Patent application title: POLYPEPTIDES AND USES THEREOF FOR TREATMENT OF AUTOIMMUNE DISORDERS AND INFECTION
Inventors:
IPC8 Class: AC07K14705FI
USPC Class:
1 1
Class name:
Publication date: 2019-08-15
Patent application number: 20190248866
Abstract:
This invention relates to C1ORF32 protein and its variants and fragments
and fusion proteins thereof, pharmaceutical composition comprising same
and methods of use therof for treatment of immune related disorders and
infections.Claims:
1. An isolated polypeptide, comprising an amino acid sequence of C1ORF32
IgV domain fragment, set forth in any one of SEQ ID NOs: 29, 30, 41-105,
with the proviso that the amino acid sequence does not include the
complete, exact sequence of SEQ ID NO: 35 or SEQ ID NO:36.
2. The isolated peptide of claim 1, wherein the isolated polypeptide has less than 90% identity with SEQ ID NO:35 or SEQ ID NO:36.
3. The isolated peptide of claim 2, wherein the isolated peptide has less than 85% identity with SEQ ID NO:35 or SEQ ID NO:36.
4. The isolated peptide of claim 3, wherein the isolated peptide has less than 80% identity with SEQ ID NO:35 or SEQ ID NO:36.
5. The isolated peptide of any of claims 1-4, wherein the isolated polypeptide consists essentially of the amino acid sequence as set forth in any one of SEQ ID NOs: 29, 30, 41-105, or optionally an amino acid sequence that is up to 95% identical thereof
6. A fusion protein comprising the polypeptide according to any of claims 1-5, fused to a heterologous sequence, directly or indirectly via a linker peptide, a polypeptide sequence or a chemical linker.
7. The fusion protein of 6, wherein the heterologous sequence comprises at least a portion of an immunoglobulin constant domain.
8. The fusion protein of claim 7, comprising an immunoglobulin heavy chain constant region corresponding to an antibody isotype selected from the group consisting of an IgG1, IgG2, IgG3, IgG4, IgM, IgE, IgA and IgD.
9. The fusion protein of 8, wherein the immunoglobulin constant domain comprises the hinge, CH2 and CH3 regions of a human IgG immunoglobulin, selected from the group consisting of C.gamma.1, C.gamma.2, C.gamma.3 and C.gamma.4 chain.
10. The fusion protein of any of claims 6-9, further comprising a domain that mediates dimerization or multimerization of the fusion protein to form homodimers, heterodimers, homomultimers, or heteromultimers.
11. The fusion protein of 10, wherein the domain that mediates dimerization or multimerization is selected from the group consisting of one or more cysteines that are capable of forming an intermolecular disulfide bond with a cysteine on the partner fusion protein, a coiled-coil domain, an acid patch, a zinc finger domain, a calcium hand domain, a CHI region, a CL region, a leucine zipper domain, an SH2 (src homology 2) domain, an SH3 (src Homology 3) domain, a PTB (phosphotyrosine binding) domain, a WW domain, a PDZ domain, a 14-3-3 domain, a WD40 domain, an EH domain, a Lim domain, an isoleucine zipper domain, and a dimerization domain of a receptor dimer pair.
12. The fusion protein of any of claims 6-11, comprising a polypeptide having an amino acid sequence set forth in any one of SEQ ID NOs: 20, 21, 31 or 115.
13. The fusion protein of claim 12, wherein said fusion protein comprises the amino acid sequence set forth in anyone of SEQ ID NOs: 29, 30, 41-105, fused to human IgG1 Fc set forth in any one of SEQ ID NOs: 20, 21, or 115.
14. The fusion protein of claim 13, wherein the amino acid sequence of said fusion protein is set forth in SEQ ID NO: 39, 108-112, 116-190.
15. The fusion protein of claim 14, wherein the amino acid sequence is set forth in any of SEQ ID NOs:112, 120 or alternatively in any of SEQ ID NOs:110, 136.
16. A dimeric protein comprising a first and a second fusion protein, wherein the first and the second fusion proteins comprise the fusion protein of any of claims 6-13, wherein the first and the second fusion proteins are bound to one another by covalent or noncovalent bonds to form a dimer.
17. A pharmaceutical composition comprising a protein of any of claims 1-5 or a fusion protein of any of claims 6-16, and a pharmaceutically acceptable diluent or carrier, adapted for treatment of any immune related disorder and infectious disorder.
18. A use of a protein of any of claims 1-5 or a fusion protein of any of claims 6-16 or pharmaceutical composition according to claim 20 for treatment of any of immune related disorder and infectious disorder.
19. The use according to claim 18, wherein the polypeptide is attached to a detectable or therapeutic moiety.
20. A method for treating an immune related disorder or an infectious disorder in a subject in need thereof, comprising administering to the subject an effective amount of the polypeptide of any of claims 1-5 or fusion protein of any of claims 6-16 or pharmaceutical composition according to claim 17.
21. The method of 20, wherein administering an effective amount of the polypeptide of any of claims 1-5 or fusion protein of any of claims 6-16 or pharmaceutical composition according to claim 20 to the subject inhibits or reduces differentiation of, proliferation of, activity of, and/or cytokine production and/or secretion by an immune cell selected from the group consisting of Th1, Th17, and/or Th22, other cells that secrete, or cells that cause other cells to secrete, inflammatory molecules.
22. The method of 20, wherein the polypeptide of any of claims 1-5 or fusion protein of any of claims 6-16 or pharmaceutical composition according to claim 17 is administered in an effective amount to inhibit or reduce differentiation of, proliferation of, activity of, and/or cytokine production and/or secretion by Th1, Th17 and/or Th22 cells.
23. The method of claim 20, wherein the polypeptide of any of claims 1-5 or fusion protein of any of claims 6-16 or pharmaceutical composition according to claim 17 is administered in an effective amount to enhance the suppressive or immunomodulatory effect of Tregs and/or Th2 cells on Th1 or Th17 cells.
24. The method of claim 20, wherein the polypeptide of any of claims 1-5 or fusion protein of any of claims 6-16 or pharmaceutical composition according to claim 17 is administered in an effective amount to promote or enhance IL-10 production.
25. The method of claim 20, wherein the polypeptide of any of claims 1-5 or fusion protein of any of claims 6-16 or pharmaceutical composition according to claim 17 is administered in an effective amount to increase cell numbers or increase populations of any of Tregs and/or Th2 cells.
26. The method of claim 20, wherein the polypeptide of any of claims 1-5 or fusion protein of any of claims 6-16 or pharmaceutical composition according to claim 17 is administered in an effective amount to inhibit the Th1 and/or Th17 pathways and to enhance the activity of Tregs and/or Th2 cells on the Th1 and Th17 pathways and/or to promote or enhance IL-10 secretion.
27. The method of claim 20, wherein the polypeptide of any of claims 1-5 or fusion protein of any of claims 6-16 or pharmaceutical composition according to claim 17 is administered in an effective amount for reducing proinflammatory molecule production in a subject.
28. The method according to any one of claims 20-27 further comprising administering a second therapeutic agent effective for treatment of any immune related disorder and infectious disorder.
29. The C1ORF32 polypeptide, fusion protein, pharmaceutical composition, method, or use according to any of the above claims, wherein the immune related disorder is selected from the group consisting of autoimmune disease and immune disorder associated with graft transplantation rejection, and wherein the infectious disorder is selected from the disease caused by bacterial infection, viral infection, fungal infection and/or other parasite infection.
30. The C1ORF32 polypeptide, fusion protein, pharmaceutical composition, method, or use according to claim 29, wherein the immune disorder associated with graft transplantation rejection is selected from the group consisting of acute and chronic rejection of organ transplantation, allogeneic stem cell transplantation, autologous stem cell transplantation, bone marrow transplantation, and graft versus host disease.
31. The C1ORF32 polypeptide, fusion protein, pharmaceutical composition, method, or use according to claim 29, wherein the autoimmune disease is selected from the group consisting of multiple sclerosis, rheumatoid arthritis; psoriatic arthritis, discoid lupus erythematosus, systemic lupus erythematosus (SLE); ulcerative colitis; Crohn's disease; benign lymphocytic angiitis, autoimmune lymphoproliferative syndrome, sarcoidosis, autoimmune thrombocytopenic purpura, idiopathic thrombocytopenic purpura, pure red cell aplasia, Sjogren's syndrome, rheumatic disease, polymyalgia rheumatica, mixed connective tissue disease, inflammatory rheumatism, degenerative rheumatism, extra-articular rheumatism, juvenile arthritis, juvenile rheumatoid arthritis, systemic juvenile idiopathic arthritis, arthritis uratica, muscular rheumatism, chronic polyarthritis, reactive arthritis, Reiter's syndrome, rheumatic fever, relapsing polychondritis, Raynaud's phenomenon, vasculitis, cryoglobulinemic vasculitis, ANCA-associated vasculitis, temporal arteritis, giant cell arteritis, Takayasu arteritis, Behcet's disease, antiphospholipid syndrome, myasthenia gravis, autoimmune haemolytic anaemia, Guillain-Barre syndrome, chronic immune polyneuropathy, chronic inflammatory demyelinating polyneuropathy, autoimmune thyroiditis, insulin dependent diabetes mellitus, type I diabetes, Addison's disease, membranous glomerulonephropathy, polyglandular autoimmune syndromes, Goodpasture's disease, autoimmune gastritis, autoimmune atrophic gastritis, pernicious anaemia, pemphigus, pemphigus vulgaris, cirrhosis, primary biliary cirrhosis, idiopathic pulmonary fibrosis, myositis, dermatomyositis, juvenile dermatomyositis, polymyositis, fibromyositis, myogelosis, celiac disease, celiac sprue dermatitis, immunoglobulin A nephropathy, Henoch-Schonlein purpura, Evans syndrome, atopic dermatitis, psoriasis, psoriasis vulgaris, psoriasis arthropathica, Graves' disease, Graves' ophthalmopathy, scleroderma, systemic scleroderma, progressive systemic scleroderma, diffuse scleroderma, localized scleroderma, Crest syndrome, asthma, allergic asthma, allergy, primary biliary cirrhosis, Hashimoto's thyroiditis, fibromyalgia, chronic fatigue and immune dysfunction syndrome (CFIDS), primary myxedema, sympathetic ophthalmia, autoimmune inner ear disease, autoimmune uveitis, autoimmune chronic active hepatitis, collagen diseases, ankylosing spondylitis, periarthritis humeroscapularis, panarteritis nodosa, polyarteritis nodosa, chondrocalcinosis, Wegener's granulomatosis, microscopic polyangiitis, chronic urticaria, bullous skin disorders, pemphigoid, bullous pemphigoid, cicatricial pemphigoid, vitiligo, atopic eczema, eczema, chronic urticaria, autoimmune urticaria, normocomplementemic urticarial vasculitis, hypocomplementemic urticarial vasculitis, alopecia areata, alopecia universalis, alopecia totalis, Devic's disease, pernicious anemia, childhood autoimmune hemolytic anemia, idiopathic autoimmune hemolytic anemia, refractory or chronic Autoimmune Cytopenias, Prevention of development of Autoimmune Anti-Factor VIII Antibodies in Acquired Hemophilia A, Cold agglutinin disease, Neuromyelitis Optica, Stiff Person Syndrome, gingivitis, periodontitis, pancreatitis, myocarditis, gastritis, gout, gouty arthritis, idiopathic pericarditis, anti-synthetase syndrome, scleritis, macrophage activation syndrome, PAPA Syndrome, Blau's Syndrome, adult and juvenile Still's disease, cryopyrin associated periodic syndrome, Muckle-Wells syndrome, familial cold auto-inflammatory syndrome, neonatal onset multisystem inflammatory disease, chronic infantile neurologic cutaneous and articular syndrome, familial Mediterranean fever, Hyper IgD syndrome, Schnitzler's syndrome, autoimmune retinopathy, age-related macular degeneration, and TNF receptor-associated periodic syndrome (TRAPS).
32. The C1ORF32 polypeptide, fusion protein, pharmaceutical composition, method, or use according to claim 29, wherein the autoimmune disease is selected from the group consisting of multiple sclerosis, rheumatoid arthritis, type I diabetes, psoriasis, systemic lupus erythematosus, inflammatory Bowel's disease, uveitis, and Sjogren's syndrome.
33. The C1ORF32 polypeptide, fusion protein, pharmaceutical composition, method, or use according to claim 32, wherein the multiple sclerosis is selected from the group consisting of benign multiple sclerosis, relapsing remitting multiple sclerosis, secondary progressive multiple sclerosis, primary progressive multiple sclerosis, chronic progressive multiple sclerosis, transitional/progressive multiple sclerosis, progressive relapsing multiple sclerosis, rapidly worsening multiple sclerosis, clinically-definite multiple sclerosis, malignant multiple sclerosis, also known as Marburg's Variant, acute multiple sclerosis and condition relating to multiple sclerosis, selected from the group consisting of Devic's disease, also known as Neuromyelitis Optica; acute disseminated encephalomyelitis, acute demyelinating optic neuritis, demyelinative transverse myelitis, Miller-Fisher syndrome, encephalomyelradiculoneuropathy, acute demyelinative polyneuropathy, tumefactive multiple sclerosis and Balo's concentric sclerosis.
34. The C1ORF32 polypeptide, fusion protein, pharmaceutical composition, method, or use according to claim 32, wherein the rheumatoid arthritis is selected from the group consisting of rheumatoid arthritis, gout and pseudo-gout, juvenile idiopathic arthritis, juvenile rheumatoid arthritis, Still's disease, ankylosing spondylitis, rheumatoid vasculitis, and conditions relating to rheumatoid arthritis, selected from the group consisting of osteoarthritis, sarcoidosis, Henoch-Schonlein purpura, Psoriatic arthritis, Reactive arthritis, Spondyloarthropathy, septic arthritis, HaemochromatosisHepatitis, vasculitis, Wegener's granulomatosis, Lyme disease, Familial Mediterranean fever, Hyperimmunoglobulinemia D with recurrent fever, TNF receptor associated periodic syndrome, and Enteropathic arthritis associated with inflammatory bowel disease.
35. The C1ORF32 polypeptide, fusion protein, pharmaceutical composition, method, or use according to claim 32, wherein the uveitis is selected from the group consisting of anterior uveitis (or iridocyclitis), intermediate uveitis (pars planitis), posterior uveitis (or chorioretinitis) and the panuveitic form.
36. The C1ORF32 polypeptide, fusion protein, pharmaceutical composition, method, or use according to claim 32, wherein the inflammatory bowel disease is selected from the group consisting of Crohn's disease and ulcerative colitis (UC) and condition relating to IBD selected from the group consisting of Collagenous colitis, Lymphocytic colitis, Ischaemic colitis, Diversion colitis, Behcet's disease, Indeterminate colitis.
37. The C1ORF32 polypeptide, fusion protein, pharmaceutical composition, method, or use according to claim 32, wherein the psoriasis is selected from the group consisting of Nonpustular Psoriasis including Psoriasis vulgaris and Psoriatic erythroderma (erythrodermic psoriasis), Pustular psoriasis including Generalized pustular psoriasis (pustular psoriasis of von Zumbusch), Pustulosis palmaris et plantaris (persistent palmoplantar pustulosis, pustular psoriasis of the Barber type, pustular psoriasis of the extremities), Annular pustular psoriasis, Acrodermatitis continua, Impetigo herpetiformis. Optionally, conditions relating to psoriasis include, e.g., drug-induced psoriasis, Inverse psoriasis, Napkin psoriasis, Seborrheic-like psoriasis, Guttate psoriasis, Nail psoriasis, Psoriatic arthritis.
38. The C1ORF32 polypeptide, fusion protein, pharmaceutical composition, method, or use according to claim 32, wherein the diabetes is selected from the group consisting of insulin-dependent diabetes mellitus, idiopathic diabetes, juvenile type 1 diabetes, maturity onset diabetes of the young, latent autoimmune diabetes in adults, gestational diabetes, and condition relating to type 1 diabetes selected from the group consisting of neuropathy including polyneuropathy, mononeuropathy, peripheral neuropathy and autonomicneuropathy; eye complications: glaucoma, cataracts, retinopathy.
39. The C1ORF32 polypeptide, fusion protein, pharmaceutical composition, method, or use according to claim 32, wherein the Sjogren's syndrome is selected from the group consisting of Primary Sjogren's syndrome and Secondary Sjogren's syndrome and condition relating to Sjogren's syndrome selected from the group consisting of connective tissue disease, such as rheumatoid arthritis, systemic lupus erythematosus, or scleroderma. Other complications include pneumonia, polmunary fibrosis, interstitial nephritis, inflammation of the tissue around the kidney's filters, glomerulonephritis, renal tubular acidosis, carpal tunnel syndrome, peripheral neuropathy, cranial neuropathy, primary biliary cirrhosis (PBC), cirrhosis, Inflammation in the esophagus, stomach, pancreas, and liver (including hepatitis), Polymyositis, Raynaud's phenomenon, Vasculitis, Autoimmune thyroid problems, lymphoma.
40. The C1ORF32 polypeptide, fusion protein, pharmaceutical composition, method, or use according to claim 32, wherein the systemic lupus erythematosus is selected from the group consisting of discoid lupus, lupus arthritis, lupus pneumonitis, lupus nephritis, and condition relating to systemic lupus erythematosus, selected from the group consisting of osteoarticular tuberculosis, antiphospholipid antibody syndrome, inflammation of various parts of the heart, such as pericarditis, myocarditis, and endocarditis, Lung and pleura inflammation, pleuritis, pleural effusion, chronic diffuse interstitial lung disease, pulmonary hypertension, pulmonary emboli, pulmonary hemorrhage, and shrinking lung syndrome, lupus headache, Guillain-Barre syndrome, aseptic meningitis, demyelinating syndrome, mononeuropathy, mononeuritis multiplex, myasthenia gravis, myelopathy, cranial neuropathy, polyneuropathy, vasculitis.
41. The C1ORF32 polypeptide, fusion protein, pharmaceutical composition, method, or use according to claim 32, wherein treating comprises one or more of preventing, curing, managing, reversing, attenuating, alleviating, minimizing, suppressing, managing, or halting the deleterious effects of the above-described diseases.
42. The C1ORF32 polypeptide, fusion protein, pharmaceutical composition, method, or use according to claim 41, wherein the treating comprises treatment of immune related disorder without global immunosuppression.
43. The C1ORF32 polypeptide, fusion protein, pharmaceutical composition, method, or use according to claim 41, wherein the treatment of immune related disorder comprises induction of immune tolerance.
44. The C1ORF32 polypeptide, fusion protein, pharmaceutical composition, method, or use according to claim 41, wherein the treatment and/or prevention comprises inhibition of infiltration of reactive T lymphocytes into the central nervous system.
45. The C1ORF32 polypeptide, fusion protein, pharmaceutical composition, method, or use according to claim 41, wherein the treatment and/or prevention comprises prevention of damage to the myelin coat of neural cells in the central nervous system.
46. The C1ORF32 polypeptide, fusion protein, pharmaceutical composition, method, or use according to claim 41, wherein treatment comprises reducing the severity of the disease, reducing the frequency of episodes of the disease, reducing the duration of such episodes, or reducing the severity of such episodes or a combination thereof.
47. A method for selecting a subject for treatment with a C1ORF32 fusion protein comprising screening subjects for levels of one or more cytokines selected from the group consisting of IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-10, IL-17, IL-6, IL-23, IL-22, and IL-21, or MMPs, comparing the levels of the cytokines to the levels of cytokines or MMPs in a control subject that does not have an immune related disorder, and administering to the subject an effective amount of the polypeptide of any of claims 1-5 or fusion protein of any of claims 6-16 or pharmaceutical composition according to claim 17 to inhibit or reduce one or more symptoms of the immune related disorder if the levels of one or more cytokines are elevated in the subject compared to levels in the control subject that does not have the immune related disorder.
48. A method for selecting a subject for treatment with a C1ORF32 fusion protein comprising screening subjects for levels of mRNA encoding one or more cytokines selected from the group consisting of IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-10, IL-17, IL-6, IL-23, IL-22, and IL-21, or MMPs, comparing the levels of the mRNAs encoding cytokines or MMPs to levels of the mRNAs encoding cytokines or MMPs in a control subject that does not have an inflammatory disorder, and administering to the subject an effective amount of the polypeptide of any of claims 1-5 or fusion protein of any of claims 6-16 or pharmaceutical composition according to claim 17 to inhibit or reduce one or more symptoms of an immune related disorder if the levels of one or more mRNAs encoding cytokines are elevated in the subject compared to levels in the control subject that does not have an immune related disorder.
49. The method of any of the above claims, wherein the subject did not previously respond to treatment with TNF blockers.
50. A method for combining therapeutic vaccination with an antigen along with administration of any one of the polypeptide of any of claims 1-5 or fusion protein of any of claims 6-16 or pharmaceutical composition according to claim 17, for treatment of infection.
51. A method for combining of any one of the polypeptide of any of claims 1-5 or fusion protein of any of claims 6-16 or pharmaceutical composition according to claim 17, used as adjuvant, along with an antigen in a vaccine, in order to increase the immune response.
52. The method of claim 50 or 51, wherein the antigen is a viral antigen, bacterial antigen, fungal antigen, parasite antigen, and/or other pathogen's antigen.
Description:
FIELD OF THE INVENTION
[0001] The present invention relates to C1ORF32 protein, and its variants, fragments and fusion proteins thereof, pharmaceutical compositions comprising same and methods of use thereof for treatment of immune related disorders and infections.
BACKGROUND OF THE INVENTION
[0002] The balance between proinflammatory mechanisms and the dampening of excessive immune activation is important for treatment of infectious disease and also for treatment of autoimmune disease. The former benefits from an activated immune system while the latter requires reduce immune system activity. Thus, the immune system has the reciprocal tasks to protect the host against invading pathogens, but simultaneously to prevent damage resulting from unwanted reactions to self antigens.
[0003] The latter part is known as immune tolerance and performed by a complex set of interactive and complementary pathways, which regulate immune responses. T cells have the ability to react to a variety of antigens, both self and nonself. Therefore, there are many mechanisms that exist naturally to eliminate potentially self-reactive responses--this is known as natural tolerance. The main mechanism for eliminating potential auto-reactive T cells occurs in the thymus and is known as central tolerance. Some potentially autoreactive T cells escape central tolerance and, therefore, peripheral tolerance mechanisms also exist. Despite these mechanisms, some self-reactive T cells may `escape` and be present in the repertoire; it is believed that their activation may lead to autoimmune disease.
[0004] Studies on therapeutic tolerance have attempted to induce and amplify potent physiological mechanisms of tolerance in order to eliminate or neutralize self-reactive T cells and prevent or treat autoimmune diseases. One way to induce tolerance is by manipulation of the interaction between costimulatory ligands and receptors on antigen presenting cells (APCs) and lymphocytes.
[0005] CTLA-4 is the most extensively studied costimulatory molecule which down-regulates immune responses. The attributes of immunosuppressive qualities and capacity to induce tolerance have made its recognition as a potential immuno-therapeutic agent for autoimmune mediated inflammatory disorders. Abatacept (commercial name: Orencia) is a fusion protein composed of the ECD (extracellular domain) of CTLA-4 fused to the Fc fragment of hIgG1. Abatacept is believed to induce costimulation blockade, which has been approved for treating patients with rheumatoid arthritis, by effectively interfering with the inflammatory cascade.
[0006] Induction of disease control with the current therapies, followed by progressive withdrawal in parallel with re-establishing immune tolerance, may be an attractive approach in the future of autoimmune therapies. Furthermore, due to their immune specificity, in the absence of global immunosuppression, such therapies should be safer.
[0007] T helper type 1 (Th1) cells are induced by IL-12 and produce IFN-.gamma., while T helper type 2 (Th2) cells secrete IL-4, IL-5 and IL-13. Th1 cells can mediate proinflammatory or cell-mediated immune responses, whereas Th2 cells mainly promote certain types of humoral immunity. Some immune related diseases, such as autoimmune reactions, inflammation, and infection, are characterized by a dysregulation of the pro-versus anti-inflammatory tendencies of the immune system, as well as an imbalance in the Th1 versus Th2 cytokine balance. During inflammation, induction of a shift in the balance from Th1 to Th2 protects the organism from systemic `overshooting` with Th1/pro-inflammatory cytokines, by reducing the inflammatory tendencies of the immune system Immunomodulatory therapies that are associated with a Th1 to Th2 immune shift have protective effects in Th1-mediated autoimmune diseases, such as multiple sclerosis and rheumatoid arthritis. For example, Laquinimod, which has demonstrated efficacy in animal models of several autoimmune diseases including MS, shows immunomodulatory effects through Th1/Th2 shift, and does not lead to immunosuppression. Glatiramer acetate (Copaxone) also induces Th1/Th2 shift with decreased secretion of proinflammatory cytokines, and increased secretion of antiinflammatory cytokines. Furtheremore, GA-specific Th2 cells are able to migrate across the blood-brain barrier and cause in situ bystander suppression of autoaggressive Th1 T cells.
[0008] The balance between proinflammatory mechanisms and the dampening of excessive immune activation is also critical for successful clearance of a pathogen without harm to the host. Excessive immune activation may lead to autoimmune attacks, while too little immune activation will not result in clearance of the pathogen from the host. Chronic pathogens exploit co-inhibitory pathways to attenuate Ag-specific T cell immunity. Emerging data from a wide range of studies on acute and chronic infections support an important role for negative costimulatory receptors in controlling infection. Most notably, exhausted T cells, functionally impaired T cells which are present during chronic infection and are characterized by reduced proliferative and cytotoxic abilities, express high levels of multiple co-inhibitory receptors such as CTLA-4, PD-1, and LAGS (Crawford et al., Curr Opin Immunol. 2009; 21:179-186; Kaufmann et al., J Immunol 2009; 182:5891-5897, Sharpe et al., Nat Immunol 2007; 8:239-245). Furthermore, the exhausted phenotype can be reversed by blocking co-inhibitory pathways (Rivas et al., J Immunol. 2009; 183:4284-91; Golden-Mason et al., J Virol. 2009; 83:9122-30), thus allowing restoration of anti viral immune function, supporting therapeutic application of co-inhibitory blockade in viral infection.
[0009] One potentially promising strategy to control chronic infections such as human immunodeficiency virus, hepatitis B virus, and hepatitis C virus is therapeutic vaccination, which aims to reduce persisting virus by stimulating a patient's own antiviral immune responses.
[0010] However, this approach has fallen short of expectations, because antiviral T cells generated during chronic infections often become functionally exhausted, as explained above, and thus do not respond properly to therapeutic vaccination. Therefore, it is necessary to restore T cell effector functions and effectively boost endogenous T-cell responses in order to develop therapeutic vaccines against chronic viral infections. Blocking the negative signaling pathways, PD-1 and CTLA-4, could restore the host immune system, enabling it to respond to further stimulation. Blockade of the PD-1/PD-L1 pathway, for example, is able to restore functional capabilities to exhausted CTLs (Hofmeyer et al, J. Biomed. & Biotech. Vol. 2011, Art. ID 451694). Combining therapeutic vaccination along with the blockade of inhibitory signals could synergistically enhance functional CD8(+) T-cell responses and improve viral control in chronically infected individuals, providing a promising strategy for the treatment of chronic viral infections. (Ha et al, Immunol Rev. 2008 June; 223:317-33). Antibodies to PD-1 and CTLA-4 are currently in clinical trials in chronic hepatitis C, as promising candidates for combination with both prophylactic and therapeutic vaccines (Diepolder and Obst, Expert Rev Vaccines. 2010 March; 9(3):243-7).
[0011] The therapeutic potential of co-inhibition blockade for treating viral infection was extensively studied by blocking the PD-1/PD-L1. Blocking this pathway was shown to be efficacious in several animal models of infection including acute and chronic Simian immunodeficiency virus (SIV) infection in rhesus macaques (Valu et al., Nature 2009; 458:206-210) and in mouse model of chronic viral infection with lymphocytic choriomeningitis virus (LCMV) (Barber et al., Nature. 2006; 439:682-7).
[0012] Modulation of costimulatory pathway has also been proven effective in optimizing antiviral immunity by limiting the memory T cell response to its protective capacities (Teijaro et al., J Immunol. 2009: 182; 5430-5438). This has been demonstrated in models of influenza infection in which inhibiting CD28 costimulation with CTLA4-Ig suppressed primary responses in naive mice infected with influenza, but was remarkably curative for memory CD4 T cell-mediated secondary responses to influenza leading to improved clinical outcome and increased survival to influenza challenge. The curative effect of CTLA4-Ig on secondary responses was accompanied by inhibition of proliferation and egress of lymphoid naive and memory T cells, while leaving lung resident memory CD4 T cell responses intact thus maintaining enhanced and rapid lung viral clearance mediated by memory CD4 T cells, yet reducing lung immunopathology.
[0013] These data demonstrate an active and reversible role for molecules of the B7:CD28 family, PD-1, CTLA-4, and their ligands, in virus-specific T cell exhaustion associated with chronic viral infection and point to promising potential for immunotherapeutic interventions based on manipulation of these inhibitory networks.
[0014] Regulating costimulation using agonists and antagonists to various costimulatory proteins has been extensively studied as a strategy for treating autoimmune diseases, graft rejection, allergy and cancer. This field has been clinically pioneered by CTLA4-Ig (Abatacept, Orencia.RTM.) that is approved for treatment of RA, and by the anti-CTLA4 antibody (Ipilimumab, Yervoy.RTM.), recently approved for the treatment of melanoma. Other costimulation regulators are currently in advanced stages of clinical development including anti PD-1 antibody (MDX-1106) which is in development for treatment of advanced/metastatic clear-cell renal cell carcinoma (RCC) and anti-CD40L Antibody (BG9588, Antova.RTM.) for treatment of renal allograft transplantation. In addition, such agents are in clinical development for viral infections, for example the anti PD-1 Ab, MDX-1106, is being tested for treatment of hepatitis C. Another example is CP-675,206 (tremelimumab) and anti-CTLA4 Ab which is in a clinical trial in hepatitis C virus-infected patients with hepatocellular carcinoma.
[0015] B cells play a critical role in recognition of foreign antigens and subsequent production of antibodies in the specific humoral adaptive immune responses that provide protection against various types of infectious agents. B cells play a critical role in recognition of foreign antigens and they produce the antibodies necessary to provide protection against various type of infectious agents. T cell help to B cells is a pivotal process of adaptive immune responses. Follicular helper T (Tfh) cells are a subset of CD4+ T cells specialized in B cell help (reviewed by Crotty, Annu. Rev. Immunol. 29: 621-663, 2011). Tfh cells express the B cell homing chemokine receptor, CXCR5, which drives Tfh cell migration into B cell follicles within lymph nodes in a CXCL13-dependent manner. The requirement of Tfh cells for B cell help and T cell-dependent antibody responses, indicates that this cell type is of great importance for protective immunity against various types of infectious agents, as well as for rational vaccine design.
[0016] Tfh cells selectively express a wealth of surface proteins, which are involved in their selective localization (such as CXCR5) and in direct physical interactions with B cells to provide B cell help. Among the latter group are several members of the costimulatory proteins family which are highly expressed in Tfh cells, including the inducible co-stimulatory receptor ICOS, and the negative costimulators (inhibitory receptors) PD-1 and BTLA (Crotty, Annu. Rev. Immunol. 29: 621-663, 2011).
BRIEF SUMMARY OF THE INVENTION
[0017] The background art fails to provide therapies that target multiple cells and pathways involved in autoimmunity and inflammation, such as Th1, Th17, Th22, Th2, Tregs, or other cells that secrete, or influence other cells that secrete, inflammatory molecules such as cytokines, metalloproteases, chemokines and other molecules. The background art also does not teach such therapies that are targeted with regard to providing a balance between excessive immune activation and desirable pro-inflammatory immune activation, for the treatment of autoimmune diseases and infectious disease.
[0018] The present invention is of C1ORF32 protein, and its variants, fragments and fusion proteins thereof, pharmaceutical compositions comprising same and methods of use therof for treatment of immune related disorders and infections.
[0019] With regard to treatment for immune related diseases, it should be noted that such diseases may optionally relate to any disease in which it is desirable to induce immune tolerance. With regard to treatment of infections, it should be noted that such diseases may optionally relate to any disease in which T cell exhaustion to a foreign pathogenic antigen plays a role.
[0020] According to at least some embodiments of the present invention, there are provided C1ORF32 polypeptides, as an isolated polypeptide, comprising an amino acid sequence of C1ORF32 IgV domain fragment, set forth in any one of SEQ ID NOs: 29, 30, 41-105, with the proviso that the amino acid sequence does not include the complete, exact sequence of SEQ ID NO: 35. Optionally, the isolated polypeptide has less than 90% identity with SEQ ID NO:35, optionally has less than 85% identity with SEQ ID NO:35 and optionally has less than 80% identity with SEQ ID NO:35. Also optionally and preferably, the isolated polypeptide consists essentially of the amino acid sequence as set forth in any one of SEQ ID NOs: 29, 30, 41-105, or optionally up to 95% identical thereof. It is further contemplated that optionally the C1ORF32 IgV domain fragment may be extended beyond the border delimited by the end of SEQ ID NO:35, as long as one or more of the above conditions regarding sequence identity are met. A further description of such fragments is provided with regard to Table 1 below.
[0021] Briefly, a sequence alignment and comparison is provided between SEQ ID NO:35 and SEQ ID NO:29, as an example of the above described inventive sequences:
TABLE-US-00001 Query: 1 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRMGESLGMSSTRAQSL 60 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRMGESLGMSSTRAQSL Sbjct: 1 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRMGESLGMSSTRAQSL 60 Query: 61 SKRNLEWDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDS 120 SKRNLEWDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDS Sbjct: 61 SKRNLEWDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDS 120 Query: 121 GLYYCIITTPDDLEGKNEGSLGLLVLGRTGLLADLLPSFAVEIMPE 166 GLYYCIITTPDDLEGKNEDSVELLVLG Sbjct: 121 GLYYCIITTPDDLEGKNEDSVELLVLG................... 147
[0022] For this non-limiting example, SEQ ID NO:29 is shorter than SEQ ID NO:35 but as noted above, for some inventive sequences, the inventive amino acid sequence is longer than SEQ ID NO:35, but still fulfills one or more of the above conditions regarding sequence identity. An equivalent difference exists between the inventive sequences and SEQ ID NO:36, such that the inventive sequences are as described above and herein, the proviso that the amino acid sequence does not include the complete, exact sequence of SEQ ID NO: 36. Optionally, the isolated polypeptide has less than 90% identity with SEQ ID NO:36, optionally has less than 85% identity with SEQ ID NO:36 and optionally has less than 80% identity with SEQ ID NO:36. It is further contemplated that optionally the C1ORF32 IgV domain fragment may be extended beyond the border delimited by the end of SEQ ID NO:36, as long as one or more of the above conditions regarding sequence identity are met.
[0023] According to at least some embodiments, there is provided an isolated polypeptide comprising a soluble C1ORF32 polypeptide or fragment or variant thereof, having an amino acid substitution preventing a cleavage of the C1ORF32 ECD (SEQ ID NO:14) between amino acids F and A at positions 179 and 180 of any of H19011_1_P8_V1 or H19011_1_P8 (Seq ID NOs: 4 or 5). Optionally, the amino acid substitution in the cleavage site of C1ORF32 ECD (SEQ ID NO:14) at positions 179 and 180 of any of H19011_1_P8_V1 or H19011_1_P8 (Seq ID NOs: 4 or 5) is selected from FA->GA; FA->AA; and FA->GG. Optionally and preferably, the polypeptide has an amino acid sequence as set forth in any one of SEQ ID NOs:45, 64, and 96.
[0024] According to at least some embodiments of the present invention, there are provided C1ORF32 polypeptides, optionally provided as fusion proteins containing a C1ORF32 polypeptide. C1ORF32 fusion polypeptides optionally have a first fusion partner comprising part of a C1ORF32 soluble polypeptide, or a sequence homologous thereto, and a second fusion partner composed of a heterologous sequence (respectively non-C1ORF32), fused together directly or indirectly via a peptide linker sequence or a chemical linker.
[0025] Optionally, the fusion protein comprises the polypeptide as described herein, fused to a heterologous sequence, directly or indirectly via a linker peptide, a polypeptide sequence or a chemical linker.
[0026] Optionally the heterologous sequence comprises at least a portion of an immunoglobulin constant domain. Also optionally, the constant domain comprises an immunoglobulin heavy chain constant region corresponding to an antibody isotype selected from the group consisting of an IgG1, IgG2, IgG3, IgG4, IgM, IgE, IgA and IgD.
[0027] Optionally the immunoglobulin constant domain comprises the hinge, CH2 and CH3 regions of a human IgG immunoglobulin, selected from the group consisting of C.gamma.1, C.gamma.2, C.gamma.3 and C.gamma.4 chain.
[0028] Optionally, the fusion protein further comprises a domain that mediates dimerization or multimerization of the fusion protein to form homodimers, heterodimers, homomultimers, or heteromultimers. Optionally, the domain that mediates dimerization or multimerization is selected from the group consisting of one or more cysteines that are capable of forming an intermolecular disulfide bond with a cysteine on the partner fusion protein, a coiled-coil domain, an acid patch, a zinc finger domain, a calcium hand domain, a CHI region, a CL region, a leucine zipper domain, an SH2 (src homology 2) domain, an SH3 (src Homology 3) domain, a PTB (phosphotyrosine binding) domain, a WW domain, a PDZ domain, a 14-3-3 domain, a WD40 domain, an EH domain, a Lim domain, an isoleucine zipper domain, and a dimerization domain of a receptor dimer pair.
[0029] According to at least some embodiments of the present invention, there is provided a dimeric protein comprising a first and a second fusion protein, wherein the first and the second fusion proteins comprise the fusion protein as described herein and wherein the first and the second fusion proteins are bound to one another by covalent or noncovalent bonds to form a dimer.
[0030] According to at least some embodiments, the isolated polypeptide is at least 80, 90, 95, 96, 97, 98 or 99% homologous to a polypeptide set forth in any one of SEQ ID NOs: 29, 30, 41-105. The C1ORF32 polypeptide may be of any species of origin. In further embodiments, the C1ORF32 polypeptide is of murine, non-human primate or human origin.
[0031] Without wishing to be limited by a single hypothesis, according to at least some embodiments the C1ORF32 protein, which may optionally comprise a fusion protein, inhibits the inflammatory activity of Th1, Th17, Th22, or other cells that secrete, or cause other cells to secrete, inflammatory molecules, including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs. Again without wishing to be limited by a single hypothesis, according to at least some embodiments the C1ORF32 protein can also increase the suppressive capacity of Tregs or the immunomodulatory activity of Th2 cells. The C1ORF32 fusion protein can also increase the production of anti-inflammatory molecules such as the cytokine IL-10.
[0032] Optionally, the fragment is of at least about 20 amino acids of the extracellular domain of C1ORF32, but no more than 169 amino acids of the extracellular domain, in order to fulfill the conditions regarding sequence identity as described with regard to SEQ ID NO:35 as described above. Optionally, the fragment is of at least about 21, 22, 23, 24, 25 and so forth amino acids of the extracellular domain of C1ORF32, but no more than 100, 101, 102 and so forth, up to 168 amino acids of the extracellular domain, as described above, optionally including any integral value between 20 and 169 amino acids in length, although as noted above, the inventive sequence may optionally have more amino acids than the ECD of SEQ ID NO:35. Optionally the polypeptide is attached to a detectable or therapeutic moiety.
[0033] According to at least some embodiments of the present invention, there is provided a method for prevention of damage to the myelin coat of neural cells in the central nervous system in MS (multiple sclerosis) patients comprising administering to a subject in need thereof a pharmaceutical composition comprising: a soluble molecule having the C1ORF32 polypeptide, selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof; optionally provided as a pharmaceutical composition. Optionally, the fragment is as described above.
[0034] Multiple sclerosis (MS) is a chronic, inflammatory, demyelinating disorder of the central nervous system (CNS), which involves autoimmune responses to myelin antigens. It is characterized by lesions within the CNS and demyelination is a key feature of these lesions. Autoreactive T cells are thought to initiate an autoimmune response directed against components of CNS myelin. The main targets of the autoimmune reactions are thought to be myelin basic protein (MBP), proteolipid protein (PLP) and myelin oligodendrocyte glycoprotein (MOG). Experimental autoimmune encephalomyelitis (EAE), an animal model of MS induced by immunization with myelin components in adjuvant, shows comparable neuronal pathology. Without wishing to be limited by a single hypothesis, studies in EAE have provided convincing evidence that T cells specific for self-antigens mediate pathology in these diseases.
[0035] According to at least some embodiments of the present invention, there is provided an isolated soluble C1ORF32 polypeptide, selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, fragment, variant, or homolog thereof; optionally as a fusion protein or conjugate, wherein said polypeptide or said fusion protein or conjugate is used for anti-immune related condition immunotherapy for an immune related disorder and/or infection as described herein, optionally provided as a pharmaceutical composition.
[0036] Optionally treating comprises one or more of preventing, curing, managing, reversing, attenuating, alleviating, minimizing, suppressing, managing, or halting the deleterious effects of the above-described diseases.
[0037] Optionally, managing comprises reducing the severity of the disease, reducing the frequency of episodes of the disease, reducing the duration of such episodes, or reducing the severity of such episodes or a combination thereof.
[0038] In another embodiment, the C1ORF32 polypeptides, fragments or variants or homologs thereof, fusion proteins or conjugates comprising same, or pharmaceutical composition comprising same, can be used to treat patients who do not respond to TNF blockers.
[0039] According to at least some embodiments, the present invention provides a method for combining therapeutic vaccination with an antigen along with administration of the foregoing pharmaceutical composition for treatment of infection. According to at least some embodiments of the present invention, the antigen is a viral antigen, a bacterial antigen, fungal antigen and/or other parasite antigen.
[0040] According to at least some embodiments, the present invention further provides a method for combining the foregoing pharmaceutical composition, used as adjuvant, along with an antigen in a vaccine, in order to increase the immune response. According to at least some embodiments of the present invention, the antigen is a viral antigen, a bacterial antigen, fungal antigen, parasite antigen, and/or other pathogen's antigen.
BRIEF DESCRIPTION OF THE FIGURES
[0041] FIG. 1 shows a schematic drawing of a full length soluble C1ORF32 protein. Signal Peptide is shown in italic face font; two potential start points of IgV are shown in underlined italic and bold shape; IgV domain is in bold face font; amino acid region deleted in H19011_1_P9 (SEQ ID NO:6) as compared to the H19011_1_P8 (SEQ ID NO:4) is shown in dashed underline; the locations of the three SNPs (DSVE->GSLG) is shown in double underlined italic and bold shape; the location of point mutations (FA->GA, FA->AA, FA->GG) is shown in bold and dashed underline. Transmembrane domain (TM) of H19011_1_P8 (SEQ ID NO:4) is shown in light font with dotted underline; in H19011_1_P9 (SEQ ID NO:6) the TM starts at amino acid residues "FVG . . . ", 2 amino acids downstream to the start point of the H19011_1_P8 (SEQ ID NO:4) transmembrane domain. Vertical bars represent five possible C-terminal end points of the soluble C1ORF32 proteins from position 1 on the left (end of IgV) to position 5 on the right (end of predicted ECD).
[0042] FIG. 2 shows SDS-PAGE results for produced proteins.
[0043] FIG. 3 shows inhibitory effect of Fc-fused C1ORF32 ECD (SEQ ID NO:108), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), and C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) on mouse CD4+ T cell IFN.gamma. secretion. Purified CD4+CD25- T cells, 1.times.10.sup.5 per well, were stimulated with anti-CD3 mAb (2 ug/mL) in the presence of test proteins or control mouse IgG2a at 0, 3 and 10 .mu.g/ml. Culture supernatants were collected 48 hrs post stimulation and analyzed using mouse IFN.gamma. ELISA kit. Results are shown as Mean.+-.SD of four wells per point (Student's t-test, ***P<0.001, compared with control mouse IgG2a).
[0044] FIG. 4 shows inhibitory effect of Fc-fused C1ORF32 ECD (SEQ ID NO:108), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), and C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) on expression of the early TCR activation marker, CD69. 1.times.10.sup.5 CD4+CD25- T cells were stimulated with plate bound anti-CD3 (2 .mu.g/ml) together with test proteins or control mIgG2a (10 .mu.g/ml). Cells were analyzed at 48 hrs for the expression CD69 by flow cytometry (**; P value<0.001 compare to control mIgG2A, student's T test).
[0045] FIG. 5 shows inhibitory effect of Fc-fused C1ORF32 ECD (SEQ ID NO:108), (two different batches produced in CHO--S And in CHO-DG44), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), and C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) (two different batches produced in CHO--S And in CHO-DG44) on naive T cell proliferation. No inhibition was observed with the IgG2a isotype control.
DETAILED DESCRIPTION OF THE INVENTION
[0046] The present invention, in at least some embodiments, relates to any one of the C1ORF32 proteins, selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, fragments, variants and homologs thereof and fusion proteins and conjugates containing same, and pharmaceutical compositions comprising same, and nucleic acid sequences encoding same, and the use thereof as a therapeutic agent for treatment of immune related disorder and/or infection, and/or optionally the corresponding DNAs or vectors or cells expressing same for use in immunotherapy.
[0047] In order that the present invention may be more readily understood, certain terms are first defined. Additional definitions are set forth throughout the detailed description.
[0048] As used herein the term "isolated" refers to a compound of interest (for example a polynucleotide or a polypeptide) that is in an environment different from that in which the compound naturally occurs e.g. separated from its natural milieu such as by concentrating a peptide to a concentration at which it is not found in nature. "Isolated" includes compounds that are within samples that are substantially enriched for the compound of interest and/or in which the compound of interest is partially or substantially purified.
[0049] An "immune cell" refers to any cell from the hemopoietic origin including but not limited to T cells, B cells, monocytes, dendritic cells, and macrophages.
[0050] As used herein, the term "polypeptide" refers to a chain of amino acids of any length, regardless of modification (e.g., phosphorylation or glycosylation).
[0051] The term "immune related disease (or disorder or condition)" as used herein should be understood to encompass any disease disorder or condition selected from the group including but not limited to autoimmune diseases, inflammatory disorders and immune disorders associated with graft transplantation rejection, such as acute and chronic rejection of organ transplantation, allogenic stem cell transplantation, autologous stem cell transplantation, bone marrow tranplantation, and graft versus host disease.
[0052] As used herein the term "inflammatory disorders" and/or "inflammation", used interchangeably, includes inflammatory abnormalities characterized by disregulated immune response to harmful stimuli, such as pathogens, damaged cells, or irritants. Inflammatory disorders underlie a vast variety of human diseases. Non-immune diseases with etiological origins in inflammatory processes include atherosclerosis, and ischaemic heart disease. Examples of disorders associated with inflammation include: Chronic prostatitis, Glomerulonephritis, Hypersensitivities, Pelvic inflammatory disease, Reperfusion injury, Sarcoidosis, Vasculitis, Interstitial cystitis, normocomplementemic urticarial vasculitis, pericarditis, myositis, anti-synthetase syndrome, scleritis, macrophage activation syndrome, Bechet's Syndrome, PAPA Syndrome, Blau's Syndrome, gout, adult and juvenile Still's disease, cryropyrinopathy, Muckle-Wells syndrome, familial cold-induced auto-inflammatory syndrome, neonatal onset multisystemic inflammatory disease, familial Mediterranean fever, chronic infantile neurologic, cutaneous and articular syndrome, systemic juvenile idiopathic arthritis, Hyper IgD syndrome, Schnitzler's syndrome, TNF receptor-associated periodic syndrome (TRAPSP), gingivitis, periodontitis, hepatitis, cirrhosis, pancreatitis, myocarditis, vasculitis, gastritis, gout, gouty arthritis, and inflammatory skin disorders, selected from the group consisting of psoriasis, atopic dermatitis, eczema, rosacea, urticaria, and acne.
[0053] The term "autoimmune disease" as used herein should be understood to encompass any disease in which recognition of a "self" antigen (self-reactivity) is at least a part of the disease process. According to at least some embodiments of the invention, the autoimmune diseases should be understood to encompass any disease disorder or condition including one or more of, but not limited to, multiple sclerosis, rheumatoid arthritis; psoriatic arthritis, discoid lupus erythematosus, systemic lupus erythematosus (SLE); ulcerative colitis; Crohn's disease; benign lymphocytic angiitis, autoimmune lymphoproliferative syndrome, sarcoidosis, autoimmune thrombocytopenic purpura, idiopathic thrombocytopenic purpura, pure red cell aplasia, Sjogren's syndrome, rheumatic disease, polymyalgia rheumatica, mixed connective tissue disease, inflammatory rheumatism, degenerative rheumatism, extra-articular rheumatism, juvenile arthritis, juvenile rheumatoid arthritis, systemic juvenile idiopathic arthritis, arthritis uratica, muscular rheumatism, chronic polyarthritis, reactive arthritis, Reiter's syndrome, rheumatic fever, relapsing polychondritis, Raynaud's phenomenon, vasculitis, cryoglobulinemic vasculitis, ANCA-associated vasculitis, temporal arteritis, giant cell arteritis, Takayasu arteritis, Behcet's disease, antiphospholipid syndrome, myasthenia gravis, autoimmune haemolytic anaemia, Guillain-Barre syndrome, chronic immune polyneuropathy, chronic inflammatory demyelinating polyneuropathy, autoimmune thyroiditis, insulin dependent diabetes mellitus, type I diabetes, Addison's disease, membranous glomerulonephropathy, polyglandular autoimmune syndromes, Goodpasture's disease, autoimmune gastritis, autoimmune atrophic gastritis, pernicious anaemia, pemphigus, pemphigus vulgaris, cirrhosis, primary biliary cirrhosis, idiopathic pulmonary fibrosis, myositis, dermatomyositis, juvenile dermatomyositis, polymyositis, fibromyositis, myogelosis, celiac disease, celiac sprue dermatitis, immunoglobulin A nephropathy, Henoch-Schonlein purpura, Evans syndrome, atopic dermatitis, psoriasis, psoriasis vulgaris, psoriasis arthropathica, Graves' disease, Graves' ophthalmopathy, scleroderma, systemic scleroderma, progressive systemic scleroderma, diffuse scleroderma, localized scleroderma, Crest syndrome, asthma, allergic asthma, allergy, primary biliary cirrhosis, Hashimoto's thyroiditis, fibromyalgia, chronic fatigue and immune dysfunction syndrome (CFIDS), primary myxedema, sympathetic ophthalmia, autoimmune inner ear disease, autoimmune uveitis, autoimmune chronic active hepatitis, collagen diseases, ankylosing spondylitis, periarthritis humeroscapularis, panarteritis nodosa, polyarteritis nodosa, chondrocalcinosis, Wegener's granulomatosis, microscopic polyangiitis, chronic urticaria, bullous skin disorders, pemphigoid, bullous pemphigoid, cicatricial pemphigoid, vitiligo, atopic eczema, eczema, chronic urticaria, autoimmune urticaria, normocomplementemic urticarial vasculitis, hypocomplementemic urticarial vasculitis, alopecia areata, alopecia universalis, alopecia totalis, Devic's disease, pernicious anemia, childhood autoimmune hemolytic anemia, idiopathic autoimmune hemolytic anemia, refractory or chronic Autoimmune Cytopenias, Prevention of development of Autoimmune Anti-Factor VIII Antibodies in Acquired Hemophilia A, Cold agglutinin disease, Neuromyelitis Optica, Stiff Person Syndrome, gingivitis, periodontitis, pancreatitis, myocarditis, gastritis, gout, gouty arthritis, idiopathic pericarditis, anti-synthetase syndrome, scleritis, macrophage activation syndrome, PAPA Syndrome, Blau's Syndrome, adult and juvenile Still's disease, cryopyrin associated periodic syndrome, Muckle-Wells syndrome, familial cold auto-inflammatory syndrome, neonatal onset multisystem inflammatory disease, chronic infantile neurologic cutaneous and articular syndrome, familial Mediterranean fever, Hyper IgD syndrome, Schnitzler's syndrome, autoimmune retinopathy, age-related macular degeneration, or TNF receptor-associated periodic syndrome (TRAPS).
[0054] As used herein, "multiple sclerosis" comprises multiple sclerosis or a related disease, and optionally refers to all types and stages of multiple sclerosis, including, but not limited to: benign multiple sclerosis, relapsing remitting multiple sclerosis, secondary progressive multiple sclerosis, primary progressive multiple sclerosis, progressive relapsing multiple sclerosis, chronic progressive multiple sclerosis, transitional/progressive multiple sclerosis, rapidly worsening multiple sclerosis, clinically-definite multiple sclerosis, malignant multiple sclerosis, also known as Marburg's Variant, and acute multiple sclerosis. Optionally, "conditions relating to multiple sclerosis" include, e.g., Devic's disease, also known as Neuromyelitis Optica; acute disseminated encephalomyelitis, acute demyelinating optic neuritis, demyelinative transverse myelitis, Miller-Fisher syndrome, encephalomyelradiculoneuropathy, acute demyelinative polyneuropathy, tumefactive multiple sclerosis and Balo's concentric sclerosis.
[0055] As used herein, "rheumatoid arthritis" comprises rheumatoid arthritis or a related disease and refers to all types and stages of rheumatoid arthritis, including, but not limited to: rheumatoid arthritis, gout and pseudo-gout, juvenile idiopathic arthritis, juvenile rheumatoid arthritis, Still's disease, ankylosing spondylitis, rheumatoid vasculitis. Optionally, conditions relating to rheumatoid arthritis include, e.g., osteoarthritis, sarcoidosis, Henoch-Schonlein purpura, Psoriatic arthritis, Reactive arthritis, Spondyloarthropathy, septic arthritis, Haemochromatosis, Hepatitis, vasculitis, Wegener's granulomatosis, Lyme disease, Familial Mediterranean fever, Hyperimmunoglobulinemia D with recurrent fever, TNF receptor associated periodic syndrome, and Enteropathic arthritis associated with inflammatory bowel disease.
[0056] As used herein, "Uveitis" refers to all types and stages of Uveitis, including, but not limited to: anterior uveitis (or iridocyclitis), intermediate uveitis (pars planitis), posterior uveitis (or chorioretinitis) and the panuveitic form.
[0057] As used herein, "inflammatory bowel disease" also refers to a related disease and refers to all types and stages of inflammatory bowel disease (IBD), including, but not limited to: Crohn's disease and ulcerative colitis (UC). Optionally, conditions relating to IBD include, e.g., Collagenous colitis, Lymphocytic colitis, Ischaemic colitis, Diversion colitis, Behcet's disease, Indeterminate colitis.
[0058] As used herein, "psoriasis" also refers to a related disease and refers to all types and stages of psoriasis, including, but not limited to: Nonpustular Psoriasis including Psoriasis vulgaris and Psoriatic erythroderma (erythrodermic psoriasis), Pustular psoriasis including Generalized pustular psoriasis (pustular psoriasis of von Zumbusch), Pustulosis palmaris et plantaris (persistent palmoplantar pustulosis, pustular psoriasis of the Barber type, pustular psoriasis of the extremities), Annular pustular psoriasis, Acrodermatitis continua, Impetigo herpetiformis. Optionally, conditions relating to psoriasis include, e.g., drug-induced psoriasis, Inverse psoriasis, Napkin psoriasis, Seborrheic-like psoriasis, Guttate psoriasis, Nail psoriasis, Psoriatic arthritis.
[0059] As used herein, "type 1 diabetes" refers to all types and stages of type 1 diabetes, including, but not limited to: insulin-dependent diabetes mellitus, idiopathic diabetes, juvenile type ldiabetes, maturity onset diabetes of the young, latent autoimmune diabetes in adults, gestational diabetes. Conditions relating to type 1 diabetes include, neuropathy including polyneuropathy, mononeuropathy, peripheral neuropathy and autonomicneuropathy; eye complications: glaucoma, cataracts, retinopathy.
[0060] As used herein, "Sjogren's syndrome" refers to all types and stages of Sjogren's syndrome, including, but not limited to: Primary Sjogren's syndrome and Secondary Sjogren's syndrome. Conditions relating to Sjogren's syndrome include connective tissue disease, such as rheumatoid arthritis, systemic lupus erythematosus, or scleroderma. Other complications include pneumonia, polmunary fibrosis, interstitial nephritis, inflammation of the tissue around the kidney's filters, glomerulonephritis, renal tubular acidosis, carpal tunnel syndrome, peripheral neuropathy, cranial neuropathy, primary biliary cirrhosis (PBC), cirrhosis, Inflammation in the esophagus, stomach, pancreas, and liver (including hepatitis), Polymyositis, Raynaud's phenomenon, Vasculitis, Autoimmune thyroid problems, lymphoma.
[0061] As used herein, "systemic lupus erythematosus", refers to all types and stages of systemic lupus erythematosus, including, but not limited to discoid lupus, lupus arthritis, lupus pneumonitis, lupus nephritis. Conditions relating to systemic lupus erythematosus include osteoarticular tuberculosis, antiphospholipid antibody syndrome, inflammation of various parts of the heart, such as pericarditis, myocarditis, and endocarditis, Lung and pleura inflammation, pleuritis, pleural effusion, chronic diffuse interstitial lung disease, pulmonary hypertension, pulmonary emboli, pulmonary hemorrhage, and shrinking lung syndrome, lupus headache, Guillain-Barre syndrome, aseptic meningitis, demyelinating syndrome, mononeuropathy, mononeuritis multiplex, myasthenia gravis, myelopathy, cranial neuropathy, polyneuropathy, vasculitis.
[0062] As used herein the term "infectious disorder and/or disease" and/or "infection", used interchangeably, includes any disorder, disease and/or condition caused by presence and/or growth of pathogenic biological agent in an individual host organism. As used herein the term "infection" comprises the disorder, disease and/or condition as above, exhibiting clinically evident illness (i.e., characteristic medical signs and/or symptoms of disease) and/or which is asymtomatic for much or all of it course. As used herein the term "infection" also comprises disorder, disease and/or condition caused by persistence of foreign antigen that lead to exhaustion T cell phenotype characterized by impaired functionality which is manifested as reduced proliferation and cytokine production. As used herein the term "infectious disorder and/or disease" and/or "infection", further includes any of the below listed infectious disorders, diseases and/or conditions, caused by a bacterial infection, viral infection, fungal infection and/or parasite infection.
[0063] As used herein the term "viral infection" comprises any infection caused by a virus, optionally including but not limited to Retroviridae (e.g., human immunodeficiency viruses, such as HIV-1 or HIV-2, acquired immune deficiency (AIDS) also referred to as HTLV-III, LAV or HTLV-III/LAV, or HIV-III; and other isolates, such as HIV-LP; Picornaviridae (e.g., polio viruses, hepatitis A virus; enteroviruses, human coxsackie viruses, rhinoviruses, echoviruses); Calciviridae (e.g., strains that cause gastroenteritis); Togaviridae (e.g., equine encephalitis viruses, rubella viruses); Flaviridae (e.g., dengue viruses, encephalitis viruses, yellow fever viruses); Coronaviridae (e.g., coronaviruses); Rhabdoviridae (e.g., vesicular stomatitis viruses, rabies viruses); Filoviridae (e.g., ebola viruses); Paramyxoviridae (e.g., parainfluenza viruses, mumps virus, measles virus, respiratory syncytial virus); Orthomyxoviridae (e.g., influenza viruses); Bungaviridae (e.g., Hantaan viruses, bunga viruses, phleboviruses and Nairo viruses); Arena viridae (hemorrhagic fever virus); Reoviridae (e.g., reoviruses, orbiviruses and rotaviruses); Birnaviridae; Hepadnaviridae (Hepatitis B virus); Parvoviridae (parvoviruses); Papovaviridae (papilloma viruses, polyoma viruses); Adenoviridae (most adenoviruses); Herperviridae (herpes simplex virus (HSV) 1 and 2, varicella zoster virus, cytomegalovirus (CMV), herpes viruses); Poxviridae (variola virsues, vaccinia viruses, pox viruses); and Iridoviridae (e.g., African swine fever virus); and unclassified viruses (e.g., the etiological agents of Spongiform encephalopathies, the agent of delta hepatitides (thought to be a defective satellite of hepatitis B virus), the agents of non-A, non-B hepatitis (class 1--internally transmitted; class 2--parenterally transmitted (i.e., Hepatitis C); Norwalk and related viruses, and astroviruses) as well as Severe acute respiratory syndrome virus and respiratory syncytial virus (RSV).
[0064] As used herein the term "fungal infection" comprises any infection caused by a fungi, optionally including but not limited to Cryptococcus neoformans, Histoplasma capsulatum, Coccidioides immitis, Blastomyces dermatitidis, Chlamydia trachomatis, Candida albicans.
[0065] As used herein the term "parasite infection" comprises any infection caused by a parasite, optionally including but not limited to protozoa, such as Amebae, Flagellates, Plasmodium falciparum, Toxoplasma gondii, Ciliates, Coccidia, Microsporidia, Sporozoa; helminthes, Nematodes (Roundworms), Cestodes (Tapeworms), Trematodes (Flukes), Arthropods, and aberrant proteins known as prions.
[0066] An infectious disorder and/or disease caused by bacteria may optionally comprise one or more of Sepsis, septic shock, sinusitis, skin infections, pneumonia, bronchitis, meningitis, Bacterial vaginosis, Urinary tract infection (UCI), Bacterial gastroenteritis, Impetigo and erysipelas, Erysipelas, Cellulitis, anthrax, whooping cough, lyme disease, Brucellosis, enteritis, acute enteritis, Tetanus, diphtheria, Pseudomembranous colitis, Gas gangrene, Acute food poisoning, Anaerobic cellulitis, Nosocomial infections, Diarrhea, Meningitis in infants, Traveller's diarrhea, Hemorrhagic colitis, Hemolytic-uremic syndrome, Tularemia, Peptic ulcer, Gastric and Duodenal ulcers, Legionnaire's Disease, Pontiac fever, Leptospirosis, Listeriosis, Leprosy (Hansen's disease), Tuberculosis, Gonorrhea, Ophthalmia neonatorum, Septic arthritis, Meningococcal disease including meningitis, Waterhouse-Friderichsen syndrome, Pseudomonas infection, Rocky mountain spotted fever, Typhoid fever type salmonellosis, Salmonellosis with gastroenteritis and enterocolitis, Bacillary dysentery/Shigellosis, Coagulase-positive staphylococcal infections: Localized skin infections including Diffuse skin infection (Impetigo), Deep localized infections, Acute infective endocarditis, Septicemia, Necrotizing pneumonia, Toxinoses such as Toxic shock syndrome and Staphylococcal food poisoning, Cystitis, Endometritis, Otitis media, Streptococcal pharyngitis, Scarlet fever, Rheumatic fever, Puerperal fever, Necrotizing fasciitis, Cholera, Plague (including Bubonic plague and Pneumonic plague), as well as any infection caused by a bacteria selected from but not limited to Helicobacter pyloris, Boreliai burgdorferi, Legionella pneumophilia, Mycobacteria sps (e.g., M. tuberculosis, M. avium, M. Intracellulare, M. kansaii, M gordonae), Staphylococcus aureus, Neisseria gonorrhoeae, Neisseria meningitidis, Listeria monocytogenes, Streptococcus pyogenes (Group A Streptococcus), Streptococcus agalactiae (Group B Streptococcus), Streptococcus (viridans group), Streptococcus faecalis, Streptococcus bovis, Streptococcus (anaerobic sps.), Streptococcus pneumoniae, pathogenic Campylobacter sp., Enterococcus sp Haemophilus influenzae, Bacillus antracis, corynebacterium diphtheriae, corynebacterium sp., Erysipelothrix rhusiopathiae, Clostridium perfringers, Clostridium tetani, Enterobacter erogenes, Klebsiella pneuomiae, Pasteurella multicoda, Bacteroides sp., Fusobacterium nucleatum, Sreptobacillus moniliformis, Treponema pallidium, Treponema pertenue, Leptospira, and Actinomeyces israelli.
