleotide of interest may be transformed using expression vectors which may contain viral origins of replication and/or endogenous expression elements and a selectable marker gene on the same or on a separate vector. Following the introduction of the vector, cells may be allowed to grow for about 1-2 days in an enriched media before they are switched to selective media. The purpose of the selectable marker is to confer resistance to selection, and its presence allows growth and recovery of cells which successfully express the introduced sequences. Resistant clones of stably transformed cells may be proliferated using tissue culture techniques appropriate to the cell type. Transient production, such as by transient transfection or infection, can also be employed. Exemplary mammalian expression systems that are suitable for transient production include HEK293 and CHO-based systems.

[0249] Any number of selection systems may be used to recover transformed or transduced cell lines. These include, but are not limited to, the herpes simplex virus thymidine kinase (Wigler et al., Cell 11:223-232 (1977)) and adenine phosphoribosyltransferase (Lowy et al., Cell 22:817-823 (1990)) genes which can be employed in tk- or aprt-cells, respectively. Also, antimetabolite, antibiotic or herbicide resistance can be used as the basis for selection; for example, dhfr which confers resistance to methotrexate (Wigler et al., Proc. Natl. Acad. Sci. U.S.A. 77:3567-70 (1980)); npt, which confers resistance to the aminoglycosides, neomycin and G-418 (Colbere-Garapin et al., J. Mol. Biol. 150:1-14 (1981)); and als or pat, which confer resistance to chlorsulfuron and phosphinotricin acetyltransferase, respectively (Murry, supra). Additional selectable genes have been described, for example, trpB, which allows cells to utilize indole in place of tryptophan, or hisD, which allows cells to utilize histinol in place of histidine (Hartman & Mulligan, Proc. Natl. Acad. Sci. U.S.A. 85:8047-51 (1988)). The use of visible markers has gained popularity with such markers as green fluorescent protein (GFP) and other fluorescent proteins (e.g., RFP, YFP), anthocyanins, .beta.-glucuronidase and its substrate GUS, and luciferase and its substrate luciferin, being widely used not only to identify transformants, but also to quantify the amount of transient or stable protein expression attributable to a specific vector system (see, e.g., Rhodes et al., Methods Mol. Biol. 55:121-131 (1995)).

[0250] Embodiments of the present invention also include high-throughput protein production systems, or micro-production systems. Certain aspects may utilize, for example, hexa-histidine fusion tags for protein expression and purification on metal chelate-modified slide surfaces or MagneHis Ni-Particles (see, e.g., Kwon et al., BMC Biotechnol. 9:72, 2009; and Lin et al., Methods Mol Biol. 498:129-41, 2009)). Also included are high-throughput cell-free protein expression systems (see, e.g., Sitaraman et al., Methods Mol Biol. 498:229-44, 2009). These and related embodiments can be used, for example, to generate microarrays of AARS protein fragment(s), which can then be used for screening libraries to identify agents that interact with the AARS protein fragment(s).

[0251] A variety of protocols for detecting and measuring the expression of polynucleotide-encoded products, using binding agents or antibodies such as polyclonal or monoclonal antibodies specific for the product, are known in the art. Examples include enzyme-linked immunosorbent assay (ELISA), western immunoblots, radioimmunoassays (RIA), and fluorescence activated cell sorting (FACS). These and other assays are described, among other places, in Hampton et al., Serological Methods, a Laboratory Manual (1990) and Maddox et al., J. Exp. Med. 158:1211-1216 (1983).

[0252] A wide variety of labels and conjugation techniques are known by those skilled in the art and may be used in various nucleic acid and amino acid assays. Means for producing labeled hybridization or PCR probes for detecting sequences related to polynucleotides include oligolabeling, nick translation, end-labeling or PCR amplification using a labeled nucleotide. Alternatively, the sequences, or any portions thereof may be cloned into a vector for the production of an mRNA probe. Such vectors are known in the art, are commercially available, and may be used to synthesize RNA probes in vitro by addition of an appropriate RNA polymerase such as T7, T3, or SP6 and labeled nucleotides. These procedures may be conducted using a variety of commercially available kits. Suitable reporter molecules or labels, which may be used include radionuclides, enzymes, fluorescent, chemiluminescent, or chromogenic agents as well as substrates, cofactors, inhibitors, magnetic particles, and the like.

[0253] Host cells transformed with a polynucleotide sequence of interest may be cultured under conditions suitable for the expression and recovery of the protein from cell culture. Certain specific embodiments utilize serum free cell expression systems. Examples include HEK293 cells and CHO cells that can grown on serum free medium (see, e.g., Rosser et al., Protein Expr. Purif. 40:237-43, 2005; and U.S. Pat. No. 6,210,922).

[0254] The protein produced by a recombinant cell may be secreted or contained intracellularly depending on the sequence and/or the vector used. As will be understood by those of skill in the art, expression vectors containing polynucleotides of the invention may be designed to contain signal sequences which direct secretion of the encoded polypeptide through a prokaryotic or eukaryotic cell membrane. Other recombinant constructions may be used to join sequences encoding a polypeptide of interest to nucleotide sequence encoding a polypeptide domain which will facilitate purification and/or detection of soluble proteins. Examples of such domains include cleavable and non-cleavable affinity purification and epitope tags such as avidin, FLAG tags, poly-histidine tags (e.g., 6.times.His), cMyc tags, VS-tags, glutathione S-transferase (GST) tags, and others.

[0255] The protein produced by a recombinant cell can be purified and characterized according to a variety of techniques known in the art. Exemplary systems for performing protein purification and analyzing protein purity include fast protein liquid chromatography (FPLC) (e.g., AKTA and Bio-Rad FPLC systems), high-pressure liquid chromatography (HPLC) (e.g., Beckman and Waters HPLC).

[0256] Exemplary chemistries for purification include ion exchange chromatography (e.g., Q, S), size exclusion chromatography, salt gradients, affinity purification (e.g., Ni, Co, FLAG, maltose, glutathione, protein A/G), gel filtration, reverse-phase, ceramic HYPERD.RTM. ion exchange chromatography, and hydrophobic interaction columns (HIC), among others known in the art. Also included are analytical methods such as SDS-PAGE (e.g., coomassie, silver stain), immunoblot, Bradford, and ELISA, which may be utilized during any step of the production or purification process, typically to measure the purity of the protein composition.

[0257] Also included are methods of concentrating AARS protein fragments, and composition comprising concentrated soluble proteins. In different aspects such concentrated solutions of AARS polypeptides may comprise proteins at a concentration of about 5 mg/mL; or about 8 mg/mL; or about 10 mg/mL; about 15 mg/mL; or about 20 mg/mL.

[0258] In one aspect such compositions may be substantially monodisperse, meaning that the AARS polypeptide compositions exist primarily (i.e. at least about 90%, or greater) in one apparent molecular weight form when assessed for example, by size exclusion chromatography, dynamic light scattering, or analytical ultracentrifugation.

[0259] In another aspect, such compositions have a purity (on a protein basis) of at least about 90%, or in some aspects at least about 95% purity, or in some embodiments, at least 98% purity. Purity may be determined via any routine analytical method as known in the art.

[0260] In another aspect, such compositions have a high molecular weight aggregate content of less than about 10%, compared to the total amount of protein present, or in some embodiments such compositions have a high molecular weight aggregate content of less than about 5%, or in some aspects such compositions have a high molecular weight aggregate content of less than about 3%, or in some embodiments a high molecular weight aggregate content of less than about 1%. High molecular weight aggregate content may be determined via a variety of analytical techniques including for example, by size exclusion chromatography, dynamic light scattering, or analytical ultracentrifugation.

[0261] In certain embodiments, as noted herein, the AARS polypeptide compositions have an endotoxin content of less than about 10 EU/mg of AARS polypeptide, or less than about 5 EU/mg of AARS polypeptide, less than about 3 EU/mg of AARS polypeptide, or less than about 1 EU/mg of AARS polypeptide.

[0262] Examples of concentration approaches contemplated herein include lyophilization, which is typically employed when the solution contains few soluble components other than the protein of interest. Lyophilization is often performed after HPLC run, and can remove most or all volatile components from the mixture. Also included are ultrafiltration techniques, which typically employ one or more selective permeable membranes to concentrate a protein solution. The membrane allows water and small molecules to pass through and retains the protein; the solution can be forced against the membrane by mechanical pump, gas pressure, or centrifugation, among other techniques.

[0263] In certain embodiments, the reagents, AARS protein fragments, or related agents (e.g., antibodies) have a purity of at least about 90%, as measured according to routine techniques in the art. In certain embodiments, such as diagnostic compositions or certain therapeutic compositions, the AARS compositions of the present invention have a purity of at least about 95%. In specific embodiments, such as therapeutic or pharmaceutical compositions, the AARS compositions of the present invention have a purity of at least about 97% or 98% or 99%. In other embodiments, such as when being used as reference or research reagents, AARS protein fragments can be of lesser purity, and may have a purity of at least about 50%, 60%, 70%, or 80%. Purity can be measured overall or in relation to selected components, such as other proteins, e.g., purity on a protein basis.

[0264] Purified AARS protein fragments can also be characterized according to their biological characteristics. Examples include binding affinity or binding kinetics to a selected ligand (e.g., a cellular binding partner of the AARS protein fragment such as a cell-surface receptor or an extracellular domain thereof), and the presence or levels of one or more canonical or non-canonical biological activity, as described herein. Binding affinity and binding kinetics can be measured according to a variety of techniques known in the art, such as BIACORE.RTM. and related technologies that utilize surface plasmon resonance (SPR), an optical phenomenon that enables detection of unlabeled interactants in real time. SPR-based biosensors can be used in determination of active concentration, screening and characterization in terms of both affinity and kinetics. The presence or levels of one or more canonical or non-canonical biological activities can be measured according to cell-based assays, including those that utilize a cellular binding partner (e.g., cell-surface receptor) of a selected AARS protein fragment, which is functionally coupled to a readout or indicator, such as a fluorescent or luminescent indicator of a non-canonical biological activity, as described herein.

[0265] In certain embodiments, as noted above, the AARS polypeptide compositions are about substantially endotoxin free, including, for example, about 95% endotoxin free, preferably about 99% endotoxin free, and more preferably about 99.99% endotoxin free. The presence of endotoxins can be detected according to routine techniques in the art, as described herein. In specific embodiments, the AARS compositions are made from a eukaryotic cell such as a mammalian or human cell in substantially serum free media.

[0266] In certain embodiments, the AARS polypeptide compositions comprise less than about 10% wt/wt high molecular weight aggregates, or less than about 5% wt/wt high molecular weight aggregates, or less than about 2% wt/wt high molecular weight aggregates, or less than about or less than about 1% wt/wt high molecular weight aggregates.

[0267] Also included are protein-based analytical assays and methods, which can be used to assess, for example, protein purity, size, solubility, and degree of aggregation, among other characteristics. Protein purity can be assessed a number of ways. For instance, purity can be assessed based on primary structure, higher order structure, size, charge, hydrophobicity, and glycosylation. Examples of methods for assessing primary structure include N- and C-terminal sequencing and peptide-mapping (see, e.g., Allen et al., Biologicals. 24:255-275, 1996)). Examples of methods for assessing higher order structure include circular dichroisim (see, e.g., Kelly et al., Biochim Biophys Acta. 1751:119-139, 2005), fluorescent spectroscopy (see, e.g., Meagher et al., J. Biol. Chem. 273:23283-89, 1998), FT-IR, amide hydrogen-deuterium exchange kinetics, differential scanning calorimetry, NMR spectroscopy, immunoreactivity with conformationally sensitive antibodies. Higher order structure can also be assessed as a function of a variety of parameters such as pH, temperature, or added salts. Examples of methods for assessing protein characteristics such as size include analytical ultracentrifugation and size exclusion HPLC (SEC-HPLC), and exemplary methods for measuring charge include ion-exchange chromatography and isolectric focusing. Hydrophobicity can be assessed, for example, by reverse-phase HPLC and hydrophobic interaction chromatography HPLC. Glycosylation can affect pharmacokinetics (e.g., clearance), conformation or stability, receptor binding, and protein function, and can be assessed, for example, by mass spectrometry and nuclear magnetic resonance (NMR) spectroscopy.

[0268] As noted above, certain embodiments include the use of SEC-HPLC to assess protein characteristics such as purity, size (e.g., size homogeneity) or degree of aggregation, and/or to purify proteins, among other uses. SEC, also including gel-filtration chromatography (GFC) and gel-permeation chromatography (GPC), refers to a chromatographic method in which molecules in solution are separated in a porous material based on their size, or more specifically their hydrodynamic volume, diffusion coefficient, and/or surface properties. The process is generally used to separate biological molecules, and to determine molecular weights and molecular weight distributions of polymers. Typically, a biological or protein sample (such as a protein extract produced according to the protein expression methods provided herein and known in the art) is loaded into a selected size-exclusion column with a defined stationary phase (the porous material), preferably a phase that does not interact with the proteins in the sample. In certain aspects, the stationary phase is composed of inert particles packed into a dense three-dimensional matrix within a glass or steel column. The mobile phase can be pure water, an aqueous buffer, an organic solvent, or a mixture thereof. The stationary-phase particles typically have small pores and/or channels which only allow molecules below a certain size to enter. Large particles are therefore excluded from these pores and channels, and their limited interaction with the stationary phase leads them to elute as a "totally-excluded" peak at the beginning of the experiment. Smaller molecules, which can fit into the pores, are removed from the flowing mobile phase, and the time they spend immobilized in the stationary-phase pores depends, in part, on how far into the pores they penetrate. Their removal from the mobile phase flow causes them to take longer to elute from the column and results in a separation between the particles based on differences in their size. A given size exclusion column has a range of molecular weights that can be separated. Overall, molecules larger than the upper limit will not be trapped by the stationary phase, molecules smaller than the lower limit will completely enter the solid phase and elute as a single band, and molecules within the range will elute at different rates, defined by their properties such as hydrodynamic volume. For examples of these methods in practice with pharmaceutical proteins, see Bruner et al., Journal of Pharmaceutical and Biomedical Analysis. 15: 1929-1935, 1997.

[0269] Protein purity for clinical applications is also discussed, for example, by Anicetti et al. (Trends in Biotechnology. 7:342-349, 1989). More recent techniques for analyzing protein purity include, without limitation, the LabChip GXII, an automated platform for rapid analysis of proteins and nucleic acids, which provides high throughput analysis of titer, sizing, and purity analysis of proteins. In certain non-limiting embodiments, clinical grade proteins such as protein fragments and antibodies can be obtained by utilizing a combination of chromatographic materials in at least two orthogonal steps, among other methods (see, e.g., Therapeutic Proteins: Methods and Protocols. Vol. 308, Eds., Smales and James, Humana Press Inc., 2005). Typically, protein agents (e.g., AARS protein fragments, antibodies, binding agents) and other agents (e.g., antisense, RNAi, small molecules) are substantially endotoxin-free, as measured according to techniques known in the art and described herein.

[0270] Protein solubility assays are also included. Such assays can be utilized, for example, to determine optimal growth and purification conditions for recombinant production, to optimize the choice of buffer(s), and to optimize the choice of AARS protein fragments or variants thereof. Solubility or aggregation can be evaluated according to a variety of parameters, including temperature, pH, salts, and the presence or absence of other additives. Examples of solubility screening assays include, without limitation, microplate-based methods of measuring protein solubility using turbidity or other measure as an end point, high-throughput assays for analysis of the solubility of purified recombinant proteins (see, e.g., Stenvall et al., Biochim Biophys Acta. 1752:6-10, 2005), assays that use structural complementation of a genetic marker protein to monitor and measure protein folding and solubility in vivo (see, e.g., Wigley et al., Nature Biotechnology. 19:131-136, 2001), and electrochemical screening of recombinant protein solubility in Escherichia coli using scanning electrochemical microscopy (SECM) (see, e.g., Nagamine et al., Biotechnology and Bioengineering. 96:1008-1013, 2006), among others. AARS protein fragments with increased solubility (or reduced aggregation) can be identified or selected for according to routine techniques in the art, including simple in vivo assays for protein solubility (see, e.g., Maxwell et al., Protein Sci. 8:1908-11, 1999).

[0271] Protein solubility and aggregation can also be measured by dynamic light scattering techniques. Aggregation is a general term that encompasses several types of interactions or characteristics, including soluble/insoluble, covalent/noncovalent, reversible/irreversible, and native/denatured interactions and characteristics. For protein therapeutics, the presence of aggregates is typically considered undesirable because of the concern that aggregates may cause an immunogenic reaction (e.g., small aggregates), or may cause adverse events on administration (e.g., particulates). Dynamic light scattering refers to a technique that can be used to determine the size distribution profile of small particles in suspension or polymers such as proteins in solution. This technique, also referred to as photon correlation spectroscopy (PCS) or quasi-elastic light scattering (QELS), uses scattered light to measure the rate of diffusion of the protein particles. Fluctuations of the scattering intensity can be observed due to the Brownian motion of the molecules and particles in solution. This motion data can be conventionally processed to derive a size distribution for the sample, wherein the size is given by the Stokes radius or hydrodynamic radius of the protein particle. The hydrodynamic size depends on both mass and shape (conformation). Dynamic scattering can detect the presence of very small amounts of aggregated protein (<0.01% by weight), even in samples that contain a large range of masses. It can also be used to compare the stability of different formulations, including, for example, applications that rely on real-time monitoring of changes at elevated temperatures. Accordingly, certain embodiments include the use of dynamic light scattering to analyze the solubility and/or presence of aggregates in a sample that contains an AARS protein fragment, antibody, or other agent of the invention.

IX. Diagnostic Methods and Compositions

[0272] AARS agents such as AARS protein fragments, AARS polynucleotides, and antibodies and other binding agents described herein can be used in diagnostic assays and diagnostic compositions. Included are biochemical, histological, and cell-based methods and compositions, among others.

[0273] These and related embodiments include the detection of the AARS polynucleotide sequence(s) or corresponding AARS polypeptide sequence(s) or portions thereof of one or more newly identified AARS protein fragments, also referred to as AARS polypeptides. For instance, certain aspects include detection of the AARS polynucleotide sequence(s) or corresponding polypeptide sequence(s) or portions thereof of one or more newly identified AARS splice variants, and/or one or more splice junctions of those splice variants. In certain embodiments, the polynucleotide or corresponding polypeptide sequence(s) of at least one of the splice junctions is unique to that particular AARS splice variant.

[0274] Also included is the direct detection of AARS protein fragments, including splice variants, proteolytic fragments, and others. In certain embodiments, the presence or levels of one or more newly identified AARS protein fragments associate or correlate with one or more cellular types or cellular states. Hence, the presence or levels of an AARS polypeptide or polynucleotide can be used to distinguish between different cellular types or different cellular states. The presence or levels of AARS protein fragments or their related polynucleotides can be detected according to polynucleotide and/or polypeptide-based diagnostic techniques, as described herein and known in the art.

[0275] Certain aspects can employ the AARS protein fragments, antibody, or AARS polynucleotides as part of a companion diagnostic method, typically to assess whether a subject or population subjects will respond favorably to a specific medical treatment. For instance, a given AARS therapeutic agent (e.g., protein fragment, antisense, RNAi, antibody, binding agent) could be identified as suitable for a subject or certain populations of subjects based on whether the subject(s) have one or more selected biomarkers for a given disease or condition. Examples of biomarkers include serum/tissue markers as well as markers that can be identified by medical imaging techniques. In certain embodiments, a naturally-occurring AARS protein fragment (or its corresponding polynucleotide) may itself provide a serum and/or tissue biomarker that can be utilized to measure drug outcome or assess the desirability of drug use in a specific subject or a specific population of subjects. In certain aspects, the identification of an AARS polypeptide or polynucleotide reference sequence may include characterizing the differential expression of that sequence, whether in a selected subject, selected tissue, or otherwise, as described herein and known in the art.

[0276] Certain of the methods provided herein rely on the differential expression of an AARS polypeptide or polynucleotide to characterize the condition or state of a cell, tissue, or subject, and to distinguish it from another cell, tissue, or subject. Non-limiting examples include methods of detecting the presence or levels of an AARS polypeptide or polynucleotide in a biological sample to distinguish between cells or tissues of different species, cells of different tissues or organs, cellular developmental states such as neonatal and adult, cellular differentiation states, conditions such as healthy, diseased and treated, intracellular and extracellular fractions, in addition to primary cell cultures and other cell cultures, such as immortalized cell cultures.

[0277] Differential expression includes a statistically significant difference in one or more gene expression levels of an AARS polynucleotide or polypeptide reference sequence compared to the expression levels of the same sequence in an appropriate control. The statistically significant difference may relate to either an increase or a decrease in expression levels, as measured by RNA levels, protein levels, protein function, or any other relevant measure of gene expression such as those described herein. Also included is a comparison between an AARS polynucleotide or polypeptide of the invention and a full-length or wild-type cytosolic or mitochondrial AARS sequence, typically of the same or corresponding type. Differential expression can be detected by a variety of techniques in the art and described herein, including polynucleotide and polypeptide based techniques, such as real-time PCR, subtractive hybridization, polynucleotide and polypeptide arrays, and others.

[0278] A result is typically referred to as statistically significant if it is unlikely to have occurred by chance. The significance level of a test or result relates traditionally to a frequentist statistical hypothesis testing concept. In simple cases, statistical significance may be defined as the probability of making a decision to reject the null hypothesis when the null hypothesis is actually true (a decision known as a Type I error, or "false positive determination"). This decision is often made using the p-value: if the p-value is less than the significance level, then the null hypothesis is rejected. The smaller the p-value, the more significant the result. Bayes factors may also be utilized to determine statistical significance (see, e.g., Goodman S., Ann Intern Med 130:1005-13, 1999).

[0279] In more complicated, but practically important cases, the significance level of a test or result may reflect an analysis in which the probability of making a decision to reject the null hypothesis when the null hypothesis is actually true is no more than the stated probability. This type of analysis allows for those applications in which the probability of deciding to reject may be much smaller than the significance level for some sets of assumptions encompassed within the null hypothesis.

[0280] In certain exemplary embodiments, statistically significant differential expression may include situations wherein the expression level of a given AARS sequence provides at least about a 1.2.times., 1.3.times., 1.4.times., 1.5.times., 1.6.times., 1.7.times., 1.8.times., 1.9.times.. 2.0.times.., 2.2.times., 2.4.times., 2.6.times., 2,8.times., 3.0.times., 4.0.times., 5.0.times., 6.0.times., 7.0.times., 8.0.times., 9.0.times., 10.0.times., 15.0.times., 20.0.times., 50.0.times., 100.0.times., or greater difference in expression (i.e., differential expression that may be higher or lower expression) in a suspected biological sample as compared to an appropriate control, including all integers and decimal points in between (e.g., 1.24.times., 1.25.times., 2.1.times., 2.5.times., 60.0.times., 75.0.times., etc.). In certain embodiments, statistically significant differential expression may include situations wherein the expression level of a given AARS sequence provides at least about 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000 percent (%) or greater difference in expression (i.e., differential expression that may be higher or lower) in a suspected biological sample as compared to an appropriate control, including all integers and decimal points in between.

[0281] As an additional example, differential expression may also be determined by performing Z-testing, i.e., calculating an absolute Z score, as described herein and known in the art (see Example 1). Z-testing is typically utilized to identify significant differences between a sample mean and a population mean. For example, as compared to a standard normal table (e.g., a control tissue), at a 95% confidence interval (i.e., at the 5% significance level), a Z-score with an absolute value greater than 1.96 indicates non-randomness. For a 99% confidence interval, if the absolute Z is greater than 2.58, it means that p<0.01, and the difference is even more significant--the null hypothesis can be rejected with greater confidence. In these and related embodiments, an absolute Z-score of 1.96, 2, 2.58, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more, including all decimal points in between (e.g., 10.1, 10.6, 11.2, etc.), may provide a strong measure of statistical significance. In certain embodiments, an absolute Z-score of greater than 6 may provide exceptionally high statistical significance.

[0282] Substantial similarly relates generally to the lack of a statistically significant difference in the expression levels between the biological sample and the reference control. Examples of substantially similar expression levels may include situations wherein the expression level of a given SSCIGS provides less than about a 0.05.times., 0.1.times., 0.2.times., 0.3.times., 0.4.times., 0.5.times., 0.6.times., 0.7.times., 0.8.times., 0.9.times.. 1.0.times.., 1.1.times., 1.2.times., 1.3.times., or 1.4.times. difference in expression (i.e., differential expression that may be higher or lower expression) in a suspected biological sample as compared to a reference sample, including all decimal points in between (e.g., 0.15.times., 0.25.times., 0.35.times., etc.). In certain embodiments, differential expression may include situations wherein the expression level of a given AARS sequence provides less than about 0.25, 0.5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 30, 40, 50 percent (%) difference in expression (i.e., differential expression that may be higher or lower) in a suspected biological sample as compared to a reference sample, including all decimal points in between.

[0283] In certain embodiments, such as when using an Affymetrix Microarray to measure the expression levels of an AARS polynucleotide or polypeptide reference sequence, differential expression may also be determined by the mean expression value summarized by Affymetrix Microarray Suite 5 software (Affymetrix, Santa Clara, Calif.), or other similar software, typically with a scaled mean expression value of 1000.

[0284] Embodiments of the present invention include methods of detecting the presence or levels of an AARS polynucleotide or polypeptide reference sequence or a portion thereof to distinguish between cells or tissues or other biological sample of a different organism or species, wherein the presence or levels of that sequence associates with a selected organism or species. General examples include methods of distinguishing between humans and any combination of bacteria, fungi, plants, and other non-human animals. Included within animals are methods of distinguishing between humans and any combination of vertebrates and invertebrates, including vertebrates such as fish, amphibians, reptiles, birds, and non-human mammals, and invertebrates such as insects, mollusks, crustaceans, and corals. Included within non-human mammals are methods of distinguishing between humans and any combination of non-human mammals from the Order Afrosoricida, Macroscelidea, Tubulidentata, Hyracoidea, Proboscidea, Sirenia, Cingulata, Pilosa, Scandentia, Dermoptera, Primates, Rodentia, Lagomorpha, Erinaceomorpha, Soricomorpha, Chiroptera, Pholidota, Cetacea, Carnivora, Perissodactyla, or Artiodactyla. Included within the Primate Order are monkeys, apes, gorillas, and chimpanzees, among others known in the art. Accordingly, the presence or levels of an AARS polynucleotide or polypeptide reference sequence or variant, as described herein, may be used to identify the source of a given biological sample, such as a cell, tissue, or organ, by distinguishing between any combination of these organisms, or by distinguishing between humans and any one or more of these organisms, such as a panel of organisms. In certain embodiments, the source of a given biological sample may also be determined by comparing the presence or levels of an AARS sequence or a portion thereof to a pre-determined value.

[0285] Embodiments of the present invention include methods of detecting the presence or levels of an AARS polynucleotide or polypeptide reference sequence or a portion thereof to distinguish between cells or other biological samples that originate from different tissues or organs. Non-limiting examples include methods of distinguishing between a cell or other biological sample that originates from any combination of skin (e.g., dermis, epidermis, subcutaneous layer), hair follicles, nervous system (e.g., brain, spinal cord, peripheral nerves), auditory system or balance organs (e.g., inner ear, middle ear, outer ear), respiratory system (e.g., nose, trachea, lungs), gastroesophogeal tissues, the gastrointestinal system (e.g., mouth, esophagus, stomach, small intestines, large intestines, rectum), vascular system (e.g., heart, blood vessels and arteries), liver, gallbladder, lymphatic/immune system (e.g., lymph nodes, lymphoid follicles, spleen, thymus, bone marrow), uro-genital system (e.g., kidneys, ureter, bladder, urethra, cervix, Fallopian tubes, ovaries, uterus, vulva, prostate, bulbourethral glands, epidiymis, prostate, seminal vesicles, testicles), musculoskeletal system (e.g., skeletal muscles, smooth muscles, bone, cartilage, tendons, ligaments), adipose tissue, mammaries, and the endocrine system (e.g., hypothalamus, pituitary, thyroid, pancreas, adrenal glands). Hence, based on the association of an AARS polynucleotide or polypeptide sequence as described herein, these methods may be used to identify or characterize the tissue or organ from which a cell or other biological sample is derived.

[0286] Embodiments of the present invention include methods of detecting the presence or levels of an AARS polynucleotide or polypeptide reference sequence or a portion thereof to distinguish between or characterize the developmental or differentiation state of the cell. Also included are methods of differentiating between germ cells, stem cells, and somatic cells. Examples of developmental states include neonatal and adult. Examples of cellular differentiation states include all of the discreet and identifiable stages between a totipotent cell, a pluripotent cell, a multipotent progenitor stem cell and a mature, fully differentiated cell.

[0287] A totipotent cell has total potential, typically arises during sexual and asexual reproduction, and includes and spores and zygotes, though in certain instances cells can dedifferentiate and regain totipotency. A pluripotent cell includes a stem cell that has the potential to differentiate into any of the three germ layers, including the endoderm (interior stomach lining, gastrointestinal tract, the lungs), the mesoderm (muscle, bone, blood, urogenital), and the ectoderm (epidermal tissues and nervous system). Multipotent progenitor cells are typically capable of differentiating into a limited number of tissue types. Examples of multipotent cells include, without limitation, hematopoietic stem cells (adult stem cells) from the bone marrow that give rise to immune cells such as red blood cells, white blood cells, and platelets, mesenchymal stem cells (adult stem cells) from the bone marrow that give rise to stromal cells, fat cells, and various types of bone cells, epithelial stem cells (progenitor cells) that give rise to the various types of skin cells, and muscle satellite cells (progenitor cells) that contribute to differentiated muscle tissue. Accordingly, the presence or levels of particular AARS polynucleotide or polypeptide sequence (e.g., splice junction of an AARS splice variant, AARS proteolytic fragment), can be used to distinguish between or characterize the above-noted cellular differentiation states, as compared to a control or a predetermined level.

[0288] Embodiments of the present invention include methods of detecting the presence or levels of an AARS polynucleotide or polypeptide reference sequence to characterize or diagnose the condition or a cell, tissue, organ, or subject, in which that condition may be characterized as healthy, diseased, at risk for being diseased, or treated. For such diagnostic purposes, the term "diagnostic" or "diagnosed" includes identifying the presence or nature of a pathologic condition, characterizing the risk of developing such a condition, and/or measuring the change (or no change) of a pathologic condition in response to therapy. Diagnostic methods may differ in their sensitivity and specificity. In certain embodiments, the "sensitivity" of a diagnostic assay refers to the percentage of diseased cells, tissues or subjects which test positive (percent of "true positives"). Diseased cells, tissues or subjects not detected by the assay are typically referred to as "false negatives." Cells, tissues or subjects that are not diseased and which test negative in the assay may be termed "true negatives." In certain embodiments, the "specificity" of a diagnostic assay may be defined as one (1) minus the false positive rate, where the "false positive" rate is defined as the proportion of those samples or subjects without the disease and which test positive. While a particular diagnostic method may not provide a definitive diagnosis of a condition, it suffices if the method provides a positive indication that aids in diagnosis.

[0289] In certain instances, the presence or risk of developing a pathologic condition can be diagnosed by comparing the presence or levels of one or more selected AARS polynucleotide or polypeptide reference sequences or portions thereof that correlate with the condition, whether by increased or decreased levels, as compared to a suitable control. A "suitable control" or "appropriate control" includes a value, level, feature, characteristic, or property determined in a cell or other biological sample of a tissue or organism, e.g., a control or normal cell, tissue or organism, exhibiting, for example, normal traits, such as the absence of the condition. In certain embodiments, a "suitable control" or "appropriate control" is a predefined value, level, feature, characteristic, or property. Other suitable controls will be apparent to persons skilled in the art. Examples of diseases and conditions are described elsewhere herein.

[0290] Embodiments of the present invention include AARS polynucleotide or nucleic acid-based detection techniques, which offer certain advantages due to sensitivity of detection. Hence, certain embodiments relate to the use or detection of AARS polynucleotides as part of a diagnostic method or assay. The presence and/or levels of AARS polynucleotides may be measured by any method known in the art, including hybridization assays such as Northern blot, quantitative or qualitative polymerase chain reaction (PCR), quantitative or qualitative reverse transcriptase PCR (RT-PCR), microarray, dot or slot blots, or in situ hybridization such as fluorescent in situ hybridization (FISH), among others. Certain of these methods are described in greater detail below.

[0291] AARS polynucleotides such as DNA and RNA can be collected and/or generated from blood, biological fluids, tissues, organs, cell lines, or other relevant sample using techniques known in the art, such as those described in Kingston. (2002 Current Protocols in Molecular Biology, Greene Publ. Assoc. Inc. & John Wiley & Sons, Inc., NY, NY (see, e.g., as described by Nelson et al. Proc Natl Acad Sci USA, 99: 11890-11895, 2002) and elsewhere. Further, a variety of commercially available kits for constructing RNA are useful for making the RNA to be used in the present invention. RNA may be constructed from organs/tissues/cells procured from normal healthy subjects; however, this invention also contemplates construction of RNA from diseased subjects. Certain embodiments contemplate using any type of organ from any type of subject or animal. For test samples RNA may be procured from an individual (e.g., any animal, including mammals) with or without visible disease and from tissue samples, biological fluids (e.g., whole blood) or the like.

[0292] In certain embodiments, amplification or construction of cDNA sequences may be helpful to increase detection capabilities. The instant disclosure, as well as the art, provides the requisite level of detail to perform such tasks. In one exemplary embodiment, whole blood is used as the source of RNA and accordingly, RNA stabilizing reagents are optionally used, such as PAX tubes, as described, for example, in Thach et al., J. Immunol. Methods. December 283(1-2):269-279, 2003 and Chai et al., J. Clin. Lab Anal. 19(5):182-188, 2005 (both of which are incorporated by reference). Complementary DNA (cDNA) libraries can be generated using techniques known in the art, such as those described in Ausubel et al. (2001 Current Protocols in Molecular Biology, Greene Publ. Assoc. Inc. & John Wiley & Sons, Inc., NY, NY); Sambrook et al. (1989 Molecular Cloning, Second Ed., Cold Spring Harbor Laboratory, Plainview, N.Y.); Maniatis et al. (1982 Molecular Cloning, Cold Spring Harbor Laboratory, Plainview, N.Y.) and elsewhere. Further, a variety of commercially available kits for constructing cDNA libraries are useful for making the cDNA libraries of the present invention. Libraries can be constructed from organs/tissues/cells procured from normal, healthy subjects.

[0293] Certain embodiments may employ hybridization methods for detecting AARS polynucleotide sequences. Methods for conducting polynucleotide hybridization assays have been well developed in the art. Hybridization assay procedures and conditions will vary depending on the application and are selected in accordance with the general binding methods known including those referred to in: Maniatis et al. Molecular Cloning: A Laboratory Manual (2nd Ed. Cold Spring Harbor, N.Y., 1989); Berger and Kimmel Methods in Enzymology, Vol. 152, Guide to Molecular Cloning Techniques (Academic Press, Inc., San Diego, Calif., 1987); Young and Davis, PNAS. 80: 1194 (1983). Methods and apparatus for carrying out repeated and controlled hybridization reactions have been described in U.S. Pat. Nos. 5,871,928, 5,874,219, 6,045,996 and 6,386,749, 6,391,623 each of which are incorporated herein by reference

[0294] Certain embodiments may employ nucleic acid amplification methods for detecting AARS polynucleotide sequences. The term "amplification" or "nucleic acid amplification" refers to the production of multiple copies of a target nucleic acid that contains at least a portion of the intended specific target nucleic acid sequence. The multiple copies may be referred to as amplicons or amplification products. In certain embodiments, the amplified target contains less than the complete target gene sequence (introns and exons) or an expressed target gene sequence (spliced transcript of exons and flanking untranslated sequences). For example, specific amplicons may be produced by amplifying a portion of the target polynucleotide by using amplification primers that hybridize to, and initiate polymerization from, internal positions of the target polynucleotide. Preferably, the amplified portion contains a detectable target sequence that may be detected using any of a variety of well-known methods.

[0295] "Selective amplification" or "specific amplification," as used herein, refers to the amplification of a target nucleic acid sequence according to the present invention wherein detectable amplification of the target sequence is substantially limited to amplification of target sequence contributed by a nucleic acid sample of interest that is being tested and is not contributed by target nucleic acid sequence contributed by some other sample source, e.g., contamination present in reagents used during amplification reactions or in the environment in which amplification reactions are performed.

[0296] The term "amplification conditions" refers to conditions permitting nucleic acid amplification according to the present invention. Amplification conditions may, in some embodiments, be less stringent than "stringent hybridization conditions" as described herein. Oligonucleotides used in the amplification reactions of the present invention hybridize to their intended targets under amplification conditions, but may or may not hybridize under stringent hybridization conditions. On the other hand, detection probes of the present invention typically hybridize under stringent hybridization conditions. Acceptable conditions to carry out nucleic acid amplifications according to the present invention can be easily ascertained by someone having ordinary skill in the art depending on the particular method of amplification employed.

[0297] Many well-known methods of nucleic acid amplification require thermocycling to alternately denature double-stranded nucleic acids and hybridize primers; however, other well-known methods of nucleic acid amplification are isothermal. The polymerase chain reaction (U.S. Pat. Nos. 4,683,195; 4,683,202; 4,800,159; 4,965,188), commonly referred to as PCR, uses multiple cycles of denaturation, annealing of primer pairs to opposite strands, and primer extension to exponentially increase copy numbers of the target sequence. In a variation called RT-PCR, reverse transcriptase (RT) is used to make a complementary DNA (cDNA) from mRNA, and the cDNA is then amplified by PCR to produce multiple copies of DNA.

[0298] As noted above, the term "PCR" refers to multiple amplification cycles that selectively amplify a target nucleic acid species. Included are quantitative PCR (qPCR), real-time PCR), reverse transcription PCR (RT-PCR) and quantitative reverse transcription PCR (qRT-PCR) is well described in the art. The term "pPCR" refers to quantitative polymerase chain reaction, and the term "qRT-PCR" refers to quantitative reverse transcription polymerase chain reaction. qPCR and qRT-PCR may be used to amplify and simultaneously quantify a targeted cDNA molecule. It enables both detection and quantification of a specific sequence in a cDNA pool, such as a selected AARS gene or transcript.

[0299] The term "real-time PCR" may use DNA-binding dye to bind to all double-stranded (ds) DNA in PCR, causing fluorescence of the dye. An increase in DNA product during PCR therefore leads to an increase in fluorescence intensity and is measured at each cycle, thus allowing DNA concentrations to be quantified. However, dsDNA dyes such as SYBR Green will bind to all dsDNA PCR products. Fluorescence is detected and measured in the real-time PCR thermocycler, and its geometric increase corresponding to exponential increase of the product is used to determine the threshold cycle ("Ct") in each reaction.

[0300] The term "Ct Score" refers to the threshold cycle number, which is the cycle at which PCR amplification has surpassed a threshold level. If there is a higher quantity of mRNA for a particular gene in a sample, it will cross the threshold earlier than a lowly expressed gene since there is more starting RNA to amplify. Therefore, a low Ct score indicates high gene expression in a sample and a high Ct score is indicative of low gene expression.

[0301] Certain embodiments may employ the ligase chain reaction (Weiss, Science. 254: 1292, 1991), commonly referred to as LCR, which uses two sets of complementary DNA oligonucleotides that hybridize to adjacent regions of the target nucleic acid. The DNA oligonucleotides are covalently linked by a DNA ligase in repeated cycles of thermal denaturation, hybridization and ligation to produce a detectable double-stranded ligated oligonucleotide product.

[0302] Another method is strand displacement amplification (Walker, G. et al., 1992, Proc. Natl. Acad. Sci. USA 89:392-396; U.S. Pat. Nos. 5,270,184 and 5,455,166), commonly referred to as SDA, which uses cycles of annealing pairs of primer sequences to opposite strands of a target sequence, primer extension in the presence of a dNTPaS to produce a duplex hemiphosphorothioated primer extension product, endonuclease-mediated nicking of a hemimodified restriction endonuclease recognition site, and polymerase-mediated primer extension from the 3' end of the nick to displace an existing strand and produce a strand for the next round of primer annealing, nicking and strand displacement, resulting in geometric amplification of product. Thermophilic SDA (tSDA) uses thermophilic endonucleases and polymerases at higher temperatures in essentially the same method (European Pat. No. 0 684 315).

[0303] Other amplification methods include, for example: nucleic acid sequence based amplification (U.S. Pat. No. 5,130,238), commonly referred to as NASBA; one that uses an RNA replicase to amplify the probe molecule itself (Lizardi, P. et al., 1988, BioTechnol. 6: 1197-1202), commonly referred to as Q.beta. replicase; a transcription based amplification method (Kwoh, D. et al., 1989, Proc. Natl. Acad. Sci. USA 86:1173-1177); self-sustained sequence replication (Guatelli, J. et al., 1990, Proc. Natl. Acad. Sci. USA 87: 1874-1878); and, transcription mediated amplification (U.S. Pat. Nos. 5,480,784 and 5,399,491), commonly referred to as TMA. For further discussion of known amplification methods see Persing, David H., 1993, "In Vitro Nucleic Acid Amplification Techniques" in Diagnostic Medical Microbiology: Principles and Applications (Persing et al., Eds.), pp. 51-87 (American Society for Microbiology, Washington, D.C.).

[0304] Illustrative transcription-based amplification systems of the present invention include TMA, which employs an RNA polymerase to produce multiple RNA transcripts of a target region (U.S. Pat. Nos. 5,480,784 and 5,399,491). TMA uses a "promoter-primer" that hybridizes to a target nucleic acid in the presence of a reverse transcriptase and an RNA polymerase to form a double-stranded promoter from which the RNA polymerase produces RNA transcripts. These transcripts can become templates for further rounds of TMA in the presence of a second primer capable of hybridizing to the RNA transcripts. Unlike PCR, LCR or other methods that require heat denaturation, TMA is an isothermal method that uses an RNase H activity to digest the RNA strand of an RNA:DNA hybrid, thereby making the DNA strand available for hybridization with a primer or promoter-primer. Generally, the RNase H activity associated with the reverse transcriptase provided for amplification is used.

[0305] In an illustrative TMA method, one amplification primer is an oligonucleotide promoter-primer that comprises a promoter sequence which becomes functional when double-stranded, located 5' of a target-binding sequence, which is capable of hybridizing to a binding site of a target RNA at a location 3' to the sequence to be amplified. A promoter-primer may be referred to as a "T7-primer" when it is specific for T7 RNA polymerase recognition. Under certain circumstances, the 3' end of a promoter-primer, or a subpopulation of such promoter-primers, may be modified to block or reduce primer extension. From an unmodified promoter-primer, reverse transcriptase creates a cDNA copy of the target RNA, while RNase H activity degrades the target RNA. A second amplification primer then binds to the cDNA. This primer may be referred to as a "non-T7 primer" to distinguish it from a "T7-primer." From this second amplification primer, reverse transcriptase creates another DNA strand, resulting in a double-stranded DNA with a functional promoter at one end. When double-stranded, the promoter sequence is capable of binding an RNA polymerase to begin transcription of the target sequence to which the promoter-primer is hybridized. An RNA polymerase uses this promoter sequence to produce multiple RNA transcripts (i.e., amplicons), generally about 100 to 1,000 copies. Each newly-synthesized amplicon can anneal with the second amplification primer. Reverse transcriptase can then create a DNA copy, while the RNase H activity degrades the RNA of this RNA:DNA duplex. The promoter-primer can then bind to the newly synthesized DNA, allowing the reverse transcriptase to create a double-stranded DNA, from which the RNA polymerase produces multiple amplicons. Thus, a billion-fold isothermic amplification can be achieved using two amplification primers.

[0306] In certain embodiments, other techniques may be used to evaluate RNA transcripts of the transcripts from a particular cDNA library, including microarray analysis (Han, M., et al., Nat Biotechnol, 19: 631-635, 2001; Bao, P., et al., Anal Chem, 74: 1792-1797, 2002; Schena et al., Proc. Natl. Acad. Sci. USA 93:10614-19, 1996; and Heller et al., Proc. Natl. Acad. Sci. USA 94:2150-55, 1997) and SAGE (serial analysis of gene expression). Like MPSS, SAGE is digital and can generate a large number of signature sequences. (see e.g., Velculescu, V. E., et al., Trends Genet, 16: 423-425., 2000; Tuteja R. and Tuteja N. Bioessays. 2004 Aug.; 26(8):916-22), although orders of magnitude fewer than that are available from techniques such as MPSS.

[0307] In certain embodiments, the term "microarray" includes a "nucleic acid microarray" having a substrate-bound plurality of nucleic acids, hybridization to each of the plurality of bound nucleic acids being separately detectable. The substrate can be solid or porous, planar or non-planar, unitary or distributed. Nucleic acid microarrays include all the devices so called in Schena (ed.), DNA Microarrays: A Practical Approach (Practical Approach Series), Oxford University Press (1999); Nature Genet. 21(1) (suppl.): 1-60 (1999); Schena (ed.), Microarray Biochip: Tools and Technology, Eaton Publishing Company/BioTechniques Books Division (2000). Nucleic acid microarrays may include a substrate-bound plurality of nucleic acids in which the plurality of nucleic acids are disposed on a plurality of beads, rather than on a unitary planar substrate, as described, for example, in Brenner et al., Proc. Natl. Acad. Sci. USA 97(4): 1665-1670 (2000). Examples of nucleic acid microarrays may be found in U.S. Pat. Nos. 6,391,623, 6,383,754, 6,383,749, 6,380,377, 6,379,897, 6,376,191, 6,372,431, 6,351,712 6,344,316, 6,316,193, 6,312,906, 6,309,828, 6,309,824, 6,306,643, 6,300,063, 6,287,850, 6,284,497, 6,284,465, 6,280,954, 6,262,216, 6,251,601, 6,245,518, 6,263,287, 6,251,601, 6,238,866, 6,228,575, 6,214,587, 6,203,989, 6,171,797, 6,103,474, 6,083,726, 6,054,274, 6,040,138, 6,083,726, 6,004,755, 6,001,309, 5,958,342, 5,952,180, 5,936,731, 5,843,655, 5,814,454, 5,837,196, 5,436,327, 5,412,087, and 5,405,783, the disclosures of which are incorporated by reference.

[0308] Additional examples include nucleic acid arrays that are commercially available from Affymetrix (Santa Clara, Calif.) under the brand name GENECHIP.TM.. Further exemplary methods of manufacturing and using arrays are provided in, for example, U.S. Pat. Nos. 7,028,629; 7,011,949; 7,011,945; 6,936,419; 6,927,032; 6,924,103; 6,921,642; and 6,818,394.

[0309] The present invention as related to arrays and microarrays also contemplates many uses for polymers attached to solid substrates. These uses include gene expression monitoring, profiling, library screening, genotyping and diagnostics. Gene expression monitoring and profiling methods and methods useful for gene expression monitoring and profiling are shown in U.S. Pat. Nos. 5,800,992, 6,013,449, 6,020,135, 6,033,860, 6,040,138, 6,177,248 and 6,309,822. Genotyping and uses therefore are shown in U.S. Ser. Nos. 10/442,021, 10/013,598 (U.S. Application No. 2003/0036069), and U.S. Pat. Nos. 5,925,525, 6,268,141, 5,856,092, 6,267,152, 6,300,063, 6,525,185, 6,632,611, 5,858,659, 6,284,460, 6,361,947, 6,368,799, 6,673,579 and 6,333,179. Other methods of nucleic acid amplification, labeling and analysis that may be used in combination with the methods disclosed herein are embodied in U.S. Pat. Nos. 5,871,928, 5,902,723, 6,045,996, 5,541,061, and 6,197,506.

[0310] As will be apparent to persons skilled in the art, certain embodiments may employ oligonucleotides, such as primers or probes, for amplification or detection, as described herein. Oligonucleotides of a defined sequence and chemical structure may be produced by techniques known to those of ordinary skill in the art, such as by chemical or biochemical synthesis, and by in vitro or in vivo expression from recombinant nucleic acid molecules, e.g., bacterial or viral vectors. In certain embodiments, an oligonucleotide does not consist solely of wild-type chromosomal DNA or the in vivo transcription products thereof.

[0311] Oligonucleotides or primers may be modified in any way, as long as a given modification is compatible with the desired function of a given oligonucleotide. One of ordinary skill in the art can easily determine whether a given modification is suitable or desired for any given oligonucleotide of the present invention. Relevant AARS oligonucleotides are described in greater detail elsewhere herein.

[0312] While the design and sequence of oligonucleotides depends on their function as described herein, several variables are generally taken into account. Among the most relevant are: length, melting temperature (Tm), specificity, complementarity with other oligonucleotides in the system, G/C content, polypyrimidine (T, C) or polypurine (A, G) stretches, and the 3'-end sequence. Controlling for these and other variables is a standard and well known aspect of oligonucleotide design, and various computer programs are readily available to screen large numbers of potential oligonucleotides for optimal ones.

[0313] Certain embodiments therefore include methods for detecting a target AARS polynucleotide in a sample, the polynucleotide comprising the sequence of a reference AARS polynucleotide, as described herein, comprising a) hybridizing the sample with a probe comprising a sequence complementary to the target polynucleotide in the sample, and which probe specifically hybridizes to said target polynucleotide, under conditions whereby a hybridization complex is formed between said probe and said target polynucleotide or fragments thereof, and b) detecting the presence or absence of said hybridization complex, and optionally, if present, the amount thereof. Also included are methods for detecting a target AARS polynucleotide in a sample, the polynucleotide comprising the sequence of a reference AARS polynucleotide, as described herein, comprising a) amplifying the target polynucleotide or fragment thereof, and b) detecting the presence or absence of said amplified target polynucleotide or fragment thereof, and, optionally, if present, the amount thereof. Specific embodiments relate to the detection of AARS splice variants, such as by detecting a unique splice junction of the splice variant, whether by hybridization, amplification, or other detection method.

[0314] Embodiments of the present invention include a variety of AARS polypeptide-based detection techniques, including antibody-based detection techniques. Included in these embodiments are the use of AARS polypeptides to generate antibodies or other binders, which may then be used in diagnostic methods and compositions to detect or quantitate selected AARS polypeptides in a cell or other biological sample, typically from a subject.

[0315] Certain embodiments may employ standard methodologies and detectors such as western blotting and immunoprecipitation, enzyme-linked immunosorbent assays (ELISA), flow cytometry, and immunofluorescence assays (IFA), which utilize an imaging device. These well-known methods typically utilize one or more monoclonal or polyclonal antibodies as described herein that specifically bind to a selected AARS polypeptide of the invention, or a unique region of that AARS polypeptide, and generally do not bind significantly to other AARS polypeptides, such as a full-length AARS polypeptide. In certain embodiments, the unique region of the AARS polypeptide may represent a unique three-dimensional structure that is possessed by a newly identified protein fragment of an AARS.

[0316] Certain embodiments may employ "arrays," such as "microarrays." In certain embodiments, a "microarray" may also refer to a "peptide microarray" or "protein microarray" having a substrate-bound collection or plurality of polypeptides, the binding to each of the plurality of bound polypeptides being separately detectable. Alternatively, the peptide microarray may have a plurality of binders, including but not limited to monoclonal antibodies, polyclonal antibodies, phage display binders, yeast 2 hybrid binders, and aptamers, which can specifically detect the binding of the AARS polypeptides described herein. The array may be based on autoantibody detection of these AARS polypeptides, as described, for example, in Robinson et al., Nature Medicine 8(3):295-301 (2002). Examples of peptide arrays may be found in WO 02/31463, WO 02/25288, WO 01/94946, WO 01/88162, WO 01/68671, WO 01/57259, WO 00/61806, WO 00/54046, WO 00/47774, WO 99/40434, WO 99/39210, and WO 97/42507 and U.S. Pat. Nos. 6,268,210, 5,766,960, and 5,143,854, each of which are incorporated by reference.

[0317] Certain embodiments may employ MS or other molecular weight-based methods for diagnostically detecting AARS polypeptide sequences. Mass spectrometry (MS) refers generally to an analytical technique for determining the elemental composition of a sample or molecule. MS may also be used for determining the chemical structures of molecules, such as peptides and other chemical compounds.

[0318] Generally, the MS principle consists of ionizing chemical compounds to generate charged molecules or molecule fragments, and then measuring their mass-to-charge ratios. In an illustrative MS procedure: a sample is loaded onto the MS instrument, and undergoes vaporization, the components of the sample are ionized by one of a variety of methods (e.g., by impacting them with an electron beam), which results in the formation of positively charged particles, the positive ions are then accelerated by a magnetic field, computations are performed on the mass-to-charge ratio (m/z) of the particles based on the details of motion of the ions as they transit through electromagnetic fields, and, detection of the ions, which in step prior were sorted according to m/z.

[0319] An illustrative MS instruments has three modules: an ion source, which converts gas phase sample molecules into ions (or, in the case of electrospray ionization, move ions that exist in solution into the gas phase); a mass analyzer, which sorts the ions by their masses by applying electromagnetic fields; and a detector, which measures the value of an indicator quantity and thus provides data for calculating the abundances of each ion present.

[0320] The MS technique has both qualitative and quantitative uses, including identifying unknown compounds, determining the isotopic composition of elements in a molecule, and determining the structure of a compound by observing its fragmentation. Other uses include quantifying the amount of a compound in a sample or studying the fundamentals of gas phase ion chemistry (the chemistry of ions and neutrals in a vacuum). Included are gas chromatography-mass spectrometry (GC/MS or GC-MS), liquid chromatography mass spectrometry (LC/MS or LC-MS), and ion mobility spectrometry/mass spectrometry (IMS/MS or IMMS) Accordingly, MS techniques may be used according to any of the methods provided herein to measure the presence or levels of an AARS polypeptide of the invention in a biological sample, and to compare those levels to a control sample or a pre-determined value.

[0321] Certain embodiments may employ cell-sorting or cell visualization or imaging devices/techniques to detect or quantitate the presence or levels of AARS polynucleotides or polypeptides. Examples include flow cytometry or FACS, immunofluorescence analysis (IFA), and in situ hybridization techniques, such as fluorescent in situ hybridization (FISH).

[0322] Certain embodiments may employ conventional biology methods, software and systems for diagnostic purposes. Computer software products of the invention typically include computer readable medium having computer-executable instructions for performing the logic steps of the method of the invention. Suitable computer readable medium include floppy disk, CD-ROM/DVD/DVD-ROM, hard-disk drive, flash memory, ROM/RAM, magnetic tapes and etc. The computer executable instructions may be written in a suitable computer language or combination of several languages. Basic computational biology methods are described in, for example Setubal and Meidanis et al., Introduction to Computational Biology Methods (PWS Publishing Company, Boston, 1997); Salzberg, Searles, Kasif, (Ed.), Computational Methods in Molecular Biology, (Elsevier, Amsterdam, 1998); Rashidi and Buehler, Bioinformatics Basics: Application in Biological Science and Medicine (CRC Press, London, 2000) and Ouelette and Bzevanis Bioinformatics: A Practical Guide for Analysis of Gene and Proteins (Wiley & Sons, Inc., 2nd ed., 2001). See U.S. Pat. No. 6,420,108.

[0323] Certain embodiments may employ various computer program products and software for a variety of purposes, such as probe design, management of data, analysis, and instrument operation. See, U.S. Pat. Nos. 5,593,839, 5,795,716, 5,733,729, 5,974,164, 6,066,454, 6,090,555, 6,185,561, 6,188,783, 6,223,127, 6,229,911 and 6,308,170.

[0324] The whole genome sampling assay (WGSA) is described, for example in Kennedy et al., Nat. Biotech. 21, 1233-1237 (2003), Matsuzaki et al., Gen. Res. 14: 414-425, (2004), and Matsuzaki, et al., Nature Methods 1:109-111 (2004). Algorithms for use with mapping assays are described, for example, in Liu et al., Bioinformatics. 19: 2397-2403 (2003) and Di et al. Bioinformatics. 21:1958 (2005). Additional methods related to WGSA and arrays useful for WGSA and applications of WGSA are disclosed, for example, in U.S. Patent Application Nos. 60/676,058 filed Apr. 29, 2005, 60/616,273 filed Oct. 5, 2004, Ser. No. 10/912,445, 11/044,831, 10/442,021, 10/650,332 and 10/463,991. Genome wide association studies using mapping assays are described in, for example, Hu et al., Cancer Res.; 65(7):2542-6 (2005), Mitra et al., Cancer Res., 64(21):8116-25 (2004), Butcher et al., Hum Mol Genet., 14(10):1315-25 (2005), and Klein et al., Science. 308(5720):385-9 (2005).

[0325] Additionally, certain embodiments may include methods for providing genetic information over networks such as the Internet as shown, for example, in U.S. application Ser. Nos. 10/197,621, 10/063,559 (United States Publication Number 2002/0183936), 10/065,856, 10/065,868, 10/328,818, 10/328,872, 10/423,403, and 60/482,389.

X. Antisense and RNAi Agents

[0326] Embodiments of the present invention also include antisense oligonucleotides and RNAi agents that target the AARS polynucleotide sequences, and methods of use thereof to reduce expression of a selected AARS transcript and/or protein fragment. Certain embodiments relate to targeting one or more splice junctions (often unique) that generate a splice variant, AARS protein fragment of instant invention. Also included are methods of antisense or RNAi inhibition that target certain splice forms, either to encourage or discourage splicing of a selected protein fragment. In certain preferred embodiments, the splice junctions that generate the AARS protein fragments are over-expressed with respect to particular tissues, and are unique to that splice variant. In these and related embodiments, such splice variants are not the only source of cytosolic AARS activity in the targeted cell type. For instance, certain splice variants to be targeted may represent about 10% to 50% of the total copy number of the AARS RNA splice variants in a given cell or tissue, and preferably about 1-10% of the total copy number of the AARS RNA splice variants in a given cell or tissue. Splice variants that are about <1% of the total copy number of the AARS RNA splice variants in a given cell or tissue may also be targeted.

[0327] In certain embodiments, the antisense or RNAi agent does not target the full-length protein, because such full-length proteins are responsible for a key step in protein synthesis, and thereby avoids lethality that often results from wild-type AARS knockouts. Certain of the methods described herein can therefore by used to avoid undesired effects such as toxicities in both chronic and acute treatments, and to selectively modulate the non-canonical activities of the AARS protein fragment. However, certain embodiments may generically target AARS sequences, including full-length AARS sequences, such as to kill or substantially derange the cell physiology of a target cell or tissue.

[0328] In certain embodiments, the AARS splice variant to be targeted possesses a non-canonical biological activity. In some embodiments, the AARS splice variant has reduced or undetectable canonical AARS activity, and the antisense or RNAi-related method more specifically modulates its non-canonical activity. In certain embodiments, the antisense or RNAi-related agents can be combined with a targeted or local delivery approach to lessen systemic undesired effects to non-targeted cells or tissues. Among others described herein, exemplary cells or tissues that could be targeted this way include cancer cells, and cells to tissues that lend themselves to localized targeting, such as tumors or epithelia via topical application.

[0329] A. Antisense Agents

[0330] The terms "antisense oligomer" or "antisense compound" or "antisense oligonucleotide" are used interchangeably and refer to a sequence of cyclic subunits, each bearing a base-pairing moiety, linked by intersubunit linkages that allow the base-pairing moieties to hybridize to a target sequence in a nucleic acid (typically an RNA) by Watson-Crick base pairing, to form a nucleic acid:oligomer heteroduplex within the target sequence, and typically thereby prevent translation of that RNA. Also included are methods of use thereof to modulate expression of a selected AARS transcript, such as a splice variant or proteolytic fragment, and/or its corresponding polypeptide.

[0331] Antisense oligonucleotides may contain between about 8 and 40 subunits, typically about 8-25 subunits, and preferably about 12 to 25 subunits. In certain embodiments, oligonucleotides may have exact sequence complementarity to the target sequence or near complementarity, as defined below. In certain embodiments, the degree of complementarity between the target and antisense targeting sequence is sufficient to form a stable duplex. The region of complementarity of the antisense oligomers with the target RNA sequence may be as short as 8-11 bases, but is preferably 12-15 bases or more, e.g., 12-20 bases, or 12-25 bases, including all integers in between these ranges. An antisense oligomer of about 14-15 bases is generally long enough to have a unique complementary sequence in targeting the selected AARS gene. In certain embodiments, a minimum length of complementary bases may be required to achieve the requisite binding Tm, as discussed herein.

[0332] In certain embodiments, antisense oligomers as long as 40 bases may be suitable, where at least a minimum number of bases, e.g., 10-12 bases, are complementary to the target sequence. In general, however, facilitated or active uptake in cells is optimized at oligomer lengths less than about 30. For certain oligomers, described further below, an optimum balance of binding stability and uptake generally occurs at lengths of 18-25 bases. Included are antisense oligomers (e.g., PNAs, LNAs, 2'-OMe, MOE) that consist of about 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, or 40 bases, in which at least about 6, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, or 40 contiguous or non-contiguous bases are complementary to their AARS target sequence, or variants thereof.

[0333] In certain embodiments, antisense oligomers may be 100% complementary to an AARS nucleic acid target sequence, or it may include mismatches, e.g., to accommodate variants, as long as a heteroduplex formed between the oligomer and AARS nucleic acid target sequence is sufficiently stable to withstand the action of cellular nucleases and other modes of degradation which may occur in vivo. The term "target sequence" refers to a portion of the target RNA against which the oligonucleotide is directed, that is, the sequence to which the oligonucleotide will hybridize by Watson-Crick base pairing of a complementary sequence. In certain embodiments, the target sequence may be a contiguous region of an AARS mRNA (e.g., a unique splice junction of an AARS mRNA), or may be composed of non-contiguous regions of the mRNA.

[0334] Oligomer backbones which are less susceptible to cleavage by nucleases are discussed below. Mismatches, if present, are less destabilizing toward the end regions of the hybrid duplex than in the middle. The number of mismatches allowed will depend on the length of the oligomer, the percentage of G:C base pairs in the duplex, and the position of the mismatch(es) in the duplex, according to well understood principles of duplex stability. Although such an antisense oligomer is not necessarily 100% complementary to the AARS nucleic acid target sequence, it is effective to stably and specifically bind to the target sequence, such that a biological activity of the nucleic acid target, e.g., expression of AARS protein(s), is modulated.

[0335] The stability of the duplex formed between an oligomer and a target sequence is a function of the binding Tm and the susceptibility of the duplex to cellular enzymatic cleavage. The Tm of an antisense oligonucleotide with respect to complementary-sequence RNA may be measured by conventional methods, such as those described by Hames et al., Nucleic Acid Hybridization, IRL Press, 1985, pp. 107-108 or as described in Miyada C. G. and Wallace R. B., 1987, Oligonucleotide hybridization techniques, Methods Enzymol. Vol. 154 pp. 94-107. In certain embodiments, antisense oligomer may have a binding Tm, with respect to a complementary-sequence RNA, of greater than body temperature and preferably greater than 50.degree. C. Tm's in the range 60-80.degree. C. or greater are preferred. According to well known principles, the Tm of an oligomer compound, with respect to a complementary-based RNA hybrid, can be increased by increasing the ratio of C:G paired bases in the duplex, and/or by increasing the length (in base pairs) of the heteroduplex. At the same time, for purposes of optimizing cellular uptake, it may be advantageous to limit the size of the antisense oligomer. For this reason, compounds that show high Tm (50.degree. C. or greater) at a length of 25 bases or less are generally preferred over those requiring greater than 25 bases for high Tm values.

[0336] Antisense oligomers can be designed to block or inhibit translation of mRNA or to inhibit natural pre-mRNA splice processing, or induce degradation of targeted mRNAs, and may be said to be "directed to" or "targeted against" a target sequence with which it hybridizes. In certain embodiments, the target sequence may include any coding or non-coding sequence of an AARS mRNA transcript, and may thus by within an exon or within an intron. In certain embodiments, the target sequence is relatively unique or exceptional among AARSs (e.g., a full-length AARS) and is selective for reducing expression of a selected AARS protein fragment, such as a proteolytic fragment or splice variant. In certain embodiments, the target site includes a 3' or 5' splice site of a pre-processed mRNA, or a branch point. The target sequence for a splice site may include an mRNA sequence having its 5' end 1 to about 25 to about 50 base pairs downstream of a splice acceptor junction or upstream of a splice donor junction in a preprocessed mRNA. In certain embodiments, a target sequence may include a splice junction of an alternatively splice AARS mRNA, such as a splice junction that does not occur in the full-length AARS, or is unique or exceptional to that transcript, in that it either does not occur or only seldom occurs in other AARS splice variants. An oligomer is more generally said to be "targeted against" a biologically relevant target, such as reference AARS polynucleotide, when it is targeted against the nucleic acid of the target in the manner described herein.

[0337] An oligonucleotide is typically complementary to a target sequence, such as a target DNA or RNA. The terms "complementary" and "complementarity" refer to polynucleotides (i.e., a sequence of nucleotides) related by the base-pairing rules. For example, the sequence "A-G-T," is complementary to the sequence "T-C-A." Complementarity may be "partial," in which only some of the nucleic acids' bases are matched according to the base pairing rules. Or, there may be "complete" or "total" complementarity (100%) between the nucleic acids. The degree of complementarity between nucleic acid strands has significant effects on the efficiency and strength of hybridization between nucleic acid strands. While perfect complementarity is often desired, some embodiments can include one or more but preferably 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 mismatches with respect to the target sequence. Variations at any location within the oligomer are included. In certain embodiments, variations in sequence near the termini of an oligomer are generally preferable to variations in the interior, and if present are typically within about 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 nucleotides of the 5' and/or 3' terminus.

[0338] The term "targeting sequence" or in certain embodiments "antisense targeting sequence" refers to the sequence in an oligonucleotide that is complementary (meaning, in addition, substantially complementary) to the target sequence in the DNA or RNA target molecule. The entire sequence, or only a portion, of the antisense compound may be complementary to the target sequence. For example, in an oligonucleotide having 20-30 bases, about 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, or 29 may be targeting sequences that are complementary to the target region. Typically, the targeting sequence is formed of contiguous bases, but may alternatively be formed of non-contiguous sequences that when placed together, e.g., from opposite ends of the oligonucleotide, constitute sequence that spans the target sequence.

[0339] Target and targeting sequences are described as "complementary" to one another when hybridization occurs in an antiparallel configuration. A targeting sequence may have "near" or "substantial" complementarity to the target sequence and still function for the purpose of the present invention, that is, it may still be functionally "complementary." In certain embodiments, an oligonucleotide may have at most one mismatch with the target sequence out of 10 nucleotides, and preferably at most one mismatch out of 20. Alternatively, an oligonucleotide may have at least about 80%, 85%, 90% sequence homology, and preferably at least 95% sequence homology, with an AARS reference polynucleotide sequence described herein, or its complement.

[0340] An oligonucleotide "specifically hybridizes" to a target polynucleotide if the oligomer hybridizes to a target (e.g., an AARS reference polynucleotide or its complement) under physiological conditions, with a Tm substantially greater than 45.degree. C., preferably at least 50.degree. C., and typically 60.degree. C.-80.degree. C. or higher. Such hybridization preferably corresponds to stringent hybridization conditions. At a given ionic strength and pH, the Tm is the temperature at which 50% of a target sequence hybridizes to a complementary polynucleotide. Again, such hybridization may occur with "near" or "substantial" complementarity of the antisense oligomer to the target sequence, as well as with exact complementarity.

[0341] The terms specifically binds or specifically hybridizes refer generally to an oligonucleotide probe or polynucleotide sequence that not only binds to its intended target gene sequence in a sample under selected hybridization conditions, but does not bind significantly to other target sequences in the sample, and thereby discriminates between its intended target and all other targets in the target pool. A probe that specifically hybridizes to its intended target sequence may also detect concentration differences under the selected hybridization conditions, as described herein.

[0342] A "nuclease-resistant" oligomeric molecule (oligomer) refers to one whose backbone is substantially resistant to nuclease cleavage, in non-hybridized or hybridized form; by common extracellular and intracellular nucleases in the body; that is, the oligomer shows little or no nuclease cleavage under normal nuclease conditions in the body to which the oligomer is exposed.

[0343] A "heteroduplex" refers to a duplex between an oligonucleotide and the complementary portion of a target polynucleotide, such as a target DNA or RNA. A "nuclease-resistant heteroduplex" refers to a heteroduplex formed by the binding of an oligomer to its complementary target, such that the heteroduplex is substantially resistant to in vivo degradation by intracellular and extracellular nucleases, such as RNaseH, which are capable of cutting double-stranded RNA/RNA or RNA/DNA complexes.

[0344] A "subunit" of an oligonucleotide refers to one nucleotide (or nucleotide analog) unit. The term may refer to the nucleotide unit with or without the attached intersubunit linkage, although, when referring to a "charged subunit", the charge typically resides within the intersubunit linkage (e.g., a phosphate or phosphorothioate linkage or a cationic linkage).

[0345] The cyclic subunits of an oligonucleotide may be based on ribose or another pentose sugar or, in certain embodiments, alternate or modified groups. Examples of modified oligonucleotide backbones include, without limitation, phosphorothioates, chiral phosphorothioates, phosphorodithioates, phosphotriesters, aminoalkylphosphotriesters, methyl and other alkyl phosphonates including 3'-alkylene phosphonates and chiral phosphonates, phosphinates, phosphoramidates including 3'-amino phosphoramidate and aminoalkylphosphoramidates, thionophosphoramidates, thionoalkylphosphonates, thionoalkylphosphotriesters, and boranophosphates having normal 3'-5' linkages, 2'-5' linked analogs of these, and those having inverted polarity wherein the adjacent pairs of nucleoside units are linked 3'-5' to 5'-3' or 2'-5' to 5'-2'. Also contemplated are peptide nucleic acids (PNAs), locked nucleic acids (LNAs), 2'-O-Methyl oligonucleotides (2'-OMe), 2'-methoxyethoxy oligonucleotides (MOE), among other oligonucleotides known in the art.

[0346] The purine or pyrimidine base pairing moiety is typically adenine, cytosine, guanine, uracil, thymine or inosine. Also included are bases such as pyridin-4-one, pyridin-2-one, phenyl, pseudouracil, 2,4,6-trimel 15thoxy benzene, 3-methyl uracil, dihydrouridine, naphthyl, aminophenyl, 5-alkylcytidines (e.g., 5-methylcytidine), 5-alkyluridines (e.g., ribothymidine), 5-halouridine (e.g., 5-bromouridine) or 6-azapyrimidines or 6-alkylpyrimidines (e.g. 6-methyluridine), propyne, quesosine, 2-thiouridine, 4-thiouridine, wybutosine, wybutoxosine, 4-acetyltidine, 5-(carboxyhydroxymethyl)uridine, 5'-carboxymethylaminomethyl-2-thiouridine, 5-carboxymethylaminomethyluridine, .beta.-D-galactosylqueosine, 1-methyladenosine, 1-methylinosine, 2,2-dimethylguanosine, 3-methylcytidine, 2-methyladenosine, 2-methylguanosine, N6-methyladenosine, 7-methylguanosine, 5-methoxyaminomethyl-2-thiouridine, 5-methylaminomethyluridine, 5-methylcarbonyhnethyluridine, 5-methyloxyuridine, 5-methyl-2-thiouridine, 2-methylthio-N6-isopentenyladenosine, .beta.-D-mannosylqueosine, uridine-5-oxyacetic acid, 2-thiocytidine, threonine derivatives and others (Burgin et al., 1996, Biochemistry, 35, 14090; Uhlman & Peyman, supra). By "modified bases" in this aspect is meant nucleotide bases other than adenine (A), guanine (G), cytosine (C), thymine (T), and uracil (U), as illustrated above; such bases can be used at any position in the antisense molecule. Persons skilled in the art will appreciate that depending on the uses of the oligomers, Ts and Us are interchangeable. For instance, with other antisense chemistries such as 2'-O-methyl antisense oligonucleotides that are more RNA-like, the T bases may be shown as U.

[0347] As noted above, certain oligonucleotides provided herein include peptide nucleic acids (PNAs). Peptide nucleic acids (PNAs) are analogs of DNA in which the backbone is structurally homomorphous with a deoxyribose backbone, consisting of N-(2-aminoethyl) glycine units to which pyrimidine or purine bases are attached. PNAs containing natural pyrimidine and purine bases hybridize to complementary oligonucleotides obeying Watson-Crick base-pairing rules, and mimic DNA in terms of base pair recognition (Egholm, Buchardt et al. 1993). The backbone of PNAs is formed by peptide bonds rather than phosphodiester bonds, making them well-suited for antisense applications (see structure below). The backbone is uncharged, resulting in PNA/DNA or PNA/RNA duplexes that exhibit greater than normal thermal stability. PNAs are not recognized by nucleases or proteases.

[0348] PNAs may be produced synthetically using any technique known in the art. PNA is a DNA analog in which a polyamide backbone replaces the traditional phosphate ribose ring of DNA. Despite a radical structural change to the natural structure, PNA is capable of sequence-specific binding in a helix form to DNA or RNA. Characteristics of PNA include a high binding affinity to complementary DNA or RNA, a destabilizing effect caused by single-base mismatch, resistance to nucleases and proteases, hybridization with DNA or RNA independent of salt concentration and triplex formation with homopurine DNA. Panagene.TM. has developed its proprietary Bts PNA monomers (Bts; benzothiazole-2-sulfonyl group) and proprietary oligomerisation process. The PNA oligomerisation using Bts PNA monomers is composed of repetitive cycles of deprotection, coupling and capping. Panagene's patents to this technology include U.S. Pat. Nos. 6,969,766, 7,211,668, 7,022,851, 7,125,994, 7,145,006 and 7,179,896. Representative United States patents that teach the preparation of PNA compounds include, but are not limited to, U.S. Pat. Nos. 5,539,082; 5,714,331; and 5,719,262, each of which is herein incorporated by reference. Further teaching of PNA compounds can be found in Nielsen et al., Science, 1991, 254, 1497.

[0349] Also included are "locked nucleic acid" subunits (LNAs). The structures of LNAs are known in the art: for example, Wengel, et al., Chemical Communications (1998) 455; Tetrahedron (1998) 54, 3607, and Accounts of Chem. Research (1999) 32, 301); Obika, et al., Tetrahedron Letters (1997) 38, 8735; (1998) 39, 5401, and Bioorganic Medicinal Chemistry (2008)16, 9230.

