APPARATUS FOR THE EXTRACORPOREAL TREATMENT OF BLOOD

Abstract

An apparatus for the extracorporeal treatment of blood comprising an extracorporeal blood circuit (2), a pump (6) configured to provide fluid displacement within the extracorporeal blood circuit, and a reaction chamber (8) connected to the extracorporeal blood circuit and configured to receive blood or plasma from the circuit and treat the blood or plasma. The reaction chamber comprises a protease enzyme immobilized to a support, in which the protease enzyme is specific for, and capable of irreversibly cleaving, a human C5a present in the blood or plasma, wherein the abundance of the human C5a in the treated blood or plasma is less than that in the untreated blood or plasma. The apparatus finds utility in the extracorporeal treatment of blood from patients with inflammatory conditions, especially auto-immune disease and sepsis.

Description

CROSS-REFERENCE TO RELATED APPLICATIONS

[0001] This application is a continuation of application Ser. No. 15/242,775 filed on Aug. 22, 2016, which is a continuation of application Ser. No. 14/314,387 filed on Jun. 25, 2014, now U.S. Pat. No. 9,422,541, which claims priority from European Patent Application No. 13197790.2, filed on Dec. 17, 2013. The contents of these previously filed applications are incorporated herein by reference in their entirety.

BACKGROUND

[0002] State-of-the-art hospital treatment for sepsis is the implementation of `The Sepsis Six` (PMID 21398303). These are a series of interventions to stabilize the patient, including delivery of antibiotics, microbial culture, delivery of high-flow oxygen, and fluids. To date, interventions to mitigate organ damage in sepsis have failed. Treatment with Drotrecogin alfa activated, a serine protease involved in switching off coagulation, was, until very recently, the major FDA-approved intervention for treatment of human sepsis. However in 2011 FDA announcing that Eli Lilly had withdrawn Xigris (Drotrecogin alfa). On the 8 Aug. 2012, AstraZeneca announced that a Phase IIb study testing the efficacy of CytoFab.TM., an anti-TNF.alpha. polyclonal antibody fragment, for treatment of severe sepsis and/or septic shock, did not show any significant improvement over placebo and AZ halted any further developments.

[0003] Two additional treatments have been proposed based on a blood purification strategy with some similarity to that proposed in this document. Cytosorb's IL-8 adsorption cassette is based on a porous material that adsorbs the cytokine IL-8, but the technique is non-selective, and removes other small protein components of the blood (found on the World Wide Web at cytosorbents.com/tech.htm). The second strategy is a specific adsorption resin removing bacterial LPS from blood circulated through a cassette (found on the World Wide Web at altecomedical.com/market_product.php), and is a treatment limited to sepsis caused by Gram negative bacteria.

[0004] There is a large body of evidence establishing the role of C5a in sepsis. The Cell Envelope Protease ScpA targets the immune proinflammatory mediator C5a and specifically cleaves the mediator, rendering it inactive.

[0005] It is an object of the invention to overcome at least one of the above-referenced problems.

SUMMARY

[0006] The invention is based on a method and device for the extracorporeal treatment of inflammatory conditions in a patient, especially auto-immune diseases, sepsis or septicemia, that involves reacting blood that has been removed from a patient with a protease enzyme immobilized to a support in which the enzyme is specific for a pro-inflammatory mediator present in the blood of the patient and is capable of cleaving the pro-inflammatory mediator and thereby reducing the abundance of pro-inflammatory mediator in the blood of the patient prior to the return of the treated blood to the patient.

[0007] In a first aspect, the invention relates to an apparatus for the extracorporeal treatment of blood comprising:

[0008] an extracorporeal blood circuit;

[0009] optionally, a pump configured to provide fluid displacement within the extracorporeal blood circuit; and

[0010] a reaction chamber connected to the extracorporeal blood circuit and configured to receive blood or a pro-inflammatory mediator containing blood fraction from the circuit and treat the blood or pro-inflammatory mediator containing blood fraction, characterized in that the reaction chamber comprises a protease enzyme irreversibly immobilized to a support, in which the protease enzyme is specific for, and capable of irreversibly cleaving, a human pro-inflammatory mediator present in the blood or plasma such that the chemoattractant capability of the pro-inflammatory mediator is reduced or preferably abrogated, wherein the abundance of functional pro-inflammatory mediator in the treated blood or plasma is less than that in the untreated blood or plasma.

[0011] Compared with extracorporeal treatment devices that operate on the basis of adsorption of pro-inflammatory mediators, the apparatus of the invention has a number of advantages. Each molecule of enzyme can cleave a large number of molecules of substrate during a treatment operation; this contrasts with the adsorption process in which the ligand, once bound to its target molecule, is unavailable for binding with further target molecules. Second, the affinity antibody-based approaches of the prior art are susceptible to cross-reacting with non-target molecules, and involve significant costs in the development and generation of suitable antibodies. In contracts, enzymes that are specific to pro-inflammatory mediators are known from the literature, and can be easily produced using recombinant DNA technology.

[0012] Preferably, the pro-inflammatory mediator is selected from a group consisting of, but not limited to: C3a, C4a, C5a, IL-8, IL-6, TNF.alpha., IL-1, or Mig. Thus, in one embodiment, the protease enzyme is capable of cleaving a human pro-inflammatory mediator selected from a group consisting of, but not limited to, C3a, C4a, C5a, IL-8, IL-6, TNF.alpha., IL-1, and Mig.

[0013] In a preferred embodiment, the invention provides an apparatus for the extracorporeal treatment of blood comprising:

[0014] an extracorporeal blood circuit;

[0015] optionally, a pump configured to provide fluid displacement within the extracorporeal blood circuit; and

[0016] a reaction chamber connected to the extracorporeal blood circuit and configured to receive blood or a human C5a-containing blood fraction from the circuit and treat the blood or human C5a-containing blood fraction,

[0017] characterized in that the reaction chamber comprises a protease enzyme irreversibly immobilized to a support, in which the protease enzyme is specific for, and capable of irreversibly cleaving, human C5a present in the blood or blood fraction such that the chemoattractant capability of the cleaved human C5a is reduced, wherein the abundance of the functional human C5a in the treated blood or blood fraction is less than that in the untreated blood or blood fraction.

[0018] As used herein, the term "functional human C5a" should be understood to mean human C5a having chemoattractant capability as determined using the chemoattractant capability assay described below. Likewise, the term "non-functional human C5a" should be understood to mean cleaved C5a protein that has reduced, or is devoid of, chemoattractant capability as determined using the chemoattractant capability assay described below.

[0019] The invention also provides an apparatus for treating human blood or a pro-inflammatory mediator-containing blood fraction, the apparatus comprising a protease enzyme irreversibly bound to a support, in which the protease enzyme is specific for, and capable of irreversibly cleaving, a pro-inflammatory mediator present in the blood or blood fraction such that the chemoattractant capability of the cleaved human pro-inflammatory mediator is reduced.

[0020] The invention also provides an apparatus for treating human blood or a C5a-containing blood fraction, the apparatus comprising a protease enzyme irreversibly bound to a support, in which the protease enzyme is specific for, and capable of irreversibly cleaving, human C5a present in the blood or blood fraction such that the chemoattractant capability of the cleaved human C5a is reduced.

[0021] The invention also provides a protease enzyme comprising the sequence of A-B-C-D, in which:

[0022] A is a protease enzyme that is specific for, and capable of irreversibly cleaving, a human pro-inflammatory mediator present in the blood such that the chemoattractant capability of the cleaved pro-inflammatory mediator is reduced, B is a poly-lysine, poly-cysteine or poly-glutamate motif, C is a spacer (for example a short peptide of 2 to 20 amino acids), and D is a poly-histidine motif.

[0023] Preferably, the protease enzyme is a recombinant bacterial C5a protease comprising a sequence of SEQ ID NO: 3 or a functional variant thereof, typically having at least 70%, 80% or 90% sequence identity with SEQ ID NO: 3.

[0024] The term "functional variant" as applied to SEQ ID NO: 3 means a protease that is specific for, and capable of irreversibly cleaving, human C5a such that the chemoattractant capability of the cleaved human C5a is reduced, or preferably abrogated.

[0025] Examples functional variants of SEQ ID NO: 3 are selected from SEQ ID NO: 4 and SEQ ID NO: 5.

[0026] In one embodiment, the apparatus of the invention includes separating means adapted to separate the blood into a C5a-containing fraction and a non-C5a containing fraction, wherein the reaction chamber receives the C5a-containing fraction. The separating means could be, for example, a filter configured to separate the blood or a fraction thereof into a low-molecular weight containing fraction and a second fraction, wherein the low molecular weight containing fraction is the C5a containing fraction.

[0027] Suitably, the apparatus of the invention includes means configured to recombine the treated C5a-containing fraction (i.e. the low molecular weight fraction) with the second non-C5a containing fraction. The recombined fractions are then returned to the patient.

[0028] In one preferred embodiment of the invention, a C-terminal of the protease enzyme comprises a first tag and a second tag located distally of the first tag and separated from the first tag by a spacer. Typically, the support comprises a coordinated transition metal ion and one or more functional groups. Suitably, the first tag comprises a motif capable of covalently reacting with the one or more functional groups, and wherein the second tag comprises a motif capable of interacting with the coordinated transition metal ion.

[0029] In this manner, the protease enzyme can be oriented with respect to the surface such that the C-terminus of the enzyme is disposed adjacent to the surface (this is achieved by the interaction between the second tag and the coordinated transition metal of the support surface), thus allowing the adjacent first tag to covalently bind to the functional groups on the surface. This will prevent unspecific binding between functional groups on the surface and lysine residues in the protease enzyme.

[0030] Preferably, the first tag is selected from poly-lysine, poly-glutamate, or poly-cysteine tag, and the functional groups on the surface are groups that are capable of covalently binding with these motifs.

[0031] Suitably, the second tag comprises a poly-histidine tag or another tag capable of interaction with a transition metal.

[0032] Preferably, the coordinated transition metal ion is selected from Ni.sup.2+, Co.sup.2+, Zn.sup.2+, and Cu.sup.2+.

[0033] Both tags can be appended onto the DNA sequence by PCR based methods using an oligonucleotide synthesized to contain the required sequence.

[0034] Typically, the support comprises a silica material, preferably a mesoporous silica material, preferably modified monodispersed mesoporous silicate material, and ideally a Ni.sup.2+-modified mesoporous silica material. Other potential materials for the support include but are not limited to methacrylates, polyacrylamides, polypyrroles and polysaccharides.

[0035] Suitably, the support comprises a bead. Preferably, the reaction chamber comprises a column containing a multiplicity of beads.

[0036] The invention also relates to an apparatus of the invention for use in a method for the ex-vivo treatment of blood in a mammal, typically a human. Preferably, the mammal has an inflammatory condition such as sepsis.