[0067] Non limiting examples of infectious disorder and/or disease caused by virus is selected from the group consisting of but not limited to acquired immune deficiency (AIDS), West Nile encephalitis, coronavirus infection, rhinovirus infection, influenza, dengue, hemorrhagic fever; an otological infection; severe acute respiratory syndrome (SARS), acute febrile pharyngitis, pharyngoconjunctival fever, epidemic keratoconjunctivitis, infantile gastroenteritis, infectious mononucleosis, Burkitt lymphoma, acute hepatitis, chronic hepatitis, hepatic cirrhosis, hepatocellular carcinoma, primary HSV-1 infection, (gingivostomatitis in children, tonsillitis & pharyngitis in adults, keratoconjunctivitis), latent HSV-1 infection (herpes labialis, cold sores), aseptic meningitis, Cytomegalovirus infection, Cytomegalic inclusion disease, Kaposi sarcoma, Castleman disease, primary effusion lymphoma, influenza, measles, encephalitis, postinfectious encephalomyelitis, Mumps, hyperplastic epithelial lesions (common, flat, plantar and anogenital warts, laryngeal papillomas, epidermodysplasia verruciformis), croup, pneumonia, bronchiolitis, Poliomyelitis, Rabies, bronchiolitis, pneumonia, German measles, congenital rubella, Hemorrhagic Fever, Chickenpox, Dengue, Ebola infection, Echovirus infection, EBV infection, Fifth Disease, Filovirus, Flavivirus, Hand, foot & mouth disease, Herpes Zoster Virus (Shingles), Human Papilloma Virus Associated Epidermal Lesions, Lassa Fever, Lymphocytic choriomeningitis, Parainfluenza Virus Infection, Paramyxovirus, Parvovirus B19 Infection, Picornavirus, Poxviruses infection, Rotavirus diarrhea, Rubella, Rubeola, Varicella, Variola infection.
[0068] An infectious disorder and/or disease caused by fungi optionally includes but is not limited to Allergic bronchopulmonary aspergillosis, Aspergilloma, Aspergillosis, Basidiobolomycosis, Blastomycosis, Candidiasis, Chronic pulmonary aspergillosis, Chytridiomycosis, Coccidioidomycosis, Conidiobolomycosis, Covered smut (barley), Cryptococcosis, Dermatophyte, Dermatophytid, Dermatophytosis, Endothrix, Entomopathogenic fungus, Epizootic lymphangitis, Epizootic ulcerative syndrome, Esophageal candidiasis, Exothrix, Fungemia, Histoplasmosis, Lobomycosis, Massospora cicadina, Mycosis, Mycosphaerella fragariae, Myringomycosis, Paracoccidioidomycosis, Pathogenic fungi, Penicilliosis, Thousand cankers disease, Tinea, Zeaspora, Zygomycosis.Non limiting examples of infectious disorder and/or disease caused by parasites is selected from the group consisting of but not limited to Acanthamoeba, Amoebiasis, Ascariasis, Ancylostomiasis, Anisakiasis, Babesiosis, Balantidiasis, Baylisascariasis, Blastocystosis, Candiru, Chagas disease, Clonorchiasis, Cochliomyia, Coccidia, Chinese Liver Fluke Cryptosporidiosis, Dientamoebiasis, Diphyllobothriasis, Dioctophyme renalis infection, Dracunculiasis, Echinococcosis, Elephantiasis, Enterobiasis, Fascioliasis, Fasciolopsiasis, Filariasis, Giardiasis, Gnathostomiasis, Hymenolepiasis, Halzoun Syndrome, Isosporiasis, Katayama fever, Leishmaniasis, lymphatic filariasis, Malaria, Metagonimiasis, Myiasis, Onchocerciasis, Pediculosis, Primary amoebic meningoencephalitis, Parasitic pneumonia, Paragonimiasis, Scabies, Schistosomiasis, Sleeping sickness, Strongyloidiasis, Sparganosis, Rhinosporidiosis, River blindness, Taeniasis (cause of Cysticercosis), Toxocariasis, Toxoplasmosis, Trichinosis, Trichomoniasis, Trichuriasis, Trypanosomiasis, Tapeworm infection.
[0069] A preferred example of infectious disease is a disease caused by any of hepatitis B, hepatitis C, infectious mononucleosis, EBV, cytomegalovirus, AIDS, HIV-1, HIV-2, tuberculosis, malaria and schistosomiasis.
[0070] As used herein, the term "vaccine" refers to a biological preparation that improves immunity to a particular disease, wherein the vaccine includes an antigen, such as weakened or killed forms of pathogen, its toxins or one of its surface proteins, against which immune responses are elicited. A vaccine typically includes an adjuvant as immune potentiator to stimulate the immune system. As used herein, the term "therapeutic vaccine" and/or "therapeutic vaccination" refers to a vaccine used to treat ongoing disease, such as infectious disease.
[0071] As used herein, the term "adjuvant" refers to an agent used to stimulate the immune system and increase the response to a vaccine, without having any specific antigenic effect in itself.
[0072] As used herein, a "costimulatory polypeptide" or "costimulatory molecule" is a polypeptide that, upon interaction with a cell-surface molecule on T cells, modulates T cell responses.
[0073] As used herein, a "costimulatory signaling" is the signaling activity resulting from the interaction between costimulatory polypeptides on antigen presenting cells and their receptors on T cells during antigen-specific T cell responses. Without wishing to be limited by a single hypothesis, the antigen-specific T cell response is believed to be mediated by two signals: 1) engagement of the T cell Receptor (TCR) with antigenic peptide presented in the context of MHC (signal 1), and 2) a second antigen-independent signal delivered by contact between different costimulatory receptor/ligand pairs (signal 2). Without wishing to be limited by a single hypothesis, this "second signal" is critical in determining the type of T cell response (activation vs inhibition) as well as the strength and duration of that response, and is regulated by both positive and negative signals from costimulatory molecules, such as the B7 family of proteins.
[0074] As used herein, the term "B7" polypeptide means a member of the B7 family of proteins that costimulate T cells including, but not limited to B7-1, B7-2, B7-DC, B7-H5, B7-H1, B7-H2, B7-H3, B7-H4, B7-H6, B7-S3 and biologically active fragments and/or variants thereof. Representative biologically active fragments include the extracellular domain or fragments of the extracellular domain that costimulate T cells.
[0075] As used herein, "inflammatory molecules" refers to molecules that induce inflammatory responses (directly or indirectly) including, but not limited to, cytokines and metalloproteases such as including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs.
[0076] As used herein, the term "vaccine" refers to a biological preparation that improves immunity to a particular disease, wherein the vaccine includes an antigen, such as weakened or killed forms of pathogen, its toxins or one of its surface proteins, against which immune responses are elicited. A vaccine typically includes an adjuvant as immune potentiator to stimulate the immune system. As used herein, the term "therapeutic vaccine" and/or "therapeutic vaccination" refers to a vaccine used to treat ongoing disease, such as infectious disease.
[0077] As used herein, the term "adjuvant" refers to an agent used to stimulate the immune system and increase the response to a vaccine, without having any specific antigenic effect in itself.
[0078] As used herein, a "vector" is a replicon, such as a plasmid, phage, or cosmid, into which another DNA segment may be inserted so as to bring about the replication of the inserted segment. The vectors described herein can be expression vectors. As used herein, an "expression vector" is a vector that includes one or more expression control sequences
[0079] As used herein, an "expression control sequence" is a DNA sequence that controls and regulates the transcription and/or translation of another DNA sequence.
[0080] "Operably linked" refers to an arrangement of elements wherein the components so described are configured so as to perform their usual or intended function. Thus, two different polypeptides operably linked together retain their respective biological functions while physically linked together.
[0081] As used herein, "valency" refers to the number of binding sites available per molecule.
[0082] As used herein, a "variant" polypeptide contains at least one amino acid sequence alteration as compared to the amino acid sequence of the corresponding wild-type polypeptide.
[0083] As used herein, "conservative" amino acid substitutions are substitutions wherein the substituted amino acid has similar structural or chemical properties. As used herein, the term "host cell" refers to prokaryotic and eukaryotic cells into which a recombinant vector can be introduced.
[0084] As used herein, "transformed" and "transfected" encompass the introduction of a nucleic acid (e.g. a vector) into a cell by a number of techniques known in the art.
[0085] As used herein, the terms "immunologic", "immunological" or "immune" response is the development of a beneficial humoral (antibody mediated) and/or a cellular (mediated by antigen-specific T cells or their secretion products) response directed against a peptide in a recipient patient. Such a response can be an active response induced by administration of immunogen or a passive response induced by administration of antibody or primed T-cells. Without wishing to be limited by a single hypothesis, a cellular immune response is elicited by the presentation of polypeptide epitopes in association with Class I or Class II MHC molecules to activate antigen-specific CD4+ T helper cells and/or CD8+ cytotoxic T cells. The response may also involve activation of monocytes, macrophages, NK cells, basophils, dendritic cells, astrocytes, microglia cells, eosinophils, activation or recruitment of neutrophils or other components of innate immunity. The presence of a cell-mediated immunological response can be determined by proliferation assays (CD4+ T cells) or CTL (cytotoxic T lymphocyte) assays. The relative contributions of humoral and cellular responses to the protective or therapeutic effect of an immunogen can be distinguished by separately isolating antibodies and T-cells from an immunized syngeneic animal and measuring protective or therapeutic effect in a second subject.
[0086] An "immunogenic agent" or "immunogen" is capable of inducing an immunological response against itself on administration to a mammal, optionally in conjunction with an adjuvant.
[0087] As used herein, the term "C1ORF32" refers to the protein encoded by any one of the H19011_1_T8 (SEQ ID NO:1), H19011_1_T9 (SEQ ID NO:2) transcripts reported herein, particularly to proteins as set forth in any one of H19011_1_P8 (SEQ ID NO:4), H19011_1_P8_V1 (SEQ ID NO:5), H19011_1_P9 (SEQ ID NO:6) or H19011_1_P9_V1 (SEQ ID NO:34), variants and fragments thereof, which can have therapeutic effect on immune related disorder and/or infection.
[0088] Fragments of C1ORF32 Polypeptides
[0089] As used herein the term "soluble C1ORF32" or "soluble C1ORF32 proteins/molecules" refers to fragments of C1ORF32 that include some or all of the IgV domain of the C1ORF32 polypeptide, and lack some or all of the intracellular and/or transmembrane domains, wherein said fragments retain a biological activity of inhibition of T cell activation.
[0090] The soluble C1ORF32 molecules used in the methods of the invention may or may not include a signal (leader) peptide sequence.
[0091] Various fragments are given in Table 1 below. "N-term" refers to the N-terminus, so "first N-term" refers to the N-terminus. Particular sequences of interest, according to at least some embodiments of the present invention, include but are not limited to SEQ ID NOs: 29, 30, 41-105, and/or 45, 64, or 96. It should be noted that one or more activities and/or functions ascribed herein to any of SEQ ID NOs: 29, 30, 41-105 are also applicable to any of SEQ ID NOs: 45, 64 or 96.
[0092] The below table describes a number of sequences with abbreviations, which are defined as follows. The terms "first N-term" and "second N-term" refer to the two potential start points of the IgV domain, as shown in FIG. 1. The terms "#1 option cut point" (and "#2 option cut point") refer to different possible C-terminal end points of the soluble protein--also as shown in FIG. 1. FIG. 1 shows five different possible C-terminal end points, which are as follows: the end of the IgV domain, #1 option cut point, #2 option cut point, the end of the produced protein, and the position before the start of the predicted TM (transmembrane region, which occurs two amino acids after the end of the produced protein). Reference to "+1" or "-1" from a reference point indicate one amino acid after or before that point, respectively, with larger numbers indicating a greater number of amino acids after or before that point as stated below.
[0093] The right-most column relates to the SEQ ID NO of the amino acid sequence fused to an Fc sequence (hIgG1C220S-SEQ ID NO 115) to form a fusion protein; for example, the amino acid sequence having SEQ ID NO:14, given as fused the above Fc sequence, has SEQ ID NO:116 as a fusion protein.
TABLE-US-00002 TABLE 1 amino acid sequences discussed in the present application SEQ ID NO with Fc SEQ (hIgG1 C220S - ID SEQ ID 115) NO: Amino acid sequence Description fusion 14 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV residues 21-184 of 116 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE H19011_1_P8 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG REITIVHDADLQIGKLMWGDSGLYYCIITTPDD LEGKNEGSLGLLVLGRTGLLADLLPSFAVEIM 15 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV residues 21-169 of 117 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE H19011_1_P9 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG REITIVHDADLQIGKLMWGDSGLYYCIITTPDD LEGKNEGSLGLLVLEWV 19 MDRVLLRWISLFWLTAMVEGLQVTVPDKKKVAM residues 1-184 of the 118 LFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRM sequence H19011_1_P8_V1 GESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRT VRVVASKQGSTVTLGDFYRGREITIVHDADLQI GKLMWGDSGLYYCIITTPDDLEGKNEDSVELLV LGRTGLLADLLPSFAVEIM 28 MDRVLLRWISLFWLTAMVEGLQVTVPDKKKVAM residues 1-169 of 119 LFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRM H19011_1_P9 GESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRT VRVVASKQGSTVTLGDFYRGREITIVHDADLQI GKLMWGDSGLYYCIITTPDDLEGKNEGSLGLLV LEW 29 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV residues 21-167 of 120 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE H19011_1_P8_V1 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG REITIVHDADLQIGKLMWGDSGLYYCIITTPDD LEGKNEDSVELLVLG 30 CHFSTSSHQPAVVQWKFKSYCQDRMGESLGMSS residues 42-145 of 121 TRAQSLSKRNLEWDPYLDCLDSRRTVRVVASKQ (H19011_1_P8 from GSTVTLGDFYRGREITIVHDADLQIGKLMWGDS first C residue to GLYYC last C residue) 35 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_from_21_ 122 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE to_184 (first N- WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG term to end of REITIVHDADLQIGKLMWGDSGLYYCIITTPDD produced ECD -2 from LEGKNEDSVELLVLGRTGLLADLLPSFAVEIM end of predicted ECD) 36 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV residues 21-169 of 123 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE H19011_1_P9_V1 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG REITIVHDADLQIGKLMWGDSGLYYCIITTPDD LEGKNEDSVELLVLEWV 37 MDRVLLRWISLFWLTAMVEGLQVTVPDKKKVAM residues 1-184 of 124 LFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRM H19011_1_P8 GESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRT VRVVASKQGSTVTLGDFYRGREITIVHDADLQI GKLMWGDSGLYYCIITTPDDLEGKNEGSLGLLV LGRTGLLADLLPSFAVEIM 40 MDRVLLRWISLFWLTAMVEGLQVTVPDKKKVAM residues 1-169 of 125 LFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRM H19011_1_P9_V1 GESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRT VRVVASKQGSTVTLGDFYRGREITIVHDADLQI GKLMWGDSGLYYCIITTPDDLEGKNEDSVELLV LEWV 41 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV residues 21-167 of 126 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE H19011_1_P8 (first N- WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG term to end of IgV) REITIVHDADLQIGKLMWGDSGLYYCIITTPDD LEGKNEGSLGLLVLG 42 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_from_21_ 127 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE l_to_164 (first N- WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG term to -3 from end REITIVHDADLQIGKLMWGDSGLYYCIITTPDD of IgV) LEGKNEDSVELL 43 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_from_21_ 128 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE l_to_165 (first N- WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG term to -2 from end REITIVHDADLQIGKLMWGDSGLYYCIITTPDD of IgV) LEGKNEDSVELLV 44 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_from_21_ 129 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE to_166 (first N- WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG term to -1 from end REITIVHDADLQIGKLMWGDSGLYYCIITTPDD of IgV) LEGKNEDSVELLVL 45 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_from_21_ 130 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE to_184 (first N- WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG term to end of REITIVHDADLQIGKLMWGDSGLYYCIITTPDD produced ECD with FA- > LEGKNEDSVELLVLGRTGLLADLLPSGGVEIM GG mutation) 46 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_from_21_ 131 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE to_168 (first N- WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG term to +1 after end REITIVHDADLQIGKLMWGDSGLYYCIITTPDD of IgV) LEGKNEDSVELLVLGR 47 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_from_21_ 132 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE to_169 (first N- WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG term to +2 after end REITIVHDADLQIGKLMWGDSGLYYCIITTPDD of IgV) LEGKNEDSVELLVLGRT 48 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_from_21_ 133 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE to_170 (first N- WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG term to +3 after end REITIVHDADLQIGKLMWGDSGLYYCIITTPDD of IgV -3 before #1 LEGKNEDSVELLVLGRTG option cut point) 49 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_from_21_ 134 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE to_171 (first N- WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG term to -2 before #1 REITIVHDADLQIGKLMWGDSGLYYCIITTPDD option cut point) LEGKNEDSVELLVLGRTGL 50 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_from_21_ 135 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE to_172 (first N- WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG term to -1 before #1 REITIVHDADLQIGKLMWGDSGLYYCIITTPDD option cut point) LEGKNEDSVELLVLGRTGLL 51 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_from_21_ 136 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE to_173 (first N- WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG term to #1 option cut REITIVHDADLQIGKLMWGDSGLYYCIITTPDD point) LEGKNEDSVELLVLGRTGLLA 52 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_from_21_ 137 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE to_174 (first N- WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG term to +1 after #1 REITIVHDADLQIGKLMWGDSGLYYCIITTPDD option cut point) LEGKNEDSVELLVLGRTGLLAD 53 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_from_21_ 138 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE to_175 (first N- WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG term to +2 after #1 REITIVHDADLQIGKLMWGDSGLYYCIITTPDD option cut point -3 LEGKNEDSVELLVLGRTGLLADL before #2 option cut point) 54 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_from_21_ 139 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE to_176 (first N- WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG term to +3 after #1 REITIVHDADLQIGKLMWGDSGLYYCIITTPDD option cut point -2 LEGKNEDSVELLVLGRTGLLADLL before #2 option cut point) 55 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_from_21_ 140 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE to_177 (first N- WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG term to -1 before #2 REITIVHDADLQIGKLMWGDSGLYYCIITTPDD option cut point) LEGKNEDSVELLVLGRTGLLADLLP 56 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_from_21_ 141 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE to_178 (first N- WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG term to #2 option cut REITIVHDADLQIGKLMWGDSGLYYCIITTPDD point LEGKNEDSVELLVLGRTGLLADLLPS 57 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_from_21_ 142 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE to_179 (first N- WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG term to +1 after #2 REITIVHDADLQIGKLMWGDSGLYYCIITTPDD option cut point) LEGKNEDSVELLVLGRTGLLADLLPSF 58 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_from_21_ 143 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE to_180 (first N- WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG term to +2 after #2 REITIVHDADLQIGKLMWGDSGLYYCIITTPDD option cut point) LEGKNEDSVELLVLGRTGLLADLLPSFA 59 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_from_21_ 144 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE to_181 (first N- WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG term to +3 after #2 REITIVHDADLQIGKLMWGDSGLYYCIITTPDD option cut point -3 LEGKNEDSVELLVLGRTGLLADLLPSFAV from end of produced ECD) 60 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_from_21_ 145 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE to_182(first N-term WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG to -2 from end of REITIVHDADLQIGKLMWGDSGLYYCIITTPDD produced ECD) LEGKNEDSVELLVLGRTGLLADLLPSFAVE 61 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_from_21_ 146 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE to_183 (first N- WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG term to -1 from end REITIVHDADLQIGKLMWGDSGLYYCIITTPDD of produced ECD -3 LEGKNEDSVELLVLGRTGLLADLLPSFAVEI from end of predicted ECD) 62 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1 from 147 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE 21 to 186 (first N- WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG term to end of REITIVHDADLQIGKLMWGDSGLYYCIITTPDD predicted ECD) LEGKNEDSVELLVLGRTGLLADLLPSFAVEIMP E 63 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_from_21_ 148 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE to_185 (first N- WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG term to +1 after REITIVHDADLQIGKLMWGDSGLYYCIITTPDD produced ECD -1 from LEGKNEDSVELLVLGRTGLLADLLPSFAVEIMP end of predicted ECD) 64 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_from_21_ 149 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE to_184 (first N- WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG term to end of REITIVHDADLQIGKLMWGDSGLYYCIITTPDD produced ECD with FA- > LEGKNEDSVELLVLGRTGLLADLLPSGAVEIM GA mutation) 65 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_from_21_ 150 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE to_187(first N-term WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG to +3 after produced REITIVHDADLQIGKLMWGDSGLYYCIITTPDD ECD +1 in predicted LEGKNEDSVELLVLGRTGLLADLLPSFAVEIMP TM) EW 66 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_from_21_ 151 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE to_188 (first N- WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG term to +2 in REITIVHDADLQIGKLMWGDSGLYYCIITTPDD predicted TM) LEGKNEDSVELLVLGRTGLLADLLPSFAVEIMP EWV 67 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_from_21_ 152 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE to_189 (first N- WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG term to +3 in REITIVHDADLQIGKLMWGDSGLYYCIITTPDD predicted TM) LEGKNEDSVELLVLGRTGLLADLLPSFAVEIMP EWVF 68 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_from_27_ 153 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD to_164(second N- CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV term to -3 from end HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE of IgV) DSVELL 69 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_from_27_ 154 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD to_165(second N-
CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV term to -2 from end HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE of IgV) DSVELLV 70 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_from_27_ 155 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD to_166 (second N- CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV term to -1 from end HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE of IgV) DSVELLVL 71 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_from_27_ 156 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD to_167 (second N- CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV term to end of IgV) HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE DSVELLVLG 72 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_from_27_ 157 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD to_168 (second N- CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV term to +1 after end HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE of IgV) DSVELLVLGR 73 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_from_27_ 158 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD to_169 (second N- CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV term to +2 after end HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE of IgV) DSVELLVLGRT 74 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_from_27_ 159 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD to_170 (second N- CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV term to +3 after end HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE of IgV -3 before #1 DSVELLVLGRTG option cut point) 75 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_from_27_ 160 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD to_171 (second N- CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV term to -2 before #1 HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE option cut point) DSVELLVLGRTGL 76 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_from_27_ 161 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD to_172 (second N- CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV term to -1 before #1 HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE option cut point) DSVELLVLGRTGLL 77 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_from_27_ 162 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD to_173 (second N- CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV term to #1 option cut HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE point) DSVELLVLGRTGLLA 78 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_from_27_ 163 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD to_174 (second N- CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV term to +1 after #1 HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE option cut point) DSVELLVLGRTGLLAD 79 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_from_27_ 164 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD to_175 (second N- CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV term to +2 after #1 HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE option cut point -3 DSVELLVLGRTGLLADL before #2 option cut point) 80 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_from_27_ 165 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD to_176 (second N- CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV term to +3 after #1 HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE option cut point -2 DSVELLVLGRTGLLADLL before #2 option cut point) 81 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_from_27_ 166 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD to_177 (second N- CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV term to -1 before #2 HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE option cut point) DSVELLVLGRTGLLADLLP 82 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_from_27_ 167 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD to_178 (second N- CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV term to #2 option cut HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE point) DSVELLVLGRTGLLADLLPS 83 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_from_27_ 168 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD to_179 (second N- CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV term to +1 after #2 HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE option cut point) DSVELLVLGRTGLLADLLPSF 84 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_from_27_ 169 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD to_180 (second N- CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV term to +2 after #2 HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE option cut point) DSVELLVLGRTGLLADLLPSFA 85 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_from_27_ 170 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD to_181 (second N- CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV term to +3 after #2 HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE option cut point -3 DSVELLVLGRTGLLADLLPSFAV from end of produced ECD) 86 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_from_27_ 171 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD to_182 (second N- CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV term to -2 from end HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE of produced ECD) DSVELLVLGRTGLLADLLPSFAVE 87 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_from_27_ 172 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD to_183 (second N- CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV term to -1 from end HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE of produced ECD -3 DSVELLVLGRTGLLADLLPSFAVEI from end of predicted ECD) 88 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_from_27_ 173 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD to_184 (second N- CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV term to end of HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE produced ECD -2 from DSVELLVLGRTGLLADLLPSFAVEIM end of predicted ECD) 89 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_from_27_ 174 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD to_185 (second N- CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV term to +1 after end HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE of produced ECD -1 DSVELLVLGRTGLLADLLPSFAVEIMP from end of predicted ECD) 90 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_from_27_ 175 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD to_186 (second N- CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV term to +2 after end HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE of produced ECD end DSVELLVLGRTGLLADLLPSFAVEIMPE of predicted ECD) 91 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_from_27_ 176 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD to_187 (second N- CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV term to +2 after end HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE of produced ECD +1 in DSVELLVLGRTGLLADLLPSFAVEIMPEW predicted TM) 92 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_from_27_ 177 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD to_188 (second N- CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV term to +2 in HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE predicted TM) DSVELLVLGRTGLLADLLPSFAVEIMPEWV 93 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_from_27_ 178 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD to_189 (second N- CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV term to +3 in HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE predicted TM) DSVELLVLGRTGLLADLLPSFAVEIMPEWVF 94 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P9_V1_from_21_ 179 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE to_167 (first N- WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG term to -2 from end REITIVHDADLQIGKLMWGDSGLYYCIITTPDD of predicted ECD) LEGKNEDSVELLVLE 95 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P9_V1_from_21_ 180 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE to_168 (first N- WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG term to -1 from end REITIVHDADLQIGKLMWGDSGLYYCIITTPDD of predicted ECD) LEGKNEDSVELLVLEW 96 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_from_21_ 181 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE to_184 (first N- WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG term to end of REITIVHDADLQIGKLMWGDSGLYYCIITTPDD produced ECD with FA- > LEGKNEDSVELLVLGRTGLLADLLPSAAVEIM AA mutation) 97 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P9_V1_from_21_ 182 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE to_170 (first N- WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG term to +1 predicted REITIVHDADLQIGKLMWGDSGLYYCIITTPDD TM) LEGKNEDSVELLVLEWVF 98 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P9_V1_from_21_ 183 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE to_171 (first N- WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG term to +2 predicted REITIVHDADLQIGKLMWGDSGLYYCIITTPDD TM) LEGKNEDSVELLVLEWVFV 99 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P9_V1_from_21_ 184 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE to_172 (first N- WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG term to +3 predicted REITIVHDADLQIGKLMWGDSGLYYCIITTPDD TM) LEGKNEDSVELLVLEWVFVG 100 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P9_V1_from_27_ 185 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD to_167 (second N- CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV term to -2 from end HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE of predicted ECD) DSVELLVLE 101 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P9_V1_from_27_ 186 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD to_168 (second N- CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV term to -1 from end HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE of predicted ECD) DSVELLVLEW 102 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P9_V1_from_27_ 187 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD to_169 (second N- CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV term to end of HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE predicted ECD) DSVELLVLEWV 103 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P9_V1_from_27_ 188 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD to_170 (second N- CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV term to +1 predicted HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE TM) DSVELLVLEWVF 104 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P9_V1_from_27_ 189 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD to_171 (second N- CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV term to +2 predicted HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE TM) DSVELLVLEWVFV 105 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P9_V1_from_27_ 190 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD to_172 (second N- CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV term to +3 predicted HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE TM) DSVELLVLEWVFVG
[0094] In particular, the fragments of the extracellular domain of C1ORF32 can include any sequence corresponding to any portion of or comprising the IgV domain of the extracellular domain of C1ORF32, having any sequence corresponding to residues of H19011_1_P8 (SEQ ID NO:4) starting from any position between 18 and 31 and ending at any position between 157 and 175 or corresponding to residues of H19011_1_P8_V1 (SEQ ID NO:5) starting from any position between 18 and 31 and ending at any position between 157 and 175, or corresponding to residues of H19011_1_P9 (SEQ ID NO:6) starting from any position between 18 and 31 and ending at any position between 159 and 172, or corresponding to residues of H19011_1_P9_V1 (SEQ ID NO:34) starting from any position between 18 and 31 and ending at any position between 159 and 172. The base sequences as given above are without a signal peptide.
[0095] The C1ORF32 proteins contain an immunoglobulin domain within the extracellular domain, the IgV domain (or V domain), which is related to the variable domain of antibodies. The IgV domain may be responsible for receptor binding, by analogy to the other B7 family members. The Ig domain of the extracellular domain includes one disulfide bond formed between intradomain cystein residues, as is typical for this fold and may be important for structure-function. In SEQ ID NO: 4 these cysteines are located at residues 42 and 145.
[0096] In one embodiment, the first fusion partner is a soluble fragment of C1ORF32. Without wishing to be limited by a single hypothesis, it is believed that useful fragments are those that retain the ability to bind to their natural receptor or receptors and/or retain the ability to inhibit T cell activation. A C1ORF32 polypeptide that is a fragment of full-length C1ORF32 typically has at least 20 percent, 30 percent, 40 percent, 50 percent, 60 percent, 70 percent, 80 percent, 90 percent, 95 percent, 98 percent, 99 percent, 100 percent, or even more than 100 percent of the ability to bind its natural receptor(s) and/or of the ability to inhibit T cell activation as compared to full-length C1ORF32. Soluble C1ORF32 polypeptide fragments are fragments of C1ORF32 polypeptides that may be shed, secreted or otherwise extracted from the producing cells. In other embodiments, the soluble fragments of C1ORF32 polypeptides include fragments of the C1ORF32 extracellular domain that retain C1ORF32 biological activity, such as fragments that retain the ability to bind to their natural receptor or receptors and/or retain the ability to inhibit T cell activation. The extracellular domain can include 1, 2, 3, 4, or 5 contiguous amino acids from the transmembrane domain, and/or 1, 2, 3, 4, or 5 contiguous amino acids from the signal sequence. Alternatively, the extracellular domain can have 1, 2, 3, 4, 5 or more amino acids removed from the C-terminus, N-terminus, or both.
[0097] In some embodiments the extracellular domain is only the IgV domain as set forth in SEQ ID NO: 29, or fragments or variants thereof, or the region between the conserved cysteines of the IgV domain which are located at residues 42 and 145 of the full-length protein SEQ ID NO:4, corresponding to the sequence set forth in SEQ ID NO: 30: CHFSTSSHQPAVVQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLDCLDSRR TVRVVASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDSGLYYC. In particular, the fragments of the IgV domain can include any sequence corresponding to residues of H19011_1_P8 (SEQ ID NO:4) starting from any position between 18 and 31 and ending at any position between 157 and 175 or corresponding to residues of H19011_1_P8_V1 (SEQ ID NO:5) starting from any position between 18 and 31 and ending at any position between 157 and 175, or corresponding to residues of H19011_1_P9 (SEQ ID NO:6) starting from any position between 18 and 31 and ending at any position between 159 and 172, or corresponding to residues of H19011_1_P9_V1 (SEQ ID NO:34) starting from any position between 18 and 31 and ending at any position between 159 and 172.
[0098] Generally, the C1ORF32 polypeptide fragments are expressed from nucleic acids that include sequences that encode a signal sequence. The signal sequence is generally cleaved from the immature polypeptide to produce the mature polypeptide lacking the signal sequence. The signal sequence of C1ORF32 can be replaced by the signal sequence of another polypeptide using standard molecule biology techniques to affect the expression levels, secretion, solubility, or other property of the polypeptide. The signal sequence that is used to replace the C1ORF32 signal sequence can be any known in the art.
[0099] In a further embodiment, the fusion protein includes the extracellular domain of C1ORF32, or a fragment thereof fused to an Ig Fc region. Recombinant IgC1ORF32 polypeptides, fragments or fusion proteins thereof fusion proteins can be prepared by fusing the coding region of the extracellular domain of C1ORF32 or a fragment thereof to the Fc region of human IgG1 or mouse IgG2a, as described previously (Chapoval, et al., Methods MoI. Med, 45:247-255 (2000)).
Variants of C1ORF32 Polypeptides
[0100] Useful variants of such C1ORF32 polypeptides include those that increase biological activity, as indicated by any of the assays described herein, or that increase half life or stability of the protein. Soluble C1ORF32 polypeptides and C1ORF32 fragments, or fusions thereof having C1ORF32 activity, can be engineered to increase biological activity. In a further embodiment, the C1ORF32 polypeptide or fusion protein has been modified with at least one amino acid substitution, deletion, or insertion that increases the binding of the molecule to an immune cell, for example a T cell, and transmits an inhibitory signal into the T cell. Other optional variants are those C1ORF32 polypeptides that are engineered to selectively bind to one type of T cell versus other immune cells. For example, the C1ORF32 polypeptide can be engineered to bind optionally to Tregs, Th0, Th1, Th17, Th2 or Th22 cells. Preferential binding refers to binding that is at least 10%, 20%, 30%, 40%, 50%, 60% f 70%, 80%, 90%, 95%, or greater for one type of cell over another type of cell. Still other variants of C1ORF32 can be engineered to have reduced binding to immune cells relative to wildtype C1ORF32. These variants can be used in combination with variants having stronger binding properties to modulate the immune response with a moderate impact. Also optionally, soluble C1ORF32 polypeptides and C1ORF32 fragments, or fusions thereof having C1ORF32 activity, can be engineered to have an increased half-life relative to wildtype. These variants typically are modified to resist enzymatic degradation. Exemplary modifications include modified amino acid residues and modified peptide bonds that resist enzymatic degradation. Various modifications to achieve this are known in the art.
[0101] Also optionally, variant C1ORF32 polypeptides can be engineered to prevent a cleavage of the full C1ORF32 ECD (SEQ ID NO:14) between amino acids F and A at positions 179 and 180 of H19011_1_P8_V1 or H19011_1_P8 (Seq ID NOs: 4 or 5). According to at least some embodiments of the present invention there is provided one or more amino acid insertions, deletions or substitutions that prevent the cleavage of the C1ORF32 polypeptides, fusion proteins, or fragments thereof. Suitable amino acid substitutions include conservative and non-conservative substitutions, as described above. According to at least some embodiments of the present invention the amino acid substitution in the cleavage site of C1ORF32 ECD at positions 179 and 180 of H19011_1_P8_V1 or H19011_1_P8 (Seq ID NOs: 4 or 5) is selected from but not limited to: FA->GA (as for example disclosed in SEQ ID NO:64); FA->AA (as for example disclosed in SEQ ID NO:96); and FA->GG (as for example disclosed in SEQ ID NO:45).
[0102] The terms "individual", "host", "subject", and "patient" are used interchangeably herein, and refer any human or nonhuman animal. The term "nonhuman animal" includes all vertebrates, e.g., mammals and non-mammals, such as nonhuman primates, sheep, dogs, cats, horses, cows chickens, amphibians, reptiles, etc.
[0103] Various aspects of the invention are described in further detail in the following subsections.
[0104] Nucleic Acids
[0105] A "nucleic acid fragment" or an "oligonucleotide" or a "polynucleotide" are used herein interchangeably to refer to a polymer of nucleic acid residues. A polynucleotide sequence of the present invention refers to a single or double stranded nucleic acid sequences which is isolated and provided in the form of an RNA sequence, a complementary polynucleotide sequence (cDNA), a genomic polynucleotide sequence and/or a composite polynucleotide sequences (e.g., a combination of the above).
[0106] Thus, the present invention encompasses nucleic acid sequences described hereinabove; fragments thereof, sequences hybridizable therewith, sequences homologous thereto [e.g., at least 90%, at least 95, 96, 97, 98 or 99% or more identical to the nucleic acid sequences set forth herein, sequences encoding similar polypeptides with different codon usage, altered sequences characterized by mutations, such as deletion, insertion or substitution of one or more nucleotides, either naturally occurring or man induced, either randomly or in a targeted fashion. The present invention also encompasses homologous nucleic acid sequences (i.e., which form a part of a polynucleotide sequence of the present invention), which include sequence regions unique to the polynucleotides of the present invention.
[0107] In cases where the polynucleotide sequences of the present invention encode previously unidentified polypeptides, the present invention also encompasses novel polypeptides or portions thereof, which are encoded by the isolated polynucleotide and respective nucleic acid fragments thereof described hereinabove and/or degenerative variants thereof.
[0108] Thus, the present invention also encompasses polypeptides encoded by the polynucleotide sequences of the present invention. The present invention also encompasses homologues of these polypeptides, such homologues can be at least 90%, at least 95, 96, 97, 98 or 99% or more homologous to the amino acid sequences set forth below, as can be determined using BlastP software of the National Center of Biotechnology Information (NCBI) using default parameters.
[0109] Finally, the present invention also encompasses fragments of the above described polypeptides and polypeptides having mutations, such as deletions, insertions or substitutions of one or more amino acids, either naturally occurring or man induced, either randomly or in a targeted fashion.
[0110] As mentioned hereinabove, biomolecular sequences of the present invention can be efficiently utilized as tissue or pathological markers and as putative drugs or drug targets for treating or preventing a disease.
[0111] Oligonucleotides designed for carrying out the methods of the present invention for any of the sequences provided herein (designed as described above) can be generated according to any oligonucleotide synthesis method known in the art such as enzymatic synthesis or solid phase synthesis. Equipment and reagents for executing solid-phase synthesis are commercially available from, for example, Applied Biosystems. Any other means for such synthesis may also be employed; the actual synthesis of the oligonucleotides is well within the capabilities of one skilled in the art.
[0112] Oligonucleotides used according to this aspect of the present invention are those having a length selected from a range of about 10 to about 200 bases preferably about 15 to about 150 bases, more preferably about 20 to about 100 bases, most preferably about 20 to about 50 bases.
[0113] The oligonucleotides of the present invention may comprise heterocyclic nucleosides consisting of purines and the pyrimidines bases, bonded in a 3' to 5' phosphodiester linkage.
[0114] Preferable oligonucleotides are those modified in either backbone, internucleoside linkages or bases, as is broadly described hereinunder. Such modifications can oftentimes facilitate oligonucleotide uptake and resistivity to intracellular conditions.
[0115] Specific examples of preferred oligonucleotides useful according to this aspect of the present invention include oligonucleotides containing modified backbones or non-natural internucleoside linkages. Oligonucleotides having modified backbones include those that retain a phosphorus atom in the backbone, as disclosed in U.S. Pat. Nos. 4,469,863; 4,476,301; 5,023,243; 5,177,196; 5,188,897; 5,264,423; 5,276,019; 5,278,302; 5,286,717; 5,321,131; 5,399,676; 5,405,939; 5,453,496; 5,455,233; 5,466, 677; 5,476,925; 5,519,126; 5,536,821; 5,541,306; 5,550,111; 5,563,253; 5,571,799; 5,587,361; and 5,625,050.
[0116] Preferred modified oligonucleotide backbones include, for example, phosphorothioates, chiral phosphorothioates, phosphorodithioates, phosphotriesters, aminoalkyl phosphotriesters, methyl and other alkyl phosphonates including 3'-alkylene phosphonates and chiral phosphonates, phosphinates, phosphoramidates including 3'-amino phosphoramidate and aminoalkylphosphoramidates, thionophosphoramidates, thionoalkylphosphonates, thionoalkylphosphotriesters, and boranophosphates having normal 3'-5' linkages, 2'-5' linked analogs of these, and those having inverted polarity wherein the adjacent pairs of nucleoside units are linked 3'-5' to 5'-3' or 2'-5' to 5'-2'. Various salts, mixed salts and free acid forms can also be used.
[0117] Alternatively, modified oligonucleotide backbones that do not include a phosphorus atom therein have backbones that are formed by short chain alkyl or cycloalkyl internucleoside linkages, mixed heteroatom and alkyl or cycloalkyl internucleoside linkages, or one or more short chain heteroatomic or heterocyclic internucleoside linkages. These include those having morpholino linkages (formed in part from the sugar portion of a nucleoside); siloxane backbones; sulfide, sulfoxide and sulfone backbones; formacetyl and thioformacetyl backbones; methylene formacetyl and thioformacetyl backbones; alkene containing backbones; sulfamate backbones; methyleneimino and methylenehydrazino backbones; sulfonate and sulfonamide backbones; amide backbones; and others having mixed N, O, S and CH2 component parts, as disclosed in U.S. Pat. Nos. 5,034,506; 5,166,315; 5,185,444; 5,214,134; 5,216,141; 5,235,033; 5,264,562; 5,264,564; 5,405,938; 5,434,257; 5,466,677; 5,470,967; 5,489,677; 5,541,307; 5,561,225; 5,596,086; 5,602,240; 5,610,289; 5,602,240; 5,608,046; 5,610,289; 5,618,704; 5,623, 070; 5,663,312; 5,633,360; 5,677,437; and 5,677,439.
[0118] Other oligonucleotides which can be used according to the present invention, are those modified in both sugar and the internucleoside linkage, i.e., the backbone, of the nucleotide units are replaced with novel groups. The base units are maintained for complementation with the appropriate polynucleotide target. An example for such an oligonucleotide mimetic, includes peptide nucleic acid (PNA). A PNA oligonucleotide refers to an oligonucleotide where the sugar-backbone is replaced with an amide containing backbone, in particular an aminoethylglycine backbone. The bases are retained and are bound directly or indirectly to aza nitrogen atoms of the amide portion of the backbone. United States patents that teach the preparation of PNA compounds include, but are not limited to, U.S. Pat. Nos. 5,539,082; 5,714,331; and 5,719,262, each of which is herein incorporated by reference. Other backbone modifications, which can be used in the present invention are disclosed in U.S. Pat. No. 6,303,374.
[0119] Oligonucleotides of the present invention may also include base modifications or substitutions. As used herein, "unmodified" or "natural" bases include the purine bases adenine (A) and guanine (G), and the pyrimidine bases thymine (T), cytosine (C) and uracil (U). Modified bases include but are not limited to other synthetic and natural bases such as 5-methylcytosine (5-me-C), 5-hydroxymethyl cytosine, xanthine, hypoxanthine, 2-aminoadenine, 6-methyl and other alkyl derivatives of adenine and guanine, 2-propyl and other alkyl derivatives of adenine and guanine, 2-thiouracil, 2-thiothymine and 2-thiocytosine, 5-halouracil and cytosine, 5-propynyl uracil and cytosine, 6-azo uracil, cytosine and thymine, 5-uracil (pseudouracil), 4-thiouracil, 8-halo, 8-amino, 8-thiol, 8-thioalkyl, 8-hydroxyl and other 8-substituted adenines and guanines, 5-halo particularly 5-bromo, 5-trifluoromethyl and other 5-substituted uracils and cytosines, 7-methylguanine and 7-methyladenine, 8-azaguanine and 8-azaadenine, 7-deazaguanine and 7-deazaadenine and 3-deazaguanine and 3-deazaadenine. Further bases include those disclosed in U.S. Pat. No. 3,687,808, those disclosed in The Concise Encyclopedia Of Polymer Science and Engineering, pages 858-859, Kroschwitz, J. I., ed. John Wiley & Sons, 1990, those disclosed by Englisch et al., Angewandte Chemie, International Edition, 1991, 30, 613, and those disclosed by Sanghvi, Y. S., Chapter 15, Antisense Research and Applications, pages 289-302, Crooke, S. T. and Lebleu, B., ed., CRC Press, 1993. Such bases are particularly useful for increasing the binding affinity of the oligomeric compounds of the invention. These include 5-substituted pyrimidines, 6-azapyrimidines and N-2, N-6 and 0-6 substituted purines, including 2-aminopropyladenine, 5-propynyluracil and 5-propynylcytosine. 5-methylcytosine substitutions have been shown to increase nucleic acid duplex stability by 0.6-1.2.degree. C. [Sanghvi Y S et al. (1993) Antisense Research and Applications, CRC Press, Boca Raton 276-278] and are presently preferred base substitutions, even more particularly when combined with 2'-O-methoxyethyl sugar modifications.
[0120] Another modification of the oligonucleotides of the invention involves chemically linking to the oligonucleotide one or more moieties or conjugates, which enhance the activity, cellular distribution or cellular uptake of the oligonucleotide. Such moieties include but are not limited to lipid moieties such as a cholesterol moiety, cholic acid, a thioether, e.g., hexyl-S-tritylthiol, a thiocholesterol, an aliphatic chain, e.g., dodecandiol or undecyl residues, a phospholipid, e.g., di-hexadecyl-rac-glycerol or triethylammonium 1,2-di-O-hexadecyl-rac-glycero-3-H-phosphonate, a polyamine or a polyethylene glycol chain, or adamantane acetic acid, a palmityl moiety, or an octadecylamine or hexylamino-carbonyl-oxycholesterol moiety, as disclosed in U.S. Pat. No. 6,303,374.
[0121] It is not necessary for all positions in a given oligonucleotide molecule to be uniformly modified, and in fact more than one of the aforementioned modifications may be incorporated in a single compound or even at a single nucleoside within an oligonucleotide.
[0122] Peptides
[0123] The terms "polypeptide," "peptide" and "protein" are used interchangeably herein to refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residue is an analog or mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers. Polypeptides can be modified, e.g., by the addition of carbohydrate residues to form glycoproteins. The terms "polypeptide," "peptide" and "protein" include glycoproteins, as well as non-glycoproteins.
[0124] Polypeptide products can be biochemically synthesized such as by employing standard solid phase techniques. Such methods include exclusive solid phase synthesis, partial solid phase synthesis methods, fragment condensation, classical solution synthesis. These methods are preferably used when the peptide is relatively short (i.e., 10 kDa) and/or when it cannot be produced by recombinant techniques (i.e., not encoded by a nucleic acid sequence) and therefore involves different chemistry.
[0125] Solid phase polypeptide synthesis procedures are well known in the art and further described by John Morrow Stewart and Janis Dillaha Young, Solid Phase Peptide Syntheses (2nd Ed., Pierce Chemical Company, 1984).
[0126] Synthetic polypeptides can be purified by preparative high performance liquid chromatography [Creighton T. (1983) Proteins, structures and molecular principles. WH Freeman and Co. N.Y.] and the composition of which can be confirmed via amino acid sequencing.
[0127] In cases where large amounts of a polypeptide are desired, it can be generated using recombinant techniques such as described by Bitter et al., (1987) Methods in Enzymol. 153:516-544, Studier et al. (1990) Methods in Enzymol. 185:60-89, Brisson et al. (1984) Nature 310:511-514, Takamatsu et al. (1987) EMBO J. 6:307-311, Coruzzi et al. (1984) EMBO J. 3:1671-1680 and Brogli et al., (1984) Science 224:838-843, Gurley et al. (1986) Mol. Cell. Biol. 6:559-565 and Weissbach & Weissbach, 1988, Methods for Plant Molecular Biology, Academic Press, NY, Section VIII, pp 421-463.
[0128] It will be appreciated that peptides identified according to the teachings of the present invention may be degradation products, synthetic peptides or recombinant peptides as well as peptidomimetics, typically, synthetic peptides and peptoids and semipeptoids which are peptide analogs, which may have, for example, modifications rendering the peptides more stable while in a body or more capable of penetrating into cells. Such modifications include, but are not limited to N terminus modification, C terminus modification, peptide bond modification, including, but not limited to, CH2-NH, CH2-S, CH2-S.dbd.O, O.dbd.C--NH, CH2-O, CH2-CH2, S.dbd.C--NH, CH.dbd.CH or CF.dbd.CH, backbone modifications, and residue modification. Methods for preparing peptidomimetic compounds are well known in the art and are specified, for example, in Quantitative Drug Design, C. A. Ramsden Gd., Chapter 17.2, F. Choplin Pergamon Press (1992), which is incorporated by reference as if fully set forth herein. Further details in this respect are provided hereinunder.
[0129] Peptide bonds (--CO--NH--) within the peptide may be substituted, for example, by N-methylated bonds (--N(CH3)-CO--), ester bonds (--C(R)H--C--O--O--C(R)--N--), ketomethylen bonds (--CO--CH2-), .alpha.-aza bonds (--NH--N(R)--CO--), wherein R is any alkyl, e.g., methyl, carba bonds (--CH2-NH--), hydroxyethylene bonds (--CH(OH)--CH2-), thioamide bonds (--CS--NH--), olefinic double bonds (--CH.dbd.CH--), retro amide bonds (--NH--CO--), peptide derivatives (--N(R)--CH2-CO--), wherein R is the "normal" side chain, naturally presented on the carbon atom.
[0130] These modifications can occur at any of the bonds along the peptide chain and even at several (2-3) at the same time.
[0131] Natural aromatic amino acids, Trp, Tyr and Phe, may be substituted by synthetic non-natural acid such as Phenylglycine, TIC, naphthylelanine (Nol), ring-methylated derivatives of Phe, halogenated derivatives of Phe or o-methyl-Tyr.
[0132] In addition to the above, the peptides of the present invention may also include one or more modified amino acids or one or more non-amino acid monomers (e.g. fatty acids, complex carbohydrates etc).
[0133] As used herein in the specification and in the claims section below the term "amino acid" or "amino acids" is understood to include the 20 naturally occurring amino acids; those amino acids often modified post-translationally in vivo, including, for example, hydroxyproline, phosphoserine and phosphothreonine; and other unusual amino acids including, but not limited to, 2-aminoadipic acid, hydroxylysine, isodesmosine, nor-valine, nor-leucine and ornithine. Furthermore, the term "amino acid" includes both D- and L-amino acids.
[0134] Since the peptides of the present invention are preferably utilized in therapeutics which require the peptides to be in soluble form, the peptides of the present invention preferably include one or more non-natural or natural polar amino acids, including but not limited to serine and threonine which are capable of increasing peptide solubility due to their hydroxyl-containing side chain.
[0135] In cases where large amounts of the peptides of the present invention are desired, the peptides of the present invention can be generated using recombinant techniques such as described by Bitter et al., (1987) Methods in Enzymol. 153:516-544, Studier et al. (1990) Methods in Enzymol. 185:60-89, Brisson et al. (1984) Nature 310:511-514, Takamatsu et al. (1987) EMBO J. 6:307-311, Coruzzi et al. (1984) EMBO J. 3:1671-1680 and Brogli et al., (1984) Science 224:838-843, Gurley et al. (1986) Mol. Cell. Biol. 6:559-565 and Weissbach & Weissbach, 1988, Methods for Plant Molecular Biology, Academic Press, NY, Section VIII, pp 421-463.
[0136] Expression Systems
[0137] To enable cellular expression of the polynucleotides of the present invention, a nucleic acid construct according to the present invention may be used, which includes at least a coding region of one of the above nucleic acid sequences, and further includes at least one cis acting regulatory element. As used herein, the phrase "cis acting regulatory element" refers to a polynucleotide sequence, preferably a promoter, which binds a trans acting regulator and regulates the transcription of a coding sequence located downstream thereto.
[0138] Any suitable promoter sequence can be used by the nucleic acid construct of the present invention.
[0139] Preferably, the promoter utilized by the nucleic acid construct of the present invention is active in the specific cell population transformed. Examples of cell type-specific and/or tissue-specific promoters include promoters such as albumin that is liver specific [Pinkert et al., (1987) Genes Dev. 1:268-277], lymphoid specific promoters [Calame et al., (1988) Adv. Immunol. 43:235-275]; in particular promoters of T-cell receptors [Winoto et al., (1989) EMBO J. 8:729-733] and immunoglobulins; [Banerji et al. (1983) Cell 33729-740], neuron-specific promoters such as the neurofilament promoter [Byrne et al. (1989) Proc. Natl. Acad. Sci. USA 86:5473-5477], pancreas-specific promoters [Edlunch et al. (1985) Science 230:912-916] or mammary gland-specific promoters such as the milk whey promoter (U.S. Pat. No. 4,873,316 and European Application Publication No. 264,166). The nucleic acid construct of the present invention can further include an enhancer, which can be adjacent or distant to the promoter sequence and can function in up regulating the transcription therefrom.
[0140] The nucleic acid construct of the present invention preferably further includes an appropriate selectable marker and/or an origin of replication. Preferably, the nucleic acid construct utilized is a shuttle vector, which can propagate both in E. coli (wherein the construct comprises an appropriate selectable marker and origin of replication) and be compatible for propagation in cells, or integration in a gene and a tissue of choice. The construct according to the present invention can be, for example, a plasmid, a bacmid, a phagemid, a cosmid, a phage, a virus or an artificial chromosome.
[0141] Examples of suitable constructs include, but are not limited to, pcDNA3, pcDNA3.1 (+/-), pGL3, PzeoSV2 (+/-), pDisplay, pEF/myc/cyto, pCMV/myc/cyto each of which is commercially available from Invitrogen Co. (www.invitrogen.com). Examples of retroviral vector and packaging systems are those sold by Clontech, San Diego, Calif., including Retro-X vectors pLNCX and pLXSN, which permit cloning into multiple cloning sites and the transgene is transcribed from CMV promoter. Vectors derived from Mo-MuLV are also included such as pBabe, where the transgene will be transcribed from the 5'LTR promoter.
[0142] Currently preferred in vivo nucleic acid transfer techniques include transfection with viral or non-viral constructs, such as adenovirus, lentivirus, Herpes simplex I virus, or adeno-associated virus (AAV) and lipid-based systems. Useful lipids for lipid-mediated transfer of the gene are, for example, DOTMA, DOPE, and DC-Chol [Tonkinson et al., Cancer Investigation, 14(1): 54-65 (1996)]. The most preferred constructs for use in gene therapy are viruses, most preferably adenoviruses, AAV, lentiviruses, or retroviruses. A viral construct such as a retroviral construct includes at least one transcriptional promoter/enhancer or locus-defining elements, or other elements that control gene expression by other means such as alternate splicing, nuclear RNA export, or post-translational modification of messenger. Such vector constructs also include a packaging signal, long terminal repeats (LTRs) or portions thereof, and positive and negative strand primer binding sites appropriate to the virus used, unless it is already present in the viral construct. In addition, such a construct typically includes a signal sequence for secretion of the peptide from a host cell in which it is placed. Preferably the signal sequence for this purpose is a mammalian signal sequence or the signal sequence of the polypeptides of the present invention. Optionally, the construct may also include a signal that directs polyadenylation, as well as one or more restriction sites and a translation termination sequence. By way of example, such constructs will typically include a 5' LTR, a tRNA binding site, a packaging signal, an origin of second-strand DNA synthesis, and a 3' LTR or a portion thereof. Other vectors can be used that are non-viral, such as cationic lipids, polylysine, and dendrimers.
[0143] Recombinant Expression Vectors and Host Cells
[0144] Another aspect of the invention pertains to vectors, preferably expression vectors, containing a nucleic acid encoding a protein of the invention, or derivatives, fragments, analogs or homologs thereof. As used herein, the term "vector" refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. One type of vector is a "plasmid", which refers to a circular double stranded DNA loop into which additional DNA segments can be ligated. Another type of vector is a viral vector, wherein additional DNA segments can be ligated into the viral genome. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) are integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operatively-linked. Such vectors are referred to herein as "expression vectors". In general, expression vectors of utility in recombinant DNA techniques are often in the form of plasmids. In the present specification, "plasmid" and "vector" can be used interchangeably as the plasmid is the most commonly used form of vector. However, the invention is intended to include such other forms of expression vectors, such as viral vectors (e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses), which serve equivalent functions.
[0145] The recombinant expression vectors of the invention comprise a nucleic acid of the invention in a form suitable for expression of the nucleic acid in a host cell, which means that the recombinant expression vectors include one or more regulatory sequences, selected on the basis of the host cells to be used for expression, that is operatively-linked to the nucleic acid sequence to be expressed. Within a recombinant expression vector, "operably-linked" is intended to mean that the nucleotide sequence of interest is linked to the regulatory sequences in a manner that allows for expression of the nucleotide sequence (e.g., in an in vitro transcription/translation system or in a host cell when the vector is introduced into the host cell).
[0146] The term "regulatory sequence" is intended to include promoters, enhancers and other expression control elements (e.g., polyadenylation signals). Such regulatory sequences are described, for example, in Goeddel, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif. (1990). Regulatory sequences include those that direct constitutive expression of a nucleotide sequence in many types of host cell and those that direct expression of the nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences). It will be appreciated by those skilled in the art that the design of the expression vector can depend on such factors as the choice of the host cell to be transformed, the level of expression of protein desired, etc. The expression vectors of the invention can be introduced into host cells to thereby produce proteins or peptides, including fusion proteins or peptides, encoded by nucleic acids as described herein.
[0147] The recombinant expression vectors of the invention can be designed for production of variant proteins in prokaryotic or eukaryotic cells. For example, proteins of the invention can be expressed in bacterial cells such as Escherichia coli, insect cells (using baculovirus expression vectors) yeast cells or mammalian cells. Suitable host cells are discussed further in Goeddel, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif. (1990). Alternatively, the recombinant expression vector can be transcribed and translated in vitro, for example using T7 promoter regulatory sequences and T7 polymerase.
[0148] Expression of proteins in prokaryotes is most often carried out in Escherichia coli with vectors containing constitutive or inducible promoters directing the expression of either fusion or non-fusion proteins. Fusion vectors add a number of amino acids to a protein encoded therein, to the amino or C terminus of the recombinant protein. Such fusion vectors typically serve three purposes: (i) to increase expression of recombinant protein; (ii) to increase the solubility of the recombinant protein; and (iii) to aid in the purification of the recombinant protein by acting as a ligand in affinity purification. Often, in fusion expression vectors, a proteolytic cleavage site is introduced at the junction of the fusion moiety and the recombinant protein to enable separation of the recombinant protein from the fusion moiety subsequent to purification of the fusion protein. Such enzymes, and their cognate recognition sequences, include Factor Xa, thrombin, PreScission, TEV and enterokinase. Typical fusion expression vectors include pGEX (Pharmacia Biotech Inc; Smith and Johnson, 1988. Gene 67: 31-40), pMAL (New England Biolabs, Beverly, Mass.) and pRITS (Pharmacia, Piscataway, N.J.) that fuse glutathione S-transferase (GST), maltose E binding protein, or protein A, respectively, to the target recombinant protein.
[0149] Examples of suitable inducible non-fusion E. coli expression vectors include pTrc (Amrann et al., (1988) Gene 69:301-315) and pET 11d (Studier et al., Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif. (1990) 60-89)--not accurate, pET11a-d have N terminal T7 tag.
[0150] One strategy to maximize recombinant protein expression in E. coli is to express the protein in a host bacterium with an impaired capacity to proteolytically cleave the recombinant protein. See, e.g., Gottesman, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif. (1990) 119-128. Another strategy is to alter the nucleic acid sequence of the nucleic acid to be inserted into an expression vector so that the individual codons for each amino acid are those preferentially utilized in E. coli (see, e.g., Wada, et al., 1992. Nucl. Acids Res. 20: 2111-2118). Such alteration of nucleic acid sequences of the invention can be carried out by standard DNA synthesis techniques. Another strategy to solve codon bias is by using BL21-codon plus bacterial strains (Invitrogen) or Rosetta bacterial strain (Novagen), these strains contain extra copies of rare E. coli tRNA genes.
[0151] In another embodiment, the expression vector encoding for the protein of the invention is a yeast expression vector. Examples of vectors for expression in yeast Saccharomyces cerevisiae include pYepSec1 (Baldari, et al., 1987. EMBO J. 6: 229-234), pMFa (Kurjan and Herskowitz, 1982. Cell 30: 933-943), pJRY88 (Schultz et al., 1987. Gene 54: 113-123), pYES2 (Invitrogen Corporation, San Diego, Calif.), and picZ (InVitrogen Corp, San Diego, Calif.).
[0152] Alternatively, polypeptides of the present invention can be produced in insect cells using baculovirus expression vectors. Baculovirus vectors available for expression of proteins in cultured insect cells (e.g., SF9 cells) include the pAc series (Smith, et al., 1983. Mol. Cell. Biol. 3: 2156-2165) and the pVL series (Lucklow and Summers, 1989. Virology 170: 31-39).
[0153] In yet another embodiment, a nucleic acid of the invention is expressed in mammalian cells using a mammalian expression vector. Examples of mammalian expression vectors include pCDM8 (Seed, 1987. Nature 329: 840) and pMT2PC (Kaufman, et al., 1987. EMBO J. 6: 187-195), pIRESpuro (Clontech), pUB6 (Invitrogen), pCEP4 (Invitrogen) pREP4 (Invitrogen), pcDNA3 (Invitrogen). When used in mammalian cells, the expression vector's control functions are often provided by viral regulatory elements. For example, commonly used promoters are derived from polyoma, adenovirus 2, cytomegalovirus, Rous Sarcoma Virus, and simian virus 40. For other suitable expression systems for both prokaryotic and eukaryotic cells see, e.g., Chapters 16 and 17 of Sambrook, et al., Molecular Cloning: A Laboratory Manual. 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989.
[0154] In another embodiment, the recombinant mammalian expression vector is capable of directing expression of the nucleic acid preferentially in a particular cell type (e.g., tissue-specific regulatory elements are used to express the nucleic acid). Tissue-specific regulatory elements are known in the art. Non-limiting examples of suitable tissue-specific promoters include the albumin promoter (liver-specific; Pinkert, et al., 1987. Genes Dev. 1: 268-277), lymphoid-specific promoters (Calame and Eaton, 1988. Adv. Immunol. 43: 235-275), in particular promoters of T cell receptors (Winoto and Baltimore, 1989. EMBO J. 8: 729-733) and immunoglobulins (Banerji, et al., 1983. Cell 33: 729-740; Queen and Baltimore, 1983. Cell 33: 741-748), neuron-specific promoters (e.g., the neurofilament promoter; Byrne and Ruddle, 1989. Proc. Natl. Acad. Sci. USA 86: 5473-5477), pancreas-specific promoters (Edlund, et al., 1985. Science 230: 912-916), and mammary gland-specific promoters (e.g., milk whey promoter; U.S. Pat. No. 4,873,316 and European Application Publication No. 264,166). Developmentally-regulated promoters are also encompassed, e.g., the murine hox promoters (Kessel and Gruss, 1990. Science 249: 374-379) and the alpha-fetoprotein promoter (Campes and Tilghman, 1989. Genes Dev. 3: 537-546).
[0155] The present invention in at least some embodiments further provides a recombinant expression vector comprising a DNA molecule of the invention cloned into the expression vector in an antisense orientation. That is, the DNA molecule is operatively-linked to a regulatory sequence in a manner that allows for expression (by transcription of the DNA molecule) of an RNA molecule that is antisense to mRNA encoding for protein of the invention. Regulatory sequences operatively linked to a nucleic acid cloned in the antisense orientation can be chosen that direct the continuous expression of the antisense RNA molecule in a variety of cell types, for instance viral promoters and/or enhancers, or regulatory sequences can be chosen that direct constitutive, tissue specific or cell type specific expression of antisense RNA. The antisense expression vector can be in the form of a recombinant plasmid, phagemid or attenuated virus in which antisense nucleic acids are produced under the control of a high efficiency regulatory region, the activity of which can be determined by the cell type into which the vector is introduced. For a discussion of the regulation of gene expression using antisense genes see, e.g., Weintraub, et al., "Antisense RNA as a molecular tool for genetic analysis," Reviews-Trends in Genetics, Vol. 1(1) 1986.
[0156] Another aspect of the invention pertains to host cells into which a recombinant expression vector of the invention has been introduced. The terms "host cell" and "recombinant host cell" are used interchangeably herein. It is understood that such terms refer not only to the particular subject cell but also to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term as used herein.
[0157] A host cell can be any prokaryotic or eukaryotic cell. For example, protein of the invention can be produced in bacterial cells such as E. coli, insect cells, yeast, plant or mammalian cells (such as Chinese hamster ovary cells (CHO) or COS or 293 cells). Other suitable host cells are known to those skilled in the art.
[0158] Vector DNA can be introduced into prokaryotic or eukaryotic cells via conventional transformation or transfection techniques. As used herein, the terms "transformation" and "transfection" are intended to refer to a variety of art-recognized techniques for introducing foreign nucleic acid (e.g., DNA) into a host cell, including calcium phosphate or calcium chloride co-precipitation, DEAE-dextran-mediated transfection, lipofection, or electroporation. Suitable methods for transforming or transfecting host cells can be found in Sambrook, et al. (Molecular Cloning: A Laboratory Manual. 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989), and other laboratory manuals.