[0350] Oligonucleotides may incorporate one or more LNAs; in some cases, the compounds may be entirely composed of LNAs. Methods for the synthesis of individual LNA nucleoside subunits and their incorporation into oligonucleotides are known in the art: U.S. Pat. Nos. 7,572,582; 7,569,575; 7,084,125; 7,060,809; 7,053,207; 7,034,133; 6,794,499; and 6,670,461. Typical intersubunit linkers include phosphodiester and phosphorothioate moieties; alternatively, non-phosphorous containing linkers may be employed. A preferred embodiment is an LNA containing compound where each LNA subunit is separated by a DNA subunit (i.e., a deoxyribose nucleotide). Further preferred compounds are composed of alternating LNA and DNA subunits where the intersubunit linker is phosphorothioate.

[0351] Certain oligonucleotides may comprise morpholino-based subunits bearing base-pairing moieties, joined by uncharged or substantially uncharged linkages. The terms "morpholino oligomer" or "PMO" (phosphoramidate- or phosphorodiamidate morpholino oligomer) refer to an oligonucleotide analog composed of morpholino subunit structures, where (i) the structures are linked together by phosphorus-containing linkages, one to three atoms long, preferably two atoms long, and preferably uncharged or cationic, joining the morpholino nitrogen of one subunit to a 5' exocyclic carbon of an adjacent subunit, and (ii) each morpholino ring bears a purine or pyrimidine or an equivalent base-pairing moiety effective to bind, by base specific hydrogen bonding, to a base in a polynucleotide.

[0352] Variations can be made to this linkage as long as they do not interfere with binding or activity. For example, the oxygen attached to phosphorus may be substituted with sulfur (thiophosphorodiamidate). The 5' oxygen may be substituted with amino or lower alkyl substituted amino. The pendant nitrogen attached to phosphorus may be unsubstituted, monosubstituted, or disubstituted with (optionally substituted) lower alkyl. The purine or pyrimidine base pairing moiety is typically adenine, cytosine, guanine, uracil, thymine or inosine. The synthesis, structures, and binding characteristics of morpholino oligomers are detailed in U.S. Pat. Nos. 5,698,685, 5,217,866, 5,142,047, 5,034,506, 5,166,315, 5,521,063, and 5,506,337, and PCT Appn. Nos. PCT/US07/11435 (cationic linkages) and U.S. Ser. No. 08/012,804 (improved synthesis), all of which are incorporated herein by reference.

[0353] The morpholino subunits may also be linked by non-phosphorus-based intersubunit linkages, as described further below, where at least one linkage is modified with a pendant cationic group as described above. Other oligonucleotide analog linkages which are uncharged in their unmodified state but which could also bear a pendant amine substituent could be used. For example, a 5'nitrogen atom on a morpholino ring could be employed in a sulfamide linkage or a urea linkage (where phosphorus is replaced with carbon or sulfur, respectively) and modified in a manner analogous to the 5'-nitrogen atom in structure (b3) above

[0354] Certain embodiments include substantially uncharged morpholino oligomers, such as a substantially uncharged phosphorodiamidate-linked morpholino oligomer. A substantially uncharged, phosphorus containing backbone in an oligonucleotide analog is one in which a majority of the subunit linkages, e.g., between 50-100%, typically at least 60% to 100% or 75% or 80% of its linkages, are uncharged at physiological pH, and contain a single phosphorous atom. Examples of morpholino oligonucleotides having phosphorus-containing backbone linkages include phosphoroamidate and phosphorodiamidate-linked morpholino oligonucleotides. Certain embodiments may contain positively charged groups at preferably about 10%-50% of their backbone linkages.

[0355] Properties of the morpholino-based subunits include, for example, the ability to be linked in a oligomeric form by stable, uncharged or positively charged backbone linkages, the ability to support a nucleotide base (e.g., adenine, cytosine, guanine, thymidine, uracil and hypoxanthine) such that the polymer formed can hybridize with a complementary-base target nucleic acid, including target RNA, Tm values above about 45.degree. C. in relatively short oligonucleotides (e.g., 10-15 bases), the ability of the oligonucleotide to be actively or passively transported into mammalian cells, and the ability of the antisense oligonucleotide:RNA heteroduplex to resist RNase and RNaseH degradation, respectively.

[0356] In certain embodiments, a substantially uncharged oligonucleotide may be modified to include charged linkages, e.g., up to about 1 per every 2-5 uncharged linkages, such as about 4-5 per every 10 uncharged linkages. In certain embodiments, optimal improvement in antisense activity may be seen when about 25% of the backbone linkages are cationic. In certain embodiments, enhancement may be seen with a small number e.g., 10-20% cationic linkages, or where the number of cationic linkages are in the range 50-80%, such as about 60%. In certain embodiments the cationic backbone charges may be further enhanced by distributing the bulk of the charges close of the "center-region" backbone linkages of the antisense oligonucleotide, e.g., in a 20-mer oligonucleotide with 8 cationic backbone linkages, having at least 70% of these charged linkages localized in the 10 centermost linkages.

[0357] Oligonucleotides that target one or more portions of an AARS polynucleotide reference sequence or its complement may be used in any of the therapeutic, diagnostic, or drug screening methods described herein and apparent to persons skilled in the art.

[0358] B. RNA Interference Agents

[0359] Certain embodiments relate to RNA interference (RNAi) agents that target one or more mRNA transcripts of an aminoacyl-tRNA synthetase (AARS) reference polynucleotide, including fragments and splice variants thereof. Also included are methods of use thereof to modulate the levels of a selected AARS transcript, such as an AARS splice variant or endogenous proteolytic fragment.

[0360] The term "double-stranded" means two separate nucleic acid strands comprising a region in which at least a portion of the strands are sufficiently complementary to hydrogen bond and form a duplex structure. The term "duplex" or "duplex structure" refers to the region of a double stranded molecule wherein the two separate strands are substantially complementary, and thus hybridize to each other. "dsRNA" refers to a ribonucleic acid molecule having a duplex structure comprising two complementary and anti-parallel nucleic acid strands (i.e., the sense and antisense strands). Not all nucleotides of a dsRNA must exhibit Watson-Crick base pairs; the two RNA strands may be substantially complementary. The RNA strands may have the same or a different number of nucleotides.

[0361] In certain embodiments, a dsRNA is or includes a region which is at least partially complementary to the target RNA. In certain embodiments, the dsRNA is fully complementary to the target RNA. It is not necessary that there be perfect complementarity between the dsRNA and the target, but the correspondence must be sufficient to enable the dsRNA, or a cleavage product thereof, to direct sequence specific silencing, such as by RNAi cleavage of the target RNA. Complementarity, or degree of homology with the target strand, is typically most critical in the antisense strand. While perfect complementarity, particularly in the antisense strand, is often desired some embodiments can include one or more but preferably 6, 5, 4, 3, 2, or fewer mismatches with respect to the target RNA. The mismatches are most tolerated in the terminal regions, and if present are preferably in a terminal region or regions, e.g., within 6, 5, 4, or 3 nucleotides of the 5' and/or 3' terminus. The sense strand need only be substantially complementary with the antisense strand to maintain the overall double-strand character of the molecule.

[0362] As used herein, "modified dsRNA" refers to a dsRNA molecule that comprises at least one alteration that renders it more resistant to nucleases (e.g., protein kinase) than an identical dsRNA molecule that recognizes the same target RNA. Modified dsRNAs may include a single-stranded nucleotide overhang and/or at least one substituted nucleotide.

[0363] As used herein, a "nucleotide overhang" refers to the unpaired nucleotide or nucleotides that protrude from the duplex structure when a 3'-end of one RNA strand extends beyond the 5'-end of the other complementary strand, or vice versa. "Blunt" or "blunt end" means that there are no unpaired nucleotides at that end of the dsRNA, i.e., no nucleotide overhang. A "blunt ended" dsRNA is a dsRNA that is double stranded over its entire length, i.e., no nucleotide overhang at either end of the molecule.

[0364] The term "terminal base pair," as used herein, refers to the last nucleotide base pair on one end of the duplex region of a double-stranded molecule. For example, if a dsRNA or other molecule is blunt ended (i.e., has no nucleotide overhangs), the last nucleotide base pairs at both ends of the molecule are terminal base pairs. Where a dsRNA or other molecule has a nucleotide overhang at one or both ends of the duplex structure, the last nucleotide base pair(s) immediately adjacent the nucleotide overhang(s) is the terminal base pair at that end(s) of the molecule.

[0365] In certain embodiments, the methods provided herein may utilize double-stranded ribonucleic acid (dsRNA) molecules as modulating agents, for reducing expression of an AARS transcript such as a selected fragment or splice variant. dsRNAs generally comprise two single strands. One strand of the dsRNA comprises a nucleotide sequence that is substantially identical to a portion of the target gene or target region (the "sense" strand), and the other strand (the "complementary" or "antisense" strand) comprises a sequence that is substantially complementary to a portion of the target region. The strands are sufficiently complementary to hybridize to form a duplex structure. In certain embodiments, the complementary RNA strand may be less than 30 nucleotides, less than 25 nucleotides in length, or even 19 to 24 nucleotides in length. In certain aspects, the complementary nucleotide sequence may be 20-23 nucleotides in length, or 22 nucleotides in length.

[0366] In certain embodiments, at least one of the RNA strands comprises a nucleotide overhang of 1 to 4 nucleotides in length. In other embodiments, the dsRNA may further comprise at least one chemically modified nucleotide. In certain aspects, a dsRNA comprising a single-stranded overhang of 1 to 4 nucleotides may comprise a molecule wherein the unpaired nucleotide of the single-stranded overhang that is directly adjacent to the terminal nucleotide pair contains a purine base. In other aspects, the last complementary nucleotide pairs on both ends of a dsRNA are a G-C pair, or, at least two of the last four terminal nucleotide pairs are G-C pairs.

[0367] Certain embodiments of the present invention may comprise microRNAs. Micro-RNAs represent a large group of small RNAs produced naturally in organisms, some of which regulate the expression of target genes. Micro-RNAs are formed from an approximately 70 nucleotide single-stranded hairpin precursor transcript by Dicer. (V. Ambros et al. Current Biology 13:807, 2003). Certain micro-RNAs may be transcribed as hairpin RNA precursors, which are then processed to their mature forms by Dicer enzyme.

[0368] Certain embodiments may also employ short-interfering RNAs (siRNA). In certain embodiments, the first strand of the double-stranded oligonucleotide contains two more nucleoside residues than the second strand. In other embodiments, the first strand and the second strand have the same number of nucleosides; however, the first and second strands may be offset such that the two terminal nucleosides on the first and second strands are not paired with a residue on the complimentary strand. In certain instances, the two nucleosides that are not paired are thymidine resides.

[0369] Also included are short hairpin RNAs (shRNAs) and micro RNAs (miRNAs). A double-stranded structure of an shRNA is formed by a single self-complementary RNA strand, and RNA duplex formation may be initiated either inside or outside the cell. MicroRNAs (miRNAs) are small non-coding RNAs of 20-22 nucleotides, typically excised from -70 nucleotide foldback RNA precursor structures known as pre-miRNAs.

[0370] In instances when the modulating agent comprises siRNA, the agent should include a region of sufficient homology to the target region, and be of sufficient length in terms of nucleotides, such that the siRNA agent, or a fragment thereof, can mediate down regulation of the target RNA. It will be understood that the term "ribonucleotide" or "nucleotide" can, in the case of a modified RNA or nucleotide surrogate, also refer to a modified nucleotide, or surrogate replacement moiety at one or more positions. Thus, an siRNA agent is or includes a region which is at least partially complementary to the target RNA, as described herein.

[0371] In addition, an siRNA modulating agent may be modified or include nucleoside surrogates. Single stranded regions of an siRNA agent may be modified or include nucleoside surrogates, e.g., the unpaired region or regions of a hairpin structure, e.g., a region which links two complementary regions, can have modifications or nucleoside surrogates. Modification to stabilize one or more 3'- or 5'-terminus of an siRNA agent, e.g., against exonucleases, or to favor the antisense siRNA agent to enter into RISC are also useful. Modifications can include C3 (or C6, C7, C12) amino linkers, thiol linkers, carboxyl linkers, non-nucleotidic spacers (C3, C6, C9, C12, abasic, triethylene glycol, hexaethylene glycol), special biotin or fluorescein reagents that come as phosphoramidites and that have another DMT-protected hydroxyl group, allowing multiple couplings during RNA synthesis.

[0372] siRNA agents may include, for example, molecules that are long enough to trigger the interferon response (which can be cleaved by Dicer (Bernstein et al. 2001. Nature, 409:363-366) and enter a RISC (RNAi-induced silencing complex)), in addition to molecules which are sufficiently short that they do not trigger the interferon response (which molecules can also be cleaved by Dicer and/or enter a RISC), e.g., molecules which are of a size which allows entry into a RISC, e.g., molecules which resemble Dicer-cleavage products. An siRNA modulating agent, or a cleavage product thereof, can down regulate a target gene, e.g., by inducing RNAi with respect to a target RNA, preferably an AARS target such as a selected splice variant.

[0373] Each strand of an siRNA agent can be equal to or less than 35, 30, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, or 15 nucleotides in length. The strand is preferably at least 19 nucleotides in length. For example, each strand can be between 21 and 25 nucleotides in length. Preferred siRNA agents have a duplex region of 17, 18, 19, 29, 21, 22, 23, 24, or 25 nucleotide pairs, and one or more overhangs, preferably one or two 3' overhangs, of 2-3 nucleotides.

[0374] In addition to homology to target RNA and the ability to down regulate a target gene, an siRNA agent may have one or more of the following properties: it may, despite modifications, even to a very large number, or all of the nucleosides, have an antisense strand that can present bases (or modified bases) in the proper three dimensional framework so as to be able to form correct base pairing and form a duplex structure with a homologous target RNA which is sufficient to allow down regulation of the target, e.g., by cleavage of the target RNA; it may, despite modifications, even to a very large number, or all of the nucleosides, still have "RNA-like" properties, i.e., it may possess the overall structural, chemical and physical properties of an RNA molecule, even though not exclusively, or even partly, of ribonucleotide-based content. For example, an siRNA agent can contain, e.g., a sense and/or an antisense strand in which all of the nucleotide sugars contain e.g., 2' fluoro in place of 2' hydroxyl. This deoxyribonucleotide-containing agent can still be expected to exhibit RNA-like properties. While not wishing to be bound by theory, the electronegative fluorine prefers an axial orientation when attached to the C2' position of ribose. This spatial preference of fluorine can, in turn, force the sugars to adopt a C3'-endo pucker. This is the same puckering mode as observed in RNA molecules and gives rise to the RNA-characteristic A-family-type helix. Further, since fluorine is a good hydrogen bond acceptor, it can participate in the same hydrogen bonding interactions with water molecules that are known to stabilize RNA structures. Generally, it is preferred that a modified moiety at the 2' sugar position will be able to enter into H-bonding which is more characteristic of the OH moiety of a ribonucleotide than the H moiety of a deoxyribonucleotide.

[0375] A "single strand RNAi agent" as used herein, is an RNAi agent which is made up of a single molecule. It may include a duplexed region, formed by intra-strand pairing, e.g., it may be, or include, a hairpin or pan-handle structure. Single strand RNAi modulating agents are preferably antisense with regard to the target molecule. A single strand RNAi agent should be sufficiently long that it can enter the RISC and participate in RISC mediated cleavage of a target mRNA. A single strand RNAi agent is at least 14, and more preferably at least 15, 20, 25, 29, 35, 40, or 50 nucleotides in length. It is preferably less than 200, 100, or 60 nucleotides in length.

[0376] Hairpin RNAi modulating agents may have a duplex region equal to or at least 17, 18, 19, 29, 21, 22, 23, 24, or 25 nucleotide pairs. The duplex region may preferably be equal to or less than 200, 100, or 50, in length. Certain ranges for the duplex region are 15-30, 17 to 23, 19 to 23, and 19 to 21 nucleotides pairs in length. The hairpin may have a single strand overhang or terminal unpaired region, preferably the 3', and preferably of the antisense side of the hairpin. In certain embodiments, overhangs are 2-3 nucleotides in length.

[0377] Certain modulating agents utilized according to the methods provided herein may comprise RNAi oligonucleotides such as chimeric oligonucleotides, or "chimeras," which contain two or more chemically distinct regions, each made up of at least one monomer unit, i.e., a nucleotide in the case of an oligonucleotide compound. These oligonucleotides typically contain at least one region wherein the oligonucleotide is modified so as to confer upon the oligonucleotide increased resistance to nuclease degradation, increased cellular uptake, and/or increased binding affinity for the target nucleic acid. Consequently, comparable results can often be obtained with shorter oligonucleotides when chimeric oligonucleotides are used, compared to phosphorothioate oligodeoxynucleotides. Chimeric oligonucleotides may be formed as composite structures of two or more oligonucleotides, modified oligonucleotides, oligonucleotides and/or oligonucleotide mimetics as described above. Such oligonucleotides have also been referred to in the art as hybrids or gapmers. Representative United States patents that teach the preparation of such hybrid structures include, but are not limited to, U.S. Pat. Nos. 5,013,830; 5,149,797; 5,220,007; 5,256,775; 5,366,878; 5,403,711; 5,491,133; 5,565,350; 5,623,065; 5,652,355; 5,652,356; 5,700,922; and 5,955,589, each of which is herein incorporated by reference. In certain embodiments, the chimeric oligonucleotide is RNA-DNA, DNA-RNA, RNA-DNA-RNA, DNA-RNA-DNA, or RNA-DNA-RNA-DNA, wherein the oligonucleotide is between 5 and 60 nucleotides in length.

[0378] In one aspect of the invention RNAi agents relate to an oligonucleotide comprising at least one ligand tethered to an altered or non-natural nucleobase. A large number of compounds can function as the altered base. The structure of the altered base is important to the extent that the altered base should not substantially prevent binding of the oligonucleotide to its target, e.g., mRNA. In certain embodiments, the altered base is difluorotolyl, nitropyrrolyl, nitroimidazolyl, nitroindolyl, napthalenyl, anthrancenyl, pyridinyl, quinolinyl, pyrenyl, or the divalent radical of any one of the non-natural nucleobases described herein. In certain embodiments, the non-natural nucleobase is difluorotolyl, nitropyrrolyl, or nitroimidazolyl. In certain embodiments, the non-natural nucleobase is difluorotolyl. A wide variety of ligands are known in the art and are amenable to the present invention. For example, the ligand can be a steroid, bile acid, lipid, folic acid, pyridoxal, B12, riboflavin, biotin, aromatic compound, polycyclic compound, crown ether, intercalator, cleaver molecule, protein-binding agent, or carbohydrate. In certain embodiments, the ligand is a steroid or aromatic compound. In certain instances, the ligand is cholesteryl.

[0379] In other embodiments, the RNAi agent is an oligonucleotide tethered to a ligand for the purposes of improving cellular targeting and uptake. For example, an RNAi agent may be tethered to an antibody, or antigen binding fragment thereof. As an additional example, an RNAi agent may be tethered to a specific ligand binding molecule, such as a polypeptide or polypeptide fragment that specifically binds a particular cell-surface receptor.

[0380] In other embodiments, the modulating agent comprises a non-natural nucleobase, as described herein. In certain instances, the ribose sugar moiety that naturally occurs in nucleosides is replaced with a hexose sugar. In certain aspects, the hexose sugar is an allose, altrose, glucose, mannose, gulose, idose, galactose, talose, or a derivative thereof. In a preferred embodiment, the hexose is a D-hexose. In certain instances, the ribose sugar moiety that naturally occurs in nucleosides is replaced with a polycyclic heteroalkyl ring or cyclohexenyl group. In certain instances, the polycyclic heteroalkyl group is a bicyclic ring containing one oxygen atom in the ring. In certain instances, the polycyclic heteroalkyl group is a bicyclo[2.2.1]heptane, a bicyclo[3.2.1]octane, or a bicyclo[3.3.1]nonane. Examples of modified RNAi agents also include oligonucleotides containing modified backbones or non-natural internucleoside linkages, as described herein.

[0381] The present invention further encompasses oligonucleotides employing ribozymes. Synthetic RNA molecules and derivatives thereof that catalyze highly specific endoribonuclease activities are known as ribozymes. (see, e.g., U.S. Pat. No. 5,543,508 to Haseloff et al., and U.S. Pat. No. 5,545,729 to Goodchild et al.) The cleavage reactions are catalyzed by the RNA molecules themselves. In naturally occurring RNA molecules, the sites of self-catalyzed cleavage are located within highly conserved regions of RNA secondary structure (Buzayan et al., Proc. Natl. Acad. Sci. U.S.A., 1986, 83, 8859; Forster et al., Cell, 1987, 50, 9). Naturally occurring autocatalytic RNA molecules have been modified to generate ribozymes which can be targeted to a particular cellular or pathogenic RNA molecule with a high degree of specificity. Thus, ribozymes serve the same general purpose as antisense oligonucleotides (i.e., modulation of expression of a specific gene) and, like oligonucleotides, are nucleic acids possessing significant portions of single-strandedness.

[0382] In certain instances, the RNAi agents or antisense oligonucleotides for use with the methods provided herein may be modified by non-ligand group. A number of non-ligand molecules have been conjugated to oligonucleotides in order to enhance the activity, cellular distribution, cellular targeting, or cellular uptake of the oligonucleotide, and procedures for performing such conjugations are available in the scientific literature. Such non-ligand moieties have included lipid moieties, such as cholesterol (Letsinger et al., Proc. Natl. Acad. Sci. USA, 1989, 86:6553), arginine-rich peptides, cholic acid (Manoharan et al., Bioorg. Med. Chem. Lett., 1994, 4:1053), a thioether, e.g., hexyl-5-tritylthiol (Manoharan et al., Ann. N.Y. Acad. Sci., 1992, 660:306; Manoharan et al., Bioorg. Med. Chem. Let., 1993, 3:2765), a thiocholesterol (Oberhauser et al., Nucl. Acids Res., 1992, 20:533), an aliphatic chain, e.g., dodecandiol or undecyl residues (Saison-Behmoaras et al., EMBO J., 1991, 10:111; Kabanov et al., FEBS Lett., 1990, 259:327; Svinarchuk et al., Biochimie, 1993, 75:49), a phospholipid, e.g., di-hexadecyl-rac-glycerol or triethylammonium 1,2-di-O-hexadecyl-rac-glycero-3-H-phosphonate (Manoharan et al., Tetrahedron Lett., 1995, 36:3651; Shea et al., Nucl. Acids Res., 1990, 18:3777), a polyamine or a polyethylene glycol chain (Manoharan et al., Nucleosides & Nucleotides, 1995, 14:969), or adamantane acetic acid (Manoharan et al., Tetrahedron Lett., 1995, 36:3651), a palmityl moiety (Mishra et al., Biochim. Biophys. Acta, 1995, 1264:229), or an octadecylamine or hexylamino-carbonyl-oxycholesterol moiety (Crooke et al., J. Pharmacol. Exp. Ther., 1996, 277:923). Representative United States patents that teach the preparation of such oligonucleotide conjugates have been listed above. Typical conjugation protocols involve the synthesis of oligonucleotides bearing an aminolinker at one or more positions of the sequence. The amino group is then reacted with the molecule being conjugated using appropriate coupling or activating reagents. The conjugation reaction may be performed either with the oligonucleotide still bound to the solid support or following cleavage of the oligonucleotide in solution phase. Purification of the oligonucleotide conjugate by HPLC typically affords the pure conjugate.

[0383] Additional examples of RNAi agents may be found in U.S. Application Publication Nos. 2007/0275465, 2007/0054279, 2006/0287260, 2006/0035254, 2006/0008822, which are incorporated by reference. Also included are vector delivery systems that are capable of expressing the AARS-targeting sequences described herein. Included are vectors that express siRNA or other duplex-forming RNA interference molecules.

[0384] A vector or nucleic acid construct system can comprise a single vector or plasmid, two or more vectors or plasmids, which together contain the total DNA to be introduced into the genome of the host cell, or a transposon. The choice of the vector will typically depend on the compatibility of the vector with the host cell into which the vector is to be introduced. In the present case, the vector or nucleic acid construct is preferably one which is operably functional in a mammalian cell, such as a muscle cell. The vector can also include a selection marker such as an antibiotic or drug resistance gene, or a reporter gene (i.e., green fluorescent protein, luciferase), that can be used for selection or identification of suitable transformants or transfectants. Exemplary delivery systems may include viral vector systems (i.e., viral-mediated transduction) including, but not limited to, retroviral (e.g., lentiviral) vectors, adenoviral vectors, adeno-associated viral vectors, and herpes viral vectors, among others known in the art.

XI. Drug Discovery

[0385] Certain embodiments relate to the use of AARS polypeptides, antibodies, or polynucleotides in drug discovery, typically to identify agents that modulate one or more of the non-canonical activities of the reference AARS polypeptide, e.g., the AARS protein fragment. For example, certain embodiments include methods of identifying one or more "cellular binding partners" of an AARS reference polypeptide, such as a cellular protein, lipid, nucleic acid or other host molecule that directly or physically interacts with the AARS polypeptide. Particular examples include for example cell-surface receptors, such as GPCRs, protein-protein interaction domains, and extracellular or intracellular domains thereof.

[0386] Also included are methods of identifying host molecules that participate in one or more non-canonical activities of the AARS polypeptide, including molecules that directly or indirectly interact with the cellular binding partner, and either regulate its role in a non-canonical activity, or are regulated by the binding partner. Such host molecules include both upstream and downstream components of the non-canonical pathway, typically related by about 1, 2, 3, 4, 5 or more identifiable steps in the pathway, relative to the cellular binding partner/AARS protein interaction.

[0387] Certain aspects include methods of identifying a compound (e.g., polypeptide) or other agent that agonizes or antagonizes the non-canonical activity of an AARS reference polypeptide or active variant thereof, such as by interacting with the AARS polypeptide and/or one or more of its cellular binding partners. Also included are methods of identifying agents that modulate the expression (e.g., splicing) of AARS splice variants, or modulate the activity of proteases that otherwise regulate the production of endogenous AARS protein fragments (resectins) at the protein level.

[0388] Certain embodiments therefore include methods of identifying a binding partner of an AARS reference polypeptide, comprising a) combining the AARS polypeptide with a biological sample under suitable conditions, and b) detecting specific binding of the AARS polypeptide to a binding partner, thereby identifying a binding partner that specifically binds to the AARS reference polypeptide. Also included are methods of screening for a compound that specifically binds to an AARS reference polypeptide or a binding partner of the AARS polypeptide, comprising a) combining the polypeptide or the binding partner with at least one test compound under suitable conditions, and b) detecting binding of the polypeptide or the binding partner to the test compound, thereby identifying a compound that specifically binds to the polypeptide or its binding partner. In certain embodiments, the compound is a polypeptide or peptide. In certain embodiments, the compound is a small molecule or other (e.g., non-biological) chemical compound. In certain embodiments, the compound is a peptide mimetic.

[0389] Any method suitable for detecting protein-protein interactions may be employed for identifying cellular proteins that interact with an AARS reference polypeptide, interact with one or more of its cellular binding partners, or both. Examples of traditional methods that may be employed include co-immunoprecipitation, cross-linking, and co-purification through gradients or chromatographic columns of cell lysates or proteins obtained from cell lysates, mainly to identify proteins in the lysate that interact with the AARS polypeptide.

[0390] In these and related embodiments, at least a portion of the amino acid sequence of a protein that interacts with an AARS polypeptide or its binding partner can be ascertained using techniques well known to those of skill in the art, such as via the Edman degradation technique. See, e.g., Creighton Proteins: Structures and Molecular Principles, W. H. Freeman & Co., N.Y., pp. 34 49, 1983. The amino acid sequence obtained may be used as a guide for the generation of oligonucleotide mixtures that can be used to screen for gene sequences encoding such proteins. Screening may be accomplished, for example, by standard hybridization or PCR techniques, as described herein and known in the art. Techniques for the generation of oligonucleotide mixtures and the screening are well known. See, e.g., Ausubel et al. Current Protocols in Molecular Biology Green Publishing Associates and Wiley Interscience, N.Y., 1989; and Innis et al., eds. PCR Protocols: A Guide to Methods and Applications Academic Press, Inc., New York, 1990.

[0391] Additionally, methods may be employed in the simultaneous identification of genes that encode the binding partner or other polypeptide. These methods include, for example, probing expression libraries, in a manner similar to the well known technique of antibody probing of lambda-gt11 libraries, using labeled AARS protein, or another polypeptide, peptide or fusion protein, e.g., a variant AARS polypeptide or AARS domain fused to a marker (e.g., an enzyme, fluor, luminescent protein, or dye), or an Ig-Fc domain.

[0392] One method that detects protein interactions in vivo, the two-hybrid system, is described in detail for illustration only and not by way of limitation. One example of this system has been described (Chien et al., PNAS USA 88:9578 9582, 1991) and is commercially available from Clontech (Palo Alto, Calif.).

[0393] Briefly, utilizing such a system, plasmids may be constructed that encode two hybrid proteins: one plasmid consists of nucleotides encoding the DNA-binding domain of a transcription activator protein fused to an AARS reference nucleotide sequence (or, in certain embodiments, its binding partner), or a variant thereof, and the other plasmid consists of nucleotides encoding the transcription activator protein's activation domain fused to a cDNA (or collection of cDNAs) encoding an unknown protein(s) that has been recombined into the plasmid as part of a cDNA library. The DNA-binding domain fusion plasmid and the activator cDNA library may be transformed into a strain of the yeast Saccharomyces cerevisiae that contains a reporter gene (e.g., HBS or lacZ) whose regulatory region contains the transcription activator's binding site. Either hybrid protein alone cannot activate transcription of the reporter gene: the DNA-binding domain hybrid cannot because it does not provide activation function and the activation domain hybrid cannot because it cannot localize to the activator's binding sites. Interaction of the two hybrid proteins reconstitutes the functional activator protein and results in expression of the reporter gene, which is detected by an assay for the reporter gene product.

[0394] The two-hybrid system or other such methodology may be used to screen activation domain libraries for proteins that interact with the "bait" gene product. By way of example, and not by way of limitation, an AARS reference polypeptide or variant may be used as the bait gene product. An AARS binding partner may also be used as a "bait" gene product. Total genomic or cDNA sequences are fused to the DNA encoding an activation domain. This library and a plasmid encoding a hybrid of a bait AARS gene product fused to the DNA-binding domain are co-transformed into a yeast reporter strain, and the resulting transformants are screened for those that express the reporter gene.

[0395] A cDNA library of the cell line from which proteins that interact with bait AARS gene products are to be detected can be made using methods routinely practiced in the art. For example, the cDNA fragments can be inserted into a vector such that they are translationally fused to the transcriptional activation domain of GAL4. This library can be co-transformed along with the bait gene-GAL4 fusion plasmid into a yeast strain, which contains a lacZ gene driven by a promoter that contains GAL4 activation sequence. A cDNA encoded protein, fused to GAL4 transcriptional activation domain, that interacts with bait gene product will reconstitute an active GAL4 protein and thereby drive expression of the HIS3 gene. Colonies, which express HIS3, can be detected by their growth on Petri dishes containing semi-solid agar based media lacking histidine. The cDNA can then be purified from these strains, and used to produce and isolate the bait AARS gene-interacting protein using techniques routinely practiced in the art.

[0396] Also included are three-hybrid systems, which allow the detection of RNA-protein interactions in yeast. See, e.g., Hook et al., RNA. 11:227-233, 2005. Accordingly, these and related methods can be used to identify a cellular binding partner of an AARS polypeptide, and to identify other proteins or nucleic acids that interact with the AARS polypeptide, the cellular binding partner, or both.

[0397] Certain embodiments relate to the use of interactome screening approaches. Particular examples include protein domain-based screening (see, e.g., Boxem et al., Cell. 134:534-545, 2008; and Yu et al., Science. 322:10-110, 2008).

[0398] As noted above, once isolated, binding partners can be identified and can, in turn, be used in conjunction with standard techniques to identify proteins or other compounds with which it interacts. Certain embodiments thus relate to methods of screening for a compound that specifically binds to the binding partner of an AARS reference polypeptide, comprising a) combining the binding partner with at least one test compound under suitable conditions, and b) detecting binding of the binding partner to the test compound, thereby identifying a compound that specifically binds to the binding partner. In certain embodiments, the test compound is a polypeptide. In certain embodiments, the test compound is a chemical compound, such as a small molecule compound or peptide mimetic.

[0399] Certain embodiments include methods of screening for a compound that modulates the activity of an AARS reference polypeptide, comprising a) combining the polypeptide with at least one test compound under conditions permissive for the activity of the polypeptide, b) assessing the activity of the polypeptide in the presence of the test compound, and c) comparing the activity of the polypeptide in the presence of the test compound with the activity of the polypeptide in the absence of the test compound, wherein a change in the activity of the polypeptide in the presence of the test compound is indicative of a compound that modulates the activity of the polypeptide. Certain embodiments include methods of screening for a compound that modulates the activity of a binding partner of an AARS reference polypeptide, comprising a) combining the polypeptide with at least one test compound under conditions permissive for the activity of the binding partner, b) assessing the activity of the binding partner in the presence of the test compound, and c) comparing the activity of the binding partner in the presence of the test compound with the activity of the binding partner in the absence of the test compound, wherein a change in the activity of the binding partner in the presence of the test compound is indicative of a compound that modulates the activity of the binding partner. Typically, these and related embodiments include assessing a selected non-canonical activity that is associated with the AARS polypeptide or its binding partner. Included are in vitro and in vivo conditions, such as cell culture conditions.

[0400] Certain embodiments include methods of screening a compound for effectiveness as a full or partial agonist of an AARS reference polypeptide or an active fragment or variant thereof, comprising a) exposing a sample comprising the polypeptide to a compound, and b) detecting agonist activity in the sample, typically by measuring an increase in the non-canonical activity of the AARS polypeptide. Certain methods include a) exposing a sample comprising a binding partner of the AARS polypeptide to a compound, and b) detecting agonist activity in the sample, typically by measuring an increase in the selected non-canonical activity of the AARS polypeptide. Certain embodiments include compositions that comprise an agonist compound identified by the method and a pharmaceutically acceptable carrier or excipient.

[0401] Also included are methods of screening a compound for effectiveness as a full or partial antagonist of an AARS reference polypeptide, comprising a) exposing a sample comprising the polypeptide to a compound, and b) detecting antagonist activity in the sample, typically by measuring a decrease in the non-canonical activity of the AARS polypeptide. Certain methods include a) exposing a sample comprising a binding partner of the AARS polypeptide to a compound, and b) detecting antagonist activity in the sample, typically by measuring a decrease in the selected non-canonical activity of the AARS polypeptide. Certain embodiments include compositions that comprise an antagonist compound identified by the method and a pharmaceutically acceptable carrier or excipient.

[0402] In certain embodiments, in vitro systems may be designed to identify compounds capable of interacting with or modulating an AARS reference sequence or its binding partner. Certain of the compounds identified by such systems may be useful, for example, in modulating the activity of the pathway, and in elaborating components of the pathway itself. They may also be used in screens for identifying compounds that disrupt interactions between components of the pathway; or may disrupt such interactions directly. One exemplary approach involves preparing a reaction mixture of the AARS polypeptide and a test compound under conditions and for a time sufficient to allow the two to interact and bind, thus forming a complex that can be removed from and/or detected in the reaction mixture

[0403] In vitro screening assays can be conducted in a variety of ways. For example, an AARS polypeptide, a cellular binding partner, or test compound(s) can be anchored onto a solid phase. In these and related embodiments, the resulting complexes may be captured and detected on the solid phase at the end of the reaction. In one example of such a method, the AARS polypeptide and/or its binding partner are anchored onto a solid surface, and the test compound(s), which are not anchored, may be labeled, either directly or indirectly, so that their capture by the component on the solid surface can be detected. In other examples, the test compound(s) are anchored to the solid surface, and the AARS polypeptide and/or its binding partner, which are not anchored, are labeled or in some way detectable. In certain embodiments, microtiter plates may conveniently be utilized as the solid phase. The anchored component (or test compound) may be immobilized by non-covalent or covalent attachments. Non-covalent attachment may be accomplished by simply coating the solid surface with a solution of the protein and drying. Alternatively, an immobilized antibody, preferably a monoclonal antibody, specific for the protein to be immobilized may be used to anchor the protein to the solid surface. The surfaces may be prepared in advance and stored.

[0404] To conduct an exemplary assay, the non-immobilized component is typically added to the coated surface containing the anchored component. After the reaction is complete, un-reacted components are removed (e.g., by washing) under conditions such that any specific complexes formed will remain immobilized on the solid surface. The detection of complexes anchored on the solid surface can be accomplished in a number of ways. For instance, where the previously non-immobilized component is pre-labeled, the detection of label immobilized on the surface indicates that complexes were formed. Where the previously non-immobilized component is not pre-labeled, an indirect label can be used to detect complexes anchored on the surface; e.g., using a labeled antibody specific for the previously non-immobilized component (the antibody, in turn, may be directly labeled or indirectly labeled with a labeled anti-Ig antibody).

[0405] Alternatively, the presence or absence of binding of a test compound can be determined, for example, using surface plasmon resonance (SPR) and the change in the resonance angle as an index, wherein an AARS polypeptide or a cellular binding partner is immobilized onto the surface of a commercially available sensorchip (e.g., manufactured by Biacore.TM.) according to a conventional method, the test compound is contacted therewith, and the sensorchip is illuminated with a light of a particular wavelength from a particular angle. The binding of a test compound can also be measured by detecting the appearance of a peak corresponding to the test compound by a method wherein an AARS polypeptide or a cellular binding partner is immobilized onto the surface of a protein chip adaptable to a mass spectrometer, a test compound is contacted therewith, and an ionization method such as MALDI-MS, ESI-MS, FAB-MS and the like is combined with a mass spectrometer (e.g., double-focusing mass spectrometer, quadrupole mass spectrometer, time-of-flight mass spectrometer, Fourier transformation mass spectrometer, ion cyclotron mass spectrometer and the like).

[0406] In certain embodiments, cell-based assays, membrane vesicle-based assays, or membrane fraction-based assays can be used to identify compounds that modulate interactions in the non-canonical pathway of the selected AARS polypeptide. To this end, cell lines that express an AARS polypeptide and/or a binding partner, or a fusion protein containing a domain or fragment of such proteins (or a combination thereof), or cell lines (e.g., COS cells, CHO cells, HEK293 cells, Hela cells etc.) that have been genetically engineered to express such protein(s) or fusion protein(s) can be used. Test compound(s) that influence the non-canonical activity can be identified by monitoring a change (e.g., a statistically significant change) in that activity as compared to a control or a predetermined amount.

[0407] For embodiments that relate to antisense and RNAi agents, for example, also included are methods of screening a compound for effectiveness in altering expression of an AARS reference polynucleotide, comprising a) exposing a sample comprising the AARS reference polynucleotide to a compound such as a potential antisense oligonucleotide, and b) detecting altered expression of the AARS polynucleotide. In certain non-limiting examples, these and related embodiments can be employed in cell-based assays or in cell-free translation assays, according to routine techniques in the art. Also included are the antisense and RNAi agents identified by such methods.

[0408] Antibodies to AARS protein fragments can also be used in screening assays, such as to identify an agent that specifically binds to an AARS, confirm the specificity or affinity of an agent that binds to an AARS protein fragment, or identify the site of interaction between the agent and the AARS protein fragment. Included are assays in which the antibody is used as a competitive inhibitor of the agent. For instance, an antibody that specifically binds to an AARS protein fragment with a known affinity can act as a competitive inhibitor of a selected agent, and be used to calculate the affinity of the agent for the AARS protein fragment. Also, one or more antibodies that specifically bind to known epitopes or sites of an AARS protein fragment can be used as a competitive inhibitor to confirm whether or not the agent binds at that same site. Other variations will be apparent to persons skilled in the art.

[0409] Also included are any of the above methods, or other screening methods known in the art, which are adapted for high-throughput screening (HTS). HTS typically uses automation to run a screen of an assay against a library of candidate compounds, for instance, an assay that measures an increase or a decrease in a non-canonical activity, as described herein.

[0410] Any of the screening methods provided herein may utilize small molecule libraries or libraries generated by combinatorial chemistry. Libraries of chemical and/or biological mixtures, such as fungal, bacterial, or algal extracts, are known in the art and can be screened with any of the assays of the invention. Examples of methods for the synthesis of molecular libraries can be found in: (Carell et al., 1994a; Carell et al., 1994b; Cho et al., 1993; DeWitt et al., 1993; Gallop et al., 1994; Zuckermann et al., 1994).

[0411] Libraries of compounds may be presented in solution (Houghten et al., 1992) or on beads (Lam et al., 1991), on chips (Fodor et al., 1993), bacteria, spores (Ladner et al., U.S. Pat. No. 5,223,409, 1993), plasmids (Cull et al., 1992) or on phage (Cwirla et al., 1990; Devlin et al., 1990; Felici et al., 1991; Ladner et al., U.S. Pat. No. 5,223,409, 1993; Scott and Smith, 1990). Embodiments of the present invention encompass the use of different libraries for the identification of small molecule modulators of one or more AARS protein fragments, their cellular binding partners, and/or their related non-canonical activities. Libraries useful for the purposes of the invention include, but are not limited to, (1) chemical libraries, (2) natural product libraries, and (3) combinatorial libraries comprised of random peptides, oligonucleotides and/or organic molecules.

[0412] Chemical libraries consist of structural analogs of known compounds or compounds that are identified as "hits" or "leads" via natural product screening. Natural product libraries are derived from collections of microorganisms, animals, plants, or marine organisms which are used to create mixtures for screening by: (1) fermentation and extraction of broths from soil, plant or marine microorganisms or (2) extraction of plants or marine organisms. Natural product libraries include polyketides, non-ribosomal peptides, and variants (non-naturally occurring) thereof. See, e.g., Cane et al., Science 282:63-68, 1998. Combinatorial libraries may be composed of large numbers of peptides, oligonucleotides or organic compounds as a mixture. They are relatively easy to prepare by traditional automated synthesis methods, PCR, cloning or proprietary synthetic methods.

[0413] More specifically, a combinatorial chemical library is a collection of diverse chemical compounds generated by either chemical synthesis or biological synthesis, by combining a number of chemical "building blocks" such as reagents. For example, a linear combinatorial chemical library such as a polypeptide library is formed by combining a set of chemical building blocks (amino acids) in every possible way for a given compound length (i.e., the number of amino acids in a polypeptide compound). Millions of chemical compounds can be synthesized through such combinatorial mixing of chemical building blocks.

[0414] For a review of combinatorial chemistry and libraries created therefrom, see, e.g., Huc, I. and Nguyen, R. (2001) Comb. Chem. High Throughput Screen 4:53-74; Lepre,C A. (2001) Drug Discov. Today 6:133-140; Peng, S. X. (2000) Biomed. Chromatogr. 14:430-441; Bohm, H. J. and Stahl, M. (2000) Curr. Opin. Chem. Biol. 4:283-286; Barnes,C and Balasubramanian, S. (2000) Curr. Opin. Chem. Biol. 4:346-350; Lepre, Enjalbal, C, et al., (2000) Mass Septrom Rev. 19:139-161; Hall, D. G., (2000) Nat. Biotechnol. 18:262-262; Lazo, J. S., and Wipf, P. (2000) J. Pharmacol. Exp. Ther. 293:705-709; Houghten, R. A., (2000) Ann. Rev. Pharmacol. Toxicol. 40:273-282; Kobayashi, S. (2000) Curr. Opin. Chem. Biol. (2000) 4:338-345; Kopylov, A. M. and Spiridonova, V. A. (2000) Mol. Biol. (Mosk) 34:1097-1113; Weber, L. (2000) Curr. Opin. Chem. Biol. 4:295-302; Dolle, R. E. (2000) J. Comb. Chem. 2:383-433; Floyd, C D., et al., (1999) Prog. Med. Chem. 36:91-168; Kundu, B., et al., (1999) Prog. Drug Res. 53:89-156; Cabilly, S. (1999) Mol. Biotechnol. 12:143-148; Lowe, G. (1999) Nat. Prod. Rep. 16:641-651; Dolle, R. E. and Nelson, K. H. (1999) J. Comb. Chem. 1:235-282; Czarnick, A. W. and Keene, J. D. (1998) Curr. Biol. 8:R705-R707; Dolle, R. E. (1998) Mol. Divers. 4:233-256; Myers, P. L., (1997) Curr. Opin. Biotechnol. 8:701-707; and Pluckthun, A. and Cortese, R. (1997) Biol. Chem. 378:443.

[0415] Devices for the preparation of combinatorial libraries are commercially available (see, e.g., 357 MPS, 390 MPS, Advanced Chem Tech, Louisville Ky., Symphony, Rainin, Woburn, Mass., 433A Applied Biosystems, Foster City, Calif., 9050 Plus, Millipore, Bedford, Mass.). In addition, numerous combinatorial libraries are themselves commercially available (see, e.g., ComGenex, Princeton, N.J., Asinex, Moscow, Ru, Tripos, Inc., St. Louis, Mo., ChemStar, Ltd., Moscow, RU, 3D Pharmaceuticals, Exton, Pa., Martek Biosciences, Columbia, Md., etc.).

XII. Methods of Use

[0416] Embodiments of the present invention include therapeutic methods of treatment. Accordingly, the AARS agents described herein, including AARS polypeptides, AARS polynucleotides, AARS polynucleotide-based vectors, AARS expressing host cells, antisense oligonucleotides, RNAi agents, as well as binding agents such as peptides, antibodies and antigen-binding fragments, peptide mimetics and other small molecules, can be used to treat a variety of non-limiting diseases or conditions associated with the non-canonical activities of a reference AARS. Examples of such non-canonical activities include modulation of extracellular signaling, modulation of cell proliferation, modulation of cell migration, modulation of cell differentiation (e.g., hematopoiesis, neurogenesis, myogenesis, osteogenesis, and adipogenesis), modulation of apoptosis or other forms of cell death, modulation of angiogenesis, modulation of cell binding, modulation of cellular metabolism, modulation of cytokine production or activity, modulation of cytokine receptor activity, modulation of cellular uptake, or secretion, immunomodulation, modulation of inflammation, modulation of metabolic processes such as glucose control, and the like.

[0417] Included are polynucleotide-based therapies, such as antisense therapies and RNAi interference therapies, which typically relate to reducing the expression of a target molecule, such as an endogenous fragment of an AARS, or a cellular binding partner of an AARS polypeptide, which otherwise contributes to its non-canonical activity. Antisense or RNAi therapies typically antagonize the non-canonical activity, such as by reducing expression of the AARS reference polypeptide. Also included are polypeptides or peptides, antibodies or antigen-binding fragment, peptide mimetics, or other small molecule-based therapies, which either agonize or antagonize the non-canonical activity of an AARS reference polypeptide, such as by interacting directly with the AARS polypeptide, its cellular binding partner(s), or both.

[0418] These and related embodiments include methods of using the AARS agents or compositions of the present invention for treating a cell, tissue or subject. The cells or tissues that may be treated or modulated by the present invention are preferably mammalian cells or tissues, or more preferably human cells or tissues. Such cells or tissues can be of a healthy state or of a diseased state.

[0419] In certain embodiments, for example, methods are provided for modulating therapeutically relevant cellular activities including, but not limited to, cellular metabolism, cell differentiation, cell proliferation, cellular uptake, cell secretion, cell death, cell mobilization, cell migration, gene transcription, mRNA translation, cell impedance, immune responses, inflammatory responses, and the like, comprising contacting a cell with an AARS agent or composition as described herein. In certain embodiments, the cell is in a subject. Accordingly, the AARS compositions may be employed in treating essentially any cell or tissue or subject that would benefit from modulation of one or more such activities.

[0420] The AARS agents and compositions may also be used in any of a number of therapeutic contexts including, for example, those relating to the treatment or prevention of neoplastic diseases, immune system diseases or conditions (e.g., autoimmune diseases and inflammation), infectious diseases, metabolic diseases, neuronal/neurological diseases, muscular/cardiovascular diseases, diseases associated with aberrant hematopoiesis, diseases associated with aberrant myogenesis, diseases associated with aberrant neurogenesis, diseases associated with aberrant adipogenesis, diseases associated with aberrant osteogenesis, diseases associated with aberrant angiogenesis, diseases associated with aberrant cell survival, diseases associated with aberrant lipid uptake, diseases associated with aging (e.g. hearing loss, peripheral or autonomic neuropathies, senile dementia, retinopathy) and others.

[0421] For example, in certain illustrative embodiments, the AARS compositions of the invention may be used to modulate angiogenesis, e.g., via modulation of endothelial cell proliferation and/or signaling. Endothelial cell proliferation and/or signaling may be monitored using an appropriate cell line (e.g., human microvascular endothelial lung cells (HMVEC-L) and human umbilical vein endothelial cells (HUVEC)), and using an appropriate assay (e.g., endothelial cell migration assays, endothelial cell proliferation assays, tube-forming assays, matrigel plug assays, etc.), many of which are known and available in the art.

[0422] Therefore, in related embodiments, the compositions of the invention may be employed in the treatment of essentially any cell or tissue or subject that would benefit from modulation of angiogenesis. For example, in some embodiments, a cell or tissue or subject experiencing or susceptible to angiogenesis (e.g., an angiogenic condition) may be contacted with a suitable composition of the invention to inhibit an angiogenic condition. In other embodiments, a cell or tissue experiencing or susceptible to insufficient angiogenesis (e.g., an angiostatic condition) may be contacted with an appropriate composition of the invention in order to interfere with angiostatic activity and/or promote angiogenesis.

[0423] Also included are methods of modulating hematopoiesis and related conditions. Examples of hematopoietic processes that may be modulated by the AARS polypeptides of the invention include, without limitation, the formation of myeloid cells (e.g., erythroid cells, mast cells monocytes/macrophages, myeloid dendritic cells, granulocytes such as basophils, neutrophils, and eosinophils, megakaryocytes, platelets) and lymphoid cells (e.g., natural killer cells, lymphoid dendritic cells, B-cells, and T-cells). Certain specific hematopoietic processes include erythropoiesis, granulopoiesis, lymphopoiesis, megakaryopoiesis, thrombopoiesis, and others. Also included are methods of modulating the trafficking or mobilization of hematopoietic cells, including hematopoietic stem cells, progenitor cells, erythrocytes, granulocytes, lymphocytes, megakaryocytes, and thrombocytes.

[0424] The methods of modulating hematopoiesis may be practiced in vivo, in vitro, ex vivo, or in any combination thereof. These methods can be practiced on any biological sample, cell culture, or tissue that contains hematopoietic stem cells, hematopoietic progenitor cells, or other stem or progenitor cells that are capable of differentiating along the hematopoietic lineage (e.g., adipose tissue derived stem cells). For in vitro and ex vivo methods, stem cells and progenitor cells, whether of hematopoietic origin or otherwise, can be isolated and/or identified according to the techniques and characteristics described herein and known in the art.

[0425] The compositions of the invention may also be useful as immunomodulators for treating anti- or pro-inflammatory indications by modulating the cells that mediate, either directly or indirectly, autoimmune and/or inflammatory diseases, conditions and disorders. The utility of the compositions of the invention as immunomodulators or modulators of inflammation can be monitored using any of a number of known and available techniques in the art including, for example, migration assays (e.g., using leukocytes or lymphocytes) or cell viability assays (e.g., using B-cells, T-cells, monocytes or NK cells).

[0426] "Inflammation" refers generally to the biological response of tissues to harmful stimuli, such as pathogens, damaged cells (e.g., wounds), and irritants. The term "inflammatory response" refers to the specific mechanisms by which inflammation is achieved and regulated, including, merely by way of illustration, immune cell activation or migration, cytokine production, vasodilation, including kinin release, fibrinolysis, and coagulation, among others described herein and known in the art.

[0427] Clinical signs of chronic inflammation are dependent upon duration of the illness, inflammatory lesions, cause and anatomical area affected. (see, e.g., Kumar et al., Robbins Basic Pathology-8.sup.th Ed., 2009 Elsevier, London; Miller, L M, Pathology Lecture Notes, Atlantic Veterinary College, Charlottetown, PEI, Canada). Chronic inflammation is associated with a variety of pathological conditions or diseases, including, for example, allergies, Alzheimer's disease, anemia, aortic valve stenosis, arthritis such as rheumatoid arthritis and osteoarthritis, cancer, congestive heart failure, fibromyalgia, fibrosis, heart attack, kidney failure, lupus, pancreatitis, stroke, surgical complications, inflammatory lung disease, inflammatory bowel disease, atherosclerosis, neurological disorders, diabetes, metabolic disorders, obesity, and psoriasis, among others described herein and known in the art. Hence, AARS compositions may be used to treat or manage chronic inflammation, modulate any of one or more of the individual chronic inflammatory responses, or treat any one or more diseases or conditions associated with chronic inflammation.

[0428] Criteria for assessing the signs and symptoms of inflammatory and other conditions, including for purposes of making differential diagnosis and also for monitoring treatments such as determining whether a therapeutically effective dose has been administered in the course of treatment, e.g., by determining improvement according to accepted clinical criteria, will be apparent to those skilled in the art and are exemplified by the teachings of e.g., Berkow et al., eds., The Merck Manual, 16th edition, Merck and Co., Rahway, N.J., 1992; Goodman et al., eds., Goodman and Gilman's The Pharmacological Basis of Therapeutics, 10.sup.th edition, Pergamon Press, Inc., Elmsford, N.Y., (2001); Avery's Drug Treatment: Principles and Practice of Clinical Pharmacology and Therapeutics, 3rd edition, ADIS Press, Ltd., Williams and Wilkins, Baltimore, Md. (1987); Ebadi, Pharmacology, Little, Brown and Co., Boston, (1985); Osolci al., eds., Remington's Pharmaceutical Sciences, 18.sup.th edition, Mack Publishing Co., Easton, Pa. (1990); Katzung, Basic and Clinical Pharmacology, Appleton and Lange, Norwalk, Conn. (1992).

[0429] In other embodiments, the AARS compositions of the invention may be used to modulate cellular proliferation and/or survival and, accordingly, for treating or preventing diseases, disorders or conditions characterized by abnormalities in cellular proliferation and/or survival. For example, in certain embodiments, the AARS compositions may be used to modulate apoptosis and/or to treat diseases or conditions associated with abnormal apoptosis. Apoptosis can be monitored by any of a number of available techniques known and available in the art including, for example, assays that measure fragmentation of DNA, alterations in membrane asymmetry, activation of apoptotic caspases and/or release of cytochrome C and AIF.

[0430] The progress of these and other therapies (e.g., ex vivo therapies) can be readily monitored by conventional methods and assays and based on criteria known to the physician or other persons of skill in the art.

XIII. Pharmaceutical Formulations, Administration and Kits

[0431] Embodiments of the present invention include AARS polynucleotides, AARS polypeptides, host cells expressing AARS polypeptides, binding agents, modulatory agents, or other compounds described herein, formulated in pharmaceutically-acceptable or physiologically-acceptable solutions for administration to a cell or an animal, either alone, or in combination with one or more other modalities of therapy. It will also be understood that, if desired, the compositions of the invention may be administered in combination with other agents as well, such as, e.g., other proteins or polypeptides or various pharmaceutically-active agents. There is virtually no limit to other components that may also be included in the compositions, provided that the additional agents do not adversely affect the modulatory or other effects desired to be achieved.

[0432] In the pharmaceutical compositions of the invention, formulation of pharmaceutically-acceptable excipients and carrier solutions is well-known to those of skill in the art, as is the development of suitable dosing and treatment regimens for using the particular compositions described herein in a variety of treatment regimens, including e.g., oral, parenteral, intravenous, intranasal, subcutaneous, and intramuscular administration and formulation.

[0433] In certain applications, the pharmaceutical or therapeutic compositions of the invention do not stimulate an immune reaction. In other embodiments, the pharmaceutical or therapeutic compositions of the invention, typically comprising one or more AARS polypeptides or polynucleotides, stimulate an immune reaction, such as by serving as an adjuvant in a vaccine or related composition, or being present in a composition together with a separate adjuvant or agent stimulates an immune response.

[0434] In certain embodiments, the AARS agents such as AARS polypeptides, AARS polynucleotides, and antibodies have a solubility that is desirable for the particular mode of administration, such intravenous administration. Examples of desirable solubilities include at least about 1 mg/ml, at least about 10 mg/ml, at least about 25 mg/ml, and at least about 50 mg/ml.

[0435] In certain applications, the pharmaceutical compositions disclosed herein may be delivered via oral administration to a subject. As such, these compositions may be formulated with an inert diluent or with an assimilable edible carrier, or they may be enclosed in hard- or soft-shell gelatin capsule, or they may be compressed into tablets, or they may be incorporated directly with the food of the diet.

[0436] In certain circumstances it will be desirable to deliver the pharmaceutical compositions disclosed herein parenterally, subcutaneously, intravenously, intramuscularly, intra-arterially, intrathecally, intraparenchymally, intraventricularlly, intraurethrally, intrasternally, intracranially, intrasynovially, or even intraperitoneally as described, for example, in U.S. Pat. Nos. 5,543,158; 5,641,515 and 5,399,363 (each specifically incorporated herein by reference in its entirety). Suitable devices for parenteral administration include needle (including microneedle) injectors, needle-free injectors, and infusion techniques.

[0437] Solutions of the active compounds as free base or pharmacologically acceptable salts may be prepared in water suitably mixed with a surfactant, such as hydroxypropylcellulose. Dispersions may also be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms.

[0438] The pharmaceutical forms suitable for injectable use include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions (U.S. Pat. No. 5,466,468, specifically incorporated herein by reference in its entirety). In all cases the form should be sterile and should be fluid to the extent that easy syringability exists. It should be stable under the conditions of manufacture and storage and should be preserved against the contaminating action of microorganisms, such as bacteria and fungi. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (e.g., glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and/or vegetable oils. Proper fluidity may be maintained, for example, by the use of a coating, such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. The prevention of the action of microorganisms can be facilitated by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like. In many cases, it will be preferable to include isotonic agents, for example, sugars or sodium chloride. Prolonged absorption of the injectable compositions can be brought about by the use in the compositions of agents delaying absorption, for example, aluminum monostearate and gelatin.

[0439] For parenteral administration in an aqueous solution, for example, the solution should be suitably buffered if necessary and the liquid diluent first rendered isotonic with sufficient saline or glucose. These particular aqueous solutions are especially suitable for intravenous, intramuscular, subcutaneous and intraperitoneal administration. In this connection, a sterile aqueous medium that can be employed will be known to those of skill in the art in light of the present disclosure. For example, one dosage may be dissolved in 1 ml of isotonic NaCl solution and either added to 1000 ml of hypodermoclysis fluid or injected at the proposed site of infusion (see, e.g., Remington's Pharmaceutical Sciences, 15th Edition, pp. 1035-1038 and 1570-1580). Some variation in dosage will necessarily occur depending on the condition of the subject being treated. The person responsible for administration will, in any event, determine the appropriate dose for the individual subject. Moreover, for human administration, preparations should meet sterility, pyrogenicity, and the general safety and purity standards as required by FDA Office of Biologics standards.

[0440] Sterile injectable solutions can be prepared by incorporating the active compounds in the required amount in the appropriate solvent with the various other ingredients enumerated above, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum-drying and freeze-drying techniques which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.

[0441] The compositions disclosed herein may be formulated in a neutral or salt form. Pharmaceutically-acceptable salts, include the acid addition salts (formed with the free amino groups of the protein) and which are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric, mandelic, and the like. Salts formed with the free carboxyl groups can also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, histidine, procaine and the like. Upon formulation, solutions will be administered in a manner compatible with the dosage formulation and in such amount as is therapeutically effective. The formulations are easily administered in a variety of dosage forms such as injectable solutions, drug-release capsules, and the like.

[0442] As used herein, "carrier" includes any and all solvents, dispersion media, vehicles, coatings, diluents, antibacterial and antifungal agents, isotonic and absorption delaying agents, buffers, carrier solutions, suspensions, colloids, and the like. The use of such media and agents for pharmaceutical active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active ingredient, its use in the therapeutic compositions is contemplated. Supplementary active ingredients can also be incorporated into the compositions.

[0443] The phrase "pharmaceutically-acceptable" refers to molecular entities and compositions that do not produce an allergic or similar untoward reaction when administered to a human. The preparation of an aqueous composition that contains a protein as an active ingredient is well understood in the art. Typically, such compositions are prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid prior to injection can also be prepared. The preparation can also be emulsified.

[0444] In certain embodiments, the pharmaceutical compositions may be delivered by intranasal sprays, inhalation, and/or other aerosol delivery vehicles. Methods for delivering genes, polynucleotides, and peptide compositions directly to the lungs via nasal aerosol sprays have been described e.g., in U.S. Pat. Nos. 5,756,353 and 5,804,212 (each specifically incorporated herein by reference in its entirety). Likewise, the delivery of drugs using intranasal microparticle resins (Takenaga et al., 1998) and lysophosphatidyl-glycerol compounds (U.S. Pat. No. 5,725,871, specifically incorporated herein by reference in its entirety) are also well-known in the pharmaceutical arts. Likewise, transmucosal drug delivery in the form of a polytetrafluoroetheylene support matrix is described in U.S. Pat. No. 5,780,045 (specifically incorporated herein by reference in its entirety).

[0445] The pharmaceutical compositions may be formulated to be immediate and/or sustained release. Sustained release compositions include delayed, modified, pulsed, controlled, targeted and programmed release. Thus the compositions may be formulated as a suspension or as a solid, semi-solid, or thixotropic liquid for administration as an implanted depot providing sustained release of the AARS polynucleotides, AARS polypeptides, binding agents, modulatory agents and other active agents. Examples of such formulations include without limitation, drug-coated stents and semi-solids and suspensions comprising drug-loaded poly(DL-lactic-co-glycolic)acid (PGLA), poly(DL-lactide-co-glycolide) (PLG) or poly(lactide) (PLA) lamellar vesicles or microparticles, hydrogels (Hoffman AS: Ann. N.Y. Acad. Sci. 944: 62-73 (2001)), poly-amino acid nanoparticles systems, sold under the trademark MEDUSA.RTM. developed by Flamel Technologies Inc., non aqueous gel systems sold under the trademark ATRIGEL.RTM. developed by Atrix, Inc., and Sucrose Acetate Isobutyrate Extended Release formulations sold under the trademark SABER.RTM. developed by Durect Corporation, and lipid-based systems developed by SkyePharma and sold under the trademark DEPOFOAM.RTM..

[0446] Sustained release devices capable of delivering desired doses of the pharmaceutical compositions over extended periods of time are known in the art. For example, U.S. Pat. Nos. 5,034,229; 5,557,318; 5,110,596; 5,728,396; 5,985,305; 6,113,938; 6,156,331; 6,375,978; and 6,395,292; teach osmotically-driven devices capable of delivering an active agent formulation, such as a solution or a suspension, at a desired rate over an extended period of time (i.e., a period ranging from more than one week up to one year or more). Other exemplary sustained release devices include regulator-type pumps that provide constant flow, adjustable flow, or programmable flow of beneficial agent formulations, which are available from Medtronic including the Intrathecal pumps sold under the trademark SYNCHROMED INFUSION SYSTEM.RTM., the Johnson and Johnson systems sold under the trademark CODMAN.RTM. division pumps, and INSET.RTM. technologies pumps. Further examples of devices are described in U.S. Pat. Nos. 6,283,949; 5,976,109; 5,836,935; and 5,511,355.

[0447] In certain embodiments, the delivery may occur by use of liposomes, nanocapsules, microparticles, microspheres, lipid particles, vesicles, and the like, for the introduction of the compositions of the present invention into suitable host cells. In particular, the compositions of the present invention may be formulated for delivery either encapsulated in a lipid particle, a liposome, a vesicle, a nanosphere, a nanoparticle or the like. The formulation and use of such delivery vehicles can be carried out using known and conventional techniques.

[0448] In certain embodiments, the agents provided herein may be attached to a pharmaceutically acceptable solid substrate, including biocompatible and biodegradable substrates such as polymers and matrices. Examples of such solid substrates include, without limitation, polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides (U.S. Pat. No. 3,773,919), copolymers of L-glutamic acid and .gamma.-ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as poly(lactic-co-glycolic acid) (PLGA) and the LUPRON DEPOT.TM. (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), poly-D-(-)-3-hydroxybutyric acid, collagen, metal, hydroxyapatite, bioglass, aluminate, bioceramic materials, and purified proteins.

[0449] In one particular embodiment, the solid substrate comprises biodegradable polymers sold under the trademark ATRIGEL.TM. (QLT, Inc., Vancouver, B.C.). The ATRIGEL.RTM. drug delivery system consists of biodegradable polymers dissolved in biocompatible carriers. Pharmaceuticals may be blended into this liquid delivery system at the time of manufacturing or, depending upon the product, may be added later by the physician at the time of use. When the liquid product is injected into the subcutaneous space through a small gauge needle or placed into accessible tissue sites through a cannula, water in the tissue fluids causes the polymer to precipitate and trap the drug in a solid implant. The drug encapsulated within the implant is then released in a controlled manner as the polymer matrix biodegrades with time.

[0450] Pharmaceutical compositions for use in the present invention may also be administered topically, (intra)dermally, or transdermally to the skin or mucosa. Typical formulations for this purpose include gels, hydrogels, lotions, solutions, creams, ointments, dusting powders, dressings, foams, films, skin patches, wafers, implants, sponges, fibers, bandages, and microemulsions. Liposomes may also be used. Typical carriers include alcohol, water, mineral oil, liquid petrolatum, white petrolatum, glycerin, polyethylene glycol, and propylene glycol. Penetration enhancers may be incorporated--see, e.g., Finnin and Morgan: J. Pharm. Sci. 88(10): 955-958, (1999). Other means of topical administration include delivery by electroporation, iontophoresis, phonophoresis, sonophoresis, and microneedle or needle-free injection for example using the systems sold under the trademarks POWDERJECT.TM., and BIOJECT.TM..

[0451] Methods of formulation are well known in the art and are disclosed, for example, in Remington: The Science and Practice of Pharmacy, Mack Publishing Company, Easton, Pa., 20th edition, ISBN: 0683306472 (2000). The compositions and agents provided herein may be administered according to the methods of the present invention in any therapeutically effective dosing regimen. The dosage amount and frequency are selected to create an effective level of the agent without harmful effects. The effective amount of a compound of the present invention will depend on the route of administration, the type of warm-blooded animal being treated, and the physical characteristics of the specific warm-blooded animal under consideration. These factors and their relationship to determining this amount are well known to skilled practitioners in the medical arts. This amount and the method of administration can be tailored to achieve optimal efficacy but will depend on such factors as weight, diet, concurrent medication and other factors which those skilled in the medical arts will recognize.

[0452] In particular embodiments, the amount of a composition or agent administered will generally range from a dosage of from about 0.1 to about 100 mg/kg/day, and typically from about 0.1 to 10 mg/kg where administered orally or intravenously. In particular embodiments, a dosage is 5 mg/kg or 7.5 mg/kg. In various embodiments, the dosage is about 50-2500 mg per day, 100-2500 mg/day, 300-1800 mg/day, or 500-1800 mg/day. In one embodiment, the dosage is between about 100 to 600 mg/day. In another embodiment, the dosage is between about 300 and 1200 mg/day. In particular embodiments, the composition or agent is administered at a dosage of 100 mg/day, 240 mg/day 300 mg/day, 600 mg/day, 1000 mg/day, 1200 mg/day, or 1800 mg/day, in one or more doses per day (i.e., where the combined doses achieve the desired daily dosage). In related embodiments, a dosage is 100 mg bid, 150 mg bid, 240 mg bid, 300 mg bid, 500 mg bid, or 600 mg bid. In various embodiments, the composition or agent is administered in single or repeat dosing. The initial dosage and subsequent dosages may be the same or different.

[0453] In certain embodiments, a composition or agent is administered in a single dosage of 0.1 to 10 mg/kg or 0.5 to 5 mg/kg. In other embodiments, a composition or agent is administered in a dosage of 0.1 to 50 mg/kg/day, 0.5 to 20 mg/kg/day, or 5 to 20 mg/kg/day.

[0454] In certain embodiments, a composition or agent is administered orally or intravenously, e.g., by infusion over a period of time of about, e.g., 10 minutes to 90 minutes. In other related embodiments, a composition or agent is administered by continuous infusion, e.g., at a dosage of between about 0.1 to about 10 mg/kg/hr over a time period. While the time period can vary, in certain embodiments the time period may be between about 10 minutes to about 24 hours or between about 10 minutes to about three days.

[0455] In particular embodiments, an effective amount or therapeutically effective amount is an amount sufficient to achieve a total concentration of the composition or agent in the blood plasma of a subject with a C.sub.max of between about 0.1 .mu.g/ml and about 20 .mu.g/ml or between about 0.3 .mu.g/ml and about 20 .mu.g/ml. In certain embodiments, an oral dosage is an amount sufficient to achieve a blood plasma concentration (C.sub.max) of between about 0.1 .mu.g/ml to about 5 .mu.g/ml or between about 0.3 .mu.g/ml to about 3 .mu.g/ml. In certain embodiments, an intravenous dosage is an amount sufficient to achieve a blood plasma concentration (C.sub.max) of between about 1 .mu.g/ml to about 10 .mu.g/ml or between about 2 .mu.g/ml and about 6 .mu.g/ml. In a related embodiment, the total concentration of an agent in the blood plasma of the subject has a mean trough concentration of less than about 20 .mu.g/ml and/or a steady state concentration of less than about 20 .mu.g/ml. In a further embodiment, the total concentration of an agent in the blood plasma of the subject has a mean trough concentration of less than about 10 .mu.g/ml and/or a steady state concentration of less than about 10 .mu.g/ml.

[0456] In yet another embodiment, the total concentration of an agent in the blood plasma of the subject has a mean trough concentration of between about 1 ng/ml and about 10 .mu.g/ml and/or a steady state concentration of between about 1 ng/ml and about 10 .mu.g/ml. In one embodiment, the total concentration of an agent in the blood plasma of the subject has a mean trough concentration of between about 0.3 .mu.g/ml and about 3 .mu.g/ml and/or a steady state concentration of between about 0.3 .mu.g/ml and about 3 .mu.g/ml.

[0457] In particular embodiments, a composition or agent is administered in an amount sufficient to achieve in the mammal a blood plasma concentration having a mean trough concentration of between about 1 ng/ml and about 10 .mu.g/ml and/or a steady state concentration of between about 1 ng/ml and about 10 .mu.g/ml. In related embodiments, the total concentration of the agent in the blood plasma of the mammal has a mean trough concentration of between about 0.3 .mu.g/ml and about 3 .mu.g/ml and/or a steady state concentration of between about 0.3 .mu.g/ml and about 3 .mu.g/ml.

[0458] In particular embodiments of the present invention, the effective amount of a composition or agent, or the blood plasma concentration of composition or agent is achieved or maintained, e.g., for at least 15 minutes, at least 30 minutes, at least 45 minutes, at least 60 minutes, at least 90 minutes, at least 2 hours, at least 3 hours, at least 4 hours, at least 8 hours, at least 12 hours, at least 24 hours, at least 48 hours, at least 3 days, at least 4 days, at least 5 days, at least 6 days, at least one week, at least 2 weeks, at least one month, at least 2 months, at least 4 months, at least 6 months, at least one year, at least 2 years, or greater than 2 years.

[0459] In certain polypeptide-based embodiments, the amount of polypeptide administered will typically be in the range of about 0.1 .mu.g/kg to about 0.1 mg/kg to about 50 mg/kg of patient body weight. Depending on the type and severity of the disease, about 0.1 .mu.g/kg to about 0.1 mg/kg to about 50 mg/kg body weight (e.g., about 0.1-15 mg/kg/dose) of polypeptide can be an initial candidate dosage for administration to the patient, whether, for example, by one or more separate administrations, or by continuous infusion. For example, a dosing regimen may comprise administering an initial loading dose of about 4 mg/kg, followed by a weekly maintenance dose of about 2 mg/kg of the polypeptide, or about half of the loading dose. However, other dosage regimens may be useful. A typical daily dosage might range from about 0.1 .mu.g/kg to about 1 .mu.g/kg to 100 mg/kg or more, depending on the factors mentioned above. For repeated administrations over several days or longer, depending on the condition, the treatment is sustained until a desired suppression of disease symptoms occurs.

[0460] In particular embodiments, the effective dosage achieves the blood plasma levels or mean trough concentration of a composition or agent described herein. These may be readily determined using routine procedures.

[0461] Embodiments of the present invention, in other aspects, provide kits comprising one or more containers filled with one or more of the polypeptides, polynucleotides, antibodies, multiunit complexes, compositions thereof, etc., of the invention, as described herein. The kits can include written instructions on how to use such compositions (e.g., to modulate cellular signaling, angiogenesis, cancer, inflammatory conditions, diagnosis etc.).

[0462] The kits herein may also include a one or more additional therapeutic agents or other components suitable or desired for the indication being treated, or for the desired diagnostic application. An additional therapeutic agent may be contained in a second container, if desired. Examples of additional therapeutic agents include, but are not limited to anti-neoplastic agents, anti-inflammatory agents, antibacterial agents, antiviral agents, angiogenic agents, etc.

[0463] The kits herein can also include one or more syringes or other components necessary or desired to facilitate an intended mode of delivery (e.g., stents, implantable depots, etc.).

[0464] All publications, patent applications, and issued patents cited in this specification are herein incorporated by reference as if each individual publication, patent application, or issued patent were specifically and individually indicated to be incorporated by reference.

[0465] Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, it will be readily apparent to one of ordinary skill in the art in light of the teachings of this invention that certain changes and modifications may be made thereto without departing from the spirit or scope of the appended claims. The following examples are provided by way of illustration only and not by way of limitation. Those of skill in the art will readily recognize a variety of noncritical parameters that could be changed or modified to yield essentially similar results.

XIV. Examples

[0466] GENERAL METHODS Unless indicated otherwise in the examples below, the following general methods for gene optimization, small and large scale protein expression, protein purification, transcriptional profiling and screening were used to make and characterize the AARS polypeptides described in the Examples below.

Gene Synthesis and Cloning into Expression Vectors

[0467] Polynucleotide sequences encoding epitope tagged versions of the AARS polypeptides were codon optimized and cloned into bacterial expression vectors using the methods listed below.

[0468] In method (1), E. coli codon-optimized DNA (Welch et al., PLoS ONE 4(9): e7007 doi:10.1371/journal.pone.0007002) encoding each AARS polypeptide is synthesized by DNA 2.0 (Menlo Park, Calif.), and two versions of each AARS polypeptide are synthesized, containing either an N-terminal, or C-terminal combined epitope tag comprising both a six histidine tag and V5 epitope tag.