[0037] The nucleic acid sequence encoding the bacterial C5a pro-protease, ScpA from Streptococcus pyogenes, is provided in SEQ ID NO: 1 below:

TABLE-US-00001 DNA sequence (SEQ ID NO: 1) GGATCCAATACTGTGACAGAAGACACTCCTGCTACCGAACAAGCCGT AGAAACCCCACAACCAACAGCGGTTTCTGAGGAAGCACCATCATCAT CAAAGGAAACCAAAATCCCACAAACTCCTGGTGATGCAGAAGAAACA GTAGCAGATGACGCTAATGATCTAGCCCCTCAAGCTCCTGCTAAAAC TGCTGATACACCAGCAACCTCAAAAGCGACTATTAGGGATTTGAACG ACCCTTCTCAGGTCAAAACCCTGCAGGAAAAAGCAGGCAAGGGAGCT GGGACTGTTGTTGCAGTGATTGATGCTGGTTTTGATAAAAATCATGA AGCGTGGCGCTTAACAGACAAAACTAAAGCACGTTACCAATCAAAAG AAGATCTTGAAAAAGCTAAAAAAGAGCACGGTATTACCTATGGCGAG TGGGTCAATGATAAGGTTGCTTATTACCACGATTATAGTAAAGATGG TAAAACCGCTGTCGATCAAGAGCACGGCACACACGTGTCAGGGATCT TGTCAGGAAATGCTCCATCTGAAACGAAAGAACCTTACCGCCTAGAA GGTGCGATGCCTGAGGCTCAATTGCTTTTGATGCGTGTCGAAATTGT AAATGGACTAGCAGACTATGCTCGTAACTACGCTCAAGCTATCAGAG ATGCTGTCAACTTGGGAGCTAAGGTGATTAATATGAGCTTTGGTAAT GCTGCACTAGCTTACGCCAACCTTCCAGACGAAACCAAAAAAGCCTT TGACTATGCCAAATCAAAAGGTGTTAGCATTGTGACCTCAGCTGGTA ATGATAGTAGCTTTGGGGGCAAAACCCGTCTACCTCTAGCAGATCAT CCTGATTATGGGGTGGTTGGGACGCCTGCAGCGGCAGACTCAACATT GACAGTTGCTTCTTACAGCCCAGATAAACAGCTCACTGAAACTGCTA CGGTCAAAACAGACGATCATCAAGCTAAAGAAATGCCTGTTCTTTCA ACAAACCGTTTTGAGCCAAACAAGGCTTACGACTATGCTTATGCTAA TCGTGGGATGAAAGAAGATGATTTTAAGGATGTCAAAGGCAAAATTG CCCTTATTGAACGTGGTGATATTGATTTCAAAGATAAGATTGCAAAC GCTAAAAAAGCTGGTGCTGTAGGGGTCTTGATCTATGACAATCAAGA CAAGGGCTTCCCGATTGAATTGCCAAATGTTGATCAGATGCCTGCGG CCTTTATCAGTCGAAAAGACGGTCTCTTATTAAAAGACAATTCTAAA AAAACCATCACCTTCAATGCGACACCTAAGGTATTGCCAACAGCAAG TGACACCAAACTAAGCCGCTTCTCAAGCTGGGGTTTGACAGCTGACG GCAATATTAAGCCAGATATTGCAGCACCCGGCCAAGATATTTTGTCA TCAGTGGCTAACAACAAGTATGCCAAACTTTCTGGAACTAGTATGTC TGCGCCATTGGTAGCGGGTATCATGGGACTATTGCAAAAGCAATATG AGACACAGTATCCTGATATGACACCATCAGAGCGTCTTGATTTAGCT AAAAAAGTATTGATGAGCTCAGCAACTGCCTTATATGATGAAGATGA AAAAGCTTATTTTTCTCCTCGCCAACAAGGAGCAGGAGCAGTCGATG CTAAAAAAGCTTCAGCAGCAACGATGTATGTGACAGATAAGGACAAT ACCTCAAGCAAGGTTCACCTGAACAATGTTTCTGATAAATTTGAAGT AACAGTAACAGTTCACAACAAATCTGATAAACCTCAAGAGTTGTATT ACCAAGCAACTGTTCAAACAGATAAAGTAGATGGAAAACACTTTGCC TTGGCTCCTAAAGCATTGTATGAGACATCATGGCAAAAAATCACAAT TCCAGCCAATAGCAGCAAACAAGTCACCGTTCCAATCGATGCTAGTC GATTTAGCAAGGACTTGCTTGCCCAAATGAAAAATGGCTATTTCTTA GAAGGTTTTGTTCGTTTCAAACAAGATCCTAAAAAAGAAGAGCTTAT GAGCATTCCATATATTGGTTTCCGAGGTGATTTTGGCAATCTGTCAG CCTTAGAAAAACCAATCTATGATAGCAAAGACGGTAGCAGCTACTAT CATGAAGCAAATAGTGATGCCAAAGACCAATTAGATGGTGATGGATT ACAGTTTTACGCTCTGAAAAATAACTTTACAGCACTTACCACAGAGT CTAACCCATGGACGATTATTAAAGCTGTCAAAGAAGGGGTTGAAAAC ATAGAGGATATCGAATCTTCAGAGATCACAGAAACCATTTTTGCAGG TACTTTTGCAAAACAAGACGATGATAGCCACTACTATATCCACCGTC ACGCTAATGGCAAACCATATGCTGCGATCTCTCCAAATGGGGACGGT AACAGAGATTATGTCCAATTCCAAGGTACTTTCTTGCGTAATGCTAA AAACCTTGTGGCTGAAGTCTTGGACAAAGAAGGAAATGTTGTTTGGA CAAGTGAGGTAACCGAGCAAGTTGTTAAAAACTACAACAATGACTTG GCAAGCACACTTGGTTCAACCCGTTTTGAAAAAACGCGTTGGGACGG TAAAGATAAAGACGGCAAAGTTGTTGTTAACGGAACCTACACCTATC GTGTCCGCTACACTCCGATTAGCTCAGGTGCAAAAGAACAACACACT GATTTTGATGTGATTGTAGACAATACGACACCTGAAGTCGCAACATC GGCAACATTCTCAACAGAAGATCGTCGTTTGACACTTGCATCTAAAC CAAAAACCAGCCAACCGATTTACCGTGAGCGTATTGCTTACACTTAT ATGGATGAGGATCTGCCAACAACAGAGTATATTTCTCCAAATGAAGA TGGTACCTTTACTCTTCCTGAAGAGGCTGAAACAATGGAAGGCGGTA CTGTTCCATTGAAAATGTCAGACTTTACTTATGTTGTTGAAGATATG GCTGGTAACATCACTTATACACCAGTGACTAAGCTATTGGAGGGCCA CTCTTAA

[0038] The amino acid sequence of the bacterial C5a pro-protease, ScpA from Streptococcus pyogenes, is provided in SEQ ID NO: 2 below:

TABLE-US-00002 Protein sequence (SEQ ID NO: 2) GPLGSNTVTEDTPATEQAVETPQPTAVSEEAPSSSKETKIPQTPGDAEE TVADDANDLAPQAPAKTADTPATSKATIRDLNDPSQVKTLQEKASKGAG TVVAVIDAGFDKNHEAWRLTDKTKARYQSKEDLEKAKKEHGITYGEWVN DKVAYYHDYSKDGKTAVDQEHGTHVSGILSGNAPSETKEPYRLEGAMPE AQLLLMRVEIVNGLADYARNYAQAIRDAVNLGAKVINMSFGNAALAYAN LPDETKKAFDYAKSKGVSIVTSAGNDSSFGGKTRLPLADHPDYGVVGTP AAADSTLTVASYSPDKQLTETATVKTDDHQAKEMPVLSTNRFEPNKAYD YAYANRGMKEDDFKDVKGKIALIERGDIDFKDKIANAKKAGAVGVLIYD NQDKGFPIELPNVDQMPAAFISRKDGLLLKDNSKKTITFNATPKVLPTA SDTKLSRFSSWGLTADGNIKPDIAAPGQDILSSVANNKYAKLSGTSMSA PLVAGIMGLLQKQYETQYPDMTPSERLDLAKKVLMSSATALYDEDEKAY FSPRQQGAGAVDAKKASAATMYVTDKDNTSSKVHLNNVSDKFEVTVTVH NKSDKPQELYYQATVQTDKVDGKHFALAPKALYETSWQKITIPANSSKQ VTVPIDASRFSKDLLAQMKNGYFLEGFVRFKQDPKKEELMSIPYIGFRG DFGNLSALEKPIYDSKDGSSYYHEANSDAKDQLDGDGLQFYALKNNFTA LTTESNPWTIIKAVKEGVENIEDIESSEITETIFAGTFAKQDDDSHYYI HRHANGKPYAAISPNGDGNRDYVQFQGTFLRNAKNLVAEVLDKEGNVVW TSEVTEQVVKNYNNDLASTLGSTRFEKTRWDGKDKDGKVVVNGTYTYRV RYTPISSGAKEQHTDFDVIVDNTTPEVATSATFSTEDRRLTLASKPKTS QPIYRERIAYTYMDEDLPTTEYISPNEDGTFTLPEEAETMEGGTVPLKM SDFTYVVEDMAGNITYTPVTKLLEGHS

[0039] The amino acid sequence of mature bacterial C5a protease, ScpA from Streptococcus pyogenes, is provided in SEQ ID NO: 3 below:

TABLE-US-00003 AEETVADDANDLAPQAPAKTADTPATSKATIRDLNDPSQVKTLQEKASK GAGTVVAVIDAGFDKNHEAWRLTDKTKARYQSKEDLEKAKKEHGITYGE WVNDKVAYYHDYSKDGKTAVDQEHGTHVSGILSGNAPSETKEPYRLEGA MPEAQLLLMRVEIVNGLADYARNYAQAIRDAVNLGAKVINMSFGNAALA YANLPDETKKAFDYAKSKGVSIVTSAGNDSSFGGKTRLPLADHPDYGVV GTPAAADSTLTVASYSPDKQLTETATVKTDDHQAKEMPVLSTNRFEPNK AYDYAYANRGMKEDDFKDVKGKIALIERGDIDFKDKIANAKKAGAVGVL IYDNQDKGFPIELPNVDQMPAAFISRKDGLLLKDNSKKTITFNATPKVL PTASDTKLSRFSSWGLTADGNIKPDIAAPGQDILSSVANNKYAKLSGTS MSAPLVAGIMGLLQKQYETQYPDMTPSERLDLAKKVLMSSATALYDEDE KAYFSPRQQGAGAVDAKKASAATMYVTDKDNTSSKVHLNNVSDKFEVTV TVHNKSDKPQELYYQATVQTDKVDGKHFALAPKALYETSWQKITIPANS SKQVTVPIDASRFSKDLLAQMKNGYFLEGFVRFKQDPKKEELMSIPYIG FRGDFGNLSALEKPIYDSKDGSSYYHEANSDAKDQLDGDGLQFYALKNN FTALTTESNPWTIIKAVKEGVENIEDIESSEITETIFAGTFAKQDDDSH YYIHRHANGKPYAAISPNGDGNRDYVQFQGTFLRNAKNLVAEVLDKEGN VVWTSEVTEQVVKNYNNDLASTLGSTRFEKTRWDGKDKDGKVVVNGTYT YRVRYTPISSGAKEQHTDFDVIVDNTTPEVATSATFSTEDRRLTLASKP KTSQPIYRERIAYTYMDEDLPTTEYISPNEDGTFTLPEEAETMEGGTVP LKMSDFTYVVEDMAGNITYTPVTKLLEGHS