[0159] For stable transfection of mammalian cells, it is known that, depending upon the expression vector and transfection technique used, only a small fraction of cells may integrate the foreign DNA into their genome. In order to identify and select these integrants, a gene that encodes a selectable marker (e.g., resistance to antibiotics) is generally introduced into the host cells along with the gene of interest. Various selectable markers include those that confer resistance to drugs, such as G418, hygromycin, puromycin, blasticidin and methotrexate. Nucleic acids encoding a selectable marker can be introduced into a host cell on the same vector as that encoding protein of the invention or can be introduced on a separate vector. Cells stably transfected with the introduced nucleic acid can be identified by drug selection (e.g., cells that have incorporated the selectable marker gene will survive, while the other cells die).
[0160] A host cell of the invention, such as a prokaryotic or eukaryotic host cell in culture, can be used to produce (i.e., express) protein of the invention. Accordingly, the present invention in at least some embodiments further provides methods for producing proteins of the invention using the host cells of the invention. In one embodiment, the method comprises culturing the host cell of the present invention (into which a recombinant expression vector encoding protein of the invention has been introduced) in a suitable medium such that the protein of the invention is produced. In another embodiment, the method further comprises isolating protein of the invention from the medium or the host cell.
[0161] For efficient production of the protein, it is preferable to place the nucleotide sequences encoding the protein of the invention under the control of expression control sequences optimized for expression in a desired host. For example, the sequences may include optimized transcriptional and/or translational regulatory sequences (such as altered Kozak sequences).
[0162] It should be noted, that according to at least some embodiments of the present invention the C1ORF32 polypeptides as described herein may optionally be isolated as naturally-occurring polypeptides, or from any source whether natural, synthetic, semi-synthetic or recombinant. Accordingly, the C1ORF32 proteins may be isolated as naturally-occurring proteins from any species, particularly mammalian, including bovine, ovine, porcine, murine, equine, and preferably human. Alternatively, the C1ORF32 proteins may be isolated as recombinant polypeptides that are expressed in prokaryote or eukaryote host cells, or isolated as a chemically synthesized polypeptide.
[0163] A skilled artisan can readily employ standard isolation methods to obtain isolated C1ORF32 proteins. The nature and degree of isolation will depend on the source and the intended use of the isolated molecules.
[0164] Fusion Proteins
[0165] According to at least some embodiments, C1ORF32 fusion polypeptides have a first fusion partner comprising all or a part of a C1ORF32 protein fused to a second polypeptide directly or via a linker peptide sequence or a chemical linker useful to connect the two proteins. The C1ORF32 polypeptide may or may not contain the native signal peptide. The C1ORF32 polypeptide may optionally be fused to a second polypeptide to form a fusion protein as described herein. The presence of the second polypeptide can alter the solubility, stability, affinity and/or valency of the C1ORF32 fusion polypeptide. As used herein, "valency" refers to the number of binding sites available per molecule. In one embodiment the second polypeptide is a polypeptide from a different source or different protein.
[0166] According to at least some embodiments, the C1ORF32 protein or fragment is selected for its activity for the treatment of immune related disorder and/or infection and/or according to one or more in vitro biological activities as described herein.
[0167] In one embodiment, the second polypeptide contains one or more domains of an immunoglobulin heavy chain constant region, preferably having an amino acid sequence corresponding to the hinge, CH2 and CH3 regions of a human immunoglobulin C.gamma.1, C.gamma.2, C.gamma.3 or C.gamma.4, chains or to the hinge, CH2 and CH3 regions of a murine immunoglobulin C.gamma.2a chain. SEQ ID NO: 20 provides exemplary sequence for the hinge, CH2 and CH3 regions of a human immunoglobulin C.gamma.1.
[0168] According to at least some embodiments, the fusion protein is a dimeric fusion protein. In an optional dimeric fusion protein, the dimer results from the covalent bonding of Cys residue in the hinge region of two of the Ig heavy chains that are the same Cys residues that are disulfide linked in dimerized normal Ig heavy chains. Such proteins are referred to as IgC1ORF32 polypeptides, fragments or fusion proteins thereof.
[0169] In one embodiment, the immunoglobulin constant domain may contain one or more amino acid insertions, deletions or substitutions that enhance binding to specific cell types, increase the bioavailablity, or increase the stability of the C1ORF32 polypeptides, fusion proteins, or fragments thereof. Suitable amino acid substitutions include conservative and non-conservative substitutions, as described above.
[0170] The fusion proteins optionally contain a domain that functions to dimerize or multimerize two or more fusion proteins. The peptide/polypeptide linker domain can either be a separate domain, or alternatively can be contained within one of the other domains (C1ORF32 polypeptide or second polypeptide) of the fusion protein. Similarly, the domain that functions to dimerize or multimerize the fusion proteins can either be a separate domain, or alternatively can be contained within one of the other domains (C1ORF32 polypeptide, second polypeptide or peptide/polypeptide linker domain) of the fusion protein. In one embodiment, the dimerization/multimerization domain and the peptide/polypeptide linker domain are the same. Further specific, illustrative and non-limiting examples of dimerization/multimerization domains and linkers are given below.
[0171] Fusion proteins disclosed herein according to at least some embodiments of the present invention are of formula I: N-R1-R2-R3-C wherein "N" represents the N-terminus of the fusion protein, "C" represents the C-terminus of the fusion protein. In the further embodiment, "R1" is a C1ORF32 polypeptide, "R2" is an optional peptide/polypeptide or chemical linker domain, and "R3" is a second polypeptide. Alternatively, R3 may be a C1ORF32 polypeptide and R1 may be a second polypeptide. Various non-limiting examples of linkers are described in greater detail below.
[0172] Optionally, the fusion protein comprises the C1ORF32 polypeptide fragments selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, fused, optionally by a linker peptide of one or more amino acids (e.g. GS) to one or more "half-life extending moieties". A "half-life extending moiety" is any moiety, for example, a polypeptide, small molecule or polymer, that, when appended to protein, extends the in vivo half-life of that protein in the body of a subject (e.g., in the plasma of the subject). For example, a half-life extending moiety is, in an embodiment of the invention, polyethylene glycol (PEG), monomethoxy PEG (mPEG) or an immunoglobulin (Ig). In an embodiment of the invention, PEG is a 5, 10, 12, 20, 30, 40 or 50 kDa moiety or larger or comprises about 12000 ethylene glycol units (PEG12000).
[0173] The fusion protein may also optionally be prepared by chemical synthetic methods and the "join" effected chemically, either during synthesis or post-synthesis. Cross-linking and other such methods may optionally be used (optionally also with the above described genetic level fusion methods), as described for example in U.S. Pat. No. 5,547,853 to Wallner et al, which is hereby incorporated by reference as if fully set forth herein as a non-limiting example only.
[0174] According to the present invention, a fusion protein may be prepared from a protein of the invention by fusion with a portion of an immunoglobulin comprising a constant region of an immunoglobulin. More preferably, the portion of the immunoglobulin comprises a heavy chain constant region which is optionally and more preferably a human heavy chain constant region. The heavy chain constant region is most preferably an IgG heavy chain constant region, and optionally and most preferably is an Fc chain, most preferably an IgG Fc fragment that comprises the hinge, CH2 and CH3 domains. The Fc chain may optionally be a known or "wild type" Fc chain, or alternatively may be mutated or truncated. The Fc portion of the fusion protein may optionally be varied by isotype or subclass, may be a chimeric or hybrid, and/or may be modified, for example to improve effector functions, control of half-life, tissue accessibility, augment biophysical characteristics such as stability, and improve efficiency of production (and less costly). Many modifications useful in construction of disclosed fusion proteins and methods for making them are known in the art, see for example Mueller, et al, MoI. Immun., 34(6):441-452 (1997), Swann, et al., Cur. Opin. Immun., 20:493-499 (2008), and Presta, Cur. Opin. Immun 20:460-470 (2008). In some embodiments the Fc region is the native IgG1, IgG2, or IgG4 Fc region. In some embodiments the Fc region is a hybrid, for example a chimeric consisting of IgG2/IgG4 Fc constant regions.
[0175] Modications to the Fc region include, but are not limited to, IgG4 modified to prevent binding to Fc gamma receptors and complement, IgG1 modified to improve binding to one or more Fc gamma receptors, IgG1 modified to minimize effector function (amino acid changes), IgG1 with altered/no glycan (typically by changing expression host or substuting the Asn at position 297), and IgG1 with altered pH-dependent binding to FcRn. The Fc region may include the entire hinge region, or less than the entire hinge region.
[0176] In another embodiment, the Fc domain may contain one or more amino acid insertions, deletions or substitutions that reduce binding to the low affinity inhibitory Fc receptor CD32B (Fc.gamma.RIIB) and retain wild-type levels of binding to or enhance binding to the low affinity activating Fc receptor CD16A (Fc.gamma.RIIIA).
[0177] Another embodiment includes IgG2-4 hybrids and IgG4 mutants that have reduced binding to FcR (Fc receptor) which increase their half life. Representative IgG2-4 hybrids and IgG4 mutants are described in Angal, S. et al., Molecular Immunology, 30(1):105-108 (1993); Mueller, J. et al., Molecular Immunology, 34(6): 441-452 (1997); and U.S. Pat. No. 6,982,323 to Wang et al. In some embodiments the IgG1 and/or IgG2 domain is deleted; for example, Angal et al. describe IgG1 and IgG2 having serine 241 replaced with a proline.
[0178] In a further embodiment, the Fc domain contains amino acid insertions, deletions or substitutions that enhance binding to CD16A. A large number of substitutions in the Fc domain of human IgG1 that increase binding to CD16A and reduce binding to CD32B are known in the art and are described in Stavenhagen, et al., Cancer Res., 57(18):8882-90 (2007). Exemplary variants of human IgG1 Fc domains with reduced binding to CD32B and/or increased binding to CD16A contain F243L, R929P, Y300L, V305I or P296L substitutions. These amino acid substitutions may be present in a human IgG1 Fc domain in any combination.
[0179] In one embodiment, the human IgG1 Fc domain variant contains a F243L, R929P and Y300L substitution. In another embodiment, the human IgG1 Fc domain variant contains a F243L, R929P, Y300L, V3O5I and P296L substitution. In another embodiment, the human IgG1 Fc domain variant contains an N297A/Q substitution, as these mutations abolishFc.gamma.R binding. Non-limiting, illustrative, exemplary types of mutations are described in US Patent Application No. 20060034852, published on Feb. 16, 2006, hereby incorporated by reference as if fully set forth herein. The term "Fc chain" also optionally comprises any type of Fc fragment.
[0180] Several of the specific amino acid residues that are important for antibody constant region-mediated activity in the IgG subclass have been identified. Inclusion, substitution or exclusion of these specific amino acids therefore allows for inclusion or exclusion of specific immunoglobulin constant region-mediated activity. Furthermore, specific changes may result in aglycosylation for example and/or other desired changes to the Fc chain. At least some changes may optionally be made to block a function of Fc which is considered to be undesirable, such as an undesirable immune system effect, as described in greater detail below.
[0181] Non-limiting, illustrative examples of mutations to Fc which may be made to modulate the activity of the fusion protein include the following changes (given with regard to the Fc sequence nomenclature as given by Kabat, from Kabat E A et al: Sequences of Proteins of Immunological Interest. US Department of Health and Human Services, NIH, 1991): 220C->S; 233-238 ELLGGP->EAEGAP; 265D->A, preferably in combination with 434N->A; 297N->A (for example to block N-glycosylation); 318-322 EYKCK->AYACA; 330-331AP->SS; or a combination thereof (see for example M. Clark, "Chemical Immunol and Antibody Engineering", pp 1-31 for a description of these mutations and their effect). The construct for the Fc chain which features the above changes optionally and preferably comprises a combination of the hinge region with the CH2 and CH3 domains.
[0182] The above mutations may optionally be implemented to enhance desired properties or alternatively to block non-desired properties. For example, aglycosylation of antibodies was shown to maintain the desired binding functionality while blocking depletion of T-cells or triggering cytokine release, which may optionally be undesired functions (see M. Clark, "Chemical Immunol and Antibody Engineering", pp 1-31). Substitution of 331proline for serine may block the ability to activate complement, which may optionally be considered an undesired function (see M. Clark, "Chemical Immunol and Antibody Engineering", pp 1-31). Changing 330 alanine to serine in combination with this change may also enhance the desired effect of blocking the ability to activate complement.
[0183] Residues 235 and 237 were shown to be involved in antibody-dependent cell-mediated cytotoxicity (ADCC), such that changing the block of residues from 233-238 as described may also block such activity if ADCC is considered to be an undesirable function.
[0184] Residue 220 is normally a cysteine for Fc from IgG1, which is the site at which the heavy chain forms a covalent linkage with the light chain. Optionally, this residue may be changed to another amino acid residue (e.g., serine), to avoid any type of covalent linkage (see M. Clark, "Chemical Immunol and Antibody Engineering", pp 1-31) or by deletion or truncation.
[0185] The above changes to residues 265 and 434 may optionally be implemented to reduce or block binding to the Fc receptor, which may optionally block undesired functionality of Fc related to its immune system functions (see "Binding site on Human IgG1 for Fc Receptors", Shields et al, Vol 276, pp 6591-6604, 2001).
[0186] The above changes are intended as illustrations only of optional changes and are not meant to be limiting in any way. Furthermore, the above explanation is provided for descriptive purposes only, without wishing to be bound by a single hypothesis.
[0187] In a further embodiment, the fusion protein includes the C1ORF32 fragment fused to an Ig Fc region. Recombinant Ig-C1ORF32 fragment polypeptides can be prepared by fusing the coding region of the C1ORF32 fragment to the Fc region of human IgG1 or mouse IgG2a, as described previously (Chapoval, et al., Methods MoI. Med, 45:247-255 (2000)). Optionally, C1ORF32 fusion protein, comprising an amino acid sequence of human C1ORF32 ECD fragment fused to murine or human immunoglobulin Fc. Optionally, said fusion protein comprises the amino acid sequence set forth in anyone of SEQ ID NOs: 29, 30, 41-105, and/or 45, 64, or 96, fused to human IgG1 Fc set forth in any one of SEQ ID NOs: 20, 21, 115. Optionally, the amino acid sequence of said fusion protein is set forth in SEQ ID NO: 39, 108-112, 116-190; optionally and preferably, the amino acid sequence is set forth in any of SEQ ID NOs:112, 120 or alternatively in any one of SEQ ID NOs:110, 136.
[0188] The aforementioned exemplary fusion proteins can incorporate any combination of the variants described herein. In another embodiment the terminal lysine of the aforementioned exemplary fusion proteins is deleted.
[0189] The disclosed fusion proteins can be isolated using standard molecular biology techniques. For example, an expression vector containing a DNA sequence encoding a C1ORF32 ECD fragments or fusion proteins thereof fusion protein is transfected into 293 cells by calcium phosphate precipitation and cultured in serum-free DMEM. The supernatant is collected at 72 h and the fusion protein is purified by Protein G, or preferably Protein A SEPHAROSE.RTM. columns (Pharmacia, Uppsala, Sweden). Optionally, a DNA sequence encoding a C1ORF32 fragments fusion protein is transfected into GPEx.RTM. retrovectors and expressed in CHO--S cells following four rounds of retrovector transduction. The protein is clarified from supernatants using protein A chromatography.
[0190] In another embodiment the second polypeptide may have a conjugation domain through which additional molecules can be bound to the C1ORF32 fragments fusion proteins. In one such embodiment, the conjugated molecule is capable of targeting the fusion protein to a particular organ or tissue; further specific, illustrative, non-limiting examples of such targeting domains and/or molecules are given below.
[0191] In another such embodiment the conjugated molecule is another immunomodulatory agent that can enhance or augment the effects of the C1ORF32 fusion protein. In another embodiment the conjugated molecule is Polyethylene Glycol (PEG).
[0192] Peptide or Polypeptide Linker Domain
[0193] The disclosed C1ORF32 fusion proteins optionally contain a peptide or polypeptide linker domain that separates the C1ORF32 polypeptide from the second polypeptide. In one embodiment, the linker domain contains the hinge region of an immunoglobulin. In a further embodiment, the hinge region is derived from a human immunoglobulin. Suitable human immunoglobulins that the hinge can be derived from include IgG, IgD and IgA. In a further embodiment, the hinge region is derived from human IgG. Amino acid sequences of immunoglobulin hinge regions and other domains are well known in the art. In one embodiment, C1ORF32 fusion polypeptides contain the hinge, CH2 and CH3 regions of a human immunoglobulin C.gamma.1 chain, optionally with the Cys at position 220 (according to full length human IgG1, position 5 in SEQ ID NO: 20) replaced with a Ser (SEQ ID NO: 115) having at least 85%, 90%, 95%, 99% or 100% sequence homology to amino acid sequence set forth in SEQ ID NO: 20:
TABLE-US-00003 EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSL TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
The hinge can be further shortened to remove amino acids 1, 2, 3, 4, 5, or combinations thereof of any one of SEQ ID NOs: 20 or 115. In one embodiment, amino acids 1-5 of any one of SEQ ID NOs: 20 or 115 are deleted.
[0194] In another embodiment, C1ORF32 fusion polypeptides contain the CH2 and CH3 regions of a human immunoglobulin C.gamma.1 chain having at least 85%, 90%, 95%, 99% or 100% sequence homology to amino acid sequence set forth in SEQ ID NO: 21:
TABLE-US-00004 APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA PIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE ALHNHYTQKSLSLSPGK
In another embodiment, the C1ORF32 fusion polypeptides contain the CH2 and CH3 regions of a murine immunoglobulin C.gamma.2a chain at least 85%, 90%, 95%, 99% or 100% sequence homology to amino acid sequence set forth in SEQ ID NO:31:
TABLE-US-00005 EPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVV DVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWM SGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVT LTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEK KNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK.
In another embodiment, the linker domain contains a hinge region of an immunoglobulin as described above, and further includes one or more additional immunoglobulin domains.
[0195] Other suitable peptide/polypeptide linker domains include naturally occurring or non-naturally occurring peptides or polypeptides. Peptide linker sequences are at least 2 amino acids in length. Optionally the peptide or polypeptide domains are flexible peptides or polypeptides. A "flexible linker" herein refers to a peptide or polypeptide containing two or more amino acid residues joined by peptide bond(s) that provides increased rotational freedom for two polypeptides linked thereby than the two linked polypeptides would have in the absence of the flexible linker. Such rotational freedom allows two or more antigen binding sites joined by the flexible linker to each access target antigen(s) more efficiently. Exemplary flexible peptides/polypeptides include, but are not limited to, the amino acid sequences Gly-Ser (SEQ ID NO: 24), Gly-Ser-Gly-Ser (SEQ ID NO: 25), Ala-Ser (SEQ ID NO:26), Gly-Gly-Gly-Ser (SEQ ID NO: 27), Gly4-Ser (SEQ ID NO: 106), (Gly4-Ser)2 (SEQ ID NO: 107), (Gly4-Ser)3 (SEQ ID NO: 32) and (Gly4-Ser)4 (SEQ ID NO: 33). Additional flexible peptide/polypeptide sequences are well known in the art. Other suitable peptide linker domains include helix forming linkers such as Ala-(Glu-Ala-Ala-Ala-Lys)n-Ala (n=1-5) (for n=1, SEQ ID NO:114 as a non-limiting example). Additional helix forming peptide/polypeptide sequences are well known in the art. Additional example of a cleavable linker is TEV-linker Gly Ser Glu Asn Leu Tyr Phe Gln Gly Ser Gly (SEQ ID NO:113). Non-limiting examples of C1ORF32 polypeptide fragments fused to Fc portion via a linker are depicted in SEQ ID NOs: 8 and 108-112.
[0196] Dimerization, Multimerization and Targeting Domains
[0197] The fusion proteins disclosed herein optionally contain a dimerization or multimerization domain that functions to dimerize or multimerize two or more fusion proteins. The domain that functions to dimerize or multimerize the fusion proteins can either be a separate domain, or alternatively can be contained within one of the other domains (C1ORF32 polypeptide, second polypeptide, or peptide/polypeptide linker domain) of the fusion protein.
[0198] Dimerization or multinierization can occur between or among two or more fusion proteins through dimerization or multimerization domains. Alternatively, dimerization or multimerization of fusion proteins can occur by chemical crosslinking. The dimers or multimers that are formed can be homodimeric/homomultimeric or heterodimeric/heteromultimeric. The second polypeptide "partner" in the C1ORF32 fusion polypeptides may be comprised of one or more other proteins, protein fragments or peptides as described herein, including but not limited to any immunoglobulin (Ig) protein or portion thereof, preferably the Fc region, or a portion of a biologically or chemically active protein such as the papillomavirus E7 gene product, melanoma-associated antigen p97), and HIV env protein (gp120). The "partner" is optionally selected to provide a soluble dimer/multimer and/or for one or more other biological activities as described herein.
[0199] A "dimerization domain" is formed by the association of at least two amino acid residues or of at least two peptides or polypeptides (which may have the same, or different, amino acid sequences). The peptides or polypeptides may interact with each other through covalent and/or non-covalent associations). Optional dimerization domains contain at least one cysteine that is capable of forming an intermolecular disulfide bond with a cysteine on the partner fusion protein. The dimerization domain can contain one or more cysteine residues such that disulfide bond(s) can form between the partner fusion proteins. In one embodiment, dimerization domains contain one, two or three to about ten cysteine residues. In a further embodiment, the dimerization domain is the hinge region of an immunoglobulin.
[0200] Additional exemplary dimerization domains can be any known in the art and include, but not limited to, coiled coils, acid patches, zinc fingers, calcium hands, a C.sub.H1-C.sub.L pair, an "interface" with an engineered "knob" and/or "protruberance" as described in U.S. Pat. No. 5,821,333, leucine zippers (e.g., from jun and/or fos) (U.S. Pat. No. 5,932,448), and/or the yeast transcriptional activator GCN4, SH2 (src homology 2), SH3 (src Homology 3) (Vidal, et al, Biochemistry, 43, 7336-44 ((2004)), phosphotyrosine binding (PTB) (Zhou, et al., Nature, 378:584-592 (1995)), WW (Sudol, Prog, Biochys. MoL Bio., 65:113-132 (1996)), PDZ (Kim, et al., Nature, 378: 85-88 (1995); Komau, et al, Science, 269.1737-1740 (1995)) 14-3-3, WD40 (Hu5 et al., J Biol Chem., 273, 33489-33494 (1998)) EH, Lim, an isoleucine zipper, a receptor dimer pair (e.g., interleukin-8 receptor (IL-8R); and integrin heterodimers such as LFA-I and GPIIIb/IIIa), or the dimerization region(s) thereof, dimeric ligand polypeptides (e.g. nerve growth factor (NGF), neurotrophin-3 (NT-3), interleukin-8 (IL-8), vascular endothelial growth factor (VEGF), VEGF-C, VEGF-D, PDGF members, and brain-derived neurotrophic factor (BDNF) (Arakawa, et al., J Biol. Chem., 269(45): 27833-27839 (1994) and Radziejewski, et al., Biochem., 32(48): 1350 (1993)) and can also be variants of these domains in which the affinity is altered. The polypeptide pairs can be identified by methods known in the art, including yeast two hybrid screens. Yeast two hybrid screens are described in U.S. Pat. Nos. 5,283,173 and 6,562,576. Affinities between a pair of interacting domains can be determined using methods known in the art, including as described in Katahira, et at, J. Biol Chem, 277, 9242-9246 (2002)). Alternatively, a library of peptide sequences can be screened for heterodimerization, for example, using the methods described in WO 01/00814. Useful methods for protein-protein interactions are also described in U.S. Pat. No. 6,790,624.
[0201] A "multimerization domain" is a domain that causes three or more peptides or polypeptides to interact with each other through covalent and/or non-covalent association(s). Suitable multimerization domains include, but are not limited to, coiled-coil domains. A coiled-coil is a peptide sequence with a contiguous pattern of mainly hydrophobic residues spaced 3 and 4 residues apart, usually in a sequence of seven amino acids (heptad repeat) or eleven amino acids (undecad repeat), which assembles (folds) to form a multimeric bundle of helices. Coiled-coils with sequences including some irregular distribution of the 3 and 4 residues spacing are also contemplated. Hydrophobic residues are in particular the hydrophobic amino acids Val, Ile, Leu, Met, Tyr, Phe and Trp. "Mainly hydrophobic" means that at least 50% of the residues must be selected from the mentioned hydrophobic amino acids.
[0202] The coiled coil domain may be derived from laminin. In the extracellular space, the heterotrimeric coiled coil protein laminin plays an important role in the formation of basement membranes. Apparently, the multifunctional oligomeric structure is required for laminin function. Coiled coil domains may also be derived from the thrombospondins in which three (TSP-I and TSP-2) or five (TSP-3, TSP-4 and TSP-5) chains are connected, or from COMP (COMPcc) (Guo, et at., EMBO J, 1998, 17: 5265-5272) which folds into a parallel five-stranded coiled coil (Malashkevich, et al., Science, 274: 761-765 (1996)). Additional non limiting examples of coiled-coil domains derived from other proteins, and other domains that mediate polypeptide multimerization are known in the art such as the vasodialator-stimulated phosphoprotein (VASP) domain, matrilin-1 (CMP), viral fusion peptides, soluble NSF (N-ethylmaleimide-sensitive factor) Attachment Protein receptor (SNARE) complexes, leucine-rich repeats, certain tRNA synthetases, are suitable for use in the disclosed fusion proteins.
[0203] In another embodiment, C1ORF32 polypeptides, fusion proteins, or fragments thereof can be induced to form multimers by binding to a second multivalent polypeptide, such as an antibody. Antibodies suitable for use to multimerize C1ORF32 polypeptides, fusion proteins, or fragments thereof include, but are not limited to, IgM antibodies and cross-linked, multivalent IgG, IgA, IgD, or IgE complexes.
[0204] Dimerization or multimerization can occur between or among two or more fusion proteins through dimerization or multimerization domains, including those described above. Alternatively, dimerization or multimerization of fusion proteins can occur by chemical crosslinking. Fusion protein dimers can be homodimers or heterodimers. Fusion protein multimers can be homomultimers or heteromultimers. Fusion protein dimers as disclosed herein are of formula N-R1-R2-R3-C N-R4-R5-R6-C or, alternatively, are of formula N-R1-R2-R3-C C-R4-R5-R6-N wherein the fusion proteins of the dimer provided by formula II are defined as being in a parallel orientation and the fusion proteins of the dimer provided by formula III are defined as being in an antiparallel orientation. Parallel and antiparallel dimers are also referred to as cis and trans dimers, respectively. "N" and "C" represent the N- and C-termini of the fusion protein, respectively. The fusion protein constituents "R1", "R2" and "R3" are as defined above with respect to formula I. With respect to both formula II and formula III, "R4" is a C1ORF32 polypeptide or a second polypeptide, "R5" is an optional peptide/polypeptide linker domain, and "R6" is a C1ORF32 polypeptide or a second polypeptide, wherein "R6" is a C1ORF32 polypeptide when "R4" is a second polypeptide, and "R6'" is a second polypeptide when "R4" is a C1ORF32 polypeptide. In one embodiment, "R1" is a C1ORF32 polypeptide, "R4" is also a C1ORF32 polypeptide, and "R3" and "R6" are both second polypeptides.
[0205] Fusion protein dimers of formula II are defined as homodimers when "R1"="R4", "R2"="R5" and "R3"="R6". Similarly, fusion protein dimers of formula III are defined as homodimers when "R1"="R6", "R2"="R5" and "R3"="R4". Fusion protein dimers are defined as heterodimers when these conditions are not met for any reason. For example, heterodimers may contain domain orientations that meet these conditions (i.e., for a dimer according to formula II, "R1" and "R4" are both C1ORF32 polypeptides, "R2" and "R5" are both peptide/polypeptide linker domains and "R3" and "R6" are both second polypeptides), however the species of one or more of these domains is not identical. For example, although "R3" and "R6" may both be C1ORF32 polypeptides, one polypeptide may contain a wild-type C1ORF32 amino acid sequence while the other polypeptide may be a variant C1ORF32 polypeptide. An exemplary variant C1ORF32 polypeptide is C1ORF32 polypeptide that has been modified to have increased or decreased binding to a target cell, increased activity on immune cells, increased or decreased half life or stability. Dimers of fusion proteins that contain either a CHI or CL region of an immunoglobulin as part of the polypeptide linker domain preferably form heterodimers wherein one fusion protein of the dimer contains a CHI region and the other fusion protein of the dimer contains a CL region.
[0206] Fusion proteins can also be used to form multimers. As with dimers, multimers may be parallel multimers, in which all fusion proteins of the multimer are aligned in the same orientation with respect to their N- and C-termini. Multimers may be antiparallel multimers, in which the fusion proteins of the multimer are alternatively aligned in opposite orientations with respect to their N- and C-termini. Multimers (parallel or antiparallel) can be either homomultimers or heteromultimers. The fusion protein is optionally produced in dimeric form; more preferably, the fusion is performed at the genetic level as described below, by joining polynucleotide sequences corresponding to the two (or more) proteins, portions of proteins and/or peptides, such that a joined or fused protein is produced by a cell according to the joined polynucleotide sequence. A description of preparation for such fusion proteins is described with regard to U.S. Pat. No. 5,851,795 to Linsley et al, which is hereby incorporated by reference as if fully set forth herein as a non-limiting example only.
[0207] Targeting Domains
[0208] The C1ORF32 polypeptides and fusion proteins can contain a targeting domain to target the molecule to specific sites in the body. Optional targeting domains target the molecule to areas of inflammation. Exemplary targeting domains are antibodies, or antigen binding fragments thereof that are specific for inflamed tissue or to a proinflammatory cytokine including but not limited to IL17, IL-4, IL-6, IL-12, IL-21, IL-22, and IL-23. In the case of neurological disorders such as Multiple Sclerosis, the targeting domain may target the molecule to the CNS or may bind to VCAM-I on the vascular epithelium. Additional targeting domains can be peptide aptamers specific for a proinflammatory molecule. In other embodiments, the C1ORF32 fusion protein can include a binding partner specific for a polypeptide displayed on the surface of an immune cell, for example a T cell. In still other embodiments, the targeting domain specifically targets activated immune cells. Optional immune cells that are targeted include Th0, Th1, Th 17, Th2 and Th22 T cells, other cells that secrete, or cause other cells to secrete inflammatory molecules including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs, and Tregs. For example, a targeting domain for Tregs may bind specifically to CD25.
[0209] The above changes are intended as illustrations only of optional changes and are not meant to be limiting in any way. Furthermore, the above explanation is provided for descriptive purposes only, without wishing to be bound by a single hypothesis.
[0210] Dimerization or multimierization can occur between or among two or more fusion proteins through dimerization or multimerization domains. Alternatively, dimerization or multimerization of fusion proteins can occur by chemical crosslinking. The dimers or multimers that are formed can be homodimeric/homomultimeric or heterodimeric/heteromultimeric. The second polypeptide "partner" in the C1ORF32 fusion polypeptides may be comprised of one or more other proteins, protein fragments or peptides as described herein, including but not limited to any immunoglobulin (Ig) protein or portion thereof, preferably the Fc region, or a portion of a biologically or chemically active protein such as the papillomavirus E7 gene product, melanoma-associated antigen p97), and HIV env protein (gp120). The "partner" is optionally selected to provide a soluble dimer/multimer and/or for one or more other biological activities as described herein.
[0211] Addition of Groups
[0212] If a protein according to the present invention is a linear molecule, it is possible to place various functional groups at various points on the linear molecule which are susceptible to or suitable for chemical modification. Functional groups can be added to the termini of linear forms of the protein according to at least some embodiments of the invention. In some embodiments, the functional groups improve the activity of the protein with regard to one or more characteristics, including but not limited to, improvement in stability, penetration (through cellular membranes and/or tissue barriers), tissue localization, efficacy, decreased clearance, decreased toxicity, improved selectivity, improved resistance to expulsion by cellular pumps, and the like. For convenience sake and without wishing to be limiting, the free N-terminus of one of the sequences contained in the compositions according to at least some embodiments of the invention will be termed as the N-terminus of the composition, and the free C-terminal of the sequence will be considered as the C-terminus of the composition. Either the C-terminus or the N-terminus of the sequences, or both, can be linked to a carboxylic acid functional groups or an amine functional group, respectively.
[0213] Non-limiting examples of suitable functional groups are described in Green and Wuts, "Protecting Groups in Organic Synthesis", John Wiley and Sons, Chapters 5 and 7, 1991, the teachings of which are incorporated herein by reference. Preferred protecting groups are those that facilitate transport of the active ingredient attached thereto into a cell, for example, by reducing the hydrophilicity and increasing the lipophilicity of the active ingredient, these being an example for "a moiety for transport across cellular membranes".
[0214] These moieties can optionally and preferably be cleaved in vivo, either by hydrolysis or enzymatically, inside the cell. (Ditter et al., J. Pharm. Sci. 57:783 (1968); Ditter et al., J. Pharm. Sci. 57:828 (1968); Ditter et al., J. Pharm. Sci. 58:557 (1969); King et al., Biochemistry 26:2294 (1987); Lindberg et al., Drug Metabolism and Disposition 17:311 (1989); and Tunek et al., Biochem. Pharm. 37:3867 (1988), Anderson et al., Arch. Biochem. Biophys. 239:538 (1985) and Singhal et al., FASEB J. 1:220 (1987)). Hydroxyl protecting groups include esters, carbonates and carbamate protecting groups Amine protecting groups include alkoxy and aryloxy carbonyl groups, as described above for N-terminal protecting groups. Carboxylic acid protecting groups include aliphatic, benzylic and aryl esters, as described above for C-terminal protecting groups. In one embodiment, the carboxylic acid group in the side chain of one or more glutamic acid or aspartic acid residue in a composition of the present invention is protected, preferably with a methyl, ethyl, benzyl or substituted benzyl ester, more preferably as a benzyl ester.
[0215] Non-limiting, illustrative examples of N-terminal protecting groups include acyl groups (--CO--R1) and alkoxy carbonyl or aryloxy carbonyl groups (--CO--O--R1), wherein R1 is an aliphatic, substituted aliphatic, benzyl, substituted benzyl, aromatic or a substituted aromatic group. Specific examples of acyl groups include but are not limited to acetyl, (ethyl)-CO--, n-propyl-CO--, iso-propyl-CO--, n-butyl-CO--, sec-butyl-CO--, t-butyl-CO--, hexyl, lauroyl, palmitoyl, myristoyl, stearyl, oleoyl phenyl-CO--, substituted phenyl-CO--, benzyl-CO-- and (substituted benzyl)-CO--. Examples of alkoxy carbonyl and aryloxy carbonyl groups include CH3-O--CO--, (ethyl)-O--CO--, n-propyl-O--CO--, iso-propyl-O--CO--, n-butyl-O--CO--, sec-butyl-O--CO--, t-butyl-O--CO--, phenyl-O-- CO--, substituted phenyl-O--CO-- and benzyl-O--CO--, (substituted benzyl)-O--CO--, Adamantan, naphtalen, myristoleyl, toluen, biphenyl, cinnamoyl, nitrobenzoy, toluoyl, furoyl, benzoyl, cyclohexane, norbornane, or Z-caproic. In order to facilitate the N-acylation, one to four glycine residues can be present in the N-terminus of the molecule.
[0216] The carboxyl group at the C-terminus of the compound can be protected, for example, by a group including but not limited to an amide (i.e., the hydroxyl group at the C-terminus is replaced with --NH.sub.2, --NHR.sub.2 and --NR.sub.2R.sub.3) or ester (i.e. the hydroxyl group at the C-terminus is replaced with --OR.sub.2). R.sub.2 and R.sub.3 are optionally independently an aliphatic, substituted aliphatic, benzyl, substituted benzyl, aryl or a substituted aryl group. In addition, taken together with the nitrogen atom, R.sub.2 and R.sub.3 can optionally form a C4 to C8 heterocyclic ring with from about 0-2 additional heteroatoms such as nitrogen, oxygen or sulfur. Non-limiting suitable examples of suitable heterocyclic rings include piperidinyl, pyrrolidinyl, morpholino, thiomorpholino or piperazinyl. Examples of C-terminal protecting groups include but are not limited to --NH.sub.2, --NHCH.sub.3, --N(CH.sub.3).sub.2, --NH(ethyl), --N(ethyl).sub.2, --N(methyl) (ethyl), --NH(benzyl), --N(C1-C4 alkyl)(benzyl), --NH(phenyl), --N(C1-C4 alkyl) (phenyl), --OCH.sub.3, --O-(ethyl), --O-(n-propyl), --O-(n-butyl), --O-(iso-propyl), --O-(sec-butyl), --O-(t-butyl), --O-benz yl and --O-phenyl.
[0217] Substitution by Peptidomimetic Moieties
[0218] A "peptidomimetic organic moiety" can optionally be substituted for amino acid residues in the composition of this invention both as conservative and as non-conservative substitutions. These moieties are also termed "non-natural amino acids" and may optionally replace amino acid residues, amino acids or act as spacer groups within the peptides in lieu of deleted amino acids. The peptidomimetic organic moieties optionally and preferably have steric, electronic or configurational properties similar to the replaced amino acid and such peptidomimetics are used to replace amino acids in the essential positions, and are considered conservative substitutions. However such similarities are not necessarily required. According to preferred embodiments of the present invention, one or more peptidomimetics are selected such that the composition at least substantially retains its physiological activity as compared to the native protein according to the present invention.
[0219] Peptidomimetics may optionally be used to inhibit degradation of the peptides by enzymatic or other degradative processes. The peptidomimetics can optionally and preferably be produced by organic synthetic techniques. Non-limiting examples of suitable peptidomimetics include D amino acids of the corresponding L amino acids, tetrazol (Zabrocki et al., J. Am. Chem. Soc. 110:5875-5880 (1988)); isosteres of amide bonds (Jones et al., Tetrahedron Lett. 29: 3853-3856 (1988)); LL-3-amino-2-propenidone-6-carboxylic acid (LL-Acp) (Kemp et al., J. Org. Chem. 50:5834-5838 (1985)). Similar analogs are shown in Kemp et al., Tetrahedron Lett. 29:5081-5082 (1988) as well as Kemp et al., Tetrahedron Lett. 29:5057-5060 (1988), Kemp et al., Tetrahedron Lett. 29:4935-4938 (1988) and Kemp et al., J. Org. Chem. 54:109-115 (1987). Other suitable but exemplary peptidomimetics are shown in Nagai and Sato, Tetrahedron Lett. 26:647-650 (1985); Di Maio et al., J. Chem. Soc. Perkin Trans., 1687 (1985); Kahn et al., Tetrahedron Lett. 30:2317 (1989); Olson et al., J. Am. Chem. Soc. 112:323-333 (1990); Garvey et al., J. Org. Chem. 56:436 (1990). Further suitable exemplary peptidomimetics include hydroxy-1,2,3,4-tetrahydroisoquinoline-3-carboxylate (Miyake et al., J. Takeda Res. Labs 43:53-76 (1989)); 1,2,3,4-tetrahydro-isoquinoline-3-carboxylate (Kazmierski et al., J. Am. Chem. Soc. 133:2275-2283 (1991)); histidine isoquinolone carboxylic acid (HIC) (Zechel et al., Int. J. Pep. Protein Res. 43 (1991)); (2S, 3S)-methyl-phenylalanine, (2S, 3R)-methyl-phenylalanine, (2R, 3S)-methyl-phenylalanine and (2R, 3R)-methyl-phenylalanine (Kazmierski and Hruby, Tetrahedron Lett. (1991)).
[0220] Exemplary, illustrative but non-limiting non-natural amino acids include beta-amino acids (beta3 and beta2), homo-amino acids, cyclic amino acids, aromatic amino acids, Pro and Pyr derivatives, 3-substituted Alanine derivatives, Glycine derivatives, ring-substituted Phe and Tyr Derivatives, linear core amino acids or diamino acids. They are available from a variety of suppliers, such as Sigma-Aldrich (USA) for example.
[0221] Protein Chemical Modifications
[0222] In the present invention any part of a protein according to at least some embodiments of the invention may optionally be chemically modified, i.e. changed by addition of functional groups. For example the side amino acid residues appearing in the native sequence may optionally be modified, although as described below alternatively other parts of the protein may optionally be modified, in addition to or in place of the side amino acid residues. The modification may optionally be performed during synthesis of the molecule if a chemical synthetic process is followed, for example by adding a chemically modified amino acid. However, chemical modification of an amino acid when it is already present in the molecule ("in situ" modification) is also possible.
[0223] The amino acid of any of the sequence regions of the molecule can optionally be modified according to any one of the following exemplary types of modification (in the peptide conceptually viewed as "chemically modified"). Non-limiting exemplary types of modification include carboxymethylation, acylation, phosphorylation, glycosylation or fatty acylation. Ether bonds can optionally be used to join the serine or threonine hydroxyl to the hydroxyl of a sugar. Amide bonds can optionally be used to join the glutamate or aspartate carboxyl groups to an amino group on a sugar (Garg and Jeanloz, Advances in Carbohydrate Chemistry and Biochemistry, Vol. 43, Academic Press (1985); Kunz, Ang. Chem. Int. Ed. English 26:294-308 (1987)). Acetal and ketal bonds can also optionally be formed between amino acids and carbohydrates. Fatty acid acyl derivatives can optionally be made, for example, by acylation of a free amino group (e.g., lysine) (Toth et al., Peptides: Chemistry, Structure and Biology, Rivier and Marshal, eds., ESCOM Publ., Leiden, 1078-1079 (1990)).
[0224] As used herein the term "chemical modification", when referring to a protein or peptide according to the present invention, refers to a protein or peptide where at least one of its amino acid residues is modified either by natural processes, such as processing or other post-translational modifications, or by chemical modification techniques which are well known in the art. Examples of the numerous known modifications typically include, but are not limited to: acetylation, acylation, amidation, ADP-ribosylation, glycosylation, GPI anchor formation, covalent attachment of a lipid or lipid derivative, methylation, myristylation, pegylation, prenylation, phosphorylation, ubiquitination, or any similar process.
[0225] Other types of modifications optionally include the addition of a cycloalkane moiety to a biological molecule, such as a protein, as described in PCT Application No. WO 2006/050262, hereby incorporated by reference as if fully set forth herein. These moieties are designed for use with biomolecules and may optionally be used to impart various properties to proteins.
[0226] Furthermore, optionally any point on a protein may be modified. For example, pegylation of a glycosylation moiety on a protein may optionally be performed, as described in PCT Application No. WO 2006/050247, hereby incorporated by reference as if fully set forth herein. One or more polyethylene glycol (PEG) groups may optionally be added to O-linked and/or N-linked glycosylation. The PEG group may optionally be branched or linear. Optionally any type of water-soluble polymer may be attached to a glycosylation site on a protein through a glycosyl linker.
[0227] Altered Glycosylation Proteins according to at least some embodiments of the invention may be modified to have an altered glycosylation pattern (i.e., altered from the original or native glycosylation pattern). As used herein, "altered" means having one or more carbohydrate moieties deleted, and/or having at least one glycosylation site added to the original protein.
[0228] Glycosylation of proteins is typically either N-linked or O-linked. N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue. The tripeptide sequences, asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain. Thus, the presence of either of these tripeptide sequences in a polypeptide creates a potential glycosylation site. O-linked glycosylation refers to the attachment of one of the sugars N-acetylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5-hydroxylysine may also be used.
[0229] Addition of glycosylation sites to proteins according to at least some embodiments of the invention is conveniently accomplished by altering the amino acid sequence of the protein such that it contains one or more of the above-described tripeptide sequences (for N-linked glycosylation sites). The alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues in the sequence of the original protein (for O-linked glycosylation sites). The protein's amino acid sequence may also be altered by introducing changes at the DNA level.
[0230] Another means of increasing the number of carbohydrate moieties on proteins is by chemical or enzymatic coupling of glycosides to the amino acid residues of the protein. Depending on the coupling mode used, the sugars may be attached to (a) arginine and histidine, (b) free carboxyl groups, (c) free sulfhydryl groups such as those of cysteine, (d) free hydroxyl groups such as those of serine, threonine, or hydroxyproline, (e) aromatic residues such as those of phenylalanine, tyrosine, or tryptophan, or (f) the amide group of glutamine. These methods are described in WO 87/05330, and in Aplin and Wriston, CRC Crit. Rev. Biochem., 22: 259-306 (1981).
[0231] Removal of any carbohydrate moieties present on proteins according to at least some embodiments of the invention may be accomplished chemically or enzymatically. Chemical deglycosylation requires exposure of the protein to trifluoromethanesulfonic acid, or an equivalent compound. This treatment results in the cleavage of most or all sugars except the linking sugar (N-acetylglucosamine or N-acetylgalactosamine), leaving the amino acid sequence intact.
[0232] Chemical deglycosylation is described by Hakimuddin et al., Arch. Biochem. Biophys., 259: 52 (1987); and Edge et al., Anal. Biochem., 118: 131 (1981). Enzymatic cleavage of carbohydrate moieties on proteins can be achieved by the use of a variety of endo- and exo-glycosidases as described by Thotakura et al., Meth. Enzymol., 138: 350 (1987).
[0233] Methods of Treatment
[0234] As used herein "therapeutic agent" is any one of the C1ORF32 proteins and polypeptides fragments according to at least some embodiments of the present invention, and/or fusion proteins and/or multimeric proteins comprising same, and/or nucleic acid sequence or fragments thereof encoding same.
[0235] As mentioned herein above, the therapeutic agents can be used to treat immune related disorders as recited herein, and/or autoimmune disorders as recited herein, and/or infectious disorders as recited herein, and/or for blocking and/or promoting immune costimulation mediated by the C1ORF32 polypeptides in a subject.
[0236] According to an additional aspect of the present invention the therapeutic agents can be used to prevent pathologic inhibition of T cell activity, such as that directed against chronic infections; and/or prevent pathologic stimulation of T cell activity, such as that directed against autoantigens in autoimmune diseases. For example, these molecules can be administered to cells in culture, in vitro or ex vivo, or to human subjects, e.g., in vivo, to treat, prevent and to diagnose a variety of disorders. Preferred subjects include human patients, having disorders mediated by cells expressing the C1ORF32 protein, and cells that possess C1ORF32 activity.
[0237] According to an additional aspect of the present invention the therapeutic agents can be used to inhibit T cell activation, as can be manifested for example by T cell proliferation and cytokine secretion.
[0238] Thus, according to an additional aspect of the present invention there is provided a method of treating immune related disorders as recited herein, and/or autoimmune disorders as recited herein, and/or infectious disorders as recited herein, and/or for blocking or promoting immune stimulation mediated by the C1ORF32 polypeptide in a subject by administering to a subject in need thereof an effective amount of any one of the therapeutic agents and/or a pharmaceutical composition comprising any of the therapeutic agents and further comprising a pharmaceutically acceptable diluent or carrier.
[0239] The subject according to the present invention is a mammal, preferably a human which is diagnosed with one of the disease, disorder or conditions described hereinabove, or alternatively is predisposed to at least one infectious disorder, and/or immune related disorder.
[0240] "Treatment" refers to both therapeutic treatment and prophylactic or preventative measures. Those in need of treatment include those already with the disorder as well as those in which the disorder is to be prevented. Hence, the mammal to be treated herein may have been diagnosed as having the disorder or may be predisposed or susceptible to the disorder. "Mammal" for purposes of treatment refers to any animal classified as a mammal, including humans, domestic and farm animals, and zoo, sports, or pet animals, such as dogs, horses, cats, cows, etc. Preferably, the mammal is human.
[0241] As used herein the term "treating" refers to preventing, delaying the onset of, curing, reversing, attenuating, alleviating, minimizing, suppressing or halting the deleterious effects of the above-described diseases, disorders or conditions. It also includes managing the disease as described above. By "manage" it is meant reducing the severity of the disease, reducing the frequency of episodes of the disease, reducing the duration of such episodes, reducing the severity of such episodes and the like.
[0242] Treating, according to the present invention, can be effected by specifically upregulating the amount and/or the expression of at least one of the polypeptides of the present invention in the subject.
[0243] Optionally, upregulation may be effected by administering to the subject at least one of the polypeptides of the present invention (e.g., recombinant or synthetic) or an active portion thereof, as described herein. However, since the bioavailability of large polypeptides may potentially be relatively small due to high degradation rate and low penetration rate, administration of polypeptides is preferably confined to small peptide fragments (e.g., about 100 amino acids). The polypeptide or peptide may optionally be administered in as part of a pharmaceutical composition, described in more detail below.
[0244] It will be appreciated that treatment of the above-described diseases according to at least some embodiments of the present invention may be combined with other treatment methods known in the art (i.e., combination therapy), as described herein.
[0245] Immune System Related Disease Treatment
[0246] The therapeutic agents and/or a pharmaceutical composition comprising same, as recited herein, according to at least some embodiments of the present invention can also be used in combination with one or more of the following agents to regulate an immune response: soluble gp39 (also known as CD40 ligand (CD40L), CD154, T-BAM, TRAP), soluble CD29, soluble CD40, soluble CD80 (e.g. ATCC 68627), soluble CD86, soluble CD28 (e.g. 68628), soluble CD56, soluble Thy-1, soluble CD3, soluble TCR, soluble VLA-4, soluble VCAM-1, soluble LECAM-1, soluble ELAM-1, soluble CD44, antibodies reactive with gp39 (e.g. ATCC HB-10916, ATCC HB-12055 and ATCC HB-12056), antibodies reactive with CD40 (e.g. ATCC HB-9110), antibodies reactive with B7 (e.g. ATCC HB-253, ATCC CRL-2223, ATCC CRL-2226, ATCC HB-301, ATCC HB-11341, etc), antibodies reactive with CD28 (e.g. ATCC HB-11944 or mAb 9.3), antibodies reactive with LFA-1 (e.g. ATCC HB-9579 and ATCC TIB-213), antibodies reactive with LFA-2, antibodies reactive with IL-2, antibodies reactive with IL-12, antibodies reactive with IFN-gamma, antibodies reactive with CD2, antibodies reactive with CD48, antibodies reactive with any ICAM (e.g., ICAM-1 (ATCC CRL-2252), ICAM-2 and ICAM-3), antibodies reactive with CTLA4 (e.g. ATCC HB-304), antibodies reactive with Thy-1, antibodies reactive with CD56, antibodies reactive with CD3, antibodies reactive with CD29, antibodies reactive with TCR, antibodies reactive with VLA-4, antibodies reactive with VCAM-1, antibodies reactive with LECAM-1, antibodies reactive with ELAM-1, antibodies reactive with CD44; L104EA29YIg, CD80 monoclonal antibodies (mAbs), CD86 mAbs, gp39 mAbs, CD40 mAbs, CD28 mAbs; anti-LFA1 mAbs, antibodies or other agents targeting mechanisms of the immune system such as CD52 (alemtuzumab), CD25 (daclizumab), VLA-4 (natalizumab), CD20 (rituximab), IL2R (daclizumab) and MS4A1 (ocrelizumab); novel oral immunomodulating agents have shown to prevent lymphocyte recirculation from lymphoid organs such as fingolimod (FTY720) or leading to lymphocyte depletion such as mylinax (oral cladribine) or teriflunomide; and agents that prevent immunoactivation such as panaclar (dimethyl fumarate BG-12) or laquinimod (ABR216062). Other combinations will be readily appreciated and understood by persons skilled in the art. In some embodiments, the therapeutic agents can be used to attenuate or reverse the activity of a pro-inflammatory drug, and/or limit the adverse effects of such drugs.
[0247] As persons skilled in the art will readily understand, the combination can include the therapeutic agents and/or a pharmaceutical composition comprising same, according to at least some embodiments of the invention and one other immunosuppressive agent; the therapeutic agents and/or a pharmaceutical composition comprising same, as recited herein, with two other immunosuppressive agents, the therapeutic agents and/or a pharmaceutical composition comprising same, as recited herein, with three other immunosuppressive agents, etc. The determination of the optimal combination and dosages can be determined and optimized using methods well known in the art.
[0248] The therapeutic agent according to the present invention and one or more other therapeutic agents can be administered in either order or simultaneously.
[0249] The invention also encompasses the use of the therapeutic agents and/or a pharmaceutical composition comprising same according to at least some embodiments of the invention in combination with other pharmaceutical agents to treat immune system diseases. For example, autoimmune disease may be treated with molecules according to at least some embodiments of the invention in conjunction with, immunosuppressants such as corticosteroids, cyclosporin, cyclophosphamide, prednisone, azathioprine, methotrexate, rapamycin, tacrolimus, biological agents such as TNF-alpha blockers or antagonists, immunosuppressive agents (e.g., antibodies against other lymphocyte surface markers (e.g., CD40, alpha-4 integrin) or against cytokines), other fusion proteins (e.g., CTLA-4-Ig (Orencia.RTM.), TNFR-Ig (Enbrel.RTM.)), TNF-alpha blockers such as Enbrel, Remicade, Cimzia and Humira, cyclophosphamide (CTX) (i.e. Endoxan.RTM., Cytoxan.RTM., Neosar.RTM., Procytox.RTM., Revimmune.TM.), methotrexate (MTX) (i.e. Rheumatrex.RTM., Trexall.RTM.), belimumab (i.e. Benlysta.RTM.), or other immunosuppressive drugs (e.g., cyclosporin A, FK506-like compounds, rapamycin compounds, or steroids), anti-proliferatives, cytotoxic agents, or other compounds that may assist in immunosuppression. or any other biological agent targeting any inflammatory cytokine, nonsteroidal antiinflammatory drugs/Cox-2 inhibitors, hydroxychloroquine, sulphasalazopryine, gold salts, etanercept, infliximab, mycophenolate mofetil, basiliximab, atacicept, rituximab, cytoxan, interferon beta-1a, interferon beta-1b, glatiramer acetate, mitoxantrone hydrochloride, anakinra and/or other biologics and/or intravenous immunoglobulin (IVIG). Non-limiting examples of such known therapeutics include interferons, such as IFN-beta-1a (REBIF.RTM.. AVONEX.RTM. and CINNOVEX.RTM.) and IFN-beta-1b (BETASERON.RTM., EXTAVIA.RTM., BETAFERON.RTM., ZIFERON.RTM.); glatiramer acetate (COPAXONE.RTM.), a polypeptide; natalizumab (TYSABRI.RTM.); and mitoxantrone (NOVANTRONE.RTM.), a cytotoxic agent.
[0250] Thus, treatment of multiple sclerosis using the agents according to at least some embodiments of the present invention may be combined with, for example, any known therapeutic agent or method for treating multiple sclerosis. Non-limiting examples of such known therapeutic agent or method for treating multiple sclerosis include interferon class, IFN-beta-1a (REBIF.RTM.. AVONEX.RTM. and CINNOVEX.RTM.) and IFN-beta-1b (BETASERON.RTM., EXTAVIA.RTM., BETAFERON.RTM., ZIFERON.RTM.); glatiramer acetate (COPAXONE.RTM.), a polypeptide; natalizumab (TYSABRI.RTM.); and mitoxantrone (NOVANTRONE.RTM.), a cytotoxic agent, Fampridine (AMPYRA.RTM.). Other drugs include corticosteroids, methotrexate, cyclophosphamide, azathioprine, and intravenous immunoglobulin (IVIG), inosine, Ocrelizumab (R1594), Mylinax (Caldribine), alemtuzumab (Campath), daclizumab (Zenapax), Panaclar/dimethyl fumarate (BG-12), Teriflunomide (HMR1726), fingolimod (FTY720), laquinimod (ABR216062), as well as Haematopoietic stem cell transplantation, Neurovax, Rituximab (Rituxan) BCG vaccine, low dose naltrexone, helminthic therapy, angioplasty, venous stents, and alternative therapy, such as vitamin D, polyunsaturated fats, medical marijuana.
[0251] Thus, treatment of rheumatoid arthritis, using the agents according to at least some embodiments of the present invention may be combined with, for example, any known therapeutic agent or method for treating rheumatoid arthritis. Non-limiting examples of such known therapeutic agents or methods for treating rheumatoid arthritis include glucocorticoids, nonsteroidal anti-inflammatory drug (NSAID) such as salicylates, or cyclooxygenase-2 inhibitors, ibuprofen and naproxen, diclofenac, indomethacin, etodolac Disease-modifying antirheumatic drugs (DMARDs)-Oral DMARDs: Auranofin (Ridaura), Azathioprine (Imuran), Cyclosporine (Sandimmune, Gengraf, Neoral, generic), D-Penicillamine (Cuprimine), Hydroxychloroquine (Plaquenil), IM gold Gold sodium thiomalate (Myochrysine) Aurothioglucose (Solganal), Leflunomide (Arava), Methotrexate (Rheumatrex), Minocycline (Minocin), Staphylococcal protein A immunoadsorption (Prosorba column), Sulfasalazine (Azulfidine). Biologic DMARDs: TNF-.alpha. blockers including Adalimumab (Humira), Etanercept (Enbrel), Infliximab (Remicade), golimumab (Simponi), certolizumab pegol (Cimzia), and other Biological DMARDs, such as Anakinra (Kineret), Rituximab (Rituxan), Tocilizumab (Actemra), CD28 inhibitor including Abatacept (Orencia) and Belatacept.
[0252] Thus, treatment of IBD, using the agents according to at least some embodiments of the present invention may be combined with, for example, any known therapeutic agent or method for treating IBD. Non-limiting examples of such known therapeutic agents or methods for treating IBD include immunosuppression to control the symptom, such as prednisone, Mesalazine (including Asacol, Pentasa, Lialda, Aspiro), azathioprine (Imuran), methotrexate, or 6-mercaptopurine, steroids, Ondansetron, TNF-.alpha. blockers (including infliximab, adalimumab golimumab, certolizumab pegol), Orencia (abatacept), ustekinumab (Stelara.RTM.), Briakinumab (ABT-874), Certolizumab pegol (Cimzia.RTM.), ITF2357 (givinostat), Natalizumab (Tysabri), Firategrast (SB-683699), Remicade (infliximab), vedolizumab (MLN0002), other drugs including GSK1605786 CCX282-B (Traficet-EN), AJM300, Stelara (ustekinumab), Semapimod (CNI-1493) tasocitinib (CP-690550), LMW Heparin MMX, Budesonide MMX, Simponi (golimumab), MultiStem.RTM., Gardasil HPV vaccine, Epaxal Berna (virosomal hepatitis A vaccine), surgery, such as bowel resection, strictureplasty or a temporary or permanent colostomy or ileostomy; antifungal drugs such as nystatin (a broad spectrum gut antifungal) and either itraconazole (Sporanox) or fluconazole (Diflucan); alternative medicine, prebiotics and probiotics, cannabis, Helminthic therapy or ova of the Trichuris suis helminth.
[0253] Thus, treatment of psoriasis, using the agents according to at least some embodiments of the present invention may be combined with, for example, any known therapeutic agent or method for treating psoriasis. Non-limiting examples of such known therapeutics for treating psoriasis include topical agents, typically used for mild disease, phototherapy for moderate disease, and systemic agents for severe disease. Non-limiting examples of topical agents: bath solutions and moisturizers, mineral oil, and petroleum jelly; ointment and creams containing coal tar, dithranol (anthralin), corticosteroids like desoximetasone (Topicort), Betamethasone, fluocinonide, vitamin D3 analogues (for example, calcipotriol), and retinoids. Non-limiting examples of phototherapy: sunlight; wavelengths of 311-313 nm, psoralen and ultraviolet A phototherapy (PUVA). Non-limiting examples of systemic agents: Biologics, such as interleukin antagonists, TNF-.alpha. blockers including antibodies such as infliximab (Remicade), adalimumab (Humira), golimumab, certolizumab pegol, and recombinant TNF-.alpha. decoy receptor, etanercept (Enbrel); drugs that target T cells, such as efalizumab (Xannelim/Raptiva), alefacept (Ameviv), dendritic cells such Efalizumab; monoclonal antibodies (MAbs) targeting cytokines, including anti-IL-12/IL-23 (ustekinumab (brand name Stelara)) and anti-Interleukin-17; Briakinumab (ABT-874); small molecules, including but not limited to ISA247; Immunosuppressants, such as methotrexate, cyclosporine; vitamin A and retinoids (synthetic forms of vitamin A); and alternative therapy, such as changes in diet and lifestyle, fasting periods, low energy diets and vegetarian diets, diets supplemented with fish oil rich in Vitamin A and Vitamin D (such as cod liver oil), Fish oils rich in the two omega-3 fatty acids eicosapentaenoic acid (EPA) and docosahexaenoic acid (DHA) and contain Vitamin E Ichthyotherapy, Hypnotherapy, cannabis.
[0254] Thus, treatment of type 1 diabetes, using the agents according to at least some embodiments of the present invention may be combined with, for example, any known therapeutic agent or method for treating type ldiabetes. Non-limiting examples of such known therapeutics for treating type 1 diabetes include insulin, insulin analogs, islet transplantation, stem cell therapy including PROCHYMAL.RTM., non-insulin therapies such as it-1beta inhibitors including Anakinra (Kineret.RTM.), Abatacept (Orencia.RTM.), Diamyd, alefacept (Ameviv.RTM.), Otelixizumab, DiaPep277 (Hsp60 derived peptide), Alpha 1-Antitrypsin, Prednisone, azathioprine, Ciclosporin, E1-INT (an injectable islet neogenesis therapy comprising an epidermal growth factor analog and a gastrin analog), statins including Zocor.RTM., Simlup.RTM., Simcard.RTM., Simvacor.RTM., Sitagliptin (dipeptidyl peptidase (DPP-4) inhibitor), Anti-CD3 mAb (e.g., Teplizumab); CTLA4-Ig (abatacept), Anti IL-1Beta (Canakinumab), Anti-CD20 mAb (e.g, rituximab).
[0255] Thus, treatment of uveitis, using the agents according to at least some embodiments of the present invention may be combined with, for example, any known therapeutic agent or method for treating uveitis. Non-limiting examples of such known therapeutics for treating uveitis include corticosteroids, topical cycloplegics, such as atropine or homatropine, or injection of PSTTA (posterior subtenon triamcinolone acetate), antimetabolite medications, such as methotrexate, TNF-.alpha. blockers (including infliximab, adalimumab, etanercept, golimumab, certolizumab pegol).
[0256] Thus, treatment for Sjogren's syndrome, using the agents according to at least some embodiments of the present invention may be combined with, for example, any known therapeutic agent or method for treating for Sjogren's syndrome. Non-limiting examples of such known therapeutics for treating for Sjogren's syndrome include Cyclosporine, pilocarpine (Salagen) and cevimeline (Evoxac), Hydroxychloroquine (Plaquenil), cortisone (prednisone and others) and/or azathioprine (Imuran) or cyclophosphamide (Cytoxan), Dexamethasone, Thalidomide, Dehydroepiandrosterone, NGX267, Rebamipide, FID 114657, Etanercept, Raptiva, Belimumab, MabThera (rituximab); Anakinra, intravenous immune globulin (IVIG), Allogeneic Mesenchymal Stem Cells (AlloMSC), Automatic neuro-electrostimulation by "Saliwell Crown".
[0257] Thus, treatment for systemic lupus erythematosus, using the agents according to at least some embodiments of the present invention may be combined with, for example, any known therapeutic agent or method for treating for systemic lupus erythematosus. Non-limiting examples of such known therapeutics for treating for systemic lupus erythematosus include corticosteroids and Disease-modifying antirheumatic drugs (DMARDs), commonly anti-malarial drugs such as plaquenil and immunosuppressants (e.g. methotrexate and azathioprine) Hydroxychloroquine, cytotoxic drugs (e.g., cyclophosphamide and mycophenolate), Hydroxychloroquine (HCQ), Benlysta (belimumab), nonsteroidal anti-inflammatory drugs, Prednisone, Cellcept, Prograf, Atacicept, Lupuzor, Intravenous Immunoglobulins (IVIGs), CellCept (mycophenolate mofetil), Orencia, CTLA4-IgG4m (RG2077), rituximab, Ocrelizumab, Epratuzumab, CNTO 136, Sifalimumab (MEDI-545), A-623 (formerly AMG 623), AMG 557, Rontalizumab, paquinimod (ABR-215757), LY2127399, CEP-33457, Dehydroepiandrosterone, Levothyroxine, abetimus sodium (LIP 394), Memantine, Opiates, Rapamycin, Renal transplantation, stem cell transplantation.