[0469] DNA encoding the N-terminally tagged AARS polypeptides is synthesized with a 5' extension encoding in 5' to 3' orientation, a ribosome binding site (rbs (underlined below)), NdeI restriction site, six histidine tag, and a V5 epitope tag, (AGGAGGTAAAACATATGCATCATCATCATCATCACGGTAAGCCTATCCCTA ACCCTTTGCTCGGTCTCGATTCTACG) (SEQ. ID. No. 1),

[0470] which is fused in frame to the predicted AARS polypeptide open reading frame. In cases where the AARS polypeptide comprises a predicted native initiation methionine (ATG) residue, or the first amino acid residue of the predicted AARS polypeptide is Met, this was deleted. At the end of the predicted AARS polypeptide open reading frame, two stop codons and a XhoI site (TAATGACTCGAG) (SEQ. ID. No. 2) are added.

[0471] DNA encoding the C-terminally tagged AARS polypeptides is synthesized with a 5' extension encoding a rbs (underlined below) and NdeI restriction site that either recapitulates the predicted native start codon for the AARS polypeptide, or inserts an ATG in frame with the predicted AARS polypeptide open reading frame, (AGGAGATAAAACATATG) (SEQ. ID. No. 3). In different embodiments, the ribosome binding site can comprise the sequences "AGGAGGTAAAACAT" (SEQ. ID. No. 4), "AGGAGATAAAACAT" (SEQ. ID. No. 5), or GAAGGAGATATACAT (SEQ. ID. No. 6). At the 3' end of the predicted AARS polypeptide open reading frame, a 3' extension is synthesized which encodes in 5' to 3' order, a V5 epitope tag, six histidine tag, two stop codons and a XhoI site, (GGTAAGCCTATCCCTAACCCTCTCCTCGGTCTCGATTCTACGCACCACCATC ATCACCATTAATGACTCGAG) (SEQ. ID. No. 7),

[0472] which is fused in frame to the predicted AARS polypeptide open reading frame. If the AARS polypeptide included a predicted native stop codon, this was deleted.

[0473] Synthesized DNA sequences encoding the AARS polypeptides are subcloned into pJExpress411 vector (DNA 2.0). After sequencing to confirm synthesis of the correct product, expression vectors are transformed into bacteria for protein expression as described more fully below.

[0474] In method (2), E. coli codon-optimized DNA (Ermolaeva M D (2001) Curr. Iss. Mol. Biol. 3 (4) 91-7) encoding each AARS polypeptide is synthesized by GENEWIZ (South Plainfield, N.J.). Each polynucleotide sequence encoding the AARS polypeptide was synthesized with short 5' and 3' extensions comprising unique restriction sites for subsequent cloning.

[0475] Specifically a BamHI restriction site was inserted at the 5' end of the predicted open reading frame. In cases where the AARS polypeptide comprises a predicted native initiation methionine residue (ATG), or the first amino acid residue of the predicted AARS polypeptide is Met, this was deleted. Additionally a XhoI restriction site was inserted at the 3' end of the predicted open reading frame. In cases where the AARS polypeptide comprises a predicted native stop codon, this was deleted.

[0476] After restriction digestion, the resulting DNA sequences are subcloned into modified pET-24b vectors (EMD, Gibbstown, N.J.) containing either an N-terminal(pET24b_N-6.times.HisN5), or C-terminal (pET24b_C-V5/6.times.His) combined epitope tag comprising both a six histidine and V5 epitope tag (vector modification by GENEWIZ, (South Plainfield, N.J.).

[0477] After restriction digestion, and cloning, the DNA encoding the N-tagged AARS polypeptide is cloned into the N-tagged vector (pET24b_N-6.times.HisN5), which comprises a 5' DNA sequence encoding six histidines and a V5 epitope tag, (CATATGCATCATCATCATCATCACGGTAAGCCTATCCCTAACCCTCTCCTCG GTCTCGATTCTACGGGATCC) (SEQ. ID. No. 8),

[0478] in frame with an initiation codon (ATG) embedded within the NdeI restriction site. This 5' extension is fused to the predicted AARS polypeptide open reading frame through a short 2 amino acid linker (GS).

[0479] At the 3' end of the predicted open reading frame, the DNA encoding the N-tagged AARS polypeptide comprises a DNA sequence encoding a 2 amino acid extension (LE) followed by two termination codons (CTCGAGTAATGA) (SEQ. ID. No. 9).

[0480] After restriction digestion, and cloning, the DNA encoding the C-tagged AARS polypeptide cloned into the C-tagged vector (pET24b_C-V5/6)(His), comprises a 5' sequence encoding an initiation codon (ATG) embedded within the NdeI restriction site which is fused to the predicted AARS polypeptide open reading frame through a short 2 amino acid linker (GS), (CATATGGGATCC) (SEQ. ID. No. 10).

[0481] At the 3' end of the predicted open reading frame, the DNA encoding the C-tagged AARS polypeptide comprises a 3' DNA sequence encoding a short linker 2 amino acid linker (LE) followed by a V5 epitope tag followed by six histidines, and two stop codons, CTCGAGGGTAAGCCTATCCCTAACCCTCTCCTCGGTCTCGATTCTACGCACC ACCACCACCACCACTAATGA (SEQ. ID. No. 11).

[0482] In method (3) (AARS polypeptides for in vivo and cell binding experiments) AARS polypeptides were prepared as described below:

[0483] Human full length AlaRS (Invitrogen Ultimate ORF collection Clone ID IOH10952) was subcloned via recombination into pET301 (Invitrogen) using an LR clonase recombination reaction. The resulting vector was used as a template to PCR amplify DNA encoding AlaRS adding a 5' NdeI site and 3' NotI site with the following oligos:

TABLE-US-00029 (SEQ. ID. No. 182) (5'-TGGCCGCATATGGACTCTACTCTAACAGC-3') (SEQ. ID. No. 183) (5'-TAGCGGCCGCGTTCTTTACATCCCCGAGG-3')

[0484] The amplified product was subcloned into pET21a (Novagen) in frame with the C-terminal six histidine tag using these restriction sites. The NdeI restriction site recapitulates the predicted native start codon.

[0485] At the 3' end of the predicted open reading frame, the DNA encoding C-tagged AlaRS comprises a DNA sequence encoding a 5 amino acid extension (AAALE (SEQ. ID. No. 184)) followed by a six histidine tag, and a termination codon; (5'-GCGGCCGCACTCGAGCACCACCACCACCACCACTGA-3') (SEQ. ID. No. 185). DNA was sequenced to confirm correct Polynucleotide sequence (Retrogen, San Diego).

[0486] ssDNA Preparation:

[0487] To prepare pET21a-C-6.times.His-AARS ssDNA, the dsDNA vector was transformed into CJ236 bacterial cells (NEB, cat no E4141S) and plated on ampicillin (100 .mu.g/mL) and chloramphenicol (30 .mu.g/mL) containing LB-Agar plates. Plates were incubated overnight at 37.degree. C. A colony was used to inoculate LB medium containing ampicillin and chloramphenicol and incubated overnight at 225 rpm and 37.degree. C. 20 mL of LB containing ampicillin and chloramphenicol was inoculated with 204 of the overnight culture and grown for 2 hours at 225 rpm and 37.degree. C. The culture was infected with 5e9 pfu of M13K07 Helper Phage (NEB, cat no NO315S). After 1 hour, kanamycin was added to the culture at a final concentration of 50 .mu.g/mL and incubated overnight at 225 rpm and 37.degree. C. Bacteria was separated and discarded from culture by two centrifugations at 1900.times. g. ssDNA was precipitated by incubation overnight at 4.degree. C. with final concentrations of 4% PEG-8000 and 500 mM Sodium Acetate. ssDNA was centrifuged at 12000.times.g and resuspended in 2 mL LB medium. ssDNA was purified from the supernatant using Qiagen QIAprep M13 kit (Qiagen, cat no 27704).

[0488] Kunkel Mutagenesis:

[0489] Kunkel mutagenesis was performed to make AlaRS1.sup.C6 using the oligo below:

TABLE-US-00030 (SEQ. ID. No 186) (5'-CCTGTGACAGCCACAATCCTCCGGATACCCTTCATATGTATATCTCC TTCTTAAAG-3').

[0490] The oligo was diluted to 170ng/4, and 340ng of the oligo was incubated with 5U PNK kinase (Roche, cat no 10633542001) in the presence of 1.times.PNK kinase buffer and 0.5 mM ATP

[0491] This reaction was incubated at 37.degree. C. for 1 hour.

[0492] 100 ng of ssDNA vector was incubated with 34ng of kinased oligo in annealing buffer (20 mM Tris, pH7.4, 2 mM MgCl.sub.2, 50 mM NaCl, final concentrations) for 5 minutes on a heat block at 75.degree. C. Reactions were allowed to cool to room temperature while contained in the heat block.

[0493] For elongation of the plasmid, 1U of T4 DNA Polymerase (Roche, cat no 11004786001) and 1U T4 DNA Ligase (Roche, cat no 10481220001) was added to 54 of the annealing reaction. Additionally, synthesis buffer was added to a final concentration of 1.1 mM dNTPs, 2.2 mM ATP, 22.2 mM Tris, pH 7.4, 11.1 mM MgCl.sub.2, and 4.4 mM DTT). This reaction was incubated on ice for 5 minutes and then at 37.degree. C. for 90 minutes. 54 of the elongation reaction was transformed into 1004 DH5a cells. Transformations were plated on Ampicillin plates and incubated overnight at 37.degree. C.

[0494] Individual colonies were used to inoculate LB medium containing ampicillin. Cultures were grown overnight at 37.degree. C. DNA plasmids were prepared using Qiagen Spin Miniprep kit (Qiagen, cat no 27106) and sequence verified (Retrogen, San Diego).

[0495] After sequencing to confirm synthesis of the correct product, expression vectors are transformed into bacteria for protein expression as described more fully below.

AARS Polypeptide Expression, Purification and Biophysical Characterization

[0496] 6.times.His-tagged AARS polypeptides are expressed in bacteria in a medium-throughput format and/or in larger scale flask cultures depending upon the amount of protein required. AARS polypeptides are purified using affinity and ion exchange chromatography as described below, and as specified for specific experiments.

[0497] Bacterial Cultures:

[0498] 100 ng of expression vector comprising codon optimized DNA encoding each AARS polypeptide (as described above) is transformed into BL21(DE3) (EMD chemicals, cat. no. 69450) competent E. coli bacteria at 42.degree. C. for 30 seconds in PCR plates. C41(DE3) (Lucigen, cat. no. 60442), HMS174(DE3) (EMD chemicals, cat. no. 69453) and Origami2(DE3) (EMD chemicals, cat. no. 71345) strains are also evaluated. The plates are placed on ice for 2 minutes and 100 .mu.L of SOC medium is added, followed by a 1-hour incubation at 37.degree. C. 5 mL of auto-induction medium (EMD chemicals, cat. no. 71491) supplemented with kanamycin (100 .mu.g/mL) is added into each well of a 24-well block (Qiagen, cat. no. 19583). The transformation reactions are added to the individual wells, the block is sealed with adhesive film (VWR, cat. no 60941-078) and incubated overnight at 250 rpm in a 37.degree. C. shaker. When low temperature (25.degree. C.) conditions are used, incubation is carried out for 48 hours instead.

[0499] For larger scale expression, 200 mL of auto-induction medium supplemented with kanamycin (100 .mu.g/mL) is added into 500-mL Erlenmeyer flasks with vent caps (Corning, cat. no. 431401). The transformation reactions are added to the individual flasks and incubated for 30 hours at 250 rpm in a 37.degree. C. shaker.

[0500] Protein Isolation:

[0501] After the culture reached stationary phase (typical OD600 of 3-6), the blocks are centrifuged at 3600.times.g for 10 minutes. The medium is carefully aspirated and the blocks are frozen at -80.degree. C. or -20.degree. C. for 10 minutes. The blocks are then allowed to thaw at room temperature and 1 mL lysis buffer (100 mL Bugbuster supplemented with 200 .mu.L lysonase (EMD chemicals, cat. no 71370) and protease inhibitors "complete mini EDTA-free" (Roche, cat. no. 11 836 170 001)) is added into each well. The pellets are resuspended by repeat pipetting until no clump is visible and transferred to eppendorf tubes, followed by a 10-20 minute incubation on a shaker at room temperature. After centrifugation at 16,000 g for 10 minutes at 4.degree. C., the lysates are loaded onto a TurboFilter 96 Plate included in the Ni-NTA Superflow 96 BioRobot Kit (Qiagen, cat. no. 969261) and centrifuged at 500 g for 5-10 minutes.

[0502] For larger scale expression, the stationary phase culture is transferred into 500-mL bottles and centrifuged at 6,000 g for 10 minutes. The medium is decanted and the pellet is stored at -80.degree. C. or -20.degree. C. before further processing. The pellet is then allowed to thaw at room temperature and 20 mL lysis buffer is added into each bottle. The pellets are resuspended by repeat pipetting until no clump is visible, followed by 20 minute incubation on a shaker at room temperature. After centrifugation at 10,000 g for 30 minutes at 4.degree. C., the lysates are transferred to clean tubes or bottles. If trace amounts of debris are carried over during the transfer, the sample is centrifuged again or passed through a 0.45 .mu.m cellulose acetate membrane (Corning, cat. no. 430314) for further clarification.

[0503] Affinity Purification:

[0504] A QIAFilter 96 Plate is loaded with 200 .mu.l Ni-NTA Superflow slurry included in the Ni-NTA Superflow 96 BioRobot Kit and the resin is equilibrated by adding 600 .mu.l binding buffer (20 mM sodium phosphate, 500 mM sodium chloride and 10 mM imidazole, pH 7.5). A vacuum of -15 in. Hg is applied until all the buffer has passed through the resin. The clarified cell lysates from the previous step are then loaded onto the QIAFilter.RTM. 96 Plate and allowed to bind for 5 minutes. A vacuum of -3 in. Hg is applied for approximately 5 minutes until all the samples have passed through the resin. The resin is then washed with 1 mL binding buffer, followed by two washes with 1 mL binding buffer containing 0.1% Triton X-100. The resin is then washed 10 times with 1 mL binding buffer without Triton X-100. The bound 6.times.His-tagged AARS polypeptides are eluted with 450 .mu.l elution buffer (20 mM sodium phosphate, 500 mM sodium chloride and 500 mM imidazole, pH 7.5) and stored at 4.degree. C.

[0505] For larger scale expression, an empty disposable column "Poly-Prep" (Bio-rad, cat. no. 731-1550) is loaded with 1 mL Ni-NTA Superflow slurry (Qiagen, cat. no. 30450) and the 0.5 mL resin is equilibrated by adding 5 mL binding buffer. The clarified cell lysate from the previous step is then loaded onto the column and allowed to pass through by gravity. The resin is first washed with 50 mL binding buffer plus 0.1% Triton X-100, then washed with 50 mL binding buffer without Triton X-100. The bound 6.times.His-tagged AARS polypeptides are eluted with 2 mL elution buffer and stored at 4.degree. C.

[0506] Desalting and Polishing Steps:

[0507] For AARS polypeptides with a molecular mass of >10 kDa, the Omega 10K membrane of an AcroPrep 96 filter plate (Pall, cat. no. 5034) is rinsed with 20 .mu.L 1.times.PBS and the plate is placed onto a vacuum manifold (>10 in Hg) until all the liquid passes through. The eluates from the previous step (Ni-NTA) are dispensed into each well and the vacuum applied until all the liquid passes through. These steps are repeated until the total eluate volume (450 .mu.L) has been processed. AARS polypeptides are recovered by adding 180 .mu.L of 1.times.PBS pH 7.4 to each well, pipetting up and down 10 times carefully and then transferred to a clean block. This step is repeated to yield a total volume of 360 .mu.L per well and the block is stored at 4.degree. C. For AARS polypeptides with a molecular mass of <10 kDa, the eluates from Ni-NTA are loaded onto an Amicon Ultra-15 Centrifugal Filter Unit with Ultracel-3 membrane (Millipore, cat. no. UFC900308), followed by the addition of 10 mL 1.times.PBS and a centrifugation at 3,600 g for 10-30 minutes until the volume is less than 360 .mu.L. The samples are recovered and 1.times.PBS is added to a final volume of 360 .mu.L.

[0508] In order to remove endotoxins, an AcroPrep Advance filter plate with Mustang Q membrane (Pall, cat. no. 8171) is rinsed with 300 .mu.l of 1.times.PBS and centrifuged at 1,000 g for 5 minutes to remove the buffer. The desalted AARS polypeptides (360 .mu.l/well) are added to the filter plate and incubated on a shaker for 5-10 minutes. The plate is then centrifuged at 1,000 g for 5-10 minutes and the flow through fractions containing the AARS polypeptides are collected and stored at 4.degree. C.

[0509] For larger scale expression, the eluates from Ni-NTA are loaded onto an Amicon Ultra-15 Centrifugal Filter Unit with Ultracel-3 or Ultracel-10 membrane (Millipore, cat. no. UFC900308 or UFC901008) depending on the molecular weight of the AARS polypeptide and then centrifuged at 3,600 g for 10-30 minutes until the volume is reduced to 250 .mu.L. The samples are mixed in 10 mL 1.times.PBS, pH7.4 and centrifuged again at 3,600 g for 10-30 minutes until the volume is about 250 .mu.L. This step is repeated one more time, the supernatants are recovered and 1.times.PBS is added to a final volume of 1.5 mL.

[0510] In order to remove endotoxins, a Sartobind Q 5 strong anion exchanger membrane (Sartorius, cat. no. Q5F) is flushed with 1 mL 1.times.PBS and the AARS polypeptides are slowly passed through the membrane using a plastic syringe. The flow through fraction containing the AARS polypeptides is collected in a 96-deep well block that is sealed and stored at 4.degree. C.

[0511] 6.times.His-tagged AARS polypeptides expressed in bacteria and found in inclusion bodies are purified using affinity chromatography and a series of refolding steps, as described below.

[0512] Bacterial Cultures:

[0513] 100 ng of plasmid encoding each AARS polypeptide is transformed into BL21(DE3) (EMD chemicals, cat. no. 69450) or C41(DE3) (Lucigen, cat. no. 60442) competent E. coli bacteria at 42.degree. C. for 30 seconds in PCR plates. The plates are placed on ice for 2 minutes and 100 .mu.l of SOC medium is added, followed by a 1-hour incubation at 37.degree. C. 5 ml of auto-induction medium (EMD chemicals, cat. no. 71491) supplemented with kanamycin (100 .mu.g/ml) is added into each well of a 24-well block (Qiagen, cat. no. 19583). The transformation reactions are added to the individual wells, the block is sealed with adhesive film (VWR, cat. no 60941-078) and incubated overnight at 250 rpm in a 37.degree. C. shaker.

[0514] For larger scale expression, 200 ml of auto-induction medium supplemented with kanamycin (100 .mu.g/ml) is added into 500-ml Erlenmeyer flasks with vent caps (Corning, cat. no. 431401). The transformation reactions are added to the individual flasks and incubated for 30 hours at 250 rpm in a 37.degree. C. shaker.

[0515] Isolation:

[0516] After the cultures reach stationary phase (typical OD600 of 3-6), the blocks are centrifuged at 3,600.times.g for 10 minutes. The medium is carefully aspirated and the blocks are frozen at -80.degree. C. or -20.degree. C. for 10 minutes. The blocks are then allowed to thaw at room temperature and 1 ml lysis buffer (100 ml Bugbuster supplemented with 200 .mu.l lysonase (EMD chemicals, cat. no 71370) and protease inhibitor "complete mini EDTA-free" (Roche, cat. no. 11 836 170 001)) is added into each well. The pellets are resuspended by repeat pipetting until no clump is visible and transferred to eppendorf tubes, followed by a 10-20 minute incubation on a shaker at room temperature. After centrifugation at 16,000.times.g for 10 minutes at 4.degree. C., the soluble lysates are discarded and the inclusion bodies are thoroughly resuspended in denaturing binding buffer (20 mM sodium phosphate, 500 mM sodium chloride, 6 M guanidine hydrochloride, 10 mM imidazole, pH 7.5). The samples are centrifuged at 16,000 g for 10 minutes and the supernatants loaded onto a TurboFilter 96 Plate included in the Ni-NTA Superflow 96 BioRobot Kit (Qiagen, cat. no. 969261) followed by centrifugation at 500 g for 5-10 minutes. The filtrates are collected in a clean 96-well block (Greiner, cat. no. 780286).

[0517] For larger scale expression, the stationary phase culture is transferred into 500-ml bottles and centrifuged at 6,000 g for 10 minutes. The medium is decanted and the pellet is stored at -80.degree. C. or -20.degree. C. before further processing. The pellet is then allowed to thaw at room temperature and 20 ml lysis buffer is added into each bottle. The pellets are resuspended by repeat pipetting until no clump is visible, followed by 20 minute incubation on a shaker at room temperature. After centrifugation at 10,000 g for 30 minutes at 4.degree. C., the soluble lysates are discarded and the insoluble inclusion bodies thoroughly resuspended in denaturing binding buffer.

[0518] Affinity Purification:

[0519] A QIAFilter 96 Plate is loaded with 200 .mu.l Ni-NTA Superflow slurry included in the Ni-NTA Superflow 96 BioRobot Kit and the resin is equilibrated by adding 600 .mu.l denaturing binding buffer (see above). A vacuum of -15 in. Hg is applied until all the buffer passes through the resin. The clarified denatured samples from the previous step are then loaded onto the QIAFilter.RTM. 96 Plate and allowed to bind for 5 minutes. A vacuum of -3 in. Hg is applied for approximately 5 minutes until all the samples pass through the resin. The resin is then washed with 1 ml denaturing binding buffer, followed by five washes with 1 ml denaturing binding buffer containing 0.1% Triton 100. The resin is then washed 15 times with 1 ml denaturing binding buffer without Triton 100. The bound 6.times.His-tagged AARS polypeptides are then eluted with 450 .mu.l denaturing elution buffer (20 mM sodium phosphate, 500 mM sodium chloride, 6 M guanidine hydrochloride and 500 mM imidazole, pH 7.5) and stored at 4.degree. C.

[0520] For larger scale expression, an empty disposable column "Poly-Prep" (Bio-rad, cat. no. 731-1550) is loaded with 1 ml Ni-NTA Superflow slurry (Qiagen, cat. no. 30450) and the 0.5 ml resin is equilibrated by adding 5 ml denaturing binding buffer (see above). The denatured inclusion bodies from the previous step are then loaded onto the column and allowed to pass through by gravity. The resin is first washed with 50 ml denaturing binding buffer plus 0.1% Triton 100, then washed with 50 ml denaturing binding buffer without Triton 100. The bound 6.times.His-tagged AARS polypeptides are eluted with 2 ml denaturing elution buffer and stored at 4.degree. C.

[0521] Refolding:

[0522] For AARS polypeptides >10 kDa, the Omega 10K membrane of an AcroPrep 96 filter plate (Pall, cat. no. 5034) is rinsed with 20 .mu.l 1.times.PBS and the plate is placed onto a vacuum manifold (>10 in. Hg) until all the liquid passes through. The eluates from the previous step (Ni-NTA) are dispensed into each well and the vacuum applied until all the liquid passes through. These steps are repeated until the total eluate volume (450 .mu.l) has been processed. AARS polypeptides are recovered by adding 200 .mu.l of refolding buffer containing 50 mM Tris, 250 mM sodium chloride, 10 mM potassium chloride, 2 mM magnesium chloride, 2 mM calcium chloride, 400 mM sucrose, 500 mM arginine, 1 mM DTT and 0.01% polysorbate 80, pH 7.4) to each well, pipetting up and down 10 times carefully, and then transferred to a clean block. This step is repeated to yield a total volume of 400 .mu.l per well and the block is placed on the shaker overnight at 4.degree. C. For AARS polypeptides <10 kDa, the eluates from Ni-NTA are loaded onto an Amicon Ultra-15 Centrifugal Filter Unit with Ultracel-3 membrane (Millipore, cat. no. UFC900308), followed by the addition of 10 ml refolding buffer and a centrifugation at 3,600 g for 10-30 minutes until the volume is less than 400 .mu.l. The samples are recovered and extra refolding buffer is added to a final volume of 400 .mu.l. The samples are transferred to a 96-well block, sealed with film and placed on a shaker overnight at 4.degree. C.

[0523] For larger scale cultures, the eluates from Ni-NTA are loaded onto an Amicon Ultra-15 centrifugal filter unit with Ultracel-3 or Ultracel-10 membrane (Millipore, cat. no. UFC900308 or UFC901008 depending on the molecular weight of the AARS polypeptide) and then centrifuged at 3,600 g for 10-30 minutes until the volume is reduced to about 500 .mu.l. For AARS polypeptides with pI>7, the samples are diluted 20-fold in the following buffer: 50 mM sodium acetate, 10 mM sodium chloride, 0.4 mM potassium chloride, 1 mM EDTA, 400 mM sucrose, 500 mM arginine, 1 mM DTT and 0.01% polysorbate 80, pH 6.0. For AARS polypeptides with pI<7, the samples are diluted 20-fold in the following buffer: 50 mM Tris, 250 mM sodium chloride, 10 mM potassium chloride, 2 mM magnesium chloride, 2 mM calcium chloride, 400 mM sucrose, 500 mM arginine, 1 mM DTT and 0.01% polysorbate 80, pH 8.0. The samples are incubated on a shaker at 4.degree. C. overnight.

[0524] Desalting and Polishing Steps:

[0525] After overnight incubation, the 96-well block is centrifuged at 3,600 g to remove any potential aggregates. The supernatants are then subjected to buffer exchange with 1.times.PBS (Invitrogen, cat. no. 10010). For AARS polypeptides >10 kDa, the Omega 10K membrane of an AcroPrep 96 filter plate is rinsed with 20 .mu.l 1.times.PBS and the plate is placed onto a vacuum manifold (>10 in. Hg) until all the liquid passes through. The samples in the refolding buffer are dispensed into each well and the vacuum applied until all the liquid passes through. These steps are repeated until the total sample volume (400 .mu.l) has been processed. AARS polypeptides are recovered by adding 180 .mu.l of 1.times.PBS pH 7.4 to each well, pipetting up and down 10 times carefully, and then transferred to a clean block. This step is repeated to yield a total volume of 360 .mu.l per well and the block is stored at 4.degree. C. For AARS polypeptides <10 kDa, the refolded samples are loaded onto an Amicon Ultra-15 Centrifugal Filter Unit with Ultracel-3 membrane (Millipore, cat. no. UFC900308) followed by the addition of 10 ml 1.times.PBS and centrifugation at 3,600 g for 10-30 minutes until the volume is less than 360 .mu.l. The samples are recovered and 1.times.PBS is added to a final volume of 360 .mu.l.

[0526] In order to remove endotoxins, an AcroPrep Advance filter plate with Mustang Q membrane (Pall, cat. no. 8171) is rinsed with 300 .mu.l of 1.times.PBS and centrifuged at 1,000 g for 5 minutes to remove the buffer. The AARS polypeptides (360 .mu.l/well) are added to the filter plate and incubated on a shaker for 5-10 minutes. The plate is then centrifuged at 1,000 g for 5-10 minutes and the flow through fractions containing the AARS polypeptides are collected and stored at 4.degree. C.

[0527] For larger scale cultures, after overnight incubation, the refolded samples are centrifuged at 10,000 g for 10 minutes to remove any insoluble aggregates. The supernatant is loaded onto an Amicon Ultra-15 Centrifugal Filter Unit and centrifuged at 3,600 g until the volume is reduced to 250 .mu.l. The samples are mixed in 10 ml 1.times.PBS and centrifuged again at 3,600 g for 10-30 minutes until the volume is about 250 .mu.l. Note that the pH of 1.times.PBS is adjusted to match the pH of the refolding buffer, either pH 6.0 or pH 8.0. This step is repeated one more time, the supernatants are recovered and 1.times.PBS is added to a final volume of 1.5 ml.

[0528] In order to remove endotoxins, a Sartobind Q 5 strong anion exchanger membrane (Sartorius, cat. no. Q5F) is flushed with 1 ml 1.times.PBS and the AARS polypeptides are slowly passed through the membrane using a plastic syringe. The flow through fraction containing the AARS polypeptides is collected in a 96-deep well block that is sealed and stored at 4.degree. C.

Protein Production for In Vivo Experiments

[0529] Bacterial Cultures:

[0530] 100 ng of expression vector comprising DNA encoding each AARS polypeptide (as described in Gene synthesis and cloning method (3)) is transformed into BL21(DE3)-RIPL (Agilent Technologies cat. #230280) competent E. coli bacteria at 42.degree. C. for 30 seconds. 500 .mu.L of LB medium is added to the cells and incubated for 1 hour at 250 rpm in a 37.degree. C. shaker, and 150 .mu.l of the transformation reactions are plated onto ampicillin LB agar plates and incubated overnight at 37.degree. C.

[0531] Individual colonies are picked to start seed cultures in 30 ml of LB-Amp and incubated overnight at 250 rpm in a 37.degree. C. shaker. Seed cultures are then used to inoculate 2.5 L LB-Amp in 6 L Erlenmeyer flasks. After the culture reaches stationary phase (typical OD600 of 0.6-0.8), the flasks are iced for 30 minutes and then induced with 1M IPTG to a final concentration on 200 .mu.M. Individual cultures are then incubated overnight at 250 rpm in a 30.degree. C. shaker

[0532] Protein Isolation:

[0533] The culture is then transferred to 500 ml Nalgene bottles (Cat #3141-0500) and centrifuged at 8,000.times.g for 10 minutes at 4.degree. C. The medium is carefully decanted and the pellets are frozen at -20.degree. C.

[0534] The pellets are then thawed and re-suspended in 50 ml Ni-NTA pH 8.0 buffer with 50 .mu.l .beta.-ME and one protease inhibitor tablet (Roche #11873580001). 300 mg of lysozyme (Sigma # L6878) is added and the mixture is rotated for 30 minutes at 4.degree. C. The re-suspended pellet is then sonicated at 25, 50, and 75% for 1 minute each (10 seconds on, 5 seconds off). The sample is then spun down at 35,000.times.g for 45 minutes at 4.degree. C.

[0535] Affinity Purification:

[0536] The supernatant is then added to 2 ml buffer equilibrated Ni-NTA agarose (Qiagen #30230) and rotated for 1 hour at 4.degree. C. The nickel bound protein mix is then poured through a buffer equilibrated eco column from Bio-RAD (Cat #737-4151) followed by washing with 1 L Ni-NTA buffer pH 8.0 (50 mM Tris, pH 8, 300 mM NaCl, 25 mM imidazole) with 0.5% Triton-X114 (Sigma # X114) and then by a 100 ml wash of endotoxin free Ni-NTA buffer pH 8.0. The purified protein is then eluted from the Ni-NTA agarose with 10 ml endotoxin free elution buffer pH 8.0 (50 mM Tris, pH 8, 300 mM NaCl, 300 mM imidazole) and dialyzed overnight in slide-a-lyzers (Pierce) against 1.times.PBS pH 7.4 (Invitrogen #10010) with two buffer changes an hour apart the next morning.

[0537] Concentration and Endotoxin Removal:

[0538] The dialyzed eluates from Ni-NTA are loaded onto an Amicon Ultra-15 Centrifugal Filter Unit with Ultracel-10 membrane (Millipore, cat. # UFC901008) and then centrifuged at 3,600.times.g for 10-30 minutes until the desired concentration is reached (usually 1.7 mg/ml).

[0539] In order to remove endotoxin, a Sartobind Q 15 strong anion exchanger membrane (Sartorius, cat. # Q15.times.) was flushed with 1 mL 1.times.PBS and the AARS polypeptides are slowly passed through the membrane using a plastic syringe. The flow through fraction containing the AARS polypeptides is collected and aliquoted. AARS polypeptides are then snap frozen in liquid nitrogen and stored at -80.degree. C.

[0540] Biophysical Characterization:

[0541] All purified AARS polypeptides are analyzed by SDS-PAGE, their concentration determined based on A.sub.280 and calculated extinction coefficient (ProtParam on ExPASy server). Endotoxin levels are measured by the QCL-1000 Endpoint Chromogenic LAL assay (Lonza, cat. no. 50-648U) according to the manufacturer's instructions.

[0542] Dynamic Light Scattering:

[0543] A Wyatt Technology DynaPro 99 instrument and the temperature controller (20.degree. C.) are warmed up for 15 minutes before the experiment followed by connection of the Dynamics software to the instrument. The acquisition time is set to 10 seconds for multiple acquisitions and the laser power is set to 100%. The quartz cuvette is washed thoroughly with deionized water and methanol before the addition of the protein sample (154 at a concentration of approximately 1 mg/mL in PBS). Air bubbles are removed by tapping the cuvette before it is inserted into the holder with the frosted side to the left. If the intensity is too high (warning message shown on the screen), the sample is further diluted with PBS until the intensity is decreased to a normal range. The data collected include hydrodynamic radius, polydispersity, predicted average molecular weight, percentage of intensity and percentage of mass.

[0544] Size Exclusion Chromatography:

[0545] The protein sample is diluted to a concentration of about 5-10 mg/mL in PBS before being loaded into a 100 .mu.L sample loop on the General Electric AKTA FPLC. The Superdex 200 10/300 GL size exclusion column (General Electric, cat. no. 17-5175-01) is used for separation. The column is first equilibrated with 1.5 column volume (CV) of 1.times.PBS buffer, followed by sample injection. The column is run in 1 CV of 1.times.PBS buffer (isocratic flow) with absorbance at 280 nm monitoring. The peak area is integrated and the percentage calculated with the Unicorn software. The elution volume is used to estimate the molecular weight based on comparison with gel filtration calibration kits (General Electric, cat. no. 28-4038-41 and 28-4038-42).

[0546] Protein Recovery Upon Storage at High Concentration:

[0547] 10 .mu.L of the AARS polypeptides concentrated to >10 mg/mL using an Amicon Ultra-15 filter unit (Millipore, cat. no. UFC901024 or UFC900324 depending on molecular weight) are transferred to a clean microcentrifuge tube. The sample is stored at room temperature for one week followed by centrifugation at 16,000 g for 10 minutes to pellet any precipitates. The concentration of the supernatant is determined by a Bradford protein assay and compared to the concentration measured prior to the week-long exposure to room temperature. The recovery is expressed as percentage of the starting concentration.

[0548] Characterization of AARS Polypeptides by LC-MS:

[0549] Purified AARS polypeptides (1 mg/mL) are diluted 1:10 into 0.1% formic acid and 0.6 .mu.g protein is loaded with a Dionex autosampler onto a C4 capillary column. The capillary column is prepared by cutting 150 mm of fused silica tubing (0.36 mm OD by 0.1 mm ID, Polymicro Technologies, cat. no. 2000023). The capillary is pulled at one end with a Suter Instrument Laser Fiber Puller and cut with a fused silica cutter to generate a 5 .mu.m tip. The capillary is packed to the length of 75 mm with C4 resin (5 .mu.m, 300A, Michrom, cat. no. PM5/64300/00) using pressure bomb. The LC-MS analysis is performed on an ThermoFisher LTQ ion trap mass spectrometer coupled to a Dionex Ultimate3000 HPLC system. The analyte is eluted from the column using a 35-minute gradient of 5-70% acetonitrile in 0.1% formic acid at a flow rate of 0.9 .mu.L/min. The LTQ is operated on a full MS scan mode (300-2,000 m/z) with a spray voltage of 2.5 kV.

[0550] Data collection and analysis: raw mass spectrometry data are stored in RAW files generated by XCalibur running on the LTQ XL mass spectrometer. The MS spectra of the major peaks on the chromatograph are further analyzed with ThermoFisher deconvoluting algorithm ProMass to obtain the AARS polypeptide molecular weights.

Functional Analysis of AARS Polypeptides

[0551] Transcriptional Profiling

[0552] Background and Therapeutic Relevance:

[0553] In addition to traditional target identification techniques, genomic tools have recently emerged as important approaches to aid in elucidating the mechanism of action of AARS polypeptides and can provide direct insight into therapeutic relevance early in the drug discovery process. To facilitate an understanding of potential therapeutic utility, primary human cell types are cultured with AARS polypeptides and transcriptional profiling is assessed at two separate time points following incubation with AARS polypeptides.

[0554] The cell types chosen for transcriptional profiling are based on the pluripotent capabilities of the cells in question and potential to identify AARS polypeptides of direct therapeutic value. For example, Mesenchymal stem cells (MSCs) can differentiate into osteogenic, adipogenic, chondrogenic, myocardial, or neural lineages when exposed to specific stimuli, making them attractive for understanding the potential relevance of the AARS polypeptides to a broad range of cell types, and diseases.

[0555] In addition to supporting hematopoietic cells, marrow stromal cells can also be induced to differentiate into cells of different connective tissue lineage, such as bone, cartilage, and fat. The potential of Human Mesenchymal stem cells (hMSCs) to maintain multipotency and proliferate extensively in vitro provides new avenues for cell-based therapy in the restoration of damaged or diseased tissue. Recent reports also indicate that HMSCs are capable of cell fate crossing germ layer boundaries. In addition to differentiating into multi-lineages of the mesoderm, these cells can also differentiate into neurons of ectodermal origin and hepatocyte-like cells of endodermal origin. During the process of differentiation, these cells may modify expression patterns of certain lineage specific transcripts.

[0556] Accordingly the ability of specific AARS polypeptides to modulate specific patterns of genes in HMSCs in a time dependent manner demonstrates that these proteins play potentially significant roles in a broad array of differentiation pathways, as well as diseases and disorders resulting from the dysfunction, or deterioration of these processes, or the corresponding cell types. Moreover AARS polypeptides with the ability to modulate gene transcription in MSCs have significant therapeutic utility to enable the in vitro or in vivo modulation of hematopoiesis, neurogenesis, myogenesis, osteogenesis, and adipogenesis, as well as in a broad range of disorders and diseases, including for example inflammatory responses, autoimmunity, cancer, neuronal degeneration, muscular dystrophy, osteoporosis, and lipodystrophy.

[0557] Human Skeletal Muscle Cells (HSkMC) can undergo differentiation to exhibit actin and myosin myofilaments, and have been used in the study of genetic muscular diseases such as Malignant Hyperthermial. HSkMC also have the potential to act as a cardiac graft, mending damage to the heart. Recently, cultured Human Skeletal Muscle cells have been used in micro gravity experiments to study the effects of low gravity environments on Human Skeletal Muscle.

[0558] Accordingly the ability of specific AARS polypeptides to modulate specific patterns of genes in HSkMC in a time dependent manner demonstrates that these proteins play potentially significant roles in the processes of myogenesis, as well as diseases and disorders resulting from the dysfunction, or deterioration of these processes as well as muscle cell development or metabolism. Accordingly AARS polypeptides with the ability to modulate gene transcription in muscle cells have therapeutic utility in a broad range of diseases including for example, the treatment of metabolic disease, cachexia, various muscle wasting conditions, as well as musculoskeletal diseases.

[0559] Methods:

[0560] The ability of AARS polypeptides to modulate gene expression is assessed using a high-throughput microfluidic real-time quantitative PCR (RT-qPCR) approach (Fluidigm Corporation). (See Petriv et al., (2010) PNAS (doi/10.1073/pnas.1009320107) in Human Marrow Stromal Cells (HMSC) and Human Skeletal Muscle Cells (HSkMC). In the experiments reported here, Human HSkMC (Cat #150-050 and HMSC (Cat #492-050 were purchased from Cell Applications. HMSC cells are cryopreserved at second passage and can be cultured and propagated to 10 population doublings. Here HMSC in the 6th Passage are used. Human Skeletal Muscle Cells (HSkMC) are cryopreserved at second passage and can be cultured and propagated for at least 15 population doublings. In the experiments reported here HSkMC at passage 6 post harvest from normal human donor are used.

[0561] In both cases, cells are plated at 50000 cells/mL in 100 .mu.L volume of growth media and exposed to AARS polypeptides at a concentration of 250 nM, or as otherwise indicated below, for 24 hours and 72 hours. Controls include Differentiation media with a standard cocktail to promote (1) Adipogenesis, (2) Osteogenesis, (3) Chondrogenesis and (4) Skeletal muscle myotube formation. Additional controls include untreated wells containing only growth media. Two wells were run for each Differentiation control. Controls: all media was made utilizing DMEM as the basal media. Standard literature was followed and Differentiation media was purchased from Cell Applications. Per the vendor, differentiation media contained the following additives: Skeletal muscle differentiation cocktail: FBS, insulin, glutamine, FGF, EGF; Adipogenesis cocktail: insulin, dexamethasone and IBMX; Osteogenesis cocktail: FBS, dexamethasone, ascorbate 2 phosphate, beta-glycerophosphate; Chondrogenesis cocktail: insulin, ascorbate-2-phosphate, and TGF-.beta.1.

[0562] Standard protocols for using an ABI (Applied Biosystems, Item # AM1728) TAQMAN.RTM. Gene Expression Cells-to-CT.TM. Kit are utilized to lyse cells and harvest genomic material. An ABI Pre-Amp Mix (Applied Biosystems, Item #4391128) is used to initiate pre-amplification. Gene specific primers are created using a Primer 3 program and purchased from IDT technologies. Fluidigm profiling arrays (Item # BMK-M-96.96) were used for actual quantitative PCR with standard Fluidigm loading reagents and pipetting devices. Table E1 below lists the genes profiled.

TABLE-US-00031 TABLE E1 List of genes assessed in transcriptional profiling Compiled UniqueList refseq_nt Full_name.sub.-- Synonyms ABCA1 NM_005502 ATP-binding cassette, ABC-1|ABC1|CERP|FLJ14958|HDLDT1 sub-family A (ABC1), |MGC164864|MGC165011|TGD member 1 ACTB NM_001101 actin, beta PS1TP5BP1 ACTG1 NM_001614 actin, gamma 1 ACT|ACTG|DFNA20|DFNA26 ACVR2B NM_001106 activin A receptor, type ACTRIIB|ActR-IIB|MGC116908 IIB APOA1 NM_000039 apolipoprotein A-I MGC117399 ARNT NM_178427 aryl hydrocarbon HIF-1beta|HIF1B|HIF1BETA|TANGO receptor nuclear |bHLHe2 translocator BAD NM_032989 BCL2-associated agonist BBC2|BCL2L8 of cell death BCL2 NM_000657 B-cell CLL/lymphoma 2 Bcl-2 BMP2 NM_001200 bone morphogenetic BMP2A protein 2 BMP4 NM_130851 bone morphogenetic BMP2B|BMP2B1|MCOPS6|OFC11|ZYME protein 4 C3AR1 NM_004054 complement component AZ3B|C3AR|HNFAG09 3a receptor 1 CASP3 NM_032991 caspase 3, apoptosis- CPP32|CPP32B|SCA-1 related cysteine peptidase CAV1 NM_001753 caveolin 1, caveolae BSCL3|CGL3|MSTP085|VIP21 protein, 22 kDa CDH5 NM_001795 cadherin 5, type 2 7B4|CD144|FLJ17376 (vascular endothelium) CFLAR NM_003879 CASP8 and FADD-like CASH|CASP8AP1|CLARP|Casper| apoptosis regulator FLAME|FLAME-1|FLAME1|FLIP|I-FLICE |MRIT| c-FLIP|c-FLIPL|c-FLIPR|c-FLIPS COMP NM_000095 cartilage oligomeric EDM1|EPD1|MED|MGC131819|MGC149768| matrix protein PSACH|THBS5 CSF1 NM_172212 colony stimulating factor MCSF|MGC31930 1 (macrophage) CTGF NM_001901 connective tissue growth CCN2|HCS24|IGFBP8|MGC102839|NOV2 factor CTNNB1 NM_001904 catenin (cadherin- CTNNB|DKFZp686D02253|FLJ25606|FLJ37923 associated protein), beta 1, 88 kDa DAAM1 NM_014992 dishevelled associated FLJ41657|KIAA0666 activator of morphogenesis 1 ELN NM_001081755 elastin FLJ38671|FLJ43523|SVAS|WBS|WS ENO1 NM_001428 enolase 1, (alpha) ENO1L1|MPB1|NNE|PPH FABP3 NM_004102 fatty acid binding protein FABP11|H-FABP|MDGI|O-FABP 3, muscle and heart (mammary-derived growth inhibitor) FAK NM_001199649 focal adhesion kinase fak1 FGF4 NM_002007 fibroblast growth factor 4 HBGF-4|HST|HST-1|HSTF1|K-FGF|KFGF FIGF NM_004469 c-fos induced growth VEGF-D|VEGFD factor (vascular endothelial growth factor D) FLT1 NM_002019 fms-related tyrosine FLT|VEGFR1 kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor) FOXA1 NM_004496 forkhead box A1 HNF3A|MGC33105|TCF3A GAPDH NM_002046 glyceraldehyde-3- G3PD|GAPD|MGC88685 phosphate dehydrogenase GFAP NM_002055 glial fibrillary acidic FLJ45472 protein SLC2A4 NM_001042 solute carrier family GLUT4 2 (facilitated glucose transporter), member 4 HAND1 NM_004821 heart and neural crest Hxt|Thing1|bHLHa27|eHand derivatives expressed 1 HIF1A NM_181054 hypoxia inducible factor HIF-1alpha|HIF1|HIF1- 1, alpha subunit (basic ALPHA|MOP1|PASD8|bHLHe78 helix-loop-helix transcription factor) HK2 NM_000189 hexokinase 2 DKFZp686M1669|HKII|HXK2 HMGB1 NM_002128 high-mobility group box DKFZp686A04236|HMG1|HMG3|SBP-1 1 HNF4A NM_178850 hepatocyte nuclear factor FLJ39654|HNF4|HNF4a7|HNF4a8|HNF4a9| 4, alpha HNF4alpha|MODY|MODY1|NR2A1|NR2A21 |TCF|TCF14 HPRT1 NM_000194 hypoxanthine HGPRT|HPRT phosphoribosyltransferase 1 HSPB1 NM_001540 heat shock 27 kDa protein CMT2F|DKFZp586P1322|HMN2B|HS.76067| 1 HSP27|HSP28|Hsp25|SRP27 ICAM1 NM_000201 intercellular adhesion BB2|CD54|P3.58 molecule 1 IFNG NM_000619 interferon, gamma IFG|IFI IGF1 NM_001111285 insulin-like growth factor IGF-I|IGF1A|IGFI 1 (somatomedin C) IGF2 NM_001127598 insulin-like growth factor C11orf43|FLJ22066|FLJ44734|INSIGF|pp9974 2 (somatomedin A) IGFBP3 NM_001013398 insulin-like growth factor BP-53|IBP3 binding protein 3 IGFBP5 NM_000599 insulin-like growth factor IBP5 binding protein 5 IKBKB NM_001556 inhibitor of kappa light FLJ33771|FLJ36218|FLJ38368|FLJ40509| polypeptide gene IKK-beta|IKK2|IKKB|MGC131801|NFKBIKB enhancer in B-cells, kinase beta IL10 NM_000572 interleukin 10 CSIF|IL- 10|IL10A|MGC126450|MGC126451|TGIF IL1B NM_000576 interleukin 1, beta IL-1|IL1-BETA|IL1F2 IL3 NM_000588 interleukin 3 (colony- IL-3|MCGF|MGC79398|MGC79399|MULTI-CSF stimulating factor, multiple) IL4 NM_172348 interleukin 4 BCGF-1|BCGF1|BSF1|IL-4|MGC79402 IL5 NM_000879 interleukin 5 (colony- EDF|IL-5|TRF stimulating factor, eosinophil) IL6R NM_181359 interleukin 6 receptor CD126|IL-6R-1|IL-6R-alpha |IL6RA|MGC104991 IL8 NM_000584 interleukin 8 CXCL8|GCP-1 |GCP1|LECT|LUCT|LYNAP|MDNCF |MONAP|NAF|NAP-1|NAP1 ITGA5 NM_002205 integrin, alpha 5 CD49e|FNRA|VLA5A (fibronectin receptor, alpha polypeptide) KDR NM_002253 kinase insert domain CD309|FLK1|VEGFR|VEGFR2 receptor (a type III receptor tyrosine kinase) LEP NM_000230 leptin FLJ94114|OB|OBS LPL NM_000237 lipoprotein lipase HDLCQ11|LIPD MAPK11 NM_002751 mitogen-activated P38B|P38BETA2|PRKM11|SAPK2|SAPK2B| protein kinase 11 p38-2|p38Beta MMP1 NM_002421 matrix metallopeptidase CLG|CLGN 1 (interstitial collagenase) MMP3 NM_002422 matrix metallopeptidase CHDS6|MGC126102|MGC126103|MGC126104| 3 (stromelysin 1, MMP-3|SL-1|STMY|STMY1|STR1 progelatinase) MYH1 NM_005963 myosin, heavy chain 1, MGC133384|MYHSA1|MYHa|MyHC- skeletal muscle, adult 2X/D|MyHC-2x MYH11 NM_022844 myosin, heavy chain 11, AAT4|DKFZp686D10126|DKFZp686D19237| smooth muscle FAA4|FLJ35232|MGC126726|MGC32963|SM HC|SMMHC MYH7 NM_000257 myosin, heavy chain 7, CMD1S|CMH1|DKFZp451F047|MGC138376| cardiac muscle, beta MGC138378|MPD1|MYHCB|SPMD|SPMM MYOD1 NM_002478 myogenic differentiation MYF3|MYOD|PUM|bHLHc1 1 NFATC1 NM_172390 nuclear factor of MGC138448|NF-ATC|NFAT2|NFATc activated T-cells, cytoplasmic, calcineurin- dependent 1 NFATC2 NM_173091 nuclear factor of NFAT1|NFATP activated T-cells, cytoplasmic, calcineurin- dependent 2 NFKB1 NM_003998 nuclear factor of kappa DKFZp686C01211|EBP-1|KBF1|MGC54151| light polypeptide gene NF-kappa-B|NF-kappaB|NFKB-p105|NFKB- enhancer in B-cells 1 p50|p105|p50 NOS2 NM_000625 nitric oxide synthase 2, HEP-NOS|INOS|NOS|NOS2A inducible NOTCH1 NM_017617 notch 1 TAN1|hN1 NR3C1 NM_001024094 nuclear receptor GCCR|GCR|GR|GRL subfamily 3, group C, member 1 (glucocorticoid receptor) NRP2 NM_201279 neuropilin 2 MGC126574|NP2|NPN2|PRO2714|VEGF165R2 PAX7 NM_013945 paired box 7 FLJ37460|HUP1|PAX7B|RMS2 PDGFB NM_033016 platelet-derived growth FLJ12858|PDGF2|SIS|SSV|c-sis factor beta polypeptide (simian sarcoma viral (v- sis) oncogene homolog) PDK4 NM_002612 pyruvate dehydrogenase FLJ40832 kinase, isozyme 4 PLA2G1B NM_000928 phospholipase A2, group MGC119834|MGC119835|PLA2|PLA2A| IB (pancreas) PPLA2 PLIN1 NM_002666 lipid droplet associated perilipin protein PPARG NM_138712 peroxisome proliferator- CIMT1|GLM1|NR1C3|PPARG1|PPARG2| activated receptor PPARgamma gamma QARS NM_005051 glutaminyl-tRNA GLNRS|PRO2195 synthetase RHOA NM_001664 ras homolog gene family, ARH12|ARHA|RHO12|RHOH12 member A RUNX1 NM_001754 runt-related transcription AML1|AML1-EVI-1|AMLCR1|CBFA2|EVI-1 factor 1 |PEBP2aB RXRA NM_002957 retinoid X receptor, alpha FLJ00280|FLJ00318|FLJ16020|FLJ16733 |MGC102720|NR2B1 SERPINE1 NM_001165413 serpin peptidase PAI|PAI-1|PAI1|PLANH1 inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1 SMAD2 NM_005901 SMAD family member 2 JV18|JV18-1|MADH2|MADR2|MGC22139| MGC34440|hMAD-2|hSMAD2 SMAD4 NM_005359 SMAD family member 4 DPC4|JIP|MADH4 TERT NM_198255 telomerase reverse EST2|TCS1|TP2|TRT|hEST2 transcriptase TGFB1 NM_000660 transforming growth CED|DPD1|LAP|TGFB|TGFbeta factor, beta 1 TGFB3 NM_003239 transforming growth ARVD|FLJ16571|TGF-beta3 factor, beta 3 THBS4 NM_003248 thrombospondin 4 TSP4 TNF NM_000594 tumor necrosis factor DIF|TNF-alpha|TNFA|TNFSF2 TUBB NM_178014 tubulin, beta M40|MGC117247|MGC16435|OK/SW-c1.56 |TUBB1|TUBB5 TUBB1 NM_030773 tubulin, beta 1 tubulin isoform beta (1) TUBG1 NM_001070 tubulin, gamma 1 GCP-1|TUBG|TUBGCP1 VCAM1 NM_080682 vascular cell adhesion CD106|DKFZp779G2333|INCAM-100 molecule 1 |MGC99561 VEGFA NM_003376 vascular endothelial MGC70609|MVCD1|VEGF|VPF growth factor A VIM NM_003380 vimentin FLJ36605 WISP1 NM_080838 WNT1 inducible CCN4|WISP1c|WISP1i|WISP1tc signaling pathway protein 1 WNT1 NM_005430 wingless-type MMTV INT1 integration site family, member 1

[0563] Bioinformatics Analysis:

[0564] Data retrieved in .csv format from the Biomark machine by Fluidigm is converted to a tabular format including sample, mRNA, and replicate information along with the raw fluorescence value. PCR reactions that failed are marked as missing. Multiple experiments were combined after normalizing to total expression of mRNA species. All measured mRNA expression is filtered based on the requirement of detection in at least 2 of all of the biological replicates tested. We assessed technical, biological and set deviation mean in entire dataset.

[0565] For data analysis Ct values for all genes of interest are first normalized to the averaged Ct values for housekeeping genes from the corresponding sample to obtain .DELTA.Ct values (.DELTA.Ct=Ct gene-Ct average housekeeping genes). Genes from each sample are then normalized to the same gene in untreated control to obtain .DELTA..DELTA.Ct values (.DELTA..DELTA.Ct=.DELTA.Ct control sample-.DELTA.Ct treated sample).

[0566] To obtain fold change values up-regulated genes (i.e. .DELTA..DELTA.Cts greater than 0) are subject to the following calculation: Fold Change=2{circumflex over ( )}.DELTA..DELTA.Ct. For down-regulated genes (i.e. .DELTA..DELTA.Cts less than 0): Fold Change=-(2{circumflex over ( )}|.DELTA..DELTA.Ct|).

[0567] Cellular Proliferation Assays (Assays A1-A11 in the Data Tables Below)

[0568] Background and Therapeutic Relevance:

[0569] The ability to modulate the rate of cellular proliferation and apoptosis of different cell types represents a fundamental property of many therapeutic compounds, and is of direct relevance to the treatment and prevention of a broad range of diseases and disorders.

[0570] Accordingly AARS polypeptides with the ability to modulate the rate of cellular proliferation and or apoptosis have significant therapeutic utility in a broad range of diseases including, as growth factors, and differentiation factors for stem cells, and in treatment regimens to enhance or suppress the proliferation of specific cell types of interest in vivo or in vitro, including for example, haemopoietic cells, immunomodulatory cells, cancer, and for the treatment and prevention of diseases associated with aging, including for example neurodegeneration, peripheral neuropathy, and loss of muscular and soft tissue tone.

[0571] Methods:

[0572] Effects of the AARS polypeptides on cellular proliferation is assessed using one or more of the methods listed below, and as more specifically elaborated in the methods below.

[0573] Hoechst 33432.

[0574] Standard cell counts to assess proliferation are performed using Hoechst 33432, which is a cell-permeant nuclear counterstain that emits blue fluorescence when bound to dsDNA. It is available as a solution (Invitrogen Cat # H-3570) that is used at a final concentration of 1 ug/mL in either media or PBS. Cells are grown in 96 well plates in the presence of AARS polypeptides for a standard growth time of 48 hours, or longer depending on cell type and as described in the examples below.

[0575] Atp-Lite.

[0576] Cellular ATP levels correlate with cellular health and can be readily determined using a variety of commercially available kits. ATP-lite (Perkin-Elmer, Cat #6016947 Boston, Mass. 02481) which is a homogenous mixture of lysis solution and ATP-detection reagent. is pre-mixed before use and is used 1:1 v:v ratio with cultured cells. Plates are incubated for 5 minutes to promote lysis and plates are measured using a luminescent plate reader. Cells are grown in 96 well plates in the presence of AARS polypeptides for a standard growth time of 48 hours, or longer depending on cell type and as described in the examples below.

[0577] ALAMARBLUE.RTM. (Resazurin) is a cell viability indicator which is based on the redox state of the cells. Resazurin, the active ingredient, is a nontoxic, cell permeable compound that is blue in color and virtually nonfluorescent when present in its oxidized form. However upon entering normal viable cells, resazurin is rapidly reduced to resorufin, which produces a red fluorescence signal. Viable cells continuously convert resazurin to resorufin, thereby generating a quantitative measure of viability--and cytotoxicity. The lack of toxicity allows long-term exposure of cells to resazurin without negative impact; cells grown in the presence of resazurin were found to produce similar numbers of viable cells as control cells, as determined by flow cytometric analysis.

[0578] Measurements are made by adding a solution of Resazurin/ALAMARBLUE.RTM. to cells, incubating them for 1-4 hours, and reading the fluorescence or absorbance. The amount of fluorescence or absorbance is proportional to the number of living cells and corresponds to the cells metabolic activity. Damaged and nonviable cells have lower innate metabolic activity and thus generate a proportionally lower signal than healthy cells. After incubation with ALAMARBLUE.RTM., samples can readily be measured on fluorescence and absorbance instrumentation. For fluorescence readings: 530 nm excitation and 590 nm emission filter settings are used.

[0579] Cells are grown in 96 well plates in the presence of AARS polypeptides for a standard growth time of 48 hours, or longer depending on cell type and as described in the examples below.

[0580] Acetylated LDL Uptake in Hepg2C3A Human Hepatocyte Cells.

[0581] (Assay B1 in the Data Tables Below)

[0582] Background and Therapeutic Relevance:

[0583] LDL is the major carrier of cholesterol in the blood, accounting for more than 60% of the cholesterol in plasma. In humans, the hepatic LDL receptor is responsible for clearing around 70% of plasma LDL from circulation. Internalized LDL is degraded to free cholesterol and amino acids in the lysosome. The liver is the most important organ for LDL catabolism and LDL receptor activity in humans. LDL that is not internalized and remains in circulation can be transported by endothelial cells into the vessel wall, resulting in the formation of atherosclerotic plaques. Circulating LDL can also be taken up by macrophages and this can also contribute to the formation of plaques. Increasing LDL uptake into hepatic tissue is thought to be beneficial to human health and finding safe and efficacious therapeutics that may the positively regulate this process may provide new therapies for cardiovascular and metabolic diseases. To investigate whether the unique properties of AARS polypeptides can regulate uptake of acetylated LDL, a standard assay for measuring acetylated LDL uptake is employed in HepG2C3a cells.

[0584] Accordingly AARS polypeptides with the ability to modulate LDL uptake have significant therapeutic utility in a broad range of diseases including for example, the treatment of hypercholesteremia, hyperlipidemia, type 1 and 2 diabetes, metabolic syndrome, and vascular diseases including atherosclerosis

[0585] Methods:

[0586] HEPG2C3a cells (ATCC # CRL-10741) are maintained in Eagles Minimal Essential (EMEM) medium supplemented with 10% FBS (HyClone Cat # SH30910.03), 50u/mL penicillin/50 .mu.g/mL streptomycin, (Invitrogen) in 15 mL medium in 75 mL flasks. Cells are grown at 37.degree. C., 5% CO.sub.2, in a humidified environment and utilized in BSL2 certified tissue culture hoods using sterile technique and appropriate personal protective equipment including goggles, gloves and lab coats. HEPG2C3a express the LDL-receptor and are competent for acetylated LDL uptake when grown on clear bottom collagen coated plates. A 100 .mu.L volume of cells is plated on collagen coated plates (Invitrogen Cat # A11428) overnight in complete medium (above) at a cell density of 50,000 cells/mL. Cells are washed once with PBS (Invitrogen Cat #10010) and 80 .mu.L of serum free EMEM is added to each well. AARS polypeptides at a final concentration of 250 nM per well are added in a consistent volume in sterile PBS to each well. A unique AARS polypeptide is placed in each well. Cells are serum starved and exposed to the AARS polypeptides for 16 hours. Following the 16 hour incubation, the, supernatant is collected and soluble ICAM is measured using a standard ELISA kit from RND Systems (Cat # DY643; Data Table F), and serum free media supplemented with 5 .mu.g/mL ac-LDL (Alexa Fluor 488 labeled Cat # L23380, Invitrogen) is added to each well. Following a 2 hour incubation at 37.degree. C. 5% CO.sub.2, cells are washed twice with sterile PBS before 100 .mu.L PBS is added to each well for quantification. Plates were analyzed for total fluorescent intensity using a bottom read on a Victor X5 fluorescent plate reader (Perkin Elmer) at an excitation wavelength centered around 485 nm, and an emission wavelength centered around 535 nm. Cells are stained with Hoechst dye and fluorescent intensity 405 nm Excitation/450 nM Emission is read to confirm total cell number is consistent across the plate.

Regulation of Human Neutrophil Oxidative Burst and Elastase Production (Assays C1-C3 in the Data Tables Below)

[0587] Neutrophil Oxidative Burst

[0588] Background and Therapeutic Relevance:

[0589] Phagocytosis by polymorphonuclear neutrophils and monocytes constitutes an essential arm of host defense against infections by microorganisms including bacteria and fungi. The phagocytic process can be separated into several major stages: chemotaxis (migration of phagocytes to inflammatory sites), attachment of particles to the cell surface of phagocytes, ingestion (phagocytosis) and intracellular killing by oxygen-dependent (oxidative burst) and oxygen-independent mechanisms. Reduced or missing burst activity is observed in inborne defects like the chronic granulomatous disease (CGD). CGD is a heterogeneous group of inherited disorders that usually manifests itself during the first two years of life. The disease is characterized by repeated and life-threatening infections caused by bacterial and fungal organisms. These infections typically consist of pneumonia, lymphadenitis, or abscesses that involve lymph nodes, lungs, and liver. The NADPH oxidase is the enzyme system responsible for producing superoxide anion, which is quickly converted to hydrogen peroxide and hydroxyl radicals. Abnormalities in the constituent peptides of the NADPH oxidase enzyme system lead to the dysfunctions characteristic of CGD. Neutrophils from CGD patients fail to produce a significant oxidative burst following stimulation. Different forms of CGD are described (classical X-linked CGD and autosomal recessive patterns). The oxidative burst of granulocytes is impaired in transplantation, later stages of HIV infection, and in the elderly, making these populations more susceptible to secondary infection and exacerbations of inflammatory disease. Various immunomodulators (e.g., cytokines (GM-CSF, G-CSF, TNF) or drugs) also seem to have effects on the oxidative burst. There is the potential for proteins with the ability to up-regulate or down-regulate oxidative burst in a therapeutic fashion to be useful for a variety of different disease states.

[0590] Methods:

[0591] The protein kinase C ligand phorbol 12-myristate 13-acetate (PMA) can be utilized in this assay as an agonist of the oxidative burst process. Heparinized whole blood is mixed with sterile dextran (0.6% final concentration) for 1 hour and allowed to separate into layers. The lower layer contains neutrophil, monocytes and red blood cells. An ammonium chloride lysis step is utilized to remove all RBCs and a 97% pure population of neutrophils with approximately 3% monocyte contamination remains following lysis step. Upon stimulation, granulocytes and monocytes produce reactive oxygen metabolites (superoxide anion, hydrogen peroxide, hypochlorous acid) which destroy bacteria inside the phagosome. Formation of the reactive oxidants during the oxidative burst can be monitored by the addition and oxidation of Amplex Red. The percentage of cells having produced reactive oxygen radicals are then analyzed as well as their mean fluorescence intensity using a fluorescent plate reader. The typical time course for this reaction is 10 minutes, with obvious burst being seen by 2 minutes and a drop off of signal being seen by 20 minutes. This assay can be run in agonist mode in the absence of PMA or in antagonist mode, with concomitant administration of AARS polypeptides and PMA at a concentration that is below the EC50 for this compound.

[0592] Regulation of Human Neutrophil Elastase Production

[0593] Background and Therapeutic Relevance:

[0594] Neutrophil elastase is a serine protease that has been implicated as having a specific role in the development of various human disease states. The wide range of activities make this a versatile enzyme with pleiotrophic effects in diseases of the lung and cardiovascular system. Elastase is seen as a two edged sword and the range of activity appears to be tissue specific. Although its key physiologic role is in innate host defense, it can also participate in tissue remodeling and possesses secretagogue actions that are now recognized as important to local inflammatory signals. Neutrophil elastase activity has been implicated in the development of emphysema for several decades, however only relatively recently has a pathogenetic function been ascribed to this serine proteinase in situations where excessive extracellular matrix deposition occurs. The use of genetically manipulated animal models is starting to uncover the potential ways in which its actions might influence fibrotic lung repair. Emerging evidence suggests that the engagement of cellular pathways with more direct effects on fibrogenic mediator generation and collagen synthesis appears to underpin the actions of neutrophil elastase in promoting lung matrix accumulation. Human neutrophil elastase is also present within atherosclerotic plaques where it contributes to matrix degradation and weakening of the vessel wall associated with the complications of aneurysm formation and plaque rupture. It is joined by other extracellular proteases in these actions but the broad range of substrates and potency of this enzyme coupled with activity associated with neutrophil degranulation single this disruptive protease out as therapeutic target in atherosclerotic disease.

[0595] Methods:

[0596] This assay uses the ENZCHEK.RTM. Elastase Assay Kit (Invitrogen Catalog # E-12056). Neutrophils are prepared from fresh human blood using a 6% dextran solution and red blood cells are lysed before plating cells in RPMI media (media should be un-supplemented with no serum, no antibiotics). A 1.0 mg/mL stock solution of the DQ elastin substrate is prepared by adding 1.0 mL of deionized water (dH2O) directly to one of the three vials containing the lyophilized substrate and mixing to dissolve. 1.times. Reaction Buffer is prepared by diluting 6 mL of the 10.times. Reaction Buffer in 54 mL dH2O. A 100 .mu.g/mL working solution of the DQ elastin substrate is prepared by diluting the DQ elastin stock solution tenfold in 1.times. Reaction Buffer. Porcine pancreatic elastase stock solution is prepared by making a 100 U/mL stock solution in dH2O. To assay for elastase activity, 50 .mu.L of 1.times. Reaction Buffer is pipette into each assay well containing 500,000 neutrophils/mL in a 30 .mu.L volume. 8 .mu.L of each AARS polypeptide is added per well, and the sample incubated for 20 minutes at 37.degree. C. 50 .mu.L of 100 .mu.g/mL DQ elastin working solution is added to each well and mixed. Samples are incubated at room temperature, protected from light, for 30 minutes. Fluorescence intensity in a fluorescence microplate reader equipped with standard fluorescein filters (ex 485/Em 535) fluorescence may be measured over multiple time points.

[0597] Binding to Toll-Like Receptors and Activation of NFkB (Assays D1-D4 in the Data Tables Below)

[0598] Background and Therapeutic Relevance:

[0599] Macrophages are major players in the innate immune system and express a large repertoire of different classes of pattern recognition receptors (PRRs), including the family of Toll-like receptors (TLRs) which are powerful regulators and controllers of the immune response.

[0600] Stimulation of TLRs by microbial pathogens and endogenous ligands initiates signaling cascades that induce the secretion of pro-inflammatory cytokines and effector cytokines that direct downstream adaptive immune responses. Endogenous ligands, as well as microbial components, are recognized by and can activate TLRs, raising the possibility that these receptors may be critical targets for the development of new therapies for multiple diseases.

[0601] Accordingly AARS polypeptides that modulate TLR receptor activity, have therapeutic utility in a broad range of diseases and disorders including for example, inflammatory diseases and disorders, autoimmune diseases, tissue transplantation/organ rejection, cancer prevention or treatment, the modulation of haematopoiesis and infection.

[0602] Measurement of TLR Activation in RAW-BLUE Cells

[0603] Mouse macrophages sold under the trademark RAW-BLUE.TM. cells (Invivogen, Catalog code: raw-sp) express all TLRs except TLR5 and include a secreted embryonic alkaline phosphatase (SEAP) gene which is inducible by NF-kB and AP-1 transcription factors. Upon TLR stimulation, RAW-BLUE.TM. cells activate NF-kB and/or AP-1 leading to the secretion of SEAP which is measurable when using SEAP detection medium.

[0604] Methods:

[0605] RAW-BLUE.TM. cells are washed twice with PBS, trypsinized and resuspended in fresh Growth Medium (Growth Medium: DMEM, 4.5 g/l glucose, 10% heat-inactivated fetal bovine serum (30 minutes at 56.degree. C.), 100 mg/mL ZEOCIN.TM. 2 mM L-glutamine). Cells are plated at a concentration of 50,000 cells/well in a 96 well plate in a total volume of 100 .mu.L, and AARS polypeptides, controls, or AARS polypeptides (+LPS) are added to each well at the concentrations shown in the experiments outlined below. Cells are incubated at 37.degree. C. in a 5% CO.sub.2 incubator for 18 hours. On experimental day 2, SEAP detection medium (QUANTI-BLUE.TM.) (Invivogen Catalog code: rep-qbl) is prepared following the instructions and 120 .mu.L is added per well to a clear flat-bottom 96-well plate, and cell supernatant is added (20 .mu.L). Samples are incubated at 37.degree. C. for about 30 minutes to up to 2 hours. SEAP levels are determined using a spectrophotometer and reading absorbance at 650 nM.

[0606] To detect AARS polypeptides that specifically block TLR activation this assay can be modified to identify potential TLR antagonists. In this case AARS polypeptides are added to the cells at a final concentration of about 250 nM per well, (or as otherwise specified in the Examples below) 1 hour prior to adding 50 ng/mL LPS. Cells are incubated and SEAP detected as described above. PBS control wells with no LPS or AARS polypeptide alone added are used to find the basal level of TLR stimulation at the time of the measurement. Control wells are pretreated with PBS and known TLR agonists and antagonists. The ratio of the background subtracted [PBS plus LPS signal] to [AARS polypeptide plus LPS signal] is used to determine percent antagonism.

[0607] Human TLR Screening in Hek293 Cells

[0608] Human HEK293 cells are genetically modified and sold under the trademark HEK-Blue.TM. TLR cells (Invivogen). The TLR2 and TLR4 versions of this cell type selectively express all TLR2 or TLR4 and include a secreted embryonic alkaline phosphatase (SEAP)reporter gene under the control of an IFN-beta minimal promoter which is fused to five NF-kB and AP-1 transcription factors binding sites. With the use of specific TLR 2 or 4 agonists (respectively), Hek-Blue.TM. TLR2 and Hek-Blue.TM. TLR4 cells activate NF-kB and/or AP-1 leading to the secretion of SEAP which is measurable when using SEAP detection reagent. The Hek-Blue.TM. TLR2 cells are co-transfected with the LPS co-receptor protein CD14 to enhance TLR2 responsiveness and improve signal quality. The parent cell expresses endogenous levels of TLR1, 3, 5, 6 and also NOD1.

[0609] Methods:

[0610] HEK-Blue.TM.-TLR2 or HEK-Blue.TM.-TLR4 cells are washed twice with PBS, trypsinized and resuspended in fresh Growth Medium (Growth Medium: DMEM, 4.5 g/L glucose, 10% heat-inactivated fetal bovine serum (30 minutes at 56.degree. C.), 100 mg/mL ZEOCIN.TM., 2 mM L-glutamine). Cells are plated at a concentration of 50,000 cells/well in a 96 well plate in a total volume of 100 .mu.L, and AARS polypeptides, controls, or AARS polypeptides (+LPS) are added to each well at the concentrations shown in the experiments outlined below. Cells are incubated at 37.degree. C. in a 5% CO.sub.2 incubator for 18 hours. On experimental day 2, SEAP detection medium (QUANTI-BLUE.TM.) (Invivogen Catalog code: rep-qbl) is prepared following the instructions and 120 .mu.L is added per well to a clear flat-bottom 96-well plate, and cell supernatant is added (20 .mu.L). Samples are incubated at 37.degree. C. for about 30 minutes to up to 2 hours. SEAP levels are determined using a spectrophotometer and reading absorbance at 650 nM. Control wells are pretreated with PBS and known TLR agonists such as UltraPure LPS (TLR-4) or PAM3CSK4 (TLR-2). The ratio of the background subtracted [PBS plus LPS signal] to [AARS polypeptide plus LPS signal] is used to determine percent agonism.

Cytokine Release (Assays E1-E16 in the Data Tables Below)

[0611] Background and Therapeutic Relevance:

[0612] Cytokines are a diverse set of small cell signaling protein molecules that are used extensively for intercellular communication, and play significant roles in normal body homeostasis, including immunomodulation and regulation. Accordingly AARS polypeptides that modulate the release, or biological activities of cytokines, have therapeutic utility in a broad range of diseases and disorders including for example, inflammatory diseases and disorders, autoimmune diseases, tissue transplantation/organ rejection, cancer prevention or treatment, the modulation of haematopoiesis and infection.

[0613] Cytokine Release from Cells in Culture

[0614] Methods:

[0615] Test cells are seeded into a 24-well plate at density of about 1 million cells/well in 1 mL of growth media. Cells are treated with either AARS polypeptide (at the concentrations shown in the examples below) or an equal volume of PBS and incubated overnight at 37.degree. with 5% CO.sub.2. Following cell treatment, samples are centrifuged at 4.degree. C. in a swinging bucket centrifuge at 2,000.times.g for 5 minutes. Media is carefully removed so as to not disturb the cell pellet and transferred to a new tube. Samples are assayed immediately or snap frozen in liquid nitrogen for subsequent analysis. Cytokine release (including the cytokines MIF, IL-8, IL-10, Serpin E1, GM-CSF, GRO, IL-1 alpha, IL-1 beta, IL-1ra, IL-6, MCP-1, MIP-1, RANTES and TNF-alpha) is determined using commercially available kits (R&D Systems, Inc, MN, USA) or via a contract research organization (MD Biosciences (St. Paul, Minn.).

[0616] Cytokine Release from Human Whole Blood

[0617] Methods:

[0618] Human whole blood is obtained from normal human donors and collected with heparin in standard collection tubes. Blood is used on the same day as it is collected to ensure adequate cell health. Blood is mixed gently and plated in an 100 .mu.L volume into 96 well polycarbonate V bottom plates. AARS polypeptides are added and slowly mixed into blood 2.times. using a multichannel pipet set on 50 .mu.L. Filter tips are used for all experimentation and full PPE is worn. All experimentation occurs in a dedicated biosafety hood that is suitable for experimentation with human blood. Blood is incubated overnight at 37.degree. C. with 5% CO.sub.2. Following cell treatment, samples are centrifuged in a swinging bucket centrifuge at 2,000.times.g for 5 minutes. Supernatant is collected for cytokine ELISAs ELISA are performed as described previously.