[0040] The amino acid sequence of a first variant of mature bacterial C5a protease, ScpA from Streptococcus pyogenes, is provided in SEQ ID NO: 4 below:

TABLE-US-00004 DANDLAPQAPAKTADTPATSKATIRDLNDPSQVKTLQEKASKGAGTVVA VIDAGFDKNHEAWRLTDKTKARYQSKEDLEKAKKEHGITYGEWVNDKVA YYHDYSKDGKTAVDQEHGTHVSGILSGNAPSETKEPYRLEGAMPEAQLL LMRVEIVNGLADYARNYAQAIRDAVNLGAKVINMSFGNAALAYANLPDE TKKAFDYAKSKGVSIVTSAGNDSSFGGKTRLPLADHPDYGVVGTPAAAD STLTVASYSPDKQLTETATVKTDDHQAKEMPVLSTNRFEPNKAYDYAYA NRGMKEDDFKDVKGKIALIERGDIDFKDKIANAKKAGAVGVLIYDNQDK GFPIELPNVDQMPAAFISRKDGLLLKDNSKKTITFNATPKVLPTASDTK LSRFSSWGLTADGNIKPDIAAPGQDILSSVANNKYAKLSGTSMSAPLVA GIMGLLQKQYETQYPDMTPSERLDLAKKVLMSSATALYDEDEKAYFSPR QQGAGAVDAKKASAATMYVTDKDNTSSKVHLNNVSDKFEVTVTVHNKSD KPQELYYQATVQTDKVDGKHFALAPKALYETSWQKITIPANSSKQVTVP IDASRFSKDLLAQMKNGYFLEGFVRFKQDPKKEELMSIPYIGFRGDFGN LSALEKPIYDSKDGSSYYHEANSDAKDQLDGDGLQFYALKNNFTALTTE SNPWTIIKAVKEGVENIEDIESSEITETIFAGTFAKQDDDSHYYIHRHA NGKPYAAISPNGDGNRDYVQFQGTFLRNAKNLVAEVLDKEGNVVWTSEV TEQVVKNYNNDLASTLGSTRFEKTRWDGKDKDGKVVVNGTYTYRVRYTP ISSGAKEQHTDFDVIVDNTTPEVATSATFSTEDRRLTLASKPKTSQPIY RERIAYTYMDEDLPTTEYISPNEDGTFTLPEEAETMEGGTVPLKMSDFT YVVEDMAGNITYTPVTKLLEGHS

[0041] The amino acid sequence of a second variant of mature bacterial C5a protease, ScpA from Streptococcus pyogenes, is provided in SEQ ID NO: 5 below:

TABLE-US-00005 KTADTPATSKATIRDLNDPSQVKTLQEKASKGAGTVVAVIDAGFDKNHE AWRLTDKTKARYQSKEDLEKAKKEHGITYGEWVNDKVAYYHDYSKDGKT AVDQEHGTHVSGILSGNAPSETKEPYRLEGAMPEAQLLLMRVEIVNGLA DYARNYAQAIRDAVNLGAKVINMSFGNAALAYANLPDETKKAFDYAKSK GVSIVTSAGNDSSFGGKTRLPLADHPDYGVVGTPAAADSTLTVASYSPD KQLTETATVKTDDHQAKEMPVLSTNRFEPNKAYDYAYANRGMKEDDFKD VKGKIALIERGDIDFKDKIANAKKAGAVGVLIYDNQDKGFPIELPNVDQ MPAAFISRKDGLLLKDNSKKTITFNATPKVLPTASDTKLSRFSSWGLTA DGNIKPDIAAPGQDILSSVANNKYAKLSGTSMSAPLVAGIMGLLQKQYE TQYPDMTPSERLDLAKKVLMSSATALYDEDEKAYFSPRQQGAGAVDAKK ASAATMYVTDKDNTSSKVHLNNVSDKFEVTVTVHNKSDKPQELYYQATV QTDKVDGKHFALAPKALYETSWQKITIPANSSKQVTVPIDASRFSKDLL AQMKNGYFLEGFVRFKQDPKKEELMSIPYIGFRGDFGNLSALEKPIYDS KDGSSYYHEANSDAKDQLDGDGLQFYALKNNFTALTTESNPWTIIKAVK EGVENIEDIESSEITETIFAGTFAKQDDDSHYYIHRHANGKPYAAISPN GDGNRDYVQFQGTFLRNAKNLVAEVLDKEGNVVWTSEVTEQVVKNYNND LASTLGSTRFEKTRWDGKDKDGKVVVNGTYTYRVRYTPISSGAKEQHTD FDVIVDNTTPEVATSATFSTEDRRLTLASKPKTSQPIYRERIAYTYMDE DLPTTEYISPNEDGTFTLPEEAETMEGGTVPLKMSDFTYVVEDMAGNIT YTPVTKLLEGHS

[0042] The proteases of SEQ ID NO:s 2, 3, 4 and 5 are all capable of cleaving human C5a such that the chemoattractant capability of the cleaved protease is abrogated.

[0043] The amino acid sequence of C5a protein is provided in SEQ ID NO: 6 below.

TABLE-US-00006 C5a protein (SEQ ID NO: 6) MLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKA FTECCVVASQLRANISHKDMQLGR

[0044] Other proteases that are specific to, and capable of cleaving, human C5a include ScpB from Streptococcus agalactiae, and functional variants thereof (Brown et al). Examples of protease enzymes capable of specifically cleaving IL-8 include ScpC from Streptococcus pyogenes, SpyCEP from Streptococcus agalactiae and functional variants thereof (Fritzer et al, Kaur et al, Zinkernagel et al, Sjolinder et al, and Hidalgo et al)

[0045] Examples of protease enzymes capable of specifically cleaving IL-6 include a published Pseudomonas enzyme which degrades it completely (Matheson et al). Also gingipains K and R seem to have degrading activity against several mediators, but lack specificity required.

[0046] Suitably, the apparatus further comprising means of separating whole blood into a plasma fraction and a cellular fraction, and means for recombining the cellular fraction with the treated plasma fraction. In a separation process, the plasma in the patient's blood is typically segregated from its remaining constituents. The separated plasma is mixed with an acetate buffer saturated with heparin. This lowers the plasma's degree of acidity (pH value) to 5.12, causing the LDL cholesterol, Lp(a) and fibrinogen to drop selectively out of the plasma. Together with the heparin additive, the separated constituents form insoluble precipitates which can be removed from the plasma in a single filtration stage. Unused surplus heparin is held back in a separate adsorber, and bicarbonate ultrafiltration is used to restore the purified plasma to the physiologically acceptable level. The selectively treated, purified plasma is then remixed with the remaining blood constituents and supplied back to the patient. During H.E.L.P. apheresis, these four steps (plasma separation, precipitation with subsequent filtration, heparin adsorption and ultrafiltration) are performed by a single device, the PLASMAT Futura. Examples of devices capable of separating whole blood into a plasma fraction and a cellular fraction in extracorporeal blood circuits are known to the person skilled in the art, and include plasmaphoresis equipment (for example B Braun PLASMAT Futura) and hemodialysis equipment (for example Gambro PHEONIX found on the World Wide Web at gambro.com/en/global/Products/Hemodialysis/Monitors/Phoenix-dialysis-syst- em/).

[0047] Typically, the reaction chamber comprises a column comprising beads in which the enzyme is immobilized to the beads. Alternatively, the reaction chamber may comprise a cartridge.

[0048] In a further aspect, the invention relates to a method for the treatment or prevention of an inflammatory condition in a human comprising the steps of reacting blood that has been removed from the patient, or a pro-inflammatory mediator containing fraction of the blood, with a protease enzyme immobilized to a support, in which the protease enzyme is specific for, and capable of irreversibly cleaving, a human pro-inflammatory mediator present in the blood or fraction such that the chemoattractant capability of the pro-inflammatory mediator is reduced or preferably abrogated, wherein the abundance of functional pro-inflammatory mediator in the treated blood or fraction is less than that in the untreated blood or fraction.

[0049] Typically, the human pro-inflammatory mediator is selected from the group consisting of, but not limited to, C3a, C4a, C5a, IL-8, IL-6, TNF.alpha., IL-1, and Mig.

[0050] In a further aspect, the invention relates to a method for the treatment or prevention of an inflammatory condition in a human comprising the steps of reacting blood that has been removed from the patient, or a pro-inflammatory mediator containing fraction of the blood, with a protease enzyme immobilized to a support, in which the protease enzyme is specific for, and capable of irreversibly cleaving, human C5a present in the blood or fraction such that the chemoattractant capability of the cleaved human C5a is reduced or preferably abrogated, wherein the abundance of functional C5a in the treated blood or fraction is less than that in the untreated blood or plasma.

[0051] Suitably, the method includes the steps of separating the blood into a plasma fraction and a cellular fraction, treating the plasma fraction, and then recombining the cellular fraction with the treated plasma fraction prior to returning the blood to the patient.

[0052] Alternatively, or in addition, the method includes the steps of separating the blood into a C5a containing fraction (for example, a low molecular weight fraction) fraction and a second fraction, treating the C5a containing fraction, and then recombining the second fraction with the treated C5a containing fraction prior to returning the blood to the patient.

[0053] Typically, the method is carried out in a continuous fashion using an extracorporeal blood circuit.

[0054] Suitably, the protease enzyme is a recombinant protein.

[0055] The invention also relates to a support and a recombinant protease enzyme immobilized to the support, in which the recombinant protease enzyme comprises a C-terminal poly-histidine tag and a C-terminal poly-lysine tag, and in which the recombinant protease enzyme comprises a protease that is specific for, and capable of irreversibly cleaving, a human pro-inflammatory mediator present in the blood or plasma.

[0056] In this specification, the term "extracorporeal blood circuit" should be understood to mean an arrangement of conduits capable of removing blood from the body for treatment outside of the body and returning the thus treated blood to the body.

[0057] In this specification, the term "reaction chamber" should be understood to mean a chamber adapted to receive blood or plasma from the extracorporeal blood circuit and allow contact between the blood or plasma and protease enzyme that is immobilized to a support within the reaction chamber.

[0058] In this specification, the term "plasma" should be understood to mean blood from which cells have been fully or partially removed.

[0059] In this specification, the term "pro-inflammatory mediator" should be understood to mean a host proteinaceous entity produced in the auto-immune or sepsis response which stimulates other components of the host immune system, in particular causing migration or stimulation of leukocytes of any class and progenitor forms of these cells. Specific examples of pro-inflammatory mediators specific to the human inflammatory response include C3a, C4a, C5a, IL-8, IL-6, TNF.alpha., IL-1, and Mig.

[0060] In the specification, the term "protease enzyme that is specific for a human pro-inflammatory mediator" should be understood to mean an enzyme with the capacity to selectively, or ideally solely, break peptide bonds of pro-inflammatory mediators of human origin by hydrolysis. The protease may also be derived from the parent protease, and modified to include a functionalization group, for example one or more of a poly-histidine, poly-lysine, or poly-glutamic acid tag.