[0258] The therapeutic agents and/or a pharmaceutical composition comprising same, as recited herein, according to at least some embodiments of the invention, may be administered as the sole active ingredient or together with other drugs in immunomodulating regimens or other anti-inflammatory agents e.g. for the treatment or prevention of allo- or xenograft acute or chronic rejection or inflammatory or autoimmune disorders, or to induce tolerance.
[0259] For example, it may be used in combination with a calcineurin inhibitor, e.g. cyclosporin A or FK506; an immunosuppressive macrolide, e.g. rapamycine or a derivative thereof; e.g. 40-0-(2-hydroxy)ethyl-rapamycin, a lymphocyte homing agent, e.g. FTY720 or an analog thereof, corticosteroids; cyclophosphamide; azathioprene; methotrexate; leflunomide or an analog thereof; mizoribine; mycophenolic acid; mycophenolate mofetil; 15-deoxyspergualine or an analog thereof; immunosuppressive monoclonal antibodies, e.g., monoclonal antibodies to leukocyte receptors, e.g., MHC, CD2, CD3, CD4, CD 11a/CD18, CD7, CD25, CD 27, B7, CD40, CD45, CD58, CD 137, ICOS, CD150 (SLAM), OX40, 4-1BB or their ligands; or other immunomodulatory compounds, e.g. CTLA4-Ig (abatacept, ORENCIA.RTM. or belatacept), CD28-Ig, B7-H4-Ig, or other costimulatory agents, or adhesion molecule inhibitors, e.g. mAbs or low molecular weight inhibitors including LFA-1 antagonists, Selectin antagonists and VLA-4 antagonists.
[0260] Where the therapeutic agents and/or a pharmaceutical composition comprising same, as recited herein, according to at least some embodiments of the invention are administered in conjunction with other immunosuppressive/immunomodulatory or anti-inflammatory therapy, e.g. as herein above specified, dosages of the co-administered immunosuppressant, immunomodulatory or anti-inflammatory compound will of course vary depending on the type of co-drug employed, e.g. whether it is a steroid or a cyclosporin, on the specific drug employed, on the condition being treated and so forth.
[0261] According to at least some embodiments of the present invention, there is provided use of a combination of the therapeutic agents and/or a pharmaceutical composition comprising same, as recited herein, and a known therapeutic agent effective for treating infection.
[0262] The therapeutic agents and/or a pharmaceutical composition comprising same, as recited herein, can be administered in combination with one or more additional therapeutic agents used for treatment of bacterial infections, including, but not limited to, antibiotics including Aminoglycosides, Carbapenems, Cephalosporins, Macrolides, Lincosamides, Nitrofurans, penicillins, Polypeptides, Quinolones, Sulfonamides, Tetracyclines, drugs against mycobacteria including but not limited to Clofazimine, Cycloserine, Cycloserine, Rifabutin, Rifapentine, Streptomycin and other antibacterial drugs such as Chloramphenicol, Fosfomycin, Metronidazole, Mupirocin, and Tinidazole.
[0263] The therapeutic agents and/or a pharmaceutical composition comprising same, as recited herein, can be administered in combination with one or more additional therapeutic agents used for treatment of viral infections, including, but not limited to, antiviral drugs such as oseltamivir (brand name Tamiflu) and zanamivir (brand name Relenza) Arbidol-adamantane derivatives (Amantadine, Rimantadine)-neuraminidase inhibitors (Oseltamivir, Laninamivir, Peramivir, Zanamivir) nucleotide analog reverse transcriptase inhibitor including Purine analogue guanine (Aciclovir#/Valacyclovir, Ganciclovir/Valganciclovir, Penciclovir/Famciclovir) and adenine (Vidarabine), Pyrimidine analogue, uridine (Idoxuridine, Trifluridine, Edoxudine), thymine (Brivudine), cytosine (Cytarabine); Foscarnet; Nucleoside analogues/NARTIs: Entecavir, Lamivudine, Telbivudine, Clevudine; Nucleotide analogues/NtRTIs: Adefovir, Tenofovir; Nucleic acid inhibitors such as Cidofovir; InterferonInterferon alfa-2b, Peginterferon alfa-2a; Ribavirin#/Taribavirin; antiretroviral drugs including zidovudine, lamivudine, abacavir, lopinavir, ritonavir, tenofovir/emtricitabine, efavirenz each of them alone or a various combinations, gp41 (Enfuvirtide), Raltegravir, protease inhibitors such as Fosamprenavir, Lopinavir and Atazanavir, Methisazone, Docosanol, Fomivirsen, Tromantadine.
[0264] The therapeutic agents and/or a pharmaceutical composition comprising same, as recited herein, can be administered in combination with one or more additional therapeutic agents used for treatment of fungal infections, including, but not limited to, antifungal drugs of the Polyene antifungals, Imidazole, triazole, and thiazole antifungals, Allylamines, Echinocandins or other anti fungal drugs.
[0265] Alternatively or additionally, an upregulating method may optionally be effected by specifically upregulating the amount (optionally expression) in the subject of at least one of the polypeptides of the present invention or active portions thereof.
[0266] As is mentioned hereinabove and in the Examples section which follows, the biomolecular sequences of this aspect of the present invention may be used as valuable therapeutic tools in the treatment of diseases, disorders or conditions in which altered activity or expression of the wild-type gene product (known protein) is known to contribute to disease, disorder or condition onset or progression. For example, in case a disease is caused by overexpression of a membrane bound-receptor, a soluble variant thereof may be used as an antagonist which competes with the receptor for binding the ligand, to thereby terminate signaling from the receptor.
[0267] According to at least some embodiments, immune cells, preferably T cells, can be contacted in vivo or ex vivo with the therapeutic agents to modulate immune responses. The T cells contacted with the therapeutic agents can be any cell which expresses the T cell receptor, including .alpha./.beta. and .gamma./.delta. T cell receptors. T-cells include all cells which express CD3, including T-cell subsets which also express CD4 and CDS. T-cells include both naive and memory cells and effector cells such as CTL. T-cells also include cells such as Th1, Tc1, Th2, Tc2, Th3, Th17, Th22, Treg, and Tr1 cells. T-cells also include NKT-cells and similar unique classes of the T-cell lineage.
[0268] In a further embodiment, the additional therapeutic agent functions to inhibit or reduce T cell activation through a separate pathway. In one such embodiment, the additional therapeutic agent is a CTL A-4 fusion protein, such as CTLA-4-Ig (abatacept). CTLA-4-Ig fusion proteins compete with the co-stimulatory receptor, CD28, on T cells for binding to CD80/CD86 (B7-1/B7-2) on antigen presenting cells, and thus function to inhibit T cell activation. In another embodiment, the additional therapeutic agent is a CTLA-4-Ig fusion protein known as belatacept. Belatacept contains two amino acid substitutions (L104E and A29Y) that markedly increase its avidity to CD86 in vivo. In another embodiment, the additional therapeutic agent is Maxy-4.
[0269] In another embodiment, the second therapeutic agent is cyclophosphamide (CTX). Cyclophosphamide (the generic name for Endoxan.RTM., Cytoxan.RTM., Neosar.RTM., Procytox.RTM., Revimmune.TM.), also known as cytophosphane, is a nitrogen mustard alkylating agent from the oxazophorines group. It is used to treat various types of cancer and some autoimmune disorders. In a further embodiment, IgC1ORF32 polypeptides, fragments or fusion proteins thereof and CTX are coadministered in effective amount to prevent or treat a chronic autoimmune disease or disorder such as Systemic lupus erythematosus (SLE). Cyclophosphamide (CTX) is the primary drug used for diffuse proliferative glomerulonephritis in patients with renal lupus. In some embodiments the combination therapy is administered in an effective amount to reduce the blood or serum levels of anti-double stranded DNA (anti-ds DNA) auto antibodies and/or to reduce proteinuria in a patient in need thereof.
[0270] In another embodiment, the second therapeutic is Tysabri or another therapeutic for MS. In a further embodiment, IgC1ORF32 polypeptides, fragments or fusion proteins thereof is cycled with Tysabri or used during a drug holiday in order to allow less frequent dosing with the second therapeutic and reduce the risk of side effects such as PML and to prevent resistance to the second therapeutic.
[0271] In another embodiment, the second therapeutic agent preferentially treats chronic inflammation, whereby the treatment regimen targets both acute and chronic inflammation. In a further embodiment the second therapeutic is a TNF-alpha blocker.
[0272] In another embodiment, the second therapeutic agent is a small molecule that inhibits or reduces differentiation, proliferation, activity, and/or cytokine production and/or secretion by Th1, Th17, Th22, and/or other cells that secrete, or cause other cells to secrete, inflammatory molecules, including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs. In another embodiment, the second therapeutic agent is a small molecule that interacts with Tregs, enhances Treg activity, promotes or enhances IL-10 secretion by Tregs, increases the number of Tregs, increases the suppressive capacity of Tregs, or combinations thereof.
[0273] Typically useful small molecules are organic molecules, preferably small organic compounds having a molecular weight of more than 100 and less than about 2,500 daltons, more preferably between 100 and 2000, more preferably between about 100 and about 1250, more preferably between about 100 and about 1000, more preferably between about 100 and about 750, more preferably between about 200 and about 500 daltons. Small molecules comprise functional groups necessary for structural interaction with proteins, particularly hydrogen bonding, and typically include at least an amine, carbonyl, hydroxyl or carboxyl group, preferably at least two of the functional chemical groups. The small molecules often comprise cyclical carbon or heterocyclic structures and/or aromatic or polyaromatic structures substituted with one or more of the above functional groups. Small molecules also include biomolecules including peptides, saccharides, fatty acids, steroids, purines, pyrimidines, derivatives, structural analogs or combinations thereof. In one embodiment, the small molecule is retinoic acid or a derivative thereof. The examples below demonstrate that retinoic acid inhibits or reduces differentiation and/or activity of ThI 7 cells. In a further embodiment, the compositions are used in combination or succession with compounds that increase Treg activity or production. Exemplary Treg enhancing agents include but are not limited to glucocorticoid fluticasone, salmeteroal, antibodies to IL-12, IFN-gamma, and IL-4; vitamin D3, and dexamethasone, and combinations thereof. Antibodies to other proinflammatory molecules can also be used in combination or alternation with the disclosed C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof. Preferred antibodies bind to IL-6, IL-23, IL-22 or IL-21.
[0274] As used herein the term "rapamycin compound" includes the neutral tricyclic compound rapamycin, rapamycin derivatives, rapamycin analogs, and other macrolide compounds which are thought to have the same mechanism of action as rapamycin (e.g., inhibition of cytokine function). The language "rapamycin compounds" includes compounds with structural similarity to rapamycin, e.g., compounds with a similar macrocyclic structure, which have been modified to enhance their therapeutic effectiveness. Exemplary Rapamycin compounds are known in the art. The language "FK506-Hke compounds" includes FK506, and FK506 derivatives and analogs, e.g., compounds with structural similarity to FK506, e.g., compounds with a similar macrocyclic structure which have been modified to enhance their therapeutic effectiveness. Examples of FK506-like compounds include, for example, those described in WO 00101385. Preferably, the language "rapamycin compound" as used herein does not include FK506-like compounds.
[0275] Other suitable therapeutics include, but are not limited to, anti-inflammatory agents. The anti-inflammatory agent can be non-steroidal, steroidal, or a combination thereof. One embodiment provides oral compositions containing about 1% (w/w) to about 5% (w/w), typically about 2.5 (w/w) or an anti-inflammatory agent. Representative examples of non-steroidal anti-inflammatory agents include, without limitation, oxicams, such as piroxicam, isoxicam, tenoxicam, sudoxicam; salicylates, such as aspirin, disalcid, benorylate, trilisate, safapryn, solprin, diflunisal, and fendosal; acetic acid derivatives, such as diclofenac, fenclofenac, indomethacin, sulindac, tolmetin, isoxepac, furofenac, tiopinac, zidometacin, acematacin, fentiazac, zomepirac, clmdanac, oxepinac, felbmac, and ketorolac; fenamates, such as mefenamic, meclofenamic, flufenamic, niflumic, and tolfenamic acids; propionic acid derivatives, such as ibuprofen, naproxen, benoxaprofen, flurbiprofen, ketoprofen, fenoprofen, fenbufen, indopropfen, pirprofen, carprofen, oxaprozin, pranoprofen, miroprofen, tioxaprofen, suprofen, alminoprofen, and tiaprofenic; pyrazoles, such as phenylbutazone, oxyphenbutazone, feprazone, azapropazone, and trimethazone. Mixtures of these non-steroidal anti-inflammatory agents may also be employed.
[0276] Representative examples of steroidal anti-inflammatory drugs include, without limitation, corticosteroids such as hydrocortisone, hydroxyl-triamcinolone, alpha-methyl dexamethasone, dexamethasone-phosphate, beclomethasone dipropionates, clobetasol valerate, desonide, desoxymethasone, desoxycorticosterone acetate, dexamethasone, dichlorisone, diflorasone diacetate, diflucortolone valerate, fluadrenolone, fluclorolone acetonide, fludrocortisone, flumethasone pivalate, fiuosinolone acetonide, fluocinonide, flucortine butylesters, fluocortolone, fluprednidene (fluprednylidene) acetate, flurandrenolone, halcinonide, hydrocortisone acetate, hydrocortisone butyrate, methylprednisolone, triamcinolone acetonide, cortisone, cortodoxone, flucetonide, fludrocortisone, difluorosone diacetate, fluradrenolone, fludrocortisone, diflurosone diacetate, fluradrenolone acetonide, medrysone, amcinafel, amcinafide, betamethasone and the balance of its esters, chloroprednisone, chlorprednisone acetate, clocortelone, clescinolone, dichlorisone, diflurprednate, flucloronide, flunisolide, fluoromethalone, fluperolone, fluprednisolone, hydrocortisone valerate, hydrocortisone cyclopentylpropionate, hydrocortamate, meprednisone, paramethasone, prednisolones prednisone, beclomethasone dipropionate, triamcinolone, and mixtures thereof.
[0277] Methods of Therapeutic Use
[0278] The C1ORF32 polypeptides, fragments or fusion proteins thereof are useful as therapeutic agents. According to at least some embodiments, immune cells, preferably T cells, can be contacted in vivo or ex vivo with C1ORF32 fusion polypeptides to decrease or inhibit immune responses including, but not limited to inflammation. According to at least some other embodiments, immune cells, preferably T cells, can be contacted in vivo or ex vivo with C1ORF32 fusion polypeptides to decrease or inhibit T cell exhaustion, optionally in combination with another therapeutic agent. In both cases, preferably the costimulatory pathway is modulated to achieve a desired immune system balance.
[0279] In either case, the T cells contacted with C1ORF32 fusion polypeptides can be any cell which expresses the T cell receptor, including .alpha./.beta. and .gamma./.delta. T cell receptors. T-cells include all cells which express CD3, including T-cell subsets which also express CD4 and CDS. T-cells include both naive and memory cells and effector cells such as CTL. T-cells also include cells such as Th1, Tc1, Th2, Tc2, Th3, Th17, Th22, Treg, and Tr1 cells. T-cells also include NKT-cells and similar unique classes of the T-cell lineage. For example the compositions can be used to modulate Th1, Th17, Th22, or other cells that secrete, or cause other cells to secrete, inflammatory molecules, including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs. The compositions can also be used to increase or promote the activity of Tregs, increase the production of cytokines such as IL-10 from Tregs, increase the differentiation of Tregs, increase the number of Tregs, or increase the survival of Tregs. The compositions can also be used to increase or promote the activity of Th2 cells, increase the production of cytokines such as IL-10 or IL-4 from Th2 cells, increase the differentiation of Th2 cells, increase the number of Th2 cells, or increase the survival of Th2 cells.
[0280] Although the below discussion applies generally to the reversal of T cell exhaustion, preferably for treatment of such exhaustion memory T cells are treated. Optionally, additionally or alternatively, treatment of T cell exhaustion encompasses the modulation of cytokine secretion, or other cells that secrete, or cause other cells to secrete, inflammatory molecules, including, but not limited to, IL-2, TNF-alpha, IFN-gamma, 15 Granzyme B and MMPs or modulate the expression of molecues of the costimulatory/coinhibtory-family including, but not limited to PD-1, Tim3, CTLA4 and LAGS.
[0281] In some embodiments, the disclosed C1ORF32 polypeptide, selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof, are administered in combination with a second therapeutic. Combination therapies may be useful in immune modulation. In some embodiments, C1ORF32 polypeptide, selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof, can be used to attenuate or reverse the activity of a pro-inflammatory drug, and/or limit the adverse effects of such drugs.
[0282] Other immune cells that can be treated with the disclosed C1ORF32 polypeptides, fragments or fusion thereof include T cell precursors, antigen presenting cells such as dendritic cells and monocytes or their precursors, B cells or combinations thereof. The C1ORF32 compositions can be used to modulate the production of antibodies by B cells by contacting the B cells with an effective amount of the C1ORF32 composition to inhibit or reduce antibody production by the B cell relative to a control. The C1ORF32 compositions can also modulate the production of cytokines by the B cells.
[0283] Methods of Treating Inflammatory Responses
[0284] The C1ORF32 polypeptides, fragments or fusion proteins thereof, selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof, according to at least some embodiments of the present invention inhibit T cell activation, as manifested by T cell proliferation and cytokine secretion. Specifically, the proteins inhibit T Th1 and Th17 responses, while promoting Th2 responses.
[0285] The C1ORF32 polypeptides, fragments or fusion proteins thereof, selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof, according to at least some embodiments of the present invention are potentially used for therapy of diseases that require down-regulation of costimulatory pathways and or such that require downregulation of Th1 and/or Th17 responses.
[0286] A further embodiment provides methods for treating or alleviating one or more symptoms of inflammation. In a further embodiment, the compositions and methods disclosed are useful for treating chronic and persistent inflammation. Inflammation in general can be treated using the disclosed C1ORF32 polypeptides or fragment or fusions thereof.
[0287] According to at least some embodiments of the present invention, there is provided use of an isolated C1ORF32 polypeptide as described herein or a fusion protein comprising an isolated C1ORF32 polypeptide as described herein, optionally in a pharmaceutical composition comprising a pharmaceutically acceptable diluent or carrier, for treatment of an immune related disorder and/or infection.
[0288] An immune response including inflammation can be inhibited or reduced in a subject, preferably a human, by administering an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof, to inhibit or reduce the biological activity of an immune cell or to reduce the amounts of proinflammatory molecules at a site of inflammation. Exemplary proinflammatory molecules include, but are not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs.
[0289] Th1 and Th17 are exemplary T cells that can be targeted for inhibition by C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof, to inhibit or reduce inflammation.
[0290] Without wishing to be limited by a single hypothesis for this biological mechanism or any other biological mechanism described herein, the C1ORF32 polypeptides, fragments or fusion proteins thereof are useful for treating inflammation by any or all of the following: inhibiting or reducing differentiation of Th1, Th17, Th22, and/or other cells that secrete, or cause other cells to secrete, inflammatory molecules, including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs; inhibiting or reducing activity of ThI, Th 17, Th22, and/or other cells that secrete, or cause other cells to secrete, inflammatory molecules, including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs; inhibiting or reducing the Th1 and/or Th17 pathways; inhibiting or reducing cytokine production and/or secretion by Th1, Th17, Th22, and/or other cells that secrete, or cause other cells to secrete, inflammatory molecules, including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6 IL-23, IL-22, IL-21, and MMPs; inhibiting or reducing proliferation of Th1, Th17, Th22, and/or other cells that secrete, or cause other cells to secrete, inflammatory molecules, including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs.
[0291] Additionally, C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can also enhance Th2 immune responses. C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can also act directly on Th2 cells to promote or enhance production of IL-4, IL-5 or IL-10, or to increase the number of Th2 cells, resulting in inhibition of Th1 and/or Th17, and in immune modulation via a Th1/Th2 shift.
[0292] Additionally, C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can cause Tregs to have an enhanced suppressive effect on an immune response. Tregs can suppress differentiation, proliferation, activity, and/or cytokine production and/or secretion by Th1, Th17, Th22, and/or other cells that secrete, or cause other cells to secrete, inflammatory molecules, including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs. For example, C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can cause Tregs to have an enhanced suppressive effect on Th1 and/or Th17 cells to reduce the level of IFN-gamma and IL-17 produced, respectively. C1ORF32polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can also act directly on Tregs to promote or enhance production of IL-10 to suppress the Th1 and/or Th17 pathway, and/or to increase the number of Tregs.
[0293] Additionally, C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can cause Th2 to have an enhanced modulatory effect on an immune response. Th2 cells can modulate differentiation, proliferation, activity, and/or cytokine production and/or secretion by Th1, Th17, Th22, and/or other cells that secrete, or cause other cells to secrete, inflammatory molecules, including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs. For example, C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can cause Th2 cells to have an enhanced modulatory effect on Th1 and/or Th17 cells to reduce the level of IFN-gamma and IL-17 produced, respectively. C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can also act directly on Th2 cells to promote or enhance production of IL-10 to suppress the Th1 and/or Th17 pathway, and/or to increase the number of Th2 cells.
[0294] Without wishing to be limited by a single hypothesis, it is believed that C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof acts at multiple points in multiple T cell pathways. For example, polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can inhibit the differentiation of naive T cells into either Th1 or Th17 cells. Alternatively, polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can interact with Th1 cells or Th17 cells, or both to inhibit or reduce the production of proinflammatory molecules.
[0295] Additionally, C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof may increase the differentiation of and/or promote Th2 responses resulting in an immunomdulatory effect on the Th1 and/or Th17 pathways to reduce the level of INF-gamma and/or IL-17 produced. C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof enhances the production of IL-10 from cells such as Th2 and/or Tregs, which in turn inhibits the activity of Th1 and/or Th17 cells.
[0296] Additionally, C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can affect Tregs to have an enhanced suppressive effect on Th1 and/or Th17 pathways to reduce the level of INF-gamma and/or IL-17 produced. Additionally, C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can enhance the production of IL-10 which inhibits the activity of Th1 and/or Th17 cells.
Inhibition of Th1 Responses
[0297] a. Inhibition of Th1 Development
[0298] One method for inhibiting or reducing inflammation includes administering an effective amount of a C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof to inhibit Th1 development in a subject in need thereof. Inflammation can be inhibited or reduced by blocking naive T cells from differentiating into Th1 cells by administering C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof. In one embodiment, the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof may inhibit or reduce proliferation of Th1 cells. C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof may also reduce naive T cells from differentiating into Th1 cells, by blocking antigen presenting cell maturation. Alternatively, C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof increase the differentiation of Th2 cells and thereby reduce the number of Th1 cells in a subject. By restricting the number of Th1 cells that can develop in the subject, the amount of proinflammatory molecules such as INF-gamma can be reduced or contained. INF-gamma stimulates the production or release of other proinflammatory molecules including IL-1beta, TNF-alpha, and MMPs. Thus, by controlling the number of Th1 cells in a subject, the levels of these other proinflammatory molecules can be controlled, thereby reducing inflammatory responses.
b. Inhibition of Proinflammatory Molecules
[0299] Another embodiment provides a method of inhibiting or reducing inflammation in a subject by administering to the subject an effective amount of a C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof to inhibit or reduce production of proinflammatory molecules by Th1 cells.
[0300] Exemplary proinflammatory molecules produced by Th1 cells includes IFN-gamma. In this embodiment the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can interact directly with the Th1 cell and inhibit or reduce IFN-gamma production by the Th1 cells. In this embodiment, the amount of proinflammatory molecules is regulated rather than the population of Th1 cells.
[0301] Inhibition of Th17 Responses a. Inhibition of Th17 Development
[0302] Inflammation can also be inhibited or reduced in a subject by administering an effective amount of a C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof, to inhibit or block naive T cells from developing into Th17 cells. In one embodiment, the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof increases the suppressive activity of Tregs on the differentiation of naive T cells into Th17 cells by an amount sufficient to reduce the number of Th17 cells in a subject. Alternatively, the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof inhibits or reduces proliferation of Th17 cells. C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof may also reduce naive T cells from differentiating into Th17 cells, by blocking antigen presenting cell maturation. By reducing the population of Th17 cells in a subject, the amount of IL-17 can be reduced, as well as IL-22 and IL-21. IL-17 is a proinflammatory cytokine that causes increases in other proinflammatory molecules such as IL-1beta, TNF-alpha, and MMPs. Thus, by reducing the amount of IL-17 these other proinflammatory molecules can be reduced, thereby reducing or inhibiting inflammation.
b. Inhibition of IL-17 Production
[0303] Still another embodiment provides a method for treating inflammation in a subject by administering an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof, to inhibit production of IL-17 by Th17 cells, as well as IL-22 and IL-21. In this embodiment, the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can act directly on Th17 cells, for example by binding to Th17 cells resulting in inhibition of IL-17 (or IL-22 and IL-21) production by those Th17 cells. As noted above, inhibition or reduction of IL-17 (and IL-22 or IL-21) leads to the reduction of other proinflammatory molecules, thereby reducing or inhibitng inflammation.
Inhibiting Th1 and Th17 Responses
[0304] The disclosed C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can be used to inhibit both the Th1 and Th17 pathways simultaneously. Using one anti-inflammatory agent to inhibit two separate pathways provides more robust inhibition or reduction of the immune response.
Promoting Th2 Responses and IL-10 Production.
[0305] Inflammation can also be treated by administering C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof thereof to a subject in an amount effective to enhance Th2 responses, and the suppressive activity of IL-10 producing cells, and to enhance suppressive or modulatory activity on the Th1 and/or Th17 pathways. In this embodiment the disclosed C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof cause an increased suppressive effect on IFN-gamma and/or IL-17 production. Another embodiment provides a method for treating inflammation by administering an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof to increase production of IL-10 by Th2, Tregs or other immune cells.
[0306] Increased production of IL-10 results in the decreased production of IL-17 by Th17 cells and deceased production of IFN-gamma by Th1 cells. In this embodiment, the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can interact directly with with immune cells to increase IL-10 production.
[0307] Still another embodiment provides a method for treating inflammation by administering an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof to inhibit or interfere with the Th1 pathway and Th17 pathway, and to enhance the suppressive effect on the Th1 and/or Th17 pathways by Th2 cells.
[0308] The C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can also be administered to a subject in an amount effective to increase Th2 cell populations or numbers.
[0309] IL-10 production can be increased relative to a control by contacting Th2 cells, Tregs or other immune cells with an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof having C1ORF32 activity. The increase can occur in vitro or in vivo.
Inflammatory Disease to be Treated
[0310] Representative inflammatory or autoimmune diseases and disorders that may be treated using C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof include, but are not limited to multiple sclerosis, rheumatoid arthritis, type I diabetes, psoriasis, systemic lupus erythematosus, inflammatory bowel disease, uveitis, and Sjogren's syndrome.
[0311] C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof acts at multiple points in the inflammatory pathway master regulator to control the expression and/or activity of effectory cytokines such as IFN-gamma and TNF-alpha. Therefore, the C1ORF32 compositions described herein are particularly useful for treating patients that do not respond to TNF-alpha blockers such as Enbrel, Remicade, Cimzia and Humira, or where TNF-alpha blockers are not safe or effective. In addition, because of its activity as a master regulator in the inflammatory pathway, the C1ORF32 compositions disclosed are particularly useful for treating chronic and persistent inflammation.
[0312] In a further embodiment, the C1ORF32 compositions described herein are used to treat relapsing and/or remitting multiple sclerosis.
Inhibition of Epitope Spreading
[0313] Epitope spreading refers to the ability of B and T cell immune response to diversify both at the level of specificity, from a single determinant to many sites on an auto antigen, and at the level of V gene usage (Monneaux, F. et al., Arthritis & Rheumatism, 46(6): 1430-1438 (2002). Epitope spreading is not restricted to systemic autoimmune disease. It has been described in T cell dependent organ specific diseases such as Diabetes mellitus type 1 and multiple sclerosis in humans, and EAE induced experimental animals with a variety of myelin proteins.
[0314] Epitope spreading involves the acquired recognition of new epitopes in the same self molecule as well as epitopes residing in proteins that are associated in the same macromolecular complex. Epitope spreading can be assessed by measuring delayed-type hypersensitivity (DTH) responses, methods of which are known in the art.
[0315] One embodiment provides a method for inhibiting or reducing epitope spreading in a subject by administering to the subject an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof. In a further embodiment the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof inhibits epitope spreading in individuals with multiple sclerosis. Preferably, the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof inhibits or blocks multiple points of the inflammation pathway.
[0316] Yet another embodiment provides a method for inhibiting or reducing epitope spreading in subjects with multiple sclerosis by administering to a subject an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof to inhibit or reduce differentiation of, proliferation of, activity of, and/or cytokine production and/or secretion by Th1, Th17, Th22, and/or other cells that secrete, or cause other cells to secrete, inflammatory molecules, including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs. Another embodiment provides a method for treating multiple sclerosis by administering to a subject an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof thereof to interact with Tregs, enhance Treg activity, promote or enhances IL-10 secretion by Tregs, increase the number of Tregs, increase the suppressive capacity of Tregs, or combinations thereof. Another embodiment provides a method for treating multiple sclerosis by administering to a subject an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof to interact with Th2 cells, enhance Th2 activity, promote or enhance IL-10 secretion by Th2 cells, increase the number of Th2 cells, increase the modulatory capacity of Th2 cells, or combinations thereof.
Induction of Immune Tolerance
[0317] In one embodiment, the present invention provides a method for inducing or re-establishing immune tolerance in a subject by administering to the subject an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof. In a further embodiment the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof induces tolerance in individuals with immune related diseases. In a specific embodiment the C1ORF32 polypeptide, fragment or fusion protein thereof induces tolerance in individuals with multiple sclerosis or any other immune related disease as described herein. Preferably, the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof inhibits or blocks multiple points of the inflammation pathway. In another specific embodiment, the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof induces tolerance in individuals with rheumatoid arthritis. Another embodiment provides a method for treating immune related diseases by administering to a subject an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof to induce immune tolerance by interacting with Tregs, enhancing Treg activity, increasing the number of Tregs, increase the suppressive capacity of Tregs, or combinations thereof. Another embodiment provides a method for treating immune related diseases by administering to a subject an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof to promote or enhance IL-10 secretion by immune cells.
Use of the Therapeutic Agents According to at Least Some Embodiments of the Invention for Adoptive Immunotherapy:
[0318] One of the cardinal features of some models of tolerance is that once the tolerance state has been established, it can be perpetuated to naive recipients by the adoptive transfer of donor-specific regulatory cells. Such adoptive transfer studies have also addressed the capacity of T-cell subpopulations and non-T cells to transfer tolerance. Such tolerance can be induced by blocking costimulation or upon engagement of a co-inhibitory B7 with its counter receptor. This approach, that have been successfully applied in animals and is evaluated in clinical trials in humans, (Scalapino K J and Daikh D I. PLoS One. 2009; 4(6):e6031; Riley et al., Immunity. 2009; 30(5): 656-665) provides a promising treatment option for autoimmune disorders and transplantation. Therapeutic agents according to at least some embodiments of the invention, are used for_for adoptive immunotherapy. Thus, in at least some embodiments, the invention provides methods for in vivo or ex vivo tolerance induction, comprising administering effective amount of the therapeutic agent according to at least some embodiments, to a patient or to leukocytes isolated from the patient, in order to induce differentiation of tolerogenic regulatory cells; followed by ex-vivo enrichment and expansion of said cells and reinfusion of the tolerogenic regulatory cells to said patient.
[0319] Alternatively, immune responses can be enhanced in a patient by removing immune cells from the patient, contacting immune cells in vitro with an agent that inhibits C1ORF32 activity, and/or which inhibits the interaction of C1ORF32 with its natural binding partners, and reintroducing the in vitro stimulated immune cells into the patient. In another embodiment, a method of modulating immune responses involves isolating immune cells from a patient, transfecting them with a nucleic acid molecule encoding a form of C1ORF32, such that the cells express all or a portion of the C1ORF32 polypeptide according to various embodiments of the present invention on their surface, and reintroducing the transfected cells into the patient. The transfected cells have the capacity to modulate immune responses in the patient.
[0320] Pharmaceutical Compositions
[0321] The present invention, in some embodiments, features a pharmaceutical composition comprising a therapeutically effective amount of a therapeutic agent according to the present invention. According to the present invention the therapeutic agent could be any one of soluble C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof or a corresponding nucleic acid sequence encoding. The pharmaceutical composition according to the present invention is further used for the treatment of immune related disorder and/or infection as described herein. The therapeutic agents of the present invention can be provided to the subject alone, or as part of a pharmaceutical composition where they are mixed with a pharmaceutically acceptable carrier.
[0322] As used herein, "pharmaceutically acceptable carrier" includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible. Preferably, the carrier is suitable for intravenous, intramuscular, subcutaneous, parenteral, spinal or epidermal administration (e.g., by injection or infusion). Depending on the route of administration, the active compound, i.e., soluble C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof or a corresponding nucleic acid sequence encoding. The pharmaceutical compounds according to at least some embodiments of the present invention may include one or more pharmaceutically acceptable salts. A "pharmaceutically acceptable salt" refers to a salt that retains the desired biological activity of the parent compound and does not impart any undesired toxicological effects (see e.g., Berge, S. M., et al. (1977) J. Pharm. Sci. 66: 1-19). Examples of such salts include acid addition salts and base addition salts. Acid addition salts include those derived from nontoxic inorganic acids, such as hydrochloric, nitric, phosphoric, sulfuric, hydrobromic, hydroiodic, phosphorous and the like, as well as from nontoxic organic acids such as aliphatic mono- and dicarboxylic acids, phenyl-substituted alkanoic acids, hydroxy alkanoic acids, aromatic acids, aliphatic and aromatic sulfonic acids and the like. Base addition salts include those derived from alkaline earth metals, such as sodium, potassium, magnesium, calcium and the like, as well as from nontoxic organic amines, such as N,N'-dibenzylethylenediamine, N-methylglucamine, chloroprocaine, choline, diethanolamine, ethylenediamine, procaine and the like.
[0323] A pharmaceutical composition according to at least some embodiments of the present invention also may include one or more pharmaceutically acceptable anti-oxidants. Examples of pharmaceutically acceptable antioxidants include: (1) water soluble antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like; (2) oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha-tocopherol, and the like; and (3) metal chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid, phosphoric acid, and the like. A pharmaceutical composition according to at least some embodiments of the present invention also may include additives such as detergents and solubilizing agents (e.g., TWEEN 20 (polysorbate-20), TWEEN 80 (polysorbate-80)) and preservatives (e.g., Thimersol, benzyl alcohol) and bulking substances (e.g., lactose, mannitol). Examples of suitable aqueous and nonaqueous carriers that may be employed in the pharmaceutical compositions according to at least some embodiments of the present invention include water, buffered saline of various buffer content (e.g., Tris-HCl, acetate, phosphate), pH and ionic strength, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate.
[0324] Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
[0325] These compositions may also contain adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of presence of microorganisms may be ensured both by sterilization procedures, supra, and by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents which delay absorption such as aluminum monostearate and gelatin.
[0326] Pharmaceutically acceptable carriers include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. The use of such media and agents for pharmaceutically active substances is known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the pharmaceutical compositions according to at least some embodiments of the present invention is contemplated. Supplementary active compounds can also be incorporated into the compositions.
[0327] Therapeutic compositions typically must be sterile and stable under the conditions of manufacture and storage. The composition can be formulated as a solution, microemulsion, liposome, or other ordered structure suitable to high drug concentration. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. In many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition. Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin. Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by sterilization microfiltration. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum drying and freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
[0328] Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by sterilization microfiltration. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum drying and freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
[0329] The amount of active ingredient which can be combined with a carrier material to produce a single dosage form will vary depending upon the subject being treated, and the particular mode of administration. The amount of active ingredient which can be combined with a carrier material to produce a single dosage form will generally be that amount of the composition which produces a therapeutic effect. Generally, out of one hundred percent, this amount will range from about 0.01 percent to about ninety-nine percent of active ingredient, preferably from about 0.1 percent to about 70 percent, most preferably from about I percent to about 30 percent of active ingredient in combination with a pharmaceutically acceptable carrier.
[0330] Dosage regimens are adjusted to provide the optimum desired response (e.g., a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms according to at least some embodiments of the present invention are dictated by and directly dependent on (a) the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals.
[0331] A composition of the present invention can be administered via one or more routes of administration using one or more of a variety of methods known in the art. As will be appreciated by the skilled artisan, the route and/or mode of administration will vary depending upon the desired results. Preferred routes of administration for therapeutic agents according to at least some embodiments of the present invention include intravascular delivery (e.g. injection or infusion), intravenous, intramuscular, intradermal, intraperitoneal, subcutaneous, spinal, oral, enteral, rectal, pulmonary (e.g. inhalation), nasal, topical (including transdermal, buccal and sublingual), intravesical, intravitreal, intraperitoneal, vaginal, brain delivery (e.g. intra-cerebroventricular, intra-cerebral, and convection enhanced diffusion), CNS delivery (e.g. intrathecal, perispinal, and intra-spinal) or parenteral (including subcutaneous, intramuscular, intraperitoneal, intravenous (IV) and intradermal), transdermal (either passively or using iontophoresis or electroporation), transmucosal (e.g., sublingual administration, nasal, vaginal, rectal, or sublingual), administration or administration via an implant, or other parenteral routes of administration, for example by injection or infusion, or other delivery routes and/or forms of administration known in the art. The phrase "parenteral administration" as used herein means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection and infusion or using bioerodible inserts, and can be formulated in dosage forms appropriate for each route of administration. In a specific embodiment, a protein, a therapeutic agent or a pharmaceutical composition according to at least some embodiments of the present invention can be administered intraperitoneally or intravenously.
[0332] Compositions of the present invention can be delivered to the lungs while inhaling and traverse across the lung epithelial lining to the blood stream when delivered either as an aerosol or spray dried particles having an aerodynamic diameter of less than about 5 microns. A wide range of mechanical devices designed for pulmonary delivery of therapeutic products can be used, including but not limited to nebulizers, metered dose inhalers, and powder inhalers, all of which are familiar to those skilled in the art. Some specific examples of commercially available devices are the Ultravent nebulizer (Mallinckrodt Inc., St. Louis, Mo.); the Acorn II nebulizer (Marquest Medical Products, Englewood, Colo.); the Ventolin metered dose inhaler (Glaxo Inc., Research Triangle Park, N.C.); and the Spinhaler powder inhaler (Fisons Corp., Bedford, Mass.). Nektar, Alkermes and Mannkind all have inhalable insulin powder preparations approved or in clinical trials where the technology could be applied to the formulations described herein.
[0333] In some in vivo approaches, the compositions disclosed herein are administered to a subject in a therapeutically effective amount. As used herein the term "effective amount" or "therapeutically effective amount" means a dosage sufficient to treat, inhibit, or alleviate one or more symptoms of the disorder being treated or to otherwise provide a desired pharmacologic and/or physiologic effect. The precise dosage will vary according to a variety of factors such as subject-dependent variables (e.g., age, immune system health, etc.), the disease, and the treatment being effected. For the polypeptide compositions disclosed herein and nucleic acids encoding the same, as further studies are conducted, information will emerge regarding appropriate dosage levels for treatment of various conditions in various patients, and the ordinary skilled worker, considering the therapeutic context, age, and general health of the recipient, will be able to ascertain proper dosing. The selected dosage depends upon the desired therapeutic effect, on the route of administration, and on the duration of the treatment desired. For polypeptide compositions, generally dosage levels of 0.0001 to 100 mg/kg of body weight daily are administered to mammals and more usually 0.001 to 20 mg/kg. For example dosages can be 0.3 mg/kg body weight, 1 mg/kg body weight, 3 mg/kg body weight, 5 mg/kg body weight or 10 mg/kg body weight or within the range of 1-10 mg/kg. An exemplary treatment regime entails administration once per week, once every two weeks, once every three weeks, once every four weeks, once a month, once every 3 months or once every three to 6 months. Generally, for intravenous injection or infusion, dosage may be lower. Dosage regimens are adjusted to provide the optimum desired response (e.g., a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms according to at least some embodiments of the present invention are dictated by and directly dependent on (a) the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals.
[0334] Optionally the polypeptide formulation may be administered in an amount between 0.0001 to 100 mg/kg weight of the patient/day, preferably between 0.001 to 20.0 mg/kg/day, according to any suitable timing regimen. A therapeutic composition according to at least some embodiments according to at least some embodiments of the present invention can be administered, for example, three times a day, twice a day, once a day, three times weekly, twice weekly or once weekly, once every two weeks or 3, 4, 5, 6, 7 or 8 weeks. Moreover, the composition can be administered over a short or long period of time (e.g., 1 week, 1 month, 1 year, 5 years).
[0335] Alternatively, therapeutic agent can be administered as a sustained release formulation, in which case less frequent administration is required. Dosage and frequency vary depending on the half-life of the therapeutic agent in the patient. In general, the half-life for fusion proteins may vary widely. The dosage and frequency of administration can vary depending on whether the treatment is prophylactic or therapeutic. In prophylactic applications, a relatively low dosage is administered at relatively infrequent intervals over a long period of time. Some patients continue to receive treatment for the rest of their lives. In therapeutic applications, a relatively high dosage at relatively short intervals is sometimes required until progression of the disease is reduced or terminated, and preferably until the patient shows partial or complete amelioration of symptoms of disease. Thereafter, the patient can be administered a prophylactic regime.
[0336] Actual dosage levels of the active ingredients in the pharmaceutical compositions of the present invention may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient. The selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions of the present invention employed, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
[0337] A "therapeutically effective dosage" of C1ORF32 soluble protein polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof, preferably results in a decrease in severity of disease symptoms, an increase in frequency and duration of disease symptom-free periods, an increase in lifepan, disease remission, or a prevention or reduction of impairment or disability due to the disease affliction.
[0338] One of ordinary skill in the art would be able to determine a therapeutically effective amount based on such factors as the subject's size, the severity of the subject's symptoms, and the particular composition or route of administration selected.
[0339] In certain embodiments, the polypeptide compositions are administered locally, for example by injection directly into a site to be treated. Typically, the injection causes an increased localized concentration of the polypeptide compositions which is greater than that which can be achieved by systemic administration. For example, in the case of a neurological disorder like Multiple Sclerosis, the protein may be administered locally to a site near the CNS. In another example, as in the case of an arthritic disorder like Rheumatoid Arthritis, the protein may be administered locally to the synovium in the affected joint. The polypeptide compositions can be combined with a matrix as described above to assist in creating a increased localized concentration of the polypeptide compositions by reducing the passive diffusion of the polypeptides out of the site to be treated.
[0340] Pharmaceutical compositions of the present invention may be administered with medical devices known in the art. For example, in an optional embodiment, a pharmaceutical composition according to at least some embodiments of the present invention can be administered with a needles hypodermic injection device, such as the devices disclosed in U.S. Pat. Nos. 5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824; or 4,596,556. Examples of well-known implants and modules useful in the present invention include: U.S. Pat. No. 4,487,603, which discloses an implantable micro-infusion pump for dispensing medication at a controlled rate; U.S. Pat. No. 4,486,194, which discloses a therapeutic device for administering medicaments through the skin; U.S. Pat. No. 4,447,233, which discloses a medication infusion pump for delivering medication at a precise infusion rate; U.S. Pat. No. 4,447,224, which discloses a variable flow implantable infusion apparatus for continuous drug delivery; U.S. Pat. No. 4,439,196, which discloses an osmotic drug delivery system having multi-chamber compartments; and U.S. Pat. No. 4,475,196, which discloses an osmotic drug delivery system. These patents are incorporated herein by reference. Many other such implants, delivery systems, and modules are known to those skilled in the art.
[0341] The active compounds can be prepared with carriers that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Many methods for the preparation of such formulations are patented or generally known to those skilled in the art. See, e.g., Sustained and Controlled Release Drug Delivery Systems, J. R. Robinson, ed., Marcel Dekker, Inc., New York, 1978.
[0342] Therapeutic compositions can be administered with medical devices known in the art. For example, in an optional embodiment, a therapeutic composition according to at least some embodiments of the present invention can be administered with a needles hypodermic injection device, such as the devices disclosed in U.S. Pat. Nos. 5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824; or 4,596,556. Examples of well-known implants and modules useful in the present invention include: U.S. Pat. No. 4,487,603, which discloses an implantable micro-infusion pump for dispensing medication at a controlled rate; U.S. Pat. No. 4,486,194, which discloses a therapeutic device for administering medicaments through the skin; U.S. Pat. No. 4,447,233, which discloses a medication infusion pump for delivering medication at a precise infusion rate; U.S. Pat. No. 4,447,224, which discloses a variable flow implantable infusion apparatus for continuous drug delivery; U.S. Pat. No. 4,439,196, which discloses an osmotic drug delivery system having multi-chamber compartments; and U.S. Pat. No. 4,475,196, which discloses an osmotic drug delivery system. These patents are incorporated herein by reference. Many other such implants, delivery systems, and modules are known to those skilled in the art.
[0343] In certain embodiments, C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof according to at least some embodiments of the present invention can be formulated to ensure proper distribution in vivo. For example, the blood-brain barrier (BBB) excludes many highly hydrophilic compounds. To ensure that the therapeutic compounds according to at least some embodiments of the present invention cross the BBB (if desired), they can be formulated, for example, in liposomes. For methods of manufacturing liposomes, see, e.g., U.S. Pat. Nos. 4,522,811; 5,374,548; and 5,399,331. The liposomes may comprise one or more moieties which are selectively transported into specific cells or organs, thus enhance targeted drug delivery (see, e.g., V. V. Ranade (1989) J. Clin. Pharmacol. 29:685). Exemplary targeting moieties include folate or biotin (see, e.g., U.S. Pat. No. 5,416,016 to Low et al.); mannosides (Umezawa et al., (1988) Biochem. Biophys. Res. Commun. 153:1038); antibodies (P. G. Bloeman et al. (1995) FEBS Lett. 357:140; M. Owais et al. (1995) Antimicrob. Agents Chemother. 39:180); surfactant protein A receptor (Briscoe et al. (1995) Am. J Physiol. 1233:134); p120 (Schreier et al. (1994) J. Biol. Chem. 269:9090); see also K. Keinanen; M. L. Laukkanen (1994) FEBS Lett. 346:123; J. J. Killion; I. J. Fidler (1994) Immunomethods 4:273.
[0344] Formulations for Parenteral Administration
[0345] In a further embodiment, compositions disclosed herein, including those containing peptides and polypeptides, are administered in an aqueous solution, by parenteral injection. The formulation may also be in the form of a suspension or emulsion. In general, pharmaceutical compositions are provided including effective amounts of a peptide or polypeptide, and optionally include pharmaceutically acceptable diluents, preservatives, solubilizers, emulsifiers, adjuvants and/or carriers. Such compositions optionally include one or more for the following: diluents, sterile water, buffered saline of various buffer content (e.g., Tris-HCl, acetate, phosphate), pH and ionic strength; and additives such as detergents and solubilizing agents (e.g., TWEEN 20 (polysorbate-20), TWEEN 80 (polysorbate-80)), anti-oxidants (e.g., water soluble antioxidants such as ascorbic acid, sodium metabisulfite, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite; oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha-tocopherol; and metal chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid, phosphoric acid), and preservatives (e.g., Thimersol, benzyl alcohol) and bulking substances (e.g., lactose, mannitol). Examples of non-aqueous solvents or vehicles are ethanol, propylene glycol, polyethylene glycol, vegetable oils, such as olive oil and corn oil, gelatin, and injectable organic esters such as ethyl oleate. The formulations may be freeze dried (lyophilized) or vacuum dried and redissolved/resuspended immediately before use. The formulation may be sterilized by, for example, filtration through a bacteria retaining filter, by incorporating sterilizing agents into the compositions, by irradiating the compositions, or by heating the compositions.
[0346] Formulations for Topical Administration
[0347] C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof, nucleic acids, and vectors disclosed herein can be applied topically. Topical administration does not work well for most peptide formulations, although it can be effective especially if applied to the lungs, nasal, oral (sublingual, buccal), vaginal, or rectal mucosa.
[0348] Compositions can be delivered to the lungs while inhaling and traverse across the lung epithelial lining to the blood stream when delivered either as an aerosol or spray dried particles having an aerodynamic diameter of less than about 5 microns.
[0349] A wide range of mechanical devices designed for pulmonary delivery of therapeutic products can be used, including but not limited to nebulizers, metered dose inhalers, and powder inhalers, all of which are familiar to those skilled in the art. Some specific examples of commercially available devices are the Ultravent nebulizer (Mallinckrodt Inc., St. Louis, Mo.); the Acorn II nebulizer (Marquest Medical Products, Englewood, Colo.); the Ventolin metered dose inhaler (Glaxo Inc., Research Triangle Park, N.C.); and the Spinhaler powder inhaler (Fisons Corp., Bedford, Mass.). Nektar, Alkermes and Mannkind all have inhalable insulin powder preparations approved or in clinical trials where the technology could be applied to the formulations described herein.
[0350] Formulations for administration to the mucosa will typically be spray dried drug particles, which may be incorporated into a tablet, gel, capsule, suspension or emulsion. Standard pharmaceutical excipients are available from any formulator. Oral formulations may be in the form of chewing gum, gel strips, tablets or lozenges.
[0351] Transdermal formulations may also be prepared. These will typically be ointments, lotions, sprays, or patches, all of which can be prepared using standard technology. Transdermal formulations will require the inclusion of penetration enhancers.
[0352] Controlled Delivery Polymeric Matrices
[0353] C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof, nucleic acids, and vectors disclosed herein may also be administered in controlled release formulations. Controlled release polymeric devices can be made for long term release systemically following implantation of a polymeric device (rod, cylinder, film, disk) or injection (microparticles). The matrix can be in the form of microparticles such as microspheres, where peptides are dispersed within a solid polymeric matrix or microcapsules, where the core is of a different material than the polymeric shell, and the peptide is dispersed or suspended in the core, which may be liquid or solid in nature. Unless specifically defined herein, microparticles, microspheres, and microcapsules are used interchangeably. Alternatively, the polymer may be cast as a thin slab or film, ranging from nanometers to four centimeters, a powder produced by grinding or other standard techniques, or even a gel such as a hydrogel.
[0354] Either non-biodegradable or biodegradable matrices can be used for delivery of polypeptides or nucleic acids encoding the polypeptides, although biodegradable matrices are preferred. These may be natural or synthetic polymers, although synthetic polymers are preferred due to the better characterization of degradation and release profiles. The polymer is selected based on the period over which release is desired. In some cases linear release may be most useful, although in others a pulse release or "bulk release" may provide more effective results. The polymer may be in the form of a hydrogel (typically in absorbing up to about 90% by weight of water), and can optionally be crosslinked with multivalent ions or polymers.
[0355] The matrices can be formed by solvent evaporation, spray drying, solvent extraction and other methods known to those skilled in the art. Bioerodible microspheres can be prepared using any of the methods developed for making microspheres for drug delivery, for example, as described by Mathiowitz and Langer, J. Controlled Release, 5:13-22 (1987); Mathiowitz, et al., Reactive Polymers, 6:275-283 (1987); and Mathiowitz, et al., J. Appl Polymer ScL, 35:755-774 (1988). The devices can be formulated for local release to treat the area of implantation or injection --which will typically deliver a dosage that is much less than the dosage for treatment of an entire body--or systemic delivery. These can be implanted or injected subcutaneously, into the muscle, fat, or swallowed.
Diagnostic Uses of C1ORF32
[0356] Soluble polypeptides according to at least some embodiments of the present invention may also be modified with a label capable of providing a detectable signal, either directly or indirectly, including, but not limited to, radioisotopes and fluorescent compounds. Such labeled polypeptides can be used for various uses, including but not limited to, prognosis, prediction, screening, early diagnosis, determination of progression, therapy selection and treatment monitoring of disease and/or an indicative condition, as detailed above.
[0357] According to at least some embodiments, the present invention provides a method for imaging an organ or tissue, the method comprising: (a) administering to a subject in need of such imaging, a labeled polypeptide; and (b) detecting the labeled polypeptide to determine where the labeled polypeptide is concentrated in the subject. When used in imaging applications, the labeled polypeptides according to at least some embodiments of the present invention typically have an imaging agent covalently or noncovalently attached thereto. Suitable imaging agents include, but are not limited to, radionuclides, detectable tags, fluorophores, fluorescent proteins, enzymatic proteins, and the like. One of skill in the art will be familiar with other methods for attaching imaging agents to polypeptides. For example, the imaging agent can be attached via site-specific conjugation, e.g., covalent attachment of the imaging agent to a peptide linker such as a polyarginine moiety having five to seven arginines present at the carboxyl-terminus of and Fc fusion molecule. The imaging agent can also be directly attached via non-site specific conjugation, e.g., covalent attachment of the imaging agent to primary amine groups present in the polypeptide. One of skill in the art will appreciate that an imaging agent can also be bound to a protein via noncovalent interactions (e.g., ionic bonds, hydrophobic interactions, hydrogen bonds, Van der Waals forces, dipole-dipole bonds, etc.).
[0358] In certain instances, the polypeptide is radiolabeled with a radionuclide by directly attaching the radionuclide to the polypeptide. In certain other instances, the radionuclide is bound to a chelating agent or chelating agent-linker attached to the polypeptide. Suitable radionuclides for direct conjugation include, without limitation, 18 F, 124 I, 125 I, 131 I, and mixtures thereof. Suitable radionuclides for use with a chelating agent include, without limitation, 47 Sc, 64 Cu, 67 Cu, 89 Sr, 86 Y, 87 Y, 90 Y, 105 Rh, 111 Ag, 111 In, 117m Sn, 149 Pm, 153 Sm, 166 Ho, 177 Lu, 186 Re, 188 Re, 211 At, 212 Bi, and mixtures thereof. Preferably, the radionuclide bound to a chelating agent is 64 Cu, 90 Y, 111 In, or mixtures thereof. Suitable chelating agents include, but are not limited to, DOTA, BAD, TETA, DTPA, EDTA, NTA, HDTA, their phosphonate analogs, and mixtures thereof. One of skill in the art will be familiar with methods for attaching radionuclides, chelating agents, and chelating agent-linkers to polypeptides of the present invention. In particular, attachment can be conveniently accomplished using, for example, commercially available bifunctional linking groups (generally heterobifunctional linking groups) that can be attached to a functional group present in a non-interfering position on the polypeptide and then further linked to a radionuclide, chelating agent, or chelating agent-linker.
[0359] Non-limiting examples of fluorophores or fluorescent dyes suitable for use as imaging agents include Alexa Fluor.RTM. dyes (Invitrogen Corp.; Carlsbad, Calif.), fluorescein, fluorescein isothiocyanate (FITC), Oregon Green.TM.; rhodamine, Texas red, tetrarhodamine isothiocynate (TRITC), CyDye.TM. fluors (e.g., C.gamma.2, C.gamma.3, C.gamma.5), and the like.
[0360] Examples of fluorescent proteins suitable for use as imaging agents include, but are not limited to, green fluorescent protein, red fluorescent protein (e.g., DsRed), yellow fluorescent protein, cyan fluorescent protein, blue fluorescent protein, and variants thereof (see, e.g., U.S. Pat. Nos. 6,403,374, 6,800,733, and 7,157,566). Specific examples of GFP variants include, but are not limited to, enhanced GFP (EGFP), destabilized EGFP, the GFP variants described in Doan et al., Mol. Microbiol., 55:1767-1781 (2005), the GFP variant described in Crameri et al., Nat. Biotechnol., 14:315-319 (1996), the cerulean fluorescent proteins described in Rizzo et al., Nat. Biotechnol, 22:445 (2004) and Tsien, Annu. Rev. Biochem., 67:509 (1998), and the yellow fluorescent protein described in Nagal et al., Nat. Biotechnol., 20:87-90 (2002). DsRed variants are described in, e.g., Shaner et al., Nat. Biotechnol., 22:1567-1572 (2004), and include mStrawberry, mCherry, morange, mBanana, mHoneydew, and mTangerine. Additional DsRed variants are described in, e.g., Wang et al., Proc. Natl. Acad. Sci. U.S.A., 101:16745-16749 (2004) and include mRaspberry and mPlum. Further examples of DsRed variants include mRFPmars described in Fischer et al., FEBS Lett., 577:227-232 (2004) and mRFPruby described in Fischer et al., FEBS Lett., 580:2495-2502 (2006).
[0361] In other embodiments, the imaging agent that is bound to a polypeptide according to at least some embodiments of the present invention comprises a detectable tag such as, for example, biotin, avidin, streptavidin, or neutravidin. In further embodiments, the imaging agent comprises an enzymatic protein including, but not limited to, luciferase, chloramphenicol acetyltransferase, .beta.-galactosidase, .beta.-glucuronidase, horseradish peroxidase, xylanase, alkaline phosphatase, and the like.
[0362] Any device or method known in the art for detecting the radioactive emissions of radionuclides in a subject is suitable for use in the present invention. For example, methods such as Single Photon Emission Computerized Tomography (SPECT), which detects the radiation from a single photon gamma-emitting radionuclide using a rotating gamma camera, and radionuclide scintigraphy, which obtains an image or series of sequential images of the distribution of a radionuclide in tissues, organs, or body systems using a scintillation gamma camera, may be used for detecting the radiation emitted from a radiolabeled polypeptide of the present invention. Positron emission tomography (PET) is another suitable technique for detecting radiation in a subject. Miniature and flexible radiation detectors intended for medical use are produced by Intra-Medical LLC (Santa Monica, Calif.). Magnetic Resonance Imaging (MRI) or any other imaging technique known to one of skill in the art is also suitable for detecting the radioactive emissions of radionuclides. Regardless of the method or device used, such detection is aimed at determining where the labeled polypeptide is concentrated in a subject, with such concentration being an indicator of disease activity.
[0363] Non-invasive fluorescence imaging of animals and humans can also provide in vivo diagnostic information and be used in a wide variety of clinical specialties. For instance, techniques have been developed over the years for simple ocular observations following UV excitation to sophisticated spectroscopic imaging using advanced equipment (see, e.g., Andersson-Engels et al., Phys. Med. Biol., 42:815-824 (1997)). Specific devices or methods known in the art for the in vivo detection of fluorescence, e.g., from fluorophores or fluorescent proteins, include, but are not limited to, in vivo near-infrared fluorescence (see, e.g., Frangioni, Curr. Opin. Chem. Biol., 7:626-634 (2003)), the Maestro.TM. in vivo fluorescence imaging system (Cambridge Research & Instrumentation, Inc.; Woburn, Mass.), in vivo fluorescence imaging using a flying-spot scanner (see, e.g., Ramanujam et al., IEEE Transactions on Biomedical Engineering, 48:1034-1041 (2001), and the like.
[0364] Other methods or devices for detecting an optical response include, without limitation, visual inspection, CCD cameras, video cameras, photographic film, laser-scanning devices, fluorometers, photodiodes, quantum counters, epifluorescence microscopes, scanning microscopes, flow cytometers, fluorescence microplate readers, or signal amplification using photomultiplier tubes.
[0365] The present invention is further illustrated by the below examples related to C1ORF32 antigen, its domains and expression data as well as prophetic examples describing the manufacture of fully human antibodies thereto. This information and examples is illustrative and should not be construed as further limiting. The contents of all figures and all references, patents and published patent applications cited throughout this application are expressly incorporated herein by reference.
EXAMPLES
Example 1
Design and Production of Mutated C1ORF32 ECD Polypeptides
[0366] This Example relates to production of ECD fragments.
[0367] Materials and Methods
C1ORF32-P8-ECD-mFC Production in CHO Cells:
[0368] To produce C1ORF32-P8-ECD-mFC in CHO cells, retrovector constructs containing cDNA that code for the protein were transduced into CHO cells, and 3-4 rounds of transductions were carried out. Cell pool of the last transduction was grown in shake flasks by fed-batch production. Medium was harvested at 12-14 days when cell viability dropped to -50%.
[0369] The harvested medium was clarified by depth filtration followed by 0.2 .mu.m filter, and the clarified material was subjected to Protein A chromatography. The eluate, pH .about.3.7, was incubated with mixing for 60 minutes at room temperature to facilitate viral inactivation, neutralized to pH .about.7.2 and filtered through a 0.2 .mu.m filter. Finally, the solution was buffer exchanged to PBS pH 7.2, concentrated to the desired protein concentration and filtered.
[0370] Results
[0371] SDS-PAGE analysis, under non-reducing conditions, of C1ORF32-P8-V1-ECD-mFC produced in CHO cells, as described below, revealed three main bands: the expected MW of .about.100 kD, a band at MW of .about.751(D, and a third one at MW of .about.55kD. SDS-PAGE analysis in reduced conditions revealed two main bands--one at the expected MW of .about.50kD and an additional of .about.301(D.
[0372] Western Blot analyses using anti-C1ORF32-P8-V1-ECD and anti-mFc demonstrated the presence of mainly three protein species: the intact full-size dimer consisting of two chains each with an C1ORF32 ECD and a Fc (homodimer); a one-arm cleaved dimer consisting of one chain with an C1ORF32 ECD and a Fc and second chain with mainly the Fc (heterodimer); and a two-armed cleaved dimer composed of two chains with mainly the Fc (fully cleaved dimer).
[0373] N-terminal sequencing revealed a major cleavage site towards the C-terminus of the C1ORF32 ECD between amino acids F and A at positions 179 and 180 of H19011_1_P8_V1 or H19011_1_P8 (Seq ID NOs: 4 or 5). To prevent this cleavage the amino acids F and A at positions 179 and 180 of H19011_1_P8_V1 or H19011_1_P8 (SEQ ID NOs: 4 or 5) were mutated as follows: FA->GA, FA->AA, and FA->GG. The resulted C1ORF32 ECD fragments are represented by, for example, SEQ ID NOs: 64, 96, and 45, respectively.
Example 2
Production of FC-Fused C1ORF32 Proteins
[0374] The Fc-fused C1ORF32 ECD proteins were produced as follows:
[0375] Fc-fused C1ORF32 ECD (SEQ ID NO:108), corresponds to C1ORF32 ECD without signal peptide (SEQ ID NO: 64) fused to mouse mIgG2a Fc (SEQ ID NO: 31) via GS_TEV_linker_SG (SEQ ID NO:113).
[0376] Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110) corresponds to C1ORF32 ECD-Delta DLLPSFAVEIM fragment without signal peptide (SEQ ID NO:51) fused to mouse mIgG2a Fc (SEQ ID NO: 31) via GS_TEV_linker_SG (SEQ ID NO:113).
[0377] C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) corresponds to C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM fragment without signal peptide (SEQ ID. NO:29) fused to mouse mIgG2a Fc (SEQ ID NO: 31) via GS_TEV_linker_SG [(SEQ ID NO:113).
[0378] All the fused proteins were produced using two service providers; Catalent and ExcellGene, each using its own production protocol as described below:
[0379] Production by Catalent (Middleton, Wis., USA): Codon-optimized cDNA sequences encoding C1ORF32 ECD (SEQ ID NO:108), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), and C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) were produced at Catalent in CHO cells, in pIRESpuro3 vector.
[0380] The cDNA sequence of the insert was verified by Catalent and was used to construct GPEx.RTM. retrovectors, followed by four rounds of retrovector transduction into Catalent's "in-house" CHO--S cell line. A pooled population was produced and expanded and gene copy index was 2.7. Cell culture supernatants were analyzed by Catalent's Fc ELISA assay and relative productivity of the 4.times. transduced pool was 28 .mu.g/ml.
[0381] The protein was produced in 5 L wave bioreactor, and purified according to their in-house process. The level of purity was estimated at >95%, by SDS PAGE and Coomassie staining (data not shown). The concentration of purified protein was measured by absorbance at A280 nm, and estimated at 1.60 mg/ml (using an absorbance coefficient of 1.28 mg/ml). Endotoxin levels were tested, and estimated at 0.25-0.5EU/ml. A total of .about.400 mg were obtained from .about.10 L of cell pool.