[0619] Cytokine Release from PBMCs

[0620] Methods:

[0621] To isolate peripheral blood mononuclear cells freshly isolated human whole blood is gently layered over Sigma HISTOPAQUE.RTM.-1077 at a ratio of 1:1 in 50 mL conical tubes at room temperature. Layered samples are centrifuged at 400.times. g in a swinging bucket clinical centrifuge for 30 minutes at room temperature with no brake. The white cellular layer at the interface between the plasma and density gradient is then removed by pipet. These peripheral blood mononuclear cells are washed twice with RPMI-1640 (Invitrogen #22400-105) by dilution and centrifugation for 10 minutes at 250.times. g. The washed PBMC were resuspended in RPMI-1640+10% FBS and plated at 1.times.106 cells/mL.

[0622] Cytokine Release from Human Synoviocytes

[0623] Background and Therapeutic Relevance:

[0624] A large number of studies have demonstrated that IL-6 and IL-8 are overproduced in several diseases, and thus may play a fundamental role in the pathogenesis of inflammatory disease. IL-6 activates endothelial cell production, leading to the release of IL-8 and monocyte chemoattractant protein, expression of adhesion molecules, and recruitment of leukocytes to inflammatory sites. These cytokines are expressed in cell types associated with inflammatory disease, including cells involved in the pathogenesis of systemic juvenile arthritis, systemic lupus erythematosus, Crohn's disease, and rheumatoid arthritis. One of the most important systemic actions of cytokine production is the induction of the acute phase response. Acute phase proteins are produced primarily by the liver and include proteins that promote the immune response through activation of complement, induction of proinflammatory cytokines, and stimulation of neutrophil chemotaxis. Alternatively, the acute phase response can be helpful, and acute-phase proteins, such as proteinase antagonists, opsonins, and procoagulants, help limit tissue destruction by resolving inflammation. In particular, IL-6 can stimulate synoviocyte proliferation and osteoclast activation, leading to synovial pannus formation and repair. IL-6 acts with IL-1 to increase production of matrix metalloproteinases, which may contribute to joint and cartilage destruction. However, IL-6 may also have protective effects in the joint, as suggested by the finding that this cytokine induces the expression of the tissue inhibitor of metalloproteinase and stimulates proteoglycan synthesis when injected into the joints of mice with antigen-induced arthritis. Human Fibroblast-Like Synoviocytes-Rheumatoid Arthritis (HFLS-RA) are isolated from synovial tissues obtained from patients with Rheumatoid Arthritis (RA). They are cryopreserved at second passage and can be cultured and propagated at least 5 population doublings. HFLS are long known for their role in joint destruction by producing cytokines and metalloproteinases that contribute to cartilage degradation.

[0625] Accordingly AARS polypeptides with the ability to modulate the growth, differentiation, or cytokine release profile of fibroblast-like synoviocytes-rheumatoid arthritis (HFLS-RA) have therapeutic utility in a broad range of diseases including for example, the treatment of inflammatory diseases and disorders including systemic juvenile arthritis, systemic lupus erythematosus, Crohn's disease, and rheumatoid arthritis.

[0626] Methods:

[0627] HFLS-RA, adult cells (Cell Applications Cat #408RA-05a) are maintained in Synoviocyte Growth Medium (Cell Applications Cat #415-50) in 15 mL medium in 125 mL flasks for 1 passage before use. Cells are maintained at 37.degree. C., 5% CO.sub.2, in a humidified environment and utilized in BSL2 certified tissue culture hoods using sterile technique and appropriate personal protective equipment including goggles, gloves and lab coats. An 80 .mu.L volume of cells is plated overnight in growth medium at a cell density of about 50,000 cells/mL. AARS polypeptides at a final concentration of 250 nM per well (or as otherwise indicated in the examples below) are added in sterile PBS to each well following overnight adherence. Control wells contain untreated cells and are incubated with an equivalent volume of PBS. Cells are exposed to proteins or PBS in basal media (Cell Applications Cat #310-470) for 24 hours. Supernatant is removed and IL-8, IL-6 and TNFa ELISA assays are run according to manufacturer's instructions (RND Systems, Cat # DY206 and DY-208, DY-210 Duo-set kits). Proliferation is assessed with Resazurin as described previously by adding fresh media containing Resazurin to plates following supernatant removal and incubating for three hours at 37.degree. C. Plates are read on a fluorescent plate reader and viability/proliferation is expressed as a function of resorufin associated fluorescence of AARS polypeptide treated wells divided by resorufin associated fluorescence of PBS only treated wells.

[0628] Human Astrocyte Proliferation and Inflammatory Cytokine Production

[0629] Background and Therapeutic Relevance:

[0630] Human astrocytes (HA) are derived from human cerebral cortex. They are cryopreserved at second passage and can be cultured and propagated 10 population doublings. HA are the most abundant cells in the central nervous system and they perform many functions such as provision of mechanical support and nutrients to neurons, and removal of wastes from neurons. In addition to playing a critical support role for optimal neuronal functioning, they also provide biochemical support of endothelial cells which form the blood-brain barrier. Recent studies have shown that astrocytes are capable of regulating neurogenesis by instructing the stem cells to adopt a neuronal fate and controlling the function of single synapses, participate actively in the transfer and storage of information in the brain. Recognition of the importance of astrocytes in nervous system functioning is increasing, HA can serve as useful in vitro model for exploring the diversity of astrocytes functions. Astrocytes have been shown to proliferate in response to IL6 and TNFalpha. In addition, these cells are capable of making their own IL6 and TNFalpha. Thus AARS polypeptides which modulate the proliferation and cytokine production in HA have therapeutic utility in a variety of neurological diseases including neuro-inflammation, neurodegeneration, tumorigenesis of the brain, and brain ischemia and repair.

[0631] Methods:

[0632] Human Astrocytes (HA) from Cell Applications (Cat #882K-05f) are maintained in Cell Applications HA Cell Growth Medium (Cat #821-500) according to manufacturer's instructions. Cells are maintained at 37.degree. C., 5% CO.sub.2, in a humidified environment and utilized in BSL2 certified tissue culture hoods using sterile technique and appropriate personal protective equipment including goggles, gloves and lab coats. An 80 .mu.L volume of cells is plated on collagen coated plates overnight in complete medium (above) at a cell density of 50,000 cells/mL. Cells are washed once with PBS and 80 .mu.L of serum free growth media is added to each well. AARS polypeptides at a final concentration of 250 nM per well (or as otherwise described in the examples below) are added in a consistent volume in sterile PBS to each well. Cells are exposed to AARS polypeptides for 48 hours and spent media is removed for cytokine assessment (as described previously). Cells are exposed to proteins or PBS in basal media (Cell Applications Cat #310-470) for 48 hours. Supernatant is removed and IL-8 and IL-6 ELISA assays are run according to manufacturer's instructions (RND Systems, Cat # DY206 and DY-208, DY-210 Duo-set kits). Proliferation is assessed with Resazurin as described previously by adding fresh media containing Resazurin to plates following supernatant removal and incubating for three hours at 37.degree. C. Plates are read on a fluorescent plate reader and viability/proliferation is expressed as a function of resorufin associated fluorescence of AARS polypeptide treated wells divided by resorufin associated fluorescence of PBS only treated wells.

[0633] Human Lung Microvascular Endothelial Cell (HLMVEC) Proliferation and Inflammatory Cytokine Production.

[0634] Background and Therapeutic Relevance:

[0635] The pulmonary vasculature is of great physiological/pathological significance. It is now recognized to be a tissue composed of metabolically active, functionally responsive cells, that interact with circulating substrates and formed elements in ways that regulate the composition of systemic arterial blood, affect target organ functions, and contribute to thrombosis, hemostasis and immune reactions, as well as tumor metastasis. Human lung microvascular endothelial cells (HLMVEC) exhibit elevated expression of chemoattractant cytokines and cell adhesion molecules that provide critical cues for directed migration of leucocytes into the lung during acute lung injury. This primary cell type can be useful tool for studying various aspects of pathology and biology of the pulmonary microvasculature in vitro. Alteration in the structure and function of the microvasculature in response to inflammatory stimuli is believed to be a key factor in organ damage and under appropriate conditions, may provide a stimulus for repair. A significant cause of these vascular alterations is the induction of an inflammatory reaction involving leukocyte infiltration. A variety of studies focused on granulocyte adhesion to the endothelium have revealed that leukocyte recruitment and emigration involves a well-orchestrated adhesion cascade. The adhesion cascade begins when the granulocyte attaches to the endothelium and begins to roll in the direction of fluid flow at a low velocity. As the granulocyte rolls, it becomes activated, subsequently firmly adheres to the endothelium, and migrates across the endothelium into the extravascular space. These adhesion events are mediated, in part, by molecular interactions that occur between CAMs on the surface of the granulocytes and cognate glycoproteins present on the endothelium. A variety of studies have revealed that the endothelial cell adhesion molecule E-selectin can interact with SLex-type glycan presenting granulocyte ligands to mediate the attachment and rolling steps of the adhesion cascade. The downstream steps of the cascade involve the interaction of endothelial-expressed intercellular adhesion molecule with granulocyte-expressed CD18 integrins.

[0636] Thus AARS polypeptides which modulate proliferation and/or cytokine production of human lung microvascular endothelial cells have therapeutic utility in a variety of vascular and pulmonary diseases including inflammatory and obstructive lung diseases including for example, pulmonary hypertension, chronic obstructive pulmonary disease, idiopathic pulmonary fibrosis, and asthma.

[0637] Methods:

[0638] HLMVEC (Cell Applications, Catalog #540-05) are maintained in Cell Applications Microvascular Endothelial Cell Growth Medium (Cat #111-500), For appropriate growth, an Attachment Factor Solution containing collagen (Cell Applications, Catalog #123-100), is used to coat plates and flasks before plating cells. Cells are maintained at 37.degree. C., 5% CO.sub.2, in a humidified environment and utilized in BSL2 certified tissue culture hoods using sterile technique and appropriate personal protective equipment including goggles, gloves and lab coats. A 800_, volume of cells is plated on collagen coated plates overnight in complete medium (above) at a cell density of 50,000 cells/mL. Cells are washed once with PBS and 80 .mu.L of serum free growth media is added to each well. AARS polypeptides at a final concentration of 250 nM per well (or as otherwise described in the examples below) are added in a consistent volume in sterile PBS to each well. Cells are exposed to AARS polypeptides for 48 hours and spent media is removed for ELISA for cell adhesion molecules and cytokine assessment (as described previously). Cell adhesion molecules including soluble VCAM and/or ICAM are measured using a standard ELISA kit from RND Systems (Cat # DY643 and DY720 respectively). Proliferation is assessed with Resazurin as described previously by adding fresh media containing Resazurin to plates following supernatant removal and incubating for three hours at 37.degree. C. Plates are read on a fluorescent plate reader and viability/proliferation is expressed as a function of resorufin associated fluorescence of AARS polypeptide treated wells divided by resorufin associated fluorescence of PBS only treated wells.

[0639] Cell Adhesion ((Assays F1-F7 in the Data Tables Below)

[0640] Background and Therapeutic Relevance:

[0641] Cell Adhesion Molecules (CAMs) are proteins located on the cell surface which are involved with the binding with other cells or with the extracellular matrix (ECM) in the process called cell adhesion. These proteins are typically transmembrane receptors and are composed of three domains: an intracellular domain that interacts with the cytoskeleton, a transmembrane domain, and an extracellular domain that interacts either with other CAMs of the same kind (homophilic binding) or with other CAMs or the extracellular matrix (heterophilic binding). Most of the CAMs belong to four protein families: Ig (immunoglobulin) superfamily (IgSF CAMs), the integrins, the cadherins, and the selectins. The immunoglobulin superfamily (IgSF) cell adhesion molecules are calcium-independent transmembrane glycoproteins, including: neural cell adhesion molecules (NCAMs), intercellular cell adhesion molecules (ICAMs), vascular cell adhesion molecule (VCAM), platelet-endothelial cell adhesion molecule (PECAM-1), endothelial cell-selective adhesion molecule (ESAM), junctional adhesion molecule (JAMs), nectins, and other cell adhesion molecules.

[0642] Cell adhesion molecules are cell surface glycoproteins that are critical for leukocyte adhesion to the sinusoidal endothelium and transmigration and cytotoxicity in a variety of inflammatory liver diseases. ICAM-1 plays an important role in inflammation, and the increased expression of ICAM-1 on endothelial cells is reflected in the activation of endothelial cells. ICAM-1 is of particular importance since it mediates firm endothelial adhesion and facilitates leukocyte transmigration. Studies have shown that there is an upregulation of ICAM-1 on both sinusoidal cells and hepatocytes in inflammatory liver conditions such as hepatitis B viral infection, autoimmune liver disorders, alcoholic hepatitis, and liver allograft rejection.

[0643] Thus AARS polypeptides which modulate cell adhesion molecule production and cell adhesion to endothelial cells have therapeutic utility in a variety of inflammatory diseases including for example, cardiovascular diseases, atherosclerosis, autoimmunity and pulmonary hypertension.

[0644] Methods:

[0645] Human umbilical vein cells (ATCC, Cat # CRL-2873) (HUVEC) are seeded at a concentration of about 1.2.times.10.sup.5 cells/well in 12 well plates coated with human fibronectin attachment solution in the suggested ATCC media and supplements and grown according to manufacturer's instructions. Cells are stimulated with AARS polypeptides at the indicated concentrations, or PBS alone, and incubated overnight in growth media. Human acute monocytic leukemia (THP-1 (TIB-202)), cells are resuspended into 0.1% BSA/RPMI serum free medium with calcein AM (6 .mu.L/mL; Invitrogen Cat # C1430) and incubated for 30 minutes. Labeled cells are collected and resuspended in RPMI medium containing 10% FBS, and the density adjusted to 2.times.10.sup.6 cells/mL.

[0646] 100 .mu.L (2.times.10.sup.5) labeled THP-1 cells are placed into each well of the HUVEC monolayer in 1 mL of growth media and incubated for 15 minutes. The wells are washed twice with PBS to remove unbound cells, and then the cells are read by fluorescent plate reader with an Excitation wavelength of 488 nm and an Emission wavelength of 530 nm.

[0647] Cellular Differentiation (Assays G1-G4 in the Data Tables Below)

[0648] Adipocyte differentiation and proliferation in primary human pre-adipocyte cells.

[0649] Background and Therapeutic Relevance:

[0650] Both obesity and lipodystrophy are commonly associated with pathologies including diabetes and cardiovascular diseases. It is now recognized that adipose tissue is an endocrine organ that secretes a wide variety of factors, and dysregulated secretion affects adipogenesis as well as whole-body glucose/insulin homeostasis. Excess adipose tissue leading to obesity has become a severe public health threat. Adipose tissue development can be affected by genetic background, hormonal balance, diet, and physical activity. Adipose tissue mass can increase when fat cells are increased in size due to higher triacylglycerol accumulation. In addition, an increase in fat cell number, arising from differentiation of precursor cells into adipocytes, can also occur even in adults as observed in severe human obesity and in rodents fed a high-carbohydrate or high-fat diet. Adipocytes specifically are thought to arise from mesenchymal cells that undergo the commitment and differentiation process, adipogenesis. Pre-adipocyte cell lines can undergo adipocyte differentiation upon treatment with adipogenic agents comprised of synthetic glucocorticoid, dexamethasone (DEX), isobutylmethylxanthine (IBMX), and insulin, have been valuable in these studies. Peroxisome proliferator-activated receptor .gamma. (PPAR.gamma.) and CCAAT enhancer-binding protein (C/EBP) family of transcription factors have been firmly established to play critical roles in adipocyte differentiation. Early during adipocyte differentiation, C/EBP.beta. and C/EBP.delta. are induced by DEX and IBMX, respectively, which together then induce PPAR.gamma. and C/EBP.alpha. to activate various adipocyte markers that are required for adipocyte function. Other transcription factors have also been reported to either positive or negatively regulate adipogenesis and various growth factors and hormones can affect adipocyte differentiation by regulating expression of adipogenic transcription factors. In fact, in addition to being the main site for energy storage in mammals by storing triacyglycerol and releasing fatty acids in times of need, adipose tissue secretes a wide array of molecules that are involved in diverse physiological processes including immune response, vascular function, and energy homeostasis. Cytokines such as TNF-.alpha. and IL-6 are secreted from adipocytes. Some of these factors may also affect growth and development of adipose tissue by autocrine/paracrine action.

[0651] Thus AARS polypeptides which have the ability to modulate the differentiation and/or proliferation of normal human pre-adipocytes have therapeutic utility in a broad range of diseases including for example, the treatment and prevention of metabolic disease, cardiovascular diseases, obesity and lipodystrophies, as well as the long term complications of diabetes.

[0652] Methods:

[0653] HPAd (human pre-adipocytes) (Cell Application Cat #803sD) are maintained according to vendor instructions. For culturing, cells are thawed quickly, and transferred immediately into 15 mL of Adipocyte Growth Medium (Cell Application Cat #811M-250) and plated into a standard sterile tissue culture treated flask. Media is replaced with fresh Adipocyte Growth Medium every other day until cell is >60% confluent. Cells are grown at 37.degree. C., 5% CO.sub.2, in a humidified environment and utilized in BSL2 certified tissue culture hoods using sterile technique and appropriate personal protective equipment including goggles, gloves and lab coats. Cells are plated in clear bottom black walled 96 well tissue culture treated assay plates for differentiation at a concentration of about 50,000 cells/mL. AARS polypeptides at a final concentration of 250 nM per well (or as otherwise indicated in the Examples below) are added to each assay well. All cells are maintained in growth media for 2 days with the exception of the positive controls which are stimulated with adipogenic differentiation media (Cell Applications Cat #811D-250). Cells are exposed to AARS polypeptides for 48 hours. Cell adhesion molecules including soluble VCAM and/or ICAM are measured using a standard ELISA kit from RND Systems (Cat # DY643 and DY720 respectively; Data Table F). Proliferation is assessed with Resazurin as described previously by adding fresh media containing Resazurin to plates following supernatant removal and incubating for three hours at 37.degree. C. (Data Table A). Plates are read on a fluorescent plate reader and viability/proliferation is expressed as a function of resorufin associated fluorescence of AARS polypeptide treated wells divided by resorufin associated fluorescence of PBS only treated wells. Fresh media is added and differentiation is maintained for 16 days post initial media exchange, with fresh media exchanged every other day to maintain cell health. On day 15, cells are placed in serum free media. On day 16, differentiation to mature adipocytes is assessed with Nile Red (Invitrogen, concentration of 3 .mu.M final) staining and quantified with a fluorescent plate reader with the appropriate wavelengths. To perform this assay cells are fixed with 10% paraformaldehyde, washed in PBS and permeabilized in PBS containing 0.5% BSA and 0.1% Triton X-100. Cell proliferation is assessed with an intensity measurement on a fluorescent reader with Hoechst dye 33432 at a concentration of 1 ug/mL final, as described previously. Adipogenesis is expressed as intensity of Nile Red signal. Hoechst dye signal is used to assess cellular number.

[0654] Human skeletal muscle cell differentiation and proliferation.

[0655] Background and Therapeutic Relevance:

[0656] The development of skeletal muscle is a multistep process that involves the determination of pluripotential mesodermal cells to give rise to myoblasts, withdrawal of the myoblasts from the cell cycle and differentiation into muscle cells, and finally growth and maturation of skeletal muscle fibers. Skeletal muscle differentiation involves myoblast alignment, elongation, and fusion into multinucleate myotubes, together with the induction of regulatory and structural muscle-specific genes. At the molecular level, myogenic commitment and muscle-specific gene expression involve the skeletal muscle-specific helix-loop-helix (bHLH) MyoD family of proteins, which includes MyoD, myogenin, myf-5, and MRF4, and the myocyte enhancer-binding factor 2 (MEF2). The DNA binding activity of MyoD family proteins is attenuated by Id, which forms complexes with E2a gene products in proliferating cells and is down-regulated when they are induced to differentiate. The decision to differentiate into myotubes is influenced negatively by several factors. Treatment of myoblasts with fetal bovine serum, basic fibroblast growth factor 2, or transforming growth factor .beta.1 is known to inhibit differentiation of myoblasts. Myogenesis is also regulated negatively by oncogenes such as c-myc, c-jun, c-fos, H-ras, and E1a. There is very little information regarding the signaling that is triggered in the myoblast upon serum withdrawal which leads to the induction of the MyoD family gene expression and to muscle differentiation. Myogenic differentiation appears to depend on the activation of integrins present on the plasma membrane of myoblasts suggesting the operation of an "outside-in" biochemical pathway in which integrin is the upstream molecular species. Interactions of insulin-like growth factor (IGF)-I and -II with their receptors are also positive regulators of skeletal muscle differentiation.

[0657] Accordingly AARS polypeptides with the ability to modulate muscle development have therapeutic utility in a broad range of diseases including for example, the treatment of metabolic disease, cachexia, various muscle wasting conditions, as well as musculoskeletal disease where muscle atrophy plays a key role in the pathogenesis and symptomology. Human Skeletal Muscle Cells (HSkMC) can undergo differentiation to exhibit actin and myosin myofilaments. HSkMC have been used in the study of genetic muscular diseases such as Malignant Hyperthermia. HSkMC also have the potential to act as a cardiac graft, mending damage to the heart, and thus AARS polypeptides with the ability to modulate muscle development also have utility as in vitro and in vivo regulators of myogenesis.

[0658] Methods:

[0659] To assess the potential role of AARS polypeptides in this process, a standard assay of skeletal muscle cell differentiation was employed. For this assay, Human Adult Skeletal Muscle Cells (HSkMC, Cell Application Cat #150-050 are isolated from healthy human donors from limbal skeletal muscle. Cells are maintained in HSkMC Growth Medium (Cell Applications, Cat #151-500). These cells can be cultured and propagated for at least 15 population doublings. For differentiation, cells are maintained in growth media for one passage and then plated at 50,000 cells per mL media in to 96 well clear bottom black walled TC treated plates treated with collagen at 100 .mu.L per well. Cells are allowed to adhere overnight. AARS polypeptides in PBS, or PBS alone, is added to each well at a final concentration of 250 nM protein (or as otherwise indicated in the examples below). Control wells received the same volume of Differentiation Media (Cell Applications Cat #151D-250) at this time. Cells are incubated with protein or differentiation media for 48 hours. At 48 hours, cell culture supernatant is collected from all wells and differentiation media is added at a volume of 150 .mu.L to the entire plate with the exception of control wells which are maintained in growth media only. Supernatant is utilized to assess cytokine production including IL6 and IL8 as described previously (Data Table E). Proliferation is assessed with Resazurin as described previously by adding fresh media containing Resazurin to plates following supernatant removal and incubating for three hours at 37.degree. C. (Data Table A). Cells are monitored under the microscope and media is exchanged for fresh Differentiation media every 2 days. On Day 10, media is removed and cells are fixed with 10% paraformaldehyde for 30 minutes. Cells are permeabilized with 0.1% Triton X-100 in PBS for 15 minutes and cells are stained with TR-Labeled phalloidin and Hoechst 33432 (as described previously) to define actin and nuclei respectively. Nuclear intensity is used to determine cell proliferation in each well and phalloidin intensity is used to determine total actin content. Cells are also stained with alpha actin skeletal muscle antibody (GenTex Cat # GTX101362). Digital photos using a fluorescent microscope as well as visual inspections and scoring are made of all wells.

[0660] Human bone marrow mesenchymal stem differentiation and proliferation.

[0661] Background and Therapeutic Relevance:

[0662] Mesenchymal stem cells (MSCs) are multipotent stem cells that can differentiate into a variety of cell types, including osteoblasts, chondrocytes, myocytes, adipocytes, beta-pancreatic islets cells, and potentially, neuronal cells. Many different events contribute to the commitment of the MSC to other lineages including the coordination of a complex network of transcription factors, cofactors and signaling intermediates from numerous pathways. MSCs are of intense therapeutic interest because they represent a population of cells with the potential treat a wide range of acute and degenerative diseases.

[0663] Moreover AARS polypeptides with the ability to modulate the differentiation of MSCs into different developmental pathways have significant therapeutic utility to enable the in vitro or in vivo modulation of hematopoiesis, neurogenesis, myogenesis, osteogenesis, and adipogenesis, as well as in a broad range of disorders and diseases, including for example inflammatory responses, autoimmunity, cancer, neuronal degeneration, muscular dystrophy, osteoporosis, and lipodystrophy. Human MSCs are immuno-privileged, and represent an advantageous cell type for allogenic transplantation, reducing the risks of rejection and complications of transplantation. Recently, there have also been significant advances in the use of autologous mesenchymal stem cells to regenerate human tissues, including cartilage and meniscus, tendons, and bone fractures. Many studies have also investigated the use of MSCs for gene therapy, including transplantation of MSCs transfected with vascular endothelial growth factor for the improvement of heart function after MI in rats, MSCs as vehicles for interferon-0 delivery into tumors in mice and gene therapy with MSCs expressing BMPs to promote bone formation. Accordingly due to the intense interest as MSCs as direct and modified therapeutics, as well as the potential of AARS polypeptides to act as therapeutic agents to regulate the differentiation of MSCs in vivo, AARS polypeptides were tested as potential inducers of MSC proliferation and differentiation.

[0664] Methods:

[0665] hMSC (human marrow stromal cells) (Cell Application Cat #492-050 are maintained according to vendor instructions. For culturing, cells are thawed quickly, and transferred immediately into 15 mL of Marrow Stromal cell Growth Medium (Cell Application Cat #419-500) and plated into a standard sterile tissue culture treated flask. Media is replaced with fresh Marrow Stromal cell Growth Medium every other day until cells are >60% confluent. Cells are grown at 37.degree. C., 5% CO.sub.2, in a humidified environment and utilized in BSL2 certified tissue culture hoods using sterile technique and appropriate personal protective equipment including goggles, gloves and lab coats. Cells are plated in clear bottom black walled 96 well tissue culture treated assay plates for differentiation at a concentration of 50,000 cells/mL. tRNA synthetase derived proteins at a final concentration of 250 nM per well (or as otherwise specified in the Examples below) are added to each assay well. All cells are maintained in growth media for 2 days with the exception of the positive controls, which was stimulated with osteogenic or chonodrogenic differentiation media (StemPro, Invitrogen, Cat # A10072-01 and A10071-01 respectively). Cells are exposed to AARS polypeptides for 48 hours. Soluble VCAM is measured using a standard ELISA kit from RND Systems (Cat # DY643; Data Table F). Proliferation is assessed with Resazurin as described previously by adding fresh media containing Resazurin to plates following supernatant removal and incubating for three hours at 37.degree. C. (Data Table A). Plates are read on a fluorescent plate reader and viability/proliferation is expressed as a function of resorufin associated fluorescence of AARS polypeptide treated wells divided by resorufin associated fluorescence of PBS only treated wells. Following an assessment of cell viability, resazurin is removed with two media exchanges and 0.5.times. differentiation media is added to all wells. Differentiation is monitored by visual inspections of all wells for 10 days post media exchange, with fresh media exchanged every other day to maintain cell health. Differentiation was assessed with alkaline phosphatase staining using ELF-97 stain (Invitrogen Cat # E6601) at day 10 post first differentiation exchange. (Yang et al, Nature Protocols (6) 187-213 (2011) doi:10.1038/nprot.2010.189).

[0666] Human pulmonary artery smooth muscle cell (hPASMC) proliferation and differentiation.

[0667] Background and Therapeutic Relevance:

[0668] Pulmonary artery smooth muscle cells (PASMCs) in normal human adult lung blood vessels are mostly quiescent, non-migratory and are largely committed to executing their contractile function in the lung. However, PASMCs are not terminally differentiated and possess the ability to modulate their phenotype and exit their quiescent state in response to changing local environmental cues. This differentiation state may occur in development, tissue injury, and vessel remodeling in response to changes in tissue demand. Pulmonary hypertension (PH) is associated with a variety of underlying conditions including an increase in peripheral pulmonary vascular resistance as a result of increased vascular tone and PASMC contractility and vascular remodeling. Vascular remodeling involves PASMC growth, synthesis of matrix material, and alterations in cell-cell and cell-matrix interactions in the walls of small pulmonary arteries (PAs), which lead to increased thickness of the smooth muscle component of the vessel wall and abnormal muscularization of the normally nonmuscularized, distal PAs. This process contributes to reduced lumen diameter and increased peripheral resistance. Although the precise role of the PASMCs in the initial cause of the disease is controversial, the changes that occur play a key role in the clinical consequences of the disease. A crucial step in studying cellular differentiation is identifying a set of cell-specific or cell-selective genes that contribute to the differentiated function(s) of the cell. A variety of smooth muscle cell (SMC) genes have been identified that serve as useful markers of the relative state of differentiation or maturation of the vascular SMCs, such as SM alpha-actin, SM MHC, hl-calponin, SM22-alpha, desmin, metavinculin, smoothelin and others. The most widely used marker is SM alpha-actin, partially because of the commercial availability of a number of very high-affinity and highly selective antibodies for this protein. Whether changes in PASMCs result from their inherent characteristics or from dysregulation of molecular events that govern PASMC growth remains an open question. However determining the regulatory cues and managing potential dis-regulation provides significant therapeutic insight to managing a variety of vascular and pulmonary diseases including pulmonary hypertension, vascular diseases.

[0669] Thus AARS polypeptides which have the ability to modulate the differentiation and/or proliferation of normal human PASMCs derived from adult humans have therapeutic utility in a variety of vascular and pulmonary diseases including inflammatory and obstructive lung diseases including for example, pulmonary hypertension, chronic obstructive pulmonary disease, idiopathic pulmonary fibrosis, and asthma.

[0670] Methods:

[0671] HPASMC (Cell Applications Cat #352-05a) are maintained in HPASMC growth media (Cell Applications Cat #352-05a) in 15 mL medium in 125 mL flasks for 1 passage before use. Cells are maintained at 37.degree. C., 5% CO.sub.2, in a humidified environment and utilized in BSL2 certified tissue culture hoods using sterile technique and appropriate personal protective equipment including goggles, gloves and lab coats. An 800_, volume of cells is plated on collagen coated overnight in growth medium at a cell density of 50,000 cells/mL. AARS polypeptides were added in sterile PBS to each well at a final concentration of 250 nM (or as otherwise specified in the Examples below). Control wells held only an equivalent volume of PBS. Positive control samples were incubated with vendor supplied HPASMC differentiation media (Cell Applications Cat #311D-250). Cells are exposed to AARS polypeptides or PBS in basal media (Cell Applications Cat #310-470) for 48 hours followed by a media exchange to differentiation media for the entire plate. Supernatant is collected and utilized to assess cytokine production including IL6 and IL8 as described previously (Data Table E). Proliferation is assessed with Resazurin as described previously by adding fresh media containing Resazurin to plates following supernatant removal and incubating for three hours at 37.degree. C. (Data Table A). Cells are monitored for 10 days with a media exchange every other day. Differentiation is assessed after fixation as described above, and permeabilzation with 0.1% Triton X-100, by quantifying staining to smooth muscle actin-alpha staining using an anti-SMA-alpha antibody (GeneTex Cat # GTX101362) and an Alexa 405 conjugated secondary antibody. Proliferation is assessed with Hoechst staining after cell fixation in 10% formaldehyde for 30 minutes. Hoechst dye is read using a bottom reading fluorescent plate reader with an excitation wavelength (Ex) of 405 nm, and an emission wavelength (Em) of 450 nm. Total actin staining is assessed via the use of an Alexa-488 labeled phalloidin stain (Invitrogen Cat # A12379).

[0672] Analysis of the Binding of AARs Polypeptides to Cells (Assays H1-H10 in the Data Tables Below)

[0673] Background and Therapeutic Relevance:

[0674] The binding of AARS polypeptides to specific cell types demonstrates that the cell type in question expresses specific receptors for the AARS polypeptide in question. Depending upon the cell type in question, cell binding implies a potential role for the AARS polypeptide in regulating the activity or behavior of the cell, or similar types of cell, in vivo. Specific examples of such regulatory roles include for example, the binding and modulation of B-cells and T-cells (immunomodulation/chemotaxis/autoimmunity/inflammation); HepG2 cells (control of metabolism, cholesterol uptake or metabolism); THP-1, jurkat, Raji cells (immunomodulation/chemotaxis/autoimmunity/inflammation), platelets (thrombopoiesis), 3T3L1 adipocytes (lipogenesis/metabolism), and C2C12 mouse myoblasts (myogenesis, osteogenesis).

[0675] Binding to Blood Cells

[0676] Methods:

[0677] Blood is collected in EDTA tubes from healthy donors. 2 mL whole blood is placed into 5 mL Falcon FACS tube. 2 mL of staining buffer (PBS+2% FBS) is added, vortexed 3-5 seconds, centrifuged for 5 minutes at 300.times. g. The supernatant aspirated, the wash repeated, and the pellet resuspended in 2 mL of staining buffer.

[0678] 100 .mu.l of washed blood is transferred to clean 5 mL FACS sample tubes.

[0679] His6- or V5-His6-tagged AARS polypeptides are added to tubes at the concentrations indicated in the specific experiments outlined below and incubated on ice for 45 minutes. After incubation, antibodies for the different cell type surface markers (BD Pharmigen Cat Nos. 560910, 555398, 555415, 340953, 560361), and FITC labeled anti-V5 tag antibody (V5-FITC, Invitrogen Cat # R96325) or FITC labeled anti-His6 antibody (AbCam Cat # ab1206) are added to tubes, incubated in the dark on ice 30 minutes. After incubation 2 mL of BD FACS Lysing Solution (cat #349202) was added to tubes. Samples are vortexed, and placed on ice for 15 minutes. Samples are washed with 1.times.2 mL PBS and resuspended in 2 mL of 2% formaldehyde in PBS prior to FACS analysis. AARS polypeptides that bind greater than 25% of a cellular population, where antibody alone has no significant signal, is deemed a hit.

[0680] Platelet Binding Assays:

[0681] 50 .mu.L of washed blood is transferred to clean 5 mL FACS sample tubes, His6- or V5-His6-tagged AARS polypeptides are added to tubes at the concentrations indicated in the specific experiments outlined below and tubes are placed on ice for 45 minutes. 20 .mu.L, CD61 pan platelet antibody (BD Pharmigen, Cat #555754) and 0.5 .mu.L, anti-V5-FITC labeled antibody (Invitrogen, R96325) or FITC labeled anti-His6 antibody (AbCam Cat # ab1206) are added to each tube. Tubes are placed on ice and protected from light for 30 minutes. Samples are brought up to a total volume in 2 mL of 1% formaldehyde in PBS and analyzed by flow cytometry within 24 hours. AARS polypeptides that bind greater than 25% of a cellular population, where antibody alone has no significant signal, is deemed a hit.

[0682] Binding to Cells in Culture:

[0683] Approximately 1.times.10.sup.6 cells in 100 .mu.L, complete RPMI medium are placed into 5 mL FACS tubes. His6- or V5-His6-tagged AARS polypeptides are added to tubes at the concentrations indicated in the specific experiments outlined below and tubes are placed on ice for 45 minutes. Cell samples are washed twice with 1 mL staining buffer (PBS+2% FBS), and then 0.54 of anti-V5-FITC antibody (Invitrogen R96325) or FITC labeled anti-His6 antibody (AbCam Cat # ab1206) in staining buffer with 200 .mu.g/mL human IgG, is added and the samples incubated on ice, protected from light, for 30 minutes. Samples are washed twice with 1 mL staining buffer, and then brought up to a total volume in 2 mL of 1% formaldehyde in PBS and analyzed by flow cytometry within 24 hours. AARS polypeptides that bind greater than 25% of a cellular population, where antibody alone has no significant signal, is deemed a hit.

[0684] Animal Studies: Modulation of Haematopoiesis and Circulating Cytokines

[0685] Background and Therapeutic Relevance:

[0686] Hematopoiesis (alternatively haemopoiesis or hemopoiesis) is the formation of blood cellular components. All cellular blood components are derived from haematopoietic stem cells (HSCs) which reside in the medulla of the bone (bone marrow) and have the unique ability to give rise to all of the different mature blood cell types. HSCs are self renewing: when they proliferate, at least some of their daughter cells remain as HSCs, so the pool of stem cells does not become depleted. The other daughters of HSCs (myeloid and lymphoid progenitor cells), however can each commit to any of the alternative differentiation pathways that lead to the production of one or more specific types of blood cells, but cannot themselves self-renew. A change in the blood components in response to exposure to an AARS polypeptide therefore suggests that the AARS polypeptide is capable of modulating hematopoiesis, and regulating the development of haematopoietic stem cells.

[0687] All blood cells can be divided into three lineages; Erythroid cells, lymphocytes and myelocytes.

[0688] Erythroid cells are the oxygen carrying red blood cells. Both reticulocytes and erythrocytes are functional and are released into the blood. Accordingly a reticulocyte count estimates the rate of erythropoiesis, and a change in red blood cell count suggests that an AARS polypeptide modulates erythropoiesis.

[0689] Lymphocytes are the cornerstone of the adaptive immune system. They are derived from common lymphoid progenitors. The lymphoid lineage is primarily composed of T-cells and B-cells (types of white blood cells). Accordingly a change in white blood cell count or composition in response to exposure to an AARS polypeptide suggests that that the AARS polypeptide modulates lymphopoiesis.

[0690] Myelocytes, which include granulocytes, megakaryocytes and macrophages, and are derived from common myeloid progenitors, are involved in a variety of roles, including innate immunity, adaptive immunity, and blood clotting. Accordingly a change in myeloid cell count or composition in response to exposure to an AARS polypeptide suggests that that the AARS polypeptide modulates myelopoiesis. The same rationale can be used to establish whether the AARS polypeptides modulate granulopoiesis, by measuring changes in granulocyte number in response to exposure to the AARS polypeptides. A role for the AARS polypeptide in modulating megakaryocytopoiesis may be inferred by a change in megakaryocyte or platelet composition or number in the blood.

[0691] Cytokine release in either wild type mice, or in various animal model systems of inflammation, provides an initial assessment of the potential ability of the AARS polypeptides to modulate inflammatory responses. The role of AARS polypeptides in modulating acute chronic inflammatory processes for example, can be readily assessed using a mouse model of diet induced obesity (DIO). The DIO model centers upon placing rodents on a high fat diet for several months leading to increased obesity, insulin resistance and immune system dysfunction. A particular consequence of this immune system dysregulation results in increased production of proinflammatory cytokines in DIO animals leading to a condition of chronic systemic inflammation. There is a growing body of evidence suggesting that low grade inflammation contributes to the development and maintenance of obesity and a diabetic phenotype that is similarly observed in the human condition termed metabolic syndrome. As such, the ability of AARS polypeptides to modulate the immune system and restore homeostatic balance towards a resolution of this chronic inflammatory state would be particularly beneficial in numerous diseases and disorders including but not limited to the treatment and prevention of the symptoms and side effects of metabolic disease, diabetes, cardiovascular diseases, atherosclerosis, obesity, as well as various autoimmune diseases and disorders, including for example, multiple sclerosis, vascular and allergic disorders.

[0692] Methods:

[0693] Male wild type control (C57BL/6) or diet induced obesity mice (C57BL/6NHsd) are purchased from Harlan (Indianapolis, Ind.) and housed individually. DIO mice are fed a high fat diet (Cat. # TD.06414-60% kcal from fat) and control mice are fed a normal diet (Cat. #2018S-18% kcal from fat). DIO mice are placed on the high fat diet starting at 6 weeks of age for a total of 10 weeks. Both DIO and control mice are allowed to feed and drink ad libitum. At 16 weeks of age, mice are sorted and randomized into groups of 5 animals based on weight. On day 2, mice are weighed and tail vein bled (1004) for pre-treatment complete blood count (CBC) analysis. On day 1, mice are weighed and intravenously injected via the tail vein with vehicle (PBS) or individual AARS polypeptides at 10 mg/kg. Four hours post-injection, mice are facial vein bled (150-2004) for subsequent cytokine analysis. On days 2, 3, & 4, mice are intravenously dosed as on day 1. On day 5, mice are weighed, terminated and blood are collected by heart puncture for Complete Blood Count (CBC analysis) (plasma-EDTA) and cytokine examination (serum).

[0694] CBC and Cytokine Analysis:

[0695] Complete blood counts are analyzed from blood draws preceding injections (day -2) and 24 hours after the final injection (day 5). CBC values are assessed for total white blood cell counts and overall red blood cell morphology. White blood cells are further characterized by total and fractional percentage of neutrophils, lymphocytes, monocytes, eosinophils, & basophils. Red blood cell breakdown included measurements of hemoglobin (dL), hematocrit (%), mean corpuscular volume (fL), mean corpuscular hemoglobin, mean corpuscular hemoglobin concentration (%), and total platelet count (10.sup.3/.mu.L. CBC analysis is performed by Antech Diagnostics (Fishers, Ind.).

[0696] Circulating cytokine levels are examined at 4 hours post-injection (day 1) and 24 hours after the final injection (day 5). Serum is isolated, snap frozen and sent to Rules Based Medicine (Austin, Tex.) for multi-analyte profiling. Serum samples are analyzed using the RodentMap panel encompassing 59 unique biomarkers including Apo A-1, CD40, CD40-L, CRP, ET-1, eotaxin, EGF, Factor VII, fibrinogen, FGF-9, FGF-basic, GST-.alpha., GCP-2, GM-CSF, KC/GRO.alpha., haptoglobin, IgA, IFN.gamma., IP-10, IL-1.alpha., IL-1(3, IL-10, IL-11, IL-12.mu.70, Il-17A, IL-18, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, LIF, lymphotactin, M-CSF-1, MIP-1.alpha., MIP-1.beta., MIP-1.gamma., MIP-2, MIP-3.beta., MDC, MMP-9, MCP-1, MCP-3, MCP-5, MPO, myoglobin, SAP, SGOT, SCF, RANTES, TPO, tissue factor, TIMP-1, TNF-.alpha., VCAM-1, VEGF-A, and vWF. A change in cytokine levels was counted as a hit if the cytokine increased by at least 2-fold or decreased by at least 50% compared to vehicle controls.

Example 1

Identification of Proteolytic Fragments and Products of Alternative Splicing from AARSs Using Protein Topography and Migration Analysis Platform

[0697] To identify AARS fragments from cell lines, conditioned media and tissues, samples are prepared in the following ways:

[0698] Mouse macrophage (RAW 264.7), cytosol and conditioned media: Cells are treated with serum free DMEM media at a density of 15.times.10.sup.6 cells/flasks. After 48 hours conditioned media and cell pellets are collected and processed. 200 .mu.g of protein from secreted and cytosolic proteomic fractions are separated by SDS-PAGE and gel slices are prepared for analysis by mass spectrometry.

[0699] Mouse pancreas tissue: The pancreas from three mice are chopped, dounce homogenized, and sonicated in PBS with protease inhibitors. Cytosolic proteome is isolated by centrifugation and 200 .mu.g of protein is separated by SDS-PAGE and gel slices are prepared for analysis by mass spectrometry.

[0700] Mouse liver tissue: Three mouse livers are chopped, dounced homogenized, and sonicated in PBS with protease inhibitors. Cytosolic proteome is isolated by centrifugation and 200 .mu.g of protein is separated by SDS-PAGE and gel slices are prepared for analysis by mass spectrometry.

[0701] In-gel digests are analyzed by LTQ XL ion trap mass spectrometer (ThermoFisher) equipped with ultimate 3000 .mu.LC system (Dionex). The samples are first loaded on PepTrap (michrom) for 10 min with 5% Acetonitrile in 0.1% formic acid using Dionex autosampler. Then the samples are analyzed with a 100 .mu.m (inner diameter) fused silica capillary column containing 10 cm of C18 resin (michrom). Peptides are eluted from the column into mass spectrometer with a flow rate of 0.45 .mu.l/min using a linear gradient of 5-33.5% acetronitrile in 0.1% formic acid within 110 min.

[0702] LTQ is operated in data-dependent scanning mode such that one full MS scan is followed by seven MS/MS scans of the seven most abundant ions. Dynamic exclusion is enabled with repeat count equals to 1, repeat duration equals to 20 seconds, exclusion list size is 300 and exclusion duration is 60 seconds.

[0703] After LC-MS/MS analysis, the raw data is searched with BioWorks3.3.1(SEQUEST) using a concatenated target/decoy variant of the mouse IPI database. The SEQUEST data are filtered and sorted with DTASelect. Tables 1, 4 and 7 show sequences identified in this way.

Example 2

Identification of Splice Variants Using Deep Sequencing

[0704] Splice variants of the aminoacyl tRNA synthetase are identified using high throughput sequencing of cDNA libraries enriched for aminoacyl tRNA synthetase transcripts. The cDNA templates are prepared from total RNA extracts of tissues such as human adult and fetal brains and enriched for aminoacyl tRNA synthetase transcripts by using primer sequences specific for all annotated exons of all annotated human aminoacyl tRNA synthetases and their associated proteins.

[0705] Human Total RNAs are obtained from Clontech. For cell line and mouse tissue samples, total RNAs are extracted using RNA Extract II Kit (MN). Genomic DNA is digested in the total RNA samples by DNAase I. To obtain mature messenger RNAs (mRNAs), the RNA samples are enriched twice by binding polyA+ RNA and digestion of RNA without 5'-cap by 5'-phosphate dependent exonuclease. Complementary DNA (cDNA) is synthesized from mature RNAs using primers that anneal to exon sequences of aminoacyl tRNA synthetase genes. A transcriptome enriched for aminoacyl tRNA synthetase genes is amplified by multiplex PCR using the aminoacyl tRNA synthetase-exon specific cDNA and different combinations of aminoacyl tRNA synthetase-exon primers. The double-stranded aminoacyl tRNA synthetase-enriched transcriptome PCR products are enzymatically repaired at both ends before adding A-overhangs to the 3' ends of the repaired fragments. Sequencing adaptors and index sequences are then added to the aminoacyl tRNA synthetase-enriched transcriptome PCRs products to generate cDNA libraries for deep sequencing with Illumina's Multiplex Sequencing Kit. In brief, the aminoacyl tRNA synthetase-enriched transcriptome PCR products with 3'-A overhangs are ligated to the InPE adaptor oligonucleotides provided in the kits. Index sequences are added to the PCR products with InPE adaptors. To obtain enough DNA fragments for deep sequencing, the PCR products with index sequences are further amplified by PCR. Aminoacyl tRNA synthetase-enriched cDNA libraries with different indexes are pooled and sequenced using an Illumina DNA sequencing machine to get 50 base pair end reads. Sequencing reads are mapped to human or mouse genome for identification of alternative splicing events. "Splicemap" software (available for public download at http://www-stat.stanford.edu/.about.kinfai/SpliceMap/) is used to identify splice junctions.

[0706] Deep sequencing of these cDNAs are performed to generate about 1 million sequencing reads of about 50 nucleotides in length. The sequences specific for exons of the aminoacyl tRNA synthetases are queried against annotated exon junctions and new exon junctions are identified as alternative splicing events.

[0707] The columns in Tables 2, 5, and 8 labeled "5' exon" and "3'exon" indicate, when present, which exons are fused together in the cDNA sequence. Tables 2, 5, and 8 show sequences that were identified for alternative splice events, transcripts containing such splice events, and the polypeptides expressed by those transcripts. Alternative splice variants identified by deep sequencing are identified in Tables 2, 5, and 8 as those ones in which there are numbers greater than zero in the columns labeled as "Sequencing reads" in the human adult or fetal brain.

Example 3

Identification of AARS Polypeptides Using Bioinformatics

[0708] AARS protein fragments (resectin or appendacrine peptides) are identified using bioinformatics. Amino acid sequences of the full length human aminoacyl tRNA synthetase are aligned with the full length amino acid sequence of its ortholog from the bacterium Escherichia coli using a program such as FASTA (available at the website http://fasta.bioch.virginia.edu/fasta www2/fasta www.cgi) or the BLASTP program from the NCBI (available at the website http://www.ncbi.nlm.nih. gov/blast/Blast. cgi?PROGRAM=blastp&BLAST PROGRAM S=blastp&PAGE_TYPE=BlastSearch&SHOW_DEFAULTS=on&LINK_LOC=blastho m). Resectin sequences from the human proteins are identified as sequences covering regions where there are gaps in the bacterial sequence in the alignment, or regions with low homology between the two species. The peptide, and corresponding DNA sequences in Tables 3, 6, and 9 include examples identified in this way.

Example 4

Differential Expression of AARs Polypeptides Identified by Mass Spectrometry

[0709] The PROTOMAP technique is used as described in Example 1 to compare the differential expression of Alanyl tRNA synthetases in different tissues/cell types (refer to Tables 1, 4, and 7) for sequences and comparisons): Aminoacyl-tRNA synthetase resectin expression is compared between mouse liver tissue and mouse pancreas tissue. Aminoacyl-tRNA synthetase resectin expression is compared between cytosol of RAW264.7 and conditioned media from RAW264.7 cells harvested after 48 hours of serum starvation.

Example 5

Differential Expression of AARS Polypeptides Identified by Deep Sequencing

[0710] To test for differential expression of spice events, the deep sequencing is done for cDNAs prepared from different tissues. The number of sequencing hits in the deep sequencing samples reflects relative abundance of a sequence in the samples. The columns labeled "Hs Adult" and Hs Fetal" in Tables 2B, 5B and 8B indicate how many times the sequence is identified in the random sequencing of the enriched cDNA from human adult brain and from human fetal brain respectively.

[0711] Expression of specific alternative splice events for aminoacyl tRNA synthetases is unexpected and indicates biological importance. The variation in relative number of reads seen in the deep sequencing of adult and fetal human brain transcriptome samples indicates that alternative splice events of aminoacyl tRNA synthetases are differentially regulated and not just artifacts due to sample handling. Additional evidence for this unexpected biological relevance is that alternative splice variants are not detected in the deep sequencing analysis of transcriptomes from adult or fetal brain for all aminoacyl tRNA synthetases (e.g., cysteinyl-tRNA synthetase and threonyl-tRNA synthetase).

Example 6

Antibody Screening

[0712] To facilitate the discovery of antibodies displaying preferential binding to specific aminoacyl tRNA synthetase fragments (e.g., >10-fold higher affinity when compared to the parental full length enzyme), a human antibody phage display library is screened by AbD Serotec (a division of MorphoSys.TM., Martinsried/Planegg, Germany) using affinity enrichment techniques (panning). Antibodies enriched after multiple rounds of screening with the aminoacyl tRNA synthetase fragments are subsequently characterized by ELISA for reactivity to the fragments, and to the parental, full length enzyme. Clones demonstrating preferential binding (e.g., >10-fold higher affinity) to the aminoacyl tRNA synthetase fragments are further characterized.

[0713] If the necessary specificity is not achieved at the end of this process, subtraction strategies, such as pre-adsorption steps with the full length enzyme and/or counter-screening, are used to eliminate cross reacting antibodies and drive the selection process towards the unique epitope(s) on the aminoacyl tRNA synthetase fragments.

Example 7

Identification of Splice Variants Using Systematic PCR

[0714] cDNA templates for PCR reactions are reverse transcribed from total RNA extracts of tissues or cells (e.g., human brain, IMR-32 and HEK293T). PCR reactions are performed using aminoacyl tRNA synthetase specific primers, pairing a forward primer (FP1) designed to anneal to the 5' untranslated region or exons in the 5' half of the gene with a reverse primer (RP1) designed to anneal to exons in the 3' half of the gene or the 3'UTR. Amplified DNA products are analyzed by agarose gel electrophoresis to identify PCR products that are a different size then the fragment amplified from the canonical transcripts. These different PCR products are excised and purified from the gel and ligated into a standard cloning vector for DNA sequence analysis. Alternative splicing variants are identified as different sequences from the canonical transcripts. Splice variants identified by this systematic PCR approach are shown in Tables 2, 5 and 8 as those variants with zero sequencing reads in both the adult and fetal brains.

Example 8

Codon Optimization of Selected Aars Polynucleotides

[0715] Representative AARS polypeptides (summarized in Table E2) are selected for further biochemical, biophysical and functional characterization based on one or more of the following criteria, i) the identification of AARS polypeptide proteolytic fragments, ii) the identification of AARS polypeptide splice variants, iii) the identification of AARS polypeptides by bioinformatic analysis, iv) evidence of differential expression of specific AARS polypeptides, v) the domain structure of the AARS protein, vi) the size of the AARS polypeptide, and vii) the minimization of similar duplicative sequences.

TABLE-US-00032 TABLE E2 Summary of AARS Polypeptides Selected for Codon Optimization and Bacterial Expression Cloning/ AARS SEQ. ID Nos. for SEQ. ID. Nos. for synthesis Polypeptide Epitope Tagged AARS Residues of AARS Location of method Name AARS polypeptides Polynucleotides protein epitope tag used AlaRS1.sup.N1 SEQ. ID. NO. 61 SEQ. ID. NO. 73 1-401 N-terminal 1 AlaRS1.sup.N1 SEQ. ID. NO. 62 SEQ. ID. NO. 73 1-401 C-terminal 1 AlaRS1.sup.N2 SEQ. ID. NO. 63 SEQ. ID. NO. 74 1-286 N-terminal 2 AlaRS1.sup.N2 SEQ. ID. NO. 64 SEQ. ID. NO. 74 1-286 C-terminal 2 AlaRS1.sup.N3 SEQ. ID. NO. 65 SEQ. ID. NO. 75 1-488 N-terminal 1 AlaRS1.sup.N3 SEQ. ID. NO. 66 SEQ. ID. NO. 75 1-488 C-terminal 1 AlaRS1.sup.N4 SEQ. ID. NO. 67 SEQ. ID. NO. 76 1-224 + 51 aa N-terminal 2 AlaRS1.sup.N4 SEQ. ID. NO. 68 SEQ. ID. NO. 76 1-224 + 51 aa C-terminal 2 AlaRS1.sup.N6 SEQ. ID. NO. 69 SEQ. ID. NO. 77 1-497 + 24 aa N-terminal 1 AlaRS1.sup.N6 SEQ. ID. NO. 70 SEQ. ID. NO. 77 1-497 + 24 aa C-terminal 1 AlaRS1.sup.N8 SEQ. ID. NO. 71 SEQ. ID. NO. 78 1-321 + 6aa.sup. N-terminal 2 AlaRS1.sup.N8 SEQ. ID. NO. 72 SEQ. ID. NO. 78 1-321 + 6aa.sup. C-terminal 2 AlaRS1.sup.C1 SEQ. ID. NO. 146 SEQ. ID. NO. 167 476-968 N-terminal 1 AlaRS1.sup.C1 SEQ. ID. NO. 147 SEQ. ID. NO. 167 476-968 C-terminal 1 AlaRS1.sup.C2 SEQ. ID. NO. 148 SEQ. ID. NO. 168 758-968 N-terminal 2 AlaRS1.sup.C2 SEQ. ID. NO. 149 SEQ. ID. NO. 168 758-968 C-terminal 2 AlaRS1.sup.C3 SEQ. ID. NO. 150 SEQ. ID. NO. 169 588-968 N-terminal 1 AlaRS1.sup.C3 SEQ. ID. NO. 151 SEQ. ID. NO. 169 588-968 C-terminal 1 AlaRS1.sup.C4 SEQ. ID. NO. 152 SEQ. ID. NO. 170 659-968 N-terminal 1 AlaRS1.sup.C4 SEQ. ID. NO. 153 SEQ. ID. NO. 170 659-968 C-terminal 1 AlaRS1.sup.C4 SEQ. ID. NO. 164 SEQ. ID. NO. 176 659 N-terminal 2 AlaRS1.sup.C4 SEQ. ID. NO. 165 SEQ. ID. NO. 176 659 C-terminal 2 AlaRS1.sup.C5 SEQ. ID. NO. 154 SEQ. ID. NO. 171 691-968 N-terminal 1 AlaRS1.sup.C5 SEQ. ID. NO. 155 SEQ. ID. NO. 171 691-968 C-terminal 1 AlaRS1.sup.C6 SEQ. ID. NO. 156 SEQ. ID. NO. 172 747-968 N-terminal 2 AlaRS1.sup.C6 SEQ. ID. NO. 157 SEQ. ID. NO. 172 747-968 C-terminal 2 AlaRS1.sup.C6 SEQ. ID. NO. 166 SEQ. ID. NO. 143 747-968 C-terminal 3 AlaRS1.sup.C7 SEQ. ID. NO. 158 SEQ. ID. NO. 173 747-968 N-terminal 1 AlaRS1.sup.C7 SEQ. ID. NO. 159 SEQ. ID. NO. 173 747-968 C-terminal 1 AlaRS1.sup.C11 SEQ. ID. NO. 160 SEQ. ID. NO. 174 .sup. 16 aa + 558-968 N-terminal 2 AlaRS1.sup.C11 SEQ. ID. NO. 161 SEQ. ID. NO. 174 .sup. 16 aa + 558-968 C-terminal 2 AlaRS1.sup.C12 SEQ. ID. NO. 162 SEQ. ID. NO. 175 2 aa + 727-968 N-terminal 1 AlaRS1.sup.C12 SEQ. ID. NO. 163 SEQ. ID. NO. 175 2 aa + 727-968 C-terminal 1 AlaRS1I1 SEQ. ID. NO. 179 SEQ. ID. NO. 181 476-749 N-terminal 2 AlaRS1I1 SEQ. ID. NO. 180 SEQ. ID. NO. 181 476-749 C-terminal 2

[0716] Polynucleotides encoding the selected AARS polypeptides listed in Table E2, along with the appropriate N or C-terminal epitope tag, are synthesized and cloned as described in the General Materials and Methods section using the gene synthesis methodology listed in Table E2.

Example 9

Small Scale Bacterial Expression and Purification

[0717] The AARS polypeptides listed in Table E2 are expressed in E. coli. as described in the General Materials and Methods section. The relative expression of soluble and inclusion body localized AARS polypeptides is summarized in Table E3 below.

TABLE-US-00033 TABLE E3 Summary of AARS Polypeptide Bacterial Expression Characteristics Amount of Protein Amount of Recovered from Protein AARS Location of Soluble Recovered from Polypeptide Epitope Tag Fraction Inclusion Bodies AlaRS1.sup.N1 N-terminal + ND AlaRS1.sup.N1 C-terminal ++ ND AlaRS1.sup.N2 N-terminal + ND AlaRS1.sup.N2 C-terminal + ND AlaRS1.sup.N3 N-terminal ++ ND AlaRS1.sup.N3 C-terminal ++ ND AlaRS1.sup.N4 N-terminal + ND AlaRS1.sup.N4 C-terminal + ND AlaRS1.sup.N6 N-terminal ++ ND AlaRS1.sup.N6 C-terminal + ND AlaRS1.sup.N8 N-terminal + ND AlaRS1.sup.N8 C-terminal + ND AlaRS1.sup.C1 N-terminal + ND AlaRS1.sup.C1 C-terminal + ND AlaRS1.sup.C2 N-terminal +++ ND AlaRS1.sup.C2 C-terminal +++ ND AlaRS1.sup.C3 N-terminal + ND AlaRS1.sup.C3 C-terminal + ND AlaRS1.sup.C4 N-terminal + ND AlaRS1.sup.C4 C-terminal + ND AlaRS1.sup.C5 N-terminal + ND AlaRS1.sup.C5 C-terminal + ND AlaRS1.sup.C6 N-terminal + ND AlaRS1.sup.C6 C-terminal ++ ND AlaRS1.sup.C7 N-terminal + ND AlaRS1.sup.C7 C-terminal + ND AlaRS1.sup.C11 N-terminal + ND AlaRS1.sup.C11 C-terminal + ND AlaRS1.sup.C12 N-terminal + ND AlaRS1.sup.C12 C-terminal + ND AlaRS1.sup.I1 N-terminal + ++ AlaRS1.sup.I1 C-terminal + + Key "+" represents 0-1 mg/L AARS polypeptide expression "++" represents 1-5 mg/L AARS polypeptide expression; "+++" represents 5-10 mg/L AARS polypeptide expression; "++++" represents 10-15 mg/L AARS polypeptide expression; "+++++" represents .gtoreq.15 mg/L AARS polypeptide expression; ND: Not Determined

[0718] Surprisingly, the protein expression data demonstrates the existence of several protein domains that exhibit high level expression of soluble protein when expressed in E. coli.

[0719] Specifically the data demonstrates that the AARS polypeptides AlaRS1', (amino acids 1-401), AlaRS1.sup.N3, (amino acids 1-488) and AlaRS1.sup.N6 (amino acids 1-497+24 amino acids) define the boundaries of a novel protein domain that is highly expressed in E. coli. This new AARS polypeptide domain comprises a portion of the full length Ala tRNA synthetase approximately spanning amino acids 1 to about 500.

[0720] Additionally the data demonstrates that the AARS polypeptides AlaRS1.sup.C2 (amino acids 758-968) and AlaRS1.sup.C6 (amino acids 747-968) define the boundaries of a second novel protein domain that is highly expressed in E. coli. This second new AARS polypeptide domain comprises a portion of the full length Ala tRNA synthetase approximately spanning amino acids from about 745 to 968.

Example 10

Large Scale Production of AARS Polypeptides

[0721] Representative AARS polypeptides are prepared in larger amounts to enable further functional and biophysical characterization. The AARS polypeptides listed in Table E4 are expressed in E. coli. in large scale culture as described in the General Materials and Methods section. The yields, and specified biophysical characteristics, for each expressed soluble protein are summarized below in Table E4.

TABLE-US-00034 TABLE E4 Summary of representative AARS Polypeptide yields and biophysical characterization Stability [percent AARS Location Working stock recovery Poly- of Epitope Yield Purity Endotoxin Molecular concentration after 1 Aggregation peptide Tag [mg/L] .sup.(1) [%] [EU/mg] Weight [mg/mL] week] .sup.(2) [DLS] AlaRS1.sup.N3 C-terminal 1.5 80 6.0 C: 56,912 13.8 98% + D: 56,907 AlaRS1.sup.I1 N- 0.3.sup.(3) 80 NA ND 1.83 ND ND terminal AlaRS1.sup.C6 C- 9.5 99 0.4 C: 26,771 19.04 60% ++++ terminal D: 26,642.sup.(4) Notes .sup.(1) Yield determined by measuring protein recovery after last purification step .sup.(2) Determined as percent recovery of non aggregated material after 1 week at 25.degree. C. .sup.(3)Measured after final Amicon concentration step .sup.(4)Likely to represent MW without N-terminal methionine C: Calculated D: Determined Key: "+" represents less than 1% high molecular protein aggregates "++" represents less than 2% high molecular protein aggregates "+++" represents less than 5% high molecular protein aggregates "++++" represents less than 10% high molecular protein aggregates ND Not Determined

[0722] The results from these studies establish that representative AARS proteins from these two families of AARS proteins, (AlaRS1' and AlaRS1.sup.C6) exhibit favorable protein expression yields, as well as good solubility, stability and aggregation characteristics, even without extensive optimization.

Example 11

Transcriptional Profiling of Representative AARS Polypeptides

[0723] To test for the ability of the AARS polypeptides to modulate gene expression, selected AARS polypeptides were incubated with Mesenchymal stems cells or human skeletal muscle cells for the times shown in Table E5.

TABLE-US-00035 TABLE E5 Transcriptional profiling of representative AARS Polypeptides in Mesenchymal Stem Cells (MSC) or Human Skeletal Muscle Cells (HSkMC) Test Sample Description Cell type and Exposure Time Location AARS of Con- MSC MSC HSkMC HSkMC Poly- Epitope centration 24 72 24 72 peptides Tag nM hours hours hours hours AlaRS1.sup.N1 C-terminal 57 19 5 11 4 AlaRS1.sup.N3 N-terminal 41 1 0 0 8 AlaRS1.sup.N3 C-terminal 250 3 3 9 7 AlaRS1.sup.N6 C-terminal 250 0 3 4 5 AlaRS1.sup.C2 N-terminal 80 1 6 7 2 AlaRS1.sup.C2 C-terminal 250 0 2 9 10 AlaRS1.sup.C6 C-terminal 250 1 3 3 1 Controls Average across all AARS 3 5 6 7 polypeptides screened Osteogenesis cocktail 17 20 11 16 Chondrogenesis cocktail 17 19 14 19 Adipogenesis cocktail 19 15 16 18 SKMC Pos Ctrl 11 8 5 4 Untreated 0 0 1 1

[0724] In Table E5, the numbers in each column represent the number of genes which were modulated, either positively or negatively by at least 4 fold compared to the control samples, as described in the general methods section. The data shows that specific forms of the AARS polypeptides tested have the surprising ability to regulate the transcription, and hence potentially modulate the developmental fate or differentiation status when added to either Mesenchymal Stem Cells (MSC) and/or Human Skeletal Muscle Cells (HSkMC). Shaded cells with bolded numbers in the table represent examples where the AARS polypeptide exhibits a significant impact on the regulation of gene transcription in the cell lines and times indicated in the table.

[0725] It is concluded that AlaRS1.sup.C2, AlaRS1.sup.N1 and AlaRS1.sup.N3 appear to be major regulators of mesenchymal Stem Cell and/or Human Skeletal Muscle Cell gene expression.

Example 12

Functional Profiling of Representative AARs Polypeptides

[0726] To test for the ability of the AARS polypeptides to modulate a range of phenotypic processes, selected AARS polypeptides were incubated with the cell types, and the conditions provided in the general methods section, and Tables E5 and E6.

TABLE-US-00036 TABLE E6 Key to Assays and criteria for indicating a hit Proliferation assays Assay Source and cell type Number Human megakaryocytic leukemia cells/Mo7e A1 Human acute promyelocytic leukemia cells/HL60 A2 Human lymphoblast (cancer cell line)/RPMI8226 A3 Human mesenchymal stem cells/hMSC A4 Human astrocytes A5 Human bone marrow aspirate cells/Bone Marrow Cells A6 Human bone marrow aspirate cells/Bone Marrow Cells A7 (Long Term Culture) Human Synoviocyte/HFLS-SynRA A8 Human pre-adipocyte cells/hPAD A9 Human pulmonary artery smooth muscle cell/hPASMC A10 Human skeletal muscle cell/hSKMC A11 Data analysis for proliferation assays was performed by dividing the numerical value in the assay well by the average PBS value for the assay plate. AARS polypeptides were considered to be proliferative if greater than 3 SD away from the PBS value in the positive direction. AARS polypeptide was considered to be cytotoxic if greater than 3 SD away from the PBS value in the negative direction. A cytotoxic compound was utilized as a negative control and the average value for this was always greater than 3 SD away from PBS average value. Cellular differentiation and phenotype assays Assay Assay Description Number Human hepatocyte (HepG2C3a cells) acetylated B1 LDL uptake Data analysis for ac-LDL uptake assay was performed by dividing the numerical value in the assay well by the average PBS value for the assay plate. AARS polypeptides were considered to be a modulator of ac-LDL uptake if greater than 2 SD away from the PBS value in the positive or negative direction. A visual check to confirm plate reader results was made using a fluorescent microscope. Human Neutrophil assays Assay Assay Description Number Neutrophil Elastase C1 Neutrophil oxidative burst (agonist) C2 Neutrophil oxidative burst (antagonist) C3 Data analysis for neutrophil assays was performed by dividing the numerical value in the assay well by the average PBS value for the assay plate. AAR polypeptides were considered to be a modulator of neutrophil elastase production or oxidative burst biology if greater than 2 SD away from the PBS value in the positive or negative direction. Modulation of Toll-like receptors (TLR) Assay Assay Description Number TLR activation in RAW BLUE cells D1 TLR antagonism in RAW BLUE cells D2 Activation of hTLR2 D3 Activation of hTLR4 D4 Data analysis for TLR modulation assays was performed by dividing the numerical value in the assay well by the average PBS value for the assay plate. AARS polypeptides were considered to be a modulator of TLR specific biology if greater than 3 SD away from the PBS value in the positive or negative direction. Positive controls, including LPS and detection reagent were always significantly distinct and >3 SD from PBS average value. Assay Assay Description Number Cytokine Release Human Synoviocyte cytokine production (IL6 release) E1 Human pulmonary artery smooth muscle cell (hPASMC) E2 cytokine production (IL6 release) Human skeletal muscle cell (hSKMC) cytokine production E3 (IL6 release) Human Astrocyte cytokine production (IL6 release) E4 Whole blood IL6 release E5 Human pulmonary artery smooth muscle cell (hPASMC) E6 cytokine production (IL8release) 72 h Incubation IL8 production Human Synoviocyte cytokine production (IL8 release) E7 Human pulmonary artery smooth muscle cell (hPASMC) E8 cytokine production (IL8release) Human skeletal muscle cell (hSKMC) cytokine production E9 (IL8 release) Human Astrocyte cytokine production (IL8 release) E10 Human hepatocyte (HepG2C3a cells) IL8 release E11 Human acute promyelocytic leukemia cells/HL60 (IL8 release) E12 Human lymphoblast (cancer cell line)/RPMI8226 (IL8 Release) E13 TNF alpha production Human Synoviocyte cytokine production (TNF alpha release) E14 Whole blood TNF alpha release E15 IL10 Release Human acute promyelocytic leukemia cells/HL60 IL10 release E16 Human Primary Blood Mononuclear cells (IL10 Release) E17 Data analysis for cytokine release assays was performed by dividing the numerical value in the assay well by the average PBS value for the assay plate. AARS polypeptides were considered to be a modulator of cytokine production or cytokine related biology if greater than 2 SD away from the PBS value in the positive or negative direction. A protein standard (specific to each assay kit) was run on every plate to insure good assay quality. Only assays with protein standard curves that had an R.sup.2 value of > than 0.9 were chosen for data analysis. Cell Adhesion and Chemotaxis Assay Assay Description Number Monocyte THP 1/Human umbilical vein endothelial cell F1 (HUVEC) cell adhesion Human hepatocyte (HepG2C3a cells) (ICAM release) F2 Human lung microvascular endothelial cell (HLMVEC) F3 cell adhesion regulation (ICAM release) Human umbilical vein endothelial cell (HUVEC) cell F4 adhesion regulation (VCAM release) Human mesenchymal stem cell (hMSC) cell adhesion F5 regulation (VCAM release) Human skeletal muscle cell (hSKMC) cell adhesion F6 regulation (VCAM release) Human pulmonary artery smooth muscle cell (hPASMC) F7 cell adhesion regulation (VCAM release) Data analysis for cell adhesion regulation assays was performed by dividing the numerical value in the assay well by the average PBS value for the assay plate. AARS polypeptides were considered to be a modulator of cell adhesion or a regulator of biology related to cell adhesion if a value of greater than 2 SD away from the PBS value in the positive or negative direction was noted. In the case of the ELISA assays, a protein standard (specific to each assay kit) was run on every plate to insure good assay quality. Only assays with protein standard curves that had an R.sup.2 value of > than 0.9 were chosen for data analysis. Cellular Differentiation Assay Assay Description Number Human pre-adiocyte (hPAD) cell differentiation G1 Human skeletal muscle (hSKMC) cell differentiation G2 Human mesenchymal stem (hMSC) cell differentiation G3 Human pulmonary artery smooth muscle cell (hPASMC) G4 differentiation Data analysis for cellular differentiation assays was performed by dividing the numerical value in the assay well by the average PBS value for the assay plate. Differentiation assays were scored based upon fluorescent intensity of particular antibodies as described in the methods section. AARS polypeptides were considered to be a modulator of cellular differentiation if an intensity reading of greater than 2 SD away from the PBS value in the positive or negative direction was noted. For the hSKMC analysis, digital photos were taken of all wells and photos were scored in a blinded fashion by three people using a 4 point scoring system where 4 indicated intense skeletal muscle actin staining and obvious myotube formation. The average value from visual scoring was used and only wells with an average value of >3 were considered hits. Differentiation control treated wells in this assay typically scored >2, while PBS treated wells scored <2. Cell Binding Assay Assay Description Number PBMC H1 Primary T cell H2 Primary B cell H3 Primary Monocyte H4 HepG2 H5 3T3L1 H6 C2C12 H7 THP1 H8 Jurkat H9 Raji H10 AARS polypeptides were considered to be binding to a particular cell type if the mean cell bound fluorescence intensity was greater than 2 SD away from the reagent control values for that cell type.

TABLE-US-00037 TABLE E7 Results of Functional Profiling studies of Representative AARS Polypeptides AARS Location of polypeptide Epitope Tag Conc/[nM] Assay Hits AlaRS1.sup.N1 C-terminal 139 D1 (Modulation of Toll- like receptors) E4, (Cytokine Release) G1 G3 (Cellular Differentiation) AlaRS1.sup.N3 N-terminal 114 G1 (Cellular Differentiation) AlaRS1.sup.N3 C-terminal 250 F2 (Cell Adhesion and Chemotaxis) G1 (Cellular Differentiation) AlaRS1.sup.N6 N-terminal 56 AlaRS1.sup.N6 C-terminal 40 F5 (Cell Adhesion and Chemotaxis) AlaRS1.sup.I1 N-terminal 172 A9 (Proliferation) C2 (Neutrophil activation) D1, D2, (Modulation of Toll-like receptors) E1, E8 (Cytokine Release) AlaRS1.sup.C2 N-terminal 250 E4 (Cytokine Release) F5 (Cell Adhesion and Chemotaxis) AlaRS1.sup.C2 C-terminal 250 A6 (Proliferation) AlaRS1.sup.C6 C-terminal 250 A4 (Proliferation) C2 (Neutrophil activation) E15, E17 (Cytokine Release) H1-H9 (Cell binding)

[0727] It is concluded that AlaRS1.sup.N1 and AlaRS1.sup.N3 appear to be major regulators of cellular differentiation, cytokine release and the potentially modulators of Toll like receptor activity, while AlaRS1.sup.N6 may play a role in regulating cell adhesion and chemotaxis. When viewed in light of the transcriptional profiling data, the phenotypic screening data demonstrates that the AARS polypeptides AlaRS1.sup.N1, (amino acids 1-401), AlaRS1.sup.N3, (amino acids 1-488) and AlaRS1.sup.N6 (amino acids 1-497+24 amino acids) define the boundaries of a novel protein domain that is highly active in a broad array of phenotypic screening assays.