[0061] In this specification, the term "functional variant thereof" as applied to a specific protease enzyme should be understood to mean a variant of the protease enzyme that retains the ability to specifically bind and irreversibly cleave the target pro-inflammatory mediator such that the chemoattractant activity of the cleaved pro-inflammatory mediator is reduced or abrogated. Thus, for example, a functional variant of ScpA from Streptococcus pyogenes includes variant ScpA proteases that have the ability to specifically bind and irreversibly cleave the human C5a protein such that the chemoattractant capability of the cleaved protease is reduced or abrogated, and include ScpA proteases from Streptococcus pyogenes (SEQ ID NO:2, 3, 4, 5) and other Streptococcal species. The term "variant" should be understood to mean proteins or polypeptides that have at least 70% sequence homology with the reference protease, and that are altered in respect of one or more amino acid residues. Preferably such alterations involve the insertion, addition, deletion and/or substitution of 20, 10, 5 or fewer amino acids, more preferably of 4 or fewer, even more preferably of 3 or fewer, most preferably of 1 or 2 amino acids only. Insertion, addition, and substitution with natural and modified amino acids is envisaged. The variant may have conservative amino acid changes, wherein the amino acid being introduced is similar structurally, chemically, or functionally to that being substituted. Typically, proteins which have been altered by substitution or deletion of catalytically-important residues will be excluded from the term "variant". For any given protease enzyme, details of such catalytically-important residues will be well known to those skilled in the art. Generally, the variant will have at least 70% amino acid sequence homology, preferably at least 80% sequence homology, more preferably at least 90% sequence homology, and ideally at least 95%, 96%, 97%, 98% or 99% sequence homology with the reference protease. In this context, sequence homology comprises both sequence identity and similarity, i.e. a polypeptide sequence that shares 90% amino acid homology with wild-type bacterial mature C5a peptidase is one in which any 90% of aligned residues are either identical to, or conservative substitutions of, the corresponding residues in wild-type bacterial C5a peptidase. Substitution may be conservative or non-conservative substitution, and may involve use of natural amino acids or amino acid analogues.

[0062] The term "variant" is also intended to include chemical derivatives of a protease, i.e. where one or more residues of a protease is chemically derivatized by reaction of a functional side group. Also included within the term variant are protease molecules in which naturally occurring amino acid residues are replaced with amino acid analogues.

[0063] Proteins and polypeptides (including variants and fragments thereof) of and for use in the invention may be generated wholly or partly by chemical synthesis or by expression from nucleic acid. The proteins and peptides of and for use in the present invention can be readily prepared according to well-established, standard liquid or, preferably, solid-phase peptide synthesis methods known in the art (see, for example, J. M. Stewart et al).

[0064] In this specification, the term "inflammatory condition" means a condition in which the host mounts a response to an assault. Examples of imflammatory conditions include chronic or acute inflammatory conditions including sepsis, septic shock, systemic inflammatory response syndrome, multiple organ dysfunction syndrome, hyper-reactive airway disease, allergic reaction.

[0065] In a different aspect, the invention provides a method of attaching a molecule comprising a polyaminoacid sequence to a surface, in which the C-terminal of the protease enzyme comprises a first tag and a second tag located distally of the first tag and separated from the first tag by a spacer, and in which the support comprises a coordinated transition metal ion and one or more functional groups, and in which the first tag comprises a motif capable of covalently reacting with the one or functional groups, and wherein the second tag comprises a motif capable of interacting with the coordinated transition metal ion, the method comprising the step of reacting the molecule comprising a polyaminoacid sequence with the surface.

BRIEF DESCRIPTION OF THE DRAWINGS

[0066] The invention description below refers to the accompanying drawings, of which:

[0067] FIG. 1 is a Diagrammatic representation of blood purifying invention.

[0068] The diagram shows the components and blood flow route envisaged for the implementation of the invention. Blood is removed from the patient and fractionated into a high protein plasma fraction and a high blood cell fraction. The former is passed over the active material (immobilized enzyme) in the reaction chamber and then recombined with the latter before return to the patient. Components of the invention are labeled: 1 the overall invention, 2 the extracorporeal blood purification device, 3 blood withdrawal line, 4 patient arm, 5 blood return line, 6 pumping system, 7 blood separator, 8 reaction chamber, 9 cartridge housing blood separation chambers, 10a and 10b blood separation chambers, 11 biocompatible size restrictive semi-permeable membrane, 12 line delivering protein rich plasma to reaction chamber, 13 line delivering blood cell rich fraction to mixing chamber, 14 line delivering treated plasma to mixing chamber, 15 mixing chamber for blood reconstitution, 16 vessel housing active component of reaction chamber, 17 reactive material comprising immobilized enzyme irreversibly coupled to solid support material.

[0069] FIG. 2a shows SDS-PAGE analysis of C5a untreated (-) and treated (+) with ScpA; and

[0070] FIG. 2b shows the scissile bond in the C5a sequence confirmed by Mass Spec analysis of C5a cleaved with ScpA.

DETAILED DESCRIPTION

[0071] Referring to FIG. 1, there is provided an apparatus for the extracorporeal treatment of blood according to the invention, and indicated generally by the reference numeral 1. The apparatus 1 comprises an extracorporeal blood circuit 2, having a feed line 3 for withdrawing blood from a patients arm 4 for treatment and a return line 5 for returning treated blood to the patient, and an adjustable pump 6 provided in the feed line for providing blood displacement within the blood circuit 2.

[0072] The apparatus also includes a blood separator 7 and a reaction chamber 8 in the circuit 2, the separator 7 being provided upstream of the reaction chamber 8. The separator comprises a cartridge 9 having two chambers 10a and 10b separated by a semi-permeable membrane 11 adapted to allow separation of blood proteins from blood cells. The whole blood passes from the patient to the first chamber 10a, where proteins in blood plasma pass into the second chamber 10b forming a protein rich plasma fraction in the second chamber and leaving blood cells in the first chamber 10a. A tube 12 is provided to transfer the thus-formed protein rich fraction plasma from the second chamber 10b to the reaction chamber 8 where it is treated. A further tube 13 is provided to transfer the cell rich fraction from the first chamber 10a to re-join with treated plasma distally of the reaction chamber 8 at a mixing chamber 15 where the two fractions are mixed prior to being returned to the patient via the whole blood return line 5.

[0073] The reaction chamber comprises a cylindrical vessel 16 filled with functionalized support material 17 containing the immobilized enzyme, thereby providing a large surface area for the treatment of the incoming plasma. The tube 12 feeds into a top of the cylindrical vessel 16, and the plasma filters through the cylinder before exiting the vessel through a tube 14.

[0074] Mesoporous silica (MPS) materials (including but not limited to MCM, SBA, MCF and PMO type materials) are prepared using a templated synthesis method. Ideally these particles will be monodispersed in nature. The particles will have a specific particle size in the range of 0.1-50 .mu.m, contain nanopores with a final internal diameter in the range 8-12 nm and have a high surface area 300-800 m.sup.2g.sup.-1.

[0075] The surface characteristics of the silica nanocarriers will be modified with a range of functional groups (e.g. --NH2, --COOH, --SH) directly during synthesis of the material, or by post synthesis grafting to facilitate covalent coupling (through the poly-Gluamate or poly-Lysine or Cysteine residues respectively) of the enzyme to the surface after orientation specific adsorption.

[0076] The Ni.sup.2+-modified MPS will be prepared by attachment of 3-iodo-trimethoxypropylsilane to the silicate surface followed by reaction with cyclam and incorporation of the metal ion. This is to generate immobilization of the protease in a controlled orientation.

[0077] In use, the extracorporeal blood circuit is connected to a patient, generally an arm of a patient, and the pump is actuated to withdraw blood from the patient and pump it through the circuit. The whole blood from the patient enters the separator 7 and is separated under pressure into the two fractions. The plasma fraction is pumped from the second chamber 10b to the reaction chamber 8 where the blood percolates through the functionalized cassette bed 17. In the reaction chamber, mediator in the plasma binds to the protease enzyme that is immobilized to the support material, and is cleaved into an inactive form that is released back into the plasma leaving the immobilized enzyme free for another reaction. As a result of the plasma passing through the reaction chamber, the concentration of functional mediator in the plasma is significantly reduced. The thus treated plasma is then pumped to the mixing chamber 15 where it rejoins with the cell rich fraction to form whole blood that is significantly depleted of active mediator protein. The whole blood is returned to the patient via the return line 5.

[0078] It will be appreciated that the use of a separator to filter the blood prior to treatment is optional, and that the treatment of whole blood in the reaction chamber forms part of the invention.

Experimental

[0079] Materials and Methods

[0080] C5a Peptidase Activity Assays

[0081] Recombinant C5a was produced as an N-term His-tagged fusion (HT-C5a) in accordance with the method of Toth et al., and chemoattractant activity was verified in an under-agarose migration assay (data not shown). The C5a-ase activity of ScpA was demonstrated in reactions consisting of 42 nM ScpA with 37 .mu.M HT-C5a, in 50 mM Tris/HCl (pH 7.5), 100 mM NaCl, and 5 mM CaCl.sub.2 for 30 min at 20.degree. C. The observed C5a-ase activity was independent of the presence of Complete Mini EDTAfree inhibitor cocktail (Roche). Matrix-assisted laser desorption ionization time-of-flight mass spectrometry analysis of cleaved HT-C5a was performed.

[0082] Results

[0083] The activity assay showed that the ScpA cleaved C5a at a single site (FIG. 2a). MS analysis indicated a loss of 830 Da, consistent with the removal of seven residues from the C terminal (FIG. 2b) which removes chemoattractant capabilities.

[0084] The invention is not limited to the embodiments hereinbefore described which may be varied in construction and detail without departing from the spirit of the invention.

REFERENCES

[0085] Brown C K, Gu Z Y, Matsuka Y V, Purushothaman S S, Winter L A, Cleary P P, Olmsted S B, Ohlendorf D H, Earhart C A. Structure of the streptococcal cell wall C5a peptidase. Proc Natl Acad Sci USA. 2005 Dec. 20; 102(51):18391-6. Epub 2005 Dec. 12. PubMed PMID: 16344483; PubMed Central PMCID: PMC1317908.

[0086] Fritzer A, Noiges B, Schweiger D, Rek A, Kungl A J, von Gabain A, Nagy E, Meinke A L. Chemokine degradation by the Group A streptococcal serine proteinase ScpC can be reconstituted in vitro and requires two separate domains. Biochem J. 2009 Aug. 27; 422(3):533-42. doi: 10.1042/BJ20090278. PubMed PMID: 19552626.

[0087] Kaur S J, Nerlich A, Bergmann S, Rohde M, Fulde M, Zahner D, Hanski E, Zinkernagel A, Nizet V, Chhatwal G S, Talay S R. The CXC chemokine-degrading protease SpyCep of Streptococcus pyogenes promotes its uptake into endothelial cells. J Biol Chem. 2010 Sep. 3; 285(36):27798-805. doi: 10.1074/jbc.M109.098053. Epub 2010 Jun. 18. PubMed PMID: 20562101; PubMed Central PMCID: PMC2934647.