[0382] Production by ExcellGene (Valais, Switzerland): Codon-optimized cDNA sequences encoding C1ORF32 ECD (SEQ ID NO:108), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), and C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) were synthesized and subcloned into ExcellGene's proprietary expression vector (pXLG6), designed for high yield transient gene expression vectors. Expression vectors were then transiently-transfected into Exellgene's CHOExpress.TM. host cells, and cells were cultured for 12-14 days in TubeSpin50.RTM. bioreactors. Viability was determined daily, and productivity was assessed at the end of the culture by Western Blot analysis. A second transient transfection was then performed, and the resultant cells were cultured in 1-2 L to obtain the required amount of protein. Culture supernatants were clarified and purified on Protein A columns. Purified proteins were analyzed by a standard SDS-PAGE gel under standard conditions, for which results are shown in FIG. 2, and concentration was determined by A280. Proteins were tested for bioburden and endotoxin. In FIG. 2, lane 12 relates to the protein having the sequence of SEQ ID NO:110, while lane 13 relates to the protein having the sequence of SEQ ID NO:112.
Example 3
The Effect of Fc-Fused C1ORF32 ECD (Seq Id No:108), Fc-Fused C1ORF32 ECD-Delta DLLPSFAVEIM (Seq Id No:110), and C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (Seq Id No:112) on TCR-Mediated Activation of Mouse CD4 T Cells.
[0383] The effect of Fc-fused C1ORF32 ECD (SEQ ID NO:108), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), and C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112)on TCR-mediated activation of mouse T cells, was evaluated by testing their effect on IFN.gamma. secretion and on the expression of the activation marker CD69 in CD4+CD25-purified T cells.
Methods
Mouse CD4 T Cells Isolation.
[0384] CD4+CD25- T cells were isolated from pools of spleens and lymph nodes of BALB/C mice by one step negative selection using T cell isolation Kit (Miltenyi Cat#130-093-227) according to the manufacturer's instructions. The purity obtained was >95%. The cells used in the functional assays, CD4+ T cells, were untouched CD4+CD25- cells, which include CD4+CD62L.sup.high naive T cells (85-90% of bulk CD4 population) and CD4+CD62L.sup.low w memory cells.
Activation of Mouse CD4 T Cells
[0385] Anti-CD3 mAb (clone 145-2C11) alone or together with Fc-fused C1ORF32 ECD (SEQ ID NO:108), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), and C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) or with control mIgG2a (BioXCell Cat. #BE0085) were co-immobilized at the stated concentrations on 96-well flat bottom tissue culture plates (Sigma, Cat. #92096), overnight at 4.degree. C. Wells were washed 3 times with PBS and plated with 1.times.10.sup.5 CD4+ T cells per well at 37.degree. C. Culture supernatants were collected 48 h post stimulation and analyzed for IFN.gamma. secretion using mouse IFN.gamma. ELISA kit (R&D Systems). The effect of immobilized Fc-fused C1ORF32 ECD (SEQ ID NO:108), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), and C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) (10 .mu.g/ml) on the activation marker CD69 was analyzed by FACS, 48 h post simulations with plate bound anti-CD3.
Results
Effect of Fc-fused C1ORF32 ECD (SEQ ID NO:108), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), and C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) on Mouse CD4 T Cells IFN.gamma. Secretion
[0386] In order to evaluate the effect of Fc-fused C1ORF32 ECD (SEQ ID NO:108), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), and C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) on CD4 T cell response, titrated amounts of the respective Fc-fusion C1ORF32 ECD protein or control mIgG2a were immobilized on 96-well plates together with anti-CD3 mAb, and IFN.gamma. secretion from CD4+ T cells was analyzed. Cells were activated for 48 hrs using full RPMI containing 10% FBS, 1 mM sodium pyruvate, 100 IU/ml Pen-Strep (without 2-ME). The results presented in FIG. 3 indicate potent inhibitory effect Fc-fused C1ORF32 ECD (SEQ ID NO:108), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), and C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) on CD4 T cells IFN-.gamma. secretion.
Effect of Fc-Fused C1ORF32 ECD (SEQ ID NO:108), Fc-Fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), and C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) on the Early Activation Marker CD69
[0387] In order to evaluate the effect of Fc-fused C1ORF32 ECD (SEQ ID NO:108), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), and C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) on the early activation marker CD69, an experiment similar to that described in FIG. 3 herein was carried out, using 10 ug/ml of Fc-fused C1ORF32 ECD (SEQ ID NO:108), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), or C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112), respectively. All Fc-fused C1ORF32 ECD proteins tested had a suppressive effect on early activation markers CD69 at 48 h post stimulation as manifested in a reduction of CD69 upregulation upon stimulation, as shown in FIG. 4.
Conclusion
[0388] Immobilized Fc-fused C1ORF32 ECD (SEQ ID NO:108), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), or C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) inhibit CD4 T cell activation to a similar extent as manifested by reduced IFN.gamma. secretion and CD69 expression compare to control Ig upon TCR stimulation.
Example 4
The Effect of Fc-Fused C1ORF32 ECD (Seq Id No:108), Fc-Fused C1ORF32 ECD-DELTA DLLPSFAVEIM (Seq Id No:110), or C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (Seq Id No:112) on Naive CD4+ T Cell Proliferation.
Procedure:
[0389] Naive CD4.sup.+ T cells were isolated from spleens of D011.10 mice (Jackson) via automax sort: CD4-negative sort (Miltenyi Cat#130-095-248), including anti-CD25 (Miltenyi Cat#130-091-072) in the negative sort cocktail, followed by CD62L-positive sort (Miltenyi Cat #130-049-701). Balb/c total splenocytes were also collected from one mouse, and irradiated with 3000 rads to serve as antigen presenting cells (APCs) for the D011.10 CD4.sup.+ T cells. Naive CD4.sup.+ T cells were cultured at 2.5.times.10.sup.5 cells per well in flat-bottom 96-well plates with irradiated APCs at a ratio of 1:1 (APCs to T cells) in 200 ul of HL-1 medium, and activated with 2 ug/ml OVA323-339 in the presence of one of Fc-fused C1ORF32 ECD (SEQ ID NO:108), (produced in CHO--S and in CHO-DG44 as detailed in Example 2) Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), (produced in CHO-DG44 as detailed in Example 2) and or C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) (produced in CHO--S and in CHO-DG44 as detailed in Example 3) or Isotype control Ig (mIgG2a, BioXCell Cat. # BE0085) at the indicated concentrations (0.1-10 ug/ml). The cells were pulsed with luCi of tritiated-thymidine at 24 hours, and harvested at 72 hours.
Results and Conclusions
[0390] As demonstrated in FIG. 5, the Fc-fused C1ORF32 ECD (SEQ ID NO:108), as well as Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), or C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) inhibit T cell proliferation in response to OVA323-339 activation in a dose dependent manner A slightly reduced activity (approximately 3 fold) was achieved by the proteins produced in CHO-DG44 versus those produced in CHO--S. These differences reflect batch to batch variation of these proteins.
Example 5
The Effect of Fc-Fused C1ORF32 ECD (Seq Id No:108), Fc-Fused C1ORF32 ECD-Delta DLLPSFAVEIM (Seq Id No:110), or C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (Seq Id No:112) on Autoimmune Disease or Infectious Disease in a Subject
[0391] A plurality of animals, having a disease model appropriate for testing of the autoimmune disease, receives each of the above described Fc-fused ECD proteins in a plurality of doses. A dose dependent response is seen.
[0392] Similarly, a plurality of animals infected with an infectious disease in which T cell exhaustion is exhibited (for example through chronic viral infection) and receives each of the above Fc-fused ECD proteins in a plurality of doses, in combination with an pharmaceutical agent in a pharmaceutically effective amount against the infectious agent. A dose dependent response is seen.
Example 6
[0393] Effect of C1ORF32 Protein Fragments and/or Fusion Proteins on Activation of Naive CD4+ T Cells with Anti-CD3/Anti-CD28 Coated Beads
[0394] Naive CD4+ T cells are isolated from 5 SJL (Harlan, Israel) mice via automax sort. Beads are coated with anti-CD3 (0.5 ug/ml; clone 2C11) and anti-CD28 (2 ug/ml; clone 37.51 eBioscience) following manufacturer's protocol (Dynabeads M-450 Epoxy Cat. 140.11, Invitrogen), and with increasing concentrations of any one of the C1ORF32 protein fragments and/or fusion proteins thereof (0.1-10 ug/ml). The total amount of protein used for beads coating with any one of the C1ORF32 protein fragments and/or fusion proteins thereof is completed to 10 ug/ml with Control Ig. Naive CD4+ T cells (0.5.times.10.sup.6/well) are activated with the coated beads at a ratio of 1:2 (beads to T cells). The cells are pulsed with luCi of tritiated-thymidine after 24 hours, and harvested after 72.
[0395] The ability of any one of the C1ORF32 protein fragments and/or fusion proteins thereof to inhibite T cell proliferation and elicit its effect in a dose dependent manner is checked. An appropriate response is seen.
Example 7
[0396] Dose Response Effect of C1ORF32 Protein Fragments and/or Fusion Proteins Thereof on Mouse CD4+ T Cell Activation with Plate Bound Anti-CD3, as Manifested in Cytokine Production and Expression of the Activation Marker CD69.
[0397] Untouched CD4+CD25- T cells are isolated from pools of spleen and lymph node cells of BALB/C mice by negative selection using CD4+CD62L+ T cell isolation Kit (Miltenyi Cat#130-093-227) according to the manufacturer's instructions. The desired purity obtained is >95%.
[0398] Tissue culture 96-well plates are coated overnight at 4.degree. C. with 2 ug/ml anti-CD3 mAb (clone 145-2C11) in the presence of any one of the C1ORF32 protein fragments and/or fusion proteins thereof at 1, 5 and 10 .mu.g/ml. Control mIgG2a (Clone C1.18.4 from BioXCell; Cat#BE0085) is added to each well in order to complete a total protein concentration of 12 .mu.g/ml per well. Wells are plated with 1.times.10.sup.5 CD4+CD25- T cells per well. At 48 hrs post stimulation, culture supernatants are collected and analyzed using mouse IFN.gamma. ELISA kit, and cells are analyzed for expression of the activation marker CD69 by flow cytometry.
[0399] The inhibitory effects of any one of the C1ORF32 protein fragments and/or fusion proteins thereof on CD4 T cell activation is demonstrated by reduced IFN.gamma. secretion and reduced expression of CD69 upon TCR stimulation, compared to control mIgG2a and CTLA4-Ig.
Example 8
[0400] The Effect of C1ORF32 Protein Fragments and/or Fusion Proteins Thereof on CD4+ T Cell Differentiation In Vitro.
[0401] To test the ability of any one of the C1ORF32 protein fragments and/or fusion proteins thereof to inhibit CD4+ T cell differentiation, naive CD4+ T cells are isolated from D011.10 mice, which are transgenic for a T cell receptor (TCR) that is specific for OVA323-339 peptide. Using D011.10 T cells enables studying both polyclonal (anti-CD3/anti-CD28 mAbs) and peptide-specific responses on the same population of CD4+ T cells. Naive CD4+ T cells are isolated from D011.10 mice and activated in culture in the presence of anti-CD3/anti-CD28 coated beads or OVA323-339 peptide plus irradiated BALB/c splenocytes, in the presence of any one of the C1ORF32 protein fragments and/or fusion proteins thereof, control Ig, or B7-H4 Ig. The cells are activated in the presence of Th driving conditions as follows: Th0 cell-(IL-2), Th1 cell-(IL-2+IL-12), Th2 cell-(IL-2+IL-4), or Th17 cell-(TGF-.beta.+IL-6+IL-23+anti-IL-2). The effects on T cell differentiation and Th-specific responses are assessed by measuring cell proliferation and subtype specific cytokine production: IL-4, IL-5, IL-10, IL-17, IFN-.gamma.. An appropriate response is seen.
Example 9
[0402] Assessment of the Effect of any One of the C1ORF32 Protein Fragments and/or Fusion Proteins Thereof on Human T Cells Activation.
[0403] The effect of any one of the C1ORF32 protein fragments and/or fusion proteins thereof on human T cell response is tested by two different in vitro assays using purified human T cells. In the first assay, human T cells are activated by anti-CD3 and anti-CD28 coated beads, and in the other assay, activation is carried out using anti-CD3 and anti-CD28 antibodies in the presence of autologous, irradiated PBMCs. The regulatory activity of any one of the C1ORF32 protein fragments and/or fusion proteins thereof on human T cell activation, is evaluated by measuring cell proliferation and cytokine release.
[0404] Study I-- Activation of Human T Cells with Anti-CD3 and Anti-CD28-Coated Beads is Inhibited by Fusion Proteins
[0405] Naive CD4+ T cells are isolated from 4 healthy human donors and activated with anti-CD3 mAb/anti-CD28 mAb coated beads in the presence of control mIgG2a, or any one of the C1ORF32 protein fragments and/or fusion proteins thereof. Two side-by-side culture sets are set up; one culture being pulsed at 24 hours with tritiated-thymidine and harvested at 72 hours while the second plate is harvested at 96 hours for cytokine production via LiquiChip.
[0406] Study II--Activation of Human T Cells with Irradiated Autologous PBMCs is Inhibited by Fusion Proteins
[0407] Total PBMCs are isolated from fresh blood of healthy human donors using ficoll gradient. 10.times.10.sup.6 total PBMCs are resuspended in Ex-Vivo 20 medium, and irradiated at 3000 rad. These cells are used to activate the isolated T cells in vitro, by presenting the anti-CD3, anti-CD28 and either of the test proteins. The rest of PBMCs are used for isolation of T cells using CD4+ T cell Isolation Kit II from Miltenyi.
[0408] For activation, 5.times.10.sup.5 isolated T cells are cultured in the presence of 5.times.10.sup.5 autologous irradiate PBMCs. Anti-CD3 (0.5 .mu.g/ml), anti-CD28 (2 .mu.g/ml) and either of any one of the C1ORF32 protein fragments and/or fusion proteins thereof or control Ig (mIgG2a) are added in a soluble form. The cultures are pulsed with luCi of triated thymidine at 24 hrs, and proliferation is measured at 72 hours.
Example 10
The Effect of any One of the C1ORF32 Protein Fragments Upon Ectopic Expression in APC-Like Cells, on Human T Cell Responses
[0409] The effects of any one of the C1ORF32 protein fragments on human T cell responses are evaluated following their ectopic expression in `T cell stimulator` cells: a murine thymoma cell line, Bw5147, which are engineered to express membrane-bound anti-human CD3 antibody fragments, that can trigger the TCR-complex on human T cells, with or without co-expression of putative costimulatory or coinhibitory ligands.
[0410] Codon-optimized cDNAs encoding any one of the C1ORF32 protein fragments are gene-synthesized and directionally cloned into a retroviral vector pCJK2 via Sfi-I sites. Monocistronic expression constructs are generated. The constructs are validated by agarose gel electrophoresis and were expressed in Bw5147 cells displaying high levels of membrane bound anti-CD3 antibody (Bw-3/2) (Leitner et al., 2010). As negative control Bw5147 cells transduced with "empty" vector (pCJK2) are used. In addition, Bw-3/2 cells expressing costimulatory molecules (ICOSL and CD70) and Bw-3/2-cells expressing coinhibitory molecules (B7-H3 and B7-H1/PD-L1) are also used as controls. Homogenously high expression of the stimulating membrane-bound anti-CD3 antibody is confirmed by FACS using a DyLight-649 anti-mouse IgG (H+L) antibody that reacts with the murine single chain antibody expressed on the stimulator cells. Presence and high level transcription of expression monocistronic constructs in the respective stimulator cells is confirmed by qPCR.
[0411] T cells are purified from buffy coats or heparinised blood derived from healthy volunteer donors and the mononuclear fraction is obtained by standard density centrifugation using Ficoll-Paque (GE-Healthcare). Untouched bulk human T cells are obtained through MACS-depletion of CD11b, CD14, CD16, CD19, CD33 and MHC-class II-bearing cells with the respective biotinylated mAb in conjunction with paramagnetic streptavidin beads (Leitner et al., 2009). Purified CD8 T cells and CD4 T cells are obtained by adding biotinylated CD4 and CD8 mAb to the pools. Naive CD4 T cells are isolated using the Naive CD4+ T cell Isolation Kit II (Miltenyi Biotec). Following isolation, cells are analyzed for purity by FACS, and samples with sufficient purity (>90%) were used for the experiments.
[0412] The stimulator cells are harvested, counted, irradiated (2.times.3000 rad) and seeded in flat-bottom 96-well plates (20000 cells/well). Liquid nitrogen stored MACS-purified T cells are thawed, counted and added to the wells at 100.000 cells per well; total volume was 200 .mu.l/well. Triplicate wells are set up for each condition. Following 48 hours of co-culture, .sup.3H-thymidine (final concentration of 0.025 mCi; PerkinElmer/NewEngland Nuclear Corporation, Wellesley, Mass.) are added to the wells. Following further culturing for 18 hours, the plates were harvested on filter-plates and incorporation of .sup.3H-Thymidine was determined as described in Pfistershammer et al., 2004. In addition, a series of experiments with MACS-purified T cell subsets (CD8 T cells, CD4 T cells, and naive CD45RA-positive CD4 T cells) are performed. Additional controls in all experiments include wells with stimulator cells alone to assess the cells microscopically and also to determine basal .sup.3H-Thymidine incorporation of the stimulator cell w/o T cells. Results with stimulator cells that quickly disintegrated following irradiation are excluded from the analysis.
[0413] Results show the effect of stimulator cells expressing any one of the C1ORF32 protein fragments on the proliferation of human bulk T cells, CD4+ T cells, CD8+ T cells, or naive CD4 CD45RA+ T cells, compared to cells expressing control costimulatory molecules (ICOSL and CD70), which results in a consistent and pronounced stimulation of proliferation of all cell subtypes, and compared to cells expressing control coinhibitory molecules (B7-H3 and B7-H1/PD-L1), which results in a mild inhibition of proliferation of different T cell subtypes.
Example 11
[0414] Characterizing the Target Cells for any One of the C1ORF32 Protein Fragments Proteins by Determining their Binding Profile to Immune Cells
[0415] Splenocytes from D011.10 mice (transgenic mice in which all of the CD4+ T cells express a T cell receptor that is specific for OVA323-339 peptide) are activated in the presence of OVA323-339 peptide, and cells are collected at t=0, 6, 12, 24, and 48 hours following initial activation to determine which cell type is expressing a receptor for any one of the C1ORF32 protein fragments over time. Cells are then co-stained for CD3, CD4, CD8, B220, CD19, CD11b, and CD11c.
Example 12
[0416] Assesment of the Effect of any One of the C1ORF32 Protein Fragments and/or Fusion Proteins Thereof on the Ability of B Cells to Class-Switch and Secrete Antibody
[0417] Resting B cells are isolated from unprimed C57BL/6 mice and activated in vitro in the presence of anti-CD40 plus (i) no exogenous cytokine, (ii) IL-4, or (iii) IFN-.gamma.. The cell cultures receive control Ig (mIgG2a), anti-CD86 mAb (as a positive control for increased Ig production), or any one of any one of the C1ORF32 protein fragments and/or fusion proteins thereof, at the time of culture set up, and are cultured for 5 days. Any one of the C1ORF32 protein fragments and/or fusion proteins thereof are tested at three concentrations each. At the end of culture, supernatants are tested for the presence of IgM, IgG1, and IgG2a via ELISA. If there appears to be an alteration in the ability of the B cells to class-switch to one isotype of antibody versus another, then the number of B cells that have class switched is determined via ELISPOT. If there is an alteration in the number of antibody producing cells, then it is determined if there is an alteration in the level of .gamma.1- and .gamma.2a-sterile transcripts versus the mature transcripts for IgG1 and IgG2a. An appropriate response is seen.
Assesment of the Therapeutic Effect of any One of the C1ORF32 Protein Fragments and/or Fusion Proteins Thereof for Treatment of Autoimmune Diseases
Example 13
[0418] Efficacy of any One of the C1ORF32 Protein Fragments and/or Fusion Proteins Thereof in Mouse R-EAE Model of Multiple Sclerosis
[0419] The therapeutic effect of any one of the C1ORF32 protein fragments and/or fusion proteins thereof for treatment of autoimmune diseases is tested in a mouse model of Multiple Sclerosis; Relapsing Remitting Experimental Autoimmune Encephalomyelitis (R-EAE):
[0420] Female SJL mice 6 weeks old are purchased from Harlan and maintained in the CCM facility for 1 week prior to beginning the experiment. Mice are randomly assigned into groups of 10 animals and primed with 50 .mu.g PLP139-151/CFA on day 0. Mice receive 6 i.p. injections of 100 ug/dose of any one of the C1ORF32 protein fragments and/or fusion proteins thereof, mIgG2a isotype control, or CTLA4-Ig (mouse ECD fused to mouse IgG2a Fc) as positive control. Treatments begin at the time of onset of disease remission and are given 3 times per week for 2 weeks. Mice are followed for disease symptoms. On day 35, (during the peak of the disease relapse) 5 mice of each group are assayed for DTH (delayed type hypersensitivity) response to disease inducing epitope (PLP139-151) and to relapse-associated myelin epitope (PLP178-191) via injection of 10 .mu.g of PLP139-151 in one ear and PLP178-191 into the opposite ear. The level of ear swelling is assayed at 24 hours post challenge.
[0421] The decrease in disease severity of R-EAE-induced mice upon treatment with any one of the C1ORF32 protein fragments and/or fusion proteins thereof, in a therapeutic mode is tested and compared to the level of inhibition of CTLA4-Ig.
[0422] In addition, inhibition of DTH responses to the disease inducing epitope (PLP139-151) and to relapse-associated epitope (PLP178-191). in R0EAE mice treated with any one of the C1ORF32 protein fragments and/or fusion proteins thereof is tested.
[0423] To test the dose dependency of the efficacy of any one of the C1ORF32 protein fragments and/or fusion proteins thereof as well as its mode of action in the PLP-induced R-EAE model, disease is induced as described above and mice are treated from onset of disease remission with 100, 30 or 10 ug/dose of any one of the C1ORF32 protein fragments and/or fusion proteins thereof, 3 times per week over two weeks. The ability of C1ORF32 protein fragments and/or fusion proteins thereof to decrease the level of disease severity in a dose dependent manner, as well as the ability to inhibit DTH responses to spread epitopes PLP178-191 and MBP84-104, to inhibit proliferation as well as reduction in IFN.gamma., IL-17, IL-4 and IL-10 release is tested.
[0424] The beneficial effect of any one of the C1ORF32 protein fragments and/or fusion proteins thereof in the R-EAE model on reduction in the infiltration of immune cells to the CNS is also tested.
Example 14
[0425] Efficacy of any of the C1ORF32 Protein Fragments and/or Fusion Proteins Thereof in Mouse CIA Models of Rheumatoid Arthritis
[0426] Any one of the C1ORF32 protein fragments and/or fusion proteins thereof is tested in mouse model of collagen-induced arthritis (CIA) which is a model of rheumatoid arthritis. Male DBA/1 mice are housed in groups of 8-10, and maintained at 21.degree. C..+-.2.degree. C. on a 12 h light/dark cycle with food and water ad libitum. Arthritis is induced by immunisation with type II collagen emulsified in complete Freund's adjuvant. Mice are monitored on a daily basis for signs of arthritis. On the appearance of arthritis (day 1) treatment with any one of the C1ORF32 protein fragments and/or fusion proteins thereof, mIgG2a isotype control or CTLA4-Ig (mouse ECD fused to mouse IgG2a Fc) as positive control (100 ug/dose, each) is initiated and given 3 times per week for 10 days. Hind footpad swelling is measured (using microcalipers), as well as the number and degree of joint involvement in all four limbs. This yields two measurements, clinical score and footpad thickness that can be used for statistical assessment.
[0427] At the end of the treatment period mice are bled and sacrificed. For histological analysis, paws are removed at post mortem, fixed in buffered formalin (10% v/v), then decalcified in EDTA in buffered formalin (5.5% w/v). The tissues are then embedded in paraffin, sectioned and stained with haematoxylin and eosin. The scoring system is as follows: 0=normal; 1=synovitis but cartilage loss and bone erosions absent or limited to discrete foci; 2=synovitis and significant erosions present but normal joint architecture intact; 3=synovitis, extensive erosions, joint architecture disrupted.
[0428] The ability of the treatment of mice with established CIA with any one of the C1ORF32 protein fragments and/or fusion proteins thereof to result in potent reduction of clinical score, paw swelling and histological damage is tested and compared to the efficacy obtained with CTLA4-Ig.
[0429] Effect of any of the C1ORF32 Protein Fragments and/or Fusion Proteins Thereof on Tolerance Induction in Transfer Model of CIA
[0430] To further understand the effect of any one of the C1ORF32 protein fragments and/or fusion proteins thereof on immune regulation, the ability of these proteins to induce tolerance in a transfer model of arthritis is analyzed.
[0431] In brief, spleen and LN cells from arthritic DBA/1 mice treated for 10 days with any one of the C1ORF32 protein fragments and/or fusion proteins thereof or control Ig2a are removed and injected i.p into T-cell deficient C.B-17 SCID recipients. The mice then receive an injection of 100 .mu.g type II collagen (without CFA), necessary for successful transfer of arthritis. Arthritis is then monitored in the SCID mice. Histology is performed and anti-collagen antibody levels are measured to determine that the C1ORF32 protein fragments and/or fusion proteins thereof treatment confers long-term disease protection.
Example 15
[0432] Assessment of the Effect of any One of C1ORF32 Protein Fragments and/or Fusion Proteins Thereof in a Viral Infection Model of TMEV
[0433] Theiler's murine encephalomyelitis virus (TMEV) is a natural endemic pathogen of mice that causes an induced demyelinating disease (TMEV-IDD) in susceptible strains of mice (SJL/J, H-2KS) that resembles the primary progressive form of MS (Munz et al., Nat Rev Immunol 2009; 9:246-58). TMEV infection results in a life-long persistent virus infection of the CNS leading to development of a chronic T cell-mediated autoimmune demyelinating disease triggered via de novo activation of CD4 T cell responses to endogenous myelin epitopes in the inflamed CNS (i.e. epitope spreading) (Miller et al., Nat Med 1997; 3:1133-6; Katz-Levy et al., J Clin Invest 1999; 104:599-610).
[0434] SJL mice clear the majority of the virus within 21 days post infection, however a latent viral infection is maintained and infect microglia, astrocytes, and neurons. Disease symptoms are manifested around day 25-30 post infection.
[0435] The effect of treatment with any one of C1ORF32 protein fragments and/or fusion proteins thereof on acute and chronic phases of viral infection is studied in the TMEV-IDD model by assessment of viral clearance and disease severity.
Method:
[0436] Female SJL/J mice (5-6 weeks) are infected with TMEV by intracranial inoculation in the right cerebral hemisphere of 3.times.10.sup.7 plaque forming units (PFU) of the BeAn strain 8386 of TMEV in 30 ul serum-free medium. From day 2 post infection mice are treated with Control Ig, or any one of C1ORF32 protein fragments and/or fusion proteins thereof, at 100 ug/dose each; 3 doses/week for 2 weeks.
[0437] Mice are followed for clinical scoring. On day 7 and day 14 post infection (after 3 and 6 treatments respectively) brains and spinal cords are collected from 5 mice in each treatment group for plaque assays. The tissues are weighted so that the ratio of PFU/mg of CNS tissue could be calculated after the plaque assay is completed.
TMEV Plaque Assay:
[0438] Brains and spinal cords of mice treated with Control Ig (mouse IgG2a), or with any one of C1ORF32 protein fragments and/or fusion proteins thereof are collected at days 7 and 14 post-infection from non-perfused anesthetized mice. The Brains and spinal cords are weighed, and homogenized. CNS homogenates are serially diluted in DMEM and added to tissue culture-treated plates of confluent BHK-21 cells for 1 h incubation at room temperature, with periodic gentle rocking.
[0439] A media/agar solution is mixed 1:1 (volume:volume), added to cells and allowed to solidify at room temperature. The plates are then cultured at 34 deg C. for 5 days. At the end of culture, 1 ml of formalin is added and incubated at room temperature for 1 h to fix the BHK monolayer. The formalin is poured off into a waste container, and the agar is removed from the plates. Plaques are visualized by staining with crystal violet for 5 min, and plates are gently rinsed with diH2O. To determine PFU/ml homogenate, the number of plaques on each plate is multiplied by the dilution factor of the homogenate and divided by the amount of homogenate added per plate. The PFU/ml is divided by the weight of the tissue to calculate PFU/mg tissue.
Example 16
[0440] Assessment of the Effect of any One of C1ORF32 Protein Fragments and/or Fusion Proteins Thereof on Primary and Secondary Immune Response to Viral Infection in a Mouse Model of Influenza
[0441] To test the effect of any one of C1ORF32 protein fragments and/or fusion proteins thereof on primary and secondary immune responses to viral infection, BALB/c naive mice (for primary immune responses) and `HA-memory mice`, is used, as well as `polyclonal flu-memory mice` (to assess secondary responses mediated by memory CD4 T cells), which are generated as detailed in Teijaro et al., J Immunol. 2009: 182; 5430-5438, and described below.
[0442] To obtain `HA-memory mice`, first HA-specific memory CD4 T cells are generated, naive CD4 T cells are purified from spleens of HA-TCR mice WALB/c-HA mice which express transgenic T cell receptor (TCR) specific for influenza hemagglutinin (HA) peptide (110-119)] and primed in vitro by culture with 5.0 microg/ml HA peptide and mitomycin C-treated, T-depleted BALB/c splenocytes as APCs for 3 days at 37.degree. C. The resultant activated HA-specific effector cells are transferred into congenic BALB/c (Thy1.1) hosts (5.times.10.sup.6 cells/mouse) to yield "HA-memory mice" with a stable population of HA-specific memory CD4 T cells.
[0443] To obtain `polyclonal-memory mice`, first polyclonal influenza-specific memory CD4 T cells are generated, by infecting BALB/c mice intranasally with a sublethal dose of PR8 influenza, CD4 T cells are isolated 2-4 months postinfection, and the frequency of influenza-specific memory CD4 T cells is determined by ELISPOT. CD4 T cells from previously primed mice are transferred into BALB/c hosts to generate "polyclonal flu-memory" mice with a full complement of endogenous T cells.
[0444] Primary and secondary responses to influenza virus are tested by infecting naive BALB/c mice or BALB/c-HA memory mice and BALB/c `polyclonal flu-memory mice` with sublethal or lethal doses of PR8 influenza virus by intranasal administration.
[0445] Mice are treated with any one of C1ORF32 protein fragments and/or fusion proteins thereof or with mIgG2a control before and following influenza challenge. Weight loss and mortality will be monitored daily. Six days after the challenge, viral content in the bronchoalveolar lavage (BAL) is analyzed by collecting lavage liquid and testing the supernatant for viral content by determining the tissue culture infectious dose 50% (TCID50) in MDCK cells. In addition, lung tissue histopathology is performed.
[0446] To test the effect of any one of C1ORF32 protein fragments and/or fusion proteins thereof on T cell expansion BALB/c or BALB/c-HA memory mice or BALB/c `polyclonal flu-memory mice` are infected as above and administered with BrdU (1 mg/dose) on days 3, 4 and 5 post infection. On day 6, spleen and lung are harvested and BrdU incorporation is estimated. Cytokine production by lung memory CD4 T cells during influenza challenge is also studied in HA-specific memory CD4 T cells stimulated in vitro with HA peptide in the presence of any one of C1ORF32 protein fragments and/or fusion proteins thereof or IgG2a for 18 hours.
Example 17
[0447] Assessment of the Effect of any One of C1ORF32 Protein Fragments and/or Fusion Proteins Thereof on Primary and Secondary CD8 T Cell Response to Viral Infection in a Mouse Model of Influenza
[0448] The effect of any one of C1ORF32 protein fragments and/or fusion proteins thereof on primary CD8 T cell responses to influenza virus is studied according to methods as described in the literature (Hendriks et al., J Immunol 2005; 175; 1665-1676; Bertram et al., J Immunol. 2004; 172:981-8) using C57BL/6 mice infected with influenza A HKx31 by intranasal or intraperitoneal administration. Any one of C1ORF32 protein fragments and/or fusion proteins thereof or mIgG2a control is administered during priming Animal weight loss and mortality is monitored daily. To follow virus-specific CD8+ T cells, MHC H-2Db tetramers loaded with the major CD8 T cell epitope, the NP.sub.366-374 peptide are used. Virus-specific H-2D.sup.b/NP366-374+CD8+ T cells in the lung, draining lymph nodes, and spleen are expected to reach a peak around day 8-10 post infection and decline thereafter to only 1.5% virus-specific CD8 T cells (Hendriks et al J Immunol 2005; 175; 1665-1676; Bertram et al., J Immunol. 2002; 168:3777-85; Bertram et a., J Immunol. 2004; 172:981-8). Thus, mice are sacrificed at days 8 and 21 post infection, and virus-specific CD8 T cell numbers is evaluated in the lung, draining lymph nodes and spleen. Viral clearance is assessed. CD8 T cell responses are evaluated in spleen cell suspensions, and include intracellular IFN-.gamma. staining and CTL activity, as previously described (Bertram et a., J Immunol. 2004; 172:981-8) and detailed below.
[0449] Cells are surface-stained with FITC-conjugated anti-mouse CD62L, PE-conjugated anti-mouse CD8 to measure CD8+ activated T cells (or anti-mouse CD4 to follow CD4+ cells). In addition to these Abs, allophycocyanin-labeled tetramers consisting of murine class I MHC molecule H-2D.sup.b, .beta..sub.2-microglobulin, and influenza NP peptide, NP.sub.366-374 are used to measure influenza-specific CD8 T cells. For intracellular IFN-.gamma. staining, cell suspensions are restimulated in culture medium for 6 h at 37.degree. C. with 1 .mu.M NP366-374 peptide and GolgiStop (BD PharMingen, San Diego, Calif.). Cells are then harvested, resuspended in PBS/2% FCS/azide, and surface stained with PE-anti-CD8 and FITC-anti-CD62L as described above. After surface staining, cells will be fixed in Cytofix/Cytoperm solution (BD PharMingen) and then stained with allophycocyanin-conjugated antimouse IFN-.gamma. diluted in 1.times. perm/wash solution (BD PharMingen). Samples are analyzed by Flow Cytometry.
[0450] For cytotoxicity assays (CTL responses) splenocytes from influenza-infected mice are incubated for 2 h at 37.degree. C. to remove adherent cells. Serial 3-fold dilutions of effectors are assayed for anti-influenza NP.sub.366-374-specific CTL activity against .sup.51Cr-labeled EL4 cells pulsed with 50 .mu.M NP.sub.366-374 peptide for 6 h as described by Bertram et al 2002 and Bertram et al 2004.
[0451] At 3 weeks postinfection, some mice are rechallenged with the serologically distinct influenza A/PR8/34 (PR8), which shares the NP gene with influenza A HKx31, but differs in hemagglutinin and neuraminidase, so that neutralizing Abs do not limit the secondary CTL response. Mice are sacrificed at days 5 & 7 following virus rechallenge, and virus-specific CD8 T cell numbers is evaluated in the lung, draining lymph nodes and spleen as described by Hendriks et al and Bertram et al (Hendriks et al., J Immunol 2005; 175; 1665-1676; Bertram et al., J Immunol. 2004; 172:981-8) and detailed above. Secondary CD8 T cell responses, including intracellular IFN-.gamma. staining and CTL activity, are evaluated in spleen cell suspensions of mice at days 5 & 7 following virus rechallenge, as described above.
[0452] To determine the effect of any one of C1ORF32 protein fragments and/or fusion proteins thereof on expansion and accumulation of memory CD8+ T cells during the secondary response, adoptive transfer experiments are performed, according to methods previously described (Hendriks et al., J Immunol 2005; 175; 1665-1676; Bertram et al., J Immunol. 2004; 172:981-8): mice are immunized with influenza influenza A HKx31. Twenty-one days later, T cells are purified from spleens on mouse T cell enrichment immunocolumns (Cedarlane Laboratories, Hornsby, Ontario, Canada) and labeled with CFSE (alternatively Thy1.1 congenic mice are used as recipients). Equal numbers of tetramer-positive T cells are injected through the tail vein of recipient mice. Mice are rechallenged with influenza virus as described above, and 7 days later splenocytes are evaluated for donor virus-specific CD8 T cells, as detailed above.
Example 18
[0453] Assessment of Protein Expression in Exhausted T Cells, and the Binding and Effect of any One of C1ORF32 Protein Fragments and/or Fusion Proteins Thereof on Reversing Exhausted T Cell Phenotype
[0454] Memory CD8 T-cell differentiation proceeds along distinct pathways after an acute versus a chronic viral infection (Klenerman and HillNat Immunol 6, 873-879, 2005). Memory CD8 T cells generated after an acute viral infection are highly functional and constitute an important component of protective immunity. In contrast, chronic infections are often characterized by varying degrees of functional impairment of virus-specific T-cell responses, and this defect is a principal reason for the inability of the host to eliminate the persisting pathogen. Although functional effector T cells are initially generated during the early stages of infection, they gradually lose function during the course of the chronic infection leading to exhausted phenotype characterized by impaired T cell functionality.
[0455] Study I. The Effect of any One of C1ORF32 Protein Fragments and/or Fusion Proteins Thereof on Clearance of Viral Infection and on T Cell Functions During Acute and Chronic Viral Infection.
[0456] The effect of any one of C1ORF32 protein fragments and/or fusion proteins thereof on acute and chronic viral infection is evaluated in a mouse model of infection with LCMV (lymphocytic chroriomeningitis virus) according to methodology described by Wherry et al J. Virol. 77: 4911-4927, 2003 and Barber et al Nature, 2006, and detailed below.
[0457] Two LCMV strains that can cause either acute or chronic infections in adult mice are used; the Armstrong strain which is cleared within a week, and the clone 13 strain which establishes a persistent infection that can last for months. As these two strains differ in only two amino acids, preserving all known T cell epitopes, it is possible to track the same CD8 T cell responses after an acute or chronic viral infection. In contrast to the highly robust memory CD8 T cells generated after an acute Armstrong infection, LCMV-specific CD8 T cells become exhausted during a persistent clone 13 infection (Wherry et al J. Virol. 77: 4911-4927, 2003; Barber et al., Nature. 2006; 439:682-7).
[0458] Mice are infected with 2.times.10.sup.5 PFU of Armstrong strain of LCMV intraperitoneally to initiate acute infection or 2.times.10.sup.6 PFU of C1-13 intravenously to initiate chronic infection. Mice are treated i.p. with any one of C1ORF32 protein fragments and/or fusion proteins thereof or with mIgG2a control, and with specific anti-C1ORF32 protein--antibody, or an isotype control.
[0459] The mice are monitored for numbers of virus specific CD8 T cells in the spleen, using virus-specific MHC tetramer epitopes, such as D.sup.bNP.sub.396-404 and D.sup.bGP.sub.33-41 which differ in acute or chronic infections. CD8 T cell functional assays, such as intracellular cytokines levels and CTL activity, are carried out as described by Wherry et al J. Virol. 77: 4911-4927, 2003, and similarly to those described in Example 40. Additional assays include production by splenocytes after stimulation with virus specific epitopes; and assessment of viral titers in the serum and in the spleen, liver, lung and kidney (Wherry et al J. Virol. 77: 4911-4927, 2003; Barber et al., Nature. 2006; 439:682-7).
[0460] Study II. Assessment of C1ORF32 Protein Expression on Exhausted T Cells and Binding of any One of C1ORF32 Protein Fragments and/or Fusion Proteins Thereof to Exhausted T Cells in Order to Evaluate Regulation of these Proteins or their Counterpart Receptors During Exhaustion of T Cells:
[0461] T cells are isolated from mice with chronic LCMV infection induced with C1-13 strain. The cells are co-stained with fluorescently labeled anti-PD-1 Ab as positive control (PD-1 is highly expressed by exhausted T cells) and biotinylated C1ORF32 protein fragments and/or fusion proteins thereof or biotinylated anti-C1ORF32 protein antibodies, and respective isotype control. Binding is detected by FACS analysis using fluorescently labeled streptavidin.
Example 19
Assessment of any One of C1ORF32 Protein Fragments Expression in Follicular Helper T (Tfh) Cells and the Binding of Ig Fusion Proteins to TFH Cells
[0462] Follicular helper T (Tfh) cells are a subset of CD4+ T cells specialized in B cell help (reviewed by Crotty, Annu. Rev. Immunol. 29: 621-663, 2011). Tfh cells migrate into B cell follicles within lymph nodes, and interact with cognate B cells at the T cell-B cell border and subsequently induce germinal center B cell differentiation and germinal center formation within the follicle (Reviewed by Crotty, Annu. Rev. Immunol. 29: 621-663, 2011). The requirement of Tfh cells for B cell help and T cell-dependent antibody responses, indicates that this cell type is of great importance for protective immunity against various types of infectious agents, as well as for rational vaccine design.
[0463] Tfh cells are readily identifiable at the peak of the CD4+ T cell response to an acute lymphocytic choriomeningitis virus (LCMV) infection as CXCR5.sup.hiSLAM.sup.loBTLA.sup.hiPD1.sup.hiBcl6.sup.+ virus-specific CD4+ T cells (Choi et al 2011, Immunity 34: 932-946). T cells are isolated from mice with acute LCMV infection induced with 2.times.10.sup.5 PFU of Armstrong strain of LCMV administered intraperitoneally. The cells are co-stained with fluorescently labeled antibodies for markers of Tfh (CXCR5, PD1, BTLA, Bcl6) which are highly expressed by Tfh cells, and biotinylated C1ORF32 protein fragments and/or fusion proteins thereof or biotinylated antibodies specific for C1ORF32 proteins, and respective isotype controls. Binding of Fc fused protein or antibody is detected by FACS analysis using fluorescently labeled streptavidin. An appropriate response is seen.
Example 20
[0464] Assessment of the Effect of any One of C1ORF32 Protein Fragments and/or Fusion Proteins Thereof on Follicular Helper T (Tfh) Cells Generation and Activity
[0465] In order to investigate the effect of any one of C1ORF32 protein fragments and/or fusion proteins thereof on Tfh differentiation and development of B cell immunity in vivo, C57BL/6 are treated with any one of C1ORF32 protein fragments and/or fusion proteins thereof and an isotype control throughout the course of an acute viral infection with Armstrong strain of LCMV (lymphocytic choriomeningitis virus). Tfh differentiation and Bcl6 protein expression is assessed by FACS analysis as described by Eto et al 2011 (PLoS One 6: e17739). Splenocytes are analyzed 8 days following LCMV infection, Tfh generation)(CD44.sup.hiCXCR.sup.5hiSLAM.sup.lo and Bcl6 expression is evaluated by FACS analysis. In addition, the effect of any one of C1ORF32 protein fragments and/or fusion proteins thereof on antigen-specific B cell responses is evaluated as described by Eto et al 2011 (PLoS One 6: e17739), including titers of anti-LCMV IgG in the serum at 8 days following LCMV infection, and quantitation by FACS analysis of plasma cell (CD138.sup.+IgD.sup.-) development at 8 days post-infection, gated on CD19+ splenocytes.
Example 21
[0466] The Effect of any One of C1ORF32 Protein Fragments and/or Fusion Proteins Thereof in Modulation of Type 1 Diabetes in Nod Mice, CD28-KO NOD, and B7-2-KO NOD
[0467] The effect of any one of C1ORF32 protein fragments and/or fusion proteins thereof is studied in a widely used mouse model of type 1 diabetes: nonobese diabetic (NOD) mice which develop spontaneous In NOD mice, spontaneous insulitis, the hallmark pathologic lesion, evolves through several characteristic stages that begin with peri-insulitis and end with with invading and destructive insulitis and overt diabetes. Peri-insulitis is first observed at 3-4 wk of age, invading insulitis at 8-10 wk, and destructive insulitis appears just before the onset of clinical diabetes, with the earliest cases at 10-12 wk. At 20 wk of age, 70-80% of female NOD mice become diabetic (Ansari et al 2003 J. Exp. Med. 198: 63-69).
[0468] Two KO mice: CD-28-KO NOD mice and B7-1/B7-2 double KO NOD mice, --which develop accelerated diabetes (Lenschow et al 1996 Immunity 5: 285-293; Salomon et al 2000 Immunity 12: 431-440), are also used.
[0469] Study I: NOD mice are treated with any one of C1ORF32 protein fragments and/or fusion proteins thereof early and late phases during the evolution of diabetes, before or after disease onset, to examine the effects of these compounds on disease pathogenesis and to demonstrate that such treatment reduces disease onset and ameliorates pathogenesis. To study the effect on insulitis, blood glucose levels are measured 3 times/week, for up to 25 weeks (Ansari et al 2003 J. Exp. Med. 198: 63-69).
[0470] Mechanism of disease modification and mode of action is studied by experimental evaluation of individual immune cell types: pancreas, pancreatic LNs and spleen will be harvested to obtain Tregs, Th subtypes and CD8 T cells, DCs and B cells. Effect on cytokines secretion from cells isolated from pancreas, pancreatic LN and spleen is analysed, focused on IFNg, IL-17, IL-4, IL-10 and TGFb. Upon effect of the tested compounds, the mechanism of disease modification is studied by examination of individual immune cell types (including Tregs, Th subtypes and CD8 T cells, DCs and B cells); cytokines (IFNg, IL-17, IL-4, IL-10 and TGFb) and histology. Histologycal analysis of the pancreas is carried out to compare the onset of insulitis, and the lymphocyte infiltration.
[0471] Study II--the Effect of any One of C1ORF32 Protein Fragments and/or Fusion Proteins Thereof in Modulation of Type 1 Diabetes in Adoptive Transfer Model
[0472] To further investigate the mode of action of the Ig fusion proteins, an adoptive transfer model of diabetes is used. T cells from diabetic or prediabetic NOD donors are transfered to NOD SCID recipient mice. These mice are monitored for development of diabetes. The urine glucose and blood glucose, and assess histology of the pancreas, and T cell responses are monitored as described in the previous example.
[0473] Study III--Diabetes is also induced by the transfer of activated CD4+CD62L+CD25-BDC2.5 T cells (transgenic for TCR recognizing islet specific peptide 1040-p31 activated by incubation with 1040-p31) to NOD recipients. Mice are treated with any one of C1ORF32 protein fragments and/or fusion proteins thereof, control mIgG2a or positive control. Treatments begin 1 day following transfer. Mice are followed for glucose levels 10-28 days post transfer (Bour-Jordan et al., J Clin Invest. 2004; 114(7):979-87).
[0474] Seven days post treatment pancreas, spleen, pancreatic LN and peripheral lymph node cells are extracted and examined for different immune cell populations. In addition, recall responses are measured by testing ex-vivo proliferation and cytokine secretion in response to p31 peptide.
[0475] C1ORF32 protein fragments and/or fusion proteins thereof prevent or reduce disease onset or the severity thereof in the above studies.
Example 22
[0476] The Effect of any One of C1ORF32 Protein Fragments and/or Fusion PROTEINS THEREOF IN LUPUS MOUSE MODELS
[0477] Study I: The lupus-prone mouse model, (NZB.times.NZW)F1 (B/W) is used. Cyclophosphamide (CTX) is the primary drug used for diffuse proliferative glomerulonephritis in patients with renal lupus, Daikh and Wofsy reported that combination treatment with CTX and CTLA4-Ig was more effective than either agent alone in reducing renal disease and prolonging survival of NZB/NZW Fl lupus mice with advanced nephritis (Daikh and Wofsy, J Immunol, 166(5):2913-6 (2001)). In the proof-of-concept study, treatments with any one of C1ORF32 protein fragments and/or fusion proteins thereof and CTX either alone or in combination are tested.
[0478] Blood samples are collected 3 days before the protein treatment and then every other week during and after treatments for plasma anti-dsDNA autoantibody analysis by ELISA. Glomerulonephritis is evaluated by histological analysis of kidneys. Proteinuria is measured by testing fresh urine samples using urinalysis dipsticks.
[0479] C1ORF32 protein fragments and/or fusion proteins thereof have a beneficial effect in at least ameliorating lupus nephtiris.
[0480] Study II: The NZM2410-derived B6.Sle1.S1e2.S1e3 mouse model of SLE is used. NZM2410 is a recombinant inbred strain produced from NZB and NZW that develops a highly penetrant lupus-like disease with an earlier onset of disease (Blenman et al 2006 Lab. Invest. 86: 1136-1148). The effect of any one of C1ORF32 protein fragments and/or fusion proteins thereof is studied in this model by assessment of proteinuria and autoantibodies as described above.
[0481] Study III: An induced lupus model is used. This model is based on chronic graft-vs-host (cGVH) disease induced by the transfer of Ia-incompatible spleen cells from one normal mouse strain (such as B6.C-H2(bm12)/KhEg (bm12)) to another (such as C57BL/6), which causes an autoimmune syndrome resembling systemic lupus erythematosus (SLE), including anti-double-stranded DNA (anti-dsDNA) autoantibodies and immune complex-type proliferative glomerulonephritis (Appleby et al Clin. Exp. Immunol. 1989 78: 449-453); Eisenberg and Choudhury 2004 Methods Mol. Med. 102:273-284).
[0482] Lupus is induced in this model following injection of spleen cells from bm12 mice into C57BL/6 recipients. The effect any one of C1ORF32 protein fragments and/or fusion proteins thereof is studied in this model by assessment of proteinuria and autoantibodies as described above. T cell and responses B cell responses will also be evaluated.
[0483] Study IV: The MRL/lpr lupus prone mouse model is used. The effect of any one of C1ORF32 protein fragments and/or fusion proteins thereof is studied in this model by assessment of proteinuria and autoantibodies as described above.
Example 23
[0484] The Effect of any of C1ORF32 Protein Fragments and/or Fusion Proteins Thereof in the Control of Intestinal Inflammation.
[0485] An adoptive transfer mouse model of colitis in mice is used, whereby Transfer of CD45RB.sup.high-CD4.sup.+ naive T cells from BALB/c mice to syngeneic SCID mice leads to the development of an IBD-like syndrome by 6-10 wks after T cell reconstitution, similar to human Crohn's disease.
[0486] SCID mice are reconstituted by i.p. injection of syngeneic CD45RB.sup.high-CD4.sup.+ T cells either alone or cotransferred with syngeneic CD45RB.sup.low-CD4.sup.+ or CD25.sup.+CD4.sup.+ cells (4.times.10.sup.5/mouse of each cell population) (Liu et al., J Immunol. 2001; 167(3): 1830-8). Colitic SCID mice, reconstituted with syngeneic CD45RB.sup.highCD4.sup.+ T cells from spleen of normal mice, are treated i.p. with any one of C1ORF32 protein fragments and/or fusion proteins thereof or Ig isotype control, twice a week starting at the beginning of T cell transfer up to 8 wk. All mice are monitored weekly for weight, soft stool or diarrhea, and rectal prolapse. All mice are sacrificed 8 wk after T cell transfer or when they exhibit a loss of. 20% of original body weight. Colonic tissues are collected for histologic and cytologic examinations. C1ORF32 protein fragments and/or fusion proteins thereof have a beneficial effect in at least ameliorating inflammatory bowel disease.
Example 24
[0487] The Effect of any One of C1ORF32 Protein Fragments and/or Fusion Proteins Thereof in Mouse Model of Psoriasis
Study I: Establishment of Psoriasis SCID Xenograft Model.
[0488] Human psoriasis plaques are transplanted on to the SCID mice. Shave biopsies (2.5_2.5 cm) are taken from patients with generalized plaque psoriasis involving 5-10% of the total skin that did not receive any systemic treatment for psoriasis or phototherapy for 6 months and did not receive any topical preparations other than emollients for 6 weeks. The biopsies are obtained from active plaques located on the thigh or arm. Each piece of biopsy is divided into four equal parts of approximately 1 cm2 size. Each piece is transplanted to a separate mouse.
[0489] Under general anesthesia, a graft bed of approximately 1 cm2 is created on the shaved area of the back of a 7- to 8-week-old CB17 SCID mouse by removing a full-thickness skin sample, keeping the vessel plexus intact on the fascia covering the underlying back muscles. The partial thickness human skin obtained by shave biopsy is then orthotopically transferred onto the graft bed. Nexaband, a liquid veterinary bandage (Veterinary Products Laboratories, Phoenix, Ariz.) is used to attach the human skin to the mouse skin and an antibiotic ointment (bacitracin) is applied. Mice are treated intraperitoneally three times per week for 4 weeks with any one of C1ORF32 protein fragments and/or fusion proteins thereof, isotype control or CTLA4-Ig (positive control).
[0490] Punch biopsies (2 mm) are obtained on day 0 (before treatment) and day 28 (after treatment) of the study period. Biopsies are snap frozen and cryosections for histopathological and immunohistochemical studies. Therapeutic efficacy is determined by comparing pre- and post treatment data: (i) rete peg lengths to determine the effect on epidermal thickness and (ii) the level of lymphomononuclear cell infiltrates to determine the effect on inflammatory cellular infiltrates. (Raychaudhuri et al. 2008, J Invest Dermatol.; 128(8):1969-76; Boehncke et al., 1999 Arch Dermatol Res 291:104-6).
[0491] C1ORF32 protein fragments and/or fusion proteins thereof have a beneficial effect in at least ameliorating psoriasis.
Study II: The Effect of any One of C1ORF32 Protein Fragments and/or Fusion Proteins Thereof in Psoriasis and Colitis Model by Adoptive Transfer of CD45RB.sub.HI Cd4+ T Cells in SCID Mice
[0492] Immunocompromised mice are injected intraveneously (i.v.) with 0.3_10.sup.6 CD4+CD45RBhi cells. On the day following the adoptive transfer of cells, mice are injected intraperitoneally (i.p.) with 10 microg of staphylococcal enterotoxin B (Davenport et al., Int Immunopharmacol. 2002 April; 2(5):653-72). Recipient mice are treated with any one of C1ORF32 protein fragments and/or fusion proteins thereof, isotype control or CTLA4-Ig (positive control). Mice are evaluated once a week for 8 weeks for weight loss and presence of skin lesions.
Example 25
[0493] The Effect of any One of C1ORF32 Protein Fragments and/or Fusion Proteins Thereof in Modulating Transplant Rejection.
[0494] Study I: THE EFFECT OF any One of C1ORF32 Protein Fragments and/or Fusion Proteins Thereof in a Model of Allogeneic Islet Transplantation in Diabetic Mice.
[0495] To test the effect of any one of C1ORF32 protein fragments and/or fusion proteins thereof on transplant rejection, a model of allogeneic islet transplantation is used. Diabetes is induced in C57BL/6 mice by treatment with streptozotocin. Seven days later, the mice are transplanted under the kidney capsule with pancreatic islets which are isolated from BALB/c donor mice. Recipient mice are treated with any one of C1ORF32 protein fragments and/or fusion proteins thereof or with mIgG2a as a negative control. Tolerance with ECDI-fixed donor splenocytes is used as the positive control for successful modulation islet graft rejection. Recipient mice are monitored for blood glucose levels as a measure of graft acceptance/rejection (Luo et al., PNAS, Sep. 23, 2008.sub.-- vol. 105_no. 38_14527-14532).
[0496] Study II: the Effect of any One of c1ORF32 Protein Fragments and/or Fusion Proteins Thereof in the Hya-Model of Skin Graft Rejection.
[0497] In humans and certain strains of laboratory mice, male tissue is recognized as non-self and destroyed by the female immune system via recognition of histocompatibility-Y chromosome encoded antigens (Hya). Male tissue destruction is thought to be accomplished by cytotoxic T lymphocytes in a helper-dependent manner.
[0498] To test the effect of any one of C1ORF32 protein fragments and/or fusion proteins thereof on transplanatation, the Hya model system is used, in which female C57BL/6 mice receive tail skin grafts from male C57BL/6 donors.
[0499] In this study, female C57BL/6 mice are engrafted with orthotopic split-thickness tail skin from age matched male C57BL/6 mice. The mice are treated with any one of C1ORF32 protein fragments and/or fusion proteins thereof, isotype control mIgG2a Immunodominant Hya-encoded CD4 epitope (Dby) attached to female splenic leukocytes (Dby-SP) serve as positive control for successful modulation of graft rejection (Martin et al., J Immunol. 2010 Sep. 15; 185(6): 3326-3336). Skin grafts are scored daily for edema, pigment loss and hair loss. Rejection is defined as complete hair loss and more than 80% pigment loss. In addition, T cell recall responses of cells isolated from spleens and draining lymph nodes at different time points are studied in response to CD4 specific epitope (Dby), CD8 epitopes (Uty and Smcy) or irrelevant peptide (OVA 323-339) while anti CD3 stimulation is used as positive control for prolifereation and cytokine secretion.
[0500] Study III: The effect of any one of C1ORF32 protein fragments and/or fusion proteins thereof on graft rejection is studied in a murine model of syngeneic bone marrow cells transplantation using the Hya model system described above. Male hematopoietic cells expressing the CD45.1 marker are transplanted to female host mice which express the CD45.2 congenic marker. Female hosts are treated with any one of C1ORF32 protein fragments and/or fusion proteins thereof or with isotype control mIgG2a. The female hosts are followed over time and the presence of CD45.1+ cells is monitored.
Example 26
[0501] The Effect of C1ORF32 Protein Fragments and/or Fusion Proteins Thereof in Treatment of Alopecia Areata.
[0502] To induce alopecia areata (AA), lesional skin from C3H/HeJ mice that had developed spontaneous AA lesions is grafted onto the back of non-affected C3H/HeJ mice, as described previously (McElwee et al., 1998). Breifly, up to six grafts .about.1-1.5 cm in diameter are aseptically removed from each donor by pinch cutting. The grafts are placed in sterile PBS while the recipient mice are prepared for transplantation. Recipient mice are anestized and a circular pice of skin .about.1.5 cm in diameter is aseptically removed from the dorsal anto-posterior midline and replaced with a donor skin graft. The graft is oriented 180.degree. from normal in order to have the hair growing in opposite direction to the reciepient hair for easy identification. Four to seven weeks after grafting the recipients develop initial hair loss. Recipient mice are treated with any one of C1ORF32 protein fragments and/or fusion proteins thereof, isotype control or CTLA4-Ig (positive control). Morphological changes are examined and documented daily. Photographs are taken before treatment, and once per week during and after treatment. After completion of treatment, all mice are anesthesized, their dorsal skin is shaved and animals are sacrificed by cervical dislocation. Skin samples are taken for histopathological examination and immunohistochemistry.
[0503] It will be appreciated that various features of the invention which are, for clarity, described in the contexts of separate embodiments may also be provided in combination in a single embodiment. Conversely, various features of the invention which are, for brevity, described in the context of a single embodiment may also be provided separately or in any suitable sub-combination. It will also be appreciated by persons skilled in the art that the present invention is not limited by what has been particularly shown and described hereinabove.