[0728] Accordingly it is concluded that AARS polypeptides comprising amino acids 1 to 497 amino acids of Alanyl tRNA synthetase (and optionally a variable c-terminal amino acid extension of about 1 to about 30 amino acids) defines the approximate boundaries of a novel, highly active AARS polypeptide domain, that is i) highly functionally active, ii) can be readily made and produced in E. coli, and iii) exhibits favorable protein stability and aggregation characteristics. It will be appreciated by those of skill in the art that any AARS polypeptides comprising as few as about the first 400 amino acids of the Alanyl tRNA synthetase, to as large as about the first 500 amino acids of Alanyl tRNA synthetase represent functional equivalents of the specific AARS polypeptides described.

[0729] Moreover AlaRS1.sup.C2 and AlaRS1.sup.C6, appear to be major regulators of proliferation and cellular differentiation, as well as neutrophil activation and cytokine release. When viewed in light of the transcriptional profiling data, the phenotypic screening data demonstrates that the AARS polypeptides AlaRS1.sup.C2, (amino acids 758-968) and AlaRS1.sup.C6, (amino acids 747-968) define the boundaries of a second novel AARS polypeptide domain that is highly active in a broad array of phenotypic screening assays.

[0730] Accordingly it is concluded that AARS polypeptides comprising amino acids 747-968 amino acids of Alanyl tRNA synthetase defines the approximate boundaries of a novel, highly active AARS polypeptide domain, that is i) highly functionally active, ii) can be readily made and produced in E. coli, and iii) exhibits favorable protein stability and aggregation characteristics. It will be appreciated by those of skill in the art that any AARS polypeptides comprising as few as about the last 210 amino acids of the Alanyl tRNA synthetase, to as large as about the last 221 amino acids of Alanyl tRNA synthetase represent functional equivalents of the specific AARS polypeptides described.

Example 13

Animal Studies

[0731] To test for the ability of the AARS polypeptides to modulate hematopoiesis and inflammatory responses, a representative AARS polypeptide, AlaRS1.sup.C6, prepared as described in Table E2, was administered to wild type and DIO mice, as described in the general methods. Results with respect to Cell Blood Counts and Cytokine release are shown in Tables E8 and E9 respectively.

TABLE-US-00038 TABLE E8 Influence of AlaRS1.sup.C6 on hematopoiesis in wild type and diet induced obese (DIO) mice Wild type Cell type Mice DIO Mice White Blood Cells - + Neutrophils 0 0 Lymphocytes - + Monocytes 0 0 HGB 0 0 HCT 0 0 MCV 0 0 MCH 0 0 MCHC 0 0 Platelets - -

TABLE-US-00039 TABLE E9 Influence of AlaRS1.sup.C6 on Cell Blood Counts and cytokine release in wild type and diet induced obese mice AARS Polypeptide CBC Acute Cytokine Chronic Cytokine C57BL/6 Mice on Normal Diet AlaRS1.sup.C6 + 15 3 C57BL/6 Mice on High Fat Diet AlaRS1.sup.C6 + 16 2

[0732] The results from the in vivo animal studies show that daily administration of AlaRS1.sup.C6 at 10 mg/kg for 4 days promoted white blood cell and lymphocyte levels, while reducing platelet counts in whole animals, in both mice and diet induced obese mice. Moreover the animal studies demonstrated that AlaRS1.sup.C6 was safe and well tolerated at this dose, and produced no overt negative effects in treated animals. AlaRS1.sup.C6 also promoted cell blood counts and acute cytokine release, suggesting a role in hematopoiesis, immune function and inflammatory responses.

Sequence CWU 1

1

186177DNAArtificial SequenceOligonucleotide 1aggaggtaaa acatatgcat catcatcatc atcacggtaa gcctatccct aaccctttgc 60tcggtctcga ttctacg 77212DNAArtificial SequenceOligonucleotide 2taatgactcg ag 12317DNAArtificial SequenceOligonucleotide 3aggagataaa acatatg 17414DNAArtificial SequenceOligonucleotide 4aggaggtaaa acat 14514DNAArtificial SequenceOligonucleotide 5aggagataaa acat 14615DNAArtificial SequenceOligonucleotide 6gaaggagata tacat 15772DNAArtificial SequenceOligonucleotide 7ggtaagccta tccctaaccc tctcctcggt ctcgattcta cgcaccacca tcatcaccat 60taatgactcg ag 72872DNAArtificial SequenceOligonucleotide 8catatgcatc atcatcatca tcacggtaag cctatcccta accctctcct cggtctcgat 60tctacgggat cc 72912DNAArtificial SequenceOligonucleotide 9ctcgagtaat ga 121012DNAArtificial SequenceOligonucleotide 10catatgggat cc 121172DNAArtificial SequenceOligonucleotide 11ctcgagggta agcctatccc taaccctctc ctcggtctcg attctacgca ccaccaccac 60caccactaat ga 7212401PRTHomo sapiens 12Met Asp Ser Thr Leu Thr Ala Ser Glu Ile Arg Gln Arg Phe Ile Asp1 5 10 15Phe Phe Lys Arg Asn Glu His Thr Tyr Val His Ser Ser Ala Thr Ile 20 25 30Pro Leu Asp Asp Pro Thr Leu Leu Phe Ala Asn Ala Gly Met Asn Gln 35 40 45Phe Lys Pro Ile Phe Leu Asn Thr Ile Asp Pro Ser His Pro Met Ala 50 55 60Lys Leu Ser Arg Ala Ala Asn Thr Gln Lys Cys Ile Arg Ala Gly Gly65 70 75 80Lys His Asn Asp Leu Asp Asp Val Gly Lys Asp Val Tyr His His Thr 85 90 95Phe Phe Glu Met Leu Gly Ser Trp Ser Phe Gly Asp Tyr Phe Lys Glu 100 105 110Leu Ala Cys Lys Met Ala Leu Glu Leu Leu Thr Gln Glu Phe Gly Ile 115 120 125Pro Ile Glu Arg Leu Tyr Val Thr Tyr Phe Gly Gly Asp Glu Ala Ala 130 135 140Gly Leu Glu Ala Asp Leu Glu Cys Lys Gln Ile Trp Gln Asn Leu Gly145 150 155 160Leu Asp Asp Thr Lys Ile Leu Pro Gly Asn Met Lys Asp Asn Phe Trp 165 170 175Glu Met Gly Asp Thr Gly Pro Cys Gly Pro Cys Ser Glu Ile His Tyr 180 185 190Asp Arg Ile Gly Gly Arg Asp Ala Ala His Leu Val Asn Gln Asp Asp 195 200 205Pro Asn Val Leu Glu Ile Trp Asn Leu Val Phe Ile Gln Tyr Asn Arg 210 215 220Glu Ala Asp Gly Ile Leu Lys Pro Leu Pro Lys Lys Ser Ile Asp Thr225 230 235 240Gly Met Gly Leu Glu Arg Leu Val Ser Val Leu Gln Asn Lys Met Ser 245 250 255Asn Tyr Asp Thr Asp Leu Phe Val Pro Tyr Phe Glu Ala Ile Gln Lys 260 265 270Gly Thr Gly Ala Arg Pro Tyr Thr Gly Lys Val Gly Ala Glu Asp Ala 275 280 285Asp Gly Ile Asp Met Ala Tyr Arg Val Leu Ala Asp His Ala Arg Thr 290 295 300Ile Thr Val Ala Leu Ala Asp Gly Gly Arg Pro Asp Asn Thr Gly Arg305 310 315 320Gly Tyr Val Leu Arg Arg Ile Leu Arg Arg Ala Val Arg Tyr Ala His 325 330 335Glu Lys Leu Asn Ala Ser Arg Gly Phe Phe Ala Thr Leu Val Asp Val 340 345 350Val Val Gln Ser Leu Gly Asp Ala Phe Pro Glu Leu Lys Lys Asp Pro 355 360 365Asp Met Val Lys Asp Ile Ile Asn Glu Glu Glu Val Gln Phe Leu Lys 370 375 380Thr Leu Ser Arg Gly Arg Arg Ile Leu Asp Arg Lys Ile Gln Ser Leu385 390 395 400Gly131203DNAHomo sapiens 13atggactcta ctctaacagc aagtgaaatc cggcagcgat ttatagattt cttcaagagg 60aacgagcata cgtatgttca ctcgtctgcc accatcccat tggatgaccc cactttgctc 120tttgccaatg caggcatgaa ccagtttaaa cccattttcc tgaacacaat tgacccatct 180caccccatgg caaagctgag cagagctgcc aatacccaga agtgcatccg ggctgggggc 240aaacataatg acctggacga tgtgggcaag gatgtctatc atcacacctt cttcgagatg 300ctgggctctt ggtcttttgg agattacttt aaggaattgg catgtaagat ggctctggaa 360ctcctcaccc aagagtttgg cattcccatt gaaagacttt atgttactta ctttggcggg 420gatgaagcag ctggcttaga agcagatctg gaatgcaaac agatctggca aaatttgggg 480ctggatgaca ccaaaatcct cccaggcaac atgaaggata acttctggga gatgggtgac 540acgggcccct gtggtccttg cagtgagatc cactacgacc ggattggtgg tcgggacgcc 600gcacatcttg tcaaccagga cgaccctaat gtgctggaga tctggaacct tgtgttcatc 660cagtataaca gggaagctga tggcattctg aaacctcttc ccaagaaaag cattgacaca 720gggatgggcc tggaacgact ggtatctgtg ctgcagaata agatgtccaa ctatgacact 780gacctttttg tcccttactt tgaagccatt cagaagggca caggtgcccg accatacact 840gggaaagttg gtgctgagga tgccgatggg attgacatgg cctaccgggt gctggctgac 900cacgctcgga ccatcactgt ggcactggct gatggtggcc ggcctgacaa cacagggcgt 960ggatatgtgt tgagacggat tctccgccga gctgtccgat acgcccatga aaagctcaat 1020gccagcaggg gcttctttgc tacgttagtg gatgttgtcg tccagtccct gggagatgca 1080tttcctgagc tgaagaagga cccagacatg gtgaaggaca tcattaatga agaagaggtg 1140cagtttctca agactctcag cagagggcgt cgcatcctgg acaggaaaat tcagagcctg 1200gga 120314756PRTHomo sapiens 14Met Asp Ser Thr Leu Thr Ala Ser Glu Ile Arg Gln Arg Phe Ile Asp1 5 10 15Phe Phe Lys Arg Asn Glu His Thr Tyr Val His Ser Ser Ala Thr Ile 20 25 30Pro Leu Asp Asp Pro Thr Leu Leu Phe Ala Asn Ala Gly Met Asn Gln 35 40 45Phe Lys Pro Ile Phe Leu Asn Thr Ile Asp Pro Ser His Pro Met Ala 50 55 60Lys Leu Ser Arg Ala Ala Asn Thr Gln Lys Cys Ile Arg Ala Gly Gly65 70 75 80Lys His Asn Asp Leu Asp Asp Val Gly Lys Asp Val Tyr His His Thr 85 90 95Phe Phe Glu Met Leu Gly Ser Trp Ser Phe Gly Asp Tyr Phe Lys Glu 100 105 110Leu Ala Cys Lys Met Ala Leu Glu Leu Leu Thr Gln Glu Phe Gly Ile 115 120 125Pro Ile Glu Arg Leu Tyr Val Thr Tyr Phe Gly Gly Asp Glu Ala Ala 130 135 140Gly Leu Glu Ala Asp Leu Glu Cys Lys Gln Ile Trp Gln Asn Leu Gly145 150 155 160Leu Asp Asp Thr Lys Ile Leu Pro Gly Asn Met Lys Asp Asn Phe Trp 165 170 175Glu Met Gly Asp Thr Gly Pro Cys Gly Pro Cys Ser Glu Ile His Tyr 180 185 190Asp Arg Ile Gly Gly Arg Asp Ala Ala His Leu Val Asn Gln Asp Asp 195 200 205Pro Asn Val Leu Glu Ile Trp Asn Leu Val Phe Ile Gln Tyr Asn Arg 210 215 220Glu Ala Asp Gly Ile Leu Lys Pro Leu Pro Lys Lys Ser Ile Asp Thr225 230 235 240Gly Met Gly Leu Glu Arg Leu Val Ser Val Leu Gln Asn Lys Met Ser 245 250 255Asn Tyr Asp Thr Asp Leu Phe Val Pro Tyr Phe Glu Ala Ile Gln Lys 260 265 270Gly Thr Gly Ala Arg Pro Tyr Thr Gly Lys Val Gly Ala Glu Asp Ala 275 280 285Asp Gly Ile Asp Met Ala Tyr Arg Val Leu Ala Asp His Ala Arg Thr 290 295 300Ile Thr Val Ala Leu Ala Asp Gly Gly Arg Pro Asp Asn Thr Gly Arg305 310 315 320Gly Tyr Val Leu Arg Arg Ile Leu Arg Arg Ala Val Arg Tyr Ala His 325 330 335Glu Lys Leu Asn Ala Ser Arg Gly Phe Phe Ala Thr Leu Val Asp Val 340 345 350Val Val Gln Ser Leu Gly Asp Ala Phe Pro Glu Leu Lys Lys Asp Pro 355 360 365Asp Met Val Lys Asp Ile Ile Asn Glu Glu Glu Val Gln Phe Leu Lys 370 375 380Thr Leu Ser Arg Gly Arg Arg Ile Leu Asp Arg Lys Ile Gln Ser Leu385 390 395 400Gly Asp Ser Lys Thr Ile Pro Gly Asp Thr Ala Trp Leu Leu Tyr Asp 405 410 415Thr Tyr Gly Phe Pro Val Asp Leu Thr Gly Leu Ile Ala Glu Glu Lys 420 425 430Gly Leu Val Val Asp Met Asp Gly Phe Glu Glu Glu Arg Lys Leu Ala 435 440 445Gln Leu Lys Ser Gln Gly Lys Gly Ala Gly Gly Glu Asp Leu Ile Met 450 455 460Leu Asp Ile Tyr Ala Ile Glu Glu Leu Arg Ala Arg Gly Leu Glu Val465 470 475 480Thr Asp Asp Ser Pro Lys Tyr Asn Tyr His Leu Asp Ser Ser Gly Ser 485 490 495Tyr Val Phe Glu Asn Thr Val Ala Thr Val Met Ala Leu Arg Arg Glu 500 505 510Lys Met Phe Val Glu Glu Val Ser Thr Gly Gln Glu Cys Gly Val Val 515 520 525Leu Asp Lys Thr Cys Phe Tyr Ala Glu Gln Gly Gly Gln Ile Tyr Asp 530 535 540Glu Gly Tyr Leu Val Lys Val Asp Asp Ser Ser Glu Asp Lys Thr Glu545 550 555 560Phe Thr Val Lys Asn Ala Gln Val Arg Gly Gly Tyr Val Leu His Ile 565 570 575Gly Thr Ile Tyr Gly Asp Leu Lys Val Gly Asp Gln Val Trp Leu Phe 580 585 590Ile Asp Glu Pro Arg Arg Arg Pro Ile Met Ser Asn His Thr Ala Thr 595 600 605His Ile Leu Asn Phe Ala Leu Arg Ser Val Leu Gly Glu Ala Asp Gln 610 615 620Lys Gly Ser Leu Val Ala Pro Asp Arg Leu Arg Phe Asp Phe Thr Ala625 630 635 640Lys Gly Ala Met Ser Thr Gln Gln Ile Lys Lys Ala Glu Glu Ile Ala 645 650 655Asn Glu Met Ile Glu Ala Ala Lys Ala Val Tyr Thr Gln Asp Cys Pro 660 665 670Leu Ala Ala Ala Lys Ala Ile Gln Gly Leu Arg Ala Val Phe Asp Glu 675 680 685Thr Tyr Pro Asp Pro Val Arg Val Val Ser Ile Gly Val Pro Val Ser 690 695 700Glu Leu Leu Asp Asp Pro Ser Gly Pro Ala Gly Ser Leu Thr Ser Val705 710 715 720Glu Phe Cys Gly Gly Thr His Leu Arg Asn Ser Ser His Ala Gly Ala 725 730 735Phe Val Ile Val Thr Glu Glu Ala Ile Ala Lys Gly Ile Arg Arg Ile 740 745 750Val Ala Val Thr 755152268DNAHomo sapiens 15atggactcta ctctaacagc aagtgaaatc cggcagcgat ttatagattt cttcaagagg 60aacgagcata cgtatgttca ctcgtctgcc accatcccat tggatgaccc cactttgctc 120tttgccaatg caggcatgaa ccagtttaaa cccattttcc tgaacacaat tgacccatct 180caccccatgg caaagctgag cagagctgcc aatacccaga agtgcatccg ggctgggggc 240aaacataatg acctggacga tgtgggcaag gatgtctatc atcacacctt cttcgagatg 300ctgggctctt ggtcttttgg agattacttt aaggaattgg catgtaagat ggctctggaa 360ctcctcaccc aagagtttgg cattcccatt gaaagacttt atgttactta ctttggcggg 420gatgaagcag ctggcttaga agcagatctg gaatgcaaac agatctggca aaatttgggg 480ctggatgaca ccaaaatcct cccaggcaac atgaaggata acttctggga gatgggtgac 540acgggcccct gtggtccttg cagtgagatc cactacgacc ggattggtgg tcgggacgcc 600gcacatcttg tcaaccagga cgaccctaat gtgctggaga tctggaacct tgtgttcatc 660cagtataaca gggaagctga tggcattctg aaacctcttc ccaagaaaag cattgacaca 720gggatgggcc tggaacgact ggtatctgtg ctgcagaata agatgtccaa ctatgacact 780gacctttttg tcccttactt tgaagccatt cagaagggca caggtgcccg accatacact 840gggaaagttg gtgctgagga tgccgatggg attgacatgg cctaccgggt gctggctgac 900cacgctcgga ccatcactgt ggcactggct gatggtggcc ggcctgacaa cacagggcgt 960ggatatgtgt tgagacggat tctccgccga gctgtccgat acgcccatga aaagctcaat 1020gccagcaggg gcttctttgc tacgttagtg gatgttgtcg tccagtccct gggagatgca 1080tttcctgagc tgaagaagga cccagacatg gtgaaggaca tcattaatga agaagaggtg 1140cagtttctca agactctcag cagagggcgt cgcatcctgg acaggaaaat tcagagcctg 1200ggagacagca agaccattcc cggagacact gcttggctcc tctatgacac ctatgggttt 1260ccagtggatc tgactggact gattgctgaa gagaagggcc tggtggtaga catggatggc 1320tttgaagagg agaggaaact ggcccagctg aaatcacagg gcaagggagc tggtggggaa 1380gacctcatta tgctggacat ttacgctatc gaagagctcc gggcacgggg tctggaggtc 1440acagatgatt ccccaaagta caattaccat ttggactcca gtggtagcta tgtatttgag 1500aacacagtgg ctacggtgat ggctctgcgc agggagaaga tgttcgtgga agaggtgtcc 1560acaggccagg agtgtggagt ggtgctggac aagacctgtt tctatgctga gcaaggaggc 1620cagatctatg acgaaggcta cctggtgaag gtggatgaca gcagtgaaga taaaacagag 1680tttacagtga agaatgctca ggtccgagga gggtatgtgc tacacattgg aaccatctac 1740ggtgacctga aagtggggga tcaggtctgg ctgtttattg atgagccccg acgaagaccc 1800atcatgagca accacacagc tacgcacatt ctgaacttcg ccctgcgctc agtgcttggg 1860gaagctgacc agaaaggctc attggttgct cctgaccgcc tcagatttga ctttactgcc 1920aagggagcca tgtccaccca acagatcaag aaggctgaag agattgctaa tgagatgatt 1980gaggcagcca aggccgtcta tacccaggat tgccccctgg cagcagcgaa agccatccag 2040ggcctacggg ctgtgtttga tgagacctat cctgaccctg tgcgagtcgt ctccattggg 2100gtcccggtgt ccgagttgct ggatgacccc tctgggcctg ctggctccct gacttctgtt 2160gagttctgtg ggggaacgca cctgcggaac tcgagtcatg caggagcttt tgtgatcgtg 2220acggaagaag ccattgccaa gggtatccgg aggattgtgg ctgtcaca 22681621PRTMus musculus 16Leu Tyr Val Thr Tyr Phe Gly Gly Asp Glu Ala Ala Gly Leu Glu Pro1 5 10 15Asp Leu Glu Cys Arg 2017150PRTMus musculus 17Gln Ile Trp Gln Asn Leu Gly Leu Asp Glu Ala Arg Ile Leu Pro Gly1 5 10 15Asn Met Lys Asp Asn Phe Trp Glu Met Gly Asp Thr Gly Pro Cys Gly 20 25 30Pro Cys Ser Glu Ile His Tyr Asp Arg Ile Gly Gly Arg Asp Ala Ala 35 40 45His Leu Val Asn Gln Asp Asp Pro Asn Val Leu Glu Ile Trp Asn Leu 50 55 60Val Phe Ile Gln Tyr Asn Arg Glu Ser Asp Gly Val Leu Lys Pro Leu65 70 75 80Pro Lys Lys Ser Ile Asp Thr Gly Met Gly Leu Glu Arg Leu Val Ser 85 90 95Val Leu Gln Asn Lys Met Ser Asn Tyr Asp Thr Asp Leu Phe Met Pro 100 105 110Tyr Phe Glu Ala Ile Gln Lys Gly Thr Gly Ala Arg Pro Tyr Thr Gly 115 120 125Lys Val Gly Ala Glu Asp Ala Asp Gly Ile Asp Met Ala Tyr Arg Val 130 135 140Leu Ala Asp His Ala Arg145 1501817PRTMus musculus 18Thr Ile Thr Val Ala Leu Ala Asp Gly Gly Arg Pro Asp Asn Thr Gly1 5 10 15Arg1952PRTMus musculus 19Gly Tyr Val Leu Arg Arg Ile Leu Arg Arg Ala Val Arg Tyr Ser His1 5 10 15Glu Lys Leu Asn Ala Ser Arg Gly Phe Phe Ala Thr Leu Val Asp Val 20 25 30Val Val Gln Ser Leu Gly Asp Ala Phe Pro Glu Leu Lys Lys Asp Pro 35 40 45Glu Met Val Lys 502012PRTMus musculus 20Asp Ile Ile Asn Glu Glu Glu Val Gln Phe Leu Lys1 5 1021252PRTMus musculus 21Leu Tyr Val Thr Tyr Phe Gly Gly Asp Glu Ala Ala Gly Leu Glu Pro1 5 10 15Asp Leu Glu Cys Arg Gln Ile Trp Gln Asn Leu Gly Leu Asp Glu Ala 20 25 30Arg Ile Leu Pro Gly Asn Met Lys Asp Asn Phe Trp Glu Met Gly Asp 35 40 45Thr Gly Pro Cys Gly Pro Cys Ser Glu Ile His Tyr Asp Arg Ile Gly 50 55 60Gly Arg Asp Ala Ala His Leu Val Asn Gln Asp Asp Pro Asn Val Leu65 70 75 80Glu Ile Trp Asn Leu Val Phe Ile Gln Tyr Asn Arg Glu Ser Asp Gly 85 90 95Val Leu Lys Pro Leu Pro Lys Lys Ser Ile Asp Thr Gly Met Gly Leu 100 105 110Glu Arg Leu Val Ser Val Leu Gln Asn Lys Met Ser Asn Tyr Asp Thr 115 120 125Asp Leu Phe Met Pro Tyr Phe Glu Ala Ile Gln Lys Gly Thr Gly Ala 130 135 140Arg Pro Tyr Thr Gly Lys Val Gly Ala Glu Asp Ala Asp Gly Ile Asp145 150 155 160Met Ala Tyr Arg Val Leu Ala Asp His Ala Arg Thr Ile Thr Val Ala 165 170 175Leu Ala Asp Gly Gly Arg Pro Asp Asn Thr Gly Arg Gly Tyr Val Leu 180 185 190Arg Arg Ile Leu Arg Arg Ala Val Arg Tyr Ser His Glu Lys Leu Asn 195 200 205Ala Ser Arg Gly Phe Phe Ala Thr Leu Val Asp Val Val Val Gln Ser 210 215 220Leu Gly Asp Ala Phe Pro Glu Leu Lys Lys Asp Pro Glu Met Val Lys225 230 235

240Asp Ile Ile Asn Glu Glu Glu Val Gln Phe Leu Lys 245 2502216PRTMus musculus 22Met Ala Leu Glu Leu Leu Thr Gln Glu Phe Gly Ile Pro Val Glu Arg1 5 10 152333PRTMus musculus 23Leu Tyr Val Thr Tyr Phe Gly Gly Asp Glu Ala Ala Gly Leu Glu Pro1 5 10 15Asp Leu Glu Cys Arg Gln Ile Trp Gln Asn Leu Gly Leu Asp Glu Ala 20 25 30Arg2489PRTMus musculus 24Ile Leu Pro Gly Asn Met Lys Asp Asn Phe Trp Glu Met Gly Asp Thr1 5 10 15Gly Pro Cys Gly Pro Cys Ser Glu Ile His Tyr Asp Arg Ile Gly Gly 20 25 30Arg Asp Ala Ala His Leu Val Asn Gln Asp Asp Pro Asn Val Leu Glu 35 40 45Ile Trp Asn Leu Val Phe Ile Gln Tyr Asn Arg Glu Ser Asp Gly Val 50 55 60Leu Lys Pro Leu Pro Lys Lys Ser Ile Asp Thr Gly Met Gly Leu Glu65 70 75 80Arg Leu Val Ser Val Leu Gln Asn Lys 852518PRTMus musculus 25Met Ser Asn Tyr Asp Thr Asp Leu Phe Met Pro Tyr Phe Glu Ala Ile1 5 10 15Gln Lys2631PRTMus musculus 26Gly Thr Gly Ala Arg Pro Tyr Thr Gly Lys Val Gly Ala Glu Asp Ala1 5 10 15Asp Gly Ile Asp Met Ala Tyr Arg Val Leu Ala Asp His Ala Arg 20 25 302717PRTMus musculus 27Thr Ile Thr Val Ala Leu Ala Asp Gly Gly Arg Pro Asp Asn Thr Gly1 5 10 15Arg2852PRTMus musculus 28Gly Tyr Val Leu Arg Arg Ile Leu Arg Arg Ala Val Arg Tyr Ser His1 5 10 15Glu Lys Leu Asn Ala Ser Arg Gly Phe Phe Ala Thr Leu Val Asp Val 20 25 30Val Val Gln Ser Leu Gly Asp Ala Phe Pro Glu Leu Lys Lys Asp Pro 35 40 45Glu Met Val Lys 502912PRTMus musculus 29Asp Ile Ile Asn Glu Glu Glu Val Gln Phe Leu Lys1 5 103020PRTMus musculus 30Thr Leu Ser Arg Gly Arg Arg Ile Leu Asp Arg Lys Ile Gln Ser Leu1 5 10 15Gly Asp Cys Lys 203128PRTMus musculus 31Thr Ile Pro Gly Asp Thr Ala Trp Leu Leu Tyr Asp Thr Tyr Gly Phe1 5 10 15Pro Val Asp Leu Thr Gly Leu Ile Ala Glu Glu Lys 20 253223PRTMus musculus 32Gly Leu Val Val Asp Met Asn Gly Phe Glu Glu Glu Arg Arg Leu Ala1 5 10 15Gln Leu Lys Ser Gln Gly Lys 203319PRTMus musculus 33Gly Ala Gly Asp Glu Asp Leu Ile Met Leu Asp Ile Tyr Ala Ile Glu1 5 10 15Glu Leu Arg3439PRTMus musculus 34Ala Lys Gly Leu Glu Ala Thr Asp Asp Ser Pro Lys Tyr Asn Tyr Gln1 5 10 15Ser Asp Ser Ser Gly Ser Tyr Val Phe Glu Cys Thr Val Ala Thr Val 20 25 30Leu Ala Leu Arg Arg Glu Lys 353518PRTMus musculus 35Met Phe Val Asp Glu Val Val Thr Gly Gln Glu Cys Gly Val Val Leu1 5 10 15Asp Lys3619PRTMus musculus 36Thr Cys Phe Tyr Ala Glu Gln Gly Gly Gln Ile Tyr Asp Glu Gly Tyr1 5 10 15Leu Val Lys3714PRTMus musculus 37Val Asp Asp Ser Ser Glu Asp Lys Thr Glu Phe Thr Val Lys1 5 103886PRTMus musculus 38Asn Ala Gln Val Arg Gly Gly Tyr Val Leu His Ile Gly Thr Ile Tyr1 5 10 15Gly Asn Leu Lys Val Gly Asp Gln Val Arg Leu Phe Ile Asp Glu Pro 20 25 30Arg Arg Arg Pro Val Met Ser Asn His Thr Ala Thr His Ile Leu Asn 35 40 45Phe Ala Leu Arg Ser Val Leu Gly Glu Ala Asp Gln Lys Gly Ser Leu 50 55 60Val Ala Pro Asp Arg Leu Arg Phe Asp Phe Thr Ala Lys Gly Ala Met65 70 75 80Ser Thr Gln Gln Ile Lys 853927PRTMus musculus 39Lys Ala Glu Glu Ile Val Asn Gly Met Ile Glu Ala Ala Lys Pro Val1 5 10 15Tyr Thr Gln Asp Cys Pro Leu Ala Ala Ala Lys 20 2540561PRTMus musculus 40Met Ala Leu Glu Leu Leu Thr Gln Glu Phe Gly Ile Pro Val Glu Arg1 5 10 15Leu Tyr Val Thr Tyr Phe Gly Gly Asp Glu Ala Ala Gly Leu Glu Pro 20 25 30Asp Leu Glu Cys Arg Gln Ile Trp Gln Asn Leu Gly Leu Asp Glu Ala 35 40 45Arg Ile Leu Pro Gly Asn Met Lys Asp Asn Phe Trp Glu Met Gly Asp 50 55 60Thr Gly Pro Cys Gly Pro Cys Ser Glu Ile His Tyr Asp Arg Ile Gly65 70 75 80Gly Arg Asp Ala Ala His Leu Val Asn Gln Asp Asp Pro Asn Val Leu 85 90 95Glu Ile Trp Asn Leu Val Phe Ile Gln Tyr Asn Arg Glu Ser Asp Gly 100 105 110Val Leu Lys Pro Leu Pro Lys Lys Ser Ile Asp Thr Gly Met Gly Leu 115 120 125Glu Arg Leu Val Ser Val Leu Gln Asn Lys Met Ser Asn Tyr Asp Thr 130 135 140Asp Leu Phe Met Pro Tyr Phe Glu Ala Ile Gln Lys Gly Thr Gly Ala145 150 155 160Arg Pro Tyr Thr Gly Lys Val Gly Ala Glu Asp Ala Asp Gly Ile Asp 165 170 175Met Ala Tyr Arg Val Leu Ala Asp His Ala Arg Thr Ile Thr Val Ala 180 185 190Leu Ala Asp Gly Gly Arg Pro Asp Asn Thr Gly Arg Gly Tyr Val Leu 195 200 205Arg Arg Ile Leu Arg Arg Ala Val Arg Tyr Ser His Glu Lys Leu Asn 210 215 220Ala Ser Arg Gly Phe Phe Ala Thr Leu Val Asp Val Val Val Gln Ser225 230 235 240Leu Gly Asp Ala Phe Pro Glu Leu Lys Lys Asp Pro Glu Met Val Lys 245 250 255Asp Ile Ile Asn Glu Glu Glu Val Gln Phe Leu Lys Thr Leu Ser Arg 260 265 270Gly Arg Arg Ile Leu Asp Arg Lys Ile Gln Ser Leu Gly Asp Cys Lys 275 280 285Thr Ile Pro Gly Asp Thr Ala Trp Leu Leu Tyr Asp Thr Tyr Gly Phe 290 295 300Pro Val Asp Leu Thr Gly Leu Ile Ala Glu Glu Lys Gly Leu Val Val305 310 315 320Asp Met Asn Gly Phe Glu Glu Glu Arg Arg Leu Ala Gln Leu Lys Ser 325 330 335Gln Gly Lys Gly Ala Gly Asp Glu Asp Leu Ile Met Leu Asp Ile Tyr 340 345 350Ala Ile Glu Glu Leu Arg Ala Lys Gly Leu Glu Ala Thr Asp Asp Ser 355 360 365Pro Lys Tyr Asn Tyr Gln Ser Asp Ser Ser Gly Ser Tyr Val Phe Glu 370 375 380Cys Thr Val Ala Thr Val Leu Ala Leu Arg Arg Glu Lys Met Phe Val385 390 395 400Asp Glu Val Val Thr Gly Gln Glu Cys Gly Val Val Leu Asp Lys Thr 405 410 415Cys Phe Tyr Ala Glu Gln Gly Gly Gln Ile Tyr Asp Glu Gly Tyr Leu 420 425 430Val Lys Val Asp Asp Ser Ser Glu Asp Lys Thr Glu Phe Thr Val Lys 435 440 445Asn Ala Gln Val Arg Gly Gly Tyr Val Leu His Ile Gly Thr Ile Tyr 450 455 460Gly Asn Leu Lys Val Gly Asp Gln Val Arg Leu Phe Ile Asp Glu Pro465 470 475 480Arg Arg Arg Pro Val Met Ser Asn His Thr Ala Thr His Ile Leu Asn 485 490 495Phe Ala Leu Arg Ser Val Leu Gly Glu Ala Asp Gln Lys Gly Ser Leu 500 505 510Val Ala Pro Asp Arg Leu Arg Phe Asp Phe Thr Ala Lys Gly Ala Met 515 520 525Ser Thr Gln Gln Ile Lys Lys Ala Glu Glu Ile Val Asn Gly Met Ile 530 535 540Glu Ala Ala Lys Pro Val Tyr Thr Gln Asp Cys Pro Leu Ala Ala Ala545 550 555 560Lys41275PRTHomo sapiens 41Met Asp Ser Thr Leu Thr Ala Ser Glu Ile Arg Gln Arg Phe Ile Asp1 5 10 15Phe Phe Lys Arg Asn Glu His Thr Tyr Val His Ser Ser Ala Thr Ile 20 25 30Pro Leu Asp Asp Pro Thr Leu Leu Phe Ala Asn Ala Gly Met Asn Gln 35 40 45Phe Lys Pro Ile Phe Leu Asn Thr Ile Asp Pro Ser His Pro Met Ala 50 55 60Lys Leu Ser Arg Ala Ala Asn Thr Gln Lys Cys Ile Arg Ala Gly Gly65 70 75 80Lys His Asn Asp Leu Asp Asp Val Gly Lys Asp Val Tyr His His Thr 85 90 95Phe Phe Glu Met Leu Gly Ser Trp Ser Phe Gly Asp Tyr Phe Lys Glu 100 105 110Leu Ala Cys Lys Met Ala Leu Glu Leu Leu Thr Gln Glu Phe Gly Ile 115 120 125Pro Ile Glu Arg Leu Tyr Val Thr Tyr Phe Gly Gly Asp Glu Ala Ala 130 135 140Gly Leu Glu Ala Asp Leu Glu Cys Lys Gln Ile Trp Gln Asn Leu Gly145 150 155 160Leu Asp Asp Thr Lys Ile Leu Pro Gly Asn Met Lys Asp Asn Phe Trp 165 170 175Glu Met Gly Asp Thr Gly Pro Cys Gly Pro Cys Ser Glu Ile His Tyr 180 185 190Asp Arg Ile Gly Gly Arg Asp Ala Ala His Leu Val Asn Gln Asp Asp 195 200 205Pro Asn Val Leu Glu Ile Trp Asn Leu Val Phe Ile Gln Tyr Asn Arg 210 215 220Ala Gln Val Pro Asp His Thr Leu Gly Lys Leu Val Leu Arg Met Pro225 230 235 240Met Gly Leu Thr Trp Pro Thr Gly Cys Trp Leu Thr Thr Leu Gly Pro 245 250 255Ser Leu Trp His Trp Leu Met Val Ala Gly Leu Thr Thr Gln Gly Val 260 265 270Asp Met Cys 27542828DNAHomo sapiens 42atggactcta ctctaacagc aagtgaaatc cggcagcgat ttatagattt cttcaagagg 60aacgagcata cgtatgttca ctcgtctgcc accatcccat tggatgaccc cactttgctc 120tttgccaatg caggcatgaa ccagtttaaa cccattttcc tgaacacaat tgacccatct 180caccccatgg caaagctgag cagagctgcc aatacccaga agtgcatccg ggctgggggc 240aaacataatg acctggacga tgtgggcaag gatgtctatc atcacacctt cttcgagatg 300ctgggctctt ggtcttttgg agattacttt aaggaattgg catgtaagat ggctctggaa 360ctcctcaccc aagagtttgg cattcccatt gaaagacttt atgttactta ctttggcggg 420gatgaagcag ctggcttaga agcagatctg gaatgcaaac agatctggca aaatttgggg 480ctggatgaca ccaaaatcct cccaggcaac atgaaggata acttctggga gatgggtgac 540acgggcccct gtggtccttg cagtgagatc cactacgacc ggattggtgg tcgggacgcc 600gcacatcttg tcaaccagga cgaccctaat gtgctggaga tctggaacct tgtgttcatc 660cagtataaca gggcacaggt gcccgaccat acactgggaa agttggtgct gaggatgccg 720atgggattga catggcctac cgggtgctgg ctgaccacgc tcggaccatc actgtggcac 780tggctgatgg tggccggcct gacaacacag ggcgtggata tgtgttga 82843521PRTHomo sapiens 43Met Asp Ser Thr Leu Thr Ala Ser Glu Ile Arg Gln Arg Phe Ile Asp1 5 10 15Phe Phe Lys Arg Asn Glu His Thr Tyr Val His Ser Ser Ala Thr Ile 20 25 30Pro Leu Asp Asp Pro Thr Leu Leu Phe Ala Asn Ala Gly Met Asn Gln 35 40 45Phe Lys Pro Ile Phe Leu Asn Thr Ile Asp Pro Ser His Pro Met Ala 50 55 60Lys Leu Ser Arg Ala Ala Asn Thr Gln Lys Cys Ile Arg Ala Gly Gly65 70 75 80Lys His Asn Asp Leu Asp Asp Val Gly Lys Asp Val Tyr His His Thr 85 90 95Phe Phe Glu Met Leu Gly Ser Trp Ser Phe Gly Asp Tyr Phe Lys Glu 100 105 110Leu Ala Cys Lys Met Ala Leu Glu Leu Leu Thr Gln Glu Phe Gly Ile 115 120 125Pro Ile Glu Arg Leu Tyr Val Thr Tyr Phe Gly Gly Asp Glu Ala Ala 130 135 140Gly Leu Glu Ala Asp Leu Glu Cys Lys Gln Ile Trp Gln Asn Leu Gly145 150 155 160Leu Asp Asp Thr Lys Ile Leu Pro Gly Asn Met Lys Asp Asn Phe Trp 165 170 175Glu Met Gly Asp Thr Gly Pro Cys Gly Pro Cys Ser Glu Ile His Tyr 180 185 190Asp Arg Ile Gly Gly Arg Asp Ala Ala His Leu Val Asn Gln Asp Asp 195 200 205Pro Asn Val Leu Glu Ile Trp Asn Leu Val Phe Ile Gln Tyr Asn Arg 210 215 220Glu Ala Asp Gly Ile Leu Lys Pro Leu Pro Lys Lys Ser Ile Asp Thr225 230 235 240Gly Met Gly Leu Glu Arg Leu Val Ser Val Leu Gln Asn Lys Met Ser 245 250 255Asn Tyr Asp Thr Asp Leu Phe Val Pro Tyr Phe Glu Ala Ile Gln Lys 260 265 270Gly Thr Gly Ala Arg Pro Tyr Thr Gly Lys Val Gly Ala Glu Asp Ala 275 280 285Asp Gly Ile Asp Met Ala Tyr Arg Val Leu Ala Asp His Ala Arg Thr 290 295 300Ile Thr Val Ala Leu Ala Asp Gly Gly Arg Pro Asp Asn Thr Gly Arg305 310 315 320Gly Tyr Val Leu Arg Arg Ile Leu Arg Arg Ala Val Arg Tyr Ala His 325 330 335Glu Lys Leu Asn Ala Ser Arg Gly Phe Phe Ala Thr Leu Val Asp Val 340 345 350Val Val Gln Ser Leu Gly Asp Ala Phe Pro Glu Leu Lys Lys Asp Pro 355 360 365Asp Met Val Lys Asp Ile Ile Asn Glu Glu Glu Val Gln Phe Leu Lys 370 375 380Thr Leu Ser Arg Gly Arg Arg Ile Leu Asp Arg Lys Ile Gln Ser Leu385 390 395 400Gly Asp Ser Lys Thr Ile Pro Gly Asp Thr Ala Trp Leu Leu Tyr Asp 405 410 415Thr Tyr Gly Phe Pro Val Asp Leu Thr Gly Leu Ile Ala Glu Glu Lys 420 425 430Gly Leu Val Val Asp Met Asp Gly Phe Glu Glu Glu Arg Lys Leu Ala 435 440 445Gln Leu Lys Ser Gln Gly Lys Gly Ala Gly Gly Glu Asp Leu Ile Met 450 455 460Leu Asp Ile Tyr Ala Ile Glu Glu Leu Arg Ala Arg Gly Leu Glu Val465 470 475 480Thr Asp Asp Ser Pro Lys Tyr Asn Tyr His Leu Asp Ser Ser Gly Ser 485 490 495Tyr Glu Asn Arg Val Tyr Ser Glu Glu Cys Ser Gly Pro Arg Arg Val 500 505 510Cys Ala Thr His Trp Asn His Leu Arg 515 520441566DNAHomo sapiens 44atggactcta ctctaacagc aagtgaaatc cggcagcgat ttatagattt cttcaagagg 60aacgagcata cgtatgttca ctcgtctgcc accatcccat tggatgaccc cactttgctc 120tttgccaatg caggcatgaa ccagtttaaa cccattttcc tgaacacaat tgacccatct 180caccccatgg caaagctgag cagagctgcc aatacccaga agtgcatccg ggctgggggc 240aaacataatg acctggacga tgtgggcaag gatgtctatc atcacacctt cttcgagatg 300ctgggctctt ggtcttttgg agattacttt aaggaattgg catgtaagat ggctctggaa 360ctcctcaccc aagagtttgg cattcccatt gaaagacttt atgttactta ctttggcggg 420gatgaagcag ctggcttaga agcagatctg gaatgcaaac agatctggca aaatttgggg 480ctggatgaca ccaaaatcct cccaggcaac atgaaggata acttctggga gatgggtgac 540acgggcccct gtggtccttg cagtgagatc cactacgacc ggattggtgg tcgggacgcc 600gcacatcttg tcaaccagga cgaccctaat gtgctggaga tctggaacct tgtgttcatc 660cagtataaca gggaagctga tggcattctg aaacctcttc ccaagaaaag cattgacaca 720gggatgggcc tggaacgact ggtatctgtg ctgcagaata agatgtccaa ctatgacact 780gacctttttg tcccttactt tgaagccatt cagaagggca caggtgcccg accatacact 840gggaaagttg gtgctgagga tgccgatggg attgacatgg cctaccgggt gctggctgac 900cacgctcgga ccatcactgt ggcactggct gatggtggcc ggcctgacaa cacagggcgt 960ggatatgtgt tgagacggat tctccgccga gctgtccgat acgcccatga aaagctcaat 1020gccagcaggg gcttctttgc tacgttagtg gatgttgtcg tccagtccct gggagatgca 1080tttcctgagc tgaagaagga cccagacatg gtgaaggaca tcattaatga agaagaggtg 1140cagtttctca agactctcag cagagggcgt cgcatcctgg acaggaaaat tcagagcctg 1200ggagacagca agaccattcc cggagacact gcttggctcc tctatgacac ctatgggttt 1260ccagtggatc tgactggact gattgctgaa gagaagggcc tggtggtaga catggatggc 1320tttgaagagg agaggaaact ggcccagctg aaatcacagg gcaagggagc tggtggggaa 1380gacctcatta tgctggacat ttacgctatc gaagagctcc gggcacgggg tctggaggtc 1440acagatgatt ccccaaagta caattaccat ttggactcca gtggtagcta tgaaaacaga 1500gtttacagtg aagaatgctc aggtccgagg agggtatgtg ctacacattg gaaccatcta 1560cggtga 156645665PRTHomo sapiens 45Met Asp Ser Thr Leu Thr Ala Ser Glu Ile Arg Gln Arg Phe Ile Asp1 5 10 15Phe Phe Lys Arg Asn Glu His Thr Tyr Val His Ser Ser Ala Thr Ile 20 25 30Pro Leu Asp Asp Pro Thr Leu Leu Phe Ala Asn Ala Gly Met Asn Gln 35 40 45Phe Lys Pro Ile Phe Leu Asn Thr Ile Asp Pro Ser His Pro Met Ala 50 55 60Lys Leu Ser Arg Ala Ala Asn Thr Gln Lys Cys Ile Arg Ala Gly Gly65

70 75 80Lys His Asn Asp Leu Asp Asp Val Gly Lys Asp Val Tyr His His Thr 85 90 95Phe Phe Glu Met Leu Gly Ser Trp Ser Phe Gly Asp Tyr Phe Lys Glu 100 105 110Leu Ala Cys Lys Met Ala Leu Glu Leu Leu Thr Gln Glu Phe Gly Ile 115 120 125Pro Ile Glu Arg Leu Tyr Val Thr Tyr Phe Gly Gly Asp Glu Ala Ala 130 135 140Gly Leu Glu Ala Asp Leu Glu Cys Lys Gln Ile Trp Gln Asn Leu Gly145 150 155 160Leu Asp Asp Thr Lys Ile Leu Pro Gly Asn Met Lys Asp Asn Phe Trp 165 170 175Glu Met Gly Asp Thr Gly Pro Cys Gly Pro Cys Ser Glu Ile His Tyr 180 185 190Asp Arg Ile Gly Gly Arg Asp Ala Ala His Leu Val Asn Gln Asp Asp 195 200 205Pro Asn Val Leu Glu Ile Trp Asn Leu Val Phe Ile Gln Tyr Asn Arg 210 215 220Glu Ala Asp Gly Ile Leu Lys Pro Leu Pro Lys Lys Ser Ile Asp Thr225 230 235 240Gly Met Gly Leu Glu Arg Leu Val Ser Val Leu Gln Asn Lys Met Ser 245 250 255Asn Tyr Asp Thr Asp Leu Phe Val Pro Tyr Phe Glu Ala Ile Gln Lys 260 265 270Gly Thr Gly Ala Arg Pro Tyr Thr Gly Lys Val Gly Ala Glu Asp Ala 275 280 285Asp Gly Ile Asp Met Ala Tyr Arg Val Leu Ala Asp His Ala Arg Thr 290 295 300Ile Thr Val Ala Leu Ala Asp Gly Gly Arg Pro Asp Asn Thr Gly Arg305 310 315 320Gly Tyr Val Leu Arg Arg Ile Leu Arg Arg Ala Val Arg Tyr Ala His 325 330 335Glu Lys Leu Asn Ala Ser Arg Gly Phe Phe Ala Thr Leu Val Asp Val 340 345 350Val Val Gln Ser Leu Gly Asp Ala Phe Pro Glu Leu Lys Lys Asp Pro 355 360 365Asp Met Val Lys Asp Ile Ile Asn Glu Glu Glu Val Gln Phe Leu Lys 370 375 380Thr Leu Ser Arg Gly Arg Arg Ile Leu Asp Arg Lys Ile Gln Ser Leu385 390 395 400Gly Asp Ser Lys Thr Ile Pro Gly Asp Thr Ala Trp Leu Leu Tyr Asp 405 410 415Thr Tyr Gly Phe Pro Val Asp Leu Thr Gly Leu Ile Ala Glu Glu Lys 420 425 430Gly Leu Val Val Asp Met Asp Gly Phe Glu Glu Glu Arg Lys Leu Ala 435 440 445Gln Leu Lys Ser Gln Gly Lys Gly Ala Gly Gly Glu Asp Leu Ile Met 450 455 460Leu Asp Ile Tyr Ala Ile Glu Glu Leu Arg Ala Arg Gly Leu Glu Val465 470 475 480Thr Asp Asp Ser Pro Lys Tyr Asn Tyr His Leu Asp Ser Ser Gly Ser 485 490 495Tyr Val Phe Glu Asn Thr Val Ala Thr Val Met Ala Leu Arg Arg Glu 500 505 510Lys Met Phe Val Glu Glu Val Ser Thr Gly Gln Glu Cys Gly Val Val 515 520 525Leu Asp Lys Thr Cys Phe Tyr Ala Glu Gln Gly Gly Gln Ile Tyr Asp 530 535 540Glu Gly Tyr Leu Val Lys Val Asp Asp Ser Ser Glu Asp Lys Thr Glu545 550 555 560Phe Thr Val Lys Asn Ala Gln Val Arg Gly Gly Tyr Val Leu His Ile 565 570 575Gly Thr Ile Tyr Gly Asp Leu Lys Val Gly Asp Gln Val Trp Leu Phe 580 585 590Ile Asp Glu Ala Pro Ala Glu Leu Glu Ser Cys Arg Ser Phe Cys Asp 595 600 605Arg Asp Gly Arg Ser His Cys Gln Gly Tyr Pro Glu Asp Cys Gly Cys 610 615 620His Arg Cys Arg Gly Pro Glu Gly Pro Gln Glu Ser Arg Glu Leu Glu625 630 635 640Glu Met Ser Leu Cys His Gly Ser Gln Ser Glu Gly Ser Asp Cys Ser 645 650 655Lys Gln Gly Cys Ala Glu Gly Asp Arg 660 665461998DNAHomo sapiens 46atggactcta ctctaacagc aagtgaaatc cggcagcgat ttatagattt cttcaagagg 60aacgagcata cgtatgttca ctcgtctgcc accatcccat tggatgaccc cactttgctc 120tttgccaatg caggcatgaa ccagtttaaa cccattttcc tgaacacaat tgacccatct 180caccccatgg caaagctgag cagagctgcc aatacccaga agtgcatccg ggctgggggc 240aaacataatg acctggacga tgtgggcaag gatgtctatc atcacacctt cttcgagatg 300ctgggctctt ggtcttttgg agattacttt aaggaattgg catgtaagat ggctctggaa 360ctcctcaccc aagagtttgg cattcccatt gaaagacttt atgttactta ctttggcggg 420gatgaagcag ctggcttaga agcagatctg gaatgcaaac agatctggca aaatttgggg 480ctggatgaca ccaaaatcct cccaggcaac atgaaggata acttctggga gatgggtgac 540acgggcccct gtggtccttg cagtgagatc cactacgacc ggattggtgg tcgggacgcc 600gcacatcttg tcaaccagga cgaccctaat gtgctggaga tctggaacct tgtgttcatc 660cagtataaca gggaagctga tggcattctg aaacctcttc ccaagaaaag cattgacaca 720gggatgggcc tggaacgact ggtatctgtg ctgcagaata agatgtccaa ctatgacact 780gacctttttg tcccttactt tgaagccatt cagaagggca caggtgcccg accatacact 840gggaaagttg gtgctgagga tgccgatggg attgacatgg cctaccgggt gctggctgac 900cacgctcgga ccatcactgt ggcactggct gatggtggcc ggcctgacaa cacagggcgt 960ggatatgtgt tgagacggat tctccgccga gctgtccgat acgcccatga aaagctcaat 1020gccagcaggg gcttctttgc tacgttagtg gatgttgtcg tccagtccct gggagatgca 1080tttcctgagc tgaagaagga cccagacatg gtgaaggaca tcattaatga agaagaggtg 1140cagtttctca agactctcag cagagggcgt cgcatcctgg acaggaaaat tcagagcctg 1200ggagacagca agaccattcc cggagacact gcttggctcc tctatgacac ctatgggttt 1260ccagtggatc tgactggact gattgctgaa gagaagggcc tggtggtaga catggatggc 1320tttgaagagg agaggaaact ggcccagctg aaatcacagg gcaagggagc tggtggggaa 1380gacctcatta tgctggacat ttacgctatc gaagagctcc gggcacgggg tctggaggtc 1440acagatgatt ccccaaagta caattaccat ttggactcca gtggtagcta tgtatttgag 1500aacacagtgg ctacggtgat ggctctgcgc agggagaaga tgttcgtgga agaggtgtcc 1560acaggccagg agtgtggagt ggtgctggac aagacctgtt tctatgctga gcaaggaggc 1620cagatctatg acgaaggcta cctggtgaag gtggatgaca gcagtgaaga taaaacagag 1680tttacagtga agaatgctca ggtccgagga gggtatgtgc tacacattgg aaccatctac 1740ggtgacctga aagtggggga tcaggtctgg ctgtttattg atgaggcacc tgcggaactc 1800gagtcatgca ggagcttttg tgatcgtgac ggaagaagcc attgccaagg gtatccggag 1860gattgtggct gtcacaggtg ccgaggccca gaaggccctc aggaaagcag agagcttgaa 1920gaaatgtctc tctgtcatgg aagccaaagt gaaggctcag actgctccaa acaaggatgt 1980gcagagggag atcgctga 199847327PRTHomo sapiens 47Met Asp Ser Thr Leu Thr Ala Ser Glu Ile Arg Gln Arg Phe Ile Asp1 5 10 15Phe Phe Lys Arg Asn Glu His Thr Tyr Val His Ser Ser Ala Thr Ile 20 25 30Pro Leu Asp Asp Pro Thr Leu Leu Phe Ala Asn Ala Gly Met Asn Gln 35 40 45Phe Lys Pro Ile Phe Leu Asn Thr Ile Asp Pro Ser His Pro Met Ala 50 55 60Lys Leu Ser Arg Ala Ala Asn Thr Gln Lys Cys Ile Arg Ala Gly Gly65 70 75 80Lys His Asn Asp Leu Asp Asp Val Gly Lys Asp Val Tyr His His Thr 85 90 95Phe Phe Glu Met Leu Gly Ser Trp Ser Phe Gly Asp Tyr Phe Lys Glu 100 105 110Leu Ala Cys Lys Met Ala Leu Glu Leu Leu Thr Gln Glu Phe Gly Ile 115 120 125Pro Ile Glu Arg Leu Tyr Val Thr Tyr Phe Gly Gly Asp Glu Ala Ala 130 135 140Gly Leu Glu Ala Asp Leu Glu Cys Lys Gln Ile Trp Gln Asn Leu Gly145 150 155 160Leu Asp Asp Thr Lys Ile Leu Pro Gly Asn Met Lys Asp Asn Phe Trp 165 170 175Glu Met Gly Asp Thr Gly Pro Cys Gly Pro Cys Ser Glu Ile His Tyr 180 185 190Asp Arg Ile Gly Gly Arg Asp Ala Ala His Leu Val Asn Gln Asp Asp 195 200 205Pro Asn Val Leu Glu Ile Trp Asn Leu Val Phe Ile Gln Tyr Asn Arg 210 215 220Glu Ala Asp Gly Ile Leu Lys Pro Leu Pro Lys Lys Ser Ile Asp Thr225 230 235 240Gly Met Gly Leu Glu Arg Leu Val Ser Val Leu Gln Asn Lys Met Ser 245 250 255Asn Tyr Asp Thr Asp Leu Phe Val Pro Tyr Phe Glu Ala Ile Gln Lys 260 265 270Gly Thr Gly Ala Arg Pro Tyr Thr Gly Lys Val Gly Ala Glu Asp Ala 275 280 285Asp Gly Ile Asp Met Ala Tyr Arg Val Leu Ala Asp His Ala Arg Thr 290 295 300Ile Thr Val Ala Leu Ala Asp Gly Gly Arg Pro Asp Asn Thr Gly Arg305 310 315 320Gly Glu Met His Phe Leu Ser 32548984DNAHomo sapiens 48atggactcta ctctaacagc aagtgaaatc cggcagcgat ttatagattt cttcaagagg 60aacgagcata cgtatgttca ctcgtctgcc accatcccat tggatgaccc cactttgctc 120tttgccaatg caggcatgaa ccagtttaaa cccattttcc tgaacacaat tgacccatct 180caccccatgg caaagctgag cagagctgcc aatacccaga agtgcatccg ggctgggggc 240aaacataatg acctggacga tgtgggcaag gatgtctatc atcacacctt cttcgagatg 300ctgggctctt ggtcttttgg agattacttt aaggaattgg catgtaagat ggctctggaa 360ctcctcaccc aagagtttgg cattcccatt gaaagacttt atgttactta ctttggcggg 420gatgaagcag ctggcttaga agcagatctg gaatgcaaac agatctggca aaatttgggg 480ctggatgaca ccaaaatcct cccaggcaac atgaaggata acttctggga gatgggtgac 540acgggcccct gtggtccttg cagtgagatc cactacgacc ggattggtgg tcgggacgcc 600gcacatcttg tcaaccagga cgaccctaat gtgctggaga tctggaacct tgtgttcatc 660cagtataaca gggaagctga tggcattctg aaacctcttc ccaagaaaag cattgacaca 720gggatgggcc tggaacgact ggtatctgtg ctgcagaata agatgtccaa ctatgacact 780gacctttttg tcccttactt tgaagccatt cagaagggca caggtgcccg accatacact 840gggaaagttg gtgctgagga tgccgatggg attgacatgg cctaccgggt gctggctgac 900cacgctcgga ccatcactgt ggcactggct gatggtggcc ggcctgacaa cacagggcgt 960ggggagatgc atttcctgag ctga 9844950DNAHomo sapiens 49accttgtgtt catccagtat aacagggcac aggtgcccga ccatacactg 505016PRTHomo sapiens 50Leu Val Phe Ile Gln Tyr Asn Arg Ala Gln Val Pro Asp His Thr Leu1 5 10 155150DNAHomo sapiens 51catttggact ccagtggtag ctatgaaaac agagtttaca gtgaagaatg 505216PRTHomo sapiens 52His Leu Asp Ser Ser Gly Ser Tyr Glu Asn Arg Val Tyr Ser Glu Glu1 5 10 155350DNAHomo sapiens 53tcaggtctgg ctgtttattg atgaggcacc tgcggaactc gagtcatgca 505416PRTHomo sapiens 54Gln Val Trp Leu Phe Ile Asp Glu Ala Pro Ala Glu Leu Glu Ser Cys1 5 10 155550DNAHomo sapiens 55gccggcctga caacacaggg cgtggggaga tgcatttcct gagctgaaga 505614PRTHomo sapiens 56Arg Pro Asp Asn Thr Gly Arg Gly Glu Met His Phe Leu Ser1 5 1057286PRTHomo sapiens 57Met Asp Ser Thr Leu Thr Ala Ser Glu Ile Arg Gln Arg Phe Ile Asp1 5 10 15Phe Phe Lys Arg Asn Glu His Thr Tyr Val His Ser Ser Ala Thr Ile 20 25 30Pro Leu Asp Asp Pro Thr Leu Leu Phe Ala Asn Ala Gly Met Asn Gln 35 40 45Phe Lys Pro Ile Phe Leu Asn Thr Ile Asp Pro Ser His Pro Met Ala 50 55 60Lys Leu Ser Arg Ala Ala Asn Thr Gln Lys Cys Ile Arg Ala Gly Gly65 70 75 80Lys His Asn Asp Leu Asp Asp Val Gly Lys Asp Val Tyr His His Thr 85 90 95Phe Phe Glu Met Leu Gly Ser Trp Ser Phe Gly Asp Tyr Phe Lys Glu 100 105 110Leu Ala Cys Lys Met Ala Leu Glu Leu Leu Thr Gln Glu Phe Gly Ile 115 120 125Pro Ile Glu Arg Leu Tyr Val Thr Tyr Phe Gly Gly Asp Glu Ala Ala 130 135 140Gly Leu Glu Ala Asp Leu Glu Cys Lys Gln Ile Trp Gln Asn Leu Gly145 150 155 160Leu Asp Asp Thr Lys Ile Leu Pro Gly Asn Met Lys Asp Asn Phe Trp 165 170 175Glu Met Gly Asp Thr Gly Pro Cys Gly Pro Cys Ser Glu Ile His Tyr 180 185 190Asp Arg Ile Gly Gly Arg Asp Ala Ala His Leu Val Asn Gln Asp Asp 195 200 205Pro Asn Val Leu Glu Ile Trp Asn Leu Val Phe Ile Gln Tyr Asn Arg 210 215 220Glu Ala Asp Gly Ile Leu Lys Pro Leu Pro Lys Lys Ser Ile Asp Thr225 230 235 240Gly Met Gly Leu Glu Arg Leu Val Ser Val Leu Gln Asn Lys Met Ser 245 250 255Asn Tyr Asp Thr Asp Leu Phe Val Pro Tyr Phe Glu Ala Ile Gln Lys 260 265 270Gly Thr Gly Ala Arg Pro Tyr Thr Gly Lys Val Gly Ala Glu 275 280 28558858DNAHomo sapiens 58atggactcta ctctaacagc aagtgaaatc cggcagcgat ttatagattt cttcaagagg 60aacgagcata cgtatgttca ctcgtctgcc accatcccat tggatgaccc cactttgctc 120tttgccaatg caggcatgaa ccagtttaaa cccattttcc tgaacacaat tgacccatct 180caccccatgg caaagctgag cagagctgcc aatacccaga agtgcatccg ggctgggggc 240aaacataatg acctggacga tgtgggcaag gatgtctatc atcacacctt cttcgagatg 300ctgggctctt ggtcttttgg agattacttt aaggaattgg catgtaagat ggctctggaa 360ctcctcaccc aagagtttgg cattcccatt gaaagacttt atgttactta ctttggcggg 420gatgaagcag ctggcttaga agcagatctg gaatgcaaac agatctggca aaatttgggg 480ctggatgaca ccaaaatcct cccaggcaac atgaaggata acttctggga gatgggtgac 540acgggcccct gtggtccttg cagtgagatc cactacgacc ggattggtgg tcgggacgcc 600gcacatcttg tcaaccagga cgaccctaat gtgctggaga tctggaacct tgtgttcatc 660cagtataaca gggaagctga tggcattctg aaacctcttc ccaagaaaag cattgacaca 720gggatgggcc tggaacgact ggtatctgtg ctgcagaata agatgtccaa ctatgacact 780gacctttttg tcccttactt tgaagccatt cagaagggca caggtgcccg accatacact 840gggaaagttg gtgctgag 85859488PRTHomo sapiens 59Met Asp Ser Thr Leu Thr Ala Ser Glu Ile Arg Gln Arg Phe Ile Asp1 5 10 15Phe Phe Lys Arg Asn Glu His Thr Tyr Val His Ser Ser Ala Thr Ile 20 25 30Pro Leu Asp Asp Pro Thr Leu Leu Phe Ala Asn Ala Gly Met Asn Gln 35 40 45Phe Lys Pro Ile Phe Leu Asn Thr Ile Asp Pro Ser His Pro Met Ala 50 55 60Lys Leu Ser Arg Ala Ala Asn Thr Gln Lys Cys Ile Arg Ala Gly Gly65 70 75 80Lys His Asn Asp Leu Asp Asp Val Gly Lys Asp Val Tyr His His Thr 85 90 95Phe Phe Glu Met Leu Gly Ser Trp Ser Phe Gly Asp Tyr Phe Lys Glu 100 105 110Leu Ala Cys Lys Met Ala Leu Glu Leu Leu Thr Gln Glu Phe Gly Ile 115 120 125Pro Ile Glu Arg Leu Tyr Val Thr Tyr Phe Gly Gly Asp Glu Ala Ala 130 135 140Gly Leu Glu Ala Asp Leu Glu Cys Lys Gln Ile Trp Gln Asn Leu Gly145 150 155 160Leu Asp Asp Thr Lys Ile Leu Pro Gly Asn Met Lys Asp Asn Phe Trp 165 170 175Glu Met Gly Asp Thr Gly Pro Cys Gly Pro Cys Ser Glu Ile His Tyr 180 185 190Asp Arg Ile Gly Gly Arg Asp Ala Ala His Leu Val Asn Gln Asp Asp 195 200 205Pro Asn Val Leu Glu Ile Trp Asn Leu Val Phe Ile Gln Tyr Asn Arg 210 215 220Glu Ala Asp Gly Ile Leu Lys Pro Leu Pro Lys Lys Ser Ile Asp Thr225 230 235 240Gly Met Gly Leu Glu Arg Leu Val Ser Val Leu Gln Asn Lys Met Ser 245 250 255Asn Tyr Asp Thr Asp Leu Phe Val Pro Tyr Phe Glu Ala Ile Gln Lys 260 265 270Gly Thr Gly Ala Arg Pro Tyr Thr Gly Lys Val Gly Ala Glu Asp Ala 275 280 285Asp Gly Ile Asp Met Ala Tyr Arg Val Leu Ala Asp His Ala Arg Thr 290 295 300Ile Thr Val Ala Leu Ala Asp Gly Gly Arg Pro Asp Asn Thr Gly Arg305 310 315 320Gly Tyr Val Leu Arg Arg Ile Leu Arg Arg Ala Val Arg Tyr Ala His 325 330 335Glu Lys Leu Asn Ala Ser Arg Gly Phe Phe Ala Thr Leu Val Asp Val 340 345 350Val Val Gln Ser Leu Gly Asp Ala Phe Pro Glu Leu Lys Lys Asp Pro 355 360 365Asp Met Val Lys Asp Ile Ile Asn Glu Glu Glu Val Gln Phe Leu Lys 370 375 380Thr Leu Ser Arg Gly Arg Arg Ile Leu Asp Arg Lys Ile Gln Ser Leu385 390 395 400Gly Asp Ser Lys Thr Ile Pro Gly Asp Thr Ala Trp Leu Leu Tyr Asp 405 410 415Thr Tyr Gly Phe Pro Val Asp Leu Thr Gly Leu Ile Ala Glu Glu Lys 420 425 430Gly Leu Val Val Asp Met Asp Gly Phe Glu Glu Glu Arg Lys Leu Ala 435 440 445Gln Leu Lys Ser Gln Gly Lys Gly Ala Gly Gly Glu Asp Leu Ile Met 450 455 460Leu Asp Ile Tyr Ala Ile Glu Glu Leu Arg Ala Arg