[0088] Zinkernagel A S, Timmer A M, Pence M A, Locke J B, Buchanan J T, Turner C E, Mishalian I, Sriskandan S, Hanski E, Nizet V. The IL-8 protease SpyCEP/ScpC of group A Streptococcus promotes resistance to neutrophil killing. Cell Host Microbe. 2008 Aug. 14; 4(2):170-8. doi: 10.1016/j.chom.2008.07.002. PubMed PMID: 18692776; PubMed Central PMCID: PMC2631432.

[0089] Sjolinder H, Lovkvist L, Plant L, Eriksson J, Aro H, Jones A, Jonsson A B. The ScpC protease of Streptococcus pyogenes affects the outcome of sepsis in a murine model. Infect Immun. 2008 September; 76(9):3959-66. doi: 10.1128/IAI.00128-08. Epub 2008 Jun. 23. PubMed PMID: 18573900; PubMed Central PMCID: PMC2519448.

[0090] Hidalgo-Grass C, Mishalian I, Dan-Goor M, Belotserkovsky I, Eran Y, Nizet V, Peled A, Hanski E. A streptococcal protease that degrades CXC chemokines and impairs bacterial clearance from infected tissues. EMBO J. 2006 Oct. 4; 25(19):4628-37. Epub 2006 Sep. 14. PubMed PMID: 16977314; PubMed Central PMCID: PMC1589981.

[0091] Matheson N R, Potempa J, Travis J. Interaction of a novel form of Pseudomonas aeruginosa alkaline protease (aeruginolysin) with interleukin-6 and interleukin-8. Biol Chem. 2006 July; 387(7):911-5. PubMed PMID: 16913841.

[0092] J. M. Stewart and J. D. Young, Solid Phase Peptide Synthesis, 2nd edition, Pierce Chemical Company, Rockford, Ill. (1984), in M. Bodanzsky and A. Bodanzsky, The Practice of Peptide Synthesis, Springer Verlag, New York (1984).

[0093] Toth, M. J., Huwyler, L., Boyar, W. C., Braunwalder, A. F., Yarwood, D., Hadala, J., Haston, W. O., Sills, M. A., Seligmann, B., Galakatos, N. The pharmacophore of the human C5a anaphylatoxin. Protein Sci. 3:1159-1168, 1994.