Sequence CWU
1
1
19011407DNAHomo Sapiens 1ccggcggcgc gatccagccc ccggccccgc ctgcgcggcc
ggcccggcgg gcgctgcgcc 60cagggacgcc cggtgcccgc cgctccgccg ccgcccgctg
ccgcggggtg acagcgatcc 120ttctgttcca gccatttccc actttcctca ctccgtaatt
cggctgggaa gttggggaag 180atggataggg tcttgctgag gtggatttct ctcttctggc
taacagccat ggtcgaaggc 240cttcaggtca cagtgcccga caagaagaag gtggccatgc
tcttccagcc cactgtgctt 300cgctgccact tctcaacatc ctcccatcag cctgcagttg
tgcagtggaa gttcaagtcc 360tactgccagg atcgcatggg agaatccttg ggcatgtcct
ctacccgggc ccaatctctc 420agcaagagaa acctggaatg ggacccctac ttggattgtt
tggacagcag gaggactgtt 480cgagtagtag cttcaaaaca gggctcgact gtcaccctgg
gagatttcta caggggcaga 540gagatcacga ttgttcatga tgcagatctt caaattggaa
agcttatgtg gggagacagc 600ggactctatt actgtattat caccacccca gatgacctgg
aggggaaaaa tgagggctca 660ctgggactgc tggtgttggg caggacaggg ctgcttgctg
atctcttgcc cagttttgct 720gtggagatta tgccagagtg ggtgtttgtt ggcctggtgc
tcctgggcgt cttcctcttc 780ttcgtcctgg tggggatctg ctggtgccag tgctgccctc
acagctgctg ctgctatgtc 840cgctgcccat gctgcccaga ttcctgctgg tgccctcaag
cctgtgagta cagtgaccgc 900tggggagaca gagcgatcga gagaaatgtc tacctctcta
cctgacagct gtgtgcgctg 960ggttcctcct ccacctcctg tcctgccacc cccaagattg
gtcattccag actcttctcc 1020gctgggtgcc cctggcctca gggatgacca ttctcatttg
ccttttcacc tacatacacc 1080tctccacact tcttatccat atctatcact ccatgcattt
ggaattctca tggacactat 1140tgataaaatg gaagggcagg tttggcgtgg tgaggttgtg
gtgtaagact gttccctctc 1200cctggggcat tcaaactaga ggaaaccttc tctggtcgtt
cccttcccat gcagagaagt 1260tcctttttat atgagaagag tgtgcaaact gtggcctttg
ggcacccacc cagccacaga 1320tttgttttat ttactcccat gatgacatgg gccacaatag
ggcctagttc ttatttgagg 1380attcacaatt tttaccttac tggccaa
140721350DNAHomo Sapiens 2ccggcggcgc gatccagccc
ccggccccgc ctgcgcggcc ggcccggcgg gcgctgcgcc 60cagggacgcc cggtgcccgc
cgctccgccg ccgcccgctg ccgcggggtg acagcgatcc 120ttctgttcca gccatttccc
actttcctca ctccgtaatt cggctgggaa gttggggaag 180atggataggg tcttgctgag
gtggatttct ctcttctggc taacagccat ggtcgaaggc 240cttcaggtca cagtgcccga
caagaagaag gtggccatgc tcttccagcc cactgtgctt 300cgctgccact tctcaacatc
ctcccatcag cctgcagttg tgcagtggaa gttcaagtcc 360tactgccagg atcgcatggg
agaatccttg ggcatgtcct ctacccgggc ccaatctctc 420agcaagagaa acctggaatg
ggacccctac ttggattgtt tggacagcag gaggactgtt 480cgagtagtag cttcaaaaca
gggctcgact gtcaccctgg gagatttcta caggggcaga 540gagatcacga ttgttcatga
tgcagatctt caaattggaa agcttatgtg gggagacagc 600ggactctatt actgtattat
caccacccca gatgacctgg aggggaaaaa tgagggctca 660ctgggactgc tggtgttgga
gtgggtgttt gttggcctgg tgctcctggg cgtcttcctc 720ttcttcgtcc tggtggggat
ctgctggtgc cagtgctgcc ctcacagctg ctgctgctat 780gtccgctgcc catgctgccc
agattcctgc tggtgccctc aagcctgtga gtacagtgac 840cgctggggag acagagcgat
cgagagaaat gtctacctct ctacctgaca gctgtgtgcg 900ctgggttcct cctccacctc
ctgtcctgcc acccccaaga ttggtcattc cagactcttc 960tccgctgggt gcccctggcc
tcagggatga ccattctcat ttgccttttc acctacatac 1020acctctccac acttcttatc
catatctatc actccatgca tttggaattc tcatggacac 1080tattgataaa atggaagggc
aggtttggcg tggtgaggtt gtggtgtaag actgttccct 1140ctccctgggg cattcaaact
agaggaaacc ttctctggtc gttcccttcc catgcagaga 1200agttcctttt tatatgagaa
gagtgtgcaa actgtggcct ttgggcaccc acccagccac 1260agatttgttt tatttactcc
catgatgaca tgggccacaa tagggcctag ttcttatttg 1320aggattcaca atttttacct
tactggccaa 13503639PRTHomo Sapiens
3Met Asp Arg Val Leu Leu Arg Trp Ile Ser Leu Phe Trp Leu Thr Ala1
5 10 15Met Val Glu Gly Leu Gln
Val Thr Val Pro Asp Lys Lys Lys Val Ala 20 25
30Met Leu Phe Gln Pro Thr Val Leu Arg Cys His Phe Ser
Thr Ser Ser 35 40 45His Gln Pro
Ala Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp 50
55 60Arg Met Gly Glu Ser Leu Gly Met Ser Ser Thr Arg
Ala Gln Ser Leu65 70 75
80Ser Lys Arg Asn Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser
85 90 95Arg Arg Thr Val Arg Val
Val Ala Ser Lys Gln Gly Ser Thr Val Thr 100
105 110Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile Thr Ile
Val His Asp Ala 115 120 125Asp Leu
Gln Ile Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr 130
135 140Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu Gly
Lys Asn Glu Asp Ser145 150 155
160Val Glu Leu Leu Val Leu Gly Arg Thr Gly Leu Leu Ala Asp Leu Leu
165 170 175Pro Ser Phe Ala
Val Glu Ile Met Pro Glu Trp Val Phe Val Gly Leu 180
185 190Val Leu Leu Gly Val Phe Leu Phe Phe Val Leu
Val Gly Ile Cys Trp 195 200 205Cys
Gln Cys Cys Pro His Ser Cys Cys Cys Tyr Val Arg Cys Pro Cys 210
215 220Cys Pro Asp Ser Cys Cys Cys Pro Gln Ala
Leu Tyr Glu Ala Gly Lys225 230 235
240Ala Ala Lys Ala Gly Tyr Pro Pro Ser Val Ser Gly Val Pro Gly
Pro 245 250 255Tyr Ser Ile
Pro Ser Val Pro Leu Gly Gly Ala Pro Ser Ser Gly Met 260
265 270Leu Met Asp Lys Pro His Pro Pro Pro Leu
Ala Pro Ser Asp Ser Thr 275 280
285Gly Gly Ser His Ser Val Arg Lys Gly Tyr Arg Ile Gln Ala Asp Lys 290
295 300Glu Arg Asp Ser Met Lys Val Leu
Tyr Tyr Val Glu Lys Glu Leu Ala305 310
315 320Gln Phe Asp Pro Ala Arg Arg Met Arg Gly Arg Tyr
Asn Asn Thr Ile 325 330
335Ser Glu Leu Ser Ser Leu His Glu Glu Asp Ser Asn Phe Arg Gln Ser
340 345 350Phe His Gln Met Arg Ser
Lys Gln Phe Pro Val Ser Gly Asp Leu Glu 355 360
365Ser Asn Pro Asp Tyr Trp Ser Gly Val Met Gly Gly Ser Ser
Gly Ala 370 375 380Ser Arg Gly Pro Ser
Ala Met Glu Tyr Asn Lys Glu Asp Arg Glu Ser385 390
395 400Phe Arg His Ser Gln Pro Arg Ser Lys Ser
Glu Met Leu Ser Arg Lys 405 410
415Asn Phe Ala Thr Gly Val Pro Ala Val Ser Met Asp Glu Leu Ala Ala
420 425 430Phe Ala Asp Ser Tyr
Gly Gln Arg Pro Arg Arg Ala Asp Gly Asn Ser 435
440 445His Glu Ala Arg Gly Gly Ser Arg Phe Glu Arg Ser
Glu Ser Arg Ala 450 455 460His Ser Gly
Phe Tyr Gln Asp Asp Ser Leu Glu Glu Tyr Tyr Gly Gln465
470 475 480Arg Ser Arg Ser Arg Glu Pro
Leu Thr Asp Ala Asp Arg Gly Trp Ala 485
490 495Phe Ser Pro Ala Arg Arg Arg Pro Ala Glu Asp Ala
His Leu Pro Arg 500 505 510Leu
Val Ser Arg Thr Pro Gly Thr Ala Pro Lys Tyr Asp His Ser Tyr 515
520 525Leu Gly Ser Ala Arg Glu Arg Gln Ala
Arg Pro Glu Gly Ala Ser Arg 530 535
540Gly Gly Ser Leu Glu Thr Pro Ser Lys Arg Ser Ala Gln Leu Gly Pro545
550 555 560Arg Ser Ala Ser
Tyr Tyr Ala Trp Ser Pro Pro Gly Thr Tyr Lys Ala 565
570 575Gly Ser Ser Gln Asp Asp Gln Glu Asp Ala
Ser Asp Asp Ala Leu Pro 580 585
590Pro Tyr Ser Glu Leu Glu Leu Thr Arg Gly Pro Ser Tyr Arg Gly Arg
595 600 605Asp Leu Pro Tyr His Ser Asn
Ser Glu Lys Lys Arg Lys Lys Glu Pro 610 615
620Ala Lys Lys Thr Asn Asp Phe Pro Thr Arg Met Ser Leu Val Val625
630 6354254PRTHomo Sapiens 4Met Asp Arg Val
Leu Leu Arg Trp Ile Ser Leu Phe Trp Leu Thr Ala1 5
10 15Met Val Glu Gly Leu Gln Val Thr Val Pro
Asp Lys Lys Lys Val Ala 20 25
30Met Leu Phe Gln Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser
35 40 45His Gln Pro Ala Val Val Gln Trp
Lys Phe Lys Ser Tyr Cys Gln Asp 50 55
60Arg Met Gly Glu Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu65
70 75 80Ser Lys Arg Asn Leu
Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser 85
90 95Arg Arg Thr Val Arg Val Val Ala Ser Lys Gln
Gly Ser Thr Val Thr 100 105
110Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala
115 120 125Asp Leu Gln Ile Gly Lys Leu
Met Trp Gly Asp Ser Gly Leu Tyr Tyr 130 135
140Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Gly
Ser145 150 155 160Leu Gly
Leu Leu Val Leu Gly Arg Thr Gly Leu Leu Ala Asp Leu Leu
165 170 175Pro Ser Phe Ala Val Glu Ile
Met Pro Glu Trp Val Phe Val Gly Leu 180 185
190Val Leu Leu Gly Val Phe Leu Phe Phe Val Leu Val Gly Ile
Cys Trp 195 200 205Cys Gln Cys Cys
Pro His Ser Cys Cys Cys Tyr Val Arg Cys Pro Cys 210
215 220Cys Pro Asp Ser Cys Trp Cys Pro Gln Ala Cys Glu
Tyr Ser Asp Arg225 230 235
240Trp Gly Asp Arg Ala Ile Glu Arg Asn Val Tyr Leu Ser Thr
245 2505254PRTHomo Sapiens 5Met Asp Arg Val Leu Leu Arg
Trp Ile Ser Leu Phe Trp Leu Thr Ala1 5 10
15Met Val Glu Gly Leu Gln Val Thr Val Pro Asp Lys Lys
Lys Val Ala 20 25 30Met Leu
Phe Gln Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser 35
40 45His Gln Pro Ala Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp 50 55 60Arg
Met Gly Glu Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu65
70 75 80Ser Lys Arg Asn Leu Glu
Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser 85
90 95Arg Arg Thr Val Arg Val Val Ala Ser Lys Gln Gly
Ser Thr Val Thr 100 105 110Leu
Gly Asp Phe Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala 115
120 125Asp Leu Gln Ile Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr 130 135
140Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser145
150 155 160Val Glu Leu Leu
Val Leu Gly Arg Thr Gly Leu Leu Ala Asp Leu Leu 165
170 175Pro Ser Phe Ala Val Glu Ile Met Pro Glu
Trp Val Phe Val Gly Leu 180 185
190Val Leu Leu Gly Val Phe Leu Phe Phe Val Leu Val Gly Ile Cys Trp
195 200 205Cys Gln Cys Cys Pro His Ser
Cys Cys Cys Tyr Val Arg Cys Pro Cys 210 215
220Cys Pro Asp Ser Cys Cys Cys Pro Gln Ala Cys Glu Tyr Ser Asp
Arg225 230 235 240Trp Gly
Asp Arg Ala Ile Glu Arg Asn Val Tyr Leu Ser Thr 245
2506235PRTHomo Sapiens 6Met Asp Arg Val Leu Leu Arg Trp Ile Ser
Leu Phe Trp Leu Thr Ala1 5 10
15Met Val Glu Gly Leu Gln Val Thr Val Pro Asp Lys Lys Lys Val Ala
20 25 30Met Leu Phe Gln Pro Thr
Val Leu Arg Cys His Phe Ser Thr Ser Ser 35 40
45His Gln Pro Ala Val Val Gln Trp Lys Phe Lys Ser Tyr Cys
Gln Asp 50 55 60Arg Met Gly Glu Ser
Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu65 70
75 80Ser Lys Arg Asn Leu Glu Trp Asp Pro Tyr
Leu Asp Cys Leu Asp Ser 85 90
95Arg Arg Thr Val Arg Val Val Ala Ser Lys Gln Gly Ser Thr Val Thr
100 105 110Leu Gly Asp Phe Tyr
Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala 115
120 125Asp Leu Gln Ile Gly Lys Leu Met Trp Gly Asp Ser
Gly Leu Tyr Tyr 130 135 140Cys Ile Ile
Thr Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Gly Ser145
150 155 160Leu Gly Leu Leu Val Leu Glu
Trp Val Phe Val Gly Leu Val Leu Leu 165
170 175Gly Val Phe Leu Phe Phe Val Leu Val Gly Ile Cys
Trp Cys Gln Cys 180 185 190Cys
Pro His Ser Cys Cys Cys Tyr Val Arg Cys Pro Cys Cys Pro Asp 195
200 205Ser Cys Trp Cys Pro Gln Ala Cys Glu
Tyr Ser Asp Arg Trp Gly Asp 210 215
220Arg Ala Ile Glu Arg Asn Val Tyr Leu Ser Thr225 230
23571287DNAArtificial SequenceSynthetic polynucleotide
7atggataggg tcttgctgag gtggatttct ctcttctggc taacagccat ggtcgaaggc
60cttcaggtca cagtgcccga caagaagaag gtggccatgc tcttccagcc cactgtgctt
120cgctgccact tctcaacatc ctcccatcag cctgcagttg tgcagtggaa gttcaagtcc
180tactgccagg atcgcatggg agaatccttg ggcatgtcct ctacccgggc ccaatctctc
240agcaagagaa acctggaatg ggacccctac ttggattgtt tggacagcag gaggactgtt
300cgagtagtag cttcaaaaca gggctcgact gtcaccctgg gagatttcta caggggcaga
360gagatcacga ttgttcatga tgcagatctt caaattggaa agcttatgtg gggagacagc
420ggactctatt actgtattat caccacccca gatgacctgg aggggaaaaa tgaggactca
480gtggaactgc tggtgttggg caggacaggg ctgcttgctg atctcttgcc cagttttgct
540gtggagatta tgggatccga gaacctgtac tttcagggca gcggcgagcc cagaggcccc
600accatcaagc cctgcccccc ctgcaagtgc ccagccccta acctgctggg cggacccagc
660gtgttcatct tcccccccaa gatcaaggac gtgctgatga tcagcctgag ccccatcgtg
720acctgcgtgg tggtggacgt gagcgaggac gaccccgacg tgcagatcag ctggttcgtg
780aacaacgtgg aggtgcacac cgcccagacc cagacccacc gggaggacta caacagcacc
840ctgcgggtgg tgtccgccct gcccatccag caccaggact ggatgagcgg caaagaattc
900aagtgcaagg tgaacaacaa ggacctgcct gcccccatcg agcggaccat cagcaagccc
960aagggcagcg tgagagcccc ccaggtgtac gtgctgcccc ctcccgagga agagatgacc
1020aagaaacagg tgaccctgac ctgcatggtg accgacttca tgcccgagga catctacgtg
1080gagtggacca acaacggcaa gaccgagctg aactacaaga acaccgagcc cgtgctggac
1140agcgacggca gctacttcat gtatagcaag ctgagagtcg agaagaaaaa ctgggtggag
1200cggaacagct acagctgcag cgtggtgcac gagggcctgc acaaccacca caccaccaag
1260agcttcagcc ggacccccgg caagtga
12878428PRTArtificial SequenceSynthetic polypeptide 8Met Asp Arg Val Leu
Leu Arg Trp Ile Ser Leu Phe Trp Leu Thr Ala1 5
10 15Met Val Glu Gly Leu Gln Val Thr Val Pro Asp
Lys Lys Lys Val Ala 20 25
30Met Leu Phe Gln Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser
35 40 45His Gln Pro Ala Val Val Gln Trp
Lys Phe Lys Ser Tyr Cys Gln Asp 50 55
60Arg Met Gly Glu Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu65
70 75 80Ser Lys Arg Asn Leu
Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser 85
90 95Arg Arg Thr Val Arg Val Val Ala Ser Lys Gln
Gly Ser Thr Val Thr 100 105
110Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala
115 120 125Asp Leu Gln Ile Gly Lys Leu
Met Trp Gly Asp Ser Gly Leu Tyr Tyr 130 135
140Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp
Ser145 150 155 160Val Glu
Leu Leu Val Leu Gly Arg Thr Gly Leu Leu Ala Asp Leu Leu
165 170 175Pro Ser Phe Ala Val Glu Ile
Met Gly Ser Glu Asn Leu Tyr Phe Gln 180 185
190Gly Ser Gly Glu Pro Arg Gly Pro Thr Ile Lys Pro Cys Pro
Pro Cys 195 200 205Lys Cys Pro Ala
Pro Asn Leu Leu Gly Gly Pro Ser Val Phe Ile Phe 210
215 220Pro Pro Lys Ile Lys Asp Val Leu Met Ile Ser Leu
Ser Pro Ile Val225 230 235
240Thr Cys Val Val Val Asp Val Ser Glu Asp Asp Pro Asp Val Gln Ile
245 250 255Ser Trp Phe Val Asn
Asn Val Glu Val His Thr Ala Gln Thr Gln Thr 260
265 270His Arg Glu Asp Tyr Asn Ser Thr Leu Arg Val Val
Ser Ala Leu Pro 275 280 285Ile Gln
His Gln Asp Trp Met Ser Gly Lys Glu Phe Lys Cys Lys Val 290
295 300Asn Asn Lys Asp Leu Pro Ala Pro Ile Glu Arg
Thr Ile Ser Lys Pro305 310 315
320Lys Gly Ser Val Arg Ala Pro Gln Val Tyr Val Leu Pro Pro Pro Glu
325 330 335Glu Glu Met Thr
Lys Lys Gln Val Thr Leu Thr Cys Met Val Thr Asp 340
345 350Phe Met Pro Glu Asp Ile Tyr Val Glu Trp Thr
Asn Asn Gly Lys Thr 355 360 365Glu
Leu Asn Tyr Lys Asn Thr Glu Pro Val Leu Asp Ser Asp Gly Ser 370
375 380Tyr Phe Met Tyr Ser Lys Leu Arg Val Glu
Lys Lys Asn Trp Val Glu385 390 395
400Arg Asn Ser Tyr Ser Cys Ser Val Val His Glu Gly Leu His Asn
His 405 410 415His Thr Thr
Lys Ser Phe Ser Arg Thr Pro Gly Lys 420
4259524DNAArtificial SequenceSynthetic polynucleotide 9gtgagtacag
tgaccgctgg ggagacagag cgatcgagag aaatgtctac ctctctacct 60gacagctgtg
tgcgctgggt tcctcctcca cctcctgtcc tgccaccccc aagattggtc 120attccagact
cttctccgct gggtgcccct ggcctcaggg atgaccattc tcatttgcct 180tttcacctac
atacacctct ccacacttct tatccatatc tatcactcca tgcatttgga 240attctcatgg
acactattga taaaatggaa gggcaggttt ggcgtggtga ggttgtggtg 300taagactgtt
ccctctccct ggggcattca aactagagga aaccttctct ggtcgttccc 360ttcccatgca
gagaagttcc tttttatatg agaagagtgt gcaaactgtg gcctttgggc 420acccacccag
ccacagattt gttttattta ctcccatgat gacatgggcc acaatagggc 480ctagttctta
tttgaggatt cacaattttt accttactgg ccaa
5241057DNAArtificial SequenceSynthetic polynucleotide 10gcaggacagg
gctgcttgct gatctcttgc ccagttttgc tgtggagatt atgccag
571161DNAArtificial SequenceSynthetic polynucleotide 11agtgggtgtt
tgttggcctg gtgctcctgg gcgtcttcct cttcttcgtc ctggtgggga 60t
611266DNAArtificial SequenceSynthetic polynucleotide 12ctgctggtgc
cagtgctgcc ctcacagctg ctgctgctat gtccgctgcc catgctgccc 60agattc
661320DNAArtificial SequenceSynthetic polynucleotide 13ctgctggtgc
cctcaagcct
2014164PRTArtificial SequenceSynthetic polypeptide 14Leu Gln Val Thr Val
Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1 5
10 15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser
Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu
35 40 45Ser Leu Gly Met Ser Ser Thr Arg
Ala Gln Ser Leu Ser Lys Arg Asn 50 55
60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65
70 75 80Arg Val Val Ala Ser
Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe 85
90 95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp
Ala Asp Leu Gln Ile 100 105
110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr
115 120 125Thr Pro Asp Asp Leu Glu Gly
Lys Asn Glu Gly Ser Leu Gly Leu Leu 130 135
140Val Leu Gly Arg Thr Gly Leu Leu Ala Asp Leu Leu Pro Ser Phe
Ala145 150 155 160Val Glu
Ile Met15149PRTArtificial SequenceSynthetic polypeptide 15Leu Gln Val Thr
Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1 5
10 15Pro Thr Val Leu Arg Cys His Phe Ser Thr
Ser Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu
35 40 45Ser Leu Gly Met Ser Ser Thr Arg
Ala Gln Ser Leu Ser Lys Arg Asn 50 55
60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65
70 75 80Arg Val Val Ala Ser
Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe 85
90 95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp
Ala Asp Leu Gln Ile 100 105
110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr
115 120 125Thr Pro Asp Asp Leu Glu Gly
Lys Asn Glu Gly Ser Leu Gly Leu Leu 130 135
140Val Leu Glu Trp Val1451633DNAArtificial SequenceSynthetic
polynucleotide 16ctagctagcc accatggata gggtcttgct gag
331729DNAArtificial SequenceSynthetic polynucleotide
17cgcggatccc ataatctcca cagcaaaac
291820PRTArtificial SequenceSynthetic polypeptide 18Cys Glu Tyr Ser Asp
Arg Trp Gly Asp Arg Ala Ile Glu Arg Asn Val1 5
10 15Tyr Leu Ser Thr
2019184PRTArtificial SequenceSynthetic polypeptide 19Met Asp Arg Val Leu
Leu Arg Trp Ile Ser Leu Phe Trp Leu Thr Ala1 5
10 15Met Val Glu Gly Leu Gln Val Thr Val Pro Asp
Lys Lys Lys Val Ala 20 25
30Met Leu Phe Gln Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser
35 40 45His Gln Pro Ala Val Val Gln Trp
Lys Phe Lys Ser Tyr Cys Gln Asp 50 55
60Arg Met Gly Glu Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu65
70 75 80Ser Lys Arg Asn Leu
Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser 85
90 95Arg Arg Thr Val Arg Val Val Ala Ser Lys Gln
Gly Ser Thr Val Thr 100 105
110Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala
115 120 125Asp Leu Gln Ile Gly Lys Leu
Met Trp Gly Asp Ser Gly Leu Tyr Tyr 130 135
140Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp
Ser145 150 155 160Val Glu
Leu Leu Val Leu Gly Arg Thr Gly Leu Leu Ala Asp Leu Leu
165 170 175Pro Ser Phe Ala Val Glu Ile
Met 18020232PRTArtificial SequenceSynthetic polypeptide 20Glu
Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala1
5 10 15Pro Glu Leu Leu Gly Gly Pro
Ser Val Phe Leu Phe Pro Pro Lys Pro 20 25
30Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys
Val Val 35 40 45Val Asp Val Ser
His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val 50 55
60Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg
Glu Glu Gln65 70 75
80Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln
85 90 95Asp Trp Leu Asn Gly Lys
Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala 100
105 110Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala
Lys Gly Gln Pro 115 120 125Arg Glu
Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr 130
135 140Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys
Gly Phe Tyr Pro Ser145 150 155
160Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr
165 170 175Lys Thr Thr Pro
Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr 180
185 190Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln
Gln Gly Asn Val Phe 195 200 205Ser
Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys 210
215 220Ser Leu Ser Leu Ser Pro Gly Lys225
23021217PRTArtificial SequenceSynthetic polypeptide 21Ala Pro
Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys1 5
10 15Pro Lys Asp Thr Leu Met Ile Ser
Arg Thr Pro Glu Val Thr Cys Val 20 25
30Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp
Tyr 35 40 45Val Asp Gly Val Glu
Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu 50 55
60Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val
Leu His65 70 75 80Gln
Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys
85 90 95Ala Leu Pro Ala Pro Ile Glu
Lys Thr Ile Ser Lys Ala Lys Gly Gln 100 105
110Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp
Glu Leu 115 120 125Thr Lys Asn Gln
Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro 130
135 140Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln
Pro Glu Asn Asn145 150 155
160Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu
165 170 175Tyr Ser Lys Leu Thr
Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val 180
185 190Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn
His Tyr Thr Gln 195 200 205Lys Ser
Leu Ser Leu Ser Pro Gly Lys 210 21522416PRTArtificial
SequenceSynthetic polypeptide 22Met Asp Arg Val Leu Leu Arg Trp Ile Ser
Leu Phe Trp Leu Thr Ala1 5 10
15Met Val Glu Gly Leu Gln Val Thr Val Pro Asp Lys Lys Lys Val Ala
20 25 30Met Leu Phe Gln Pro Thr
Val Leu Arg Cys His Phe Ser Thr Ser Ser 35 40
45His Gln Pro Ala Val Val Gln Trp Lys Phe Lys Ser Tyr Cys
Gln Asp 50 55 60Arg Met Gly Glu Ser
Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu65 70
75 80Ser Lys Arg Asn Leu Glu Trp Asp Pro Tyr
Leu Asp Cys Leu Asp Ser 85 90
95Arg Arg Thr Val Arg Val Val Ala Ser Lys Gln Gly Ser Thr Val Thr
100 105 110Leu Gly Asp Phe Tyr
Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala 115
120 125Asp Leu Gln Ile Gly Lys Leu Met Trp Gly Asp Ser
Gly Leu Tyr Tyr 130 135 140Cys Ile Ile
Thr Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser145
150 155 160Val Glu Leu Leu Val Leu Gly
Arg Thr Gly Leu Leu Ala Asp Leu Leu 165
170 175Pro Ser Phe Ala Val Glu Ile Met Glu Pro Lys Ser
Cys Asp Lys Thr 180 185 190His
Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser 195
200 205Val Phe Leu Phe Pro Pro Lys Pro Lys
Asp Thr Leu Met Ile Ser Arg 210 215
220Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro225
230 235 240Glu Val Lys Phe
Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala 245
250 255Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn
Ser Thr Tyr Arg Val Val 260 265
270Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr
275 280 285Lys Cys Lys Val Ser Asn Lys
Ala Leu Pro Ala Pro Ile Glu Lys Thr 290 295
300Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr
Leu305 310 315 320Pro Pro
Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys
325 330 335Leu Val Lys Gly Phe Tyr Pro
Ser Asp Ile Ala Val Glu Trp Glu Ser 340 345
350Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val
Leu Asp 355 360 365Ser Asp Gly Ser
Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser 370
375 380Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val
Met His Glu Ala385 390 395
400Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys
405 410 41523411PRTArtificial
SequenceSynthetic polypeptide 23Met Asp Arg Val Leu Leu Arg Trp Ile Ser
Leu Phe Trp Leu Thr Ala1 5 10
15Met Val Glu Gly Leu Gln Val Thr Val Pro Asp Lys Lys Lys Val Ala
20 25 30Met Leu Phe Gln Pro Thr
Val Leu Arg Cys His Phe Ser Thr Ser Ser 35 40
45His Gln Pro Ala Val Val Gln Trp Lys Phe Lys Ser Tyr Cys
Gln Asp 50 55 60Arg Met Gly Glu Ser
Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu65 70
75 80Ser Lys Arg Asn Leu Glu Trp Asp Pro Tyr
Leu Asp Cys Leu Asp Ser 85 90
95Arg Arg Thr Val Arg Val Val Ala Ser Lys Gln Gly Ser Thr Val Thr
100 105 110Leu Gly Asp Phe Tyr
Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala 115
120 125Asp Leu Gln Ile Gly Lys Leu Met Trp Gly Asp Ser
Gly Leu Tyr Tyr 130 135 140Cys Ile Ile
Thr Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser145
150 155 160Val Glu Leu Leu Val Leu Gly
Arg Thr Gly Leu Leu Ala Asp Leu Leu 165
170 175Pro Ser Phe Ala Val Glu Ile Met Asp Lys Thr His
Thr Cys Pro Pro 180 185 190Cys
Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro 195
200 205Pro Lys Pro Lys Asp Thr Leu Met Ile
Ser Arg Thr Pro Glu Val Thr 210 215
220Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn225
230 235 240Trp Tyr Val Asp
Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg 245
250 255Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val
Val Ser Val Leu Thr Val 260 265
270Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser
275 280 285Asn Lys Ala Leu Pro Ala Pro
Ile Glu Lys Thr Ile Ser Lys Ala Lys 290 295
300Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg
Asp305 310 315 320Glu Leu
Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe
325 330 335Tyr Pro Ser Asp Ile Ala Val
Glu Trp Glu Ser Asn Gly Gln Pro Glu 340 345
350Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly
Ser Phe 355 360 365Phe Leu Tyr Ser
Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly 370
375 380Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu
His Asn His Tyr385 390 395
400Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 405
410242PRTArtificial SequenceSynthetic polypeptide 24Gly
Ser1254PRTArtificial SequenceSynthetic polypeptide 25Gly Ser Gly
Ser1262PRTArtificial SequenceSynthetic polypeptide 26Ala
Ser1274PRTArtificial SequenceSynthetic polypeptide 27Gly Gly Gly
Ser128169PRTArtificial SequenceSynthetic polypeptide 28Met Asp Arg Val
Leu Leu Arg Trp Ile Ser Leu Phe Trp Leu Thr Ala1 5
10 15Met Val Glu Gly Leu Gln Val Thr Val Pro
Asp Lys Lys Lys Val Ala 20 25
30Met Leu Phe Gln Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser
35 40 45His Gln Pro Ala Val Val Gln Trp
Lys Phe Lys Ser Tyr Cys Gln Asp 50 55
60Arg Met Gly Glu Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu65
70 75 80Ser Lys Arg Asn Leu
Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser 85
90 95Arg Arg Thr Val Arg Val Val Ala Ser Lys Gln
Gly Ser Thr Val Thr 100 105
110Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala
115 120 125Asp Leu Gln Ile Gly Lys Leu
Met Trp Gly Asp Ser Gly Leu Tyr Tyr 130 135
140Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Gly
Ser145 150 155 160Leu Gly
Leu Leu Val Leu Glu Trp Val 16529147PRTArtificial
SequenceSynthetic polypeptide 29Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu
Gly14530104PRTArtificial SequenceSynthetic polypeptide 30Cys His Phe Ser
Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys1 5
10 15Phe Lys Ser Tyr Cys Gln Asp Arg Met Gly
Glu Ser Leu Gly Met Ser 20 25
30Ser Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp Pro
35 40 45Tyr Leu Asp Cys Leu Asp Ser Arg
Arg Thr Val Arg Val Val Ala Ser 50 55
60Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe Tyr Arg Gly Arg Glu65
70 75 80Ile Thr Ile Val His
Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp 85
90 95Gly Asp Ser Gly Leu Tyr Tyr Cys
10031233PRTArtificial SequenceSynthetic polypeptide 31Glu Pro Arg Gly Pro
Thr Ile Lys Pro Cys Pro Pro Cys Lys Cys Pro1 5
10 15Ala Pro Asn Leu Leu Gly Gly Pro Ser Val Phe
Ile Phe Pro Pro Lys 20 25
30Ile Lys Asp Val Leu Met Ile Ser Leu Ser Pro Ile Val Thr Cys Val
35 40 45Val Val Asp Val Ser Glu Asp Asp
Pro Asp Val Gln Ile Ser Trp Phe 50 55
60Val Asn Asn Val Glu Val His Thr Ala Gln Thr Gln Thr His Arg Glu65
70 75 80Asp Tyr Asn Ser Thr
Leu Arg Val Val Ser Ala Leu Pro Ile Gln His 85
90 95Gln Asp Trp Met Ser Gly Lys Glu Phe Lys Cys
Lys Val Asn Asn Lys 100 105
110Asp Leu Pro Ala Pro Ile Glu Arg Thr Ile Ser Lys Pro Lys Gly Ser
115 120 125Val Arg Ala Pro Gln Val Tyr
Val Leu Pro Pro Pro Glu Glu Glu Met 130 135
140Thr Lys Lys Gln Val Thr Leu Thr Cys Met Val Thr Asp Phe Met
Pro145 150 155 160Glu Asp
Ile Tyr Val Glu Trp Thr Asn Asn Gly Lys Thr Glu Leu Asn
165 170 175Tyr Lys Asn Thr Glu Pro Val
Leu Asp Ser Asp Gly Ser Tyr Phe Met 180 185
190Tyr Ser Lys Leu Arg Val Glu Lys Lys Asn Trp Val Glu Arg
Asn Ser 195 200 205Tyr Ser Cys Ser
Val Val His Glu Gly Leu His Asn His His Thr Thr 210
215 220Lys Ser Phe Ser Arg Thr Pro Gly Lys225
2303215PRTArtificial SequenceSynthetic polypeptide 32Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser1 5
10 153320PRTArtificial SequenceSynthetic
polypeptide 33Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
Gly1 5 10 15Gly Gly Gly
Ser 2034235PRTArtificial SequenceSynthetic polypeptide 34Met
Asp Arg Val Leu Leu Arg Trp Ile Ser Leu Phe Trp Leu Thr Ala1
5 10 15Met Val Glu Gly Leu Gln Val
Thr Val Pro Asp Lys Lys Lys Val Ala 20 25
30Met Leu Phe Gln Pro Thr Val Leu Arg Cys His Phe Ser Thr
Ser Ser 35 40 45His Gln Pro Ala
Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp 50 55
60Arg Met Gly Glu Ser Leu Gly Met Ser Ser Thr Arg Ala
Gln Ser Leu65 70 75
80Ser Lys Arg Asn Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser
85 90 95Arg Arg Thr Val Arg Val
Val Ala Ser Lys Gln Gly Ser Thr Val Thr 100
105 110Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile Thr Ile
Val His Asp Ala 115 120 125Asp Leu
Gln Ile Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr 130
135 140Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu Gly
Lys Asn Glu Asp Ser145 150 155
160Val Glu Leu Leu Val Leu Glu Trp Val Phe Val Gly Leu Val Leu Leu
165 170 175Gly Val Phe Leu
Phe Phe Val Leu Val Gly Ile Cys Trp Cys Gln Cys 180
185 190Cys Pro His Ser Cys Cys Cys Tyr Val Arg Cys
Pro Cys Cys Pro Asp 195 200 205Ser
Cys Cys Cys Pro Gln Ala Cys Glu Tyr Ser Asp Arg Trp Gly Asp 210
215 220Arg Ala Ile Glu Arg Asn Val Tyr Leu Ser
Thr225 230 23535164PRTArtificial
SequenceSynthetic polypeptide 35Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu Gly
Arg Thr Gly Leu Leu Ala Asp Leu Leu Pro Ser Phe Ala145
150 155 160Val Glu Ile
Met36149PRTArtificial SequenceSynthetic polypeptide 36Leu Gln Val Thr Val
Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1 5
10 15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser
Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu
35 40 45Ser Leu Gly Met Ser Ser Thr Arg
Ala Gln Ser Leu Ser Lys Arg Asn 50 55
60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65
70 75 80Arg Val Val Ala Ser
Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe 85
90 95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp
Ala Asp Leu Gln Ile 100 105
110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr
115 120 125Thr Pro Asp Asp Leu Glu Gly
Lys Asn Glu Asp Ser Val Glu Leu Leu 130 135
140Val Leu Glu Trp Val14537184PRTArtificial SequenceSynthetic
polypeptide 37Met Asp Arg Val Leu Leu Arg Trp Ile Ser Leu Phe Trp Leu Thr
Ala1 5 10 15Met Val Glu
Gly Leu Gln Val Thr Val Pro Asp Lys Lys Lys Val Ala 20
25 30Met Leu Phe Gln Pro Thr Val Leu Arg Cys
His Phe Ser Thr Ser Ser 35 40
45His Gln Pro Ala Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp 50
55 60Arg Met Gly Glu Ser Leu Gly Met Ser
Ser Thr Arg Ala Gln Ser Leu65 70 75
80Ser Lys Arg Asn Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu
Asp Ser 85 90 95Arg Arg
Thr Val Arg Val Val Ala Ser Lys Gln Gly Ser Thr Val Thr 100
105 110Leu Gly Asp Phe Tyr Arg Gly Arg Glu
Ile Thr Ile Val His Asp Ala 115 120
125Asp Leu Gln Ile Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr
130 135 140Cys Ile Ile Thr Thr Pro Asp
Asp Leu Glu Gly Lys Asn Glu Gly Ser145 150
155 160Leu Gly Leu Leu Val Leu Gly Arg Thr Gly Leu Leu
Ala Asp Leu Leu 165 170
175Pro Ser Phe Ala Val Glu Ile Met 18038416PRTArtificial
SequenceSynthetic polypeptide 38Met Asp Arg Val Leu Leu Arg Trp Ile Ser
Leu Phe Trp Leu Thr Ala1 5 10
15Met Val Glu Gly Leu Gln Val Thr Val Pro Asp Lys Lys Lys Val Ala
20 25 30Met Leu Phe Gln Pro Thr
Val Leu Arg Cys His Phe Ser Thr Ser Ser 35 40
45His Gln Pro Ala Val Val Gln Trp Lys Phe Lys Ser Tyr Cys
Gln Asp 50 55 60Arg Met Gly Glu Ser
Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu65 70
75 80Ser Lys Arg Asn Leu Glu Trp Asp Pro Tyr
Leu Asp Cys Leu Asp Ser 85 90
95Arg Arg Thr Val Arg Val Val Ala Ser Lys Gln Gly Ser Thr Val Thr
100 105 110Leu Gly Asp Phe Tyr
Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala 115
120 125Asp Leu Gln Ile Gly Lys Leu Met Trp Gly Asp Ser
Gly Leu Tyr Tyr 130 135 140Cys Ile Ile
Thr Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Gly Ser145
150 155 160Leu Gly Leu Leu Val Leu Gly
Arg Thr Gly Leu Leu Ala Asp Leu Leu 165
170 175Pro Ser Phe Ala Val Glu Ile Met Glu Pro Lys Ser
Cys Asp Lys Thr 180 185 190His
Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser 195
200 205Val Phe Leu Phe Pro Pro Lys Pro Lys
Asp Thr Leu Met Ile Ser Arg 210 215
220Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro225
230 235 240Glu Val Lys Phe
Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala 245
250 255Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn
Ser Thr Tyr Arg Val Val 260 265
270Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr
275 280 285Lys Cys Lys Val Ser Asn Lys
Ala Leu Pro Ala Pro Ile Glu Lys Thr 290 295
300Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr
Leu305 310 315 320Pro Pro
Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys
325 330 335Leu Val Lys Gly Phe Tyr Pro
Ser Asp Ile Ala Val Glu Trp Glu Ser 340 345
350Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val
Leu Asp 355 360 365Ser Asp Gly Ser
Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser 370
375 380Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val
Met His Glu Ala385 390 395
400Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys
405 410 41539411PRTArtificial
SequenceSynthetic polypeptide 39Met Asp Arg Val Leu Leu Arg Trp Ile Ser
Leu Phe Trp Leu Thr Ala1 5 10
15Met Val Glu Gly Leu Gln Val Thr Val Pro Asp Lys Lys Lys Val Ala
20 25 30Met Leu Phe Gln Pro Thr
Val Leu Arg Cys His Phe Ser Thr Ser Ser 35 40
45His Gln Pro Ala Val Val Gln Trp Lys Phe Lys Ser Tyr Cys
Gln Asp 50 55 60Arg Met Gly Glu Ser
Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu65 70
75 80Ser Lys Arg Asn Leu Glu Trp Asp Pro Tyr
Leu Asp Cys Leu Asp Ser 85 90
95Arg Arg Thr Val Arg Val Val Ala Ser Lys Gln Gly Ser Thr Val Thr
100 105 110Leu Gly Asp Phe Tyr
Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala 115
120 125Asp Leu Gln Ile Gly Lys Leu Met Trp Gly Asp Ser
Gly Leu Tyr Tyr 130 135 140Cys Ile Ile
Thr Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Gly Ser145
150 155 160Leu Gly Leu Leu Val Leu Gly
Arg Thr Gly Leu Leu Ala Asp Leu Leu 165
170 175Pro Ser Phe Ala Val Glu Ile Met Asp Lys Thr His
Thr Cys Pro Pro 180 185 190Cys
Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro 195
200 205Pro Lys Pro Lys Asp Thr Leu Met Ile
Ser Arg Thr Pro Glu Val Thr 210 215
220Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn225
230 235 240Trp Tyr Val Asp
Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg 245
250 255Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val
Val Ser Val Leu Thr Val 260 265
270Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser
275 280 285Asn Lys Ala Leu Pro Ala Pro
Ile Glu Lys Thr Ile Ser Lys Ala Lys 290 295
300Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg
Asp305 310 315 320Glu Leu
Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe
325 330 335Tyr Pro Ser Asp Ile Ala Val
Glu Trp Glu Ser Asn Gly Gln Pro Glu 340 345
350Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly
Ser Phe 355 360 365Phe Leu Tyr Ser
Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly 370
375 380Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu
His Asn His Tyr385 390 395
400Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 405
41040169PRTArtificial SequenceSynthetic polypeptide 40Met Asp
Arg Val Leu Leu Arg Trp Ile Ser Leu Phe Trp Leu Thr Ala1 5
10 15Met Val Glu Gly Leu Gln Val Thr
Val Pro Asp Lys Lys Lys Val Ala 20 25
30Met Leu Phe Gln Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser
Ser 35 40 45His Gln Pro Ala Val
Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp 50 55
60Arg Met Gly Glu Ser Leu Gly Met Ser Ser Thr Arg Ala Gln
Ser Leu65 70 75 80Ser
Lys Arg Asn Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser
85 90 95Arg Arg Thr Val Arg Val Val
Ala Ser Lys Gln Gly Ser Thr Val Thr 100 105
110Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile Thr Ile Val His
Asp Ala 115 120 125Asp Leu Gln Ile
Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr 130
135 140Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu Gly Lys
Asn Glu Asp Ser145 150 155
160Val Glu Leu Leu Val Leu Glu Trp Val
16541147PRTArtificial SequenceSynthetic polypeptide 41Leu Gln Val Thr Val
Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1 5
10 15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser
Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu
35 40 45Ser Leu Gly Met Ser Ser Thr Arg
Ala Gln Ser Leu Ser Lys Arg Asn 50 55
60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65
70 75 80Arg Val Val Ala Ser
Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe 85
90 95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp
Ala Asp Leu Gln Ile 100 105
110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr
115 120 125Thr Pro Asp Asp Leu Glu Gly
Lys Asn Glu Gly Ser Leu Gly Leu Leu 130 135
140Val Leu Gly14542144PRTArtificial SequenceSynthetic polypeptide
42Leu Gln Val Thr Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1
5 10 15Pro Thr Val Leu Arg Cys
His Phe Ser Thr Ser Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg
Met Gly Glu 35 40 45Ser Leu Gly
Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn 50
55 60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser
Arg Arg Thr Val65 70 75
80Arg Val Val Ala Ser Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
85 90 95Tyr Arg Gly Arg Glu Ile
Thr Ile Val His Asp Ala Asp Leu Gln Ile 100
105 110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr
Cys Ile Ile Thr 115 120 125Thr Pro
Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser Val Glu Leu Leu 130
135 14043145PRTArtificial SequenceSynthetic
polypeptide 43Leu Gln Val Thr Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe
Gln1 5 10 15Pro Thr Val
Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala 20
25 30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys
Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn 50
55 60Leu Glu Trp Asp Pro Tyr Leu Asp Cys
Leu Asp Ser Arg Arg Thr Val65 70 75
80Arg Val Val Ala Ser Lys Gln Gly Ser Thr Val Thr Leu Gly
Asp Phe 85 90 95Tyr Arg
Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile 100
105 110Gly Lys Leu Met Trp Gly Asp Ser Gly
Leu Tyr Tyr Cys Ile Ile Thr 115 120
125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser Val Glu Leu Leu
130 135 140Val14544146PRTArtificial
SequenceSynthetic polypeptide 44Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val
Leu14545164PRTArtificial SequenceSynthetic polypeptide 45Leu Gln Val Thr
Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1 5
10 15Pro Thr Val Leu Arg Cys His Phe Ser Thr
Ser Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu
35 40 45Ser Leu Gly Met Ser Ser Thr Arg
Ala Gln Ser Leu Ser Lys Arg Asn 50 55
60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65
70 75 80Arg Val Val Ala Ser
Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe 85
90 95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp
Ala Asp Leu Gln Ile 100 105
110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr
115 120 125Thr Pro Asp Asp Leu Glu Gly
Lys Asn Glu Asp Ser Val Glu Leu Leu 130 135
140Val Leu Gly Arg Thr Gly Leu Leu Ala Asp Leu Leu Pro Ser Gly
Gly145 150 155 160Val Glu
Ile Met46148PRTArtificial SequenceSynthetic polypeptide 46Leu Gln Val Thr
Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1 5
10 15Pro Thr Val Leu Arg Cys His Phe Ser Thr
Ser Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu
35 40 45Ser Leu Gly Met Ser Ser Thr Arg
Ala Gln Ser Leu Ser Lys Arg Asn 50 55
60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65
70 75 80Arg Val Val Ala Ser
Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe 85
90 95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp
Ala Asp Leu Gln Ile 100 105
110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr
115 120 125Thr Pro Asp Asp Leu Glu Gly
Lys Asn Glu Asp Ser Val Glu Leu Leu 130 135
140Val Leu Gly Arg14547149PRTArtificial SequenceSynthetic
polypeptide 47Leu Gln Val Thr Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe
Gln1 5 10 15Pro Thr Val
Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala 20
25 30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys
Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn 50
55 60Leu Glu Trp Asp Pro Tyr Leu Asp Cys
Leu Asp Ser Arg Arg Thr Val65 70 75
80Arg Val Val Ala Ser Lys Gln Gly Ser Thr Val Thr Leu Gly
Asp Phe 85 90 95Tyr Arg
Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile 100
105 110Gly Lys Leu Met Trp Gly Asp Ser Gly
Leu Tyr Tyr Cys Ile Ile Thr 115 120
125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser Val Glu Leu Leu
130 135 140Val Leu Gly Arg
Thr14548150PRTArtificial SequenceSynthetic polypeptide 48Leu Gln Val Thr
Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1 5
10 15Pro Thr Val Leu Arg Cys His Phe Ser Thr
Ser Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu
35 40 45Ser Leu Gly Met Ser Ser Thr Arg
Ala Gln Ser Leu Ser Lys Arg Asn 50 55
60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65
70 75 80Arg Val Val Ala Ser
Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe 85
90 95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp
Ala Asp Leu Gln Ile 100 105
110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr
115 120 125Thr Pro Asp Asp Leu Glu Gly
Lys Asn Glu Asp Ser Val Glu Leu Leu 130 135
140Val Leu Gly Arg Thr Gly145 15049151PRTArtificial
SequenceSynthetic polypeptide 49Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu Gly
Arg Thr Gly Leu145 15050152PRTArtificial
SequenceSynthetic polypeptide 50Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu Gly
Arg Thr Gly Leu Leu145 15051153PRTArtificial
SequenceSynthetic polypeptide 51Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu Gly
Arg Thr Gly Leu Leu Ala145 15052154PRTArtificial
SequenceSynthetic polypeptide 52Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu Gly
Arg Thr Gly Leu Leu Ala Asp145 15053155PRTArtificial
SequenceSynthetic polypeptide 53Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu Gly
Arg Thr Gly Leu Leu Ala Asp Leu145 150
15554156PRTArtificial SequenceSynthetic polypeptide 54Leu Gln Val Thr Val
Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1 5
10 15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser
Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu
35 40 45Ser Leu Gly Met Ser Ser Thr Arg
Ala Gln Ser Leu Ser Lys Arg Asn 50 55
60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65
70 75 80Arg Val Val Ala Ser
Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe 85
90 95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp
Ala Asp Leu Gln Ile 100 105
110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr
115 120 125Thr Pro Asp Asp Leu Glu Gly
Lys Asn Glu Asp Ser Val Glu Leu Leu 130 135
140Val Leu Gly Arg Thr Gly Leu Leu Ala Asp Leu Leu145
150 15555157PRTArtificial SequenceSynthetic polypeptide
55Leu Gln Val Thr Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1
5 10 15Pro Thr Val Leu Arg Cys
His Phe Ser Thr Ser Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg
Met Gly Glu 35 40 45Ser Leu Gly
Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn 50
55 60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser
Arg Arg Thr Val65 70 75
80Arg Val Val Ala Ser Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
85 90 95Tyr Arg Gly Arg Glu Ile
Thr Ile Val His Asp Ala Asp Leu Gln Ile 100
105 110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr
Cys Ile Ile Thr 115 120 125Thr Pro
Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser Val Glu Leu Leu 130
135 140Val Leu Gly Arg Thr Gly Leu Leu Ala Asp Leu
Leu Pro145 150 15556158PRTArtificial
SequenceSynthetic polypeptide 56Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu Gly
Arg Thr Gly Leu Leu Ala Asp Leu Leu Pro Ser145 150
15557159PRTArtificial SequenceSynthetic polypeptide 57Leu Gln
Val Thr Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1 5
10 15Pro Thr Val Leu Arg Cys His Phe
Ser Thr Ser Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg Met Gly
Glu 35 40 45Ser Leu Gly Met Ser
Ser Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn 50 55
60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser Arg Arg
Thr Val65 70 75 80Arg
Val Val Ala Ser Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
85 90 95Tyr Arg Gly Arg Glu Ile Thr
Ile Val His Asp Ala Asp Leu Gln Ile 100 105
110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr Cys Ile
Ile Thr 115 120 125Thr Pro Asp Asp
Leu Glu Gly Lys Asn Glu Asp Ser Val Glu Leu Leu 130
135 140Val Leu Gly Arg Thr Gly Leu Leu Ala Asp Leu Leu
Pro Ser Phe145 150 15558160PRTArtificial
SequenceSynthetic polypeptide 58Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu Gly
Arg Thr Gly Leu Leu Ala Asp Leu Leu Pro Ser Phe Ala145
150 155 16059161PRTArtificial
SequenceSynthetic polypeptide 59Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu Gly
Arg Thr Gly Leu Leu Ala Asp Leu Leu Pro Ser Phe Ala145
150 155 160Val60162PRTArtificial
SequenceSynthetic polypeptide 60Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu Gly
Arg Thr Gly Leu Leu Ala Asp Leu Leu Pro Ser Phe Ala145
150 155 160Val Glu61163PRTArtificial
SequenceSynthetic polypeptide 61Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu Gly
Arg Thr Gly Leu Leu Ala Asp Leu Leu Pro Ser Phe Ala145
150 155 160Val Glu Ile62166PRTArtificial
SequenceSynthetic polypeptide 62Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu Gly
Arg Thr Gly Leu Leu Ala Asp Leu Leu Pro Ser Phe Ala145
150 155 160Val Glu Ile Met Pro Glu
16563165PRTArtificial SequenceSynthetic polypeptide 63Leu Gln Val
Thr Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1 5
10 15Pro Thr Val Leu Arg Cys His Phe Ser
Thr Ser Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu
35 40 45Ser Leu Gly Met Ser Ser Thr
Arg Ala Gln Ser Leu Ser Lys Arg Asn 50 55
60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65
70 75 80Arg Val Val Ala
Ser Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe 85
90 95Tyr Arg Gly Arg Glu Ile Thr Ile Val His
Asp Ala Asp Leu Gln Ile 100 105
110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr
115 120 125Thr Pro Asp Asp Leu Glu Gly
Lys Asn Glu Asp Ser Val Glu Leu Leu 130 135
140Val Leu Gly Arg Thr Gly Leu Leu Ala Asp Leu Leu Pro Ser Phe
Ala145 150 155 160Val Glu
Ile Met Pro 16564164PRTArtificial SequenceSynthetic
polypeptide 64Leu Gln Val Thr Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe
Gln1 5 10 15Pro Thr Val
Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala 20
25 30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys
Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn 50
55 60Leu Glu Trp Asp Pro Tyr Leu Asp Cys
Leu Asp Ser Arg Arg Thr Val65 70 75
80Arg Val Val Ala Ser Lys Gln Gly Ser Thr Val Thr Leu Gly
Asp Phe 85 90 95Tyr Arg
Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile 100
105 110Gly Lys Leu Met Trp Gly Asp Ser Gly
Leu Tyr Tyr Cys Ile Ile Thr 115 120
125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser Val Glu Leu Leu
130 135 140Val Leu Gly Arg Thr Gly Leu
Leu Ala Asp Leu Leu Pro Ser Gly Ala145 150
155 160Val Glu Ile Met65167PRTArtificial
SequenceSynthetic polypeptide 65Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu Gly
Arg Thr Gly Leu Leu Ala Asp Leu Leu Pro Ser Phe Ala145
150 155 160Val Glu Ile Met Pro Glu Trp
16566168PRTArtificial SequenceSynthetic polypeptide 66Leu Gln
Val Thr Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1 5
10 15Pro Thr Val Leu Arg Cys His Phe
Ser Thr Ser Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg Met Gly
Glu 35 40 45Ser Leu Gly Met Ser
Ser Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn 50 55
60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser Arg Arg
Thr Val65 70 75 80Arg
Val Val Ala Ser Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
85 90 95Tyr Arg Gly Arg Glu Ile Thr
Ile Val His Asp Ala Asp Leu Gln Ile 100 105
110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr Cys Ile
Ile Thr 115 120 125Thr Pro Asp Asp
Leu Glu Gly Lys Asn Glu Asp Ser Val Glu Leu Leu 130
135 140Val Leu Gly Arg Thr Gly Leu Leu Ala Asp Leu Leu
Pro Ser Phe Ala145 150 155
160Val Glu Ile Met Pro Glu Trp Val 16567169PRTArtificial
SequenceSynthetic polypeptide 67Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu Gly
Arg Thr Gly Leu Leu Ala Asp Leu Leu Pro Ser Phe Ala145
150 155 160Val Glu Ile Met Pro Glu Trp
Val Phe 16568138PRTArtificial SequenceSynthetic
polypeptide 68Asp Lys Lys Lys Val Ala Met Leu Phe Gln Pro Thr Val Leu Arg
Cys1 5 10 15His Phe Ser
Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe 20
25 30Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu
Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp Pro Tyr 50
55 60Leu Asp Cys Leu Asp Ser Arg Arg Thr
Val Arg Val Val Ala Ser Lys65 70 75
80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe Tyr Arg Gly Arg
Glu Ile 85 90 95Thr Ile
Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly 100
105 110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile
Thr Thr Pro Asp Asp Leu Glu 115 120
125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu 130
13569139PRTArtificial SequenceSynthetic polypeptide 69Asp Lys Lys Lys Val
Ala Met Leu Phe Gln Pro Thr Val Leu Arg Cys1 5
10 15His Phe Ser Thr Ser Ser His Gln Pro Ala Val
Val Gln Trp Lys Phe 20 25
30Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu Ser Leu Gly Met Ser Ser
35 40 45Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn Leu Glu Trp Asp Pro Tyr 50 55
60Leu Asp Cys Leu Asp Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65
70 75 80Gln Gly Ser Thr Val
Thr Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile 85
90 95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly
Lys Leu Met Trp Gly 100 105
110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu
115 120 125Gly Lys Asn Glu Asp Ser Val
Glu Leu Leu Val 130 13570140PRTArtificial
SequenceSynthetic polypeptide 70Asp Lys Lys Lys Val Ala Met Leu Phe Gln
Pro Thr Val Leu Arg Cys1 5 10
15His Phe Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe
20 25 30Lys Ser Tyr Cys Gln Asp
Arg Met Gly Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp
Pro Tyr 50 55 60Leu Asp Cys Leu Asp
Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65 70
75 80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
Tyr Arg Gly Arg Glu Ile 85 90
95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly
100 105 110Asp Ser Gly Leu Tyr
Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu 115
120 125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu
130 135 14071141PRTArtificial
SequenceSynthetic polypeptide 71Asp Lys Lys Lys Val Ala Met Leu Phe Gln
Pro Thr Val Leu Arg Cys1 5 10
15His Phe Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe
20 25 30Lys Ser Tyr Cys Gln Asp
Arg Met Gly Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp
Pro Tyr 50 55 60Leu Asp Cys Leu Asp
Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65 70
75 80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
Tyr Arg Gly Arg Glu Ile 85 90
95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly
100 105 110Asp Ser Gly Leu Tyr
Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu 115
120 125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu
Gly 130 135 14072142PRTArtificial
SequenceSynthetic polypeptide 72Asp Lys Lys Lys Val Ala Met Leu Phe Gln
Pro Thr Val Leu Arg Cys1 5 10
15His Phe Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe
20 25 30Lys Ser Tyr Cys Gln Asp
Arg Met Gly Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp
Pro Tyr 50 55 60Leu Asp Cys Leu Asp
Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65 70
75 80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
Tyr Arg Gly Arg Glu Ile 85 90
95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly
100 105 110Asp Ser Gly Leu Tyr
Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu 115
120 125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu
Gly Arg 130 135 14073143PRTArtificial
SequenceSynthetic polypeptide 73Asp Lys Lys Lys Val Ala Met Leu Phe Gln
Pro Thr Val Leu Arg Cys1 5 10
15His Phe Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe
20 25 30Lys Ser Tyr Cys Gln Asp
Arg Met Gly Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp
Pro Tyr 50 55 60Leu Asp Cys Leu Asp
Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65 70
75 80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
Tyr Arg Gly Arg Glu Ile 85 90
95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly
100 105 110Asp Ser Gly Leu Tyr
Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu 115
120 125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu
Gly Arg Thr 130 135
14074144PRTArtificial SequenceSynthetic polypeptide 74Asp Lys Lys Lys Val
Ala Met Leu Phe Gln Pro Thr Val Leu Arg Cys1 5
10 15His Phe Ser Thr Ser Ser His Gln Pro Ala Val
Val Gln Trp Lys Phe 20 25
30Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu Ser Leu Gly Met Ser Ser
35 40 45Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn Leu Glu Trp Asp Pro Tyr 50 55
60Leu Asp Cys Leu Asp Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65
70 75 80Gln Gly Ser Thr Val
Thr Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile 85
90 95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly
Lys Leu Met Trp Gly 100 105
110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu
115 120 125Gly Lys Asn Glu Asp Ser Val
Glu Leu Leu Val Leu Gly Arg Thr Gly 130 135
14075145PRTArtificial SequenceSynthetic polypeptide 75Asp Lys Lys
Lys Val Ala Met Leu Phe Gln Pro Thr Val Leu Arg Cys1 5
10 15His Phe Ser Thr Ser Ser His Gln Pro
Ala Val Val Gln Trp Lys Phe 20 25
30Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu Ser Leu Gly Met Ser Ser
35 40 45Thr Arg Ala Gln Ser Leu Ser
Lys Arg Asn Leu Glu Trp Asp Pro Tyr 50 55
60Leu Asp Cys Leu Asp Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65
70 75 80Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile 85
90 95Thr Ile Val His Asp Ala Asp Leu Gln Ile
Gly Lys Leu Met Trp Gly 100 105
110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu
115 120 125Gly Lys Asn Glu Asp Ser Val
Glu Leu Leu Val Leu Gly Arg Thr Gly 130 135
140Leu14576146PRTArtificial SequenceSynthetic polypeptide 76Asp Lys
Lys Lys Val Ala Met Leu Phe Gln Pro Thr Val Leu Arg Cys1 5
10 15His Phe Ser Thr Ser Ser His Gln
Pro Ala Val Val Gln Trp Lys Phe 20 25
30Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu Ser Leu Gly Met Ser
Ser 35 40 45Thr Arg Ala Gln Ser
Leu Ser Lys Arg Asn Leu Glu Trp Asp Pro Tyr 50 55
60Leu Asp Cys Leu Asp Ser Arg Arg Thr Val Arg Val Val Ala
Ser Lys65 70 75 80Gln
Gly Ser Thr Val Thr Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile
85 90 95Thr Ile Val His Asp Ala Asp
Leu Gln Ile Gly Lys Leu Met Trp Gly 100 105
110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr Thr Pro Asp Asp
Leu Glu 115 120 125Gly Lys Asn Glu
Asp Ser Val Glu Leu Leu Val Leu Gly Arg Thr Gly 130
135 140Leu Leu14577147PRTArtificial SequenceSynthetic
polypeptide 77Asp Lys Lys Lys Val Ala Met Leu Phe Gln Pro Thr Val Leu Arg
Cys1 5 10 15His Phe Ser
Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe 20
25 30Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu
Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp Pro Tyr 50
55 60Leu Asp Cys Leu Asp Ser Arg Arg Thr
Val Arg Val Val Ala Ser Lys65 70 75
80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe Tyr Arg Gly Arg
Glu Ile 85 90 95Thr Ile
Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly 100
105 110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile
Thr Thr Pro Asp Asp Leu Glu 115 120
125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu Gly Arg Thr Gly
130 135 140Leu Leu
Ala14578148PRTArtificial SequenceSynthetic polypeptide 78Asp Lys Lys Lys
Val Ala Met Leu Phe Gln Pro Thr Val Leu Arg Cys1 5
10 15His Phe Ser Thr Ser Ser His Gln Pro Ala
Val Val Gln Trp Lys Phe 20 25
30Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu Ser Leu Gly Met Ser Ser
35 40 45Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn Leu Glu Trp Asp Pro Tyr 50 55
60Leu Asp Cys Leu Asp Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65
70 75 80Gln Gly Ser Thr Val
Thr Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile 85
90 95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly
Lys Leu Met Trp Gly 100 105
110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu
115 120 125Gly Lys Asn Glu Asp Ser Val
Glu Leu Leu Val Leu Gly Arg Thr Gly 130 135
140Leu Leu Ala Asp14579149PRTArtificial SequenceSynthetic
polypeptide 79Asp Lys Lys Lys Val Ala Met Leu Phe Gln Pro Thr Val Leu Arg
Cys1 5 10 15His Phe Ser
Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe 20
25 30Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu
Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp Pro Tyr 50
55 60Leu Asp Cys Leu Asp Ser Arg Arg Thr
Val Arg Val Val Ala Ser Lys65 70 75
80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe Tyr Arg Gly Arg
Glu Ile 85 90 95Thr Ile
Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly 100
105 110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile
Thr Thr Pro Asp Asp Leu Glu 115 120
125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu Gly Arg Thr Gly
130 135 140Leu Leu Ala Asp
Leu14580150PRTArtificial SequenceSynthetic polypeptide 80Asp Lys Lys Lys
Val Ala Met Leu Phe Gln Pro Thr Val Leu Arg Cys1 5
10 15His Phe Ser Thr Ser Ser His Gln Pro Ala
Val Val Gln Trp Lys Phe 20 25
30Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu Ser Leu Gly Met Ser Ser
35 40 45Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn Leu Glu Trp Asp Pro Tyr 50 55
60Leu Asp Cys Leu Asp Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65
70 75 80Gln Gly Ser Thr Val
Thr Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile 85
90 95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly
Lys Leu Met Trp Gly 100 105
110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu
115 120 125Gly Lys Asn Glu Asp Ser Val
Glu Leu Leu Val Leu Gly Arg Thr Gly 130 135
140Leu Leu Ala Asp Leu Leu145 15081151PRTArtificial
SequenceSynthetic polypeptide 81Asp Lys Lys Lys Val Ala Met Leu Phe Gln
Pro Thr Val Leu Arg Cys1 5 10
15His Phe Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe
20 25 30Lys Ser Tyr Cys Gln Asp
Arg Met Gly Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp
Pro Tyr 50 55 60Leu Asp Cys Leu Asp
Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65 70
75 80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
Tyr Arg Gly Arg Glu Ile 85 90
95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly
100 105 110Asp Ser Gly Leu Tyr
Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu 115
120 125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu
Gly Arg Thr Gly 130 135 140Leu Leu Ala
Asp Leu Leu Pro145 15082152PRTArtificial
SequenceSynthetic polypeptide 82Asp Lys Lys Lys Val Ala Met Leu Phe Gln
Pro Thr Val Leu Arg Cys1 5 10
15His Phe Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe
20 25 30Lys Ser Tyr Cys Gln Asp
Arg Met Gly Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp
Pro Tyr 50 55 60Leu Asp Cys Leu Asp
Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65 70
75 80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
Tyr Arg Gly Arg Glu Ile 85 90
95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly
100 105 110Asp Ser Gly Leu Tyr
Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu 115
120 125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu
Gly Arg Thr Gly 130 135 140Leu Leu Ala
Asp Leu Leu Pro Ser145 15083153PRTArtificial
SequenceSynthetic polypeptide 83Asp Lys Lys Lys Val Ala Met Leu Phe Gln
Pro Thr Val Leu Arg Cys1 5 10
15His Phe Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe
20 25 30Lys Ser Tyr Cys Gln Asp
Arg Met Gly Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp
Pro Tyr 50 55 60Leu Asp Cys Leu Asp
Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65 70
75 80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
Tyr Arg Gly Arg Glu Ile 85 90
95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly
100 105 110Asp Ser Gly Leu Tyr
Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu 115
120 125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu
Gly Arg Thr Gly 130 135 140Leu Leu Ala
Asp Leu Leu Pro Ser Phe145 15084154PRTArtificial
SequenceSynthetic polypeptide 84Asp Lys Lys Lys Val Ala Met Leu Phe Gln
Pro Thr Val Leu Arg Cys1 5 10
15His Phe Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe
20 25 30Lys Ser Tyr Cys Gln Asp
Arg Met Gly Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp
Pro Tyr 50 55 60Leu Asp Cys Leu Asp
Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65 70
75 80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
Tyr Arg Gly Arg Glu Ile 85 90
95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly
100 105 110Asp Ser Gly Leu Tyr
Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu 115
120 125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu
Gly Arg Thr Gly 130 135 140Leu Leu Ala
Asp Leu Leu Pro Ser Phe Ala145 15085155PRTArtificial
SequenceSynthetic polypeptide 85Asp Lys Lys Lys Val Ala Met Leu Phe Gln
Pro Thr Val Leu Arg Cys1 5 10
15His Phe Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe
20 25 30Lys Ser Tyr Cys Gln Asp
Arg Met Gly Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp
Pro Tyr 50 55 60Leu Asp Cys Leu Asp
Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65 70
75 80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
Tyr Arg Gly Arg Glu Ile 85 90
95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly
100 105 110Asp Ser Gly Leu Tyr
Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu 115
120 125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu
Gly Arg Thr Gly 130 135 140Leu Leu Ala
Asp Leu Leu Pro Ser Phe Ala Val145 150
15586156PRTArtificial SequenceSynthetic polypeptide 86Asp Lys Lys Lys Val
Ala Met Leu Phe Gln Pro Thr Val Leu Arg Cys1 5
10 15His Phe Ser Thr Ser Ser His Gln Pro Ala Val
Val Gln Trp Lys Phe 20 25
30Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu Ser Leu Gly Met Ser Ser
35 40 45Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn Leu Glu Trp Asp Pro Tyr 50 55
60Leu Asp Cys Leu Asp Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65
70 75 80Gln Gly Ser Thr Val
Thr Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile 85
90 95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly
Lys Leu Met Trp Gly 100 105
110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu
115 120 125Gly Lys Asn Glu Asp Ser Val
Glu Leu Leu Val Leu Gly Arg Thr Gly 130 135
140Leu Leu Ala Asp Leu Leu Pro Ser Phe Ala Val Glu145
150 15587157PRTArtificial SequenceSynthetic polypeptide
87Asp Lys Lys Lys Val Ala Met Leu Phe Gln Pro Thr Val Leu Arg Cys1
5 10 15His Phe Ser Thr Ser Ser
His Gln Pro Ala Val Val Gln Trp Lys Phe 20 25
30Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu Ser Leu Gly
Met Ser Ser 35 40 45Thr Arg Ala
Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp Pro Tyr 50
55 60Leu Asp Cys Leu Asp Ser Arg Arg Thr Val Arg Val
Val Ala Ser Lys65 70 75
80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile
85 90 95Thr Ile Val His Asp Ala
Asp Leu Gln Ile Gly Lys Leu Met Trp Gly 100
105 110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr Thr Pro
Asp Asp Leu Glu 115 120 125Gly Lys
Asn Glu Asp Ser Val Glu Leu Leu Val Leu Gly Arg Thr Gly 130
135 140Leu Leu Ala Asp Leu Leu Pro Ser Phe Ala Val
Glu Ile145 150 15588158PRTArtificial
SequenceSynthetic polypeptide 88Asp Lys Lys Lys Val Ala Met Leu Phe Gln
Pro Thr Val Leu Arg Cys1 5 10
15His Phe Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe
20 25 30Lys Ser Tyr Cys Gln Asp
Arg Met Gly Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp
Pro Tyr 50 55 60Leu Asp Cys Leu Asp
Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65 70
75 80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
Tyr Arg Gly Arg Glu Ile 85 90
95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly
100 105 110Asp Ser Gly Leu Tyr
Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu 115
120 125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu
Gly Arg Thr Gly 130 135 140Leu Leu Ala
Asp Leu Leu Pro Ser Phe Ala Val Glu Ile Met145 150
15589159PRTArtificial SequenceSynthetic polypeptide 89Asp Lys
Lys Lys Val Ala Met Leu Phe Gln Pro Thr Val Leu Arg Cys1 5
10 15His Phe Ser Thr Ser Ser His Gln
Pro Ala Val Val Gln Trp Lys Phe 20 25
30Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu Ser Leu Gly Met Ser
Ser 35 40 45Thr Arg Ala Gln Ser
Leu Ser Lys Arg Asn Leu Glu Trp Asp Pro Tyr 50 55
60Leu Asp Cys Leu Asp Ser Arg Arg Thr Val Arg Val Val Ala
Ser Lys65 70 75 80Gln
Gly Ser Thr Val Thr Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile
85 90 95Thr Ile Val His Asp Ala Asp
Leu Gln Ile Gly Lys Leu Met Trp Gly 100 105
110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr Thr Pro Asp Asp
Leu Glu 115 120 125Gly Lys Asn Glu
Asp Ser Val Glu Leu Leu Val Leu Gly Arg Thr Gly 130
135 140Leu Leu Ala Asp Leu Leu Pro Ser Phe Ala Val Glu
Ile Met Pro145 150 15590160PRTArtificial
SequenceSynthetic polypeptide 90Asp Lys Lys Lys Val Ala Met Leu Phe Gln
Pro Thr Val Leu Arg Cys1 5 10
15His Phe Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe
20 25 30Lys Ser Tyr Cys Gln Asp
Arg Met Gly Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp
Pro Tyr 50 55 60Leu Asp Cys Leu Asp
Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65 70
75 80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
Tyr Arg Gly Arg Glu Ile 85 90
95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly
100 105 110Asp Ser Gly Leu Tyr
Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu 115
120 125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu
Gly Arg Thr Gly 130 135 140Leu Leu Ala
Asp Leu Leu Pro Ser Phe Ala Val Glu Ile Met Pro Glu145
150 155 16091161PRTArtificial
SequenceSynthetic polypeptide 91Asp Lys Lys Lys Val Ala Met Leu Phe Gln
Pro Thr Val Leu Arg Cys1 5 10
15His Phe Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe
20 25 30Lys Ser Tyr Cys Gln Asp
Arg Met Gly Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp
Pro Tyr 50 55 60Leu Asp Cys Leu Asp
Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65 70
75 80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
Tyr Arg Gly Arg Glu Ile 85 90
95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly
100 105 110Asp Ser Gly Leu Tyr
Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu 115
120 125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu
Gly Arg Thr Gly 130 135 140Leu Leu Ala
Asp Leu Leu Pro Ser Phe Ala Val Glu Ile Met Pro Glu145
150 155 160Trp92162PRTArtificial
SequenceSynthetic polypeptide 92Asp Lys Lys Lys Val Ala Met Leu Phe Gln
Pro Thr Val Leu Arg Cys1 5 10
15His Phe Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe
20 25 30Lys Ser Tyr Cys Gln Asp
Arg Met Gly Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp
Pro Tyr 50 55 60Leu Asp Cys Leu Asp
Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65 70
75 80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
Tyr Arg Gly Arg Glu Ile 85 90
95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly
100 105 110Asp Ser Gly Leu Tyr
Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu 115
120 125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu
Gly Arg Thr Gly 130 135 140Leu Leu Ala
Asp Leu Leu Pro Ser Phe Ala Val Glu Ile Met Pro Glu145
150 155 160Trp Val93163PRTArtificial
SequenceSynthetic polypeptide 93Asp Lys Lys Lys Val Ala Met Leu Phe Gln
Pro Thr Val Leu Arg Cys1 5 10
15His Phe Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe
20 25 30Lys Ser Tyr Cys Gln Asp
Arg Met Gly Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp
Pro Tyr 50 55 60Leu Asp Cys Leu Asp
Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65 70
75 80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
Tyr Arg Gly Arg Glu Ile 85 90
95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly
100 105 110Asp Ser Gly Leu Tyr
Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu 115
120 125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu
Gly Arg Thr Gly 130 135 140Leu Leu Ala
Asp Leu Leu Pro Ser Phe Ala Val Glu Ile Met Pro Glu145
150 155 160Trp Val Phe94147PRTArtificial
SequenceSynthetic polypeptide 94Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu
Glu14595148PRTArtificial SequenceSynthetic polypeptide 95Leu Gln Val Thr
Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1 5
10 15Pro Thr Val Leu Arg Cys His Phe Ser Thr
Ser Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu
35 40 45Ser Leu Gly Met Ser Ser Thr Arg
Ala Gln Ser Leu Ser Lys Arg Asn 50 55
60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65
70 75 80Arg Val Val Ala Ser
Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe 85
90 95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp
Ala Asp Leu Gln Ile 100 105
110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr
115 120 125Thr Pro Asp Asp Leu Glu Gly
Lys Asn Glu Asp Ser Val Glu Leu Leu 130 135
140Val Leu Glu Trp14596164PRTArtificial SequenceSynthetic
polypeptide 96Leu Gln Val Thr Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe
Gln1 5 10 15Pro Thr Val
Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala 20
25 30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys
Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn 50
55 60Leu Glu Trp Asp Pro Tyr Leu Asp Cys
Leu Asp Ser Arg Arg Thr Val65 70 75
80Arg Val Val Ala Ser Lys Gln Gly Ser Thr Val Thr Leu Gly
Asp Phe 85 90 95Tyr Arg
Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile 100
105 110Gly Lys Leu Met Trp Gly Asp Ser Gly
Leu Tyr Tyr Cys Ile Ile Thr 115 120
125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser Val Glu Leu Leu
130 135 140Val Leu Gly Arg Thr Gly Leu
Leu Ala Asp Leu Leu Pro Ser Ala Ala145 150
155 160Val Glu Ile Met97150PRTArtificial
SequenceSynthetic polypeptide 97Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu Glu
Trp Val Phe145 15098151PRTArtificial SequenceSynthetic
polypeptide 98Leu Gln Val Thr Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe
Gln1 5 10 15Pro Thr Val
Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala 20
25 30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys
Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn 50
55 60Leu Glu Trp Asp Pro Tyr Leu Asp Cys
Leu Asp Ser Arg Arg Thr Val65 70 75
80Arg Val Val Ala Ser Lys Gln Gly Ser Thr Val Thr Leu Gly
Asp Phe 85 90 95Tyr Arg
Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile 100
105 110Gly Lys Leu Met Trp Gly Asp Ser Gly
Leu Tyr Tyr Cys Ile Ile Thr 115 120
125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser Val Glu Leu Leu
130 135 140Val Leu Glu Trp Val Phe Val145
15099152PRTArtificial SequenceSynthetic polypeptide 99Leu
Gln Val Thr Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1
5 10 15Pro Thr Val Leu Arg Cys His
Phe Ser Thr Ser Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg Met
Gly Glu 35 40 45Ser Leu Gly Met
Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn 50 55
60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser Arg
Arg Thr Val65 70 75
80Arg Val Val Ala Ser Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
85 90 95Tyr Arg Gly Arg Glu Ile
Thr Ile Val His Asp Ala Asp Leu Gln Ile 100
105 110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr
Cys Ile Ile Thr 115 120 125Thr Pro
Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser Val Glu Leu Leu 130
135 140Val Leu Glu Trp Val Phe Val Gly145
150100141PRTArtificial SequenceSynthetic polypeptide 100Asp Lys Lys
Lys Val Ala Met Leu Phe Gln Pro Thr Val Leu Arg Cys1 5
10 15His Phe Ser Thr Ser Ser His Gln Pro
Ala Val Val Gln Trp Lys Phe 20 25
30Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu Ser Leu Gly Met Ser Ser
35 40 45Thr Arg Ala Gln Ser Leu Ser
Lys Arg Asn Leu Glu Trp Asp Pro Tyr 50 55
60Leu Asp Cys Leu Asp Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65
70 75 80Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile 85
90 95Thr Ile Val His Asp Ala Asp Leu Gln Ile
Gly Lys Leu Met Trp Gly 100 105
110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu
115 120 125Gly Lys Asn Glu Asp Ser Val
Glu Leu Leu Val Leu Glu 130 135
140101142PRTArtificial SequenceSynthetic polypeptide 101Asp Lys Lys Lys
Val Ala Met Leu Phe Gln Pro Thr Val Leu Arg Cys1 5
10 15His Phe Ser Thr Ser Ser His Gln Pro Ala
Val Val Gln Trp Lys Phe 20 25
30Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu Ser Leu Gly Met Ser Ser
35 40 45Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn Leu Glu Trp Asp Pro Tyr 50 55
60Leu Asp Cys Leu Asp Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65
70 75 80Gln Gly Ser Thr Val
Thr Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile 85
90 95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly
Lys Leu Met Trp Gly 100 105
110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu
115 120 125Gly Lys Asn Glu Asp Ser Val
Glu Leu Leu Val Leu Glu Trp 130 135
140102143PRTArtificial SequenceSynthetic polypeptide 102Asp Lys Lys Lys
Val Ala Met Leu Phe Gln Pro Thr Val Leu Arg Cys1 5
10 15His Phe Ser Thr Ser Ser His Gln Pro Ala
Val Val Gln Trp Lys Phe 20 25
30Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu Ser Leu Gly Met Ser Ser
35 40 45Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn Leu Glu Trp Asp Pro Tyr 50 55
60Leu Asp Cys Leu Asp Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65
70 75 80Gln Gly Ser Thr Val
Thr Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile 85
90 95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly
Lys Leu Met Trp Gly 100 105
110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu
115 120 125Gly Lys Asn Glu Asp Ser Val
Glu Leu Leu Val Leu Glu Trp Val 130 135
140103144PRTArtificial SequenceSynthetic polypeptide 103Asp Lys Lys Lys
Val Ala Met Leu Phe Gln Pro Thr Val Leu Arg Cys1 5
10 15His Phe Ser Thr Ser Ser His Gln Pro Ala
Val Val Gln Trp Lys Phe 20 25
30Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu Ser Leu Gly Met Ser Ser
35 40 45Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn Leu Glu Trp Asp Pro Tyr 50 55
60Leu Asp Cys Leu Asp Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65
70 75 80Gln Gly Ser Thr Val
Thr Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile 85
90 95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly
Lys Leu Met Trp Gly 100 105
110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu
115 120 125Gly Lys Asn Glu Asp Ser Val
Glu Leu Leu Val Leu Glu Trp Val Phe 130 135
140104145PRTArtificial SequenceSynthetic polypeptide 104Asp Lys Lys
Lys Val Ala Met Leu Phe Gln Pro Thr Val Leu Arg Cys1 5
10 15His Phe Ser Thr Ser Ser His Gln Pro
Ala Val Val Gln Trp Lys Phe 20 25
30Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu Ser Leu Gly Met Ser Ser
35 40 45Thr Arg Ala Gln Ser Leu Ser
Lys Arg Asn Leu Glu Trp Asp Pro Tyr 50 55
60Leu Asp Cys Leu Asp Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65
70 75 80Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile 85
90 95Thr Ile Val His Asp Ala Asp Leu Gln Ile
Gly Lys Leu Met Trp Gly 100 105
110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu
115 120 125Gly Lys Asn Glu Asp Ser Val
Glu Leu Leu Val Leu Glu Trp Val Phe 130 135
140Val145105146PRTArtificial SequenceSynthetic polypeptide 105Asp
Lys Lys Lys Val Ala Met Leu Phe Gln Pro Thr Val Leu Arg Cys1
5 10 15His Phe Ser Thr Ser Ser His
Gln Pro Ala Val Val Gln Trp Lys Phe 20 25
30Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu Ser Leu Gly Met
Ser Ser 35 40 45Thr Arg Ala Gln
Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp Pro Tyr 50 55
60Leu Asp Cys Leu Asp Ser Arg Arg Thr Val Arg Val Val
Ala Ser Lys65 70 75
80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile
85 90 95Thr Ile Val His Asp Ala
Asp Leu Gln Ile Gly Lys Leu Met Trp Gly 100
105 110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr Thr Pro
Asp Asp Leu Glu 115 120 125Gly Lys
Asn Glu Asp Ser Val Glu Leu Leu Val Leu Glu Trp Val Phe 130
135 140Val Gly1451065PRTArtificial SequenceSynthetic
polypeptide 106Gly Gly Gly Gly Ser1 510710PRTArtificial
SequenceSynthetic polypeptide 107Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser1
5 10108408PRTArtificial SequenceSynthetic
polypeptide 108Leu Gln Val Thr Val Pro Asp Lys Lys Lys Val Ala Met Leu
Phe Gln1 5 10 15Pro Thr
Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala 20
25 30Val Val Gln Trp Lys Phe Lys Ser Tyr
Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn 50
55 60Leu Glu Trp Asp Pro Tyr Leu Asp Cys
Leu Asp Ser Arg Arg Thr Val65 70 75
80Arg Val Val Ala Ser Lys Gln Gly Ser Thr Val Thr Leu Gly
Asp Phe 85 90 95Tyr Arg
Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile 100
105 110Gly Lys Leu Met Trp Gly Asp Ser Gly
Leu Tyr Tyr Cys Ile Ile Thr 115 120
125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser Val Glu Leu Leu
130 135 140Val Leu Gly Arg Thr Gly Leu
Leu Ala Asp Leu Leu Pro Ser Phe Ala145 150
155 160Val Glu Ile Met Gly Ser Glu Asn Leu Tyr Phe Gln
Gly Ser Gly Glu 165 170
175Pro Arg Gly Pro Thr Ile Lys Pro Cys Pro Pro Cys Lys Cys Pro Ala
180 185 190Pro Asn Leu Leu Gly Gly
Pro Ser Val Phe Ile Phe Pro Pro Lys Ile 195 200
205Lys Asp Val Leu Met Ile Ser Leu Ser Pro Ile Val Thr Cys
Val Val 210 215 220Val Asp Val Ser Glu
Asp Asp Pro Asp Val Gln Ile Ser Trp Phe Val225 230
235 240Asn Asn Val Glu Val His Thr Ala Gln Thr
Gln Thr His Arg Glu Asp 245 250
255Tyr Asn Ser Thr Leu Arg Val Val Ser Ala Leu Pro Ile Gln His Gln
260 265 270Asp Trp Met Ser Gly
Lys Glu Phe Lys Cys Lys Val Asn Asn Lys Asp 275
280 285Leu Pro Ala Pro Ile Glu Arg Thr Ile Ser Lys Pro
Lys Gly Ser Val 290 295 300Arg Ala Pro
Gln Val Tyr Val Leu Pro Pro Pro Glu Glu Glu Met Thr305
310 315 320Lys Lys Gln Val Thr Leu Thr
Cys Met Val Thr Asp Phe Met Pro Glu 325
330 335Asp Ile Tyr Val Glu Trp Thr Asn Asn Gly Lys Thr
Glu Leu Asn Tyr 340 345 350Lys
Asn Thr Glu Pro Val Leu Asp Ser Asp Gly Ser Tyr Phe Met Tyr 355
360 365Ser Lys Leu Arg Val Glu Lys Lys Asn
Trp Val Glu Arg Asn Ser Tyr 370 375
380Ser Cys Ser Val Val His Glu Gly Leu His Asn His His Thr Thr Lys385
390 395 400Ser Phe Ser Arg
Thr Pro Gly Lys 405109417PRTArtificial SequenceSynthetic
polypeptide 109Met Asp Arg Val Leu Leu Arg Trp Ile Ser Leu Phe Trp Leu
Thr Ala1 5 10 15Met Val
Glu Gly Leu Gln Val Thr Val Pro Asp Lys Lys Lys Val Ala 20
25 30Met Leu Phe Gln Pro Thr Val Leu Arg
Cys His Phe Ser Thr Ser Ser 35 40
45His Gln Pro Ala Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp 50
55 60Arg Met Gly Glu Ser Leu Gly Met Ser
Ser Thr Arg Ala Gln Ser Leu65 70 75
80Ser Lys Arg Asn Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu
Asp Ser 85 90 95Arg Arg
Thr Val Arg Val Val Ala Ser Lys Gln Gly Ser Thr Val Thr 100
105 110Leu Gly Asp Phe Tyr Arg Gly Arg Glu
Ile Thr Ile Val His Asp Ala 115 120
125Asp Leu Gln Ile Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr
130 135 140Cys Ile Ile Thr Thr Pro Asp
Asp Leu Glu Gly Lys Asn Glu Asp Ser145 150
155 160Val Glu Leu Leu Val Leu Gly Arg Thr Gly Leu Leu
Ala Gly Ser Glu 165 170
175Asn Leu Tyr Phe Gln Gly Ser Gly Glu Pro Arg Gly Pro Thr Ile Lys
180 185 190Pro Cys Pro Pro Cys Lys
Cys Pro Ala Pro Asn Leu Leu Gly Gly Pro 195 200
205Ser Val Phe Ile Phe Pro Pro Lys Ile Lys Asp Val Leu Met
Ile Ser 210 215 220Leu Ser Pro Ile Val
Thr Cys Val Val Val Asp Val Ser Glu Asp Asp225 230
235 240Pro Asp Val Gln Ile Ser Trp Phe Val Asn
Asn Val Glu Val His Thr 245 250
255Ala Gln Thr Gln Thr His Arg Glu Asp Tyr Asn Ser Thr Leu Arg Val
260 265 270Val Ser Ala Leu Pro
Ile Gln His Gln Asp Trp Met Ser Gly Lys Glu 275
280 285Phe Lys Cys Lys Val Asn Asn Lys Asp Leu Pro Ala
Pro Ile Glu Arg 290 295 300Thr Ile Ser
Lys Pro Lys Gly Ser Val Arg Ala Pro Gln Val Tyr Val305
310 315 320Leu Pro Pro Pro Glu Glu Glu
Met Thr Lys Lys Gln Val Thr Leu Thr 325
330 335Cys Met Val Thr Asp Phe Met Pro Glu Asp Ile Tyr
Val Glu Trp Thr 340 345 350Asn
Asn Gly Lys Thr Glu Leu Asn Tyr Lys Asn Thr Glu Pro Val Leu 355
360 365Asp Ser Asp Gly Ser Tyr Phe Met Tyr
Ser Lys Leu Arg Val Glu Lys 370 375
380Lys Asn Trp Val Glu Arg Asn Ser Tyr Ser Cys Ser Val Val His Glu385
390 395 400Gly Leu His Asn
His His Thr Thr Lys Ser Phe Ser Arg Thr Pro Gly 405
410 415Lys110397PRTArtificial SequenceSynthetic
polypeptide 110Leu Gln Val Thr Val Pro Asp Lys Lys Lys Val Ala Met Leu
Phe Gln1 5 10 15Pro Thr
Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala 20
25 30Val Val Gln Trp Lys Phe Lys Ser Tyr
Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn 50
55 60Leu Glu Trp Asp Pro Tyr Leu Asp Cys
Leu Asp Ser Arg Arg Thr Val65 70 75
80Arg Val Val Ala Ser Lys Gln Gly Ser Thr Val Thr Leu Gly
Asp Phe 85 90 95Tyr Arg
Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile 100
105 110Gly Lys Leu Met Trp Gly Asp Ser Gly
Leu Tyr Tyr Cys Ile Ile Thr 115 120
125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser Val Glu Leu Leu
130 135 140Val Leu Gly Arg Thr Gly Leu
Leu Ala Gly Ser Glu Asn Leu Tyr Phe145 150
155 160Gln Gly Ser Gly Glu Pro Arg Gly Pro Thr Ile Lys
Pro Cys Pro Pro 165 170
175Cys Lys Cys Pro Ala Pro Asn Leu Leu Gly Gly Pro Ser Val Phe Ile
180 185 190Phe Pro Pro Lys Ile Lys
Asp Val Leu Met Ile Ser Leu Ser Pro Ile 195 200
205Val Thr Cys Val Val Val Asp Val Ser Glu Asp Asp Pro Asp
Val Gln 210 215 220Ile Ser Trp Phe Val
Asn Asn Val Glu Val His Thr Ala Gln Thr Gln225 230
235 240Thr His Arg Glu Asp Tyr Asn Ser Thr Leu
Arg Val Val Ser Ala Leu 245 250
255Pro Ile Gln His Gln Asp Trp Met Ser Gly Lys Glu Phe Lys Cys Lys
260 265 270Val Asn Asn Lys Asp
Leu Pro Ala Pro Ile Glu Arg Thr Ile Ser Lys 275
280 285Pro Lys Gly Ser Val Arg Ala Pro Gln Val Tyr Val
Leu Pro Pro Pro 290 295 300Glu Glu Glu
Met Thr Lys Lys Gln Val Thr Leu Thr Cys Met Val Thr305
310 315 320Asp Phe Met Pro Glu Asp Ile
Tyr Val Glu Trp Thr Asn Asn Gly Lys 325
330 335Thr Glu Leu Asn Tyr Lys Asn Thr Glu Pro Val Leu
Asp Ser Asp Gly 340 345 350Ser
Tyr Phe Met Tyr Ser Lys Leu Arg Val Glu Lys Lys Asn Trp Val 355
360 365Glu Arg Asn Ser Tyr Ser Cys Ser Val
Val His Glu Gly Leu His Asn 370 375
380His His Thr Thr Lys Ser Phe Ser Arg Thr Pro Gly Lys385
390 395111411PRTArtificial SequenceSynthetic polypeptide
111Met Asp Arg Val Leu Leu Arg Trp Ile Ser Leu Phe Trp Leu Thr Ala1
5 10 15Met Val Glu Gly Leu Gln
Val Thr Val Pro Asp Lys Lys Lys Val Ala 20 25
30Met Leu Phe Gln Pro Thr Val Leu Arg Cys His Phe Ser
Thr Ser Ser 35 40 45His Gln Pro
Ala Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp 50
55 60Arg Met Gly Glu Ser Leu Gly Met Ser Ser Thr Arg
Ala Gln Ser Leu65 70 75
80Ser Lys Arg Asn Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser
85 90 95Arg Arg Thr Val Arg Val
Val Ala Ser Lys Gln Gly Ser Thr Val Thr 100
105 110Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile Thr Ile
Val His Asp Ala 115 120 125Asp Leu
Gln Ile Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr 130
135 140Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu Gly
Lys Asn Glu Asp Ser145 150 155
160Val Glu Leu Leu Val Leu Gly Gly Ser Glu Asn Leu Tyr Phe Gln Gly
165 170 175Ser Gly Glu Pro
Arg Gly Pro Thr Ile Lys Pro Cys Pro Pro Cys Lys 180
185 190Cys Pro Ala Pro Asn Leu Leu Gly Gly Pro Ser
Val Phe Ile Phe Pro 195 200 205Pro
Lys Ile Lys Asp Val Leu Met Ile Ser Leu Ser Pro Ile Val Thr 210
215 220Cys Val Val Val Asp Val Ser Glu Asp Asp
Pro Asp Val Gln Ile Ser225 230 235
240Trp Phe Val Asn Asn Val Glu Val His Thr Ala Gln Thr Gln Thr
His 245 250 255Arg Glu Asp
Tyr Asn Ser Thr Leu Arg Val Val Ser Ala Leu Pro Ile 260
265 270Gln His Gln Asp Trp Met Ser Gly Lys Glu
Phe Lys Cys Lys Val Asn 275 280
285Asn Lys Asp Leu Pro Ala Pro Ile Glu Arg Thr Ile Ser Lys Pro Lys 290
295 300Gly Ser Val Arg Ala Pro Gln Val
Tyr Val Leu Pro Pro Pro Glu Glu305 310
315 320Glu Met Thr Lys Lys Gln Val Thr Leu Thr Cys Met
Val Thr Asp Phe 325 330
335Met Pro Glu Asp Ile Tyr Val Glu Trp Thr Asn Asn Gly Lys Thr Glu
340 345 350Leu Asn Tyr Lys Asn Thr
Glu Pro Val Leu Asp Ser Asp Gly Ser Tyr 355 360
365Phe Met Tyr Ser Lys Leu Arg Val Glu Lys Lys Asn Trp Val
Glu Arg 370 375 380Asn Ser Tyr Ser Cys
Ser Val Val His Glu Gly Leu His Asn His His385 390
395 400Thr Thr Lys Ser Phe Ser Arg Thr Pro Gly
Lys 405 410112391PRTArtificial
SequenceSynthetic polypeptide 112Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu Gly
Gly Ser Glu Asn Leu Tyr Phe Gln Gly Ser Gly Glu Pro145
150 155 160Arg Gly Pro Thr Ile Lys Pro
Cys Pro Pro Cys Lys Cys Pro Ala Pro 165
170 175Asn Leu Leu Gly Gly Pro Ser Val Phe Ile Phe Pro
Pro Lys Ile Lys 180 185 190Asp
Val Leu Met Ile Ser Leu Ser Pro Ile Val Thr Cys Val Val Val 195
200 205Asp Val Ser Glu Asp Asp Pro Asp Val
Gln Ile Ser Trp Phe Val Asn 210 215
220Asn Val Glu Val His Thr Ala Gln Thr Gln Thr His Arg Glu Asp Tyr225
230 235 240Asn Ser Thr Leu
Arg Val Val Ser Ala Leu Pro Ile Gln His Gln Asp 245
250 255Trp Met Ser Gly Lys Glu Phe Lys Cys Lys
Val Asn Asn Lys Asp Leu 260 265
270Pro Ala Pro Ile Glu Arg Thr Ile Ser Lys Pro Lys Gly Ser Val Arg
275 280 285Ala Pro Gln Val Tyr Val Leu
Pro Pro Pro Glu Glu Glu Met Thr Lys 290 295
300Lys Gln Val Thr Leu Thr Cys Met Val Thr Asp Phe Met Pro Glu
Asp305 310 315 320Ile Tyr
Val Glu Trp Thr Asn Asn Gly Lys Thr Glu Leu Asn Tyr Lys
325 330 335Asn Thr Glu Pro Val Leu Asp
Ser Asp Gly Ser Tyr Phe Met Tyr Ser 340 345
350Lys Leu Arg Val Glu Lys Lys Asn Trp Val Glu Arg Asn Ser
Tyr Ser 355 360 365Cys Ser Val Val
His Glu Gly Leu His Asn His His Thr Thr Lys Ser 370
375 380Phe Ser Arg Thr Pro Gly Lys385
39011311PRTArtificial SequenceSynthetic polypeptide 113Gly Ser Glu Asn
Leu Tyr Phe Gln Gly Ser Gly1 5
1011412PRTArtificial SequenceSynthetic polypeptide 114Ala Glu Ala Ala Ala
Lys Glu Ala Ala Ala Lys Ala1 5
10115232PRTArtificial SequenceSynthetic polypeptide 115Glu Pro Lys Ser
Ser Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala1 5
10 15Pro Glu Leu Leu Gly Gly Pro Ser Val Phe
Leu Phe Pro Pro Lys Pro 20 25
30Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val
35 40 45Val Asp Val Ser His Glu Asp Pro
Glu Val Lys Phe Asn Trp Tyr Val 50 55
60Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln65
70 75 80Tyr Asn Ser Thr Tyr
Arg Val Val Ser Val Leu Thr Val Leu His Gln 85
90 95Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys
Val Ser Asn Lys Ala 100 105
110Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro
115 120 125Arg Glu Pro Gln Val Tyr Thr
Leu Pro Pro Ser Arg Asp Glu Leu Thr 130 135
140Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro
Ser145 150 155 160Asp Ile
Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr
165 170 175Lys Thr Thr Pro Pro Val Leu
Asp Ser Asp Gly Ser Phe Phe Leu Tyr 180 185
190Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn
Val Phe 195 200 205Ser Cys Ser Val
Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys 210
215 220Ser Leu Ser Leu Ser Pro Gly Lys225
230116396PRTArtificial sequenceSynthetic polypeptide 116Leu Gln Val Thr
Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1 5
10 15Pro Thr Val Leu Arg Cys His Phe Ser Thr
Ser Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu
35 40 45Ser Leu Gly Met Ser Ser Thr Arg
Ala Gln Ser Leu Ser Lys Arg Asn 50 55
60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65
70 75 80Arg Val Val Ala Ser
Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe 85
90 95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp
Ala Asp Leu Gln Ile 100 105
110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr
115 120 125Thr Pro Asp Asp Leu Glu Gly
Lys Asn Glu Gly Ser Leu Gly Leu Leu 130 135
140Val Leu Gly Arg Thr Gly Leu Leu Ala Asp Leu Leu Pro Ser Phe
Ala145 150 155 160Val Glu
Ile Met Glu Pro Lys Ser Ser Asp Lys Thr His Thr Cys Pro
165 170 175Pro Cys Pro Ala Pro Glu Leu
Leu Gly Gly Pro Ser Val Phe Leu Phe 180 185
190Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro
Glu Val 195 200 205Thr Cys Val Val
Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe 210
215 220Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala
Lys Thr Lys Pro225 230 235
240Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr
245 250 255Val Leu His Gln Asp
Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val 260
265 270Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr
Ile Ser Lys Ala 275 280 285Lys Gly
Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg 290
295 300Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr
Cys Leu Val Lys Gly305 310 315
320Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro
325 330 335Glu Asn Asn Tyr
Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser 340
345 350Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys
Ser Arg Trp Gln Gln 355 360 365Gly
Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His 370
375 380Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro
Gly Lys385 390 395117381PRTArtificial
sequenceSynthetic polypeptide 117Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Gly Ser
Leu Gly Leu Leu 130 135 140Val Leu Glu
Trp Val Glu Pro Lys Ser Ser Asp Lys Thr His Thr Cys145
150 155 160Pro Pro Cys Pro Ala Pro Glu
Leu Leu Gly Gly Pro Ser Val Phe Leu 165
170 175Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser
Arg Thr Pro Glu 180 185 190Val
Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys 195
200 205Phe Asn Trp Tyr Val Asp Gly Val Glu
Val His Asn Ala Lys Thr Lys 210 215
220Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu225
230 235 240Thr Val Leu His
Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys 245
250 255Val Ser Asn Lys Ala Leu Pro Ala Pro Ile
Glu Lys Thr Ile Ser Lys 260 265
270Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser
275 280 285Arg Asp Glu Leu Thr Lys Asn
Gln Val Ser Leu Thr Cys Leu Val Lys 290 295
300Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly
Gln305 310 315 320Pro Glu
Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly
325 330 335Ser Phe Phe Leu Tyr Ser Lys
Leu Thr Val Asp Lys Ser Arg Trp Gln 340 345
350Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu
His Asn 355 360 365His Tyr Thr Gln
Lys Ser Leu Ser Leu Ser Pro Gly Lys 370 375
380118416PRTArtificial sequenceSynthetic polypeptide 118Met Asp Arg
Val Leu Leu Arg Trp Ile Ser Leu Phe Trp Leu Thr Ala1 5
10 15Met Val Glu Gly Leu Gln Val Thr Val
Pro Asp Lys Lys Lys Val Ala 20 25
30Met Leu Phe Gln Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser
35 40 45His Gln Pro Ala Val Val Gln
Trp Lys Phe Lys Ser Tyr Cys Gln Asp 50 55
60Arg Met Gly Glu Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu65
70 75 80Ser Lys Arg Asn
Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser 85
90 95Arg Arg Thr Val Arg Val Val Ala Ser Lys
Gln Gly Ser Thr Val Thr 100 105
110Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala
115 120 125Asp Leu Gln Ile Gly Lys Leu
Met Trp Gly Asp Ser Gly Leu Tyr Tyr 130 135
140Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp
Ser145 150 155 160Val Glu
Leu Leu Val Leu Gly Arg Thr Gly Leu Leu Ala Asp Leu Leu
165 170 175Pro Ser Phe Ala Val Glu Ile
Met Glu Pro Lys Ser Ser Asp Lys Thr 180 185
190His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly
Pro Ser 195 200 205Val Phe Leu Phe
Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg 210
215 220Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser
His Glu Asp Pro225 230 235
240Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala
245 250 255Lys Thr Lys Pro Arg
Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val 260
265 270Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn
Gly Lys Glu Tyr 275 280 285Lys Cys
Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr 290
295 300Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro
Gln Val Tyr Thr Leu305 310 315
320Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys
325 330 335Leu Val Lys Gly
Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser 340
345 350Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr
Pro Pro Val Leu Asp 355 360 365Ser
Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser 370
375 380Arg Trp Gln Gln Gly Asn Val Phe Ser Cys
Ser Val Met His Glu Ala385 390 395
400Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly
Lys 405 410
415119400PRTArtificial sequenceSynthetic polypeptide 119Met Asp Arg Val
Leu Leu Arg Trp Ile Ser Leu Phe Trp Leu Thr Ala1 5
10 15Met Val Glu Gly Leu Gln Val Thr Val Pro
Asp Lys Lys Lys Val Ala 20 25
30Met Leu Phe Gln Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser
35 40 45His Gln Pro Ala Val Val Gln Trp
Lys Phe Lys Ser Tyr Cys Gln Asp 50 55
60Arg Met Gly Glu Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu65
70 75 80Ser Lys Arg Asn Leu
Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser 85
90 95Arg Arg Thr Val Arg Val Val Ala Ser Lys Gln
Gly Ser Thr Val Thr 100 105
110Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala
115 120 125Asp Leu Gln Ile Gly Lys Leu
Met Trp Gly Asp Ser Gly Leu Tyr Tyr 130 135
140Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Gly
Ser145 150 155 160Leu Gly
Leu Leu Val Leu Glu Trp Glu Pro Lys Ser Ser Asp Lys Thr
165 170 175His Thr Cys Pro Pro Cys Pro
Ala Pro Glu Leu Leu Gly Gly Pro Ser 180 185
190Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile
Ser Arg 195 200 205Thr Pro Glu Val
Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro 210
215 220Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu
Val His Asn Ala225 230 235
240Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val
245 250 255Ser Val Leu Thr Val
Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr 260
265 270Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro
Ile Glu Lys Thr 275 280 285Ile Ser
Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu 290
295 300Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln
Val Ser Leu Thr Cys305 310 315
320Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser
325 330 335Asn Gly Gln Pro
Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp 340
345 350Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu
Thr Val Asp Lys Ser 355 360 365Arg
Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala 370
375 380Leu His Asn His Tyr Thr Gln Lys Ser Leu
Ser Leu Ser Pro Gly Lys385 390 395
400120379PRTArtificial sequenceSynthetic polypeptide 120Leu Gln
Val Thr Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1 5
10 15Pro Thr Val Leu Arg Cys His Phe
Ser Thr Ser Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg Met Gly
Glu 35 40 45Ser Leu Gly Met Ser
Ser Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn 50 55
60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser Arg Arg
Thr Val65 70 75 80Arg
Val Val Ala Ser Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
85 90 95Tyr Arg Gly Arg Glu Ile Thr
Ile Val His Asp Ala Asp Leu Gln Ile 100 105
110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr Cys Ile
Ile Thr 115 120 125Thr Pro Asp Asp
Leu Glu Gly Lys Asn Glu Asp Ser Val Glu Leu Leu 130
135 140Val Leu Gly Glu Pro Lys Ser Ser Asp Lys Thr His
Thr Cys Pro Pro145 150 155
160Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro
165 170 175Pro Lys Pro Lys Asp
Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr 180
185 190Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu
Val Lys Phe Asn 195 200 205Trp Tyr
Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg 210
215 220Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val
Ser Val Leu Thr Val225 230 235
240Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser
245 250 255Asn Lys Ala Leu
Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys 260
265 270Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu
Pro Pro Ser Arg Asp 275 280 285Glu
Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe 290
295 300Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu
Ser Asn Gly Gln Pro Glu305 310 315
320Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser
Phe 325 330 335Phe Leu Tyr
Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly 340
345 350Asn Val Phe Ser Cys Ser Val Met His Glu
Ala Leu His Asn His Tyr 355 360
365Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 370
375121336PRTArtificial sequenceSynthetic polypeptide 121Cys His Phe Ser
Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys1 5
10 15Phe Lys Ser Tyr Cys Gln Asp Arg Met Gly
Glu Ser Leu Gly Met Ser 20 25
30Ser Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp Pro
35 40 45Tyr Leu Asp Cys Leu Asp Ser Arg
Arg Thr Val Arg Val Val Ala Ser 50 55
60Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe Tyr Arg Gly Arg Glu65
70 75 80Ile Thr Ile Val His
Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp 85
90 95Gly Asp Ser Gly Leu Tyr Tyr Cys Glu Pro Lys
Ser Ser Asp Lys Thr 100 105
110His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser
115 120 125Val Phe Leu Phe Pro Pro Lys
Pro Lys Asp Thr Leu Met Ile Ser Arg 130 135
140Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp
Pro145 150 155 160Glu Val
Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala
165 170 175Lys Thr Lys Pro Arg Glu Glu
Gln Tyr Asn Ser Thr Tyr Arg Val Val 180 185
190Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys
Glu Tyr 195 200 205Lys Cys Lys Val
Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr 210
215 220Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln
Val Tyr Thr Leu225 230 235
240Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys
245 250 255Leu Val Lys Gly Phe
Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser 260
265 270Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro
Pro Val Leu Asp 275 280 285Ser Asp
Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser 290
295 300Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser
Val Met His Glu Ala305 310 315
320Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys
325 330
335122396PRTArtificial sequenceSynthetic polypeptide 122Leu Gln Val Thr
Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1 5
10 15Pro Thr Val Leu Arg Cys His Phe Ser Thr
Ser Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu
35 40 45Ser Leu Gly Met Ser Ser Thr Arg
Ala Gln Ser Leu Ser Lys Arg Asn 50 55
60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65
70 75 80Arg Val Val Ala Ser
Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe 85
90 95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp
Ala Asp Leu Gln Ile 100 105
110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr
115 120 125Thr Pro Asp Asp Leu Glu Gly
Lys Asn Glu Asp Ser Val Glu Leu Leu 130 135
140Val Leu Gly Arg Thr Gly Leu Leu Ala Asp Leu Leu Pro Ser Phe
Ala145 150 155 160Val Glu
Ile Met Glu Pro Lys Ser Ser Asp Lys Thr His Thr Cys Pro
165 170 175Pro Cys Pro Ala Pro Glu Leu
Leu Gly Gly Pro Ser Val Phe Leu Phe 180 185
190Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro
Glu Val 195 200 205Thr Cys Val Val
Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe 210
215 220Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala
Lys Thr Lys Pro225 230 235
240Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr
245 250 255Val Leu His Gln Asp
Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val 260
265 270Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr
Ile Ser Lys Ala 275 280 285Lys Gly
Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg 290
295 300Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr
Cys Leu Val Lys Gly305 310 315
320Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro
325 330 335Glu Asn Asn Tyr
Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser 340
345 350Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys
Ser Arg Trp Gln Gln 355 360 365Gly
Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His 370
375 380Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro
Gly Lys385 390 395123381PRTArtificial
sequenceSynthetic polypeptide 123Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu Glu
Trp Val Glu Pro Lys Ser Ser Asp Lys Thr His Thr Cys145
150 155 160Pro Pro Cys Pro Ala Pro Glu
Leu Leu Gly Gly Pro Ser Val Phe Leu 165
170 175Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser
Arg Thr Pro Glu 180 185 190Val
Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys 195
200 205Phe Asn Trp Tyr Val Asp Gly Val Glu
Val His Asn Ala Lys Thr Lys 210 215
220Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu225
230 235 240Thr Val Leu His
Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys 245
250 255Val Ser Asn Lys Ala Leu Pro Ala Pro Ile
Glu Lys Thr Ile Ser Lys 260 265
270Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser
275 280 285Arg Asp Glu Leu Thr Lys Asn
Gln Val Ser Leu Thr Cys Leu Val Lys 290 295
300Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly
Gln305 310 315 320Pro Glu
Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly
325 330 335Ser Phe Phe Leu Tyr Ser Lys
Leu Thr Val Asp Lys Ser Arg Trp Gln 340 345
350Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu
His Asn 355 360 365His Tyr Thr Gln
Lys Ser Leu Ser Leu Ser Pro Gly Lys 370 375
380124416PRTArtificial sequenceSynthetic polypeptide 124Met Asp Arg
Val Leu Leu Arg Trp Ile Ser Leu Phe Trp Leu Thr Ala1 5
10 15Met Val Glu Gly Leu Gln Val Thr Val
Pro Asp Lys Lys Lys Val Ala 20 25
30Met Leu Phe Gln Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser
35 40 45His Gln Pro Ala Val Val Gln
Trp Lys Phe Lys Ser Tyr Cys Gln Asp 50 55
60Arg Met Gly Glu Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu65
70 75 80Ser Lys Arg Asn
Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser 85
90 95Arg Arg Thr Val Arg Val Val Ala Ser Lys
Gln Gly Ser Thr Val Thr 100 105
110Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala
115 120 125Asp Leu Gln Ile Gly Lys Leu
Met Trp Gly Asp Ser Gly Leu Tyr Tyr 130 135
140Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Gly
Ser145 150 155 160Leu Gly
Leu Leu Val Leu Gly Arg Thr Gly Leu Leu Ala Asp Leu Leu
165 170 175Pro Ser Phe Ala Val Glu Ile
Met Glu Pro Lys Ser Ser Asp Lys Thr 180 185
190His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly
Pro Ser 195 200 205Val Phe Leu Phe
Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg 210
215 220Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser
His Glu Asp Pro225 230 235
240Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala
245 250 255Lys Thr Lys Pro Arg
Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val 260
265 270Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn
Gly Lys Glu Tyr 275 280 285Lys Cys
Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr 290
295 300Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro
Gln Val Tyr Thr Leu305 310 315
320Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys
325 330 335Leu Val Lys Gly
Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser 340
345 350Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr
Pro Pro Val Leu Asp 355 360 365Ser
Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser 370
375 380Arg Trp Gln Gln Gly Asn Val Phe Ser Cys
Ser Val Met His Glu Ala385 390 395
400Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly
Lys 405 410
415125401PRTArtificial sequenceSynthetic polypeptide 125Met Asp Arg Val
Leu Leu Arg Trp Ile Ser Leu Phe Trp Leu Thr Ala1 5
10 15Met Val Glu Gly Leu Gln Val Thr Val Pro
Asp Lys Lys Lys Val Ala 20 25
30Met Leu Phe Gln Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser
35 40 45His Gln Pro Ala Val Val Gln Trp
Lys Phe Lys Ser Tyr Cys Gln Asp 50 55
60Arg Met Gly Glu Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu65
70 75 80Ser Lys Arg Asn Leu
Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser 85
90 95Arg Arg Thr Val Arg Val Val Ala Ser Lys Gln
Gly Ser Thr Val Thr 100 105
110Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala
115 120 125Asp Leu Gln Ile Gly Lys Leu
Met Trp Gly Asp Ser Gly Leu Tyr Tyr 130 135
140Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp
Ser145 150 155 160Val Glu
Leu Leu Val Leu Glu Trp Val Glu Pro Lys Ser Ser Asp Lys
165 170 175Thr His Thr Cys Pro Pro Cys
Pro Ala Pro Glu Leu Leu Gly Gly Pro 180 185
190Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met
Ile Ser 195 200 205Arg Thr Pro Glu
Val Thr Cys Val Val Val Asp Val Ser His Glu Asp 210
215 220Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val
Glu Val His Asn225 230 235
240Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val
245 250 255Val Ser Val Leu Thr
Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu 260
265 270Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala
Pro Ile Glu Lys 275 280 285Thr Ile
Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr 290
295 300Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn
Gln Val Ser Leu Thr305 310 315
320Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu
325 330 335Ser Asn Gly Gln
Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu 340
345 350Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys
Leu Thr Val Asp Lys 355 360 365Ser
Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu 370
375 380Ala Leu His Asn His Tyr Thr Gln Lys Ser
Leu Ser Leu Ser Pro Gly385 390 395
400Lys126379PRTArtificial sequenceSynthetic polypeptide 126Leu
Gln Val Thr Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1
5 10 15Pro Thr Val Leu Arg Cys His
Phe Ser Thr Ser Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg Met
Gly Glu 35 40 45Ser Leu Gly Met
Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn 50 55
60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser Arg
Arg Thr Val65 70 75
80Arg Val Val Ala Ser Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
85 90 95Tyr Arg Gly Arg Glu Ile
Thr Ile Val His Asp Ala Asp Leu Gln Ile 100
105 110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr
Cys Ile Ile Thr 115 120 125Thr Pro
Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser Val Glu Leu Leu 130
135 140Val Leu Gly Glu Pro Lys Ser Ser Asp Lys Thr
His Thr Cys Pro Pro145 150 155
160Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro
165 170 175Pro Lys Pro Lys
Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr 180
185 190Cys Val Val Val Asp Val Ser His Glu Asp Pro
Glu Val Lys Phe Asn 195 200 205Trp
Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg 210
215 220Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val
Val Ser Val Leu Thr Val225 230 235
240Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val
Ser 245 250 255Asn Lys Ala
Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys 260
265 270Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr
Leu Pro Pro Ser Arg Asp 275 280
285Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe 290
295 300Tyr Pro Ser Asp Ile Ala Val Glu
Trp Glu Ser Asn Gly Gln Pro Glu305 310
315 320Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser
Asp Gly Ser Phe 325 330
335Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly
340 345 350Asn Val Phe Ser Cys Ser
Val Met His Glu Ala Leu His Asn His Tyr 355 360
365Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 370
375127376PRTArtificial sequenceSynthetic polypeptide 127Leu Gln
Val Thr Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1 5
10 15Pro Thr Val Leu Arg Cys His Phe
Ser Thr Ser Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg Met Gly
Glu 35 40 45Ser Leu Gly Met Ser
Ser Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn 50 55
60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser Arg Arg
Thr Val65 70 75 80Arg
Val Val Ala Ser Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
85 90 95Tyr Arg Gly Arg Glu Ile Thr
Ile Val His Asp Ala Asp Leu Gln Ile 100 105
110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr Cys Ile
Ile Thr 115 120 125Thr Pro Asp Asp
Leu Glu Gly Lys Asn Glu Asp Ser Val Glu Leu Leu 130
135 140Glu Pro Lys Ser Ser Asp Lys Thr His Thr Cys Pro
Pro Cys Pro Ala145 150 155
160Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro
165 170 175Lys Asp Thr Leu Met
Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val 180
185 190Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe
Asn Trp Tyr Val 195 200 205Asp Gly
Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln 210
215 220Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu
Thr Val Leu His Gln225 230 235
240Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala
245 250 255Leu Pro Ala Pro
Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro 260
265 270Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser
Arg Asp Glu Leu Thr 275 280 285Lys
Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser 290
295 300Asp Ile Ala Val Glu Trp Glu Ser Asn Gly
Gln Pro Glu Asn Asn Tyr305 310 315
320Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu
Tyr 325 330 335Ser Lys Leu
Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe 340
345 350Ser Cys Ser Val Met His Glu Ala Leu His
Asn His Tyr Thr Gln Lys 355 360
365Ser Leu Ser Leu Ser Pro Gly Lys 370
375128377PRTArtificial sequenceSynthetic polypeptide 128Leu Gln Val Thr
Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1 5
10 15Pro Thr Val Leu Arg Cys His Phe Ser Thr
Ser Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu
35 40 45Ser Leu Gly Met Ser Ser Thr Arg
Ala Gln Ser Leu Ser Lys Arg Asn 50 55
60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65
70 75 80Arg Val Val Ala Ser
Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe 85
90 95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp
Ala Asp Leu Gln Ile 100 105
110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr
115 120 125Thr Pro Asp Asp Leu Glu Gly
Lys Asn Glu Asp Ser Val Glu Leu Leu 130 135
140Val Glu Pro Lys Ser Ser Asp Lys Thr His Thr Cys Pro Pro Cys
Pro145 150 155 160Ala Pro
Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys
165 170 175Pro Lys Asp Thr Leu Met Ile
Ser Arg Thr Pro Glu Val Thr Cys Val 180 185
190Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn
Trp Tyr 195 200 205Val Asp Gly Val
Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu 210
215 220Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu
Thr Val Leu His225 230 235
240Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys
245 250 255Ala Leu Pro Ala Pro
Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln 260
265 270Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser
Arg Asp Glu Leu 275 280 285Thr Lys
Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro 290
295 300Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly
Gln Pro Glu Asn Asn305 310 315
320Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu
325 330 335Tyr Ser Lys Leu
Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val 340
345 350Phe Ser Cys Ser Val Met His Glu Ala Leu His
Asn His Tyr Thr Gln 355 360 365Lys
Ser Leu Ser Leu Ser Pro Gly Lys 370
375129378PRTArtificial sequenceSynthetic polypeptide 129Leu Gln Val Thr
Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1 5
10 15Pro Thr Val Leu Arg Cys His Phe Ser Thr
Ser Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu
35 40 45Ser Leu Gly Met Ser Ser Thr Arg
Ala Gln Ser Leu Ser Lys Arg Asn 50 55
60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65
70 75 80Arg Val Val Ala Ser
Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe 85
90 95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp
Ala Asp Leu Gln Ile 100 105
110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr
115 120 125Thr Pro Asp Asp Leu Glu Gly
Lys Asn Glu Asp Ser Val Glu Leu Leu 130 135
140Val Leu Glu Pro Lys Ser Ser Asp Lys Thr His Thr Cys Pro Pro
Cys145 150 155 160Pro Ala
Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro
165 170 175Lys Pro Lys Asp Thr Leu Met
Ile Ser Arg Thr Pro Glu Val Thr Cys 180 185
190Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe
Asn Trp 195 200 205Tyr Val Asp Gly
Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu 210
215 220Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val
Leu Thr Val Leu225 230 235
240His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn
245 250 255Lys Ala Leu Pro Ala
Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly 260
265 270Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro
Ser Arg Asp Glu 275 280 285Leu Thr
Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr 290
295 300Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn
Gly Gln Pro Glu Asn305 310 315
320Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe
325 330 335Leu Tyr Ser Lys
Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn 340
345 350Val Phe Ser Cys Ser Val Met His Glu Ala Leu
His Asn His Tyr Thr 355 360 365Gln
Lys Ser Leu Ser Leu Ser Pro Gly Lys 370
375130396PRTArtificial sequenceSynthetic polypeptide 130Leu Gln Val Thr
Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1 5
10 15Pro Thr Val Leu Arg Cys His Phe Ser Thr
Ser Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu
35 40 45Ser Leu Gly Met Ser Ser Thr Arg
Ala Gln Ser Leu Ser Lys Arg Asn 50 55
60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65
70 75 80Arg Val Val Ala Ser
Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe 85
90 95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp
Ala Asp Leu Gln Ile 100 105
110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr
115 120 125Thr Pro Asp Asp Leu Glu Gly
Lys Asn Glu Asp Ser Val Glu Leu Leu 130 135
140Val Leu Gly Arg Thr Gly Leu Leu Ala Asp Leu Leu Pro Ser Gly
Gly145 150 155 160Val Glu
Ile Met Glu Pro Lys Ser Ser Asp Lys Thr His Thr Cys Pro
165 170 175Pro Cys Pro Ala Pro Glu Leu
Leu Gly Gly Pro Ser Val Phe Leu Phe 180 185
190Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro
Glu Val 195 200 205Thr Cys Val Val
Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe 210
215 220Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala
Lys Thr Lys Pro225 230 235
240Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr
245 250 255Val Leu His Gln Asp
Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val 260
265 270Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr
Ile Ser Lys Ala 275 280 285Lys Gly
Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg 290
295 300Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr
Cys Leu Val Lys Gly305 310 315
320Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro
325 330 335Glu Asn Asn Tyr
Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser 340
345 350Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys
Ser Arg Trp Gln Gln 355 360 365Gly
Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His 370
375 380Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro
Gly Lys385 390 395131380PRTArtificial
sequenceSynthetic polypeptide 131Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu Gly
Arg Glu Pro Lys Ser Ser Asp Lys Thr His Thr Cys Pro145
150 155 160Pro Cys Pro Ala Pro Glu Leu
Leu Gly Gly Pro Ser Val Phe Leu Phe 165
170 175Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg
Thr Pro Glu Val 180 185 190Thr
Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe 195
200 205Asn Trp Tyr Val Asp Gly Val Glu Val
His Asn Ala Lys Thr Lys Pro 210 215
220Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr225
230 235 240Val Leu His Gln
Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val 245
250 255Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu
Lys Thr Ile Ser Lys Ala 260 265
270Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg
275 280 285Asp Glu Leu Thr Lys Asn Gln
Val Ser Leu Thr Cys Leu Val Lys Gly 290 295
300Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln
Pro305 310 315 320Glu Asn
Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser
325 330 335Phe Phe Leu Tyr Ser Lys Leu
Thr Val Asp Lys Ser Arg Trp Gln Gln 340 345
350Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His
Asn His 355 360 365Tyr Thr Gln Lys
Ser Leu Ser Leu Ser Pro Gly Lys 370 375
380132381PRTArtificial sequenceSynthetic polypeptide 132Leu Gln Val Thr
Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1 5
10 15Pro Thr Val Leu Arg Cys His Phe Ser Thr
Ser Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu
35 40 45Ser Leu Gly Met Ser Ser Thr Arg
Ala Gln Ser Leu Ser Lys Arg Asn 50 55
60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65
70 75 80Arg Val Val Ala Ser
Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe 85
90 95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp
Ala Asp Leu Gln Ile 100 105
110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr
115 120 125Thr Pro Asp Asp Leu Glu Gly
Lys Asn Glu Asp Ser Val Glu Leu Leu 130 135
140Val Leu Gly Arg Thr Glu Pro Lys Ser Ser Asp Lys Thr His Thr
Cys145 150 155 160Pro Pro
Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu
165 170 175Phe Pro Pro Lys Pro Lys Asp
Thr Leu Met Ile Ser Arg Thr Pro Glu 180 185
190Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu
Val Lys 195 200 205Phe Asn Trp Tyr
Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys 210
215 220Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val
Val Ser Val Leu225 230 235
240Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys
245 250 255Val Ser Asn Lys Ala
Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys 260
265 270Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr
Leu Pro Pro Ser 275 280 285Arg Asp
Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys 290
295 300Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp
Glu Ser Asn Gly Gln305 310 315
320Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly
325 330 335Ser Phe Phe Leu
Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln 340
345 350Gln Gly Asn Val Phe Ser Cys Ser Val Met His
Glu Ala Leu His Asn 355 360 365His
Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 370
375 380133382PRTArtificial sequenceSynthetic polypeptide
133Leu Gln Val Thr Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1
5 10 15Pro Thr Val Leu Arg Cys
His Phe Ser Thr Ser Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg
Met Gly Glu 35 40 45Ser Leu Gly
Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn 50
55 60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser
Arg Arg Thr Val65 70 75
80Arg Val Val Ala Ser Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
85 90 95Tyr Arg Gly Arg Glu Ile
Thr Ile Val His Asp Ala Asp Leu Gln Ile 100
105 110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr
Cys Ile Ile Thr 115 120 125Thr Pro
Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser Val Glu Leu Leu 130
135 140Val Leu Gly Arg Thr Gly Glu Pro Lys Ser Ser
Asp Lys Thr His Thr145 150 155
160Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe
165 170 175Leu Phe Pro Pro
Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro 180
185 190Glu Val Thr Cys Val Val Val Asp Val Ser His
Glu Asp Pro Glu Val 195 200 205Lys
Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr 210
215 220Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr
Tyr Arg Val Val Ser Val225 230 235
240Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys
Cys 245 250 255Lys Val Ser
Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser 260
265 270Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln
Val Tyr Thr Leu Pro Pro 275 280
285Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val 290
295 300Lys Gly Phe Tyr Pro Ser Asp Ile
Ala Val Glu Trp Glu Ser Asn Gly305 310
315 320Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val
Leu Asp Ser Asp 325 330
335Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp
340 345 350Gln Gln Gly Asn Val Phe
Ser Cys Ser Val Met His Glu Ala Leu His 355 360
365Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys
370 375 380134383PRTArtificial
sequenceSynthetic polypeptide 134Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu Gly
Arg Thr Gly Leu Glu Pro Lys Ser Ser Asp Lys Thr His145
150 155 160Thr Cys Pro Pro Cys Pro Ala
Pro Glu Leu Leu Gly Gly Pro Ser Val 165
170 175Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met
Ile Ser Arg Thr 180 185 190Pro
Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu 195
200 205Val Lys Phe Asn Trp Tyr Val Asp Gly
Val Glu Val His Asn Ala Lys 210 215
220Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser225
230 235 240Val Leu Thr Val
Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys 245
250 255Cys Lys Val Ser Asn Lys Ala Leu Pro Ala
Pro Ile Glu Lys Thr Ile 260 265
270Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro
275 280 285Pro Ser Arg Asp Glu Leu Thr
Lys Asn Gln Val Ser Leu Thr Cys Leu 290 295
300Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser
Asn305 310 315 320Gly Gln
Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser
325 330 335Asp Gly Ser Phe Phe Leu Tyr
Ser Lys Leu Thr Val Asp Lys Ser Arg 340 345
350Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu
Ala Leu 355 360 365His Asn His Tyr
Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 370 375
380135384PRTArtificial sequenceSynthetic polypeptide 135Leu
Gln Val Thr Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1
5 10 15Pro Thr Val Leu Arg Cys His
Phe Ser Thr Ser Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg Met
Gly Glu 35 40 45Ser Leu Gly Met
Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn 50 55
60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser Arg
Arg Thr Val65 70 75
80Arg Val Val Ala Ser Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
85 90 95Tyr Arg Gly Arg Glu Ile
Thr Ile Val His Asp Ala Asp Leu Gln Ile 100
105 110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr
Cys Ile Ile Thr 115 120 125Thr Pro
Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser Val Glu Leu Leu 130
135 140Val Leu Gly Arg Thr Gly Leu Leu Glu Pro Lys
Ser Ser Asp Lys Thr145 150 155
160His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser
165 170 175Val Phe Leu Phe
Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg 180
185 190Thr Pro Glu Val Thr Cys Val Val Val Asp Val
Ser His Glu Asp Pro 195 200 205Glu
Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala 210
215 220Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn
Ser Thr Tyr Arg Val Val225 230 235
240Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu
Tyr 245 250 255Lys Cys Lys
Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr 260
265 270Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu
Pro Gln Val Tyr Thr Leu 275 280
285Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys 290
295 300Leu Val Lys Gly Phe Tyr Pro Ser
Asp Ile Ala Val Glu Trp Glu Ser305 310
315 320Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro
Pro Val Leu Asp 325 330
335Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser
340 345 350Arg Trp Gln Gln Gly Asn
Val Phe Ser Cys Ser Val Met His Glu Ala 355 360
365Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro
Gly Lys 370 375 380136385PRTArtificial
sequenceSynthetic polypeptide 136Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu Gly
Arg Thr Gly Leu Leu Ala Glu Pro Lys Ser Ser Asp Lys145
150 155 160Thr His Thr Cys Pro Pro Cys
Pro Ala Pro Glu Leu Leu Gly Gly Pro 165
170 175Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr
Leu Met Ile Ser 180 185 190Arg
Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp 195
200 205Pro Glu Val Lys Phe Asn Trp Tyr Val
Asp Gly Val Glu Val His Asn 210 215
220Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val225
230 235 240Val Ser Val Leu
Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu 245
250 255Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu
Pro Ala Pro Ile Glu Lys 260 265
270Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr
275 280 285Leu Pro Pro Ser Arg Asp Glu
Leu Thr Lys Asn Gln Val Ser Leu Thr 290 295
300Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp
Glu305 310 315 320Ser Asn
Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu
325 330 335Asp Ser Asp Gly Ser Phe Phe
Leu Tyr Ser Lys Leu Thr Val Asp Lys 340 345
350Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met
His Glu 355 360 365Ala Leu His Asn
His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 370
375 380Lys385137386PRTArtificial sequenceSynthetic
polypeptide 137Leu Gln Val Thr Val Pro Asp Lys Lys Lys Val Ala Met Leu
Phe Gln1 5 10 15Pro Thr
Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala 20
25 30Val Val Gln Trp Lys Phe Lys Ser Tyr
Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn 50
55 60Leu Glu Trp Asp Pro Tyr Leu Asp Cys
Leu Asp Ser Arg Arg Thr Val65 70 75
80Arg Val Val Ala Ser Lys Gln Gly Ser Thr Val Thr Leu Gly
Asp Phe 85 90 95Tyr Arg
Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile 100
105 110Gly Lys Leu Met Trp Gly Asp Ser Gly
Leu Tyr Tyr Cys Ile Ile Thr 115 120
125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser Val Glu Leu Leu
130 135 140Val Leu Gly Arg Thr Gly Leu
Leu Ala Asp Glu Pro Lys Ser Ser Asp145 150
155 160Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu
Leu Leu Gly Gly 165 170
175Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile
180 185 190Ser Arg Thr Pro Glu Val
Thr Cys Val Val Val Asp Val Ser His Glu 195 200
205Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu
Val His 210 215 220Asn Ala Lys Thr Lys
Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg225 230
235 240Val Val Ser Val Leu Thr Val Leu His Gln
Asp Trp Leu Asn Gly Lys 245 250
255Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu
260 265 270Lys Thr Ile Ser Lys
Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr 275
280 285Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn
Gln Val Ser Leu 290 295 300Thr Cys Leu
Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp305
310 315 320Glu Ser Asn Gly Gln Pro Glu
Asn Asn Tyr Lys Thr Thr Pro Pro Val 325
330 335Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys
Leu Thr Val Asp 340 345 350Lys
Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His 355
360 365Glu Ala Leu His Asn His Tyr Thr Gln
Lys Ser Leu Ser Leu Ser Pro 370 375
380Gly Lys385138387PRTArtificial sequenceSynthetic polypeptide 138Leu Gln
Val Thr Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1 5
10 15Pro Thr Val Leu Arg Cys His Phe
Ser Thr Ser Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg Met Gly
Glu 35 40 45Ser Leu Gly Met Ser
Ser Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn 50 55
60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser Arg Arg
Thr Val65 70 75 80Arg
Val Val Ala Ser Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
85 90 95Tyr Arg Gly Arg Glu Ile Thr
Ile Val His Asp Ala Asp Leu Gln Ile 100 105
110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr Cys Ile
Ile Thr 115 120 125Thr Pro Asp Asp
Leu Glu Gly Lys Asn Glu Asp Ser Val Glu Leu Leu 130
135 140Val Leu Gly Arg Thr Gly Leu Leu Ala Asp Leu Glu
Pro Lys Ser Ser145 150 155
160Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly
165 170 175Gly Pro Ser Val Phe
Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met 180
185 190Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val
Asp Val Ser His 195 200 205Glu Asp
Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val 210
215 220His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln
Tyr Asn Ser Thr Tyr225 230 235
240Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly
245 250 255Lys Glu Tyr Lys
Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile 260
265 270Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro
Arg Glu Pro Gln Val 275 280 285Tyr
Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser 290
295 300Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro
Ser Asp Ile Ala Val Glu305 310 315
320Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro
Pro 325 330 335Val Leu Asp
Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val 340
345 350Asp Lys Ser Arg Trp Gln Gln Gly Asn Val
Phe Ser Cys Ser Val Met 355 360
365His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser 370
375 380Pro Gly Lys385139388PRTArtificial
sequenceSynthetic polypeptide 139Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu Gly
Arg Thr Gly Leu Leu Ala Asp Leu Leu Glu Pro Lys Ser145
150 155 160Ser Asp Lys Thr His Thr Cys
Pro Pro Cys Pro Ala Pro Glu Leu Leu 165
170 175Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro
Lys Asp Thr Leu 180 185 190Met
Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser 195
200 205His Glu Asp Pro Glu Val Lys Phe Asn
Trp Tyr Val Asp Gly Val Glu 210 215
220Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr225
230 235 240Tyr Arg Val Val
Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn 245
250 255Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn
Lys Ala Leu Pro Ala Pro 260 265
270Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln
275 280 285Val Tyr Thr Leu Pro Pro Ser
Arg Asp Glu Leu Thr Lys Asn Gln Val 290 295
300Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala
Val305 310 315 320Glu Trp
Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro
325 330 335Pro Val Leu Asp Ser Asp Gly
Ser Phe Phe Leu Tyr Ser Lys Leu Thr 340 345
350Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys
Ser Val 355 360 365Met His Glu Ala
Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu 370
375 380Ser Pro Gly Lys385140389PRTArtificial
sequenceSynthetic polypeptide 140Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu Gly
Arg Thr Gly Leu Leu Ala Asp Leu Leu Pro Glu Pro Lys145
150 155 160Ser Ser Asp Lys Thr His Thr
Cys Pro Pro Cys Pro Ala Pro Glu Leu 165
170 175Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys
Pro Lys Asp Thr 180 185 190Leu
Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val 195
200 205Ser His Glu Asp Pro Glu Val Lys Phe
Asn Trp Tyr Val Asp Gly Val 210 215
220Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser225
230 235 240Thr Tyr Arg Val
Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 245
250 255Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser
Asn Lys Ala Leu Pro Ala 260 265
270Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro
275 280 285Gln Val Tyr Thr Leu Pro Pro
Ser Arg Asp Glu Leu Thr Lys Asn Gln 290 295
300Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile
Ala305 310 315 320Val Glu
Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr
325 330 335Pro Pro Val Leu Asp Ser Asp
Gly Ser Phe Phe Leu Tyr Ser Lys Leu 340 345
350Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser
Cys Ser 355 360 365Val Met His Glu
Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 370
375 380Leu Ser Pro Gly Lys385141390PRTArtificial
sequenceSynthetic polypeptide 141Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu Gly
Arg Thr Gly Leu Leu Ala Asp Leu Leu Pro Ser Glu Pro145
150 155 160Lys Ser Ser Asp Lys Thr His
Thr Cys Pro Pro Cys Pro Ala Pro Glu 165
170 175Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro
Lys Pro Lys Asp 180 185 190Thr
Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp 195
200 205Val Ser His Glu Asp Pro Glu Val Lys
Phe Asn Trp Tyr Val Asp Gly 210 215
220Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn225
230 235 240Ser Thr Tyr Arg
Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp 245
250 255Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val
Ser Asn Lys Ala Leu Pro 260 265
270Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu
275 280 285Pro Gln Val Tyr Thr Leu Pro
Pro Ser Arg Asp Glu Leu Thr Lys Asn 290 295
300Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp
Ile305 310 315 320Ala Val
Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr
325 330 335Thr Pro Pro Val Leu Asp Ser
Asp Gly Ser Phe Phe Leu Tyr Ser Lys 340 345
350Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe
Ser Cys 355 360 365Ser Val Met His
Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu 370
375 380Ser Leu Ser Pro Gly Lys385
390142391PRTArtificial sequenceSynthetic polypeptide 142Leu Gln Val Thr
Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1 5
10 15Pro Thr Val Leu Arg Cys His Phe Ser Thr
Ser Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu
35 40 45Ser Leu Gly Met Ser Ser Thr Arg
Ala Gln Ser Leu Ser Lys Arg Asn 50 55
60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65
70 75 80Arg Val Val Ala Ser
Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe 85
90 95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp
Ala Asp Leu Gln Ile 100 105
110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr
115 120 125Thr Pro Asp Asp Leu Glu Gly
Lys Asn Glu Asp Ser Val Glu Leu Leu 130 135
140Val Leu Gly Arg Thr Gly Leu Leu Ala Asp Leu Leu Pro Ser Phe
Glu145 150 155 160Pro Lys
Ser Ser Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro
165 170 175Glu Leu Leu Gly Gly Pro Ser
Val Phe Leu Phe Pro Pro Lys Pro Lys 180 185
190Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val
Val Val 195 200 205Asp Val Ser His
Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp 210
215 220Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg
Glu Glu Gln Tyr225 230 235
240Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp
245 250 255Trp Leu Asn Gly Lys
Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu 260
265 270Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys
Gly Gln Pro Arg 275 280 285Glu Pro
Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys 290