Gly Leu Glu Val465 470 475 480Thr Asp Asp Ser Pro Lys Tyr Asn 485601464DNAHomo sapiens 60atggactcta ctctaacagc aagtgaaatc cggcagcgat ttatagattt cttcaagagg 60aacgagcata cgtatgttca ctcgtctgcc accatcccat tggatgaccc cactttgctc 120tttgccaatg caggcatgaa ccagtttaaa cccattttcc tgaacacaat tgacccatct 180caccccatgg caaagctgag cagagctgcc aatacccaga agtgcatccg ggctgggggc 240aaacataatg acctggacga tgtgggcaag gatgtctatc atcacacctt cttcgagatg 300ctgggctctt ggtcttttgg agattacttt aaggaattgg catgtaagat ggctctggaa 360ctcctcaccc aagagtttgg cattcccatt gaaagacttt atgttactta ctttggcggg 420gatgaagcag ctggcttaga agcagatctg gaatgcaaac agatctggca aaatttgggg 480ctggatgaca ccaaaatcct cccaggcaac atgaaggata acttctggga gatgggtgac 540acgggcccct gtggtccttg cagtgagatc cactacgacc ggattggtgg tcgggacgcc 600gcacatcttg tcaaccagga cgaccctaat gtgctggaga tctggaacct tgtgttcatc 660cagtataaca gggaagctga tggcattctg aaacctcttc ccaagaaaag cattgacaca 720gggatgggcc tggaacgact ggtatctgtg ctgcagaata agatgtccaa ctatgacact 780gacctttttg tcccttactt tgaagccatt cagaagggca caggtgcccg accatacact 840gggaaagttg gtgctgagga tgccgatggg attgacatgg cctaccgggt gctggctgac 900cacgctcgga ccatcactgt ggcactggct gatggtggcc ggcctgacaa cacagggcgt 960ggatatgtgt tgagacggat tctccgccga gctgtccgat acgcccatga aaagctcaat 1020gccagcaggg gcttctttgc tacgttagtg gatgttgtcg tccagtccct gggagatgca 1080tttcctgagc tgaagaagga cccagacatg gtgaaggaca tcattaatga agaagaggtg 1140cagtttctca agactctcag cagagggcgt cgcatcctgg acaggaaaat tcagagcctg 1200ggagacagca agaccattcc cggagacact gcttggctcc tctatgacac ctatgggttt 1260ccagtggatc tgactggact gattgctgaa gagaagggcc tggtggtaga catggatggc 1320tttgaagagg agaggaaact ggcccagctg aaatcacagg gcaagggagc tggtggggaa 1380gacctcatta tgctggacat ttacgctatc gaagagctcc gggcacgggg tctggaggtc 1440acagatgatt ccccaaagta caat 146461421PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with N-terminal 6xHis affinity tag 61Met His His His His His His Gly Lys Pro Ile Pro Asn Pro Leu Leu1 5 10 15Gly Leu Asp Ser Thr Asp Ser Thr Leu Thr Ala Ser Glu Ile Arg Gln 20 25 30Arg Phe Ile Asp Phe Phe Lys Arg Asn Glu His Thr Tyr Val His Ser 35 40 45Ser Ala Thr Ile Pro Leu Asp Asp Pro Thr Leu Leu Phe Ala Asn Ala 50 55 60Gly Met Asn Gln Phe Lys Pro Ile Phe Leu Asn Thr Ile Asp Pro Ser65 70 75 80His Pro Met Ala Lys Leu Ser Arg Ala Ala Asn Thr Gln Lys Cys Ile 85 90 95Arg Ala Gly Gly Lys His Asn Asp Leu Asp Asp Val Gly Lys Asp Val 100 105 110Tyr His His Thr Phe Phe Glu Met Leu Gly Ser Trp Ser Phe Gly Asp 115 120 125Tyr Phe Lys Glu Leu Ala Cys Lys Met Ala Leu Glu Leu Leu Thr Gln 130 135 140Glu Phe Gly Ile Pro Ile Glu Arg Leu Tyr Val Thr Tyr Phe Gly Gly145 150 155 160Asp Glu Ala Ala Gly Leu Glu Ala Asp Leu Glu Cys Lys Gln Ile Trp 165 170 175Gln Asn Leu Gly Leu Asp Asp Thr Lys Ile Leu Pro Gly Asn Met Lys 180 185 190Asp Asn Phe Trp Glu Met Gly Asp Thr Gly Pro Cys Gly Pro Cys Ser 195 200 205Glu Ile His Tyr Asp Arg Ile Gly Gly Arg Asp Ala Ala His Leu Val 210 215 220Asn Gln Asp Asp Pro Asn Val Leu Glu Ile Trp Asn Leu Val Phe Ile225 230 235 240Gln Tyr Asn Arg Glu Ala Asp Gly Ile Leu Lys Pro Leu Pro Lys Lys 245 250 255Ser Ile Asp Thr Gly Met Gly Leu Glu Arg Leu Val Ser Val Leu Gln 260 265 270Asn Lys Met Ser Asn Tyr Asp Thr Asp Leu Phe Val Pro Tyr Phe Glu 275 280 285Ala Ile Gln Lys Gly Thr Gly Ala Arg Pro Tyr Thr Gly Lys Val Gly 290 295 300Ala Glu Asp Ala Asp Gly Ile Asp Met Ala Tyr Arg Val Leu Ala Asp305 310 315 320His Ala Arg Thr Ile Thr Val Ala Leu Ala Asp Gly Gly Arg Pro Asp 325 330 335Asn Thr Gly Arg Gly Tyr Val Leu Arg Arg Ile Leu Arg Arg Ala Val 340 345 350Arg Tyr Ala His Glu Lys Leu Asn Ala Ser Arg Gly Phe Phe Ala Thr 355 360 365Leu Val Asp Val Val Val Gln Ser Leu Gly Asp Ala Phe Pro Glu Leu 370 375 380Lys Lys Asp Pro Asp Met Val Lys Asp Ile Ile Asn Glu Glu Glu Val385 390 395 400Gln Phe Leu Lys Thr Leu Ser Arg Gly Arg Arg Ile Leu Asp Arg Lys 405 410 415Ile Gln Ser Leu Gly 42062421PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with C-terminal 6xHis affinity tag 62Met Asp Ser Thr Leu Thr Ala Ser Glu Ile Arg Gln Arg Phe Ile Asp1 5 10 15Phe Phe Lys Arg Asn Glu His Thr Tyr Val His Ser Ser Ala Thr Ile 20 25 30Pro Leu Asp Asp Pro Thr Leu Leu Phe Ala Asn Ala Gly Met Asn Gln 35 40 45Phe Lys Pro Ile Phe Leu Asn Thr Ile Asp Pro Ser His Pro Met Ala 50 55 60Lys Leu Ser Arg Ala Ala Asn Thr Gln Lys Cys Ile Arg Ala Gly Gly65 70 75 80Lys His Asn Asp Leu Asp Asp Val Gly Lys Asp Val Tyr His His Thr 85 90 95Phe Phe Glu Met Leu Gly Ser Trp Ser Phe Gly Asp Tyr Phe Lys Glu 100 105 110Leu Ala Cys Lys Met Ala Leu Glu Leu Leu Thr Gln Glu Phe Gly Ile 115 120 125Pro Ile Glu Arg Leu Tyr Val Thr Tyr Phe Gly Gly Asp Glu Ala Ala 130 135 140Gly Leu Glu Ala Asp Leu Glu Cys Lys Gln Ile Trp Gln Asn Leu Gly145 150 155 160Leu Asp Asp Thr Lys Ile Leu Pro Gly Asn Met Lys Asp Asn Phe Trp 165 170 175Glu Met Gly Asp Thr Gly Pro Cys Gly Pro Cys Ser Glu Ile His Tyr 180 185 190Asp Arg Ile Gly Gly Arg Asp Ala Ala His Leu Val Asn Gln Asp Asp 195 200 205Pro Asn Val Leu Glu Ile Trp Asn Leu Val Phe Ile Gln Tyr Asn Arg 210 215 220Glu Ala Asp Gly Ile Leu Lys Pro Leu Pro Lys Lys Ser Ile Asp Thr225 230 235 240Gly Met Gly Leu Glu Arg Leu Val Ser Val Leu Gln Asn Lys Met Ser 245 250 255Asn Tyr Asp Thr Asp Leu Phe Val Pro Tyr Phe Glu Ala Ile Gln Lys 260 265 270Gly Thr Gly Ala Arg Pro Tyr Thr Gly Lys Val Gly Ala Glu Asp Ala 275 280 285Asp Gly Ile Asp Met Ala Tyr Arg Val Leu Ala Asp His Ala Arg Thr 290 295 300Ile Thr Val Ala Leu Ala Asp Gly Gly Arg Pro Asp Asn Thr Gly Arg305 310 315 320Gly Tyr Val Leu Arg Arg Ile Leu Arg Arg Ala Val Arg Tyr Ala His 325 330 335Glu Lys Leu Asn Ala Ser Arg Gly Phe Phe Ala Thr Leu Val Asp Val 340 345 350Val Val Gln Ser Leu Gly Asp Ala Phe Pro Glu Leu Lys Lys Asp Pro 355 360 365Asp Met Val Lys Asp Ile Ile Asn Glu Glu Glu Val Gln Phe Leu Lys 370 375 380Thr Leu Ser Arg Gly Arg Arg Ile Leu Asp Arg Lys Ile Gln Ser Leu385 390 395 400Gly Gly Lys Pro Ile Pro Asn Pro Leu Leu Gly Leu Asp Ser Thr His 405 410 415His His His His His 42063310PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with N-terminal 6xHis affinity tag 63Met His His His His His His Gly Lys Pro Ile Pro Asn Pro Leu Leu1 5 10 15Gly Leu Asp Ser Thr Gly Ser Asp Ser Thr Leu Thr Ala Ser Glu Ile 20 25 30Arg Gln Arg Phe Ile Asp Phe Phe Lys Arg Asn Glu His Thr Tyr Val 35 40 45His Ser Ser Ala Thr Ile Pro Leu Asp Asp Pro Thr Leu Leu Phe Ala 50 55 60Asn Ala Gly Met Asn Gln Phe Lys Pro Ile Phe Leu Asn Thr Ile Asp65 70 75 80Pro Ser His Pro Met Ala Lys Leu Ser Arg Ala Ala Asn Thr Gln Lys 85 90 95Cys Ile Arg Ala Gly Gly Lys His Asn Asp Leu Asp Asp Val Gly Lys 100 105 110Asp Val Tyr His His Thr Phe Phe Glu Met Leu Gly Ser Trp Ser Phe 115 120 125Gly Asp Tyr Phe Lys Glu Leu Ala Cys Lys Met Ala Leu Glu Leu Leu 130 135 140Thr Gln Glu Phe Gly Ile Pro Ile Glu Arg Leu Tyr Val Thr Tyr Phe145 150 155 160Gly Gly Asp Glu Ala Ala Gly Leu Glu Ala Asp Leu Glu Cys Lys Gln 165 170 175Ile Trp Gln Asn Leu Gly Leu Asp Asp Thr Lys Ile Leu Pro Gly Asn 180 185 190Met Lys Asp Asn Phe Trp Glu Met Gly Asp Thr Gly Pro Cys Gly Pro 195 200 205Cys Ser Glu Ile His Tyr Asp Arg Ile Gly Gly Arg Asp Ala Ala His 210 215 220Leu Val Asn Gln Asp Asp Pro Asn Val Leu Glu Ile Trp Asn Leu Val225 230 235 240Phe Ile Gln Tyr Asn Arg Glu Ala Asp Gly Ile Leu Lys Pro Leu Pro 245 250 255Lys Lys Ser Ile Asp Thr Gly Met Gly Leu Glu Arg Leu Val Ser Val 260 265 270Leu Gln Asn Lys Met Ser Asn Tyr Asp Thr Asp Leu Phe Val Pro Tyr 275 280 285Phe Glu Ala Ile Gln Lys Gly Thr Gly Ala Arg Pro Tyr Thr Gly Lys 290 295 300Val Gly Ala Glu Leu Glu305 31064310PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with C-terminal 6xHis affinity tag 64Met Gly Ser Asp Ser Thr Leu Thr Ala Ser Glu Ile Arg Gln Arg Phe1 5 10 15Ile Asp Phe Phe Lys Arg Asn Glu His Thr Tyr Val His Ser Ser Ala 20 25 30Thr Ile Pro Leu Asp Asp Pro Thr Leu Leu Phe Ala Asn Ala Gly Met 35 40 45Asn Gln Phe Lys Pro Ile Phe Leu Asn Thr Ile Asp Pro Ser His Pro 50 55 60Met Ala Lys Leu Ser Arg Ala Ala Asn Thr Gln Lys Cys Ile Arg Ala65 70 75 80Gly Gly Lys His Asn Asp Leu Asp Asp Val Gly Lys Asp Val Tyr His 85 90 95His Thr Phe Phe Glu Met Leu Gly Ser Trp Ser Phe Gly Asp Tyr Phe 100 105 110Lys Glu Leu Ala Cys Lys Met Ala Leu Glu Leu Leu Thr Gln Glu Phe 115 120 125Gly Ile Pro Ile Glu Arg Leu Tyr Val Thr Tyr Phe Gly Gly Asp Glu 130 135 140Ala Ala Gly Leu Glu Ala Asp Leu Glu Cys Lys Gln Ile Trp Gln Asn145 150 155 160Leu Gly Leu Asp Asp Thr Lys Ile Leu Pro Gly Asn Met Lys Asp Asn 165 170 175Phe Trp Glu Met Gly Asp Thr Gly Pro Cys Gly Pro Cys Ser Glu Ile 180 185 190His Tyr Asp Arg Ile Gly Gly Arg Asp Ala Ala His Leu Val Asn Gln 195 200 205Asp Asp Pro Asn Val Leu Glu Ile Trp Asn Leu Val Phe Ile Gln Tyr 210 215 220Asn Arg Glu Ala Asp Gly Ile Leu Lys Pro Leu Pro Lys Lys Ser Ile225 230 235 240Asp Thr Gly Met Gly Leu Glu Arg Leu Val Ser Val Leu Gln Asn Lys 245 250 255Met Ser Asn Tyr Asp Thr Asp Leu Phe Val Pro Tyr Phe Glu Ala Ile 260 265 270Gln Lys Gly Thr Gly Ala Arg Pro Tyr Thr Gly Lys Val Gly Ala Glu 275 280 285Leu Glu Gly Lys Pro Ile Pro Asn Pro Leu Leu Gly Leu Asp Ser Thr 290 295 300His His His His His His305 31065508PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with N-terminal 6xHis affinity tag 65Met His His His His His His Gly Lys Pro Ile Pro Asn Pro Leu Leu1 5 10 15Gly Leu Asp Ser Thr Asp Ser Thr Leu Thr Ala Ser Glu Ile Arg Gln 20 25 30Arg Phe Ile Asp Phe Phe Lys Arg Asn Glu His Thr Tyr Val His Ser 35 40 45Ser Ala Thr Ile Pro Leu Asp Asp Pro Thr Leu Leu Phe Ala Asn Ala 50 55 60Gly Met Asn Gln Phe Lys Pro Ile Phe Leu Asn Thr Ile Asp Pro Ser65 70 75 80His Pro Met Ala Lys Leu Ser Arg Ala Ala Asn Thr Gln Lys Cys Ile 85 90 95Arg Ala Gly Gly Lys His Asn Asp Leu Asp Asp Val Gly Lys Asp Val 100 105 110Tyr His His Thr Phe Phe Glu Met Leu Gly Ser Trp Ser Phe Gly Asp 115 120 125Tyr Phe Lys Glu Leu Ala Cys Lys Met Ala Leu Glu Leu Leu Thr Gln 130 135 140Glu Phe Gly Ile Pro Ile Glu Arg Leu Tyr Val Thr Tyr Phe Gly Gly145 150 155 160Asp Glu Ala Ala Gly Leu Glu Ala Asp Leu Glu Cys Lys Gln Ile Trp 165 170 175Gln Asn Leu Gly Leu Asp Asp Thr Lys Ile Leu Pro Gly Asn Met Lys 180 185 190Asp Asn Phe Trp Glu Met Gly Asp Thr Gly Pro Cys Gly Pro Cys Ser 195 200 205Glu Ile His Tyr Asp Arg Ile Gly Gly Arg Asp Ala Ala His Leu Val 210 215 220Asn Gln Asp Asp Pro Asn Val Leu Glu Ile Trp Asn Leu Val Phe Ile225 230 235 240Gln Tyr Asn Arg Glu Ala Asp Gly Ile Leu Lys Pro Leu Pro Lys Lys 245 250 255Ser Ile Asp Thr Gly Met Gly Leu Glu Arg Leu Val Ser Val Leu Gln 260 265 270Asn Lys Met Ser Asn Tyr Asp Thr Asp Leu Phe Val Pro Tyr Phe Glu 275 280 285Ala Ile Gln Lys Gly Thr Gly Ala Arg Pro Tyr Thr Gly Lys Val Gly 290 295 300Ala Glu Asp Ala Asp Gly Ile Asp Met Ala Tyr Arg Val Leu Ala Asp305 310 315 320His Ala Arg Thr Ile Thr Val Ala Leu Ala Asp Gly Gly Arg Pro Asp 325 330 335Asn Thr Gly Arg Gly Tyr Val Leu Arg Arg Ile Leu Arg Arg Ala Val 340 345 350Arg Tyr Ala His Glu Lys Leu Asn Ala Ser Arg Gly Phe Phe Ala Thr 355 360 365Leu Val Asp Val Val Val Gln Ser Leu Gly Asp Ala Phe Pro Glu Leu 370 375 380Lys Lys Asp Pro Asp Met Val Lys Asp Ile Ile Asn Glu Glu Glu Val385 390 395 400Gln Phe Leu Lys Thr Leu Ser Arg Gly Arg Arg Ile Leu Asp Arg Lys 405 410 415Ile Gln Ser Leu Gly Asp Ser Lys Thr Ile Pro Gly Asp Thr Ala Trp 420 425 430Leu Leu Tyr Asp Thr Tyr Gly Phe Pro Val Asp Leu Thr Gly Leu Ile 435 440 445Ala Glu Glu Lys Gly Leu Val Val Asp Met Asp Gly Phe Glu Glu Glu 450 455 460Arg Lys Leu Ala Gln Leu Lys Ser Gln Gly Lys Gly Ala Gly Gly Glu465 470 475 480Asp Leu Ile Met Leu Asp Ile Tyr Ala Ile Glu Glu Leu Arg Ala Arg 485 490 495Gly Leu Glu Val Thr Asp Asp Ser Pro Lys Tyr Asn 500 50566508PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with C-terminal 6xHis affinity tag 66Met Asp Ser Thr Leu Thr Ala Ser Glu Ile Arg Gln Arg Phe Ile Asp1 5 10 15Phe Phe Lys Arg Asn Glu His Thr Tyr Val His Ser Ser Ala Thr Ile 20 25 30Pro Leu Asp Asp Pro Thr Leu Leu Phe Ala Asn Ala Gly Met Asn Gln 35 40 45Phe Lys Pro Ile Phe Leu Asn Thr Ile Asp Pro Ser His Pro Met Ala 50 55 60Lys Leu Ser Arg Ala Ala Asn Thr Gln Lys Cys Ile Arg Ala Gly Gly65 70 75 80Lys His Asn Asp Leu Asp Asp Val Gly Lys Asp Val Tyr His His Thr 85 90 95Phe Phe Glu Met Leu Gly Ser Trp Ser Phe Gly Asp Tyr Phe Lys Glu 100 105 110Leu Ala Cys Lys Met Ala Leu Glu Leu Leu Thr Gln Glu Phe Gly Ile 115 120 125Pro Ile Glu Arg Leu Tyr Val Thr Tyr Phe Gly Gly Asp Glu Ala Ala 130 135 140Gly Leu Glu Ala Asp Leu Glu Cys Lys Gln Ile Trp Gln Asn Leu Gly145 150

155 160Leu Asp Asp Thr Lys Ile Leu Pro Gly Asn Met Lys Asp Asn Phe Trp 165 170 175Glu Met Gly Asp Thr Gly Pro Cys Gly Pro Cys Ser Glu Ile His Tyr 180 185 190Asp Arg Ile Gly Gly Arg Asp Ala Ala His Leu Val Asn Gln Asp Asp 195 200 205Pro Asn Val Leu Glu Ile Trp Asn Leu Val Phe Ile Gln Tyr Asn Arg 210 215 220Glu Ala Asp Gly Ile Leu Lys Pro Leu Pro Lys Lys Ser Ile Asp Thr225 230 235 240Gly Met Gly Leu Glu Arg Leu Val Ser Val Leu Gln Asn Lys Met Ser 245 250 255Asn Tyr Asp Thr Asp Leu Phe Val Pro Tyr Phe Glu Ala Ile Gln Lys 260 265 270Gly Thr Gly Ala Arg Pro Tyr Thr Gly Lys Val Gly Ala Glu Asp Ala 275 280 285Asp Gly Ile Asp Met Ala Tyr Arg Val Leu Ala Asp His Ala Arg Thr 290 295 300Ile Thr Val Ala Leu Ala Asp Gly Gly Arg Pro Asp Asn Thr Gly Arg305 310 315 320Gly Tyr Val Leu Arg Arg Ile Leu Arg Arg Ala Val Arg Tyr Ala His 325 330 335Glu Lys Leu Asn Ala Ser Arg Gly Phe Phe Ala Thr Leu Val Asp Val 340 345 350Val Val Gln Ser Leu Gly Asp Ala Phe Pro Glu Leu Lys Lys Asp Pro 355 360 365Asp Met Val Lys Asp Ile Ile Asn Glu Glu Glu Val Gln Phe Leu Lys 370 375 380Thr Leu Ser Arg Gly Arg Arg Ile Leu Asp Arg Lys Ile Gln Ser Leu385 390 395 400Gly Asp Ser Lys Thr Ile Pro Gly Asp Thr Ala Trp Leu Leu Tyr Asp 405 410 415Thr Tyr Gly Phe Pro Val Asp Leu Thr Gly Leu Ile Ala Glu Glu Lys 420 425 430Gly Leu Val Val Asp Met Asp Gly Phe Glu Glu Glu Arg Lys Leu Ala 435 440 445Gln Leu Lys Ser Gln Gly Lys Gly Ala Gly Gly Glu Asp Leu Ile Met 450 455 460Leu Asp Ile Tyr Ala Ile Glu Glu Leu Arg Ala Arg Gly Leu Glu Val465 470 475 480Thr Asp Asp Ser Pro Lys Tyr Asn Gly Lys Pro Ile Pro Asn Pro Leu 485 490 495Leu Gly Leu Asp Ser Thr His His His His His His 500 50567299PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with N-terminal 6xHis affinity tag 67Met His His His His His His Gly Lys Pro Ile Pro Asn Pro Leu Leu1 5 10 15Gly Leu Asp Ser Thr Gly Ser Asp Ser Thr Leu Thr Ala Ser Glu Ile 20 25 30Arg Gln Arg Phe Ile Asp Phe Phe Lys Arg Asn Glu His Thr Tyr Val 35 40 45His Ser Ser Ala Thr Ile Pro Leu Asp Asp Pro Thr Leu Leu Phe Ala 50 55 60Asn Ala Gly Met Asn Gln Phe Lys Pro Ile Phe Leu Asn Thr Ile Asp65 70 75 80Pro Ser His Pro Met Ala Lys Leu Ser Arg Ala Ala Asn Thr Gln Lys 85 90 95Cys Ile Arg Ala Gly Gly Lys His Asn Asp Leu Asp Asp Val Gly Lys 100 105 110Asp Val Tyr His His Thr Phe Phe Glu Met Leu Gly Ser Trp Ser Phe 115 120 125Gly Asp Tyr Phe Lys Glu Leu Ala Cys Lys Met Ala Leu Glu Leu Leu 130 135 140Thr Gln Glu Phe Gly Ile Pro Ile Glu Arg Leu Tyr Val Thr Tyr Phe145 150 155 160Gly Gly Asp Glu Ala Ala Gly Leu Glu Ala Asp Leu Glu Cys Lys Gln 165 170 175Ile Trp Gln Asn Leu Gly Leu Asp Asp Thr Lys Ile Leu Pro Gly Asn 180 185 190Met Lys Asp Asn Phe Trp Glu Met Gly Asp Thr Gly Pro Cys Gly Pro 195 200 205Cys Ser Glu Ile His Tyr Asp Arg Ile Gly Gly Arg Asp Ala Ala His 210 215 220Leu Val Asn Gln Asp Asp Pro Asn Val Leu Glu Ile Trp Asn Leu Val225 230 235 240Phe Ile Gln Tyr Asn Arg Ala Gln Val Pro Asp His Thr Leu Gly Lys 245 250 255Leu Val Leu Arg Met Pro Met Gly Leu Thr Trp Pro Thr Gly Cys Trp 260 265 270Leu Thr Thr Leu Gly Pro Ser Leu Trp His Trp Leu Met Val Ala Gly 275 280 285Leu Thr Thr Gln Gly Val Asp Met Cys Leu Glu 290 29568299PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with C-terminal 6xHis affinity tag 68Met Gly Ser Asp Ser Thr Leu Thr Ala Ser Glu Ile Arg Gln Arg Phe1 5 10 15Ile Asp Phe Phe Lys Arg Asn Glu His Thr Tyr Val His Ser Ser Ala 20 25 30Thr Ile Pro Leu Asp Asp Pro Thr Leu Leu Phe Ala Asn Ala Gly Met 35 40 45Asn Gln Phe Lys Pro Ile Phe Leu Asn Thr Ile Asp Pro Ser His Pro 50 55 60Met Ala Lys Leu Ser Arg Ala Ala Asn Thr Gln Lys Cys Ile Arg Ala65 70 75 80Gly Gly Lys His Asn Asp Leu Asp Asp Val Gly Lys Asp Val Tyr His 85 90 95His Thr Phe Phe Glu Met Leu Gly Ser Trp Ser Phe Gly Asp Tyr Phe 100 105 110Lys Glu Leu Ala Cys Lys Met Ala Leu Glu Leu Leu Thr Gln Glu Phe 115 120 125Gly Ile Pro Ile Glu Arg Leu Tyr Val Thr Tyr Phe Gly Gly Asp Glu 130 135 140Ala Ala Gly Leu Glu Ala Asp Leu Glu Cys Lys Gln Ile Trp Gln Asn145 150 155 160Leu Gly Leu Asp Asp Thr Lys Ile Leu Pro Gly Asn Met Lys Asp Asn 165 170 175Phe Trp Glu Met Gly Asp Thr Gly Pro Cys Gly Pro Cys Ser Glu Ile 180 185 190His Tyr Asp Arg Ile Gly Gly Arg Asp Ala Ala His Leu Val Asn Gln 195 200 205Asp Asp Pro Asn Val Leu Glu Ile Trp Asn Leu Val Phe Ile Gln Tyr 210 215 220Asn Arg Ala Gln Val Pro Asp His Thr Leu Gly Lys Leu Val Leu Arg225 230 235 240Met Pro Met Gly Leu Thr Trp Pro Thr Gly Cys Trp Leu Thr Thr Leu 245 250 255Gly Pro Ser Leu Trp His Trp Leu Met Val Ala Gly Leu Thr Thr Gln 260 265 270Gly Val Asp Met Cys Leu Glu Gly Lys Pro Ile Pro Asn Pro Leu Leu 275 280 285Gly Leu Asp Ser Thr His His His His His His 290 29569541PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with N-terminal 6xHis affinity tag 69Met His His His His His His Gly Lys Pro Ile Pro Asn Pro Leu Leu1 5 10 15Gly Leu Asp Ser Thr Asp Ser Thr Leu Thr Ala Ser Glu Ile Arg Gln 20 25 30Arg Phe Ile Asp Phe Phe Lys Arg Asn Glu His Thr Tyr Val His Ser 35 40 45Ser Ala Thr Ile Pro Leu Asp Asp Pro Thr Leu Leu Phe Ala Asn Ala 50 55 60Gly Met Asn Gln Phe Lys Pro Ile Phe Leu Asn Thr Ile Asp Pro Ser65 70 75 80His Pro Met Ala Lys Leu Ser Arg Ala Ala Asn Thr Gln Lys Cys Ile 85 90 95Arg Ala Gly Gly Lys His Asn Asp Leu Asp Asp Val Gly Lys Asp Val 100 105 110Tyr His His Thr Phe Phe Glu Met Leu Gly Ser Trp Ser Phe Gly Asp 115 120 125Tyr Phe Lys Glu Leu Ala Cys Lys Met Ala Leu Glu Leu Leu Thr Gln 130 135 140Glu Phe Gly Ile Pro Ile Glu Arg Leu Tyr Val Thr Tyr Phe Gly Gly145 150 155 160Asp Glu Ala Ala Gly Leu Glu Ala Asp Leu Glu Cys Lys Gln Ile Trp 165 170 175Gln Asn Leu Gly Leu Asp Asp Thr Lys Ile Leu Pro Gly Asn Met Lys 180 185 190Asp Asn Phe Trp Glu Met Gly Asp Thr Gly Pro Cys Gly Pro Cys Ser 195 200 205Glu Ile His Tyr Asp Arg Ile Gly Gly Arg Asp Ala Ala His Leu Val 210 215 220Asn Gln Asp Asp Pro Asn Val Leu Glu Ile Trp Asn Leu Val Phe Ile225 230 235 240Gln Tyr Asn Arg Glu Ala Asp Gly Ile Leu Lys Pro Leu Pro Lys Lys 245 250 255Ser Ile Asp Thr Gly Met Gly Leu Glu Arg Leu Val Ser Val Leu Gln 260 265 270Asn Lys Met Ser Asn Tyr Asp Thr Asp Leu Phe Val Pro Tyr Phe Glu 275 280 285Ala Ile Gln Lys Gly Thr Gly Ala Arg Pro Tyr Thr Gly Lys Val Gly 290 295 300Ala Glu Asp Ala Asp Gly Ile Asp Met Ala Tyr Arg Val Leu Ala Asp305 310 315 320His Ala Arg Thr Ile Thr Val Ala Leu Ala Asp Gly Gly Arg Pro Asp 325 330 335Asn Thr Gly Arg Gly Tyr Val Leu Arg Arg Ile Leu Arg Arg Ala Val 340 345 350Arg Tyr Ala His Glu Lys Leu Asn Ala Ser Arg Gly Phe Phe Ala Thr 355 360 365Leu Val Asp Val Val Val Gln Ser Leu Gly Asp Ala Phe Pro Glu Leu 370 375 380Lys Lys Asp Pro Asp Met Val Lys Asp Ile Ile Asn Glu Glu Glu Val385 390 395 400Gln Phe Leu Lys Thr Leu Ser Arg Gly Arg Arg Ile Leu Asp Arg Lys 405 410 415Ile Gln Ser Leu Gly Asp Ser Lys Thr Ile Pro Gly Asp Thr Ala Trp 420 425 430Leu Leu Tyr Asp Thr Tyr Gly Phe Pro Val Asp Leu Thr Gly Leu Ile 435 440 445Ala Glu Glu Lys Gly Leu Val Val Asp Met Asp Gly Phe Glu Glu Glu 450 455 460Arg Lys Leu Ala Gln Leu Lys Ser Gln Gly Lys Gly Ala Gly Gly Glu465 470 475 480Asp Leu Ile Met Leu Asp Ile Tyr Ala Ile Glu Glu Leu Arg Ala Arg 485 490 495Gly Leu Glu Val Thr Asp Asp Ser Pro Lys Tyr Asn Tyr His Leu Asp 500 505 510Ser Ser Gly Ser Tyr Glu Asn Arg Val Tyr Ser Glu Glu Cys Ser Gly 515 520 525Pro Arg Arg Val Cys Ala Thr His Trp Asn His Leu Arg 530 535 54070541PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with C-terminal 6xHis affinity tag 70Met Asp Ser Thr Leu Thr Ala Ser Glu Ile Arg Gln Arg Phe Ile Asp1 5 10 15Phe Phe Lys Arg Asn Glu His Thr Tyr Val His Ser Ser Ala Thr Ile 20 25 30Pro Leu Asp Asp Pro Thr Leu Leu Phe Ala Asn Ala Gly Met Asn Gln 35 40 45Phe Lys Pro Ile Phe Leu Asn Thr Ile Asp Pro Ser His Pro Met Ala 50 55 60Lys Leu Ser Arg Ala Ala Asn Thr Gln Lys Cys Ile Arg Ala Gly Gly65 70 75 80Lys His Asn Asp Leu Asp Asp Val Gly Lys Asp Val Tyr His His Thr 85 90 95Phe Phe Glu Met Leu Gly Ser Trp Ser Phe Gly Asp Tyr Phe Lys Glu 100 105 110Leu Ala Cys Lys Met Ala Leu Glu Leu Leu Thr Gln Glu Phe Gly Ile 115 120 125Pro Ile Glu Arg Leu Tyr Val Thr Tyr Phe Gly Gly Asp Glu Ala Ala 130 135 140Gly Leu Glu Ala Asp Leu Glu Cys Lys Gln Ile Trp Gln Asn Leu Gly145 150 155 160Leu Asp Asp Thr Lys Ile Leu Pro Gly Asn Met Lys Asp Asn Phe Trp 165 170 175Glu Met Gly Asp Thr Gly Pro Cys Gly Pro Cys Ser Glu Ile His Tyr 180 185 190Asp Arg Ile Gly Gly Arg Asp Ala Ala His Leu Val Asn Gln Asp Asp 195 200 205Pro Asn Val Leu Glu Ile Trp Asn Leu Val Phe Ile Gln Tyr Asn Arg 210 215 220Glu Ala Asp Gly Ile Leu Lys Pro Leu Pro Lys Lys Ser Ile Asp Thr225 230 235 240Gly Met Gly Leu Glu Arg Leu Val Ser Val Leu Gln Asn Lys Met Ser 245 250 255Asn Tyr Asp Thr Asp Leu Phe Val Pro Tyr Phe Glu Ala Ile Gln Lys 260 265 270Gly Thr Gly Ala Arg Pro Tyr Thr Gly Lys Val Gly Ala Glu Asp Ala 275 280 285Asp Gly Ile Asp Met Ala Tyr Arg Val Leu Ala Asp His Ala Arg Thr 290 295 300Ile Thr Val Ala Leu Ala Asp Gly Gly Arg Pro Asp Asn Thr Gly Arg305 310 315 320Gly Tyr Val Leu Arg Arg Ile Leu Arg Arg Ala Val Arg Tyr Ala His 325 330 335Glu Lys Leu Asn Ala Ser Arg Gly Phe Phe Ala Thr Leu Val Asp Val 340 345 350Val Val Gln Ser Leu Gly Asp Ala Phe Pro Glu Leu Lys Lys Asp Pro 355 360 365Asp Met Val Lys Asp Ile Ile Asn Glu Glu Glu Val Gln Phe Leu Lys 370 375 380Thr Leu Ser Arg Gly Arg Arg Ile Leu Asp Arg Lys Ile Gln Ser Leu385 390 395 400Gly Asp Ser Lys Thr Ile Pro Gly Asp Thr Ala Trp Leu Leu Tyr Asp 405 410 415Thr Tyr Gly Phe Pro Val Asp Leu Thr Gly Leu Ile Ala Glu Glu Lys 420 425 430Gly Leu Val Val Asp Met Asp Gly Phe Glu Glu Glu Arg Lys Leu Ala 435 440 445Gln Leu Lys Ser Gln Gly Lys Gly Ala Gly Gly Glu Asp Leu Ile Met 450 455 460Leu Asp Ile Tyr Ala Ile Glu Glu Leu Arg Ala Arg Gly Leu Glu Val465 470 475 480Thr Asp Asp Ser Pro Lys Tyr Asn Tyr His Leu Asp Ser Ser Gly Ser 485 490 495Tyr Glu Asn Arg Val Tyr Ser Glu Glu Cys Ser Gly Pro Arg Arg Val 500 505 510Cys Ala Thr His Trp Asn His Leu Arg Gly Lys Pro Ile Pro Asn Pro 515 520 525Leu Leu Gly Leu Asp Ser Thr His His His His His His 530 535 54071351PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with N-terminal 6xHis affinity tag 71Met His His His His His His Gly Lys Pro Ile Pro Asn Pro Leu Leu1 5 10 15Gly Leu Asp Ser Thr Gly Ser Asp Ser Thr Leu Thr Ala Ser Glu Ile 20 25 30Arg Gln Arg Phe Ile Asp Phe Phe Lys Arg Asn Glu His Thr Tyr Val 35 40 45His Ser Ser Ala Thr Ile Pro Leu Asp Asp Pro Thr Leu Leu Phe Ala 50 55 60Asn Ala Gly Met Asn Gln Phe Lys Pro Ile Phe Leu Asn Thr Ile Asp65 70 75 80Pro Ser His Pro Met Ala Lys Leu Ser Arg Ala Ala Asn Thr Gln Lys 85 90 95Cys Ile Arg Ala Gly Gly Lys His Asn Asp Leu Asp Asp Val Gly Lys 100 105 110Asp Val Tyr His His Thr Phe Phe Glu Met Leu Gly Ser Trp Ser Phe 115 120 125Gly Asp Tyr Phe Lys Glu Leu Ala Cys Lys Met Ala Leu Glu Leu Leu 130 135 140Thr Gln Glu Phe Gly Ile Pro Ile Glu Arg Leu Tyr Val Thr Tyr Phe145 150 155 160Gly Gly Asp Glu Ala Ala Gly Leu Glu Ala Asp Leu Glu Cys Lys Gln 165 170 175Ile Trp Gln Asn Leu Gly Leu Asp Asp Thr Lys Ile Leu Pro Gly Asn 180 185 190Met Lys Asp Asn Phe Trp Glu Met Gly Asp Thr Gly Pro Cys Gly Pro 195 200 205Cys Ser Glu Ile His Tyr Asp Arg Ile Gly Gly Arg Asp Ala Ala His 210 215 220Leu Val Asn Gln Asp Asp Pro Asn Val Leu Glu Ile Trp Asn Leu Val225 230 235 240Phe Ile Gln Tyr Asn Arg Glu Ala Asp Gly Ile Leu Lys Pro Leu Pro 245 250 255Lys Lys Ser Ile Asp Thr Gly Met Gly Leu Glu Arg Leu Val Ser Val 260 265 270Leu Gln Asn Lys Met Ser Asn Tyr Asp Thr Asp Leu Phe Val Pro Tyr 275 280 285Phe Glu Ala Ile Gln Lys Gly Thr Gly Ala Arg Pro Tyr Thr Gly Lys 290 295 300Val Gly Ala Glu Asp Ala Asp Gly Ile Asp Met Ala Tyr Arg Val Leu305 310 315 320Ala Asp His Ala Arg Thr Ile Thr Val Ala Leu Ala Asp Gly Gly Arg 325 330 335Pro Asp Asn Thr Gly Arg Gly Glu Met His Phe Leu Ser Leu Glu 340 345 35072351PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with C-terminal 6xHis affinity tag 72Met Gly Ser Asp Ser Thr Leu Thr Ala Ser

Glu Ile Arg Gln Arg Phe1 5 10 15Ile Asp Phe Phe Lys Arg Asn Glu His Thr Tyr Val His Ser Ser Ala 20 25 30Thr Ile Pro Leu Asp Asp Pro Thr Leu Leu Phe Ala Asn Ala Gly Met 35 40 45Asn Gln Phe Lys Pro Ile Phe Leu Asn Thr Ile Asp Pro Ser His Pro 50 55 60Met Ala Lys Leu Ser Arg Ala Ala Asn Thr Gln Lys Cys Ile Arg Ala65 70 75 80Gly Gly Lys His Asn Asp Leu Asp Asp Val Gly Lys Asp Val Tyr His 85 90 95His Thr Phe Phe Glu Met Leu Gly Ser Trp Ser Phe Gly Asp Tyr Phe 100 105 110Lys Glu Leu Ala Cys Lys Met Ala Leu Glu Leu Leu Thr Gln Glu Phe 115 120 125Gly Ile Pro Ile Glu Arg Leu Tyr Val Thr Tyr Phe Gly Gly Asp Glu 130 135 140Ala Ala Gly Leu Glu Ala Asp Leu Glu Cys Lys Gln Ile Trp Gln Asn145 150 155 160Leu Gly Leu Asp Asp Thr Lys Ile Leu Pro Gly Asn Met Lys Asp Asn 165 170 175Phe Trp Glu Met Gly Asp Thr Gly Pro Cys Gly Pro Cys Ser Glu Ile 180 185 190His Tyr Asp Arg Ile Gly Gly Arg Asp Ala Ala His Leu Val Asn Gln 195 200 205Asp Asp Pro Asn Val Leu Glu Ile Trp Asn Leu Val Phe Ile Gln Tyr 210 215 220Asn Arg Glu Ala Asp Gly Ile Leu Lys Pro Leu Pro Lys Lys Ser Ile225 230 235 240Asp Thr Gly Met Gly Leu Glu Arg Leu Val Ser Val Leu Gln Asn Lys 245 250 255Met Ser Asn Tyr Asp Thr Asp Leu Phe Val Pro Tyr Phe Glu Ala Ile 260 265 270Gln Lys Gly Thr Gly Ala Arg Pro Tyr Thr Gly Lys Val Gly Ala Glu 275 280 285Asp Ala Asp Gly Ile Asp Met Ala Tyr Arg Val Leu Ala Asp His Ala 290 295 300Arg Thr Ile Thr Val Ala Leu Ala Asp Gly Gly Arg Pro Asp Asn Thr305 310 315 320Gly Arg Gly Glu Met His Phe Leu Ser Leu Glu Gly Lys Pro Ile Pro 325 330 335Asn Pro Leu Leu Gly Leu Asp Ser Thr His His His His His His 340 345 350731212DNAArtificial SequenceCodon optimized Alanyl tRNA Synthetase polynucleotid 73gacagcacgc tgaccgcatc cgaaatccgc caacgcttca ttgacttttt caaacgtaac 60gagcatactt acgtccatag cagcgcaacc attccgctgg atgacccaac cctgctgttt 120gccaacgctg gcatgaatca attcaagccg attttcctga atactatcga cccgagccac 180ccgatggcga aactgtctcg tgcggcgaat acgcaaaagt gcatccgtgc gggtggtaag 240cacaatgact tggatgatgt tggtaaggac gtttaccacc ataccttttt cgaaatgctg 300ggttcctgga gctttggtga ctactttaaa gagctggcgt gtaaaatggc tttggagttg 360ctgacgcagg agttcggcat tccgattgag cgtctgtacg tgacctactt cggtggcgat 420gaggcggcag gtctggaggc agacctggag tgcaaacaga tttggcagaa tctgggcctg 480gacgacacca aaatcttgcc gggtaacatg aaagataact tctgggaaat gggcgatacc 540ggtccgtgcg gtccgtgtag cgagattcac tatgatcgta ttggtggtcg cgatgccgcc 600cacctggtta accaagatga tcctaacgtc ctggagattt ggaatctggt gtttatccaa 660tacaaccgcg aggcggatgg cattctgaag ccgctgccaa agaaaagcat cgatacgggt 720atgggcctgg aacgcctggt gagcgtgctg cagaataaga tgagcaatta tgacacggat 780ctgtttgtcc cgtatttcga agcaatccag aagggtaccg gtgcgcgtcc gtacaccggt 840aaagtgggcg ctgaggacgc ggacggtatt gacatggcct accgtgtgtt ggctgatcac 900gcgcgcacca tcacggtcgc cctggcagat ggtggccgtc cggacaacac cggtcgtggt 960tatgtactgc gtcgtatcct gcgtcgcgcg gtccgttatg cacatgaaaa gctgaacgcg 1020tcgcgtggct tcttcgccac gctggtcgat gttgttgtgc agagcctggg cgatgcgttt 1080ccggagctga agaaagaccc ggacatggtt aaggacatca tcaacgaaga agaagttcag 1140tttctgaaaa ccttgagccg tggccgtcgc attctggacc gcaaaatcca atctttgggc 1200taatgactcg ag 121274867DNAArtificial SequenceCodon optimized Alanyl tRNA Synthetase polynucleotid 74ggatccgact caaccctgac agcaagcgaa attcgtcagc gctttatcga cttcttcaaa 60cgtaacgagc acacctatgt ccatagcagt gccacaattc cgctggatga ccctaccctg 120ctgtttgcta atgccggcat gaatcagttc aaaccgattt ttctgaatac catcgacccg 180tcacatccaa tggcgaaact gtctcgtgcc gctaatactc aaaaatgtat ccgtgccggt 240ggtaaacaca atgacctgga tgatgtgggc aaagacgtgt atcaccacac gttcttcgag 300atgctgggtt cttggtcttt tggggactat ttcaaagaac tggcctgtaa aatggccctg 360gaactgctga cacaggagtt tggaattccg attgaacgcc tgtatgtcac ctattttggc 420ggggatgaag ctgccggtct ggaagcagac ctggagtgta aacaaatctg gcagaacctg 480ggactggatg atacgaaaat cctgccgggc aacatgaaag acaacttttg ggaaatgggc 540gatactggcc catgtggacc ttgttccgaa atccattatg accgtatcgg tggtcgtgat 600gccgctcatc tggttaatca ggatgacccg aatgttctgg aaatctggaa cctggtgttc 660attcagtata accgtgaggc tgatggcatc ctgaaacctc tgccgaaaaa atccatcgat 720accggtatgg ggctggaacg cctggtttct gtactgcaaa acaaaatgtc gaactatgac 780accgacctgt ttgtcccgta tttcgaagcc attcaaaaag gcaccggtgc ccgtccttat 840acagggaaag ttggcgccga actcgag 867751473DNAArtificial SequenceCodon optimized Alanyl tRNA Synthetase polynucleotid 75gacagcaccc tgaccgcatc cgaaatccgc cagcgcttca ttgacttttt caagcgcaac 60gagcatacct atgtgcatag cagcgcaacc atcccgctgg atgatcctac gttgctgttt 120gcgaatgcgg gcatgaatca gttcaaaccg atctttttga acacgattga cccaagccat 180ccgatggcta aactgagccg tgccgctaat acccagaagt gcattcgtgc gggtggtaag 240cacaacgact tggacgacgt gggtaaggat gtgtatcacc acacgttctt tgagatgctg 300ggcagctggt ccttcggcga ttactttaaa gaactggcgt gcaagatggc actggaactg 360ttgacccaag aatttggcat cccgattgag cgtctgtacg ttacctactt tggcggcgat 420gaggctgcag gcctggaggc ggacctggag tgcaaacaga tctggcaaaa tctgggcctg 480gatgacacca agatcctgcc gggtaatatg aaagataact tctgggagat gggcgacacg 540ggtccgtgtg gcccgtgttc ggagatccac tacgaccgca ttggtggtcg tgacgcagcg 600catctggtga atcaagatga cccgaatgtg ctggagatct ggaatttggt tttcatccaa 660tacaaccgtg aggcggatgg tattctgaaa ccgttgccga aaaagtctat cgacaccggc 720atgggtctgg agcgtctggt tagcgtgctg cagaacaaaa tgagcaacta cgatactgat 780ctgtttgtgc cgtatttcga ggcgatccaa aagggtaccg gtgcccgtcc gtacacgggt 840aaggttggtg cggaggatgc tgacggtatc gacatggcct accgtgtctt ggccgatcac 900gcccgcacca ttaccgtcgc gttggctgat ggtggtcgcc cggacaacac cggtcgcggt 960tatgttctgc gtcgtatcct gcgtcgtgca gtccgctatg cgcacgagaa actgaatgcg 1020agccgtggct tctttgccac cctggtcgac gttgttgttc agtccctggg cgatgcgttc 1080ccggaactga agaaagatcc ggatatggta aaggacatta tcaacgaaga agaggtccag 1140ttcctgaaaa ctctgtctcg tggccgtcgt attctggacc gcaagatcca aagcctgggt 1200gacagcaaaa cgattccagg tgatacggcg tggctgctgt acgacacgta tggtttccct 1260gtcgacctga cgggtctgat tgcggaagaa aagggcctgg tcgttgacat ggacggtttt 1320gaagaagagc gcaagctggc ccaattgaaa agccagggta aaggtgcagg tggcgaagat 1380ctgattatgc tggacattta tgcaattgaa gagctgcgtg cgcgtggcct ggaggtgacc 1440gatgatagcc cgaaatacaa ctaatgactc gag 147376834DNAArtificial SequenceCodon optimized Alanyl tRNA Synthetase polynucleotid 76ggatccgata gtactctgac ggcaagtgaa atccgtcaac gctttatcga cttctttaaa 60cgtaatgagc acacgtatgt ccactctagt gccaccatcc ctctggatga tccaaccctg 120ctgttcgcta acgctggtat gaaccagttt aaaccaatct tcctgaacac gattgatccg 180agccatccta tggcgaaact gtctcgtgcc gctaatactc aaaaatgtat ccgtgctggc 240ggaaaacaca atgatctgga tgacgtgggc aaagatgttt atcatcacac ctttttcgaa 300atgctgggca gctggtcttt cggcgattat ttcaaagaac tggcctgtaa gatggccctg 360gagctgctga cacaagagtt cggtatccct atcgaacgtc tgtatgtcac gtattttggg 420ggtgacgaag cagctggcct ggaggctgat ctggagtgta aacaaatctg gcagaatctg 480ggtctggacg atacaaaaat cctgcctggc aatatgaaag acaatttctg ggagatgggc 540gacacaggtc catgtggtcc atgctctgag attcactatg accgtatcgg aggacgtgac 600gctgctcacc tggtaaacca agacgaccct aacgtcctgg aaatctggaa tctggtcttt 660attcagtata accgtgccca agtgccggac catactctgg gcaaactggt actgcgtatg 720ccaatgggcc tgacttggcc tacaggttgt tggctgacaa ctctgggacc ttctctgtgg 780cattggctga tggttgctgg tctgactacc cagggtgttg atatgtgtct cgag 834771572DNAArtificial SequenceCodon optimized Alanyl tRNA Synthetase polynucleotid 77gacagcacgc tgaccgcatc cgaaatccgc caacgcttca ttgacttctt caaacgtaat 60gagcacacgt acgttcatag cagcgcgacc atccctttgg acgatccgac cctgctgttc 120gctaacgccg gtatgaatca gtttaagccg atttttctga atacgatcga cccaagccac 180ccgatggcga aactgtcccg tgccgcaaac acccagaaat gtattcgtgc cggtggtaaa 240cataacgatc tggatgacgt gggtaaagac gtttaccacc acaccttctt cgagatgctg 300ggtagctggt cttttggcga ctatttcaaa gagctggcgt gcaagatggc cctggagctg 360ctgacgcagg agtttggtat tccgattgag cgtctgtatg tcacctattt cggtggtgat 420gaagcagcgg gcttggaggc ggatctggaa tgcaagcaaa tctggcagaa tttgggcctg 480gatgacacca agattctgcc gggcaatatg aaagataact tttgggaaat gggtgacact 540ggcccgtgtg gcccgtgctc tgagattcac tatgatcgca tcggtggccg cgacgcggct 600catctggtta accaagatga cccaaacgtg ttggagattt ggaatctggt gttcattcag 660tacaaccgcg aggcggatgg catcctgaag ccgctgccga aaaagagcat cgacacgggt 720atgggtctgg agcgcctggt gagcgtcctg caaaacaaga tgagcaatta cgatacggat 780ctgttcgtcc cgtacttcga ggcgattcaa aagggtaccg gtgcacgccc gtacacgggt 840aaagttggtg ccgaggatgc agacggcatt gacatggctt accgtgttct ggctgatcat 900gcgcgtacca ttaccgtggc gctggcagac ggtggtcgcc cggacaacac cggtcgtggt 960tatgttctgc gtcgcatcct gcgtcgtgcc gtccgttatg cgcacgaaaa actgaacgca 1020tcgcgtggct ttttcgcgac tctggttgac gtggtggttc agtctttggg tgacgcattt 1080ccggagttga agaaagatcc ggacatggtc aaagacatta tcaatgaaga agaagtccag 1140tttctgaaaa cgctgagccg tggccgtcgc atcttggatc gcaagatcca aagcctgggc 1200gatagcaaga cgattccggg cgataccgcg tggctgctgt atgataccta cggttttccg 1260gtggacctga ccggcctgat cgcggaagag aagggcctgg tcgttgatat ggatggcttt 1320gaagaagaac gtaagctggc gcagctgaaa agccaaggta aaggtgctgg tggcgaagat 1380ctgatcatgc tggacatcta cgcaatcgaa gagctgcgtg cgcgtggttt ggaggtcacc 1440gacgacagcc cgaagtacaa ctaccacctg gacagcagcg gcagctacga gaatcgtgtt 1500tatagcgaag agtgctccgg tcctcgtcgc gtgtgtgcca ctcactggaa tcatttgcgt 1560taatgactcg ag 157278990DNAArtificial SequenceCodon optimized Alanyl tRNA Synthetase polynucleotid 78ggatccgact ctacactgac cgcctctgaa attcgccagc gctttatcga cttcttcaaa 60cgtaacgagc acacctatgt tcattctagt gccacgattc ctctggatga tccgacactg 120ctgttcgcta atgccggtat gaatcagttt aaaccgatct tcctgaatac catcgatcca 180agccacccta tggcaaaact gtctcgtgct gccaatactc aaaaatgtat ccgtgccggg 240ggtaaacaca atgatctgga cgacgtgggc aaagatgtgt atcaccacac gttcttcgaa 300atgctgggtt catggagctt tggggactat ttcaaagagc tggcctgtaa aatggctctg 360gaactgctga cacaggagtt tggaattccg attgaacgtc tgtatgtgac gtattttggc 420ggggatgaag cagccggtct ggaggctgac ctggagtgta aacaaatctg gcagaacctg 480ggactggatg acacgaaaat cctgcctggc aacatgaaag acaacttttg ggagatgggt 540gacactggtc cttgtggacc ttgctccgaa atccactatg accgtatcgg tggtcgtgat 600gctgctcacc tggttaatca ggatgaccct aacgttctgg aaatttggaa cctggttttt 660atccagtata accgtgaggc agatgggatt ctgaaaccgc tgcctaaaaa aagcatcgac 720acgggtatgg gactggaacg cctggtttct gtactgcaga acaaaatgag caactatgat 780accgacctgt ttgtgcctta tttcgaggcc attcagaaag gcactggagc acgtccttat 840acagggaaag tgggcgctga agatgctgat ggcattgata tggcgtatcg tgtactggct 900gatcatgccc gtaccattac cgtagccctg gctgacggtg gacgtccgga taatacgggg 960cgtggggaaa tgcattttct gagcctcgag 99079493PRTHomo sapiens 79Arg Gly Leu Glu Val Thr Asp Asp Ser Pro Lys Tyr Asn Tyr His Leu1 5 10 15Asp Ser Ser Gly Ser Tyr Val Phe Glu Asn Thr Val Ala Thr Val Met 20 25 30Ala Leu Arg Arg Glu Lys Met Phe Val Glu Glu Val Ser Thr Gly Gln 35 40 45Glu Cys Gly Val Val Leu Asp Lys Thr Cys Phe Tyr Ala Glu Gln Gly 50 55 60Gly Gln Ile Tyr Asp Glu Gly Tyr Leu Val Lys Val Asp Asp Ser Ser65 70 75 80Glu Asp Lys Thr Glu Phe Thr Val Lys Asn Ala Gln Val Arg Gly Gly 85 90 95Tyr Val Leu His Ile Gly Thr Ile Tyr Gly Asp Leu Lys Val Gly Asp 100 105 110Gln Val Trp Leu Phe Ile Asp Glu Pro Arg Arg Arg Pro Ile Met Ser 115 120 125Asn His Thr Ala Thr His Ile Leu Asn Phe Ala Leu Arg Ser Val Leu 130 135 140Gly Glu Ala Asp Gln Lys Gly Ser Leu Val Ala Pro Asp Arg Leu Arg145 150 155 160Phe Asp Phe Thr Ala Lys Gly Ala Met Ser Thr Gln Gln Ile Lys Lys 165 170 175Ala Glu Glu Ile Ala Asn Glu Met Ile Glu Ala Ala Lys Ala Val Tyr 180 185 190Thr Gln Asp Cys Pro Leu Ala Ala Ala Lys Ala Ile Gln Gly Leu Arg 195 200 205Ala Val Phe Asp Glu Thr Tyr Pro Asp Pro Val Arg Val Val Ser Ile 210 215 220Gly Val Pro Val Ser Glu Leu Leu Asp Asp Pro Ser Gly Pro Ala Gly225 230 235 240Ser Leu Thr Ser Val Glu Phe Cys Gly Gly Thr His Leu Arg Asn Ser 245 250 255Ser His Ala Gly Ala Phe Val Ile Val Thr Glu Glu Ala Ile Ala Lys 260 265 270Gly Ile Arg Arg Ile Val Ala Val Thr Gly Ala Glu Ala Gln Lys Ala 275 280 285Leu Arg Lys Ala Glu Ser Leu Lys Lys Cys Leu Ser Val Met Glu Ala 290 295 300Lys Val Lys Ala Gln Thr Ala Pro Asn Lys Asp Val Gln Arg Glu Ile305 310 315 320Ala Asp Leu Gly Glu Ala Leu Ala Thr Ala Val Ile Pro Gln Trp Gln 325 330 335Lys Asp Glu Leu Arg Glu Thr Leu Lys Ser Leu Lys Lys Val Met Asp 340 345 350Asp Leu Asp Arg Ala Ser Lys Ala Asp Val Gln Lys Arg Val Leu Glu 355 360 365Lys Thr Lys Gln Phe Ile Asp Ser Asn Pro Asn Gln Pro Leu Val Ile 370 375 380Leu Glu Met Glu Ser Gly Ala Ser Ala Lys Ala Leu Asn Glu Ala Leu385 390 395 400Lys Leu Phe Lys Met His Ser Pro Gln Thr Ser Ala Met Leu Phe Thr 405 410 415Val Asp Asn Glu Ala Gly Lys Ile Thr Cys Leu Cys Gln Val Pro Gln 420 425 430Asn Ala Ala Asn Arg Gly Leu Lys Ala Ser Glu Trp Val Gln Gln Val 435 440 445Ser Gly Leu Met Asp Gly Lys Gly Gly Gly Lys Asp Val Ser Ala Gln 450 455 460Ala Thr Gly Lys Asn Val Gly Cys Leu Gln Glu Ala Leu Gln Leu Ala465 470 475 480Thr Ser Phe Ala Gln Leu Arg Leu Gly Asp Val Lys Asn 485 490801482DNAHomo sapiens 80cggggtctgg aggtcacaga tgattcccca aagtacaatt accatttgga ctccagtggt 60agctatgtat ttgagaacac agtggctacg gtgatggctc tgcgcaggga gaagatgttc 120gtggaagagg tgtccacagg ccaggagtgt ggagtggtgc tggacaagac ctgtttctat 180gctgagcaag gaggccagat ctatgacgaa ggctacctgg tgaaggtgga tgacagcagt 240gaagataaaa cagagtttac agtgaagaat gctcaggtcc gaggagggta tgtgctacac 300attggaacca tctacggtga cctgaaagtg ggggatcagg tctggctgtt tattgatgag 360ccccgacgaa gacccatcat gagcaaccac acagctacgc acattctgaa cttcgccctg 420cgctcagtgc ttggggaagc tgaccagaaa ggctcattgg ttgctcctga ccgcctcaga 480tttgacttta ctgccaaggg agccatgtcc acccaacaga tcaagaaggc tgaagagatt 540gctaatgaga tgattgaggc agccaaggcc gtctataccc aggattgccc cctggcagca 600gcgaaagcca tccagggcct acgggctgtg tttgatgaga cctatcctga ccctgtgcga 660gtcgtctcca ttggggtccc ggtgtccgag ttgctggatg acccctctgg gcctgctggc 720tccctgactt ctgttgagtt ctgtggggga acgcacctgc ggaactcgag tcatgcagga 780gcttttgtga tcgtgacgga agaagccatt gccaagggta tccggaggat tgtggctgtc 840acaggtgccg aggcccagaa ggccctcagg aaagcagaga gcttgaagaa atgtctctct 900gtcatggaag ccaaagtgaa ggctcagact gctccaaaca aggatgtgca gagggagatc 960gctgaccttg gagaggccct ggccactgca gtcatccccc agtggcagaa ggatgaattg 1020cgggagactc tcaaatccct aaagaaggtc atggatgact tggaccgagc cagcaaagcc 1080gatgtccaga aacgagtgtt agagaagacg aagcagttca tcgacagcaa ccccaaccag 1140cctcttgtca tcctggagat ggagagcggc gcctcagcca aggccctgaa tgaagccttg 1200aagctcttca agatgcactc ccctcagact tctgccatgc tcttcacggt ggacaatgag 1260gctggcaaga tcacgtgcct gtgtcaagtt ccccagaatg cagccaatcg gggcttaaaa 1320gccagcgagt gggtgcagca ggtgtcaggc ttgatggacg gtaaaggtgg tggcaaggat 1380gtgtctgcac aggccacagg caagaacgtt ggctgcctgc aggaggcgct gcagctggcc 1440acttccttcg cccagctgcg cctcggggat gtaaagaact ga 148281211PRTHomo sapiens 81Ala Glu Ala Gln Lys Ala Leu Arg Lys Ala Glu Ser Leu Lys Lys Cys1 5 10 15Leu Ser Val Met Glu Ala Lys Val Lys Ala Gln Thr Ala Pro Asn Lys 20 25 30Asp Val Gln Arg Glu Ile Ala Asp Leu Gly Glu Ala Leu Ala Thr Ala 35 40 45Val Ile Pro Gln Trp Gln Lys Asp Glu Leu Arg Glu Thr Leu Lys Ser 50 55 60Leu Lys Lys Val Met Asp Asp Leu Asp Arg Ala Ser Lys Ala Asp Val65 70 75 80Gln Lys Arg Val Leu Glu Lys Thr Lys Gln Phe Ile Asp Ser Asn Pro 85 90 95Asn Gln Pro Leu Val Ile Leu Glu Met Glu Ser Gly Ala Ser Ala Lys 100 105 110Ala Leu Asn Glu Ala Leu Lys Leu Phe Lys Met His Ser Pro Gln Thr 115 120 125Ser Ala

Met Leu Phe Thr Val Asp Asn Glu Ala Gly Lys Ile Thr Cys 130 135 140Leu Cys Gln Val Pro Gln Asn Ala Ala Asn Arg Gly Leu Lys Ala Ser145 150 155 160Glu Trp Val Gln Gln Val Ser Gly Leu Met Asp Gly Lys Gly Gly Gly 165 170 175Lys Asp Val Ser Ala Gln Ala Thr Gly Lys Asn Val Gly Cys Leu Gln 180 185 190Glu Ala Leu Gln Leu Ala Thr Ser Phe Ala Gln Leu Arg Leu Gly Asp 195 200 205Val Lys Asn 21082636DNAHomo sapiens 82gccgaggccc agaaggccct caggaaagca gagagcttga agaaatgtct ctctgtcatg 60gaagccaaag tgaaggctca gactgctcca aacaaggatg tgcagaggga gatcgctgac 120cttggagagg ccctggccac tgcagtcatc ccccagtggc agaaggatga attgcgggag 180actctcaaat ccctaaagaa ggtcatggat gacttggacc gagccagcaa agccgatgtc 240cagaaacgag tgttagagaa gacgaagcag ttcatcgaca gcaaccccaa ccagcctctt 300gtcatcctgg agatggagag cggcgcctca gccaaggccc tgaatgaagc cttgaagctc 360ttcaagatgc actcccctca gacttctgcc atgctcttca cggtggacaa tgaggctggc 420aagatcacgt gcctgtgtca agttccccag aatgcagcca atcggggctt aaaagccagc 480gagtgggtgc agcaggtgtc aggcttgatg gacggtaaag gtggtggcaa ggatgtgtct 540gcacaggcca caggcaagaa cgttggctgc ctgcaggagg cgctgcagct ggccacttcc 600ttcgcccagc tgcgcctcgg ggatgtaaag aactga 63683381PRTHomo sapiens 83Gln Val Trp Leu Phe Ile Asp Glu Pro Arg Arg Arg Pro Ile Met Ser1 5 10 15Asn His Thr Ala Thr His Ile Leu Asn Phe Ala Leu Arg Ser Val Leu 20 25 30Gly Glu Ala Asp Gln Lys Gly Ser Leu Val Ala Pro Asp Arg Leu Arg 35 40 45Phe Asp Phe Thr Ala Lys Gly Ala Met Ser Thr Gln Gln Ile Lys Lys 50 55 60Ala Glu Glu Ile Ala Asn Glu Met Ile Glu Ala Ala Lys Ala Val Tyr65 70 75 80Thr Gln Asp Cys Pro Leu Ala Ala Ala Lys Ala Ile Gln Gly Leu Arg 85 90 95Ala Val Phe Asp Glu Thr Tyr Pro Asp Pro Val Arg Val Val Ser Ile 100 105 110Gly Val Pro Val Ser Glu Leu Leu Asp Asp Pro Ser Gly Pro Ala Gly 115 120 125Ser Leu Thr Ser Val Glu Phe Cys Gly Gly Thr His Leu Arg Asn Ser 130 135 140Ser His Ala Gly Ala Phe Val Ile Val Thr Glu Glu Ala Ile Ala Lys145 150 155 160Gly Ile Arg Arg Ile Val Ala Val Thr Gly Ala Glu Ala Gln Lys Ala 165 170 175Leu Arg Lys Ala Glu Ser Leu Lys Lys Cys Leu Ser Val Met Glu Ala 180 185 190Lys Val Lys Ala Gln Thr Ala Pro Asn Lys Asp Val Gln Arg Glu Ile 195 200 205Ala Asp Leu Gly Glu Ala Leu Ala Thr Ala Val Ile Pro Gln Trp Gln 210 215 220Lys Asp Glu Leu Arg Glu Thr Leu Lys Ser Leu Lys Lys Val Met Asp225 230 235 240Asp Leu Asp Arg Ala Ser Lys Ala Asp Val Gln Lys Arg Val Leu Glu 245 250 255Lys Thr Lys Gln Phe Ile Asp Ser Asn Pro Asn Gln Pro Leu Val Ile 260 265 270Leu Glu Met Glu Ser Gly Ala Ser Ala Lys Ala Leu Asn Glu Ala Leu 275 280 285Lys Leu Phe Lys Met His Ser Pro Gln Thr Ser Ala Met Leu Phe Thr 290 295 300Val Asp Asn Glu Ala Gly Lys Ile Thr Cys Leu Cys Gln Val Pro Gln305 310 315 320Asn Ala Ala Asn Arg Gly Leu Lys Ala Ser Glu Trp Val Gln Gln Val 325 330 335Ser Gly Leu Met Asp Gly Lys Gly Gly Gly Lys Asp Val Ser Ala Gln 340 345 350Ala Thr Gly Lys Asn Val Gly Cys Leu Gln Glu Ala Leu Gln Leu Ala 355 360 365Thr Ser Phe Ala Gln Leu Arg Leu Gly Asp Val Lys Asn 370 375 380841146DNAHomo sapiens 84caggtctggc tgtttattga tgagccccga cgaagaccca tcatgagcaa ccacacagct 60acgcacattc tgaacttcgc cctgcgctca gtgcttgggg aagctgacca gaaaggctca 120ttggttgctc ctgaccgcct cagatttgac tttactgcca agggagccat gtccacccaa 180cagatcaaga aggctgaaga gattgctaat gagatgattg aggcagccaa ggccgtctat 240acccaggatt gccccctggc agcagcgaaa gccatccagg gcctacgggc tgtgtttgat 300gagacctatc ctgaccctgt gcgagtcgtc tccattgggg tcccggtgtc cgagttgctg 360gatgacccct ctgggcctgc tggctccctg acttctgttg agttctgtgg gggaacgcac 420ctgcggaact cgagtcatgc aggagctttt gtgatcgtga cggaagaagc cattgccaag 480ggtatccgga ggattgtggc tgtcacaggt gccgaggccc agaaggccct caggaaagca 540gagagcttga agaaatgtct ctctgtcatg gaagccaaag tgaaggctca gactgctcca 600aacaaggatg tgcagaggga gatcgctgac cttggagagg ccctggccac tgcagtcatc 660ccccagtggc agaaggatga attgcgggag actctcaaat ccctaaagaa ggtcatggat 720gacttggacc gagccagcaa agccgatgtc cagaaacgag tgttagagaa gacgaagcag 780ttcatcgaca gcaaccccaa ccagcctctt gtcatcctgg agatggagag cggcgcctca 840gccaaggccc tgaatgaagc cttgaagctc ttcaagatgc actcccctca gacttctgcc 900atgctcttca cggtggacaa tgaggctggc aagatcacgt gcctgtgtca agttccccag 960aatgcagcca atcggggctt aaaagccagc gagtgggtgc agcaggtgtc aggcttgatg 1020gacggtaaag gtggtggcaa ggatgtgtct gcacaggcca caggcaagaa cgttggctgc 1080ctgcaggagg cgctgcagct ggccacttcc ttcgcccagc tgcgcctcgg ggatgtaaag 1140aactga 11468519PRTMus musculus 85Thr Cys Phe Tyr Ala Glu Gln Gly Gly Gln Ile Tyr Asp Glu Gly Tyr1 5 10 15Leu Val Lys86243PRTMus musculus 86Val Asp Asp Ser Ser Glu Asp Lys Thr Glu Phe Thr Val Lys Asn Ala1 5 10 15Gln Val Arg Gly Gly Tyr Val Leu His Ile Gly Thr Ile Tyr Gly Asn 20 25 30Leu Lys Val Gly Asp Gln Val Arg Leu Phe Ile Asp Glu Pro Arg Arg 35 40 45Arg Pro Val Met Ser Asn His Thr Ala Thr His Ile Leu Asn Phe Ala 50 55 60Leu Arg Ser Val Leu Gly Glu Ala Asp Gln Lys Gly Ser Leu Val Ala65 70 75 80Pro Asp Arg Leu Arg Phe Asp Phe Thr Ala Lys Gly Ala Met Ser Thr 85 90 95Gln Gln Ile Lys Lys Ala Glu Glu Ile Val Asn Gly Met Ile Glu Ala 100 105 110Ala Lys Pro Val Tyr Thr Gln Asp Cys Pro Leu Ala Ala Ala Lys Ala 115 120 125Ile Gln Gly Leu Arg Ala Val Phe Asp Glu Thr Tyr Pro Asp Pro Val 130 135 140Arg Val Val Ser Ile Gly Val Pro Val Ser Glu Leu Leu Asp Asp Pro145 150 155 160Cys Gly Pro Ala Gly Ser Leu Thr Ser Val Glu Phe Cys Gly Gly Thr 165 170 175His Leu Arg Asn Ser Ser His Ala Gly Ala Phe Val Ile Val Thr Glu 180 185 190Glu Ala Ile Ala Lys Gly Ile Arg Arg Ile Val Ala Val Thr Gly Ala 195 200 205Glu Ala Gln Lys Ala Leu Arg Lys Ser Glu Thr Leu Lys Lys Ser Leu 210 215 220Ser Ala Met Glu Ala Lys Val Lys Ala Gln Thr Ala Pro Asn Lys Asp225 230 235 240Val Gln Arg8719PRTMus musculus 87Glu Ile Ala Asp Leu Gly Glu Ala Leu Ala Thr Ala Val Ile Pro Gln1 5 10 15Trp Gln Lys8818PRTMus musculus 88Met Phe Val Asp Glu Val Val Thr Gly Gln Glu Cys Gly Val Val Leu1 5 10 15Asp Lys8919PRTMus musculus 89Thr Cys Phe Tyr Ala Glu Gln Gly Gly Gln Ile Tyr Asp Glu Gly Tyr1 5 10 15Leu Val Lys9014PRTMus musculus 90Val Asp Asp Ser Ser Glu Asp Lys Thr Glu Phe Thr Val Lys1 5 109124PRTMus musculus 91Tyr Asn Tyr Gln Ser Asp Ser Ser Gly Ser Tyr Val Phe Glu Cys Thr1 5 10 15Val Ala Thr Val Leu Ala Leu Arg 209221PRTMus musculus 92Arg Glu Lys Met Phe Val Asp Glu Val Val Thr Gly Gln Glu Cys Gly1 5 10 15Val Val Leu Asp Lys 209319PRTMus musculus 93Thr Cys Phe Tyr Ala Glu Gln Gly Gly Gln Ile Tyr Asp Glu Gly Tyr1 5 10 15Leu Val Lys94365PRTMus musculus 94Val Asp Asp Ser Ser Glu Asp Lys Thr Glu Phe Thr Val Lys Asn Ala1 5 10 15Gln Val Arg Gly Gly Tyr Val Leu His Ile Gly Thr Ile Tyr Gly Asn 20 25 30Leu Lys Val Gly Asp Gln Val Arg Leu Phe Ile Asp Glu Pro Arg Arg 35 40 45Arg Pro Val Met Ser Asn His Thr Ala Thr His Ile Leu Asn Phe Ala 50 55 60Leu Arg Ser Val Leu Gly Glu Ala Asp Gln Lys Gly Ser Leu Val Ala65 70 75 80Pro Asp Arg Leu Arg Phe Asp Phe Thr Ala Lys Gly Ala Met Ser Thr 85 90 95Gln Gln Ile Lys Lys Ala Glu Glu Ile Val Asn Gly Met Ile Glu Ala 100 105 110Ala Lys Pro Val Tyr Thr Gln Asp Cys Pro Leu Ala Ala Ala Lys Ala 115 120 125Ile Gln Gly Leu Arg Ala Val Phe Asp Glu Thr Tyr Pro Asp Pro Val 130 135 140Arg Val Val Ser Ile Gly Val Pro Val Ser Glu Leu Leu Asp Asp Pro145 150 155 160Cys Gly Pro Ala Gly Ser Leu Thr Ser Val Glu Phe Cys Gly Gly Thr 165 170 175His Leu Arg Asn Ser Ser His Ala Gly Ala Phe Val Ile Val Thr Glu 180 185 190Glu Ala Ile Ala Lys Gly Ile Arg Arg Ile Val Ala Val Thr Gly Ala 195 200 205Glu Ala Gln Lys Ala Leu Arg Lys Ser Glu Thr Leu Lys Lys Ser Leu 210 215 220Ser Ala Met Glu Ala Lys Val Lys Ala Gln Thr Ala Pro Asn Lys Asp225 230 235 240Val Gln Arg Glu Ile Ala Asp Leu Gly Glu Ala Leu Ala Thr Ala Val 245 250 255Ile Pro Gln Trp Gln Lys Asp Glu Gln Arg Glu Thr Leu Lys Ser Leu 260 265 270Lys Lys Val Met Asp Asp Leu Asp Arg Ala Ser Lys Ala Asp Val Gln 275 280 285Lys Arg Val Leu Glu Lys Thr Lys Gln Leu Ile Asp Ser Asn Pro Asn 290 295 300Gln Pro Leu Val Ile Leu Glu Met Glu Ser Gly Ala Ser Ala Lys Ala305 310 315 320Leu Asn Glu Ala Leu Lys Leu Phe Lys Thr His Ser Pro Gln Thr Ser 325 330 335Ala Met Leu Phe Thr Val Asp Asn Glu Ala Gly Lys Ile Thr Cys Leu 340 345 350Cys Gln Val Pro Gln Asn Ala Ala Asn Arg Gly Leu Lys 355 360 3659515PRTMus musculus 95Ala Ser Glu Trp Val Gln Gln Val Ser Gly Leu Met Asp Gly Lys1 5 10 159614PRTMus musculus 96Val Asp Asp Ser Ser Glu Asp Lys Thr Glu Phe Thr Val Lys1 5 1097229PRTMus musculus 97Asn Ala Gln Val Arg Gly Gly Tyr Val Leu His Ile Gly Thr Ile Tyr1 5 10 15Gly Asn Leu Lys Val Gly Asp Gln Val Arg Leu Phe Ile Asp Glu Pro 20 25 30Arg Arg Arg Pro Val Met Ser Asn His Thr Ala Thr His Ile Leu Asn 35 40 45Phe Ala Leu Arg Ser Val Leu Gly Glu Ala Asp Gln Lys Gly Ser Leu 50 55 60Val Ala Pro Asp Arg Leu Arg Phe Asp Phe Thr Ala Lys Gly Ala Met65 70 75 80Ser Thr Gln Gln Ile Lys Lys Ala Glu Glu Ile Val Asn Gly Met Ile 85 90 95Glu Ala Ala Lys Pro Val Tyr Thr Gln Asp Cys Pro Leu Ala Ala Ala 100 105 110Lys Ala Ile Gln Gly Leu Arg Ala Val Phe Asp Glu Thr Tyr Pro Asp 115 120 125Pro Val Arg Val Val Ser Ile Gly Val Pro Val Ser Glu Leu Leu Asp 130 135 140Asp Pro Cys Gly Pro Ala Gly Ser Leu Thr Ser Val Glu Phe Cys Gly145 150 155 160Gly Thr His Leu Arg Asn Ser Ser His Ala Gly Ala Phe Val Ile Val 165 170 175Thr Glu Glu Ala Ile Ala Lys Gly Ile Arg Arg Ile Val Ala Val Thr 180 185 190Gly Ala Glu Ala Gln Lys Ala Leu Arg Lys Ser Glu Thr Leu Lys Lys 195 200 205Ser Leu Ser Ala Met Glu Ala Lys Val Lys Ala Gln Thr Ala Pro Asn 210 215 220Lys Asp Val Gln Arg2259819PRTMus musculus 98Glu Ile Ala Asp Leu Gly Glu Ala Leu Ala Thr Ala Val Ile Pro Gln1 5 10 15Trp Gln Lys9967PRTMus musculus 99Asp Glu Gln Arg Glu Thr Leu Lys Ser Leu Lys Lys Val Met Asp Asp1 5 10 15Leu Asp Arg Ala Ser Lys Ala Asp Val Gln Lys Arg Val Leu Glu Lys 20 25 30Thr Lys Gln Leu Ile Asp Ser Asn Pro Asn Gln Pro Leu Val Ile Leu 35 40 45Glu Met Glu Ser Gly Ala Ser Ala Lys Ala Leu Asn Glu Ala Leu Lys 50 55 60Leu Phe Lys6510019PRTMus musculus 100Thr His Ser Pro Gln Thr Ser Ala Met Leu Phe Thr Val Asp Asn Glu1 5 10 15Ala Gly Lys10114PRTMus musculus 101Ile Thr Cys Leu Cys Gln Val Pro Gln Asn Ala Ala Asn Arg1 5 101023PRTMus musculus 102Gly Leu Lys110315PRTMus musculus 103Ala Ser Glu Trp Val Gln Gln Val Ser Gly Leu Met Asp Gly Lys1 5 10 15104281PRTMus musculus 104Thr Cys Phe Tyr Ala Glu Gln Gly Gly Gln Ile Tyr Asp Glu Gly Tyr1 5 10 15Leu Val Lys Val Asp Asp Ser Ser Glu Asp Lys Thr Glu Phe Thr Val 20 25 30Lys Asn Ala Gln Val Arg Gly Gly Tyr Val Leu His Ile Gly Thr Ile 35 40 45Tyr Gly Asn Leu Lys Val Gly Asp Gln Val Arg Leu Phe Ile Asp Glu 50 55 60Pro Arg Arg Arg Pro Val Met Ser Asn His Thr Ala Thr His Ile Leu65 70 75 80Asn Phe Ala Leu Arg Ser Val Leu Gly Glu Ala Asp Gln Lys Gly Ser 85 90 95Leu Val Ala Pro Asp Arg Leu Arg Phe Asp Phe Thr Ala Lys Gly Ala 100 105 110Met Ser Thr Gln Gln Ile Lys Lys Ala Glu Glu Ile Val Asn Gly Met 115 120 125Ile Glu Ala Ala Lys Pro Val Tyr Thr Gln Asp Cys Pro Leu Ala Ala 130 135 140Ala Lys Ala Ile Gln Gly Leu Arg Ala Val Phe Asp Glu Thr Tyr Pro145 150 155 160Asp Pro Val Arg Val Val Ser Ile Gly Val Pro Val Ser Glu Leu Leu 165 170 175Asp Asp Pro Cys Gly Pro Ala Gly Ser Leu Thr Ser Val Glu Phe Cys 180 185 190Gly Gly Thr His Leu Arg Asn Ser Ser His Ala Gly Ala Phe Val Ile 195 200 205Val Thr Glu Glu Ala Ile Ala Lys Gly Ile Arg Arg Ile Val Ala Val 210 215 220Thr Gly Ala Glu Ala Gln Lys Ala Leu Arg Lys Ser Glu Thr Leu Lys225 230 235 240Lys Ser Leu Ser Ala Met Glu Ala Lys Val Lys Ala Gln Thr Ala Pro 245 250 255Asn Lys Asp Val Gln Arg Glu Ile Ala Asp Leu Gly Glu Ala Leu Ala 260 265 270Thr Ala Val Ile Pro Gln Trp Gln Lys 275 28010551PRTMus musculus 105Met Phe Val Asp Glu Val Val Thr Gly Gln Glu Cys Gly Val Val Leu1 5 10 15Asp Lys Thr Cys Phe Tyr Ala Glu Gln Gly Gly Gln Ile Tyr Asp Glu 20 25 30Gly Tyr Leu Val Lys Val Asp Asp Ser Ser Glu Asp Lys Thr Glu Phe 35 40 45Thr Val Lys 50106444PRTMus musculus 106Tyr Asn Tyr Gln Ser Asp Ser Ser Gly Ser Tyr Val Phe Glu Cys Thr1 5 10 15Val Ala Thr Val Leu Ala Leu Arg Arg Glu Lys Met Phe Val Asp Glu 20 25 30Val Val Thr Gly Gln Glu Cys Gly Val Val Leu Asp Lys Thr Cys Phe 35 40 45Tyr Ala Glu Gln Gly Gly Gln Ile Tyr Asp Glu Gly Tyr Leu Val Lys 50 55 60Val Asp Asp Ser Ser Glu Asp Lys Thr Glu Phe Thr Val Lys Asn Ala65 70 75 80Gln Val Arg Gly Gly Tyr Val Leu His Ile Gly Thr Ile Tyr Gly Asn 85 90 95Leu Lys Val Gly Asp Gln Val Arg Leu Phe Ile Asp Glu Pro Arg Arg 100 105 110Arg Pro Val Met Ser Asn His Thr Ala Thr His Ile Leu Asn Phe Ala 115 120 125Leu Arg Ser Val Leu Gly Glu Ala Asp Gln Lys Gly Ser Leu Val Ala 130 135 140Pro Asp Arg Leu Arg Phe Asp Phe Thr Ala Lys Gly Ala Met Ser Thr145 150 155 160Gln Gln