Sequence CWU 1

1

613015DNAStreptococcus pyogenesmisc_feature(1)..(3015)Gene encoding ScpA 1ggatccaata ctgtgacaga agacactcct gctaccgaac aagccgtaga aaccccacaa 60ccaacagcgg tttctgagga agcaccatca tcatcaaagg aaaccaaaat cccacaaact 120cctggtgatg cagaagaaac agtagcagat gacgctaatg atctagcccc tcaagctcct 180gctaaaactg ctgatacacc agcaacctca aaagcgacta ttagggattt gaacgaccct 240tctcaggtca aaaccctgca ggaaaaagca ggcaagggag ctgggactgt tgttgcagtg 300attgatgctg gttttgataa aaatcatgaa gcgtggcgct taacagacaa aactaaagca 360cgttaccaat caaaagaaga tcttgaaaaa gctaaaaaag agcacggtat tacctatggc 420gagtgggtca atgataaggt tgcttattac cacgattata gtaaagatgg taaaaccgct 480gtcgatcaag agcacggcac acacgtgtca gggatcttgt caggaaatgc tccatctgaa 540acgaaagaac cttaccgcct agaaggtgcg atgcctgagg ctcaattgct tttgatgcgt 600gtcgaaattg taaatggact agcagactat gctcgtaact acgctcaagc tatcagagat 660gctgtcaact tgggagctaa ggtgattaat atgagctttg gtaatgctgc actagcttac 720gccaaccttc cagacgaaac caaaaaagcc tttgactatg ccaaatcaaa aggtgttagc 780attgtgacct cagctggtaa tgatagtagc tttgggggca aaacccgtct acctctagca 840gatcatcctg attatggggt ggttgggacg cctgcagcgg cagactcaac attgacagtt 900gcttcttaca gcccagataa acagctcact gaaactgcta cggtcaaaac agacgatcat 960caagctaaag aaatgcctgt tctttcaaca aaccgttttg agccaaacaa ggcttacgac 1020tatgcttatg ctaatcgtgg gatgaaagaa gatgatttta aggatgtcaa aggcaaaatt 1080gcccttattg aacgtggtga tattgatttc aaagataaga ttgcaaacgc taaaaaagct 1140ggtgctgtag gggtcttgat ctatgacaat caagacaagg gcttcccgat tgaattgcca 1200aatgttgatc agatgcctgc ggcctttatc agtcgaaaag acggtctctt attaaaagac 1260aattctaaaa aaaccatcac cttcaatgcg acacctaagg tattgccaac agcaagtgac 1320accaaactaa gccgcttctc aagctggggt ttgacagctg acggcaatat taagccagat 1380attgcagcac ccggccaaga tattttgtca tcagtggcta acaacaagta tgccaaactt 1440tctggaacta gtatgtctgc gccattggta gcgggtatca tgggactatt gcaaaagcaa 1500tatgagacac agtatcctga tatgacacca tcagagcgtc ttgatttagc taaaaaagta 1560ttgatgagct cagcaactgc cttatatgat gaagatgaaa aagcttattt ttctcctcgc 1620caacaaggag caggagcagt cgatgctaaa aaagcttcag cagcaacgat gtatgtgaca 1680gataaggaca atacctcaag caaggttcac ctgaacaatg tttctgataa atttgaagta 1740acagtaacag ttcacaacaa atctgataaa cctcaagagt tgtattacca agcaactgtt 1800caaacagata aagtagatgg aaaacacttt gccttggctc ctaaagcatt gtatgagaca 1860tcatggcaaa aaatcacaat tccagccaat agcagcaaac aagtcaccgt tccaatcgat 1920gctagtcgat ttagcaagga cttgcttgcc caaatgaaaa atggctattt cttagaaggt 1980tttgttcgtt tcaaacaaga tcctaaaaaa gaagagctta tgagcattcc atatattggt 2040ttccgaggtg attttggcaa tctgtcagcc ttagaaaaac caatctatga tagcaaagac 2100ggtagcagct actatcatga agcaaatagt gatgccaaag accaattaga tggtgatgga 2160ttacagtttt acgctctgaa aaataacttt acagcactta ccacagagtc taacccatgg 2220acgattatta aagctgtcaa agaaggggtt gaaaacatag aggatatcga atcttcagag 2280atcacagaaa ccatttttgc aggtactttt gcaaaacaag acgatgatag ccactactat 2340atccaccgtc acgctaatgg caaaccatat gctgcgatct ctccaaatgg ggacggtaac 2400agagattatg tccaattcca aggtactttc ttgcgtaatg ctaaaaacct tgtggctgaa 2460gtcttggaca aagaaggaaa tgttgtttgg acaagtgagg taaccgagca agttgttaaa 2520aactacaaca atgacttggc aagcacactt ggttcaaccc gttttgaaaa aacgcgttgg 2580gacggtaaag ataaagacgg caaagttgtt gttaacggaa cctacaccta tcgtgtccgc 2640tacactccga ttagctcagg tgcaaaagaa caacacactg attttgatgt gattgtagac 2700aatacgacac ctgaagtcgc aacatcggca acattctcaa cagaagatcg tcgtttgaca 2760cttgcatcta aaccaaaaac cagccaaccg atttaccgtg agcgtattgc ttacacttat 2820atggatgagg atctgccaac aacagagtat atttctccaa atgaagatgg tacctttact 2880cttcctgaag aggctgaaac aatggaaggc ggtactgttc cattgaaaat gtcagacttt 2940acttatgttg ttgaagatat ggctggtaac atcacttata caccagtgac taagctattg 3000gagggccact cttaa 301521007PRTStreptococcus pyogenesMISC_FEATURE(1)..(1007)ScpA pro-protease 2Gly Pro Leu Gly Ser Asn Thr Val Thr Glu Asp Thr Pro Ala Thr Glu1 5 10 15Gln Ala Val Glu Thr Pro Gln Pro Thr Ala Val Ser Glu Glu Ala Pro 20 25 30Ser Ser Ser Lys Glu Thr Lys Ile Pro Gln Thr Pro Gly Asp Ala Glu 35 40 45Glu Thr Val Ala Asp Asp Ala Asn Asp Leu Ala Pro Gln Ala Pro Ala 50 55 60Lys Thr Ala Asp Thr Pro Ala Thr Ser Lys Ala Thr Ile Arg Asp Leu65 70 75 80Asn Asp Pro Ser Gln Val Lys Thr Leu Gln Glu Lys Ala Ser Lys Gly 85 90 95Ala Gly Thr Val Val Ala Val Ile Asp Ala Gly Phe Asp Lys Asn His 100 105 110Glu Ala Trp Arg Leu Thr Asp Lys Thr Lys Ala Arg Tyr Gln Ser Lys 115 120 125Glu Asp Leu Glu Lys Ala Lys Lys Glu His Gly Ile Thr Tyr Gly Glu 130 135 140Trp Val Asn Asp Lys Val Ala Tyr Tyr His Asp Tyr Ser Lys Asp Gly145 150 155 160Lys Thr Ala Val Asp Gln Glu His Gly Thr His Val Ser Gly Ile Leu 165 170 175Ser Gly Asn Ala Pro Ser Glu Thr Lys Glu Pro Tyr Arg Leu Glu Gly 180 185 190Ala Met Pro Glu Ala Gln Leu Leu Leu Met Arg Val Glu Ile Val Asn 195 200 205Gly Leu Ala Asp Tyr Ala Arg Asn Tyr Ala Gln Ala Ile Arg Asp Ala 210 215 220Val Asn Leu Gly Ala Lys Val Ile Asn Met Ser Phe Gly Asn Ala Ala225 230 235 240Leu Ala Tyr Ala Asn Leu Pro Asp Glu Thr Lys Lys Ala Phe Asp Tyr 245 250 255Ala Lys Ser Lys Gly Val Ser Ile Val Thr Ser Ala Gly Asn Asp Ser 260 265 270Ser Phe Gly Gly Lys Thr Arg Leu Pro Leu Ala Asp His Pro Asp Tyr 275 280 285Gly Val Val Gly Thr Pro Ala Ala Ala Asp Ser Thr Leu Thr Val Ala 290 295 300Ser Tyr Ser Pro Asp Lys Gln Leu Thr Glu Thr Ala Thr Val Lys Thr305 310 315 320Asp Asp His Gln Ala Lys Glu Met Pro Val Leu Ser Thr Asn Arg Phe 325 330 335Glu Pro Asn Lys Ala Tyr Asp Tyr Ala Tyr Ala Asn Arg Gly Met Lys 340 345 350Glu Asp Asp Phe Lys Asp Val Lys Gly Lys Ile Ala Leu Ile Glu Arg 355 360 365Gly Asp Ile Asp Phe Lys Asp Lys Ile Ala Asn Ala Lys Lys Ala Gly 370 375 380Ala Val Gly Val Leu Ile Tyr Asp Asn Gln Asp Lys Gly Phe Pro Ile385 390 395 400Glu Leu Pro Asn Val Asp Gln Met Pro Ala Ala Phe Ile Ser Arg Lys 405 410 415Asp Gly Leu Leu Leu Lys Asp Asn Ser Lys Lys Thr Ile Thr Phe Asn 420 425 430Ala Thr Pro Lys Val Leu Pro Thr Ala Ser Asp Thr Lys Leu Ser Arg 435 440 445Phe Ser Ser Trp Gly Leu Thr Ala Asp Gly Asn Ile Lys Pro Asp Ile 450 455 460Ala Ala Pro Gly Gln Asp Ile Leu Ser Ser Val Ala Asn Asn Lys Tyr465 470 475 480Ala Lys Leu Ser Gly Thr Ser Met Ser Ala Pro Leu Val Ala Gly Ile 485 490 495Met Gly Leu Leu Gln Lys Gln Tyr Glu Thr Gln Tyr Pro Asp Met Thr 500 505 510Pro Ser Glu Arg Leu Asp Leu Ala Lys Lys Val Leu Met Ser Ser Ala 515 520 525Thr Ala Leu Tyr Asp Glu Asp Glu Lys Ala Tyr Phe Ser Pro Arg Gln 530 535 540Gln Gly Ala Gly Ala Val Asp Ala Lys Lys Ala Ser Ala Ala Thr Met545 550 555 560Tyr Val Thr Asp Lys Asp Asn Thr Ser Ser Lys Val His Leu Asn Asn 565 570 575Val Ser Asp Lys Phe Glu Val Thr Val Thr Val His Asn Lys Ser Asp 580 585 590Lys Pro Gln Glu Leu Tyr Tyr Gln Ala Thr Val Gln Thr Asp Lys Val 595 600 605Asp Gly Lys His Phe Ala Leu Ala Pro Lys Ala Leu Tyr Glu Thr Ser 610 615 620Trp Gln Lys Ile Thr Ile Pro Ala Asn Ser Ser Lys Gln Val Thr Val625 630 635 640Pro Ile Asp Ala Ser Arg Phe Ser Lys Asp Leu Leu Ala Gln Met Lys 645 650 655Asn Gly Tyr Phe Leu Glu Gly Phe Val Arg Phe Lys Gln Asp Pro Lys 660 665 670Lys Glu Glu Leu Met Ser Ile Pro Tyr Ile Gly Phe Arg Gly Asp Phe 675 680 685Gly Asn Leu Ser Ala Leu Glu Lys Pro Ile Tyr Asp Ser Lys Asp Gly 690 695 700Ser Ser Tyr Tyr His Glu Ala Asn Ser Asp Ala Lys Asp Gln Leu Asp705 710 715 720Gly Asp Gly Leu Gln Phe Tyr Ala Leu Lys Asn Asn Phe Thr Ala Leu 725 730 735Thr Thr Glu Ser Asn Pro Trp Thr Ile Ile Lys Ala Val Lys Glu Gly 740 745 750Val Glu Asn Ile Glu Asp Ile Glu Ser Ser Glu Ile Thr Glu Thr Ile 755 760 765Phe Ala Gly Thr Phe Ala Lys Gln Asp Asp Asp Ser His Tyr Tyr Ile 770 775 780His Arg His Ala Asn Gly Lys Pro Tyr Ala Ala Ile Ser Pro Asn Gly785 790 795 800Asp Gly Asn Arg Asp Tyr Val Gln Phe Gln Gly Thr Phe Leu Arg Asn 805 810 815Ala Lys Asn Leu Val Ala Glu Val Leu Asp Lys Glu Gly Asn Val Val 820 825 830Trp Thr Ser Glu Val Thr Glu Gln Val Val Lys Asn Tyr Asn Asn Asp 835 840 845Leu Ala Ser Thr Leu Gly Ser Thr Arg Phe Glu Lys Thr Arg Trp Asp 850 855 860Gly Lys Asp Lys Asp Gly Lys Val Val Val Asn Gly Thr Tyr Thr Tyr865 870 875 880Arg Val Arg Tyr Thr Pro Ile Ser Ser Gly Ala Lys Glu Gln His Thr 885 890 895Asp Phe Asp Val Ile Val Asp Asn Thr Thr Pro Glu Val Ala Thr Ser 900 905 910Ala Thr Phe Ser Thr Glu Asp Arg Arg Leu Thr Leu Ala Ser Lys Pro 915 920 925Lys Thr Ser Gln Pro Ile Tyr Arg Glu Arg Ile Ala Tyr Thr Tyr Met 930 935 940Asp Glu Asp Leu Pro Thr Thr Glu Tyr Ile Ser Pro Asn Glu Asp Gly945 950 955 960Thr Phe Thr Leu Pro Glu Glu Ala Glu Thr Met Glu Gly Gly Thr Val 965 970 975Pro Leu Lys Met Ser Asp Phe Thr Tyr Val Val Glu Asp Met Ala Gly 980 985 990Asn Ile Thr Tyr Thr Pro Val Thr Lys Leu Leu Glu Gly His Ser 995 1000 10053961PRTStreptococcus pyogenesMISC_FEATURE(1)..(961)ScpA mature protease 3Ala Glu Glu Thr Val Ala Asp Asp Ala Asn Asp Leu Ala Pro Gln Ala1 5 10 15Pro Ala Lys Thr Ala Asp Thr Pro Ala Thr Ser Lys Ala Thr Ile Arg 20 25 30Asp Leu Asn Asp Pro Ser Gln Val Lys Thr Leu Gln Glu Lys Ala Ser 35 40 45Lys Gly Ala Gly Thr Val Val Ala Val Ile Asp Ala Gly Phe Asp Lys 50 55 60Asn His Glu Ala Trp Arg Leu Thr Asp Lys Thr Lys Ala Arg Tyr Gln65 70 75 80Ser Lys Glu Asp Leu Glu Lys Ala Lys Lys Glu His Gly Ile Thr Tyr 85 90 95Gly Glu Trp Val Asn Asp Lys Val Ala Tyr Tyr His Asp Tyr Ser Lys 100 105 110Asp Gly Lys Thr Ala Val Asp Gln Glu His Gly Thr His Val Ser Gly 115 120 125Ile Leu Ser Gly Asn Ala Pro Ser Glu Thr Lys Glu Pro Tyr Arg Leu 130 135 140Glu Gly Ala Met Pro Glu Ala Gln Leu Leu Leu Met Arg Val Glu Ile145 150 155 160Val Asn Gly Leu Ala Asp Tyr Ala Arg Asn Tyr Ala Gln Ala Ile Arg 165 170 175Asp Ala Val Asn Leu Gly Ala Lys Val Ile Asn Met Ser Phe Gly Asn 180 185 190Ala Ala Leu Ala Tyr Ala Asn Leu Pro Asp Glu Thr Lys Lys Ala Phe 195 200 205Asp Tyr Ala Lys Ser Lys Gly Val Ser Ile Val Thr Ser Ala Gly Asn 210 215 220Asp Ser Ser Phe Gly Gly Lys Thr Arg Leu Pro Leu Ala Asp His Pro225 230 235 240Asp Tyr Gly Val Val Gly Thr Pro Ala Ala Ala Asp Ser Thr Leu Thr 245 250 255Val Ala Ser Tyr Ser Pro Asp Lys Gln Leu Thr Glu Thr Ala Thr Val 260 265 270Lys Thr Asp Asp His Gln Ala Lys Glu Met Pro Val Leu Ser Thr Asn 275 280 285Arg Phe Glu Pro Asn Lys Ala Tyr Asp Tyr Ala Tyr Ala Asn Arg Gly 290 295 300Met Lys Glu Asp Asp Phe Lys Asp Val Lys Gly Lys Ile Ala Leu Ile305 310 315 320Glu Arg Gly Asp Ile Asp Phe Lys Asp Lys Ile Ala Asn Ala Lys Lys 325 330 335Ala Gly Ala Val Gly Val Leu Ile Tyr Asp Asn Gln Asp Lys Gly Phe 340 345 350Pro Ile Glu Leu Pro Asn Val Asp Gln Met Pro Ala Ala Phe Ile Ser 355 360 365Arg Lys Asp Gly Leu Leu Leu Lys Asp Asn Ser Lys Lys Thr Ile Thr 370 375 380Phe Asn Ala Thr Pro Lys Val Leu Pro Thr Ala Ser Asp Thr Lys Leu385 390 395 400Ser Arg Phe Ser Ser Trp Gly Leu Thr Ala Asp Gly Asn Ile Lys Pro 405 410 415Asp Ile Ala Ala Pro Gly Gln Asp Ile Leu Ser Ser Val Ala Asn Asn 420 425 430Lys Tyr Ala Lys Leu Ser Gly Thr Ser Met Ser Ala Pro Leu Val Ala 435 440 445Gly Ile Met Gly Leu Leu Gln Lys Gln Tyr Glu Thr Gln Tyr Pro Asp 450 455 460Met Thr Pro Ser Glu Arg Leu Asp Leu Ala Lys Lys Val Leu Met Ser465 470 475 480Ser Ala Thr Ala Leu Tyr Asp Glu Asp Glu Lys Ala Tyr Phe Ser Pro 485 490 495Arg Gln Gln Gly Ala Gly Ala Val Asp Ala Lys Lys Ala Ser Ala Ala 500 505 510Thr Met Tyr Val Thr Asp Lys Asp Asn Thr Ser Ser Lys Val His Leu 515 520 525Asn Asn Val Ser Asp Lys Phe Glu Val Thr Val Thr Val His Asn Lys 530 535 540Ser Asp Lys Pro Gln Glu Leu Tyr Tyr Gln Ala Thr Val Gln Thr Asp545 550 555 560Lys Val Asp Gly Lys His Phe Ala Leu Ala Pro Lys Ala Leu Tyr Glu 565 570 575Thr Ser Trp Gln Lys Ile Thr Ile Pro Ala Asn Ser Ser Lys Gln Val 580 585 590Thr Val Pro Ile Asp Ala Ser Arg Phe Ser Lys Asp Leu Leu Ala Gln 595 600 605Met Lys Asn Gly Tyr Phe Leu Glu Gly Phe Val Arg Phe Lys Gln Asp 610 615 620Pro Lys Lys Glu Glu Leu Met Ser Ile Pro Tyr Ile Gly Phe Arg Gly625 630 635 640Asp Phe Gly Asn Leu Ser Ala Leu Glu Lys Pro Ile Tyr Asp Ser Lys 645 650 655Asp Gly Ser Ser Tyr Tyr His Glu Ala Asn Ser Asp Ala Lys Asp Gln 660 665 670Leu Asp Gly Asp Gly Leu Gln Phe Tyr Ala Leu Lys Asn Asn Phe Thr 675 680 685Ala Leu Thr Thr Glu Ser Asn Pro Trp Thr Ile Ile Lys Ala Val Lys 690 695 700Glu Gly Val Glu Asn Ile Glu Asp Ile Glu Ser Ser Glu Ile Thr Glu705 710 715 720Thr Ile Phe Ala Gly Thr Phe Ala Lys Gln Asp Asp Asp Ser His Tyr 725 730 735Tyr Ile His Arg His Ala Asn Gly Lys Pro Tyr Ala Ala Ile Ser Pro 740 745 750Asn Gly Asp Gly Asn Arg Asp Tyr Val Gln Phe Gln Gly Thr Phe Leu 755 760 765Arg Asn Ala Lys Asn Leu Val Ala Glu Val Leu Asp Lys Glu Gly Asn 770 775 780Val Val Trp Thr Ser Glu Val Thr Glu Gln Val Val Lys Asn Tyr Asn785 790 795 800Asn Asp Leu Ala Ser Thr Leu Gly Ser Thr Arg Phe Glu Lys Thr Arg 805 810 815Trp Asp Gly Lys Asp Lys Asp Gly Lys Val Val Val Asn Gly Thr Tyr 820 825 830Thr Tyr Arg Val Arg Tyr Thr Pro Ile Ser Ser Gly Ala Lys Glu Gln 835 840 845His Thr Asp Phe Asp Val Ile Val Asp Asn Thr Thr Pro Glu Val Ala 850 855 860Thr Ser Ala Thr Phe Ser Thr Glu Asp Arg Arg Leu Thr Leu Ala Ser865 870 875 880Lys Pro Lys Thr Ser Gln Pro Ile Tyr Arg Glu Arg Ile Ala Tyr Thr 885 890 895Tyr Met Asp Glu Asp Leu Pro Thr Thr Glu Tyr Ile Ser Pro Asn Glu 900 905 910Asp Gly Thr Phe Thr Leu Pro Glu Glu Ala Glu Thr Met Glu Gly Gly 915 920 925Thr Val