Ile Lys Lys Ala Glu Glu Ile Val Asn Gly Met Ile Glu Ala 165 170 175Ala Lys Pro Val Tyr Thr Gln Asp Cys Pro Leu Ala Ala Ala Lys Ala 180 185 190Ile Gln Gly Leu Arg Ala Val Phe Asp Glu Thr Tyr Pro Asp Pro Val 195 200 205Arg Val Val Ser Ile Gly Val Pro Val Ser Glu Leu Leu Asp Asp Pro 210 215 220Cys Gly Pro Ala Gly Ser Leu Thr Ser Val Glu Phe Cys Gly Gly Thr225 230 235 240His Leu Arg Asn Ser Ser His Ala Gly Ala Phe Val Ile Val Thr Glu 245 250 255Glu Ala Ile Ala Lys Gly Ile Arg Arg Ile Val Ala Val Thr Gly Ala 260 265 270Glu Ala Gln Lys Ala Leu Arg Lys Ser Glu Thr Leu Lys Lys Ser Leu 275 280 285Ser Ala Met Glu Ala Lys Val Lys Ala Gln Thr Ala Pro Asn Lys Asp 290 295 300Val Gln Arg Glu Ile Ala Asp Leu Gly Glu Ala Leu Ala Thr Ala Val305 310 315 320Ile Pro Gln Trp Gln Lys Asp Glu Gln Arg Glu Thr Leu Lys Ser Leu 325 330 335Lys Lys Val Met Asp Asp Leu Asp Arg Ala Ser Lys Ala Asp Val Gln 340 345 350Lys Arg Val Leu Glu Lys Thr Lys Gln Leu Ile Asp Ser Asn Pro Asn 355 360 365Gln Pro Leu Val Ile Leu Glu Met Glu Ser Gly Ala Ser Ala Lys Ala 370 375 380Leu Asn Glu Ala Leu Lys Leu Phe Lys Thr His Ser Pro Gln Thr Ser385 390 395 400Ala Met Leu Phe Thr Val Asp Asn Glu Ala Gly Lys Ile Thr Cys Leu 405 410 415Cys Gln Val Pro Gln Asn Ala Ala Asn Arg Gly Leu Lys Ala Ser Glu 420 425 430Trp Val Gln Gln Val Ser Gly Leu Met Asp Gly Lys 435 440107380PRTMus musculus 107Val Asp Asp Ser Ser Glu Asp Lys Thr Glu Phe Thr Val Lys Asn Ala1 5 10 15Gln Val Arg Gly Gly Tyr Val Leu His Ile Gly Thr Ile Tyr Gly Asn 20 25 30Leu Lys Val Gly Asp Gln Val Arg Leu Phe Ile Asp Glu Pro Arg Arg 35 40 45Arg Pro Val Met Ser Asn His Thr Ala Thr His Ile Leu Asn Phe Ala 50 55 60Leu Arg Ser Val Leu Gly Glu Ala Asp Gln Lys Gly Ser Leu Val Ala65 70 75 80Pro Asp Arg Leu Arg Phe Asp Phe Thr Ala Lys Gly Ala Met Ser Thr 85 90 95Gln Gln Ile Lys Lys Ala Glu Glu Ile Val Asn Gly Met Ile Glu Ala 100 105 110Ala Lys Pro Val Tyr Thr Gln Asp Cys Pro Leu Ala Ala Ala Lys Ala 115 120 125Ile Gln Gly Leu Arg Ala Val Phe Asp Glu Thr Tyr Pro Asp Pro Val 130 135 140Arg Val Val Ser Ile Gly Val Pro Val Ser Glu Leu Leu Asp Asp Pro145 150 155 160Cys Gly Pro Ala Gly Ser Leu Thr Ser Val Glu Phe Cys Gly Gly Thr 165 170 175His Leu Arg Asn Ser Ser His Ala Gly Ala Phe Val Ile Val Thr Glu 180 185 190Glu Ala Ile Ala Lys Gly Ile Arg Arg Ile Val Ala Val Thr Gly Ala 195 200 205Glu Ala Gln Lys Ala Leu Arg Lys Ser Glu Thr Leu Lys Lys Ser Leu 210 215 220Ser Ala Met Glu Ala Lys Val Lys Ala Gln Thr Ala Pro Asn Lys Asp225 230 235 240Val Gln Arg Glu Ile Ala Asp Leu Gly Glu Ala Leu Ala Thr Ala Val 245 250 255Ile Pro Gln Trp Gln Lys Asp Glu Gln Arg Glu Thr Leu Lys Ser Leu 260 265 270Lys Lys Val Met Asp Asp Leu Asp Arg Ala Ser Lys Ala Asp Val Gln 275 280 285Lys Arg Val Leu Glu Lys Thr Lys Gln Leu Ile Asp Ser Asn Pro Asn 290 295 300Gln Pro Leu Val Ile Leu Glu Met Glu Ser Gly Ala Ser Ala Lys Ala305 310 315 320Leu Asn Glu Ala Leu Lys Leu Phe Lys Thr His Ser Pro Gln Thr Ser 325 330 335Ala Met Leu Phe Thr Val Asp Asn Glu Ala Gly Lys Ile Thr Cys Leu 340 345 350Cys Gln Val Pro Gln Asn Ala Ala Asn Arg Gly Leu Lys Ala Ser Glu 355 360 365Trp Val Gln Gln Val Ser Gly Leu Met Asp Gly Lys 370 375 38010828PRTMus musculus 108Asp Met Ser Ala Gln Ala Thr Gly Lys Asn Val Gly Cys Leu Gln Glu1 5 10 15Ala Leu Gln Leu Ala Thr Ser Phe Ala Gln Leu Arg 20 251099PRTMus musculus 109Asp Met Ser Ala Gln Ala Thr Gly Lys1 511019PRTMus musculus 110Asn Val Gly Cys Leu Gln Glu Ala Leu Gln Leu Ala Thr Ser Phe Ala1 5 10 15Gln Leu Arg11151PRTMus musculus 111Met Phe Val Asp Glu Val Val Thr Gly Gln Glu Cys Gly Val Val Leu1 5 10 15Asp Lys Thr Cys Phe Tyr Ala Glu Gln Gly Gly Gln Ile Tyr Asp Glu 20 25 30Gly Tyr Leu Val Lys Val Asp Asp Ser Ser Glu Asp Lys Thr Glu Phe 35 40 45Thr Val Lys 5011219PRTMus musculus 112Glu Ile Ala Asp Leu Gly Glu Ala Leu Ala Thr Ala Val Ile Pro Gln1 5 10 15Trp Gln Lys11386PRTMus musculus 113Asp Glu Gln Arg Glu Thr Leu Lys Ser Leu Lys Lys Val Met Asp Asp1 5 10 15Leu Asp Arg Ala Ser Lys Ala Asp Val Gln Lys Arg Val Leu Glu Lys 20 25 30Thr Lys Gln Leu Ile Asp Ser Asn Pro Asn Gln Pro Leu Val Ile Leu 35 40 45Glu Met Glu Ser Gly Ala Ser Ala Lys Ala Leu Asn Glu Ala Leu Lys 50 55 60Leu Phe Lys Thr His Ser Pro Gln Thr Ser Ala Met Leu Phe Thr Val65 70 75 80Asp Asn Glu Ala Gly Lys 8511414PRTMus musculus 114Ile Thr Cys Leu Cys Gln Val Pro Gln Asn Ala Ala Asn Arg1 5 10115119PRTMus musculus 115Glu Ile Ala Asp Leu Gly Glu Ala Leu Ala Thr Ala Val Ile Pro Gln1 5 10 15Trp Gln Lys Asp Glu Gln Arg Glu Thr Leu Lys Ser Leu Lys Lys Val 20 25 30Met Asp Asp Leu Asp Arg Ala Ser Lys Ala Asp Val Gln Lys Arg Val 35 40 45Leu Glu Lys Thr Lys Gln Leu Ile Asp Ser Asn Pro Asn Gln Pro Leu 50 55 60Val Ile Leu Glu Met Glu Ser Gly Ala Ser Ala Lys Ala Leu Asn Glu65 70 75 80Ala Leu Lys Leu Phe Lys Thr His Ser Pro Gln Thr Ser Ala Met Leu 85 90 95Phe Thr Val Asp Asn Glu Ala Gly Lys Ile Thr Cys Leu Cys Gln Val 100 105 110Pro Gln Asn Ala Ala Asn Arg 115116676PRTHomo sapiens 116Met Ala Tyr Arg Val Leu Ala Asp His Ala Arg Thr Ile Thr Val Ala1 5 10 15Leu Ala Asp Gly Gly Arg Pro Asp Asn Thr Gly Arg Gly Tyr Val Leu 20 25 30Arg Arg Ile Leu Arg Arg Ala Val Arg Tyr Ala His Glu Lys Leu Asn 35 40 45Ala Ser Arg Gly Phe Phe Ala Thr Leu Val Asp Val Val Val Gln Ser 50 55 60Leu Gly Asp Ala Phe Pro Glu Leu Lys Lys Asp Pro Asp Met Val Lys65 70 75 80Asp Ile Ile Asn Glu Glu Glu Val Gln Phe Leu Lys Thr Leu Ser Arg 85 90 95Gly Arg Arg Ile Leu Asp Arg Lys Ile Gln Ser Leu Gly Asp Ser Lys 100 105 110Thr Ile Pro Gly Asp Thr Ala Trp Leu Leu Tyr Asp Thr Tyr Gly Phe 115 120 125Pro Val Asp Leu Thr Gly Leu Ile Ala Glu Glu Lys Gly Leu Val Val 130 135 140Asp Met Asp Gly Phe Glu Glu Glu Arg Lys Leu Ala Gln Leu Lys Ser145 150 155 160Gln Gly Lys Gly Ala Gly Gly Glu Asp Leu Ile Met Leu Asp Ile Tyr 165 170 175Ala Ile Glu Glu Leu Arg Ala Arg Gly Leu Glu Val Thr Asp Asp Ser 180 185 190Pro Lys Tyr Asn Tyr His Leu Asp Ser Ser Gly Ser Tyr Val Phe Glu 195 200 205Asn Thr Val Ala Thr Val Met Ala Leu Arg Arg Glu Lys Met Phe Val 210 215 220Glu Glu Val Ser Thr Gly Gln Glu Cys Gly Val Val Leu Asp Lys Thr225 230 235 240Cys Phe Tyr Ala Glu Gln Gly Gly Gln Ile Tyr Asp Glu Gly Tyr Leu 245 250 255Val Lys Val Asp Asp Ser Ser Glu Asp Lys Thr Glu Phe Thr Val Lys 260 265 270Asn Ala Gln Val Arg Gly Gly Tyr Val Leu His Ile Gly Thr Ile Tyr 275 280 285Gly Asp Leu Lys Val Gly Asp Gln Val Trp Leu Phe Ile Asp Glu Pro 290 295 300Arg Arg Arg Pro Ile Met Ser Asn His Thr Ala Thr His Ile Leu Asn305 310 315 320Phe Ala Leu Arg Ser Val Leu Gly Glu Ala Asp Gln Lys Gly Ser Leu 325 330 335Val Ala Pro Asp Arg Leu Arg Phe Asp Phe Thr Ala Lys Gly Ala Met 340 345 350Ser Thr Gln Gln Ile Lys Lys Ala Glu Glu Ile Ala Asn Glu Met Ile 355 360 365Glu Ala Ala Lys Ala Val Tyr Thr Gln Asp Cys Pro Leu Ala Ala Ala 370 375 380Lys Ala Ile Gln Gly Leu Arg Ala Val Phe Asp Glu Thr Tyr Pro Asp385 390 395 400Pro Val Arg Val Val Ser Ile Gly Val Pro Val Ser Glu Leu Leu Asp 405 410 415Asp Pro Ser Gly Pro Ala Gly Ser Leu Thr Ser Val Glu Phe Cys Gly 420 425 430Gly Thr His Leu Arg Asn Ser Ser His Ala Gly Ala Phe Val Ile Val 435 440 445Thr Glu Glu Ala Ile Ala Lys Gly Ile Arg Arg Ile Val Ala Val Thr 450 455 460Gly Ala Glu Ala Gln Lys Ala Leu Arg Lys Ala Glu Ser Leu Lys Lys465 470 475 480Cys Leu Ser Val Met Glu Ala Lys Val Lys Ala Gln Thr Ala Pro Asn 485 490 495Lys Asp Val Gln Arg Glu Ile Ala Asp Leu Gly Glu Ala Leu Ala Thr 500 505 510Ala Val Ile Pro Gln Trp Gln Lys Asp Glu Leu Arg Glu Thr Leu Lys 515 520 525Ser Leu Lys Lys Val Met Asp Asp Leu Asp Arg Ala Ser Lys Ala Asp 530 535 540Val Gln Lys Arg Val Leu Glu Lys Thr Lys Gln Phe Ile Asp Ser Asn545 550 555 560Pro Asn Gln Pro Leu Val Ile Leu Glu Met Glu Ser Gly Ala Ser Ala 565 570 575Lys Ala Leu Asn Glu Ala Leu Lys Leu Phe Lys Met His Ser Pro Gln 580 585 590Thr Ser Ala Met Leu Phe Thr Val Asp Asn Glu Ala Gly Lys Ile Thr 595 600 605Cys Leu Cys Gln Val Pro Gln Asn Ala Ala Asn Arg Gly Leu Lys Ala 610 615 620Ser Glu Trp Val Gln Gln Val Ser Gly Leu Met Asp Gly Lys Gly Gly625 630 635 640Gly Lys Asp Val Ser Ala Gln Ala Thr Gly Lys Asn Val Gly Cys Leu 645 650 655Gln Glu Ala Leu Gln Leu Ala Thr Ser Phe Ala Gln Leu Arg Leu Gly 660 665 670Asp Val Lys Asn 6751172031DNAHomo sapiens 117atggcctacc gggtgctggc tgaccacgct cggaccatca ctgtggcact ggctgatggt 60ggccggcctg acaacacagg gcgtggatat gtgttgagac ggattctccg ccgagctgtc 120cgatacgccc atgaaaagct caatgccagc aggggcttct ttgctacgtt agtggatgtt 180gtcgtccagt ccctgggaga tgcatttcct gagctgaaga aggacccaga catggtgaag 240gacatcatta atgaagaaga ggtgcagttt ctcaagactc tcagcagagg gcgtcgcatc 300ctggacagga aaattcagag cctgggagac agcaagacca ttcccggaga cactgcttgg 360ctcctctatg acacctatgg gtttccagtg gatctgactg gactgattgc tgaagagaag 420ggcctggtgg tagacatgga tggctttgaa gaggagagga aactggccca gctgaaatca 480cagggcaagg gagctggtgg ggaagacctc attatgctgg acatttacgc tatcgaagag 540ctccgggcac ggggtctgga ggtcacagat gattccccaa agtacaatta ccatttggac 600tccagtggta gctatgtatt tgagaacaca gtggctacgg tgatggctct gcgcagggag 660aagatgttcg tggaagaggt gtccacaggc caggagtgtg gagtggtgct ggacaagacc 720tgtttctatg ctgagcaagg aggccagatc tatgacgaag gctacctggt gaaggtggat 780gacagcagtg aagataaaac agagtttaca gtgaagaatg ctcaggtccg aggagggtat 840gtgctacaca ttggaaccat ctacggtgac ctgaaagtgg gggatcaggt ctggctgttt 900attgatgagc cccgacgaag acccatcatg agcaaccaca cagctacgca cattctgaac 960ttcgccctgc gctcagtgct tggggaagct gaccagaaag gctcattggt tgctcctgac 1020cgcctcagat ttgactttac tgccaaggga gccatgtcca cccaacagat caagaaggct 1080gaagagattg ctaatgagat gattgaggca gccaaggccg tctataccca ggattgcccc 1140ctggcagcag cgaaagccat ccagggccta cgggctgtgt ttgatgagac ctatcctgac 1200cctgtgcgag tcgtctccat tggggtcccg gtgtccgagt tgctggatga cccctctggg 1260cctgctggct ccctgacttc tgttgagttc tgtgggggaa cgcacctgcg gaactcgagt 1320catgcaggag cttttgtgat cgtgacggaa gaagccattg ccaagggtat ccggaggatt 1380gtggctgtca caggtgccga ggcccagaag gccctcagga aagcagagag cttgaagaaa 1440tgtctctctg tcatggaagc caaagtgaag gctcagactg ctccaaacaa ggatgtgcag 1500agggagatcg ctgaccttgg agaggccctg gccactgcag tcatccccca gtggcagaag 1560gatgaattgc gggagactct caaatcccta aagaaggtca tggatgactt ggaccgagcc 1620agcaaagccg atgtccagaa acgagtgtta gagaagacga agcagttcat cgacagcaac 1680cccaaccagc ctcttgtcat cctggagatg gagagcggcg cctcagccaa ggccctgaat 1740gaagccttga agctcttcaa gatgcactcc cctcagactt ctgccatgct cttcacggtg 1800gacaatgagg ctggcaagat cacgtgcctg tgtcaagttc cccagaatgc agccaatcgg 1860ggcttaaaag ccagcgagtg ggtgcagcag gtgtcaggct tgatggacgg taaaggtggt 1920ggcaaggatg tgtctgcaca ggccacaggc aagaacgttg gctgcctgca ggaggcgctg 1980cagctggcca cttccttcgc ccagctgcgc ctcggggatg taaagaactg a 2031118567PRTHomo sapiens 118Met Asp Ser Thr Leu Thr Ala Ser Glu Ile Arg Gln Arg Phe Ile Asp1 5 10 15Phe Phe Lys Arg Asn Glu His Thr Tyr Val His Ser Ser Ala Thr Ile 20 25 30Pro Leu Asp Asp Pro Thr Leu Leu Phe Ala Asn Ala Gly Met Asn Gln 35 40 45Leu Lys Ser Gln Gly Lys Gly Ala Gly Gly Glu Asp Leu Ile Met Leu 50 55 60Asp Ile Tyr Ala Ile Glu Glu Leu Arg Ala Arg Gly Leu Glu Val Thr65 70 75 80Asp Asp Ser Pro Lys Tyr Asn Tyr His Leu Asp Ser Ser Gly Ser Tyr 85 90 95Val Phe Glu Asn Thr Val Ala Thr Val Met Ala Leu Arg Arg Glu Lys 100 105 110Met Phe Val Glu Glu Val Ser Thr Gly Gln Glu Cys Gly Val Val Leu 115 120 125Asp Lys Thr Cys Phe Tyr Ala Glu Gln Gly Gly Gln Ile Tyr Asp Glu 130 135 140Gly Tyr Leu Val Lys Val Asp Asp Ser Ser Glu Asp Lys Thr Glu Phe145 150 155 160Thr Val Lys Asn Ala Gln Val Arg Gly Gly Tyr Val Leu His Ile Gly 165 170 175Thr Ile Tyr Gly Asp Leu Lys Val Gly Asp Gln Val Trp Leu Phe Ile 180 185 190Asp Glu Pro Arg Arg Arg Pro Ile Met Ser Asn His Thr Ala Thr His 195 200 205Ile Leu Asn Phe Ala Leu Arg Ser Val Leu Gly Glu Ala Asp Gln Lys 210 215 220Gly Ser Leu Val Ala Pro Asp Arg Leu Arg Phe Asp Phe Thr Ala Lys225 230 235 240Gly Ala Met Ser Thr Gln Gln Ile Lys Lys Ala Glu Glu Ile Ala Asn 245 250 255Glu Met Ile Glu Ala Ala Lys Ala Val Tyr Thr Gln Asp Cys Pro Leu 260 265 270Ala Ala Ala Lys Ala Ile Gln Gly Leu Arg Ala Val Phe Asp Glu Thr 275 280 285Tyr Pro Asp Pro Val Arg Val Val Ser Ile Gly Val Pro Val Ser Glu 290 295 300Leu Leu Asp Asp Pro Ser Gly Pro Ala Gly Ser Leu Thr Ser Val Glu305 310 315 320Phe Cys Gly Gly Thr His Leu Arg Asn Ser Ser His Ala Gly Ala Phe 325 330 335Val Ile Val Thr Glu Glu Ala Ile Ala Lys Gly Ile Arg Arg Ile Val 340 345 350Ala Val Thr Gly Ala Glu Ala Gln Lys Ala Leu Arg Lys Ala Glu Ser 355 360 365Leu Lys Lys Cys Leu Ser Val Met Glu Ala Lys Val Lys Ala Gln Thr 370 375 380Ala Pro Asn Lys Asp Val Gln Arg Glu Ile Ala Asp Leu Gly Glu Ala385 390 395 400Leu Ala Thr Ala Val Ile Pro Gln Trp Gln Lys Asp Glu Leu Arg Glu 405 410 415Thr Leu Lys Ser Leu Lys Lys Val Met Asp Asp Leu Asp Arg Ala Ser 420

425 430Lys Ala Asp Val Gln Lys Arg Val Leu Glu Lys Thr Lys Gln Phe Ile 435 440 445Asp Ser Asn Pro Asn Gln Pro Leu Val Ile Leu Glu Met Glu Ser Gly 450 455 460Ala Ser Ala Lys Ala Leu Asn Glu Ala Leu Lys Leu Phe Lys Met His465 470 475 480Ser Pro Gln Thr Ser Ala Met Leu Phe Thr Val Asp Asn Glu Ala Gly 485 490 495Lys Ile Thr Cys Leu Cys Gln Val Pro Gln Asn Ala Ala Asn Arg Gly 500 505 510Leu Lys Ala Ser Glu Trp Val Gln Gln Val Ser Gly Leu Met Asp Gly 515 520 525Lys Gly Gly Gly Lys Asp Val Ser Ala Gln Ala Thr Gly Lys Asn Val 530 535 540Gly Cys Leu Gln Glu Ala Leu Gln Leu Ala Thr Ser Phe Ala Gln Leu545 550 555 560Arg Leu Gly Asp Val Lys Asn 5651191704DNAHomo sapiens 119atggactcta ctctaacagc aagtgaaatc cggcagcgat ttatagattt cttcaagagg 60aacgagcata cgtatgttca ctcgtctgcc accatcccat tggatgaccc cactttgctc 120tttgccaatg caggcatgaa ccagctgaaa tcacagggca agggagctgg tggggaagac 180ctcattatgc tggacattta cgctatcgaa gagctccggg cacggggtct ggaggtcaca 240gatgattccc caaagtacaa ttaccatttg gactccagtg gtagctatgt atttgagaac 300acagtggcta cggtgatggc tctgcgcagg gagaagatgt tcgtggaaga ggtgtccaca 360ggccaggagt gtggagtggt gctggacaag acctgtttct atgctgagca aggaggccag 420atctatgacg aaggctacct ggtgaaggtg gatgacagca gtgaagataa aacagagttt 480acagtgaaga atgctcaggt ccgaggaggg tatgtgctac acattggaac catctacggt 540gacctgaaag tgggggatca ggtctggctg tttattgatg agccccgacg aagacccatc 600atgagcaacc acacagctac gcacattctg aacttcgccc tgcgctcagt gcttggggaa 660gctgaccaga aaggctcatt ggttgctcct gaccgcctca gatttgactt tactgccaag 720ggagccatgt ccacccaaca gatcaagaag gctgaagaga ttgctaatga gatgattgag 780gcagccaagg ccgtctatac ccaggattgc cccctggcag cagcgaaagc catccagggc 840ctacgggctg tgtttgatga gacctatcct gaccctgtgc gagtcgtctc cattggggtc 900ccggtgtccg agttgctgga tgacccctct gggcctgctg gctccctgac ttctgttgag 960ttctgtgggg gaacgcacct gcggaactcg agtcatgcag gagcttttgt gatcgtgacg 1020gaagaagcca ttgccaaggg tatccggagg attgtggctg tcacaggtgc cgaggcccag 1080aaggccctca ggaaagcaga gagcttgaag aaatgtctct ctgtcatgga agccaaagtg 1140aaggctcaga ctgctccaaa caaggatgtg cagagggaga tcgctgacct tggagaggcc 1200ctggccactg cagtcatccc ccagtggcag aaggatgaat tgcgggagac tctcaaatcc 1260ctaaagaagg tcatggatga cttggaccga gccagcaaag ccgatgtcca gaaacgagtg 1320ttagagaaga cgaagcagtt catcgacagc aaccccaacc agcctcttgt catcctggag 1380atggagagcg gcgcctcagc caaggccctg aatgaagcct tgaagctctt caagatgcac 1440tcccctcaga cttctgccat gctcttcacg gtggacaatg aggctggcaa gatcacgtgc 1500ctgtgtcaag ttccccagaa tgcagccaat cggggcttaa aagccagcga gtgggtgcag 1560caggtgtcag gcttgatgga cggtaaaggt ggtggcaagg atgtgtctgc acaggccaca 1620ggcaagaacg ttggctgcct gcaggaggcg ctgcagctgg ccacttcctt cgcccagctg 1680cgcctcgggg atgtaaagaa ctga 1704120878PRTHomo sapiens 120Met Asp Ser Thr Leu Thr Ala Ser Glu Ile Arg Gln Arg Phe Ile Asp1 5 10 15Phe Phe Lys Arg Asn Glu His Thr Tyr Val His Ser Ser Ala Thr Ile 20 25 30Pro Leu Asp Asp Pro Thr Leu Leu Phe Ala Asn Ala Gly Met Asn Gln 35 40 45Phe Lys Pro Ile Phe Leu Asn Thr Ile Asp Pro Ser His Pro Met Ala 50 55 60Lys Leu Ser Arg Ala Ala Asn Thr Gln Lys Cys Ile Arg Ala Gly Gly65 70 75 80Lys His Asn Asp Leu Asp Asp Val Gly Lys Asp Val Tyr His His Thr 85 90 95Phe Phe Glu Met Leu Gly Ser Trp Ser Phe Gly Asp Tyr Phe Lys Glu 100 105 110Leu Ala Cys Lys Met Ala Leu Glu Leu Leu Thr Gln Glu Phe Gly Ile 115 120 125Pro Ile Glu Arg Leu Tyr Val Thr Tyr Phe Gly Gly Asp Glu Ala Ala 130 135 140Gly Leu Glu Ala Asp Leu Glu Cys Lys Gln Ile Trp Gln Asn Leu Gly145 150 155 160Leu Asp Asp Thr Lys Ile Leu Pro Gly Asn Met Lys Asp Asn Phe Trp 165 170 175Glu Met Gly Asp Thr Gly Pro Cys Gly Pro Cys Ser Glu Ile His Tyr 180 185 190Asp Arg Ile Gly Gly Arg Asp Ala Ala His Leu Val Asn Gln Asp Asp 195 200 205Pro Asn Val Leu Glu Ile Trp Asn Leu Val Phe Ile Gln Tyr Asn Arg 210 215 220Glu Ala Asp Gly Ile Leu Lys Pro Leu Pro Lys Lys Ser Ile Asp Thr225 230 235 240Gly Met Gly Leu Glu Arg Leu Val Ser Val Leu Gln Asn Lys Met Ser 245 250 255Asn Tyr Asp Thr Asp Leu Phe Val Pro Tyr Phe Glu Ala Ile Gln Lys 260 265 270Gly Thr Gly Ala Arg Pro Tyr Thr Gly Lys Val Gly Ala Glu Asp Ala 275 280 285Asp Gly Ile Asp Met Ala Tyr Arg Val Leu Ala Asp His Ala Arg Thr 290 295 300Ile Thr Val Ala Leu Ala Asp Gly Gly Arg Pro Asp Asn Thr Gly Arg305 310 315 320Gly Tyr Val Leu Arg Arg Ile Leu Arg Arg Ala Val Arg Tyr Ala His 325 330 335Glu Lys Leu Asn Ala Ser Arg Gly Phe Phe Ala Thr Leu Val Asp Val 340 345 350Val Val Gln Ser Leu Gly Asp Ala Phe Pro Glu Leu Lys Lys Asp Pro 355 360 365Asp Met Val Lys Asp Ile Ile Asn Glu Glu Glu Val Gln Phe Leu Lys 370 375 380Thr Leu Ser Arg Gly Arg Arg Ile Leu Asp Arg Lys Ile Gln Ser Leu385 390 395 400Gly Asp Ser Lys Thr Ile Pro Val Phe Glu Asn Thr Val Ala Thr Val 405 410 415Met Ala Leu Arg Arg Glu Lys Met Phe Val Glu Glu Val Ser Thr Gly 420 425 430Gln Glu Cys Gly Val Val Leu Asp Lys Thr Cys Phe Tyr Ala Glu Gln 435 440 445Gly Gly Gln Ile Tyr Asp Glu Gly Tyr Leu Val Lys Val Asp Asp Ser 450 455 460Ser Glu Asp Lys Thr Glu Phe Thr Val Lys Asn Ala Gln Val Arg Gly465 470 475 480Gly Tyr Val Leu His Ile Gly Thr Ile Tyr Gly Asp Leu Lys Val Gly 485 490 495Asp Gln Val Trp Leu Phe Ile Asp Glu Pro Arg Arg Arg Pro Ile Met 500 505 510Ser Asn His Thr Ala Thr His Ile Leu Asn Phe Ala Leu Arg Ser Val 515 520 525Leu Gly Glu Ala Asp Gln Lys Gly Ser Leu Val Ala Pro Asp Arg Leu 530 535 540Arg Phe Asp Phe Thr Ala Lys Gly Ala Met Ser Thr Gln Gln Ile Lys545 550 555 560Lys Ala Glu Glu Ile Ala Asn Glu Met Ile Glu Ala Ala Lys Ala Val 565 570 575Tyr Thr Gln Asp Cys Pro Leu Ala Ala Ala Lys Ala Ile Gln Gly Leu 580 585 590Arg Ala Val Phe Asp Glu Thr Tyr Pro Asp Pro Val Arg Val Val Ser 595 600 605Ile Gly Val Pro Val Ser Glu Leu Leu Asp Asp Pro Ser Gly Pro Ala 610 615 620Gly Ser Leu Thr Ser Val Glu Phe Cys Gly Gly Thr His Leu Arg Asn625 630 635 640Ser Ser His Ala Gly Ala Phe Val Ile Val Thr Glu Glu Ala Ile Ala 645 650 655Lys Gly Ile Arg Arg Ile Val Ala Val Thr Gly Ala Glu Ala Gln Lys 660 665 670Ala Leu Arg Lys Ala Glu Ser Leu Lys Lys Cys Leu Ser Val Met Glu 675 680 685Ala Lys Val Lys Ala Gln Thr Ala Pro Asn Lys Asp Val Gln Arg Glu 690 695 700Ile Ala Asp Leu Gly Glu Ala Leu Ala Thr Ala Val Ile Pro Gln Trp705 710 715 720Gln Lys Asp Glu Leu Arg Glu Thr Leu Lys Ser Leu Lys Lys Val Met 725 730 735Asp Asp Leu Asp Arg Ala Ser Lys Ala Asp Val Gln Lys Arg Val Leu 740 745 750Glu Lys Thr Lys Gln Phe Ile Asp Ser Asn Pro Asn Gln Pro Leu Val 755 760 765Ile Leu Glu Met Glu Ser Gly Ala Ser Ala Lys Ala Leu Asn Glu Ala 770 775 780Leu Lys Leu Phe Lys Met His Ser Pro Gln Thr Ser Ala Met Leu Phe785 790 795 800Thr Val Asp Asn Glu Ala Gly Lys Ile Thr Cys Leu Cys Gln Val Pro 805 810 815Gln Asn Ala Ala Asn Arg Gly Leu Lys Ala Ser Glu Trp Val Gln Gln 820 825 830Val Ser Gly Leu Met Asp Gly Lys Gly Gly Gly Lys Asp Val Ser Ala 835 840 845Gln Ala Thr Gly Lys Asn Val Gly Cys Leu Gln Glu Ala Leu Gln Leu 850 855 860Ala Thr Ser Phe Ala Gln Leu Arg Leu Gly Asp Val Lys Asn865 870 8751212637DNAHomo sapiens 121atggactcta ctctaacagc aagtgaaatc cggcagcgat ttatagattt cttcaagagg 60aacgagcata cgtatgttca ctcgtctgcc accatcccat tggatgaccc cactttgctc 120tttgccaatg caggcatgaa ccagtttaaa cccattttcc tgaacacaat tgacccatct 180caccccatgg caaagctgag cagagctgcc aatacccaga agtgcatccg ggctgggggc 240aaacataatg acctggacga tgtgggcaag gatgtctatc atcacacctt cttcgagatg 300ctgggctctt ggtcttttgg agattacttt aaggaattgg catgtaagat ggctctggaa 360ctcctcaccc aagagtttgg cattcccatt gaaagacttt atgttactta ctttggcggg 420gatgaagcag ctggcttaga agcagatctg gaatgcaaac agatctggca aaatttgggg 480ctggatgaca ccaaaatcct cccaggcaac atgaaggata acttctggga gatgggtgac 540acgggcccct gtggtccttg cagtgagatc cactacgacc ggattggtgg tcgggacgcc 600gcacatcttg tcaaccagga cgaccctaat gtgctggaga tctggaacct tgtgttcatc 660cagtataaca gggaagctga tggcattctg aaacctcttc ccaagaaaag cattgacaca 720gggatgggcc tggaacgact ggtatctgtg ctgcagaata agatgtccaa ctatgacact 780gacctttttg tcccttactt tgaagccatt cagaagggca caggtgcccg accatacact 840gggaaagttg gtgctgagga tgccgatggg attgacatgg cctaccgggt gctggctgac 900cacgctcgga ccatcactgt ggcactggct gatggtggcc ggcctgacaa cacagggcgt 960ggatatgtgt tgagacggat tctccgccga gctgtccgat acgcccatga aaagctcaat 1020gccagcaggg gcttctttgc tacgttagtg gatgttgtcg tccagtccct gggagatgca 1080tttcctgagc tgaagaagga cccagacatg gtgaaggaca tcattaatga agaagaggtg 1140cagtttctca agactctcag cagagggcgt cgcatcctgg acaggaaaat tcagagcctg 1200ggagacagca agaccattcc cgtatttgag aacacagtgg ctacggtgat ggctctgcgc 1260agggagaaga tgttcgtgga agaggtgtcc acaggccagg agtgtggagt ggtgctggac 1320aagacctgtt tctatgctga gcaaggaggc cagatctatg acgaaggcta cctggtgaag 1380gtggatgaca gcagtgaaga taaaacagag tttacagtga agaatgctca ggtccgagga 1440gggtatgtgc tacacattgg aaccatctac ggtgacctga aagtggggga tcaggtctgg 1500ctgtttattg atgagccccg acgaagaccc atcatgagca accacacagc tacgcacatt 1560ctgaacttcg ccctgcgctc agtgcttggg gaagctgacc agaaaggctc attggttgct 1620cctgaccgcc tcagatttga ctttactgcc aagggagcca tgtccaccca acagatcaag 1680aaggctgaag agattgctaa tgagatgatt gaggcagcca aggccgtcta tacccaggat 1740tgccccctgg cagcagcgaa agccatccag ggcctacggg ctgtgtttga tgagacctat 1800cctgaccctg tgcgagtcgt ctccattggg gtcccggtgt ccgagttgct ggatgacccc 1860tctgggcctg ctggctccct gacttctgtt gagttctgtg ggggaacgca cctgcggaac 1920tcgagtcatg caggagcttt tgtgatcgtg acggaagaag ccattgccaa gggtatccgg 1980aggattgtgg ctgtcacagg tgccgaggcc cagaaggccc tcaggaaagc agagagcttg 2040aagaaatgtc tctctgtcat ggaagccaaa gtgaaggctc agactgctcc aaacaaggat 2100gtgcagaggg agatcgctga ccttggagag gccctggcca ctgcagtcat cccccagtgg 2160cagaaggatg aattgcggga gactctcaaa tccctaaaga aggtcatgga tgacttggac 2220cgagccagca aagccgatgt ccagaaacga gtgttagaga agacgaagca gttcatcgac 2280agcaacccca accagcctct tgtcatcctg gagatggaga gcggcgcctc agccaaggcc 2340ctgaatgaag ccttgaagct cttcaagatg cactcccctc agacttctgc catgctcttc 2400acggtggaca atgaggctgg caagatcacg tgcctgtgtc aagttcccca gaatgcagcc 2460aatcggggct taaaagccag cgagtgggtg cagcaggtgt caggcttgat ggacggtaaa 2520ggtggtggca aggatgtgtc tgcacaggcc acaggcaaga acgttggctg cctgcaggag 2580gcgctgcagc tggccacttc cttcgcccag ctgcgcctcg gggatgtaaa gaactga 2637122427PRTHomo sapiens 122Met Ile Pro Gln Ser Thr Ile Thr Ile Trp Thr Pro Val Val Ala Met1 5 10 15Lys Thr Glu Phe Thr Val Lys Asn Ala Gln Val Arg Gly Gly Tyr Val 20 25 30Leu His Ile Gly Thr Ile Tyr Gly Asp Leu Lys Val Gly Asp Gln Val 35 40 45Trp Leu Phe Ile Asp Glu Pro Arg Arg Arg Pro Ile Met Ser Asn His 50 55 60Thr Ala Thr His Ile Leu Asn Phe Ala Leu Arg Ser Val Leu Gly Glu65 70 75 80Ala Asp Gln Lys Gly Ser Leu Val Ala Pro Asp Arg Leu Arg Phe Asp 85 90 95Phe Thr Ala Lys Gly Ala Met Ser Thr Gln Gln Ile Lys Lys Ala Glu 100 105 110Glu Ile Ala Asn Glu Met Ile Glu Ala Ala Lys Ala Val Tyr Thr Gln 115 120 125Asp Cys Pro Leu Ala Ala Ala Lys Ala Ile Gln Gly Leu Arg Ala Val 130 135 140Phe Asp Glu Thr Tyr Pro Asp Pro Val Arg Val Val Ser Ile Gly Val145 150 155 160Pro Val Ser Glu Leu Leu Asp Asp Pro Ser Gly Pro Ala Gly Ser Leu 165 170 175Thr Ser Val Glu Phe Cys Gly Gly Thr His Leu Arg Asn Ser Ser His 180 185 190Ala Gly Ala Phe Val Ile Val Thr Glu Glu Ala Ile Ala Lys Gly Ile 195 200 205Arg Arg Ile Val Ala Val Thr Gly Ala Glu Ala Gln Lys Ala Leu Arg 210 215 220Lys Ala Glu Ser Leu Lys Lys Cys Leu Ser Val Met Glu Ala Lys Val225 230 235 240Lys Ala Gln Thr Ala Pro Asn Lys Asp Val Gln Arg Glu Ile Ala Asp 245 250 255Leu Gly Glu Ala Leu Ala Thr Ala Val Ile Pro Gln Trp Gln Lys Asp 260 265 270Glu Leu Arg Glu Thr Leu Lys Ser Leu Lys Lys Val Met Asp Asp Leu 275 280 285Asp Arg Ala Ser Lys Ala Asp Val Gln Lys Arg Val Leu Glu Lys Thr 290 295 300Lys Gln Phe Ile Asp Ser Asn Pro Asn Gln Pro Leu Val Ile Leu Glu305 310 315 320Met Glu Ser Gly Ala Ser Ala Lys Ala Leu Asn Glu Ala Leu Lys Leu 325 330 335Phe Lys Met His Ser Pro Gln Thr Ser Ala Met Leu Phe Thr Val Asp 340 345 350Asn Glu Ala Gly Lys Ile Thr Cys Leu Cys Gln Val Pro Gln Asn Ala 355 360 365Ala Asn Arg Gly Leu Lys Ala Ser Glu Trp Val Gln Gln Val Ser Gly 370 375 380Leu Met Asp Gly Lys Gly Gly Gly Lys Asp Val Ser Ala Gln Ala Thr385 390 395 400Gly Lys Asn Val Gly Cys Leu Gln Glu Ala Leu Gln Leu Ala Thr Ser 405 410 415Phe Ala Gln Leu Arg Leu Gly Asp Val Lys Asn 420 4251231284DNAHomo sapiens 123atgattcccc aaagtacaat taccatttgg actccagtgg tagctatgaa aacagagttt 60acagtgaaga atgctcaggt ccgaggaggg tatgtgctac acattggaac catctacggt 120gacctgaaag tgggggatca ggtctggctg tttattgatg agccccgacg aagacccatc 180atgagcaacc acacagctac gcacattctg aacttcgccc tgcgctcagt gcttggggaa 240gctgaccaga aaggctcatt ggttgctcct gaccgcctca gatttgactt tactgccaag 300ggagccatgt ccacccaaca gatcaagaag gctgaagaga ttgctaatga gatgattgag 360gcagccaagg ccgtctatac ccaggattgc cccctggcag cagcgaaagc catccagggc 420ctacgggctg tgtttgatga gacctatcct gaccctgtgc gagtcgtctc cattggggtc 480ccggtgtccg agttgctgga tgacccctct gggcctgctg gctccctgac ttctgttgag 540ttctgtgggg gaacgcacct gcggaactcg agtcatgcag gagcttttgt gatcgtgacg 600gaagaagcca ttgccaaggg tatccggagg attgtggctg tcacaggtgc cgaggcccag 660aaggccctca ggaaagcaga gagcttgaag aaatgtctct ctgtcatgga agccaaagtg 720aaggctcaga ctgctccaaa caaggatgtg cagagggaga tcgctgacct tggagaggcc 780ctggccactg cagtcatccc ccagtggcag aaggatgaat tgcgggagac tctcaaatcc 840ctaaagaagg tcatggatga cttggaccga gccagcaaag ccgatgtcca gaaacgagtg 900ttagagaaga cgaagcagtt catcgacagc aaccccaacc agcctcttgt catcctggag 960atggagagcg gcgcctcagc caaggccctg aatgaagcct tgaagctctt caagatgcac 1020tcccctcaga cttctgccat gctcttcacg gtggacaatg aggctggcaa gatcacgtgc 1080ctgtgtcaag ttccccagaa tgcagccaat cggggcttaa aagccagcga gtgggtgcag 1140caggtgtcag gcttgatgga cggtaaaggt ggtggcaagg atgtgtctgc acaggccaca 1200ggcaagaacg ttggctgcct gcaggaggcg ctgcagctgg ccacttcctt cgcccagctg 1260cgcctcgggg atgtaaagaa ctga 1284124244PRTHomo sapiens 124Met Arg His Leu Arg Asn Ser Ser His Ala Gly Ala Phe Val Ile Val1 5 10 15Thr Glu Glu Ala Ile Ala Lys Gly Ile Arg Arg Ile Val Ala Val Thr 20 25 30Gly Ala Glu Ala Gln Lys Ala Leu Arg Lys Ala Glu Ser Leu Lys Lys 35 40 45Cys Leu Ser Val Met Glu Ala Lys Val Lys Ala Gln Thr Ala Pro Asn 50 55 60Lys Asp Val Gln Arg Glu Ile Ala Asp Leu Gly Glu Ala Leu Ala Thr65 70

75 80Ala Val Ile Pro Gln Trp Gln Lys Asp Glu Leu Arg Glu Thr Leu Lys 85 90 95Ser Leu Lys Lys Val Met Asp Asp Leu Asp Arg Ala Ser Lys Ala Asp 100 105 110Val Gln Lys Arg Val Leu Glu Lys Thr Lys Gln Phe Ile Asp Ser Asn 115 120 125Pro Asn Gln Pro Leu Val Ile Leu Glu Met Glu Ser Gly Ala Ser Ala 130 135 140Lys Ala Leu Asn Glu Ala Leu Lys Leu Phe Lys Met His Ser Pro Gln145 150 155 160Thr Ser Ala Met Leu Phe Thr Val Asp Asn Glu Ala Gly Lys Ile Thr 165 170 175Cys Leu Cys Gln Val Pro Gln Asn Ala Ala Asn Arg Gly Leu Lys Ala 180 185 190Ser Glu Trp Val Gln Gln Val Ser Gly Leu Met Asp Gly Lys Gly Gly 195 200 205Gly Lys Asp Val Ser Ala Gln Ala Thr Gly Lys Asn Val Gly Cys Leu 210 215 220Gln Glu Ala Leu Gln Leu Ala Thr Ser Phe Ala Gln Leu Arg Leu Gly225 230 235 240Asp Val Lys Asn125735DNAHomo sapiens 125atgaggcacc tgcggaactc gagtcatgca ggagcttttg tgatcgtgac ggaagaagcc 60attgccaagg gtatccggag gattgtggct gtcacaggtg ccgaggccca gaaggccctc 120aggaaagcag agagcttgaa gaaatgtctc tctgtcatgg aagccaaagt gaaggctcag 180actgctccaa acaaggatgt gcagagggag atcgctgacc ttggagaggc cctggccact 240gcagtcatcc cccagtggca gaaggatgaa ttgcgggaga ctctcaaatc cctaaagaag 300gtcatggatg acttggaccg agccagcaaa gccgatgtcc agaaacgagt gttagagaag 360acgaagcagt tcatcgacag caaccccaac cagcctcttg tcatcctgga gatggagagc 420ggcgcctcag ccaaggccct gaatgaagcc ttgaagctct tcaagatgca ctcccctcag 480acttctgcca tgctcttcac ggtggacaat gaggctggca agatcacgtg cctgtgtcaa 540gttccccaga atgcagccaa tcggggctta aaagccagcg agtgggtgca gcaggtgtca 600ggcttgatgg acggtaaagg tggtggcaag gatgtgtctg cacaggccac aggcaagaac 660gttggctgcc tgcaggaggc gctgcagctg gccacttcct tcgcccagct gcgcctcggg 720gatgtaaaga actga 735126599PRTHomo sapiens 126Met Val Lys Asp Ile Ile Asn Glu Glu Glu Val Gln Phe Leu Lys Thr1 5 10 15Leu Ser Arg Gly Arg Arg Ile Leu Asp Arg Lys Ile Gln Ser Leu Gly 20 25 30Asp Ser Lys Thr Ile Pro Gly Asp Thr Ala Trp Leu Leu Tyr Asp Thr 35 40 45Tyr Gly Phe Pro Val Asp Leu Thr Gly Leu Ile Ala Glu Glu Lys Gly 50 55 60Leu Val Val Asp Met Asp Gly Phe Glu Glu Glu Arg Lys Leu Ala Gln65 70 75 80Leu Lys Ser Gln Gly Lys Gly Ala Gly Gly Glu Asp Leu Ile Met Leu 85 90 95Asp Ile Tyr Ala Ile Glu Glu Leu Arg Ala Arg Gly Leu Glu Val Thr 100 105 110Asp Asp Ser Pro Lys Tyr Asn Tyr His Leu Asp Ser Ser Gly Ser Tyr 115 120 125Val Phe Glu Asn Thr Val Ala Thr Val Met Ala Leu Arg Arg Glu Lys 130 135 140Met Phe Val Glu Glu Val Ser Thr Gly Gln Glu Cys Gly Val Val Leu145 150 155 160Asp Lys Thr Cys Phe Tyr Ala Glu Gln Gly Gly Gln Ile Tyr Asp Glu 165 170 175Gly Tyr Leu Val Lys Val Asp Asp Ser Ser Glu Asp Lys Thr Glu Phe 180 185 190Thr Val Lys Asn Ala Gln Val Arg Gly Gly Tyr Val Leu His Ile Gly 195 200 205Thr Ile Tyr Gly Asp Leu Lys Val Gly Asp Gln Val Trp Leu Phe Ile 210 215 220Asp Glu Pro Arg Arg Arg Pro Ile Met Ser Asn His Thr Ala Thr His225 230 235 240Ile Leu Asn Phe Ala Leu Arg Ser Val Leu Gly Glu Ala Asp Gln Lys 245 250 255Gly Ser Leu Val Ala Pro Asp Arg Leu Arg Phe Asp Phe Thr Ala Lys 260 265 270Gly Ala Met Ser Thr Gln Gln Ile Lys Lys Ala Glu Glu Ile Ala Asn 275 280 285Glu Met Ile Glu Ala Ala Lys Ala Val Tyr Thr Gln Asp Cys Pro Leu 290 295 300Ala Ala Ala Lys Ala Ile Gln Gly Leu Arg Ala Val Phe Asp Glu Thr305 310 315 320Tyr Pro Asp Pro Val Arg Val Val Ser Ile Gly Val Pro Val Ser Glu 325 330 335Leu Leu Asp Asp Pro Ser Gly Pro Ala Gly Ser Leu Thr Ser Val Glu 340 345 350Phe Cys Gly Gly Thr His Leu Arg Asn Ser Ser His Ala Gly Ala Phe 355 360 365Val Ile Val Thr Glu Glu Ala Ile Ala Lys Gly Ile Arg Arg Ile Val 370 375 380Ala Val Thr Gly Ala Glu Ala Gln Lys Ala Leu Arg Lys Ala Glu Ser385 390 395 400Leu Lys Lys Cys Leu Ser Val Met Glu Ala Lys Val Lys Ala Gln Thr 405 410 415Ala Pro Asn Lys Asp Val Gln Arg Glu Ile Ala Asp Leu Gly Glu Ala 420 425 430Leu Ala Thr Ala Val Ile Pro Gln Trp Gln Lys Asp Glu Leu Arg Glu 435 440 445Thr Leu Lys Ser Leu Lys Lys Val Met Asp Asp Leu Asp Arg Ala Ser 450 455 460Lys Ala Asp Val Gln Lys Arg Val Leu Glu Lys Thr Lys Gln Phe Ile465 470 475 480Asp Ser Asn Pro Asn Gln Pro Leu Val Ile Leu Glu Met Glu Ser Gly 485 490 495Ala Ser Ala Lys Ala Leu Asn Glu Ala Leu Lys Leu Phe Lys Met His 500 505 510Ser Pro Gln Thr Ser Ala Met Leu Phe Thr Val Asp Asn Glu Ala Gly 515 520 525Lys Ile Thr Cys Leu Cys Gln Val Pro Gln Asn Ala Ala Asn Arg Gly 530 535 540Leu Lys Ala Ser Glu Trp Val Gln Gln Val Ser Gly Leu Met Asp Gly545 550 555 560Lys Gly Gly Gly Lys Asp Val Ser Ala Gln Ala Thr Gly Lys Asn Val 565 570 575Gly Cys Leu Gln Glu Ala Leu Gln Leu Ala Thr Ser Phe Ala Gln Leu 580 585 590Arg Leu Gly Asp Val Lys Asn 5951271800DNAHomo sapiens 127atggtgaagg acatcattaa tgaagaagag gtgcagtttc tcaagactct cagcagaggg 60cgtcgcatcc tggacaggaa aattcagagc ctgggagaca gcaagaccat tcccggagac 120actgcttggc tcctctatga cacctatggg tttccagtgg atctgactgg actgattgct 180gaagagaagg gcctggtggt agacatggat ggctttgaag aggagaggaa actggcccag 240ctgaaatcac agggcaaggg agctggtggg gaagacctca ttatgctgga catttacgct 300atcgaagagc tccgggcacg gggtctggag gtcacagatg attccccaaa gtacaattac 360catttggact ccagtggtag ctatgtattt gagaacacag tggctacggt gatggctctg 420cgcagggaga agatgttcgt ggaagaggtg tccacaggcc aggagtgtgg agtggtgctg 480gacaagacct gtttctatgc tgagcaagga ggccagatct atgacgaagg ctacctggtg 540aaggtggatg acagcagtga agataaaaca gagtttacag tgaagaatgc tcaggtccga 600ggagggtatg tgctacacat tggaaccatc tacggtgacc tgaaagtggg ggatcaggtc 660tggctgttta ttgatgagcc ccgacgaaga cccatcatga gcaaccacac agctacgcac 720attctgaact tcgccctgcg ctcagtgctt ggggaagctg accagaaagg ctcattggtt 780gctcctgacc gcctcagatt tgactttact gccaagggag ccatgtccac ccaacagatc 840aagaaggctg aagagattgc taatgagatg attgaggcag ccaaggccgt ctatacccag 900gattgccccc tggcagcagc gaaagccatc cagggcctac gggctgtgtt tgatgagacc 960tatcctgacc ctgtgcgagt cgtctccatt ggggtcccgg tgtccgagtt gctggatgac 1020ccctctgggc ctgctggctc cctgacttct gttgagttct gtgggggaac gcacctgcgg 1080aactcgagtc atgcaggagc ttttgtgatc gtgacggaag aagccattgc caagggtatc 1140cggaggattg tggctgtcac aggtgccgag gcccagaagg ccctcaggaa agcagagagc 1200ttgaagaaat gtctctctgt catggaagcc aaagtgaagg ctcagactgc tccaaacaag 1260gatgtgcaga gggagatcgc tgaccttgga gaggccctgg ccactgcagt catcccccag 1320tggcagaagg atgaattgcg ggagactctc aaatccctaa agaaggtcat ggatgacttg 1380gaccgagcca gcaaagccga tgtccagaaa cgagtgttag agaagacgaa gcagttcatc 1440gacagcaacc ccaaccagcc tcttgtcatc ctggagatgg agagcggcgc ctcagccaag 1500gccctgaatg aagccttgaa gctcttcaag atgcactccc ctcagacttc tgccatgctc 1560ttcacggtgg acaatgaggc tggcaagatc acgtgcctgt gtcaagttcc ccagaatgca 1620gccaatcggg gcttaaaagc cagcgagtgg gtgcagcagg tgtcaggctt gatggacggt 1680aaaggtggtg gcaaggatgt gtctgcacag gccacaggca agaacgttgg ctgcctgcag 1740gaggcgctgc agctggccac ttccttcgcc cagctgcgcc tcggggatgt aaagaactga 180012850DNAHomo sapiens 128accttgtgtt catccagtat aacagggcac aggtgcccga ccatacactg 5012950DNAHomo sapiens 129ctttgccaat gcaggcatga accagctgaa atcacagggc aagggagctg 5013016PRTHomo sapiens 130Phe Ala Asn Ala Gly Met Asn Gln Leu Lys Ser Gln Gly Lys Gly Ala1 5 10 1513150DNAHomo sapiens 131ctgggagaca gcaagaccat tcccgtattt gagaacacag tggctacggt 5013216PRTHomo sapiens 132Leu Gly Asp Ser Lys Thr Ile Pro Val Phe Glu Asn Thr Val Ala Thr1 5 10 1513350DNAHomo sapiens 133catttggact ccagtggtag ctatgaaaac agagtttaca gtgaagaatg 5013416PRTHomo sapiens 134Ile Trp Thr Pro Val Val Ala Met Lys Thr Glu Phe Thr Val Lys Asn1 5 10 1513550DNAHomo sapiens 135tcaggtctgg ctgtttattg atgaggcacc tgcggaactc gagtcatgca 5013610PRTHomo sapiens 136Met Arg His Leu Arg Asn Ser Ser His Ala1 5 1013750DNAHomo sapiens 137gccggcctga caacacaggg cgtggggaga tgcatttcct gagctgaaga 50138310PRTHomo sapiens 138Met Ile Glu Ala Ala Lys Ala Val Tyr Thr Gln Asp Cys Pro Leu Ala1 5 10 15Ala Ala Lys Ala Ile Gln Gly Leu Arg Ala Val Phe Asp Glu Thr Tyr 20 25 30Pro Asp Pro Val Arg Val Val Ser Ile Gly Val Pro Val Ser Glu Leu 35 40 45Leu Asp Asp Pro Ser Gly Pro Ala Gly Ser Leu Thr Ser Val Glu Phe 50 55 60Cys Gly Gly Thr His Leu Arg Asn Ser Ser His Ala Gly Ala Phe Val65 70 75 80Ile Val Thr Glu Glu Ala Ile Ala Lys Gly Ile Arg Arg Ile Val Ala 85 90 95Val Thr Gly Ala Glu Ala Gln Lys Ala Leu Arg Lys Ala Glu Ser Leu 100 105 110Lys Lys Cys Leu Ser Val Met Glu Ala Lys Val Lys Ala Gln Thr Ala 115 120 125Pro Asn Lys Asp Val Gln Arg Glu Ile Ala Asp Leu Gly Glu Ala Leu 130 135 140Ala Thr Ala Val Ile Pro Gln Trp Gln Lys Asp Glu Leu Arg Glu Thr145 150 155 160Leu Lys Ser Leu Lys Lys Val Met Asp Asp Leu Asp Arg Ala Ser Lys 165 170 175Ala Asp Val Gln Lys Arg Val Leu Glu Lys Thr Lys Gln Phe Ile Asp 180 185 190Ser Asn Pro Asn Gln Pro Leu Val Ile Leu Glu Met Glu Ser Gly Ala 195 200 205Ser Ala Lys Ala Leu Asn Glu Ala Leu Lys Leu Phe Lys Met His Ser 210 215 220Pro Gln Thr Ser Ala Met Leu Phe Thr Val Asp Asn Glu Ala Gly Lys225 230 235 240Ile Thr Cys Leu Cys Gln Val Pro Gln Asn Ala Ala Asn Arg Gly Leu 245 250 255Lys Ala Ser Glu Trp Val Gln Gln Val Ser Gly Leu Met Asp Gly Lys 260 265 270Gly Gly Gly Lys Asp Val Ser Ala Gln Ala Thr Gly Lys Asn Val Gly 275 280 285Cys Leu Gln Glu Ala Leu Gln Leu Ala Thr Ser Phe Ala Gln Leu Arg 290 295 300Leu Gly Asp Val Lys Asn305 310139933DNAHomo sapiens 139atgattgagg cagccaaggc cgtctatacc caggattgcc ccctggcagc agcgaaagcc 60atccagggcc tacgggctgt gtttgatgag acctatcctg accctgtgcg agtcgtctcc 120attggggtcc cggtgtccga gttgctggat gacccctctg ggcctgctgg ctccctgact 180tctgttgagt tctgtggggg aacgcacctg cggaactcga gtcatgcagg agcttttgtg 240atcgtgacgg aagaagccat tgccaagggt atccggagga ttgtggctgt cacaggtgcc 300gaggcccaga aggccctcag gaaagcagag agcttgaaga aatgtctctc tgtcatggaa 360gccaaagtga aggctcagac tgctccaaac aaggatgtgc agagggagat cgctgacctt 420ggagaggccc tggccactgc agtcatcccc cagtggcaga aggatgaatt gcgggagact 480ctcaaatccc taaagaaggt catggatgac ttggaccgag ccagcaaagc cgatgtccag 540aaacgagtgt tagagaagac gaagcagttc atcgacagca accccaacca gcctcttgtc 600atcctggaga tggagagcgg cgcctcagcc aaggccctga atgaagcctt gaagctcttc 660aagatgcact cccctcagac ttctgccatg ctcttcacgg tggacaatga ggctggcaag 720atcacgtgcc tgtgtcaagt tccccagaat gcagccaatc ggggcttaaa agccagcgag 780tgggtgcagc aggtgtcagg cttgatggac ggtaaaggtg gtggcaagga tgtgtctgca 840caggccacag gcaagaacgt tggctgcctg caggaggcgc tgcagctggc cacttccttc 900gcccagctgc gcctcgggga tgtaaagaac tga 933140278PRTHomo sapiens 140Pro Asp Pro Val Arg Val Val Ser Ile Gly Val Pro Val Ser Glu Leu1 5 10 15Leu Asp Asp Pro Ser Gly Pro Ala Gly Ser Leu Thr Ser Val Glu Phe 20 25 30Cys Gly Gly Thr His Leu Arg Asn Ser Ser His Ala Gly Ala Phe Val 35 40 45Ile Val Thr Glu Glu Ala Ile Ala Lys Gly Ile Arg Arg Ile Val Ala 50 55 60Val Thr Gly Ala Glu Ala Gln Lys Ala Leu Arg Lys Ala Glu Ser Leu65 70 75 80Lys Lys Cys Leu Ser Val Met Glu Ala Lys Val Lys Ala Gln Thr Ala 85 90 95Pro Asn Lys Asp Val Gln Arg Glu Ile Ala Asp Leu Gly Glu Ala Leu 100 105 110Ala Thr Ala Val Ile Pro Gln Trp Gln Lys Asp Glu Leu Arg Glu Thr 115 120 125Leu Lys Ser Leu Lys Lys Val Met Asp Asp Leu Asp Arg Ala Ser Lys 130 135 140Ala Asp Val Gln Lys Arg Val Leu Glu Lys Thr Lys Gln Phe Ile Asp145 150 155 160Ser Asn Pro Asn Gln Pro Leu Val Ile Leu Glu Met Glu Ser Gly Ala 165 170 175Ser Ala Lys Ala Leu Asn Glu Ala Leu Lys Leu Phe Lys Met His Ser 180 185 190Pro Gln Thr Ser Ala Met Leu Phe Thr Val Asp Asn Glu Ala Gly Lys 195 200 205Ile Thr Cys Leu Cys Gln Val Pro Gln Asn Ala Ala Asn Arg Gly Leu 210 215 220Lys Ala Ser Glu Trp Val Gln Gln Val Ser Gly Leu Met Asp Gly Lys225 230 235 240Gly Gly Gly Lys Asp Val Ser Ala Gln Ala Thr Gly Lys Asn Val Gly 245 250 255Cys Leu Gln Glu Ala Leu Gln Leu Ala Thr Ser Phe Ala Gln Leu Arg 260 265 270Leu Gly Asp Val Lys Asn 275141837DNAHomo sapiens 141cctgaccctg tgcgagtcgt ctccattggg gtcccggtgt ccgagttgct ggatgacccc 60tctgggcctg ctggctccct gacttctgtt gagttctgtg ggggaacgca cctgcggaac 120tcgagtcatg caggagcttt tgtgatcgtg acggaagaag ccattgccaa gggtatccgg 180aggattgtgg ctgtcacagg tgccgaggcc cagaaggccc tcaggaaagc agagagcttg 240aagaaatgtc tctctgtcat ggaagccaaa gtgaaggctc agactgctcc aaacaaggat 300gtgcagaggg agatcgctga ccttggagag gccctggcca ctgcagtcat cccccagtgg 360cagaaggatg aattgcggga gactctcaaa tccctaaaga aggtcatgga tgacttggac 420cgagccagca aagccgatgt ccagaaacga gtgttagaga agacgaagca gttcatcgac 480agcaacccca accagcctct tgtcatcctg gagatggaga gcggcgcctc agccaaggcc 540ctgaatgaag ccttgaagct cttcaagatg cactcccctc agacttctgc catgctcttc 600acggtggaca atgaggctgg caagatcacg tgcctgtgtc aagttcccca gaatgcagcc 660aatcggggct taaaagccag cgagtgggtg cagcaggtgt caggcttgat ggacggtaaa 720ggtggtggca aggatgtgtc tgcacaggcc acaggcaaga acgttggctg cctgcaggag 780gcgctgcagc tggccacttc cttcgcccag ctgcgcctcg gggatgtaaa gaactga 837142222PRTHomo sapiens 142Lys Gly Ile Arg Arg Ile Val Ala Val Thr Gly Ala Glu Ala Gln Lys1 5 10 15Ala Leu Arg Lys Ala Glu Ser Leu Lys Lys Cys Leu Ser Val Met Glu 20 25 30Ala Lys Val Lys Ala Gln Thr Ala Pro Asn Lys Asp Val Gln Arg Glu 35 40 45Ile Ala Asp Leu Gly Glu Ala Leu Ala Thr Ala Val Ile Pro Gln Trp 50 55 60Gln Lys Asp Glu Leu Arg Glu Thr Leu Lys Ser Leu Lys Lys Val Met65 70 75 80Asp Asp Leu Asp Arg Ala Ser Lys Ala Asp Val Gln Lys Arg Val Leu 85 90 95Glu Lys Thr Lys Gln Phe Ile Asp Ser Asn Pro Asn Gln Pro Leu Val 100 105 110Ile Leu Glu Met Glu Ser Gly Ala Ser Ala Lys Ala Leu Asn Glu Ala 115 120 125Leu Lys Leu Phe Lys Met His Ser Pro Gln Thr Ser Ala Met Leu Phe 130 135 140Thr Val Asp Asn Glu Ala Gly Lys Ile Thr Cys Leu Cys Gln Val Pro145 150 155 160Gln Asn Ala Ala Asn Arg Gly Leu Lys Ala Ser Glu Trp Val Gln Gln 165 170 175Val Ser Gly Leu Met Asp Gly Lys Gly Gly Gly Lys Asp Val Ser Ala 180 185 190Gln Ala Thr Gly Lys Asn Val Gly Cys Leu Gln Glu Ala Leu Gln Leu 195 200 205Ala Thr Ser Phe Ala Gln Leu Arg Leu Gly Asp Val Lys Asn 210 215 220143669DNAHomo

sapiens 143aagggtatcc ggaggattgt ggctgtcaca ggtgccgagg cccagaaggc cctcaggaaa 60gcagagagct tgaagaaatg tctctctgtc atggaagcca aagtgaaggc tcagactgct 120ccaaacaagg atgtgcagag ggagatcgct gaccttggag aggccctggc cactgcagtc 180atcccccagt ggcagaagga tgaattgcgg gagactctca aatccctaaa gaaggtcatg 240gatgacttgg accgagccag caaagccgat gtccagaaac gagtgttaga gaagacgaag 300cagttcatcg acagcaaccc caaccagcct cttgtcatcc tggagatgga gagcggcgcc 360tcagccaagg ccctgaatga agccttgaag ctcttcaaga tgcactcccc tcagacttct 420gccatgctct tcacggtgga caatgaggct ggcaagatca cgtgcctgtg tcaagttccc 480cagaatgcag ccaatcgggg cttaaaagcc agcgagtggg tgcagcaggt gtcaggcttg 540atggacggta aaggtggtgg caaggatgtg tctgcacagg ccacaggcaa gaacgttggc 600tgcctgcagg aggcgctgca gctggccact tccttcgccc agctgcgcct cggggatgta 660aagaactga 669144113PRTHomo sapiens 144Pro Leu Val Ile Leu Glu Met Glu Ser Gly Ala Ser Ala Lys Ala Leu1 5 10 15Asn Glu Ala Leu Lys Leu Phe Lys Met His Ser Pro Gln Thr Ser Ala 20 25 30Met Leu Phe Thr Val Asp Asn Glu Ala Gly Lys Ile Thr Cys Leu Cys 35 40 45Gln Val Pro Gln Asn Ala Ala Asn Arg Gly Leu Lys Ala Ser Glu Trp 50 55 60Val Gln Gln Val Ser Gly Leu Met Asp Gly Lys Gly Gly Gly Lys Asp65 70 75 80Val Ser Ala Gln Ala Thr Gly Lys Asn Val Gly Cys Leu Gln Glu Ala 85 90 95Leu Gln Leu Ala Thr Ser Phe Ala Gln Leu Arg Leu Gly Asp Val Lys 100 105 110Asn145342DNAHomo sapiens 145cctcttgtca tcctggagat ggagagcggc gcctcagcca aggccctgaa tgaagccttg 60aagctcttca agatgcactc ccctcagact tctgccatgc tcttcacggt ggacaatgag 120gctggcaaga tcacgtgcct gtgtcaagtt ccccagaatg cagccaatcg gggcttaaaa 180gccagcgagt gggtgcagca ggtgtcaggc ttgatggacg gtaaaggtgg tggcaaggat 240gtgtctgcac aggccacagg caagaacgtt ggctgcctgc aggaggcgct gcagctggcc 300acttccttcg cccagctgcg cctcggggat gtaaagaact ga 342146514PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with N-terminal 6xHis affinity tag 146Met His His His His His His Gly Lys Pro Ile Pro Asn Pro Leu Leu1 5 10 15Gly Leu Asp Ser Thr Arg Gly Leu Glu Val Thr Asp Asp Ser Pro Lys 20 25 30Tyr Asn Tyr His Leu Asp Ser Ser Gly Ser Tyr Val Phe Glu Asn Thr 35 40 45Val Ala Thr Val Met Ala Leu Arg Arg Glu Lys Met Phe Val Glu Glu 50 55 60Val Ser Thr Gly Gln Glu Cys Gly Val Val Leu Asp Lys Thr Cys Phe65 70 75 80Tyr Ala Glu Gln Gly Gly Gln Ile Tyr Asp Glu Gly Tyr Leu Val Lys 85 90 95Val Asp Asp Ser Ser Glu Asp Lys Thr Glu Phe Thr Val Lys Asn Ala 100 105 110Gln Val Arg Gly Gly Tyr Val Leu His Ile Gly Thr Ile Tyr Gly Asp 115 120 125Leu Lys Val Gly Asp Gln Val Trp Leu Phe Ile Asp Glu Pro Arg Arg 130 135 140Arg Pro Ile Met Ser Asn His Thr Ala Thr His Ile Leu Asn Phe Ala145 150 155 160Leu Arg Ser Val Leu Gly Glu Ala Asp Gln Lys Gly Ser Leu Val Ala 165 170 175Pro Asp Arg Leu Arg Phe Asp Phe Thr Ala Lys Gly Ala Met Ser Thr 180 185 190Gln Gln Ile Lys Lys Ala Glu Glu Ile Ala Asn Glu Met Ile Glu Ala 195 200 205Ala Lys Ala Val Tyr Thr Gln Asp Cys Pro Leu Ala Ala Ala Lys Ala 210 215 220Ile Gln Gly Leu Arg Ala Val Phe Asp Glu Thr Tyr Pro Asp Pro Val225 230 235 240Arg Val Val Ser Ile Gly Val Pro Val Ser Glu Leu Leu Asp Asp Pro 245 250 255Ser Gly Pro Ala Gly Ser Leu Thr Ser Val Glu Phe Cys Gly Gly Thr 260 265 270His Leu Arg Asn Ser Ser His Ala Gly Ala Phe Val Ile Val Thr Glu 275 280 285Glu Ala Ile Ala Lys Gly Ile Arg Arg Ile Val Ala Val Thr Gly Ala 290 295 300Glu Ala Gln Lys Ala Leu Arg Lys Ala Glu Ser Leu Lys Lys Cys Leu305 310 315 320Ser Val Met Glu Ala Lys Val Lys Ala Gln Thr Ala Pro Asn Lys Asp 325 330 335Val Gln Arg Glu Ile Ala Asp Leu Gly Glu Ala Leu Ala Thr Ala Val 340 345 350Ile Pro Gln Trp Gln Lys Asp Glu Leu Arg Glu Thr Leu Lys Ser Leu 355 360 365Lys Lys Val Met Asp Asp Leu Asp Arg Ala Ser Lys Ala Asp Val Gln 370 375 380Lys Arg Val Leu Glu Lys Thr Lys Gln Phe Ile Asp Ser Asn Pro Asn385 390 395 400Gln Pro Leu Val Ile Leu Glu Met Glu Ser Gly Ala Ser Ala Lys Ala 405 410 415Leu Asn Glu Ala Leu Lys Leu Phe Lys Met His Ser Pro Gln Thr Ser 420 425 430Ala Met Leu Phe Thr Val Asp Asn Glu Ala Gly Lys Ile Thr Cys Leu 435 440 445Cys Gln Val Pro Gln Asn Ala Ala Asn Arg Gly Leu Lys Ala Ser Glu 450 455 460Trp Val Gln Gln Val Ser Gly Leu Met Asp Gly Lys Gly Gly Gly Lys465 470 475 480Asp Val Ser Ala Gln Ala Thr Gly Lys Asn Val Gly Cys Leu Gln Glu 485 490 495Ala Leu Gln Leu Ala Thr Ser Phe Ala Gln Leu Arg Leu Gly Asp Val 500 505 510Lys Asn147514PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with C-terminal 6xHis affinity tag 147Met Arg Gly Leu Glu Val Thr Asp Asp Ser Pro Lys Tyr Asn Tyr His1 5 10 15Leu Asp Ser Ser Gly Ser Tyr Val Phe Glu Asn Thr Val Ala Thr Val 20 25 30Met Ala Leu Arg Arg Glu Lys Met Phe Val Glu Glu Val Ser Thr Gly 35 40 45Gln Glu Cys Gly Val Val Leu Asp Lys Thr Cys Phe Tyr Ala Glu Gln 50 55 60Gly Gly Gln Ile Tyr Asp Glu Gly Tyr Leu Val Lys Val Asp Asp Ser65 70 75 80Ser Glu Asp Lys Thr Glu Phe Thr Val Lys Asn Ala Gln Val Arg Gly 85 90 95Gly Tyr Val Leu His Ile Gly Thr Ile Tyr Gly Asp Leu Lys Val Gly 100 105 110Asp Gln Val Trp Leu Phe Ile Asp Glu Pro Arg Arg Arg Pro Ile Met 115 120 125Ser Asn His Thr Ala Thr His Ile Leu Asn Phe Ala Leu Arg Ser Val 130 135 140Leu Gly Glu Ala Asp Gln Lys Gly Ser Leu Val Ala Pro Asp Arg Leu145 150 155 160Arg Phe Asp Phe Thr Ala Lys Gly Ala Met Ser Thr Gln Gln Ile Lys 165 170 175Lys Ala Glu Glu Ile Ala Asn Glu Met Ile Glu Ala Ala Lys Ala Val 180 185 190Tyr Thr Gln Asp Cys Pro Leu Ala Ala Ala Lys Ala Ile Gln Gly Leu 195 200 205Arg Ala Val Phe Asp Glu Thr Tyr Pro Asp Pro Val Arg Val Val Ser 210 215 220Ile Gly Val Pro Val Ser Glu Leu Leu Asp Asp Pro Ser Gly Pro Ala225 230 235 240Gly Ser Leu Thr Ser Val Glu Phe Cys Gly Gly Thr His Leu Arg Asn 245 250 255Ser Ser His Ala Gly Ala Phe Val Ile Val Thr Glu Glu Ala Ile Ala 260 265 270Lys Gly Ile Arg Arg Ile Val Ala Val Thr Gly Ala Glu Ala Gln Lys 275 280 285Ala Leu Arg Lys Ala Glu Ser Leu Lys Lys Cys Leu Ser Val Met Glu 290 295 300Ala Lys Val Lys Ala Gln Thr Ala Pro Asn Lys Asp Val Gln Arg Glu305 310 315 320Ile Ala Asp Leu Gly Glu Ala Leu Ala Thr Ala Val Ile Pro Gln Trp 325 330 335Gln Lys Asp Glu Leu Arg Glu Thr Leu Lys Ser Leu Lys Lys Val Met 340 345 350Asp Asp Leu Asp Arg Ala Ser Lys Ala Asp Val Gln Lys Arg Val Leu 355 360 365Glu Lys Thr Lys Gln Phe Ile Asp Ser Asn Pro Asn Gln Pro Leu Val 370 375 380Ile Leu Glu Met Glu Ser Gly Ala Ser Ala Lys Ala Leu Asn Glu Ala385 390 395 400Leu Lys Leu Phe Lys Met His Ser Pro Gln Thr Ser Ala Met Leu Phe 405 410 415Thr Val Asp Asn Glu Ala Gly Lys Ile Thr Cys Leu Cys Gln Val Pro 420 425 430Gln Asn Ala Ala Asn Arg Gly Leu Lys Ala Ser Glu Trp Val Gln Gln 435 440 445Val Ser Gly Leu Met Asp Gly Lys Gly Gly Gly Lys Asp Val Ser Ala 450 455 460Gln Ala Thr Gly Lys Asn Val Gly Cys Leu Gln Glu Ala Leu Gln Leu465 470 475 480Ala Thr Ser Phe Ala Gln Leu Arg Leu Gly Asp Val Lys Asn Gly Lys 485 490 495Pro Ile Pro Asn Pro Leu Leu Gly Leu Asp Ser Thr His His His His 500 505 510His His148236PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with N-terminal 6xHis affinity tag 148Met His His His His His His Gly Lys Pro Ile Pro Asn Pro Leu Leu1 5 10 15Gly Leu Asp Ser Thr Gly Ser Ala Glu Ala Gln Lys Ala Leu Arg Lys 20 25 30Ala Glu Ser Leu Lys Lys Cys Leu Ser Val Met Glu Ala Lys Val Lys 35 40 45Ala Gln Thr Ala Pro Asn Lys Asp Val Gln Arg Glu Ile Ala Asp Leu 50 55 60Gly Glu Ala Leu Ala Thr Ala Val Ile Pro Gln Trp Gln Lys Asp Glu65 70 75 80Leu Arg Glu Thr Leu Lys Ser Leu Lys Lys Val Met Asp Asp Leu Asp 85 90 95Arg Ala Ser Lys Ala Asp Val Gln Lys Arg Val Leu Glu Lys Thr Lys 100 105 110Gln Phe Ile Asp Ser Asn Pro Asn Gln Pro Leu Val Ile Leu Glu Met 115 120 125Glu Ser Gly Ala Ser Ala Lys Ala Leu Asn Glu Ala Leu Lys Leu Phe 130 135 140Lys Met His Ser Pro Gln Thr Ser Ala Met Leu Phe Thr Val Asp Asn145 150 155 160Glu Ala Gly Lys Ile Thr Cys Leu Cys Gln Val Pro Gln Asn Ala Ala 165 170 175Asn Arg Gly Leu Lys Ala Ser Glu Trp Val Gln Gln Val Ser Gly Leu 180 185 190Met Asp Gly Lys Gly Gly Gly Lys Asp Val Ser Ala Gln Ala Thr Gly 195 200 205Lys Asn Val Gly Cys Leu Gln Glu Ala Leu Gln Leu Ala Thr Ser Phe 210 215 220Ala Gln Leu Arg Leu Gly Asp Val Lys Asn Leu Glu225 230 235149236PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with C-terminal 6xHis affinity tag 149Met Gly Ser Ala Glu Ala Gln Lys Ala Leu Arg Lys Ala Glu Ser Leu1 5 10 15Lys Lys Cys Leu Ser Val Met Glu Ala Lys Val Lys Ala Gln Thr Ala 20 25 30Pro Asn Lys Asp Val Gln Arg Glu Ile Ala Asp Leu Gly Glu Ala Leu 35 40 45Ala Thr Ala Val Ile Pro Gln Trp Gln Lys Asp Glu Leu Arg Glu Thr 50 55 60Leu Lys Ser Leu Lys Lys Val Met Asp Asp Leu Asp Arg Ala Ser Lys65 70 75 80Ala Asp Val Gln Lys Arg Val Leu Glu Lys Thr Lys Gln Phe Ile Asp 85 90 95Ser Asn Pro Asn Gln Pro Leu Val Ile Leu Glu Met Glu Ser Gly Ala 100 105 110Ser Ala Lys Ala Leu Asn Glu Ala Leu Lys Leu Phe Lys Met His Ser 115 120 125Pro Gln Thr Ser Ala Met Leu Phe Thr Val Asp Asn Glu Ala Gly Lys 130 135 140Ile Thr Cys Leu Cys Gln Val Pro Gln Asn Ala Ala Asn Arg Gly Leu145 150 155 160Lys Ala Ser Glu Trp Val Gln Gln Val Ser Gly Leu Met Asp Gly Lys 165 170 175Gly Gly Gly Lys Asp Val Ser Ala Gln Ala Thr Gly Lys Asn Val Gly 180 185 190Cys Leu Gln Glu Ala Leu Gln Leu Ala Thr Ser Phe Ala Gln Leu Arg 195 200 205Leu Gly Asp Val Lys Asn Leu Glu Gly Lys Pro Ile Pro Asn Pro Leu 210 215 220Leu Gly Leu Asp Ser Thr His His His His His His225 230 235150402PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with N-terminal 6xHis affinity tag 150Met His His His His His His Gly Lys Pro Ile Pro Asn Pro Leu Leu1 5 10 15Gly Leu Asp Ser Thr Gln Val Trp Leu Phe Ile Asp Glu Pro Arg Arg 20 25 30Arg Pro Ile Met Ser Asn His Thr Ala Thr His Ile Leu Asn Phe Ala 35 40 45Leu Arg Ser Val Leu Gly Glu Ala Asp Gln Lys Gly Ser Leu Val Ala 50 55 60Pro Asp Arg Leu Arg Phe Asp Phe Thr Ala Lys Gly Ala Met Ser Thr65 70 75 80Gln Gln Ile Lys Lys Ala Glu Glu Ile Ala Asn Glu Met Ile Glu Ala 85 90 95Ala Lys Ala Val Tyr Thr Gln Asp Cys Pro Leu Ala Ala Ala Lys Ala 100 105 110Ile Gln Gly Leu Arg Ala Val Phe Asp Glu Thr Tyr Pro Asp Pro Val 115 120 125Arg Val Val Ser Ile Gly Val Pro Val Ser Glu Leu Leu Asp Asp Pro 130 135 140Ser Gly Pro Ala Gly Ser Leu Thr Ser Val Glu Phe Cys Gly Gly Thr145 150 155 160His Leu Arg Asn Ser Ser His Ala Gly Ala Phe Val Ile Val Thr Glu 165 170 175Glu Ala Ile Ala Lys Gly Ile Arg Arg Ile Val Ala Val Thr Gly Ala 180 185 190Glu Ala Gln Lys Ala Leu Arg Lys Ala Glu Ser Leu Lys Lys Cys Leu 195 200 205Ser Val Met Glu Ala Lys Val Lys Ala Gln Thr Ala Pro Asn Lys Asp 210 215 220Val Gln Arg Glu Ile Ala Asp Leu Gly Glu Ala Leu Ala Thr Ala Val225 230 235 240Ile Pro Gln Trp Gln Lys Asp Glu Leu Arg Glu Thr Leu Lys Ser Leu 245 250 255Lys Lys Val Met Asp Asp Leu Asp Arg Ala Ser Lys Ala Asp Val Gln 260 265 270Lys Arg Val Leu Glu Lys Thr Lys Gln Phe Ile Asp Ser Asn Pro Asn 275 280 285Gln Pro Leu Val Ile Leu Glu Met Glu Ser Gly Ala Ser Ala Lys Ala 290 295 300Leu Asn Glu Ala Leu Lys Leu Phe Lys Met His Ser Pro Gln Thr Ser305 310 315 320Ala Met Leu Phe Thr Val Asp Asn Glu Ala Gly Lys Ile Thr Cys Leu 325 330 335Cys Gln Val Pro Gln Asn Ala Ala Asn Arg Gly Leu Lys Ala Ser Glu 340 345 350Trp Val Gln Gln Val Ser Gly Leu Met Asp Gly Lys Gly Gly Gly Lys 355 360 365Asp Val Ser Ala Gln Ala Thr Gly Lys Asn Val Gly Cys Leu Gln Glu 370 375 380Ala Leu Gln Leu Ala Thr Ser Phe Ala Gln Leu Arg Leu Gly Asp Val385 390 395 400Lys Asn151402PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with C-terminal 6xHis affinity tag 151Met Gln Val Trp Leu Phe Ile Asp Glu Pro Arg Arg Arg Pro Ile Met1 5 10 15Ser Asn His Thr Ala Thr His Ile Leu Asn Phe Ala Leu Arg Ser Val 20 25 30Leu Gly Glu Ala Asp Gln Lys Gly Ser Leu Val Ala Pro Asp Arg Leu 35 40 45Arg Phe Asp Phe Thr Ala Lys Gly Ala Met Ser Thr Gln Gln Ile Lys 50 55 60Lys Ala Glu Glu Ile Ala Asn Glu Met Ile Glu Ala Ala Lys Ala Val65 70 75 80Tyr Thr Gln Asp Cys Pro Leu Ala Ala Ala Lys Ala Ile Gln Gly Leu 85 90 95Arg Ala Val Phe Asp Glu Thr Tyr Pro Asp Pro Val Arg Val Val Ser 100 105 110Ile Gly Val Pro Val Ser Glu Leu Leu Asp Asp Pro Ser Gly Pro Ala 115 120 125Gly Ser Leu Thr Ser Val Glu Phe Cys Gly Gly Thr His Leu Arg Asn 130 135 140Ser Ser His Ala Gly Ala Phe Val Ile Val Thr Glu Glu Ala Ile Ala145 150 155 160Lys Gly Ile Arg Arg Ile Val Ala Val Thr Gly Ala Glu Ala Gln Lys 165 170 175Ala Leu Arg Lys Ala Glu Ser Leu Lys Lys Cys Leu Ser Val Met Glu 180 185