Pro Leu Lys Met Ser Asp Phe Thr Tyr Val Val Glu Asp Met 930 935 940Ala Gly Asn Ile Thr Tyr Thr Pro Val Thr Lys Leu Leu Glu Gly His945 950 955 960Ser4954PRTStreptococcus pyogenesMISC_FEATURE(1)..(954)ScpA protease variant 4Asp Ala Asn Asp Leu Ala Pro Gln Ala Pro Ala Lys Thr Ala Asp Thr1 5 10 15Pro Ala Thr Ser Lys Ala Thr Ile Arg Asp Leu Asn Asp Pro Ser Gln 20 25 30Val Lys Thr Leu Gln Glu Lys Ala Ser Lys Gly Ala Gly Thr Val Val 35 40 45Ala Val Ile Asp Ala Gly Phe Asp Lys Asn His Glu Ala Trp Arg Leu 50 55 60Thr Asp Lys Thr Lys Ala Arg Tyr Gln Ser Lys Glu Asp Leu Glu Lys65 70 75 80Ala Lys Lys Glu His Gly Ile Thr Tyr Gly Glu Trp Val Asn Asp Lys 85 90 95Val Ala Tyr Tyr His Asp Tyr Ser Lys Asp Gly Lys Thr Ala Val Asp 100 105 110Gln Glu His Gly Thr His Val Ser Gly Ile Leu Ser Gly Asn Ala Pro 115 120 125Ser Glu Thr Lys Glu Pro Tyr Arg Leu Glu Gly Ala Met Pro Glu Ala 130 135 140Gln Leu Leu Leu Met Arg Val Glu Ile Val Asn Gly Leu Ala Asp Tyr145 150 155 160Ala Arg Asn Tyr Ala Gln Ala Ile Arg Asp Ala Val Asn Leu Gly Ala 165 170 175Lys Val Ile Asn Met Ser Phe Gly Asn Ala Ala Leu Ala Tyr Ala Asn 180 185 190Leu Pro Asp Glu Thr Lys Lys Ala Phe Asp Tyr Ala Lys Ser Lys Gly 195 200 205Val Ser Ile Val Thr Ser Ala Gly Asn Asp Ser Ser Phe Gly Gly Lys 210 215 220Thr Arg Leu Pro Leu Ala Asp His Pro Asp Tyr Gly Val Val Gly Thr225 230 235 240Pro Ala Ala Ala Asp Ser Thr Leu Thr Val Ala Ser Tyr Ser Pro Asp 245 250 255Lys Gln Leu Thr Glu Thr Ala Thr Val Lys Thr Asp Asp His Gln Ala 260 265 270Lys Glu Met Pro Val Leu Ser Thr Asn Arg Phe Glu Pro Asn Lys Ala 275 280 285Tyr Asp Tyr Ala Tyr Ala Asn Arg Gly Met Lys Glu Asp Asp Phe Lys 290 295 300Asp Val Lys Gly Lys Ile Ala Leu Ile Glu Arg Gly Asp Ile Asp Phe305 310 315 320Lys Asp Lys Ile Ala Asn Ala Lys Lys Ala Gly Ala Val Gly Val Leu 325 330 335Ile Tyr Asp Asn Gln Asp Lys Gly Phe Pro Ile Glu Leu Pro Asn Val 340 345 350Asp Gln Met Pro Ala Ala Phe Ile Ser Arg Lys Asp Gly Leu Leu Leu 355 360 365Lys Asp Asn Ser Lys Lys Thr Ile Thr Phe Asn Ala Thr Pro Lys Val 370 375 380Leu Pro Thr Ala Ser Asp Thr Lys Leu Ser Arg Phe Ser Ser Trp Gly385 390 395 400Leu Thr Ala Asp Gly Asn Ile Lys Pro Asp Ile Ala Ala Pro Gly Gln 405 410 415Asp Ile Leu Ser Ser Val Ala Asn Asn Lys Tyr Ala Lys Leu Ser Gly 420 425 430Thr Ser Met Ser Ala Pro Leu Val Ala Gly Ile Met Gly Leu Leu Gln 435 440 445Lys Gln Tyr Glu Thr Gln Tyr Pro Asp Met Thr Pro Ser Glu Arg Leu 450 455 460Asp Leu Ala Lys Lys Val Leu Met Ser Ser Ala Thr Ala Leu Tyr Asp465 470 475 480Glu Asp Glu Lys Ala Tyr Phe Ser Pro Arg Gln Gln Gly Ala Gly Ala 485 490 495Val Asp Ala Lys Lys Ala Ser Ala Ala Thr Met Tyr Val Thr Asp Lys 500 505 510Asp Asn Thr Ser Ser Lys Val His Leu Asn Asn Val Ser Asp Lys Phe 515 520 525Glu Val Thr Val Thr Val His Asn Lys Ser Asp Lys Pro Gln Glu Leu 530 535 540Tyr Tyr Gln Ala Thr Val Gln Thr Asp Lys Val Asp Gly Lys His Phe545 550 555 560Ala Leu Ala Pro Lys Ala Leu Tyr Glu Thr Ser Trp Gln Lys Ile Thr 565 570 575Ile Pro Ala Asn Ser Ser Lys Gln Val Thr Val Pro Ile Asp Ala Ser 580 585 590Arg Phe Ser Lys Asp Leu Leu Ala Gln Met Lys Asn Gly Tyr Phe Leu 595 600 605Glu Gly Phe Val Arg Phe Lys Gln Asp Pro Lys Lys Glu Glu Leu Met 610 615 620Ser Ile Pro Tyr Ile Gly Phe Arg Gly Asp Phe Gly Asn Leu Ser Ala625 630 635 640Leu Glu Lys Pro Ile Tyr Asp Ser Lys Asp Gly Ser Ser Tyr Tyr His 645 650 655Glu Ala Asn Ser Asp Ala Lys Asp Gln Leu Asp Gly Asp Gly Leu Gln 660 665 670Phe Tyr Ala Leu Lys Asn Asn Phe Thr Ala Leu Thr Thr Glu Ser Asn 675 680 685Pro Trp Thr Ile Ile Lys Ala Val Lys Glu Gly Val Glu Asn Ile Glu 690 695 700Asp Ile Glu Ser Ser Glu Ile Thr Glu Thr Ile Phe Ala Gly Thr Phe705 710 715 720Ala Lys Gln Asp Asp Asp Ser His Tyr Tyr Ile His Arg His Ala Asn 725 730 735Gly Lys Pro Tyr Ala Ala Ile Ser Pro Asn Gly Asp Gly Asn Arg Asp 740 745 750Tyr Val Gln Phe Gln Gly Thr Phe Leu Arg Asn Ala Lys Asn Leu Val 755 760 765Ala Glu Val Leu Asp Lys Glu Gly Asn Val Val Trp Thr Ser Glu Val 770 775 780Thr Glu Gln Val Val Lys Asn Tyr Asn Asn Asp Leu Ala Ser Thr Leu785 790 795 800Gly Ser Thr Arg Phe Glu Lys Thr Arg Trp Asp Gly Lys Asp Lys Asp 805 810 815Gly Lys Val Val Val Asn Gly Thr Tyr Thr Tyr Arg Val Arg Tyr Thr 820 825 830Pro Ile Ser Ser Gly Ala Lys Glu Gln His Thr Asp Phe Asp Val Ile 835 840 845Val Asp Asn Thr Thr Pro Glu Val Ala Thr Ser Ala Thr Phe Ser Thr 850 855 860Glu Asp Arg Arg Leu Thr Leu Ala Ser Lys Pro Lys Thr Ser Gln Pro865 870 875 880Ile Tyr Arg Glu Arg Ile Ala Tyr Thr Tyr Met Asp Glu Asp Leu Pro 885 890 895Thr Thr Glu Tyr Ile Ser Pro Asn Glu Asp Gly Thr Phe Thr Leu Pro 900 905 910Glu Glu Ala Glu Thr Met Glu Gly Gly Thr Val Pro Leu Lys Met Ser 915 920 925Asp Phe Thr Tyr Val Val Glu Asp Met Ala Gly Asn Ile Thr Tyr Thr 930 935 940Pro Val Thr Lys Leu Leu Glu Gly His Ser945 9505943PRTStreptococcus pyogenesMISC_FEATURE(1)..(943)ScpA protease variant 5Lys Thr Ala Asp Thr Pro Ala Thr Ser Lys Ala Thr Ile Arg Asp Leu1 5 10 15Asn Asp Pro Ser Gln Val Lys Thr Leu Gln Glu Lys Ala Ser Lys Gly 20 25 30Ala Gly Thr Val Val Ala Val Ile Asp Ala Gly Phe Asp Lys Asn His 35 40 45Glu Ala Trp Arg Leu Thr Asp Lys Thr Lys Ala Arg Tyr Gln Ser Lys 50 55 60Glu Asp Leu Glu Lys Ala Lys Lys Glu His Gly Ile Thr Tyr Gly Glu65 70 75 80Trp Val Asn Asp Lys Val Ala Tyr Tyr His Asp Tyr Ser Lys Asp Gly 85 90 95Lys Thr Ala Val Asp Gln Glu His Gly Thr His Val Ser Gly Ile Leu 100 105 110Ser Gly Asn Ala Pro Ser Glu Thr Lys Glu Pro Tyr Arg Leu Glu Gly 115 120 125Ala Met Pro Glu Ala Gln Leu Leu Leu Met Arg Val Glu Ile Val Asn 130 135 140Gly Leu Ala Asp Tyr Ala Arg Asn Tyr Ala Gln Ala Ile Arg Asp Ala145 150 155 160Val Asn Leu Gly Ala Lys Val Ile Asn Met Ser Phe Gly Asn Ala Ala 165 170 175Leu Ala Tyr Ala Asn Leu Pro Asp Glu Thr Lys Lys Ala Phe Asp Tyr 180 185 190Ala Lys Ser Lys Gly Val Ser Ile Val Thr Ser Ala Gly Asn Asp Ser 195 200 205Ser Phe Gly Gly Lys Thr Arg Leu Pro Leu Ala Asp His Pro Asp Tyr 210 215 220Gly Val Val Gly Thr Pro Ala Ala Ala Asp Ser Thr Leu Thr Val Ala225 230 235 240Ser Tyr Ser Pro Asp Lys Gln Leu Thr Glu Thr Ala Thr Val Lys Thr 245 250 255Asp Asp His Gln Ala Lys Glu Met Pro Val Leu Ser Thr Asn Arg Phe 260 265 270Glu Pro Asn Lys Ala Tyr Asp Tyr Ala Tyr Ala Asn Arg Gly Met Lys 275 280 285Glu Asp Asp Phe Lys Asp Val Lys Gly Lys Ile Ala Leu Ile Glu Arg 290 295 300Gly Asp Ile Asp Phe Lys Asp Lys Ile Ala Asn Ala Lys Lys Ala Gly305 310 315 320Ala Val Gly Val Leu Ile Tyr Asp Asn Gln Asp Lys Gly Phe Pro Ile 325 330 335Glu Leu Pro Asn Val Asp Gln Met Pro Ala Ala Phe Ile Ser Arg Lys 340 345 350Asp Gly Leu Leu Leu Lys Asp Asn Ser Lys Lys Thr Ile Thr Phe Asn 355 360 365Ala Thr Pro Lys Val Leu Pro Thr Ala Ser Asp Thr Lys Leu Ser Arg 370 375 380Phe Ser Ser Trp Gly Leu Thr Ala Asp Gly Asn Ile Lys Pro Asp Ile385 390 395 400Ala Ala Pro Gly Gln Asp Ile Leu Ser Ser Val Ala Asn Asn Lys Tyr 405 410 415Ala Lys Leu Ser Gly Thr Ser Met Ser Ala Pro Leu Val Ala Gly Ile 420 425 430Met Gly Leu Leu Gln Lys Gln Tyr Glu Thr Gln Tyr Pro Asp Met Thr 435 440 445Pro Ser Glu Arg Leu Asp Leu Ala Lys Lys Val Leu Met Ser Ser Ala 450 455 460Thr Ala Leu Tyr Asp Glu Asp Glu Lys Ala Tyr Phe Ser Pro Arg Gln465 470 475 480Gln Gly Ala Gly Ala Val Asp Ala Lys Lys Ala Ser Ala Ala Thr Met 485 490 495Tyr Val Thr Asp Lys Asp Asn Thr Ser Ser Lys Val His Leu Asn Asn 500 505 510Val Ser Asp Lys Phe Glu Val Thr Val Thr Val His Asn Lys Ser Asp 515 520 525Lys Pro Gln Glu Leu Tyr Tyr Gln Ala Thr Val Gln Thr Asp Lys Val 530 535 540Asp Gly Lys His Phe Ala Leu Ala Pro Lys Ala Leu Tyr Glu Thr Ser545 550 555 560Trp Gln Lys Ile Thr Ile Pro Ala Asn Ser Ser Lys Gln Val Thr Val 565 570 575Pro Ile Asp Ala Ser Arg Phe Ser Lys Asp Leu Leu Ala Gln Met Lys 580 585 590Asn Gly Tyr Phe Leu Glu Gly Phe Val Arg Phe Lys Gln Asp Pro Lys 595 600 605Lys Glu Glu Leu Met Ser Ile Pro Tyr Ile Gly Phe Arg Gly Asp Phe 610 615 620Gly Asn Leu Ser Ala Leu Glu Lys Pro Ile Tyr Asp Ser Lys Asp Gly625 630 635 640Ser Ser Tyr Tyr His Glu Ala Asn Ser Asp Ala Lys Asp Gln Leu Asp 645 650 655Gly Asp Gly Leu Gln Phe Tyr Ala Leu Lys Asn Asn Phe Thr Ala Leu 660 665 670Thr Thr Glu Ser Asn Pro Trp Thr Ile Ile Lys Ala Val Lys Glu Gly 675 680 685Val Glu Asn Ile Glu Asp Ile Glu Ser Ser Glu Ile Thr Glu Thr Ile 690 695 700Phe Ala Gly Thr Phe Ala Lys Gln Asp Asp Asp Ser His Tyr Tyr Ile705 710 715 720His Arg His Ala Asn Gly Lys Pro Tyr Ala Ala Ile Ser Pro Asn Gly 725 730 735Asp Gly Asn Arg Asp Tyr Val Gln Phe Gln Gly Thr Phe Leu Arg Asn 740 745 750Ala Lys Asn Leu Val Ala Glu Val Leu Asp Lys Glu Gly Asn Val Val 755 760 765Trp Thr Ser Glu Val Thr Glu Gln Val Val Lys Asn Tyr Asn Asn Asp 770 775 780Leu Ala Ser Thr Leu Gly Ser Thr Arg Phe Glu Lys Thr Arg Trp Asp785 790 795 800Gly Lys Asp Lys Asp Gly Lys Val Val Val Asn Gly Thr Tyr Thr Tyr 805 810 815Arg Val Arg Tyr Thr Pro Ile Ser Ser Gly Ala Lys Glu Gln His Thr 820 825 830Asp Phe Asp Val Ile Val Asp Asn Thr Thr Pro Glu Val Ala Thr Ser 835 840 845Ala Thr Phe Ser Thr Glu Asp Arg Arg Leu Thr Leu Ala Ser Lys Pro 850 855 860Lys Thr Ser Gln Pro Ile Tyr Arg Glu Arg Ile Ala Tyr Thr Tyr Met865 870 875 880Asp Glu Asp Leu Pro Thr Thr Glu Tyr Ile Ser Pro Asn Glu Asp Gly 885 890 895Thr Phe Thr Leu Pro Glu Glu Ala Glu Thr Met Glu Gly Gly Thr Val 900 905 910Pro Leu Lys Met Ser Asp Phe Thr Tyr Val Val Glu Asp Met Ala Gly 915 920 925Asn Ile Thr Tyr Thr Pro Val Thr Lys Leu Leu Glu Gly His Ser 930 935 940674PRTHomo sapiensMISC_FEATURE(1)..(74)Human C5a protein 6Met Leu Gln Lys Lys Ile Glu Glu Ile Ala Ala Lys Tyr Lys His Ser1 5 10 15Val Val Lys Lys Cys Cys Tyr Asp Gly Ala Cys Val Asn Asn Asp Glu 20 25 30Thr Cys Glu Gln Arg Ala Ala Arg Ile Ser Leu Gly Pro Arg Cys Ile 35 40 45Lys Ala Phe Thr Glu Cys Cys Val Val Ala Ser Gln Leu Arg Ala Asn 50 55 60Ile Ser His Lys Asp Met Gln Leu Gly Arg65 70