190Ala Lys Val Lys Ala Gln Thr Ala Pro Asn Lys Asp Val Gln Arg Glu 195 200 205Ile Ala Asp Leu Gly Glu Ala Leu Ala Thr Ala Val Ile Pro Gln Trp 210 215 220Gln Lys Asp Glu Leu Arg Glu Thr Leu Lys Ser Leu Lys Lys Val Met225 230 235 240Asp Asp Leu Asp Arg Ala Ser Lys Ala Asp Val Gln Lys Arg Val Leu 245 250 255Glu Lys Thr Lys Gln Phe Ile Asp Ser Asn Pro Asn Gln Pro Leu Val 260 265 270Ile Leu Glu Met Glu Ser Gly Ala Ser Ala Lys Ala Leu Asn Glu Ala 275 280 285Leu Lys Leu Phe Lys Met His Ser Pro Gln Thr Ser Ala Met Leu Phe 290 295 300Thr Val Asp Asn Glu Ala Gly Lys Ile Thr Cys Leu Cys Gln Val Pro305 310 315 320Gln Asn Ala Ala Asn Arg Gly Leu Lys Ala Ser Glu Trp Val Gln Gln 325 330 335Val Ser Gly Leu Met Asp Gly Lys Gly Gly Gly Lys Asp Val Ser Ala 340 345 350Gln Ala Thr Gly Lys Asn Val Gly Cys Leu Gln Glu Ala Leu Gln Leu 355 360 365Ala Thr Ser Phe Ala Gln Leu Arg Leu Gly Asp Val Lys Asn Gly Lys 370 375 380Pro Ile Pro Asn Pro Leu Leu Gly Leu Asp Ser Thr His His His His385 390 395 400His His152330PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with N-terminal 6xHis affinity tag (DNA2.0) 152Met His His His His His His Gly Lys Pro Ile Pro Asn Pro Leu Leu1 5 10 15Gly Leu Asp Ser Thr Ile Glu Ala Ala Lys Ala Val Tyr Thr Gln Asp 20 25 30Cys Pro Leu Ala Ala Ala Lys Ala Ile Gln Gly Leu Arg Ala Val Phe 35 40 45Asp Glu Thr Tyr Pro Asp Pro Val Arg Val Val Ser Ile Gly Val Pro 50 55 60Val Ser Glu Leu Leu Asp Asp Pro Ser Gly Pro Ala Gly Ser Leu Thr65 70 75 80Ser Val Glu Phe Cys Gly Gly Thr His Leu Arg Asn Ser Ser His Ala 85 90 95Gly Ala Phe Val Ile Val Thr Glu Glu Ala Ile Ala Lys Gly Ile Arg 100 105 110Arg Ile Val Ala Val Thr Gly Ala Glu Ala Gln Lys Ala Leu Arg Lys 115 120 125Ala Glu Ser Leu Lys Lys Cys Leu Ser Val Met Glu Ala Lys Val Lys 130 135 140Ala Gln Thr Ala Pro Asn Lys Asp Val Gln Arg Glu Ile Ala Asp Leu145 150 155 160Gly Glu Ala Leu Ala Thr Ala Val Ile Pro Gln Trp Gln Lys Asp Glu 165 170 175Leu Arg Glu Thr Leu Lys Ser Leu Lys Lys Val Met Asp Asp Leu Asp 180 185 190Arg Ala Ser Lys Ala Asp Val Gln Lys Arg Val Leu Glu Lys Thr Lys 195 200 205Gln Phe Ile Asp Ser Asn Pro Asn Gln Pro Leu Val Ile Leu Glu Met 210 215 220Glu Ser Gly Ala Ser Ala Lys Ala Leu Asn Glu Ala Leu Lys Leu Phe225 230 235 240Lys Met His Ser Pro Gln Thr Ser Ala Met Leu Phe Thr Val Asp Asn 245 250 255Glu Ala Gly Lys Ile Thr Cys Leu Cys Gln Val Pro Gln Asn Ala Ala 260 265 270Asn Arg Gly Leu Lys Ala Ser Glu Trp Val Gln Gln Val Ser Gly Leu 275 280 285Met Asp Gly Lys Gly Gly Gly Lys Asp Val Ser Ala Gln Ala Thr Gly 290 295 300Lys Asn Val Gly Cys Leu Gln Glu Ala Leu Gln Leu Ala Thr Ser Phe305 310 315 320Ala Gln Leu Arg Leu Gly Asp Val Lys Asn 325 330153330PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with C-terminal 6xHis affinity tag (DNA2.0) 153Met Ile Glu Ala Ala Lys Ala Val Tyr Thr Gln Asp Cys Pro Leu Ala1 5 10 15Ala Ala Lys Ala Ile Gln Gly Leu Arg Ala Val Phe Asp Glu Thr Tyr 20 25 30Pro Asp Pro Val Arg Val Val Ser Ile Gly Val Pro Val Ser Glu Leu 35 40 45Leu Asp Asp Pro Ser Gly Pro Ala Gly Ser Leu Thr Ser Val Glu Phe 50 55 60Cys Gly Gly Thr His Leu Arg Asn Ser Ser His Ala Gly Ala Phe Val65 70 75 80Ile Val Thr Glu Glu Ala Ile Ala Lys Gly Ile Arg Arg Ile Val Ala 85 90 95Val Thr Gly Ala Glu Ala Gln Lys Ala Leu Arg Lys Ala Glu Ser Leu 100 105 110Lys Lys Cys Leu Ser Val Met Glu Ala Lys Val Lys Ala Gln Thr Ala 115 120 125Pro Asn Lys Asp Val Gln Arg Glu Ile Ala Asp Leu Gly Glu Ala Leu 130 135 140Ala Thr Ala Val Ile Pro Gln Trp Gln Lys Asp Glu Leu Arg Glu Thr145 150 155 160Leu Lys Ser Leu Lys Lys Val Met Asp Asp Leu Asp Arg Ala Ser Lys 165 170 175Ala Asp Val Gln Lys Arg Val Leu Glu Lys Thr Lys Gln Phe Ile Asp 180 185 190Ser Asn Pro Asn Gln Pro Leu Val Ile Leu Glu Met Glu Ser Gly Ala 195 200 205Ser Ala Lys Ala Leu Asn Glu Ala Leu Lys Leu Phe Lys Met His Ser 210 215 220Pro Gln Thr Ser Ala Met Leu Phe Thr Val Asp Asn Glu Ala Gly Lys225 230 235 240Ile Thr Cys Leu Cys Gln Val Pro Gln Asn Ala Ala Asn Arg Gly Leu 245 250 255Lys Ala Ser Glu Trp Val Gln Gln Val Ser Gly Leu Met Asp Gly Lys 260 265 270Gly Gly Gly Lys Asp Val Ser Ala Gln Ala Thr Gly Lys Asn Val Gly 275 280 285Cys Leu Gln Glu Ala Leu Gln Leu Ala Thr Ser Phe Ala Gln Leu Arg 290 295 300Leu Gly Asp Val Lys Asn Gly Lys Pro Ile Pro Asn Pro Leu Leu Gly305 310 315 320Leu Asp Ser Thr His His His His His His 325 330154299PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with N-terminal 6xHis affinity tag 154Met His His His His His His Gly Lys Pro Ile Pro Asn Pro Leu Leu1 5 10 15Gly Leu Asp Ser Thr Pro Asp Pro Val Arg Val Val Ser Ile Gly Val 20 25 30Pro Val Ser Glu Leu Leu Asp Asp Pro Ser Gly Pro Ala Gly Ser Leu 35 40 45Thr Ser Val Glu Phe Cys Gly Gly Thr His Leu Arg Asn Ser Ser His 50 55 60Ala Gly Ala Phe Val Ile Val Thr Glu Glu Ala Ile Ala Lys Gly Ile65 70 75 80Arg Arg Ile Val Ala Val Thr Gly Ala Glu Ala Gln Lys Ala Leu Arg 85 90 95Lys Ala Glu Ser Leu Lys Lys Cys Leu Ser Val Met Glu Ala Lys Val 100 105 110Lys Ala Gln Thr Ala Pro Asn Lys Asp Val Gln Arg Glu Ile Ala Asp 115 120 125Leu Gly Glu Ala Leu Ala Thr Ala Val Ile Pro Gln Trp Gln Lys Asp 130 135 140Glu Leu Arg Glu Thr Leu Lys Ser Leu Lys Lys Val Met Asp Asp Leu145 150 155 160Asp Arg Ala Ser Lys Ala Asp Val Gln Lys Arg Val Leu Glu Lys Thr 165 170 175Lys Gln Phe Ile Asp Ser Asn Pro Asn Gln Pro Leu Val Ile Leu Glu 180 185 190Met Glu Ser Gly Ala Ser Ala Lys Ala Leu Asn Glu Ala Leu Lys Leu 195 200 205Phe Lys Met His Ser Pro Gln Thr Ser Ala Met Leu Phe Thr Val Asp 210 215 220Asn Glu Ala Gly Lys Ile Thr Cys Leu Cys Gln Val Pro Gln Asn Ala225 230 235 240Ala Asn Arg Gly Leu Lys Ala Ser Glu Trp Val Gln Gln Val Ser Gly 245 250 255Leu Met Asp Gly Lys Gly Gly Gly Lys Asp Val Ser Ala Gln Ala Thr 260 265 270Gly Lys Asn Val Gly Cys Leu Gln Glu Ala Leu Gln Leu Ala Thr Ser 275 280 285Phe Ala Gln Leu Arg Leu Gly Asp Val Lys Asn 290 295155299PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with C-terminal 6xHis affinity tag 155Met Pro Asp Pro Val Arg Val Val Ser Ile Gly Val Pro Val Ser Glu1 5 10 15Leu Leu Asp Asp Pro Ser Gly Pro Ala Gly Ser Leu Thr Ser Val Glu 20 25 30Phe Cys Gly Gly Thr His Leu Arg Asn Ser Ser His Ala Gly Ala Phe 35 40 45Val Ile Val Thr Glu Glu Ala Ile Ala Lys Gly Ile Arg Arg Ile Val 50 55 60Ala Val Thr Gly Ala Glu Ala Gln Lys Ala Leu Arg Lys Ala Glu Ser65 70 75 80Leu Lys Lys Cys Leu Ser Val Met Glu Ala Lys Val Lys Ala Gln Thr 85 90 95Ala Pro Asn Lys Asp Val Gln Arg Glu Ile Ala Asp Leu Gly Glu Ala 100 105 110Leu Ala Thr Ala Val Ile Pro Gln Trp Gln Lys Asp Glu Leu Arg Glu 115 120 125Thr Leu Lys Ser Leu Lys Lys Val Met Asp Asp Leu Asp Arg Ala Ser 130 135 140Lys Ala Asp Val Gln Lys Arg Val Leu Glu Lys Thr Lys Gln Phe Ile145 150 155 160Asp Ser Asn Pro Asn Gln Pro Leu Val Ile Leu Glu Met Glu Ser Gly 165 170 175Ala Ser Ala Lys Ala Leu Asn Glu Ala Leu Lys Leu Phe Lys Met His 180 185 190Ser Pro Gln Thr Ser Ala Met Leu Phe Thr Val Asp Asn Glu Ala Gly 195 200 205Lys Ile Thr Cys Leu Cys Gln Val Pro Gln Asn Ala Ala Asn Arg Gly 210 215 220Leu Lys Ala Ser Glu Trp Val Gln Gln Val Ser Gly Leu Met Asp Gly225 230 235 240Lys Gly Gly Gly Lys Asp Val Ser Ala Gln Ala Thr Gly Lys Asn Val 245 250 255Gly Cys Leu Gln Glu Ala Leu Gln Leu Ala Thr Ser Phe Ala Gln Leu 260 265 270Arg Leu Gly Asp Val Lys Asn Gly Lys Pro Ile Pro Asn Pro Leu Leu 275 280 285Gly Leu Asp Ser Thr His His His His His His 290 295156247PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with N-terminal 6xHis affinity tag 156Met His His His His His His Gly Lys Pro Ile Pro Asn Pro Leu Leu1 5 10 15Gly Leu Asp Ser Thr Gly Ser Lys Gly Ile Arg Arg Ile Val Ala Val 20 25 30Thr Gly Ala Glu Ala Gln Lys Ala Leu Arg Lys Ala Glu Ser Leu Lys 35 40 45Lys Cys Leu Ser Val Met Glu Ala Lys Val Lys Ala Gln Thr Ala Pro 50 55 60Asn Lys Asp Val Gln Arg Glu Ile Ala Asp Leu Gly Glu Ala Leu Ala65 70 75 80Thr Ala Val Ile Pro Gln Trp Gln Lys Asp Glu Leu Arg Glu Thr Leu 85 90 95Lys Ser Leu Lys Lys Val Met Asp Asp Leu Asp Arg Ala Ser Lys Ala 100 105 110Asp Val Gln Lys Arg Val Leu Glu Lys Thr Lys Gln Phe Ile Asp Ser 115 120 125Asn Pro Asn Gln Pro Leu Val Ile Leu Glu Met Glu Ser Gly Ala Ser 130 135 140Ala Lys Ala Leu Asn Glu Ala Leu Lys Leu Phe Lys Met His Ser Pro145 150 155 160Gln Thr Ser Ala Met Leu Phe Thr Val Asp Asn Glu Ala Gly Lys Ile 165 170 175Thr Cys Leu Cys Gln Val Pro Gln Asn Ala Ala Asn Arg Gly Leu Lys 180 185 190Ala Ser Glu Trp Val Gln Gln Val Ser Gly Leu Met Asp Gly Lys Gly 195 200 205Gly Gly Lys Asp Val Ser Ala Gln Ala Thr Gly Lys Asn Val Gly Cys 210 215 220Leu Gln Glu Ala Leu Gln Leu Ala Thr Ser Phe Ala Gln Leu Arg Leu225 230 235 240Gly Asp Val Lys Asn Leu Glu 245157247PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with C-terminal 6xHis affinity tag 157Met Gly Ser Lys Gly Ile Arg Arg Ile Val Ala Val Thr Gly Ala Glu1 5 10 15Ala Gln Lys Ala Leu Arg Lys Ala Glu Ser Leu Lys Lys Cys Leu Ser 20 25 30Val Met Glu Ala Lys Val Lys Ala Gln Thr Ala Pro Asn Lys Asp Val 35 40 45Gln Arg Glu Ile Ala Asp Leu Gly Glu Ala Leu Ala Thr Ala Val Ile 50 55 60Pro Gln Trp Gln Lys Asp Glu Leu Arg Glu Thr Leu Lys Ser Leu Lys65 70 75 80Lys Val Met Asp Asp Leu Asp Arg Ala Ser Lys Ala Asp Val Gln Lys 85 90 95Arg Val Leu Glu Lys Thr Lys Gln Phe Ile Asp Ser Asn Pro Asn Gln 100 105 110Pro Leu Val Ile Leu Glu Met Glu Ser Gly Ala Ser Ala Lys Ala Leu 115 120 125Asn Glu Ala Leu Lys Leu Phe Lys Met His Ser Pro Gln Thr Ser Ala 130 135 140Met Leu Phe Thr Val Asp Asn Glu Ala Gly Lys Ile Thr Cys Leu Cys145 150 155 160Gln Val Pro Gln Asn Ala Ala Asn Arg Gly Leu Lys Ala Ser Glu Trp 165 170 175Val Gln Gln Val Ser Gly Leu Met Asp Gly Lys Gly Gly Gly Lys Asp 180 185 190Val Ser Ala Gln Ala Thr Gly Lys Asn Val Gly Cys Leu Gln Glu Ala 195 200 205Leu Gln Leu Ala Thr Ser Phe Ala Gln Leu Arg Leu Gly Asp Val Lys 210 215 220Asn Leu Glu Gly Lys Pro Ile Pro Asn Pro Leu Leu Gly Leu Asp Ser225 230 235 240Thr His His His His His His 245158134PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with N-terminal 6xHis affinity tag 158Met His His His His His His Gly Lys Pro Ile Pro Asn Pro Leu Leu1 5 10 15Gly Leu Asp Ser Thr Pro Leu Val Ile Leu Glu Met Glu Ser Gly Ala 20 25 30Ser Ala Lys Ala Leu Asn Glu Ala Leu Lys Leu Phe Lys Met His Ser 35 40 45Pro Gln Thr Ser Ala Met Leu Phe Thr Val Asp Asn Glu Ala Gly Lys 50 55 60Ile Thr Cys Leu Cys Gln Val Pro Gln Asn Ala Ala Asn Arg Gly Leu65 70 75 80Lys Ala Ser Glu Trp Val Gln Gln Val Ser Gly Leu Met Asp Gly Lys 85 90 95Gly Gly Gly Lys Asp Val Ser Ala Gln Ala Thr Gly Lys Asn Val Gly 100 105 110Cys Leu Gln Glu Ala Leu Gln Leu Ala Thr Ser Phe Ala Gln Leu Arg 115 120 125Leu Gly Asp Val Lys Asn 130159134PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with C-terminal 6xHis affinity tag 159Met Pro Leu Val Ile Leu Glu Met Glu Ser Gly Ala Ser Ala Lys Ala1 5 10 15Leu Asn Glu Ala Leu Lys Leu Phe Lys Met His Ser Pro Gln Thr Ser 20 25 30Ala Met Leu Phe Thr Val Asp Asn Glu Ala Gly Lys Ile Thr Cys Leu 35 40 45Cys Gln Val Pro Gln Asn Ala Ala Asn Arg Gly Leu Lys Ala Ser Glu 50 55 60Trp Val Gln Gln Val Ser Gly Leu Met Asp Gly Lys Gly Gly Gly Lys65 70 75 80Asp Val Ser Ala Gln Ala Thr Gly Lys Asn Val Gly Cys Leu Gln Glu 85 90 95Ala Leu Gln Leu Ala Thr Ser Phe Ala Gln Leu Arg Leu Gly Asp Val 100 105 110Lys Asn Gly Lys Pro Ile Pro Asn Pro Leu Leu Gly Leu Asp Ser Thr 115 120 125His His His His His His 130160451PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with N-terminal 6xHis affinity tag 160Met His His His His His His Gly Lys Pro Ile Pro Asn Pro Leu Leu1 5 10 15Gly Leu Asp Ser Thr Gly Ser Ile Pro Gln Ser Thr Ile Thr Ile Trp 20 25 30Thr Pro Val Val Ala Met Lys Thr Glu Phe Thr Val Lys Asn Ala Gln 35 40 45Val Arg Gly Gly Tyr Val Leu His Ile Gly Thr Ile Tyr Gly Asp Leu 50 55 60Lys Val Gly Asp Gln Val Trp Leu Phe Ile Asp Glu Pro Arg Arg Arg65 70 75 80Pro Ile Met Ser Asn His Thr Ala Thr His Ile Leu Asn Phe Ala Leu 85 90 95Arg Ser Val Leu Gly Glu Ala Asp Gln Lys Gly Ser Leu Val Ala Pro 100 105 110Asp Arg Leu Arg Phe Asp Phe Thr Ala Lys Gly Ala Met Ser Thr Gln 115

120 125Gln Ile Lys Lys Ala Glu Glu Ile Ala Asn Glu Met Ile Glu Ala Ala 130 135 140Lys Ala Val Tyr Thr Gln Asp Cys Pro Leu Ala Ala Ala Lys Ala Ile145 150 155 160Gln Gly Leu Arg Ala Val Phe Asp Glu Thr Tyr Pro Asp Pro Val Arg 165 170 175Val Val Ser Ile Gly Val Pro Val Ser Glu Leu Leu Asp Asp Pro Ser 180 185 190Gly Pro Ala Gly Ser Leu Thr Ser Val Glu Phe Cys Gly Gly Thr His 195 200 205Leu Arg Asn Ser Ser His Ala Gly Ala Phe Val Ile Val Thr Glu Glu 210 215 220Ala Ile Ala Lys Gly Ile Arg Arg Ile Val Ala Val Thr Gly Ala Glu225 230 235 240Ala Gln Lys Ala Leu Arg Lys Ala Glu Ser Leu Lys Lys Cys Leu Ser 245 250 255Val Met Glu Ala Lys Val Lys Ala Gln Thr Ala Pro Asn Lys Asp Val 260 265 270Gln Arg Glu Ile Ala Asp Leu Gly Glu Ala Leu Ala Thr Ala Val Ile 275 280 285Pro Gln Trp Gln Lys Asp Glu Leu Arg Glu Thr Leu Lys Ser Leu Lys 290 295 300Lys Val Met Asp Asp Leu Asp Arg Ala Ser Lys Ala Asp Val Gln Lys305 310 315 320Arg Val Leu Glu Lys Thr Lys Gln Phe Ile Asp Ser Asn Pro Asn Gln 325 330 335Pro Leu Val Ile Leu Glu Met Glu Ser Gly Ala Ser Ala Lys Ala Leu 340 345 350Asn Glu Ala Leu Lys Leu Phe Lys Met His Ser Pro Gln Thr Ser Ala 355 360 365Met Leu Phe Thr Val Asp Asn Glu Ala Gly Lys Ile Thr Cys Leu Cys 370 375 380Gln Val Pro Gln Asn Ala Ala Asn Arg Gly Leu Lys Ala Ser Glu Trp385 390 395 400Val Gln Gln Val Ser Gly Leu Met Asp Gly Lys Gly Gly Gly Lys Asp 405 410 415Val Ser Ala Gln Ala Thr Gly Lys Asn Val Gly Cys Leu Gln Glu Ala 420 425 430Leu Gln Leu Ala Thr Ser Phe Ala Gln Leu Arg Leu Gly Asp Val Lys 435 440 445Asn Leu Glu 450161451PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with C-terminal 6xHis affinity tag 161Met Gly Ser Ile Pro Gln Ser Thr Ile Thr Ile Trp Thr Pro Val Val1 5 10 15Ala Met Lys Thr Glu Phe Thr Val Lys Asn Ala Gln Val Arg Gly Gly 20 25 30Tyr Val Leu His Ile Gly Thr Ile Tyr Gly Asp Leu Lys Val Gly Asp 35 40 45Gln Val Trp Leu Phe Ile Asp Glu Pro Arg Arg Arg Pro Ile Met Ser 50 55 60Asn His Thr Ala Thr His Ile Leu Asn Phe Ala Leu Arg Ser Val Leu65 70 75 80Gly Glu Ala Asp Gln Lys Gly Ser Leu Val Ala Pro Asp Arg Leu Arg 85 90 95Phe Asp Phe Thr Ala Lys Gly Ala Met Ser Thr Gln Gln Ile Lys Lys 100 105 110Ala Glu Glu Ile Ala Asn Glu Met Ile Glu Ala Ala Lys Ala Val Tyr 115 120 125Thr Gln Asp Cys Pro Leu Ala Ala Ala Lys Ala Ile Gln Gly Leu Arg 130 135 140Ala Val Phe Asp Glu Thr Tyr Pro Asp Pro Val Arg Val Val Ser Ile145 150 155 160Gly Val Pro Val Ser Glu Leu Leu Asp Asp Pro Ser Gly Pro Ala Gly 165 170 175Ser Leu Thr Ser Val Glu Phe Cys Gly Gly Thr His Leu Arg Asn Ser 180 185 190Ser His Ala Gly Ala Phe Val Ile Val Thr Glu Glu Ala Ile Ala Lys 195 200 205Gly Ile Arg Arg Ile Val Ala Val Thr Gly Ala Glu Ala Gln Lys Ala 210 215 220Leu Arg Lys Ala Glu Ser Leu Lys Lys Cys Leu Ser Val Met Glu Ala225 230 235 240Lys Val Lys Ala Gln Thr Ala Pro Asn Lys Asp Val Gln Arg Glu Ile 245 250 255Ala Asp Leu Gly Glu Ala Leu Ala Thr Ala Val Ile Pro Gln Trp Gln 260 265 270Lys Asp Glu Leu Arg Glu Thr Leu Lys Ser Leu Lys Lys Val Met Asp 275 280 285Asp Leu Asp Arg Ala Ser Lys Ala Asp Val Gln Lys Arg Val Leu Glu 290 295 300Lys Thr Lys Gln Phe Ile Asp Ser Asn Pro Asn Gln Pro Leu Val Ile305 310 315 320Leu Glu Met Glu Ser Gly Ala Ser Ala Lys Ala Leu Asn Glu Ala Leu 325 330 335Lys Leu Phe Lys Met His Ser Pro Gln Thr Ser Ala Met Leu Phe Thr 340 345 350Val Asp Asn Glu Ala Gly Lys Ile Thr Cys Leu Cys Gln Val Pro Gln 355 360 365Asn Ala Ala Asn Arg Gly Leu Lys Ala Ser Glu Trp Val Gln Gln Val 370 375 380Ser Gly Leu Met Asp Gly Lys Gly Gly Gly Lys Asp Val Ser Ala Gln385 390 395 400Ala Thr Gly Lys Asn Val Gly Cys Leu Gln Glu Ala Leu Gln Leu Ala 405 410 415Thr Ser Phe Ala Gln Leu Arg Leu Gly Asp Val Lys Asn Leu Glu Gly 420 425 430Lys Pro Ile Pro Asn Pro Leu Leu Gly Leu Asp Ser Thr His His His 435 440 445His His His 450162264PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with N-terminal 6xHis affinity tag 162Met His His His His His His Gly Lys Pro Ile Pro Asn Pro Leu Leu1 5 10 15Gly Leu Asp Ser Thr Arg His Leu Arg Asn Ser Ser His Ala Gly Ala 20 25 30Phe Val Ile Val Thr Glu Glu Ala Ile Ala Lys Gly Ile Arg Arg Ile 35 40 45Val Ala Val Thr Gly Ala Glu Ala Gln Lys Ala Leu Arg Lys Ala Glu 50 55 60Ser Leu Lys Lys Cys Leu Ser Val Met Glu Ala Lys Val Lys Ala Gln65 70 75 80Thr Ala Pro Asn Lys Asp Val Gln Arg Glu Ile Ala Asp Leu Gly Glu 85 90 95Ala Leu Ala Thr Ala Val Ile Pro Gln Trp Gln Lys Asp Glu Leu Arg 100 105 110Glu Thr Leu Lys Ser Leu Lys Lys Val Met Asp Asp Leu Asp Arg Ala 115 120 125Ser Lys Ala Asp Val Gln Lys Arg Val Leu Glu Lys Thr Lys Gln Phe 130 135 140Ile Asp Ser Asn Pro Asn Gln Pro Leu Val Ile Leu Glu Met Glu Ser145 150 155 160Gly Ala Ser Ala Lys Ala Leu Asn Glu Ala Leu Lys Leu Phe Lys Met 165 170 175His Ser Pro Gln Thr Ser Ala Met Leu Phe Thr Val Asp Asn Glu Ala 180 185 190Gly Lys Ile Thr Cys Leu Cys Gln Val Pro Gln Asn Ala Ala Asn Arg 195 200 205Gly Leu Lys Ala Ser Glu Trp Val Gln Gln Val Ser Gly Leu Met Asp 210 215 220Gly Lys Gly Gly Gly Lys Asp Val Ser Ala Gln Ala Thr Gly Lys Asn225 230 235 240Val Gly Cys Leu Gln Glu Ala Leu Gln Leu Ala Thr Ser Phe Ala Gln 245 250 255Leu Arg Leu Gly Asp Val Lys Asn 260163264PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with C-terminal 6xHis affinity tag 163Met Arg His Leu Arg Asn Ser Ser His Ala Gly Ala Phe Val Ile Val1 5 10 15Thr Glu Glu Ala Ile Ala Lys Gly Ile Arg Arg Ile Val Ala Val Thr 20 25 30Gly Ala Glu Ala Gln Lys Ala Leu Arg Lys Ala Glu Ser Leu Lys Lys 35 40 45Cys Leu Ser Val Met Glu Ala Lys Val Lys Ala Gln Thr Ala Pro Asn 50 55 60Lys Asp Val Gln Arg Glu Ile Ala Asp Leu Gly Glu Ala Leu Ala Thr65 70 75 80Ala Val Ile Pro Gln Trp Gln Lys Asp Glu Leu Arg Glu Thr Leu Lys 85 90 95Ser Leu Lys Lys Val Met Asp Asp Leu Asp Arg Ala Ser Lys Ala Asp 100 105 110Val Gln Lys Arg Val Leu Glu Lys Thr Lys Gln Phe Ile Asp Ser Asn 115 120 125Pro Asn Gln Pro Leu Val Ile Leu Glu Met Glu Ser Gly Ala Ser Ala 130 135 140Lys Ala Leu Asn Glu Ala Leu Lys Leu Phe Lys Met His Ser Pro Gln145 150 155 160Thr Ser Ala Met Leu Phe Thr Val Asp Asn Glu Ala Gly Lys Ile Thr 165 170 175Cys Leu Cys Gln Val Pro Gln Asn Ala Ala Asn Arg Gly Leu Lys Ala 180 185 190Ser Glu Trp Val Gln Gln Val Ser Gly Leu Met Asp Gly Lys Gly Gly 195 200 205Gly Lys Asp Val Ser Ala Gln Ala Thr Gly Lys Asn Val Gly Cys Leu 210 215 220Gln Glu Ala Leu Gln Leu Ala Thr Ser Phe Ala Gln Leu Arg Leu Gly225 230 235 240Asp Val Lys Asn Gly Lys Pro Ile Pro Asn Pro Leu Leu Gly Leu Asp 245 250 255Ser Thr His His His His His His 260164334PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with N-terminal 6xHis affinity tag (Genewiz) 164Met His His His His His His Gly Lys Pro Ile Pro Asn Pro Leu Leu1 5 10 15Gly Leu Asp Ser Thr Gly Ser Ile Glu Ala Ala Lys Ala Val Tyr Thr 20 25 30Gln Asp Cys Pro Leu Ala Ala Ala Lys Ala Ile Gln Gly Leu Arg Ala 35 40 45Val Phe Asp Glu Thr Tyr Pro Asp Pro Val Arg Val Val Ser Ile Gly 50 55 60Val Pro Val Ser Glu Leu Leu Asp Asp Pro Ser Gly Pro Ala Gly Ser65 70 75 80Leu Thr Ser Val Glu Phe Cys Gly Gly Thr His Leu Arg Asn Ser Ser 85 90 95His Ala Gly Ala Phe Val Ile Val Thr Glu Glu Ala Ile Ala Lys Gly 100 105 110Ile Arg Arg Ile Val Ala Val Thr Gly Ala Glu Ala Gln Lys Ala Leu 115 120 125Arg Lys Ala Glu Ser Leu Lys Lys Cys Leu Ser Val Met Glu Ala Lys 130 135 140Val Lys Ala Gln Thr Ala Pro Asn Lys Asp Val Gln Arg Glu Ile Ala145 150 155 160Asp Leu Gly Glu Ala Leu Ala Thr Ala Val Ile Pro Gln Trp Gln Lys 165 170 175Asp Glu Leu Arg Glu Thr Leu Lys Ser Leu Lys Lys Val Met Asp Asp 180 185 190Leu Asp Arg Ala Ser Lys Ala Asp Val Gln Lys Arg Val Leu Glu Lys 195 200 205Thr Lys Gln Phe Ile Asp Ser Asn Pro Asn Gln Pro Leu Val Ile Leu 210 215 220Glu Met Glu Ser Gly Ala Ser Ala Lys Ala Leu Asn Glu Ala Leu Lys225 230 235 240Leu Phe Lys Met His Ser Pro Gln Thr Ser Ala Met Leu Phe Thr Val 245 250 255Asp Asn Glu Ala Gly Lys Ile Thr Cys Leu Cys Gln Val Pro Gln Asn 260 265 270Ala Ala Asn Arg Gly Leu Lys Ala Ser Glu Trp Val Gln Gln Val Ser 275 280 285Gly Leu Met Asp Gly Lys Gly Gly Gly Lys Asp Val Ser Ala Gln Ala 290 295 300Thr Gly Lys Asn Val Gly Cys Leu Gln Glu Ala Leu Gln Leu Ala Thr305 310 315 320Ser Phe Ala Gln Leu Arg Leu Gly Asp Val Lys Asn Leu Glu 325 330165334PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with C-terminal 6xHis affinity tag (Genewiz) 165Met Gly Ser Ile Glu Ala Ala Lys Ala Val Tyr Thr Gln Asp Cys Pro1 5 10 15Leu Ala Ala Ala Lys Ala Ile Gln Gly Leu Arg Ala Val Phe Asp Glu 20 25 30Thr Tyr Pro Asp Pro Val Arg Val Val Ser Ile Gly Val Pro Val Ser 35 40 45Glu Leu Leu Asp Asp Pro Ser Gly Pro Ala Gly Ser Leu Thr Ser Val 50 55 60Glu Phe Cys Gly Gly Thr His Leu Arg Asn Ser Ser His Ala Gly Ala65 70 75 80Phe Val Ile Val Thr Glu Glu Ala Ile Ala Lys Gly Ile Arg Arg Ile 85 90 95Val Ala Val Thr Gly Ala Glu Ala Gln Lys Ala Leu Arg Lys Ala Glu 100 105 110Ser Leu Lys Lys Cys Leu Ser Val Met Glu Ala Lys Val Lys Ala Gln 115 120 125Thr Ala Pro Asn Lys Asp Val Gln Arg Glu Ile Ala Asp Leu Gly Glu 130 135 140Ala Leu Ala Thr Ala Val Ile Pro Gln Trp Gln Lys Asp Glu Leu Arg145 150 155 160Glu Thr Leu Lys Ser Leu Lys Lys Val Met Asp Asp Leu Asp Arg Ala 165 170 175Ser Lys Ala Asp Val Gln Lys Arg Val Leu Glu Lys Thr Lys Gln Phe 180 185 190Ile Asp Ser Asn Pro Asn Gln Pro Leu Val Ile Leu Glu Met Glu Ser 195 200 205Gly Ala Ser Ala Lys Ala Leu Asn Glu Ala Leu Lys Leu Phe Lys Met 210 215 220His Ser Pro Gln Thr Ser Ala Met Leu Phe Thr Val Asp Asn Glu Ala225 230 235 240Gly Lys Ile Thr Cys Leu Cys Gln Val Pro Gln Asn Ala Ala Asn Arg 245 250 255Gly Leu Lys Ala Ser Glu Trp Val Gln Gln Val Ser Gly Leu Met Asp 260 265 270Gly Lys Gly Gly Gly Lys Asp Val Ser Ala Gln Ala Thr Gly Lys Asn 275 280 285Val Gly Cys Leu Gln Glu Ala Leu Gln Leu Ala Thr Ser Phe Ala Gln 290 295 300Leu Arg Leu Gly Asp Val Lys Asn Leu Glu Gly Lys Pro Ile Pro Asn305 310 315 320Pro Leu Leu Gly Leu Asp Ser Thr His His His His His His 325 330166234PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with C-terminal 6xHis affinity tag (Version 2) 166Met Lys Gly Ile Arg Arg Ile Val Ala Val Thr Gly Ala Glu Ala Gln1 5 10 15Lys Ala Leu Arg Lys Ala Glu Ser Leu Lys Lys Cys Leu Ser Val Met 20 25 30Glu Ala Lys Val Lys Ala Gln Thr Ala Pro Asn Lys Asp Val Gln Arg 35 40 45Glu Ile Ala Asp Leu Gly Glu Ala Leu Ala Thr Ala Val Ile Pro Gln 50 55 60Trp Gln Lys Asp Glu Leu Arg Glu Thr Leu Lys Ser Leu Lys Lys Val65 70 75 80Met Asp Asp Leu Asp Arg Ala Ser Lys Ala Asp Val Gln Lys Arg Val 85 90 95Leu Glu Lys Thr Lys Gln Phe Ile Asp Ser Asn Pro Asn Gln Pro Leu 100 105 110Val Ile Leu Glu Met Glu Ser Gly Ala Ser Ala Lys Ala Leu Asn Glu 115 120 125Ala Leu Lys Leu Phe Lys Met His Ser Pro Gln Thr Ser Ala Met Leu 130 135 140Phe Thr Val Asp Asn Glu Ala Gly Lys Ile Thr Cys Leu Cys Gln Val145 150 155 160Pro Gln Asn Ala Ala Asn Arg Gly Leu Lys Ala Ser Glu Trp Val Gln 165 170 175Gln Val Ser Gly Leu Met Asp Gly Lys Gly Gly Gly Lys Asp Val Ser 180 185 190Ala Gln Ala Thr Gly Lys Asn Val Gly Cys Leu Gln Glu Ala Leu Gln 195 200 205Leu Ala Thr Ser Phe Ala Gln Leu Arg Leu Gly Asp Val Lys Asn Ala 210 215 220Ala Ala Leu Glu His His His His His His225 2301671491DNAArtificial SequenceCodon optimized Alanyl tRNA Synthetase polynucleotide 167cgcggcctgg aagtaacgga tgacagccca aaatacaact accatctgga ctctagcggc 60tcgtacgtct ttgaaaatac cgtcgccacg gttatggctt tgcgccgtga gaagatgttc 120gtggaagagg tttccaccgg ccaggaatgc ggtgtggtgc tggataagac ctgcttttac 180gcggagcagg gtggtcagat ttacgatgag ggttatctgg tcaaagttga cgattctagc 240gaagataaga cggagttcac cgtcaaaaac gcgcaagtcc gcggtggcta cgtcctgcac 300attggcacta tctatggtga tctgaaggtt ggtgaccaag tttggctgtt catcgacgag 360ccgcgtcgtc gtccgatcat gagcaatcat accgcgacgc atatcctgaa ctttgcgctg 420cgttcggtcc tgggtgaggc ggatcaaaaa ggctccctgg tggctccgga tcgcctgcgc 480ttcgacttca ctgccaaagg cgcgatgagc acccagcaga ttaagaaagc cgaagagatc 540gcaaacgaga tgattgaggc tgcgaaggcg gtctataccc aggactgtcc gctggcggca 600gcgaaggcta ttcaaggtct gcgcgctgtt tttgatgaaa cttatccgga tccagttcgt 660gttgttagca tcggcgtgcc ggtgagcgaa ctgttggacg atccgagcgg tccggcaggt 720agcttgacga gcgtcgagtt ttgtggtggc acccacctgc gtaacagcag ccacgcgggt 780gcattcgtta tcgtgaccga agaggccatt gcaaaaggca tccgtcgcat cgttgcggtt 840accggtgccg aggcgcagaa ggcactgcgt aaagcggaaa gcttgaagaa atgcctgagc 900gtgatggagg cgaaggtgaa agcacagacg gcaccgaata aggatgtgca acgtgagatt 960gccgatttgg gtgaggccct ggcgaccgca gttattccgc agtggcaaaa ggacgagctg 1020cgtgaaaccc tgaaatccct gaaaaaggtg

atggacgacc tggaccgcgc atccaaagcg 1080gacgtccaaa agcgtgtcct ggagaaaacc aaacaattca ttgactccaa cccgaaccag 1140cctctggtca ttctggaaat ggagagcggt gccagcgcaa aggctctgaa tgaggcgctg 1200aagctgttca agatgcacag cccgcagacg agcgcgatgc tgtttaccgt tgataatgaa 1260gccggcaaaa tcacgtgtct gtgccaagtc ccgcagaatg cggcgaatcg tggtttgaaa 1320gccagcgaat gggtgcaaca ggtgtctggt ttgatggacg gtaagggtgg cggcaaagac 1380gttagcgcac aagctaccgg taagaatgtg ggctgcctgc aagaagcgct gcagctggcg 1440acgagctttg cacagctgcg tttgggtgat gtgaaaaact aatgactcga g 1491168645DNAArtificial SequenceCodon optimized Alanyl tRNA Synthetase polynucleotide 168ggatccgcag aagcacagaa agccctgcgt aaagccgaat ctctgaaaaa atgcctgagc 60gtgatggaag cgaaagtcaa agcccaaaca gcaccgaata aagacgtcca acgtgaaatt 120gccgatctgg gtgaggcgct ggctacagcc gttatcccac aatggcagaa agatgaactg 180cgtgaaaccc tgaaaagcct gaaaaaagtg atggatgacc tggatcgtgc ctctaaagca 240gatgttcaaa aacgtgtcct ggagaaaacg aaacaattca ttgatagcaa cccgaaccaa 300ccactggtaa tcctggaaat ggaaagcgga gcatcagcaa aagcactgaa cgaagcgctg 360aaactgttca aaatgcacag cccacagaca tccgccatgc tgttcaccgt tgataatgaa 420gccggcaaaa tcacctgcct gtgtcaggtt cctcagaacg ctgctaaccg tggactgaaa 480gcaagcgaat gggttcaaca agtgagtggt ctgatggacg gtaaaggtgg tggtaaagat 540gtgtcagcac aagcgaccgg taaaaatgtt gggtgcctgc aggaagctct gcaactggca 600acctcatttg cccaactgcg cctgggagat gtgaaaaacc tcgag 6451691155DNAArtificial SequenceCodon optimized Alanyl tRNA Synthetase polynucleotide 169caagtctggc tgttcatcga cgaaccacgc cgccgcccaa ttatgagcaa ccataccgcg 60acccatattc tgaactttgc cctgcgttct gtgctgggcg aagcagatca gaagggcagc 120ctggttgctc cggatcgtct gcgttttgat ttcaccgcga aaggtgcgat gtctacgcaa 180cagatcaaga aggcggaaga aattgctaac gagatgatcg aggcggcgaa agcggtttac 240acgcaagatt gcccgctggc tgccgcaaaa gcgattcagg gtctgcgtgc ggtgtttgat 300gaaacttatc cggacccggt tcgcgttgtg tccatcggcg tgccggtgag cgagctgttg 360gacgacccga gcggtccggc tggcagcctg accagcgttg aattctgtgg tggtacccac 420ttgcgcaaca gcagccacgc cggtgcgttc gttattgtga ccgaagaggc aattgcaaaa 480ggtatccgtc gtatcgtggc ggtcaccggt gctgaggcac aaaaggcgct gcgtaaggcg 540gagtcgttga agaaatgttt gagcgttatg gaggcgaaag ttaaagcgca gacggcaccg 600aataaggatg tccagcgcga gatcgcggac ctgggtgagg ccctggccac cgcggtgatt 660ccgcaatggc agaaagatga gctgcgtgaa acgctgaaga gcttgaaaaa ggtcatggac 720gacctggacc gtgcgagcaa ggcagacgta cagaagcgcg ttctggagaa aactaaacag 780tttatcgaca gcaacccgaa ccaaccgctg gtcattctgg aaatggaaag cggcgcaagc 840gctaaggcac tgaatgaggc gctgaaactg ttcaaaatgc acagccctca gacgtctgca 900atgctgttca ccgtcgataa tgaagcgggt aagatcacgt gcctgtgtca ggtgccgcaa 960aacgccgcga atcgtggtct gaaagcgtcc gagtgggtcc aacaggtgag cggtctgatg 1020gatggcaagg gtggcggtaa agatgtttcc gcccaggcca ccggcaaaaa tgttggttgc 1080ctgcaagagg cactgcaact ggcaaccagc tttgcccagc tgcgtttggg cgacgtcaag 1140aattaatgac tcgag 1155170939DNAArtificial SequenceCodon optimized Alanyl tRNA Synthetase polynucleotide (DNA2.0) 170atcgaagccg caaaagccgt ctacacccag gactgcccgc tggcggctgc caaggccatc 60caaggtttgc gtgcagtctt tgacgaaacg tatcctgatc cggtgcgcgt cgtgagcatc 120ggtgtgccag tgtctgagct gctggacgat ccgtcgggtc cggcaggctc tctgaccagc 180gttgaattct gcggcggtac ccatctgcgt aatagcagcc acgccggtgc gttcgttatc 240gttaccgaag aggcgattgc gaaaggcatt cgtcgtatcg ttgcagtcac tggtgcggag 300gcgcaaaagg cgttgcgtaa agcagaaagc ctgaagaaat gtctgagcgt aatggaagct 360aaagttaagg cccaaacggc accgaacaaa gacgtgcagc gcgagattgc agacctgggc 420gaggcgctgg cgacggcagt tattccgcag tggcagaaag acgaactgcg cgaaacgctg 480aaaagcttga aaaaggttat ggatgacttg gaccgtgcaa gcaaggctga tgtccaaaag 540cgcgtcctgg agaaaaccaa gcagttcatt gatagcaatc cgaaccaacc gctggtcatt 600ctggagatgg agagcggtgc gagcgcgaag gcgctgaacg aggctctgaa gttgtttaag 660atgcactccc cgcaaacgag cgcaatgctg tttaccgttg ataatgaagc gggtaagatc 720acctgtctgt gccaggtgcc gcaaaatgcg gctaaccgtg gcctgaaagc gtccgagtgg 780gtccagcagg tttccggtct gatggatggc aaaggcggtg gtaaagacgt gagcgcgcag 840gccaccggca aaaatgtggg ttgtctgcaa gaggccctgc agctggcgac cagcttcgcg 900caactgcgtc tgggtgatgt gaagaactaa tgactcgag 939171846DNAArtificial SequenceCodon optimized Alanyl tRNA Synthetase polynucleotide 171ccagacccag tccgcgtagt aagcatcggc gtcccagtaa gcgagctgct ggacgatccg 60tctggccctg ccggctccct gaccagcgtg gagttttgcg gtggcaccca tctgcgcaat 120tccagccacg cgggtgcttt tgtgatcgtg accgaagaag ctattgcaaa gggtattcgt 180cgtatcgtgg cggtgaccgg tgcagaagct cagaaggccc tgcgtaaagc cgagtcgctg 240aagaaatgtt tgagcgttat ggaggcaaag gttaaagcgc aaaccgcacc gaacaaggac 300gttcagcgtg aaattgcgga cctgggtgag gcgctggcga cggcagtgat cccgcaatgg 360cagaaagatg agctgcgcga aaccttgaaa agcttgaaga aagttatgga tgatttggac 420cgcgccagca aagctgatgt tcaaaagcgt gtcttggaaa agaccaaaca attcattgac 480agcaacccga atcagccgct ggttattctg gagatggaga gcggcgcatc cgcgaaggcg 540ctgaacgaag cactgaaact gtttaagatg cacagcccgc aaactagcgc gatgctgttc 600acggttgaca atgaggcggg taaaatcacg tgcctgtgcc aagtgccgca gaacgcggca 660aatcgtggtc tgaaagccag cgaatgggtt cagcaggtca gcggcctgat ggatggtaaa 720ggtggtggca aggacgtcag cgcgcaagcg accggtaaga atgtgggctg tctgcaagag 780gcgctgcagc tggcgacgtc tttcgcccag ctgcgtctgg gtgatgtcaa aaactaatga 840ctcgag 846172678DNAArtificial SequenceCodon optimized Alanyl tRNA Synthetase polynucleotide 172ggatccaaag gcatccgccg tattgtagca gtaaccggtg ccgaggctca aaaagcgctg 60cgcaaagctg aaagcctgaa aaaatgcctg tcggtgatgg aggcaaaagt gaaagcacag 120acagctccta acaaagatgt tcaacgtgag atcgctgacc tgggagaagc actggctacc 180gccgtcattc ctcagtggca aaaagacgag ctgcgcgaga cactgaaatc actgaaaaaa 240gtcatggacg atctggaccg tgctagtaaa gccgatgttc aaaaacgtgt cctggagaaa 300accaaacaat tcatcgactc caaccctaat cagccgctgg ttatcctgga gatggagagt 360ggcgctagtg ccaaagcgct gaacgaggct ctgaaactgt tcaaaatgca ctcccctcaa 420acctcagcaa tgctgttcac agtggacaac gaggctggca aaatcacatg cctgtgccaa 480gtgccacaaa atgccgccaa tcgtggtctg aaagcgtcag aatgggtaca acaagtgagc 540ggactgatgg atggcaaagg gggcggaaaa gacgttagtg cccaagcaac tgggaaaaac 600gtggggtgtc tgcaagaggc tctgcagctg gctacgagtt tcgcccaact gcgtctggga 660gatgtgaaaa atctcgag 678173351DNAArtificial SequenceCodon optimized Alanyl tRNA Synthetase polynucleotide 173ccactggtca ttttggaaat ggagagcggt gcaagcgcaa aagcgctgaa cgaagctctg 60aagctgttca agatgcactc tccgcaaacg agcgcgatgc tgtttaccgt cgataatgag 120gccggtaaaa tcacctgcct gtgtcaggtt ccgcagaatg cggccaaccg tggtttgaag 180gcctccgagt gggttcagca agtgagcggt ctgatggatg gcaaaggtgg tggcaaagac 240gtgagcgcgc aggctacggg caaaaacgtg ggttgcctgc aagaagcgct gcaattggcg 300accagcttcg cacagctgcg cctgggcgac gttaagaatt aatgactcga g 3511741290DNAArtificial SequenceCodon optimized Alanyl tRNA Synthetase polynucleotide 174ggatccatcc ctcagagcac cattacgatt tggaccccgg ttgttgccat gaaaacggag 60tttaccgtga aaaatgccca ggttcgtgga ggttatgttc tgcacattgg gacgatctat 120ggcgacctga aagttggtga ccaagtgtgg ctgttcatcg atgagcctcg ccgccgtcct 180atcatgagta accataccgc cacccatatt ctgaatttcg ccctgcgttc agtactggga 240gaagcagacc aaaaaggcag cctggtagcc cctgatcgcc tgcgctttga ttttacggcc 300aaaggagcca tgtctacaca gcagatcaaa aaagccgaag agatcgcaaa tgagatgatc 360gaagccgcca aagcagttta tacccaggat tgtccgctgg cagcagcaaa agccattcaa 420ggcctgcgtg cggtgtttga cgaaacttat ccggacccag tccgtgttgt gagtatcggt 480gtccctgtta gcgaactgct ggatgaccca tctggtcctg ccggttcact gacaagcgtg 540gaattttgtg gtggaaccca cctgcgtaat agcagtcatg ctggggcctt tgttattgtg 600accgaagagg ccattgctaa aggaattcgc cgtattgttg ccgttacagg tgctgaagct 660cagaaagcac tgcgcaaagc tgaatcgctg aaaaaatgcc tgagcgtgat ggaagcgaaa 720gtgaaagctc aaaccgcccc gaataaagat gttcaacgtg agattgccga tctgggagag 780gcgctggcta cagctgttat tcctcagtgg cagaaagatg agctgcgtga aaccctgaaa 840agtctgaaaa aagtgatgga tgacctggac cgtgcttcaa aagcagatgt tcaaaaacgt 900gtgctggaga aaacgaaaca gtttatcgac agcaacccga atcaacctct ggttattctg 960gagatggaaa gcggtgctag tgctaaagcc ctgaatgaag ccctgaaact gttcaaaatg 1020cacagccctc agacatcagc catgctgttt acggtggata acgaagcagg caaaatcacc 1080tgtctgtgtc aggtccctca aaacgctgct aatcgtggcc tgaaagcaag cgaatgggta 1140cagcaggttt ctggactgat ggatggtaaa ggtggtggca aagacgttag tgcccaagcg 1200acgggtaaaa atgttggctg tctgcaggaa gctctgcagc tggccacctc atttgctcaa 1260ctgcgtctgg gagatgtgaa aaacctcgag 1290175741DNAArtificial SequenceCodon optimized Alanyl tRNA Synthetase polynucleotide 175cgtcatctga gaaactctag ccacgccggc gccttcgtca tcgttactga agaagcgatc 60gcgaaaggta tccgtcgcat tgtagcggtg accggtgcgg aagcgcaaaa agcgctgcgt 120aaagcggaga gcctgaagaa atgcttgagc gttatggagg cgaaagtgaa ggctcagacc 180gcaccgaaca aagatgtcca acgtgaaatt gcggacctgg gtgaagcgct ggccaccgca 240gttatcccgc agtggcaaaa ggacgagctg cgtgaaaccc tgaagagcct gaaaaaggtt 300atggacgatc tggaccgtgc ctcgaaagcg gacgtgcaaa aacgcgttct ggagaaaacc 360aagcagttta ttgattccaa cccgaatcaa ccgctggtta tcctggagat ggaatccggt 420gcgagcgcaa aggccctgaa tgaggccctg aagctgttca aaatgcacag cccgcagacg 480agcgcaatgc tgtttacggt ggacaatgag gctggtaaga ttacgtgtct gtgtcaggtg 540cctcagaatg cagcgaaccg cggtctgaag gcgagcgagt gggtccaaca ggtgagcggc 600ctgatggatg gcaaaggtgg cggcaaggat gttagcgcac aagcaaccgg caaaaatgtc 660ggttgcctgc aagaggctct gcagttggca acgtctttcg ctcagttgcg cttgggtgat 720gtcaagaact aatgactcga g 741176939DNAArtificial SequenceCodon optimized Alanyl tRNA Synthetase polynucleotide (Genewiz) 176ggatccattg aagccgccaa agccgtgtat acacaagatt gtcctctggc tgctgctaaa 60gcaattcagg gactgcgtgc cgtgtttgat gaaacctatc cggacccggt tcgtgttgtg 120agtattggtg tcccggttag tgaactgctg gatgaccctt ctggtccagc gggttctctg 180acatctgtgg agttctgtgg tggtacacac ctgcgtaata gcagtcatgc cggtgccttt 240gtgattgtta ccgaagaggc cattgccaaa gggattcgcc gtatcgttgc tgttactgga 300gctgaagcac aaaaagcact gcgcaaagcc gaatctctga aaaaatgcct gtccgtgatg 360gaagcaaaag tgaaagctca aaccgccccg aataaagacg ttcaacgtga aatcgctgat 420ctgggcgaag cactggctac cgctgtcatt cctcagtggc aaaaagatga actgcgcgaa 480acgctgaaaa gtctgaaaaa agtgatggat gacctggatc gtgcctcaaa agccgatgtc 540caaaaacgtg tgctggagaa aacaaaacag tttatcgata gcaaccctaa tcaacctctg 600gtgatcctgg aaatggaaag tggagcgtcg gctaaagctc tgaatgaagc actgaaactg 660ttcaaaatgc atagccctca gacatccgcc atgctgttca ccgtggataa tgaagctggc 720aaaatcacct gtctgtgcca agttcctcaa aatgccgcca atcgtggtct gaaagcaagc 780gaatgggttc aacaagtgtc tggtctgatg gatggtaaag ggggtggtaa agatgtttct 840gcccaggcaa ccggtaaaaa cgtgggttgt ctgcaagaag cactgcaact ggcaacctca 900tttgcccaac tgcgtctggg tgatgtgaaa aacctcgag 939177274PRTHomo sapiens 177Arg Gly Leu Glu Val Thr Asp Asp Ser Pro Lys Tyr Asn Tyr His Leu1 5 10 15Asp Ser Ser Gly Ser Tyr Val Phe Glu Asn Thr Val Ala Thr Val Met 20 25 30Ala Leu Arg Arg Glu Lys Met Phe Val Glu Glu Val Ser Thr Gly Gln 35 40 45Glu Cys Gly Val Val Leu Asp Lys Thr Cys Phe Tyr Ala Glu Gln Gly 50 55 60Gly Gln Ile Tyr Asp Glu Gly Tyr Leu Val Lys Val Asp Asp Ser Ser65 70 75 80Glu Asp Lys Thr Glu Phe Thr Val Lys Asn Ala Gln Val Arg Gly Gly 85 90 95Tyr Val Leu His Ile Gly Thr Ile Tyr Gly Asp Leu Lys Val Gly Asp 100 105 110Gln Val Trp Leu Phe Ile Asp Glu Pro Arg Arg Arg Pro Ile Met Ser 115 120 125Asn His Thr Ala Thr His Ile Leu Asn Phe Ala Leu Arg Ser Val Leu 130 135 140Gly Glu Ala Asp Gln Lys Gly Ser Leu Val Ala Pro Asp Arg Leu Arg145 150 155 160Phe Asp Phe Thr Ala Lys Gly Ala Met Ser Thr Gln Gln Ile Lys Lys 165 170 175Ala Glu Glu Ile Ala Asn Glu Met Ile Glu Ala Ala Lys Ala Val Tyr 180 185 190Thr Gln Asp Cys Pro Leu Ala Ala Ala Lys Ala Ile Gln Gly Leu Arg 195 200 205Ala Val Phe Asp Glu Thr Tyr Pro Asp Pro Val Arg Val Val Ser Ile 210 215 220Gly Val Pro Val Ser Glu Leu Leu Asp Asp Pro Ser Gly Pro Ala Gly225 230 235 240Ser Leu Thr Ser Val Glu Phe Cys Gly Gly Thr His Leu Arg Asn Ser 245 250 255Ser His Ala Gly Ala Phe Val Ile Val Thr Glu Glu Ala Ile Ala Lys 260 265 270Gly Ile178822DNAHomo sapiens 178cggggtctgg aggtcacaga tgattcccca aagtacaatt accatttgga ctccagtggt 60agctatgtat ttgagaacac agtggctacg gtgatggctc tgcgcaggga gaagatgttc 120gtggaagagg tgtccacagg ccaggagtgt ggagtggtgc tggacaagac ctgtttctat 180gctgagcaag gaggccagat ctatgacgaa ggctacctgg tgaaggtgga tgacagcagt 240gaagataaaa cagagtttac agtgaagaat gctcaggtcc gaggagggta tgtgctacac 300attggaacca tctacggtga cctgaaagtg ggggatcagg tctggctgtt tattgatgag 360ccccgacgaa gacccatcat gagcaaccac acagctacgc acattctgaa cttcgccctg 420cgctcagtgc ttggggaagc tgaccagaaa ggctcattgg ttgctcctga ccgcctcaga 480tttgacttta ctgccaaggg agccatgtcc acccaacaga tcaagaaggc tgaagagatt 540gctaatgaga tgattgaggc agccaaggcc gtctataccc aggattgccc cctggcagca 600gcgaaagcca tccagggcct acgggctgtg tttgatgaga cctatcctga ccctgtgcga 660gtcgtctcca ttggggtccc ggtgtccgag ttgctggatg acccctctgg gcctgctggc 720tccctgactt ctgttgagtt ctgtggggga acgcacctgc ggaactcgag tcatgcagga 780gcttttgtga tcgtgacgga agaagccatt gccaagggta tc 822179299PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with N-terminal 6xHis affinity tag 179Met His His His His His His Gly Lys Pro Ile Pro Asn Pro Leu Leu1 5 10 15Gly Leu Asp Ser Thr Gly Ser Arg Gly Leu Glu Val Thr Asp Asp Ser 20 25 30Pro Lys Tyr Asn Tyr His Leu Asp Ser Ser Gly Ser Tyr Val Phe Glu 35 40 45Asn Thr Val Ala Thr Val Met Ala Leu Arg Arg Glu Lys Met Phe Val 50 55 60Glu Glu Val Ser Thr Gly Gln Glu Cys Gly Val Val Leu Asp Lys Thr65 70 75 80Cys Phe Tyr Ala Glu Gln Gly Gly Gln Ile Tyr Asp Glu Gly Tyr Leu 85 90 95Val Lys Val Asp Asp Ser Ser Glu Asp Lys Thr Glu Phe Thr Val Lys 100 105 110Asn Ala Gln Val Arg Gly Gly Tyr Val Leu His Ile Gly Thr Ile Tyr 115 120 125Gly Asp Leu Lys Val Gly Asp Gln Val Trp Leu Phe Ile Asp Glu Pro 130 135 140Arg Arg Arg Pro Ile Met Ser Asn His Thr Ala Thr His Ile Leu Asn145 150 155 160Phe Ala Leu Arg Ser Val Leu Gly Glu Ala Asp Gln Lys Gly Ser Leu 165 170 175Val Ala Pro Asp Arg Leu Arg Phe Asp Phe Thr Ala Lys Gly Ala Met 180 185 190Ser Thr Gln Gln Ile Lys Lys Ala Glu Glu Ile Ala Asn Glu Met Ile 195 200 205Glu Ala Ala Lys Ala Val Tyr Thr Gln Asp Cys Pro Leu Ala Ala Ala 210 215 220Lys Ala Ile Gln Gly Leu Arg Ala Val Phe Asp Glu Thr Tyr Pro Asp225 230 235 240Pro Val Arg Val Val Ser Ile Gly Val Pro Val Ser Glu Leu Leu Asp 245 250 255Asp Pro Ser Gly Pro Ala Gly Ser Leu Thr Ser Val Glu Phe Cys Gly 260 265 270Gly Thr His Leu Arg Asn Ser Ser His Ala Gly Ala Phe Val Ile Val 275 280 285Thr Glu Glu Ala Ile Ala Lys Gly Ile Leu Glu 290 295180299PRTArtificial SequenceAlanyl tRNA Synthetase polypeptide with C-terminal 6xHis affinity tag 180Met Gly Ser Arg Gly Leu Glu Val Thr Asp Asp Ser Pro Lys Tyr Asn1 5 10 15Tyr His Leu Asp Ser Ser Gly Ser Tyr Val Phe Glu Asn Thr Val Ala 20 25 30Thr Val Met Ala Leu Arg Arg Glu Lys Met Phe Val Glu Glu Val Ser 35 40 45Thr Gly Gln Glu Cys Gly Val Val Leu Asp Lys Thr Cys Phe Tyr Ala 50 55 60Glu Gln Gly Gly Gln Ile Tyr Asp Glu Gly Tyr Leu Val Lys Val Asp65 70 75 80Asp Ser Ser Glu Asp Lys Thr Glu Phe Thr Val Lys Asn Ala Gln Val 85 90 95Arg Gly Gly Tyr Val Leu His Ile Gly Thr Ile Tyr Gly Asp Leu Lys 100 105 110Val Gly Asp Gln Val Trp Leu Phe Ile Asp Glu Pro Arg Arg Arg Pro 115 120 125Ile Met Ser Asn His Thr Ala Thr His Ile Leu Asn Phe Ala Leu Arg 130 135 140Ser Val Leu Gly Glu Ala Asp Gln Lys Gly Ser Leu Val Ala Pro Asp145 150 155 160Arg Leu Arg Phe Asp Phe Thr Ala Lys Gly Ala Met Ser Thr Gln Gln 165 170 175Ile Lys Lys Ala Glu Glu Ile Ala Asn Glu Met Ile Glu Ala Ala Lys 180 185 190Ala Val Tyr Thr Gln Asp Cys Pro Leu Ala Ala Ala Lys Ala Ile Gln 195 200 205Gly Leu Arg Ala Val Phe Asp Glu Thr Tyr Pro Asp Pro Val Arg Val 210 215 220Val Ser Ile Gly Val Pro Val Ser Glu Leu Leu Asp Asp Pro Ser Gly225 230 235 240Pro Ala Gly Ser

Leu Thr Ser Val Glu Phe Cys Gly Gly Thr His Leu 245 250 255Arg Asn Ser Ser His Ala Gly Ala Phe Val Ile Val Thr Glu Glu Ala 260 265 270Ile Ala Lys Gly Ile Leu Glu Gly Lys Pro Ile Pro Asn Pro Leu Leu 275 280 285Gly Leu Asp Ser Thr His His His His His His 290 295181834DNAArtificial SequenceCodon optimized Alanyl tRNA Synthetase polynucleotide 181ggatcccgtg gactggaggt tactgatgat agcccgaaat ataactatca cctggacagc 60tctggttctt atgtgtttga gaatacggtt gccactgtaa tggccctgcg tcgtgaaaaa 120atgttcgtcg aggaagtgtc tactggtcag gaatgtgggg ttgttctgga caaaacgtgc 180ttctatgccg agcagggtgg acaaatctat gacgaggggt atctggtcaa agtggatgat 240tcgagcgagg ataaaacgga gtttactgtt aaaaacgctc aggtccgtgg tggttatgtt 300ctgcatattg gcaccatcta tggggatctg aaagtgggag atcaggtttg gctgttcatt 360gatgagcctc gtcgtcgtcc tattatgagc aatcacaccg ccactcatat tctgaacttc 420gccctgcgct ctgttctggg tgaagccgac caaaaaggat cactggttgc cccggatcgt 480ctgcgcttcg attttaccgc taaaggcgcc atgtcgacac agcagatcaa aaaagccgaa 540gaaatcgcca acgagatgat tgaagcggcc aaagccgttt atacccagga ttgtccgctg 600gcagcagcaa aagcaattca ggggctgcgt gcagttttcg atgaaacgta tccggaccct 660gtccgtgttg ttagcattgg tgttccggtt tctgagctgc tggacgatcc tagtggtcca 720gctggatctc tgacctctgt ggaattttgt ggagggaccc atctgcgtaa tagcagccat 780gctggggcat ttgttattgt gaccgaggaa gcaattgcca aaggcatcct cgag 83418229DNAArtificial SequenceOligonucleotide 182tggccgcata tggactctac tctaacagc 2918329DNAArtificial SequenceOligonucleotide 183tagcggccgc gttctttaca tccccgagg 291845PRTArtificial SequenceLinker 184Ala Ala Ala Leu Glu1 518536DNAArtificial SequenceOligonucleotide 185gcggccgcac tcgagcacca ccaccaccac cactga 3618656DNAArtificial SequenceOligonucleotide 186cctgtgacag ccacaatcct ccggataccc ttcatatgta tatctccttc ttaaag 56



User Contributions:

Comment about this patent or add new information about this topic:

CAPTCHA
Similar patent applications:
DateTitle
2017-01-05Generating and ranking service provider recommendations in a social network
2017-01-05Automatic approval of advertisements for a social networking system
2017-01-05System and method for automated collections of debts for businesses
2017-01-05Method and system for analyzing user behavior associated with web contents
2017-01-05Online ad metrics and billing reporting
New patent applications in this class:
DateTitle
2022-09-22Electronic device
2022-09-22Front-facing proximity detection using capacitive sensor
2022-09-22Touch-control panel and touch-control display apparatus
2022-09-22Sensing circuit with signal compensation
2022-09-22Reduced-size interfaces for managing alerts
Website © 2025 Advameg, Inc.