Claims

1. A method for the extracorporeal treatment of blood, the method comprising removing blood or a blood fraction from a patient and reacting the blood or blood fraction with a protease enzyme that is specific for and capable of irreversibly cleaving functional C5a, thereby reducing an abundance of functional C5a in the blood or blood fraction, wherein the protease enzyme is immobilised to a support.

2. The method of claim 1, wherein the protease enzyme is a recombinant bacterial C5a protease comprising SEQ ID NO. 3, or a functional variant thereof having at least 90% sequence identity with SEQ ID NO: 3.

3. The method of claim 2, wherein the functional variant of SEQ ID NO: 3 is SEQ ID NO: 4 or SEQ ID NO: 5.

4. The method of claim 1, wherein the reacting step is carried out with an apparatus comprising: an extracorporeal blood circuit; a pump configured to provide fluid displacement with the extracorporeal blood circuit; and a reaction chamber connected to the extracorporeal blood circuit, the reaction chamber configured to receive the blood or blood fraction from the extracorporeal blood circuit and to treat the blood or blood fraction, wherein the reaction chamber contains the protease enzyme immobilised to the support.

5. The method of claim 4, wherein the protease enzyme is a recombinant bacterial C5a protease comprising SEQ ID NO. 3, or a functional variant thereof having at least 90% sequence identity with SEQ ID NO: 3.

6. The method of claim 5, wherein the functional variant of SEQ ID NO: 3 is SEQ ID NO: 4 or SEQ ID NO: 5.

7. The method of claim 4, wherein the apparatus further comprises separating means adapted to separate the blood or blood fraction into a C5a-containing fraction and a non-C5a containing fraction, wherein the reaction chamber receives the C5a-containing fraction.

8. The method of claim 7, wherein the protease enzyme is a recombinant bacterial C5a protease comprising SEQ ID NO. 3, or a functional variant thereof having at least 90% sequence identity with SEQ ID NO: 3.

9. The method of claim 8, wherein the functional variant of SEQ ID NO: 3 is SEQ ID NO: 4 or SEQ ID NO: 5.

10. The method of claim 7, wherein the apparatus further comprises means configured to recombine the treated C5a-containing fraction with the non-C5a containing fraction.

11. The method of claim 1, wherein the support includes a coordinated transition metal ion and one or more functional groups; the C-terminus of the protease enzyme comprises a first tag and a second tag located distally of the first tag, the second tag being separated from the first tag by a spacer; the first tag comprises a motif capable of covalently reacting with the one or more functional groups; and the second tag comprises a motif capable of interacting with the coordinated transition metal ion.

12. The method of claim 11, wherein the first tag is poly-lysine, poly-glutamate, or poly-cysteine, and the second tag is poly-histidine.

13. The method of claim 12, wherein the protease enzyme is a recombinant bacterial C5a protease comprising SEQ ID NO. 3, SEQ ID NO: 4, or SEQ ID NO: 5.

14. The method of claim 1, wherein the support includes a silica material, a methacrylate, a polyacrylamide, a polypyrrole, or a polysaccharide.

15. The method of claim 14, wherein the silica material is selected from the group consisting of mesoporous silica, a monodispersed mesoporous silicate, and a Ni2+-modified mesoporous silica.

16. The method of claim 1, wherein the support comprises a multiplicity of beads and the protease enzyme is irreversibly immobilized to a surface of the beads.

17. A method for treating sepsis, the method comprising removing blood or a blood fraction from a patient having sepsis and reacting the blood or blood fraction with a protease enzyme that is specific for and capable of irreversibly cleaving functional C5a, thereby reducing an abundance of functional C5a in the blood or blood fraction, wherein the protease enzyme is immobilised to a support.

18. The method of claim 17, wherein the protease enzyme is a recombinant bacterial C5a protease comprising SEQ ID NO. 3, SEQ ID NO: 4, or SEQ ID NO: 5.

19. A method for treating an inflammatory condition in a human, the method comprising removing blood or a blood fraction from a patient having an inflammatory condition and reacting the blood or blood fraction with a protease enzyme that is specific for and capable of irreversibly cleaving functional C5a, thereby reducing an abundance of functional C5a in the blood or blood fraction, wherein the protease enzyme is immobilised to a support.

20. The method of claim 19, wherein the protease enzyme is a recombinant bacterial C5a protease comprising SEQ ID NO. 3, SEQ ID NO: 4, or SEQ ID NO: 5.