295 300Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly
Phe Tyr Pro Ser Asp305 310 315
320Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys
325 330 335Thr Thr Pro Pro
Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser 340
345 350Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln
Gly Asn Val Phe Ser 355 360 365Cys
Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser 370
375 380Leu Ser Leu Ser Pro Gly Lys385
390143392PRTArtificial sequenceSynthetic polypeptide 143Leu Gln Val
Thr Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1 5
10 15Pro Thr Val Leu Arg Cys His Phe Ser
Thr Ser Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu
35 40 45Ser Leu Gly Met Ser Ser Thr
Arg Ala Gln Ser Leu Ser Lys Arg Asn 50 55
60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65
70 75 80Arg Val Val Ala
Ser Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe 85
90 95Tyr Arg Gly Arg Glu Ile Thr Ile Val His
Asp Ala Asp Leu Gln Ile 100 105
110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr
115 120 125Thr Pro Asp Asp Leu Glu Gly
Lys Asn Glu Asp Ser Val Glu Leu Leu 130 135
140Val Leu Gly Arg Thr Gly Leu Leu Ala Asp Leu Leu Pro Ser Phe
Ala145 150 155 160Glu Pro
Lys Ser Ser Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala
165 170 175Pro Glu Leu Leu Gly Gly Pro
Ser Val Phe Leu Phe Pro Pro Lys Pro 180 185
190Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys
Val Val 195 200 205Val Asp Val Ser
His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val 210
215 220Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro
Arg Glu Glu Gln225 230 235
240Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln
245 250 255Asp Trp Leu Asn Gly
Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala 260
265 270Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala
Lys Gly Gln Pro 275 280 285Arg Glu
Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr 290
295 300Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys
Gly Phe Tyr Pro Ser305 310 315
320Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr
325 330 335Lys Thr Thr Pro
Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr 340
345 350Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln
Gln Gly Asn Val Phe 355 360 365Ser
Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys 370
375 380Ser Leu Ser Leu Ser Pro Gly Lys385
390144393PRTArtificial sequenceSynthetic polypeptide 144Leu Gln
Val Thr Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1 5
10 15Pro Thr Val Leu Arg Cys His Phe
Ser Thr Ser Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg Met Gly
Glu 35 40 45Ser Leu Gly Met Ser
Ser Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn 50 55
60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser Arg Arg
Thr Val65 70 75 80Arg
Val Val Ala Ser Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
85 90 95Tyr Arg Gly Arg Glu Ile Thr
Ile Val His Asp Ala Asp Leu Gln Ile 100 105
110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr Cys Ile
Ile Thr 115 120 125Thr Pro Asp Asp
Leu Glu Gly Lys Asn Glu Asp Ser Val Glu Leu Leu 130
135 140Val Leu Gly Arg Thr Gly Leu Leu Ala Asp Leu Leu
Pro Ser Phe Ala145 150 155
160Val Glu Pro Lys Ser Ser Asp Lys Thr His Thr Cys Pro Pro Cys Pro
165 170 175Ala Pro Glu Leu Leu
Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys 180
185 190Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu
Val Thr Cys Val 195 200 205Val Val
Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr 210
215 220Val Asp Gly Val Glu Val His Asn Ala Lys Thr
Lys Pro Arg Glu Glu225 230 235
240Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His
245 250 255Gln Asp Trp Leu
Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys 260
265 270Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser
Lys Ala Lys Gly Gln 275 280 285Pro
Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu 290
295 300Thr Lys Asn Gln Val Ser Leu Thr Cys Leu
Val Lys Gly Phe Tyr Pro305 310 315
320Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn
Asn 325 330 335Tyr Lys Thr
Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu 340
345 350Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg
Trp Gln Gln Gly Asn Val 355 360
365Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln 370
375 380Lys Ser Leu Ser Leu Ser Pro Gly
Lys385 390145394PRTArtificial sequenceSynthetic
polypeptide 145Leu Gln Val Thr Val Pro Asp Lys Lys Lys Val Ala Met Leu
Phe Gln1 5 10 15Pro Thr
Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala 20
25 30Val Val Gln Trp Lys Phe Lys Ser Tyr
Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn 50
55 60Leu Glu Trp Asp Pro Tyr Leu Asp Cys
Leu Asp Ser Arg Arg Thr Val65 70 75
80Arg Val Val Ala Ser Lys Gln Gly Ser Thr Val Thr Leu Gly
Asp Phe 85 90 95Tyr Arg
Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile 100
105 110Gly Lys Leu Met Trp Gly Asp Ser Gly
Leu Tyr Tyr Cys Ile Ile Thr 115 120
125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser Val Glu Leu Leu
130 135 140Val Leu Gly Arg Thr Gly Leu
Leu Ala Asp Leu Leu Pro Ser Phe Ala145 150
155 160Val Glu Glu Pro Lys Ser Ser Asp Lys Thr His Thr
Cys Pro Pro Cys 165 170
175Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro
180 185 190Lys Pro Lys Asp Thr Leu
Met Ile Ser Arg Thr Pro Glu Val Thr Cys 195 200
205Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe
Asn Trp 210 215 220Tyr Val Asp Gly Val
Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu225 230
235 240Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val
Ser Val Leu Thr Val Leu 245 250
255His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn
260 265 270Lys Ala Leu Pro Ala
Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly 275
280 285Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro
Ser Arg Asp Glu 290 295 300Leu Thr Lys
Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr305
310 315 320Pro Ser Asp Ile Ala Val Glu
Trp Glu Ser Asn Gly Gln Pro Glu Asn 325
330 335Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp
Gly Ser Phe Phe 340 345 350Leu
Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn 355
360 365Val Phe Ser Cys Ser Val Met His Glu
Ala Leu His Asn His Tyr Thr 370 375
380Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys385
390146395PRTArtificial sequenceSynthetic polypeptide 146Leu Gln Val Thr
Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1 5
10 15Pro Thr Val Leu Arg Cys His Phe Ser Thr
Ser Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu
35 40 45Ser Leu Gly Met Ser Ser Thr Arg
Ala Gln Ser Leu Ser Lys Arg Asn 50 55
60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65
70 75 80Arg Val Val Ala Ser
Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe 85
90 95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp
Ala Asp Leu Gln Ile 100 105
110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr
115 120 125Thr Pro Asp Asp Leu Glu Gly
Lys Asn Glu Asp Ser Val Glu Leu Leu 130 135
140Val Leu Gly Arg Thr Gly Leu Leu Ala Asp Leu Leu Pro Ser Phe
Ala145 150 155 160Val Glu
Ile Glu Pro Lys Ser Ser Asp Lys Thr His Thr Cys Pro Pro
165 170 175Cys Pro Ala Pro Glu Leu Leu
Gly Gly Pro Ser Val Phe Leu Phe Pro 180 185
190Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu
Val Thr 195 200 205Cys Val Val Val
Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn 210
215 220Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys
Thr Lys Pro Arg225 230 235
240Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val
245 250 255Leu His Gln Asp Trp
Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser 260
265 270Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile
Ser Lys Ala Lys 275 280 285Gly Gln
Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp 290
295 300Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys
Leu Val Lys Gly Phe305 310 315
320Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu
325 330 335Asn Asn Tyr Lys
Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe 340
345 350Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser
Arg Trp Gln Gln Gly 355 360 365Asn
Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr 370
375 380Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly
Lys385 390 395147398PRTArtificial
sequenceSynthetic polypeptide 147Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu Gly
Arg Thr Gly Leu Leu Ala Asp Leu Leu Pro Ser Phe Ala145
150 155 160Val Glu Ile Met Pro Glu Glu
Pro Lys Ser Ser Asp Lys Thr His Thr 165
170 175Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly
Pro Ser Val Phe 180 185 190Leu
Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro 195
200 205Glu Val Thr Cys Val Val Val Asp Val
Ser His Glu Asp Pro Glu Val 210 215
220Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr225
230 235 240Lys Pro Arg Glu
Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val 245
250 255Leu Thr Val Leu His Gln Asp Trp Leu Asn
Gly Lys Glu Tyr Lys Cys 260 265
270Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser
275 280 285Lys Ala Lys Gly Gln Pro Arg
Glu Pro Gln Val Tyr Thr Leu Pro Pro 290 295
300Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu
Val305 310 315 320Lys Gly
Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly
325 330 335Gln Pro Glu Asn Asn Tyr Lys
Thr Thr Pro Pro Val Leu Asp Ser Asp 340 345
350Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser
Arg Trp 355 360 365Gln Gln Gly Asn
Val Phe Ser Cys Ser Val Met His Glu Ala Leu His 370
375 380Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro
Gly Lys385 390 395148397PRTArtificial
sequenceSynthetic polypeptide 148Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu Gly
Arg Thr Gly Leu Leu Ala Asp Leu Leu Pro Ser Phe Ala145
150 155 160Val Glu Ile Met Pro Glu Pro
Lys Ser Ser Asp Lys Thr His Thr Cys 165
170 175Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro
Ser Val Phe Leu 180 185 190Phe
Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu 195
200 205Val Thr Cys Val Val Val Asp Val Ser
His Glu Asp Pro Glu Val Lys 210 215
220Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys225
230 235 240Pro Arg Glu Glu
Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu 245
250 255Thr Val Leu His Gln Asp Trp Leu Asn Gly
Lys Glu Tyr Lys Cys Lys 260 265
270Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys
275 280 285Ala Lys Gly Gln Pro Arg Glu
Pro Gln Val Tyr Thr Leu Pro Pro Ser 290 295
300Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val
Lys305 310 315 320Gly Phe
Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln
325 330 335Pro Glu Asn Asn Tyr Lys Thr
Thr Pro Pro Val Leu Asp Ser Asp Gly 340 345
350Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg
Trp Gln 355 360 365Gln Gly Asn Val
Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn 370
375 380His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly
Lys385 390 395149396PRTArtificial
sequenceSynthetic polypeptide 149Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu Gly
Arg Thr Gly Leu Leu Ala Asp Leu Leu Pro Ser Gly Ala145
150 155 160Val Glu Ile Met Glu Pro Lys
Ser Ser Asp Lys Thr His Thr Cys Pro 165
170 175Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser
Val Phe Leu Phe 180 185 190Pro
Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val 195
200 205Thr Cys Val Val Val Asp Val Ser His
Glu Asp Pro Glu Val Lys Phe 210 215
220Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro225
230 235 240Arg Glu Glu Gln
Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr 245
250 255Val Leu His Gln Asp Trp Leu Asn Gly Lys
Glu Tyr Lys Cys Lys Val 260 265
270Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala
275 280 285Lys Gly Gln Pro Arg Glu Pro
Gln Val Tyr Thr Leu Pro Pro Ser Arg 290 295
300Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys
Gly305 310 315 320Phe Tyr
Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro
325 330 335Glu Asn Asn Tyr Lys Thr Thr
Pro Pro Val Leu Asp Ser Asp Gly Ser 340 345
350Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp
Gln Gln 355 360 365Gly Asn Val Phe
Ser Cys Ser Val Met His Glu Ala Leu His Asn His 370
375 380Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys385
390 395150399PRTArtificial
sequenceSynthetic polypeptide 150Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu Gly
Arg Thr Gly Leu Leu Ala Asp Leu Leu Pro Ser Phe Ala145
150 155 160Val Glu Ile Met Pro Glu Trp
Glu Pro Lys Ser Ser Asp Lys Thr His 165
170 175Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly
Gly Pro Ser Val 180 185 190Phe
Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr 195
200 205Pro Glu Val Thr Cys Val Val Val Asp
Val Ser His Glu Asp Pro Glu 210 215
220Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys225
230 235 240Thr Lys Pro Arg
Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser 245
250 255Val Leu Thr Val Leu His Gln Asp Trp Leu
Asn Gly Lys Glu Tyr Lys 260 265
270Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile
275 280 285Ser Lys Ala Lys Gly Gln Pro
Arg Glu Pro Gln Val Tyr Thr Leu Pro 290 295
300Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys
Leu305 310 315 320Val Lys
Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn
325 330 335Gly Gln Pro Glu Asn Asn Tyr
Lys Thr Thr Pro Pro Val Leu Asp Ser 340 345
350Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys
Ser Arg 355 360 365Trp Gln Gln Gly
Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu 370
375 380His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser
Pro Gly Lys385 390 395151400PRTArtificial
sequenceSynthetic polypeptide 151Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu Gly
Arg Thr Gly Leu Leu Ala Asp Leu Leu Pro Ser Phe Ala145
150 155 160Val Glu Ile Met Pro Glu Trp
Val Glu Pro Lys Ser Ser Asp Lys Thr 165
170 175His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu
Gly Gly Pro Ser 180 185 190Val
Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg 195
200 205Thr Pro Glu Val Thr Cys Val Val Val
Asp Val Ser His Glu Asp Pro 210 215
220Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala225
230 235 240Lys Thr Lys Pro
Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val 245
250 255Ser Val Leu Thr Val Leu His Gln Asp Trp
Leu Asn Gly Lys Glu Tyr 260 265
270Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr
275 280 285Ile Ser Lys Ala Lys Gly Gln
Pro Arg Glu Pro Gln Val Tyr Thr Leu 290 295
300Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr
Cys305 310 315 320Leu Val
Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser
325 330 335Asn Gly Gln Pro Glu Asn Asn
Tyr Lys Thr Thr Pro Pro Val Leu Asp 340 345
350Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp
Lys Ser 355 360 365Arg Trp Gln Gln
Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala 370
375 380Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu
Ser Pro Gly Lys385 390 395
400152401PRTArtificial sequenceSynthetic polypeptide 152Leu Gln Val Thr
Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1 5
10 15Pro Thr Val Leu Arg Cys His Phe Ser Thr
Ser Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu
35 40 45Ser Leu Gly Met Ser Ser Thr Arg
Ala Gln Ser Leu Ser Lys Arg Asn 50 55
60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65
70 75 80Arg Val Val Ala Ser
Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe 85
90 95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp
Ala Asp Leu Gln Ile 100 105
110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr
115 120 125Thr Pro Asp Asp Leu Glu Gly
Lys Asn Glu Asp Ser Val Glu Leu Leu 130 135
140Val Leu Gly Arg Thr Gly Leu Leu Ala Asp Leu Leu Pro Ser Phe
Ala145 150 155 160Val Glu
Ile Met Pro Glu Trp Val Phe Glu Pro Lys Ser Ser Asp Lys
165 170 175Thr His Thr Cys Pro Pro Cys
Pro Ala Pro Glu Leu Leu Gly Gly Pro 180 185
190Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met
Ile Ser 195 200 205Arg Thr Pro Glu
Val Thr Cys Val Val Val Asp Val Ser His Glu Asp 210
215 220Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val
Glu Val His Asn225 230 235
240Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val
245 250 255Val Ser Val Leu Thr
Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu 260
265 270Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala
Pro Ile Glu Lys 275 280 285Thr Ile
Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr 290
295 300Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn
Gln Val Ser Leu Thr305 310 315
320Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu
325 330 335Ser Asn Gly Gln
Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu 340
345 350Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys
Leu Thr Val Asp Lys 355 360 365Ser
Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu 370
375 380Ala Leu His Asn His Tyr Thr Gln Lys Ser
Leu Ser Leu Ser Pro Gly385 390 395
400Lys153370PRTArtificial sequenceSynthetic polypeptide 153Asp
Lys Lys Lys Val Ala Met Leu Phe Gln Pro Thr Val Leu Arg Cys1
5 10 15His Phe Ser Thr Ser Ser His
Gln Pro Ala Val Val Gln Trp Lys Phe 20 25
30Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu Ser Leu Gly Met
Ser Ser 35 40 45Thr Arg Ala Gln
Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp Pro Tyr 50 55
60Leu Asp Cys Leu Asp Ser Arg Arg Thr Val Arg Val Val
Ala Ser Lys65 70 75
80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile
85 90 95Thr Ile Val His Asp Ala
Asp Leu Gln Ile Gly Lys Leu Met Trp Gly 100
105 110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr Thr Pro
Asp Asp Leu Glu 115 120 125Gly Lys
Asn Glu Asp Ser Val Glu Leu Leu Glu Pro Lys Ser Ser Asp 130
135 140Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro
Glu Leu Leu Gly Gly145 150 155
160Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile
165 170 175Ser Arg Thr Pro
Glu Val Thr Cys Val Val Val Asp Val Ser His Glu 180
185 190Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp
Gly Val Glu Val His 195 200 205Asn
Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg 210
215 220Val Val Ser Val Leu Thr Val Leu His Gln
Asp Trp Leu Asn Gly Lys225 230 235
240Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile
Glu 245 250 255Lys Thr Ile
Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr 260
265 270Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr
Lys Asn Gln Val Ser Leu 275 280
285Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp 290
295 300Glu Ser Asn Gly Gln Pro Glu Asn
Asn Tyr Lys Thr Thr Pro Pro Val305 310
315 320Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys
Leu Thr Val Asp 325 330
335Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His
340 345 350Glu Ala Leu His Asn His
Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro 355 360
365Gly Lys 370154371PRTArtificial sequenceSynthetic
polypeptide 154Asp Lys Lys Lys Val Ala Met Leu Phe Gln Pro Thr Val Leu
Arg Cys1 5 10 15His Phe
Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe 20
25 30Lys Ser Tyr Cys Gln Asp Arg Met Gly
Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp Pro Tyr 50
55 60Leu Asp Cys Leu Asp Ser Arg Arg Thr
Val Arg Val Val Ala Ser Lys65 70 75
80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe Tyr Arg Gly Arg
Glu Ile 85 90 95Thr Ile
Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly 100
105 110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile
Thr Thr Pro Asp Asp Leu Glu 115 120
125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Glu Pro Lys Ser Ser
130 135 140Asp Lys Thr His Thr Cys Pro
Pro Cys Pro Ala Pro Glu Leu Leu Gly145 150
155 160Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys
Asp Thr Leu Met 165 170
175Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His
180 185 190Glu Asp Pro Glu Val Lys
Phe Asn Trp Tyr Val Asp Gly Val Glu Val 195 200
205His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser
Thr Tyr 210 215 220Arg Val Val Ser Val
Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly225 230
235 240Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys
Ala Leu Pro Ala Pro Ile 245 250
255Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val
260 265 270Tyr Thr Leu Pro Pro
Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser 275
280 285Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp
Ile Ala Val Glu 290 295 300Trp Glu Ser
Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro305
310 315 320Val Leu Asp Ser Asp Gly Ser
Phe Phe Leu Tyr Ser Lys Leu Thr Val 325
330 335Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser
Cys Ser Val Met 340 345 350His
Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser 355
360 365Pro Gly Lys 370155372PRTArtificial
sequenceSynthetic polypeptide 155Asp Lys Lys Lys Val Ala Met Leu Phe Gln
Pro Thr Val Leu Arg Cys1 5 10
15His Phe Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe
20 25 30Lys Ser Tyr Cys Gln Asp
Arg Met Gly Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp
Pro Tyr 50 55 60Leu Asp Cys Leu Asp
Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65 70
75 80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
Tyr Arg Gly Arg Glu Ile 85 90
95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly
100 105 110Asp Ser Gly Leu Tyr
Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu 115
120 125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu
Glu Pro Lys Ser 130 135 140Ser Asp Lys
Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu145
150 155 160Gly Gly Pro Ser Val Phe Leu
Phe Pro Pro Lys Pro Lys Asp Thr Leu 165
170 175Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val
Val Asp Val Ser 180 185 190His
Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu 195
200 205Val His Asn Ala Lys Thr Lys Pro Arg
Glu Glu Gln Tyr Asn Ser Thr 210 215
220Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn225
230 235 240Gly Lys Glu Tyr
Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro 245
250 255Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly
Gln Pro Arg Glu Pro Gln 260 265
270Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val
275 280 285Ser Leu Thr Cys Leu Val Lys
Gly Phe Tyr Pro Ser Asp Ile Ala Val 290 295
300Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr
Pro305 310 315 320Pro Val
Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr
325 330 335Val Asp Lys Ser Arg Trp Gln
Gln Gly Asn Val Phe Ser Cys Ser Val 340 345
350Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu
Ser Leu 355 360 365Ser Pro Gly Lys
370156373PRTArtificial sequenceSynthetic polypeptide 156Asp Lys Lys
Lys Val Ala Met Leu Phe Gln Pro Thr Val Leu Arg Cys1 5
10 15His Phe Ser Thr Ser Ser His Gln Pro
Ala Val Val Gln Trp Lys Phe 20 25
30Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu Ser Leu Gly Met Ser Ser
35 40 45Thr Arg Ala Gln Ser Leu Ser
Lys Arg Asn Leu Glu Trp Asp Pro Tyr 50 55
60Leu Asp Cys Leu Asp Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65
70 75 80Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile 85
90 95Thr Ile Val His Asp Ala Asp Leu Gln Ile
Gly Lys Leu Met Trp Gly 100 105
110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu
115 120 125Gly Lys Asn Glu Asp Ser Val
Glu Leu Leu Val Leu Gly Glu Pro Lys 130 135
140Ser Ser Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu
Leu145 150 155 160Leu Gly
Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr
165 170 175Leu Met Ile Ser Arg Thr Pro
Glu Val Thr Cys Val Val Val Asp Val 180 185
190Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp
Gly Val 195 200 205Glu Val His Asn
Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser 210
215 220Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His
Gln Asp Trp Leu225 230 235
240Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala
245 250 255Pro Ile Glu Lys Thr
Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 260
265 270Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu
Thr Lys Asn Gln 275 280 285Val Ser
Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala 290
295 300Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn
Asn Tyr Lys Thr Thr305 310 315
320Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu
325 330 335Thr Val Asp Lys
Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 340
345 350Val Met His Glu Ala Leu His Asn His Tyr Thr
Gln Lys Ser Leu Ser 355 360 365Leu
Ser Pro Gly Lys 370157374PRTArtificial sequenceSynthetic polypeptide
157Asp Lys Lys Lys Val Ala Met Leu Phe Gln Pro Thr Val Leu Arg Cys1
5 10 15His Phe Ser Thr Ser Ser
His Gln Pro Ala Val Val Gln Trp Lys Phe 20 25
30Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu Ser Leu Gly
Met Ser Ser 35 40 45Thr Arg Ala
Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp Pro Tyr 50
55 60Leu Asp Cys Leu Asp Ser Arg Arg Thr Val Arg Val
Val Ala Ser Lys65 70 75
80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile
85 90 95Thr Ile Val His Asp Ala
Asp Leu Gln Ile Gly Lys Leu Met Trp Gly 100
105 110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr Thr Pro
Asp Asp Leu Glu 115 120 125Gly Lys
Asn Glu Asp Ser Val Glu Leu Leu Val Leu Gly Arg Glu Pro 130
135 140Lys Ser Ser Asp Lys Thr His Thr Cys Pro Pro
Cys Pro Ala Pro Glu145 150 155
160Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp
165 170 175Thr Leu Met Ile
Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp 180
185 190Val Ser His Glu Asp Pro Glu Val Lys Phe Asn
Trp Tyr Val Asp Gly 195 200 205Val
Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn 210
215 220Ser Thr Tyr Arg Val Val Ser Val Leu Thr
Val Leu His Gln Asp Trp225 230 235
240Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu
Pro 245 250 255Ala Pro Ile
Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu 260
265 270Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg
Asp Glu Leu Thr Lys Asn 275 280
285Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile 290
295 300Ala Val Glu Trp Glu Ser Asn Gly
Gln Pro Glu Asn Asn Tyr Lys Thr305 310
315 320Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe
Leu Tyr Ser Lys 325 330
335Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys
340 345 350Ser Val Met His Glu Ala
Leu His Asn His Tyr Thr Gln Lys Ser Leu 355 360
365Ser Leu Ser Pro Gly Lys 370158375PRTArtificial
sequenceSynthetic polypeptide 158Asp Lys Lys Lys Val Ala Met Leu Phe Gln
Pro Thr Val Leu Arg Cys1 5 10
15His Phe Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe
20 25 30Lys Ser Tyr Cys Gln Asp
Arg Met Gly Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp
Pro Tyr 50 55 60Leu Asp Cys Leu Asp
Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65 70
75 80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
Tyr Arg Gly Arg Glu Ile 85 90
95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly
100 105 110Asp Ser Gly Leu Tyr
Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu 115
120 125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu
Gly Arg Thr Glu 130 135 140Pro Lys Ser
Ser Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro145
150 155 160Glu Leu Leu Gly Gly Pro Ser
Val Phe Leu Phe Pro Pro Lys Pro Lys 165
170 175Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr
Cys Val Val Val 180 185 190Asp
Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp 195
200 205Gly Val Glu Val His Asn Ala Lys Thr
Lys Pro Arg Glu Glu Gln Tyr 210 215
220Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp225
230 235 240Trp Leu Asn Gly
Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu 245
250 255Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys
Ala Lys Gly Gln Pro Arg 260 265
270Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys
275 280 285Asn Gln Val Ser Leu Thr Cys
Leu Val Lys Gly Phe Tyr Pro Ser Asp 290 295
300Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr
Lys305 310 315 320Thr Thr
Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser
325 330 335Lys Leu Thr Val Asp Lys Ser
Arg Trp Gln Gln Gly Asn Val Phe Ser 340 345
350Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln
Lys Ser 355 360 365Leu Ser Leu Ser
Pro Gly Lys 370 375159376PRTArtificial
sequenceSynthetic polypeptide 159Asp Lys Lys Lys Val Ala Met Leu Phe Gln
Pro Thr Val Leu Arg Cys1 5 10
15His Phe Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe
20 25 30Lys Ser Tyr Cys Gln Asp
Arg Met Gly Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp
Pro Tyr 50 55 60Leu Asp Cys Leu Asp
Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65 70
75 80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
Tyr Arg Gly Arg Glu Ile 85 90
95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly
100 105 110Asp Ser Gly Leu Tyr
Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu 115
120 125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu
Gly Arg Thr Gly 130 135 140Glu Pro Lys
Ser Ser Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala145
150 155 160Pro Glu Leu Leu Gly Gly Pro
Ser Val Phe Leu Phe Pro Pro Lys Pro 165
170 175Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val
Thr Cys Val Val 180 185 190Val
Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val 195
200 205Asp Gly Val Glu Val His Asn Ala Lys
Thr Lys Pro Arg Glu Glu Gln 210 215
220Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln225
230 235 240Asp Trp Leu Asn
Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala 245
250 255Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser
Lys Ala Lys Gly Gln Pro 260 265
270Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr
275 280 285Lys Asn Gln Val Ser Leu Thr
Cys Leu Val Lys Gly Phe Tyr Pro Ser 290 295
300Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn
Tyr305 310 315 320Lys Thr
Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr
325 330 335Ser Lys Leu Thr Val Asp Lys
Ser Arg Trp Gln Gln Gly Asn Val Phe 340 345
350Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr
Gln Lys 355 360 365Ser Leu Ser Leu
Ser Pro Gly Lys 370 375160377PRTArtificial
sequenceSynthetic polypeptide 160Asp Lys Lys Lys Val Ala Met Leu Phe Gln
Pro Thr Val Leu Arg Cys1 5 10
15His Phe Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe
20 25 30Lys Ser Tyr Cys Gln Asp
Arg Met Gly Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp
Pro Tyr 50 55 60Leu Asp Cys Leu Asp
Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65 70
75 80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
Tyr Arg Gly Arg Glu Ile 85 90
95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly
100 105 110Asp Ser Gly Leu Tyr
Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu 115
120 125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu
Gly Arg Thr Gly 130 135 140Leu Glu Pro
Lys Ser Ser Asp Lys Thr His Thr Cys Pro Pro Cys Pro145
150 155 160Ala Pro Glu Leu Leu Gly Gly
Pro Ser Val Phe Leu Phe Pro Pro Lys 165
170 175Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu
Val Thr Cys Val 180 185 190Val
Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr 195
200 205Val Asp Gly Val Glu Val His Asn Ala
Lys Thr Lys Pro Arg Glu Glu 210 215
220Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His225
230 235 240Gln Asp Trp Leu
Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys 245
250 255Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile
Ser Lys Ala Lys Gly Gln 260 265
270Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu
275 280 285Thr Lys Asn Gln Val Ser Leu
Thr Cys Leu Val Lys Gly Phe Tyr Pro 290 295
300Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn
Asn305 310 315 320Tyr Lys
Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu
325 330 335Tyr Ser Lys Leu Thr Val Asp
Lys Ser Arg Trp Gln Gln Gly Asn Val 340 345
350Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr
Thr Gln 355 360 365Lys Ser Leu Ser
Leu Ser Pro Gly Lys 370 375161378PRTArtificial
sequenceSynthetic polypeptide 161Asp Lys Lys Lys Val Ala Met Leu Phe Gln
Pro Thr Val Leu Arg Cys1 5 10
15His Phe Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe
20 25 30Lys Ser Tyr Cys Gln Asp
Arg Met Gly Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp
Pro Tyr 50 55 60Leu Asp Cys Leu Asp
Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65 70
75 80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
Tyr Arg Gly Arg Glu Ile 85 90
95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly
100 105 110Asp Ser Gly Leu Tyr
Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu 115
120 125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu
Gly Arg Thr Gly 130 135 140Leu Leu Glu
Pro Lys Ser Ser Asp Lys Thr His Thr Cys Pro Pro Cys145
150 155 160Pro Ala Pro Glu Leu Leu Gly
Gly Pro Ser Val Phe Leu Phe Pro Pro 165
170 175Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro
Glu Val Thr Cys 180 185 190Val
Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp 195
200 205Tyr Val Asp Gly Val Glu Val His Asn
Ala Lys Thr Lys Pro Arg Glu 210 215
220Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu225
230 235 240His Gln Asp Trp
Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn 245
250 255Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr
Ile Ser Lys Ala Lys Gly 260 265
270Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu
275 280 285Leu Thr Lys Asn Gln Val Ser
Leu Thr Cys Leu Val Lys Gly Phe Tyr 290 295
300Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu
Asn305 310 315 320Asn Tyr
Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe
325 330 335Leu Tyr Ser Lys Leu Thr Val
Asp Lys Ser Arg Trp Gln Gln Gly Asn 340 345
350Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His
Tyr Thr 355 360 365Gln Lys Ser Leu
Ser Leu Ser Pro Gly Lys 370 375162379PRTArtificial
sequenceSynthetic polypeptide 162Asp Lys Lys Lys Val Ala Met Leu Phe Gln
Pro Thr Val Leu Arg Cys1 5 10
15His Phe Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe
20 25 30Lys Ser Tyr Cys Gln Asp
Arg Met Gly Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp
Pro Tyr 50 55 60Leu Asp Cys Leu Asp
Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65 70
75 80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
Tyr Arg Gly Arg Glu Ile 85 90
95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly
100 105 110Asp Ser Gly Leu Tyr
Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu 115
120 125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu
Gly Arg Thr Gly 130 135 140Leu Leu Ala
Glu Pro Lys Ser Ser Asp Lys Thr His Thr Cys Pro Pro145
150 155 160Cys Pro Ala Pro Glu Leu Leu
Gly Gly Pro Ser Val Phe Leu Phe Pro 165
170 175Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr
Pro Glu Val Thr 180 185 190Cys
Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn 195
200 205Trp Tyr Val Asp Gly Val Glu Val His
Asn Ala Lys Thr Lys Pro Arg 210 215
220Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val225
230 235 240Leu His Gln Asp
Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser 245
250 255Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys
Thr Ile Ser Lys Ala Lys 260 265
270Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp
275 280 285Glu Leu Thr Lys Asn Gln Val
Ser Leu Thr Cys Leu Val Lys Gly Phe 290 295
300Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro
Glu305 310 315 320Asn Asn
Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe
325 330 335Phe Leu Tyr Ser Lys Leu Thr
Val Asp Lys Ser Arg Trp Gln Gln Gly 340 345
350Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn
His Tyr 355 360 365Thr Gln Lys Ser
Leu Ser Leu Ser Pro Gly Lys 370 375163380PRTArtificial
sequenceSynthetic polypeptide 163Asp Lys Lys Lys Val Ala Met Leu Phe Gln
Pro Thr Val Leu Arg Cys1 5 10
15His Phe Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe
20 25 30Lys Ser Tyr Cys Gln Asp
Arg Met Gly Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp
Pro Tyr 50 55 60Leu Asp Cys Leu Asp
Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65 70
75 80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
Tyr Arg Gly Arg Glu Ile 85 90
95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly
100 105 110Asp Ser Gly Leu Tyr
Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu 115
120 125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu
Gly Arg Thr Gly 130 135 140Leu Leu Ala
Asp Glu Pro Lys Ser Ser Asp Lys Thr His Thr Cys Pro145
150 155 160Pro Cys Pro Ala Pro Glu Leu
Leu Gly Gly Pro Ser Val Phe Leu Phe 165
170 175Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg
Thr Pro Glu Val 180 185 190Thr
Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe 195
200 205Asn Trp Tyr Val Asp Gly Val Glu Val
His Asn Ala Lys Thr Lys Pro 210 215
220Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr225
230 235 240Val Leu His Gln
Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val 245
250 255Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu
Lys Thr Ile Ser Lys Ala 260 265
270Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg
275 280 285Asp Glu Leu Thr Lys Asn Gln
Val Ser Leu Thr Cys Leu Val Lys Gly 290 295
300Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln
Pro305 310 315 320Glu Asn
Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser
325 330 335Phe Phe Leu Tyr Ser Lys Leu
Thr Val Asp Lys Ser Arg Trp Gln Gln 340 345
350Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His
Asn His 355 360 365Tyr Thr Gln Lys
Ser Leu Ser Leu Ser Pro Gly Lys 370 375
380164381PRTArtificial sequenceSynthetic polypeptide 164Asp Lys Lys Lys
Val Ala Met Leu Phe Gln Pro Thr Val Leu Arg Cys1 5
10 15His Phe Ser Thr Ser Ser His Gln Pro Ala
Val Val Gln Trp Lys Phe 20 25
30Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu Ser Leu Gly Met Ser Ser
35 40 45Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn Leu Glu Trp Asp Pro Tyr 50 55
60Leu Asp Cys Leu Asp Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65
70 75 80Gln Gly Ser Thr Val
Thr Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile 85
90 95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly
Lys Leu Met Trp Gly 100 105
110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu
115 120 125Gly Lys Asn Glu Asp Ser Val
Glu Leu Leu Val Leu Gly Arg Thr Gly 130 135
140Leu Leu Ala Asp Leu Glu Pro Lys Ser Ser Asp Lys Thr His Thr
Cys145 150 155 160Pro Pro
Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu
165 170 175Phe Pro Pro Lys Pro Lys Asp
Thr Leu Met Ile Ser Arg Thr Pro Glu 180 185
190Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu
Val Lys 195 200 205Phe Asn Trp Tyr
Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys 210
215 220Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val
Val Ser Val Leu225 230 235
240Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys
245 250 255Val Ser Asn Lys Ala
Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys 260
265 270Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr
Leu Pro Pro Ser 275 280 285Arg Asp
Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys 290
295 300Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp
Glu Ser Asn Gly Gln305 310 315
320Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly
325 330 335Ser Phe Phe Leu
Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln 340
345 350Gln Gly Asn Val Phe Ser Cys Ser Val Met His
Glu Ala Leu His Asn 355 360 365His
Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 370
375 380165382PRTArtificial sequenceSynthetic polypeptide
165Asp Lys Lys Lys Val Ala Met Leu Phe Gln Pro Thr Val Leu Arg Cys1
5 10 15His Phe Ser Thr Ser Ser
His Gln Pro Ala Val Val Gln Trp Lys Phe 20 25
30Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu Ser Leu Gly
Met Ser Ser 35 40 45Thr Arg Ala
Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp Pro Tyr 50
55 60Leu Asp Cys Leu Asp Ser Arg Arg Thr Val Arg Val
Val Ala Ser Lys65 70 75
80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile
85 90 95Thr Ile Val His Asp Ala
Asp Leu Gln Ile Gly Lys Leu Met Trp Gly 100
105 110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr Thr Pro
Asp Asp Leu Glu 115 120 125Gly Lys
Asn Glu Asp Ser Val Glu Leu Leu Val Leu Gly Arg Thr Gly 130
135 140Leu Leu Ala Asp Leu Leu Glu Pro Lys Ser Ser
Asp Lys Thr His Thr145 150 155
160Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe
165 170 175Leu Phe Pro Pro
Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro 180
185 190Glu Val Thr Cys Val Val Val Asp Val Ser His
Glu Asp Pro Glu Val 195 200 205Lys
Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr 210
215 220Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr
Tyr Arg Val Val Ser Val225 230 235
240Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys
Cys 245 250 255Lys Val Ser
Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser 260
265 270Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln
Val Tyr Thr Leu Pro Pro 275 280
285Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val 290
295 300Lys Gly Phe Tyr Pro Ser Asp Ile
Ala Val Glu Trp Glu Ser Asn Gly305 310
315 320Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val
Leu Asp Ser Asp 325 330
335Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp
340 345 350Gln Gln Gly Asn Val Phe
Ser Cys Ser Val Met His Glu Ala Leu His 355 360
365Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys
370 375 380166383PRTArtificial
sequenceSynthetic polypeptide 166Asp Lys Lys Lys Val Ala Met Leu Phe Gln
Pro Thr Val Leu Arg Cys1 5 10
15His Phe Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe
20 25 30Lys Ser Tyr Cys Gln Asp
Arg Met Gly Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp
Pro Tyr 50 55 60Leu Asp Cys Leu Asp
Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65 70
75 80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
Tyr Arg Gly Arg Glu Ile 85 90
95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly
100 105 110Asp Ser Gly Leu Tyr
Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu 115
120 125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu
Gly Arg Thr Gly 130 135 140Leu Leu Ala
Asp Leu Leu Pro Glu Pro Lys Ser Ser Asp Lys Thr His145
150 155 160Thr Cys Pro Pro Cys Pro Ala
Pro Glu Leu Leu Gly Gly Pro Ser Val 165
170 175Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met
Ile Ser Arg Thr 180 185 190Pro
Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu 195
200 205Val Lys Phe Asn Trp Tyr Val Asp Gly
Val Glu Val His Asn Ala Lys 210 215
220Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser225
230 235 240Val Leu Thr Val
Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys 245
250 255Cys Lys Val Ser Asn Lys Ala Leu Pro Ala
Pro Ile Glu Lys Thr Ile 260 265
270Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro
275 280 285Pro Ser Arg Asp Glu Leu Thr
Lys Asn Gln Val Ser Leu Thr Cys Leu 290 295
300Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser
Asn305 310 315 320Gly Gln
Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser
325 330 335Asp Gly Ser Phe Phe Leu Tyr
Ser Lys Leu Thr Val Asp Lys Ser Arg 340 345
350Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu
Ala Leu 355 360 365His Asn His Tyr
Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 370 375
380167384PRTArtificial sequenceSynthetic polypeptide 167Asp
Lys Lys Lys Val Ala Met Leu Phe Gln Pro Thr Val Leu Arg Cys1
5 10 15His Phe Ser Thr Ser Ser His
Gln Pro Ala Val Val Gln Trp Lys Phe 20 25
30Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu Ser Leu Gly Met
Ser Ser 35 40 45Thr Arg Ala Gln
Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp Pro Tyr 50 55
60Leu Asp Cys Leu Asp Ser Arg Arg Thr Val Arg Val Val
Ala Ser Lys65 70 75
80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile
85 90 95Thr Ile Val His Asp Ala
Asp Leu Gln Ile Gly Lys Leu Met Trp Gly 100
105 110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr Thr Pro
Asp Asp Leu Glu 115 120 125Gly Lys
Asn Glu Asp Ser Val Glu Leu Leu Val Leu Gly Arg Thr Gly 130
135 140Leu Leu Ala Asp Leu Leu Pro Ser Glu Pro Lys
Ser Ser Asp Lys Thr145 150 155
160His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser
165 170 175Val Phe Leu Phe
Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg 180
185 190Thr Pro Glu Val Thr Cys Val Val Val Asp Val
Ser His Glu Asp Pro 195 200 205Glu
Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala 210
215 220Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn
Ser Thr Tyr Arg Val Val225 230 235
240Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu
Tyr 245 250 255Lys Cys Lys
Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr 260
265 270Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu
Pro Gln Val Tyr Thr Leu 275 280
285Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys 290
295 300Leu Val Lys Gly Phe Tyr Pro Ser
Asp Ile Ala Val Glu Trp Glu Ser305 310
315 320Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro
Pro Val Leu Asp 325 330
335Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser
340 345 350Arg Trp Gln Gln Gly Asn
Val Phe Ser Cys Ser Val Met His Glu Ala 355 360
365Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro
Gly Lys 370 375 380168385PRTArtificial
sequenceSynthetic polypeptide 168Asp Lys Lys Lys Val Ala Met Leu Phe Gln
Pro Thr Val Leu Arg Cys1 5 10
15His Phe Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe
20 25 30Lys Ser Tyr Cys Gln Asp
Arg Met Gly Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp
Pro Tyr 50 55 60Leu Asp Cys Leu Asp
Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65 70
75 80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
Tyr Arg Gly Arg Glu Ile 85 90
95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly
100 105 110Asp Ser Gly Leu Tyr
Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu 115
120 125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu
Gly Arg Thr Gly 130 135 140Leu Leu Ala
Asp Leu Leu Pro Ser Phe Glu Pro Lys Ser Ser Asp Lys145
150 155 160Thr His Thr Cys Pro Pro Cys
Pro Ala Pro Glu Leu Leu Gly Gly Pro 165
170 175Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr
Leu Met Ile Ser 180 185 190Arg
Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp 195
200 205Pro Glu Val Lys Phe Asn Trp Tyr Val
Asp Gly Val Glu Val His Asn 210 215
220Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val225
230 235 240Val Ser Val Leu
Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu 245
250 255Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu
Pro Ala Pro Ile Glu Lys 260 265
270Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr
275 280 285Leu Pro Pro Ser Arg Asp Glu
Leu Thr Lys Asn Gln Val Ser Leu Thr 290 295
300Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp
Glu305 310 315 320Ser Asn
Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu
325 330 335Asp Ser Asp Gly Ser Phe Phe
Leu Tyr Ser Lys Leu Thr Val Asp Lys 340 345
350Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met
His Glu 355 360 365Ala Leu His Asn
His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 370
375 380Lys385169386PRTArtificial sequenceSynthetic
polypeptide 169Asp Lys Lys Lys Val Ala Met Leu Phe Gln Pro Thr Val Leu
Arg Cys1 5 10 15His Phe
Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe 20
25 30Lys Ser Tyr Cys Gln Asp Arg Met Gly
Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp Pro Tyr 50
55 60Leu Asp Cys Leu Asp Ser Arg Arg Thr
Val Arg Val Val Ala Ser Lys65 70 75
80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe Tyr Arg Gly Arg
Glu Ile 85 90 95Thr Ile
Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly 100
105 110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile
Thr Thr Pro Asp Asp Leu Glu 115 120
125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu Gly Arg Thr Gly
130 135 140Leu Leu Ala Asp Leu Leu Pro
Ser Phe Ala Glu Pro Lys Ser Ser Asp145 150
155 160Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu
Leu Leu Gly Gly 165 170
175Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile
180 185 190Ser Arg Thr Pro Glu Val
Thr Cys Val Val Val Asp Val Ser His Glu 195 200
205Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu
Val His 210 215 220Asn Ala Lys Thr Lys
Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg225 230
235 240Val Val Ser Val Leu Thr Val Leu His Gln
Asp Trp Leu Asn Gly Lys 245 250
255Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu
260 265 270Lys Thr Ile Ser Lys
Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr 275
280 285Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn
Gln Val Ser Leu 290 295 300Thr Cys Leu
Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp305
310 315 320Glu Ser Asn Gly Gln Pro Glu
Asn Asn Tyr Lys Thr Thr Pro Pro Val 325
330 335Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys
Leu Thr Val Asp 340 345 350Lys
Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His 355
360 365Glu Ala Leu His Asn His Tyr Thr Gln
Lys Ser Leu Ser Leu Ser Pro 370 375
380Gly Lys385170387PRTArtificial sequenceSynthetic polypeptide 170Asp Lys
Lys Lys Val Ala Met Leu Phe Gln Pro Thr Val Leu Arg Cys1 5
10 15His Phe Ser Thr Ser Ser His Gln
Pro Ala Val Val Gln Trp Lys Phe 20 25
30Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu Ser Leu Gly Met Ser
Ser 35 40 45Thr Arg Ala Gln Ser
Leu Ser Lys Arg Asn Leu Glu Trp Asp Pro Tyr 50 55
60Leu Asp Cys Leu Asp Ser Arg Arg Thr Val Arg Val Val Ala
Ser Lys65 70 75 80Gln
Gly Ser Thr Val Thr Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile
85 90 95Thr Ile Val His Asp Ala Asp
Leu Gln Ile Gly Lys Leu Met Trp Gly 100 105
110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr Thr Pro Asp Asp
Leu Glu 115 120 125Gly Lys Asn Glu
Asp Ser Val Glu Leu Leu Val Leu Gly Arg Thr Gly 130
135 140Leu Leu Ala Asp Leu Leu Pro Ser Phe Ala Val Glu
Pro Lys Ser Ser145 150 155
160Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly
165 170 175Gly Pro Ser Val Phe
Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met 180
185 190Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val
Asp Val Ser His 195 200 205Glu Asp
Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val 210
215 220His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln
Tyr Asn Ser Thr Tyr225 230 235
240Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly
245 250 255Lys Glu Tyr Lys
Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile 260
265 270Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro
Arg Glu Pro Gln Val 275 280 285Tyr
Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser 290
295 300Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro
Ser Asp Ile Ala Val Glu305 310 315
320Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro
Pro 325 330 335Val Leu Asp
Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val 340
345 350Asp Lys Ser Arg Trp Gln Gln Gly Asn Val
Phe Ser Cys Ser Val Met 355 360
365His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser 370
375 380Pro Gly Lys385171388PRTArtificial
sequenceSynthetic polypeptide 171Asp Lys Lys Lys Val Ala Met Leu Phe Gln
Pro Thr Val Leu Arg Cys1 5 10
15His Phe Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe
20 25 30Lys Ser Tyr Cys Gln Asp
Arg Met Gly Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp
Pro Tyr 50 55 60Leu Asp Cys Leu Asp
Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65 70
75 80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
Tyr Arg Gly Arg Glu Ile 85 90
95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly
100 105 110Asp Ser Gly Leu Tyr
Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu 115
120 125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu
Gly Arg Thr Gly 130 135 140Leu Leu Ala
Asp Leu Leu Pro Ser Phe Ala Val Glu Glu Pro Lys Ser145
150 155 160Ser Asp Lys Thr His Thr Cys
Pro Pro Cys Pro Ala Pro Glu Leu Leu 165
170 175Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro
Lys Asp Thr Leu 180 185 190Met
Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser 195
200 205His Glu Asp Pro Glu Val Lys Phe Asn
Trp Tyr Val Asp Gly Val Glu 210 215
220Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr225
230 235 240Tyr Arg Val Val
Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn 245
250 255Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn
Lys Ala Leu Pro Ala Pro 260 265
270Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln
275 280 285Val Tyr Thr Leu Pro Pro Ser
Arg Asp Glu Leu Thr Lys Asn Gln Val 290 295
300Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala
Val305 310 315 320Glu Trp
Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro
325 330 335Pro Val Leu Asp Ser Asp Gly
Ser Phe Phe Leu Tyr Ser Lys Leu Thr 340 345
350Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys
Ser Val 355 360 365Met His Glu Ala
Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu 370
375 380Ser Pro Gly Lys385172389PRTArtificial
sequenceSynthetic polypeptide 172Asp Lys Lys Lys Val Ala Met Leu Phe Gln
Pro Thr Val Leu Arg Cys1 5 10
15His Phe Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe
20 25 30Lys Ser Tyr Cys Gln Asp
Arg Met Gly Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp
Pro Tyr 50 55 60Leu Asp Cys Leu Asp
Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65 70
75 80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
Tyr Arg Gly Arg Glu Ile 85 90
95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly
100 105 110Asp Ser Gly Leu Tyr
Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu 115
120 125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu
Gly Arg Thr Gly 130 135 140Leu Leu Ala
Asp Leu Leu Pro Ser Phe Ala Val Glu Ile Glu Pro Lys145
150 155 160Ser Ser Asp Lys Thr His Thr
Cys Pro Pro Cys Pro Ala Pro Glu Leu 165
170 175Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys
Pro Lys Asp Thr 180 185 190Leu
Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val 195
200 205Ser His Glu Asp Pro Glu Val Lys Phe
Asn Trp Tyr Val Asp Gly Val 210 215
220Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser225
230 235 240Thr Tyr Arg Val
Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 245
250 255Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser
Asn Lys Ala Leu Pro Ala 260 265
270Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro
275 280 285Gln Val Tyr Thr Leu Pro Pro
Ser Arg Asp Glu Leu Thr Lys Asn Gln 290 295
300Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile
Ala305 310 315 320Val Glu
Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr
325 330 335Pro Pro Val Leu Asp Ser Asp
Gly Ser Phe Phe Leu Tyr Ser Lys Leu 340 345
350Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser
Cys Ser 355 360 365Val Met His Glu
Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 370
375 380Leu Ser Pro Gly Lys385173390PRTArtificial
sequenceSynthetic polypeptide 173Asp Lys Lys Lys Val Ala Met Leu Phe Gln
Pro Thr Val Leu Arg Cys1 5 10
15His Phe Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe
20 25 30Lys Ser Tyr Cys Gln Asp
Arg Met Gly Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp
Pro Tyr 50 55 60Leu Asp Cys Leu Asp
Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65 70
75 80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
Tyr Arg Gly Arg Glu Ile 85 90
95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly
100 105 110Asp Ser Gly Leu Tyr
Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu 115
120 125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu
Gly Arg Thr Gly 130 135 140Leu Leu Ala
Asp Leu Leu Pro Ser Phe Ala Val Glu Ile Met Glu Pro145
150 155 160Lys Ser Ser Asp Lys Thr His
Thr Cys Pro Pro Cys Pro Ala Pro Glu 165
170 175Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro
Lys Pro Lys Asp 180 185 190Thr
Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp 195
200 205Val Ser His Glu Asp Pro Glu Val Lys
Phe Asn Trp Tyr Val Asp Gly 210 215
220Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn225
230 235 240Ser Thr Tyr Arg
Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp 245
250 255Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val
Ser Asn Lys Ala Leu Pro 260 265
270Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu
275 280 285Pro Gln Val Tyr Thr Leu Pro
Pro Ser Arg Asp Glu Leu Thr Lys Asn 290 295
300Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp
Ile305 310 315 320Ala Val
Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr
325 330 335Thr Pro Pro Val Leu Asp Ser
Asp Gly Ser Phe Phe Leu Tyr Ser Lys 340 345
350Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe
Ser Cys 355 360 365Ser Val Met His
Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu 370
375 380Ser Leu Ser Pro Gly Lys385
390174391PRTArtificial sequenceSynthetic polypeptide 174Asp Lys Lys Lys
Val Ala Met Leu Phe Gln Pro Thr Val Leu Arg Cys1 5
10 15His Phe Ser Thr Ser Ser His Gln Pro Ala
Val Val Gln Trp Lys Phe 20 25
30Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu Ser Leu Gly Met Ser Ser
35 40 45Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn Leu Glu Trp Asp Pro Tyr 50 55
60Leu Asp Cys Leu Asp Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65
70 75 80Gln Gly Ser Thr Val
Thr Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile 85
90 95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly
Lys Leu Met Trp Gly 100 105
110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu
115 120 125Gly Lys Asn Glu Asp Ser Val
Glu Leu Leu Val Leu Gly Arg Thr Gly 130 135
140Leu Leu Ala Asp Leu Leu Pro Ser Phe Ala Val Glu Ile Met Pro
Glu145 150 155 160Pro Lys
Ser Ser Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro
165 170 175Glu Leu Leu Gly Gly Pro Ser
Val Phe Leu Phe Pro Pro Lys Pro Lys 180 185
190Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val
Val Val 195 200 205Asp Val Ser His
Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp 210
215 220Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg
Glu Glu Gln Tyr225 230 235
240Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp
245 250 255Trp Leu Asn Gly Lys
Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu 260
265 270Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys
Gly Gln Pro Arg 275 280 285Glu Pro
Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys 290
295 300Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly
Phe Tyr Pro Ser Asp305 310 315
320Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys
325 330 335Thr Thr Pro Pro
Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser 340
345 350Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln
Gly Asn Val Phe Ser 355 360 365Cys
Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser 370
375 380Leu Ser Leu Ser Pro Gly Lys385
390175392PRTArtificial sequenceSynthetic polypeptide 175Asp Lys Lys
Lys Val Ala Met Leu Phe Gln Pro Thr Val Leu Arg Cys1 5
10 15His Phe Ser Thr Ser Ser His Gln Pro
Ala Val Val Gln Trp Lys Phe 20 25
30Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu Ser Leu Gly Met Ser Ser
35 40 45Thr Arg Ala Gln Ser Leu Ser
Lys Arg Asn Leu Glu Trp Asp Pro Tyr 50 55
60Leu Asp Cys Leu Asp Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65
70 75 80Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile 85
90 95Thr Ile Val His Asp Ala Asp Leu Gln Ile
Gly Lys Leu Met Trp Gly 100 105
110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu
115 120 125Gly Lys Asn Glu Asp Ser Val
Glu Leu Leu Val Leu Gly Arg Thr Gly 130 135
140Leu Leu Ala Asp Leu Leu Pro Ser Phe Ala Val Glu Ile Met Pro
Glu145 150 155 160Glu Pro
Lys Ser Ser Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala
165 170 175Pro Glu Leu Leu Gly Gly Pro
Ser Val Phe Leu Phe Pro Pro Lys Pro 180 185
190Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys
Val Val 195 200 205Val Asp Val Ser
His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val 210
215 220Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro
Arg Glu Glu Gln225 230 235
240Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln
245 250 255Asp Trp Leu Asn Gly
Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala 260
265 270Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala
Lys Gly Gln Pro 275 280 285Arg Glu
Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr 290
295 300Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys
Gly Phe Tyr Pro Ser305 310 315
320Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr
325 330 335Lys Thr Thr Pro
Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr 340
345 350Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln
Gln Gly Asn Val Phe 355 360 365Ser
Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys 370
375 380Ser Leu Ser Leu Ser Pro Gly Lys385
390176393PRTArtificial sequenceSynthetic polypeptide 176Asp Lys
Lys Lys Val Ala Met Leu Phe Gln Pro Thr Val Leu Arg Cys1 5
10 15His Phe Ser Thr Ser Ser His Gln
Pro Ala Val Val Gln Trp Lys Phe 20 25
30Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu Ser Leu Gly Met Ser
Ser 35 40 45Thr Arg Ala Gln Ser
Leu Ser Lys Arg Asn Leu Glu Trp Asp Pro Tyr 50 55
60Leu Asp Cys Leu Asp Ser Arg Arg Thr Val Arg Val Val Ala
Ser Lys65 70 75 80Gln
Gly Ser Thr Val Thr Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile
85 90 95Thr Ile Val His Asp Ala Asp
Leu Gln Ile Gly Lys Leu Met Trp Gly 100 105
110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr Thr Pro Asp Asp
Leu Glu 115 120 125Gly Lys Asn Glu
Asp Ser Val Glu Leu Leu Val Leu Gly Arg Thr Gly 130
135 140Leu Leu Ala Asp Leu Leu Pro Ser Phe Ala Val Glu
Ile Met Pro Glu145 150 155
160Trp Glu Pro Lys Ser Ser Asp Lys Thr His Thr Cys Pro Pro Cys Pro
165 170 175Ala Pro Glu Leu Leu
Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys 180
185 190Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu
Val Thr Cys Val 195 200 205Val Val
Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr 210
215 220Val Asp Gly Val Glu Val His Asn Ala Lys Thr
Lys Pro Arg Glu Glu225 230 235
240Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His
245 250 255Gln Asp Trp Leu
Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys 260
265 270Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser
Lys Ala Lys Gly Gln 275 280 285Pro
Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu 290
295 300Thr Lys Asn Gln Val Ser Leu Thr Cys Leu
Val Lys Gly Phe Tyr Pro305 310 315
320Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn
Asn 325 330 335Tyr Lys Thr
Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu 340
345 350Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg
Trp Gln Gln Gly Asn Val 355 360
365Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln 370
375 380Lys Ser Leu Ser Leu Ser Pro Gly
Lys385 390177394PRTArtificial sequenceSynthetic
polypeptide 177Asp Lys Lys Lys Val Ala Met Leu Phe Gln Pro Thr Val Leu
Arg Cys1 5 10 15His Phe
Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe 20
25 30Lys Ser Tyr Cys Gln Asp Arg Met Gly
Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp Pro Tyr 50
55 60Leu Asp Cys Leu Asp Ser Arg Arg Thr
Val Arg Val Val Ala Ser Lys65 70 75
80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe Tyr Arg Gly Arg
Glu Ile 85 90 95Thr Ile
Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly 100
105 110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile
Thr Thr Pro Asp Asp Leu Glu 115 120
125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu Gly Arg Thr Gly
130 135 140Leu Leu Ala Asp Leu Leu Pro
Ser Phe Ala Val Glu Ile Met Pro Glu145 150
155 160Trp Val Glu Pro Lys Ser Ser Asp Lys Thr His Thr
Cys Pro Pro Cys 165 170
175Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro
180 185 190Lys Pro Lys Asp Thr Leu
Met Ile Ser Arg Thr Pro Glu Val Thr Cys 195 200
205Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe
Asn Trp 210 215 220Tyr Val Asp Gly Val
Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu225 230
235 240Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val
Ser Val Leu Thr Val Leu 245 250
255His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn
260 265 270Lys Ala Leu Pro Ala
Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly 275
280 285Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro
Ser Arg Asp Glu 290 295 300Leu Thr Lys
Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr305
310 315 320Pro Ser Asp Ile Ala Val Glu
Trp Glu Ser Asn Gly Gln Pro Glu Asn 325
330 335Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp
Gly Ser Phe Phe 340 345 350Leu
Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn 355
360 365Val Phe Ser Cys Ser Val Met His Glu
Ala Leu His Asn His Tyr Thr 370 375
380Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys385
390178395PRTArtificial sequenceSynthetic polypeptide 178Asp Lys Lys Lys
Val Ala Met Leu Phe Gln Pro Thr Val Leu Arg Cys1 5
10 15His Phe Ser Thr Ser Ser His Gln Pro Ala
Val Val Gln Trp Lys Phe 20 25
30Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu Ser Leu Gly Met Ser Ser
35 40 45Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn Leu Glu Trp Asp Pro Tyr 50 55
60Leu Asp Cys Leu Asp Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65
70 75 80Gln Gly Ser Thr Val
Thr Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile 85
90 95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly
Lys Leu Met Trp Gly 100 105
110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu
115 120 125Gly Lys Asn Glu Asp Ser Val
Glu Leu Leu Val Leu Gly Arg Thr Gly 130 135
140Leu Leu Ala Asp Leu Leu Pro Ser Phe Ala Val Glu Ile Met Pro
Glu145 150 155 160Trp Val
Phe Glu Pro Lys Ser Ser Asp Lys Thr His Thr Cys Pro Pro
165 170 175Cys Pro Ala Pro Glu Leu Leu
Gly Gly Pro Ser Val Phe Leu Phe Pro 180 185
190Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu
Val Thr 195 200 205Cys Val Val Val
Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn 210
215 220Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys
Thr Lys Pro Arg225 230 235
240Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val
245 250 255Leu His Gln Asp Trp
Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser 260
265 270Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile
Ser Lys Ala Lys 275 280 285Gly Gln
Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp 290
295 300Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys
Leu Val Lys Gly Phe305 310 315
320Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu
325 330 335Asn Asn Tyr Lys
Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe 340
345 350Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser
Arg Trp Gln Gln Gly 355 360 365Asn
Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr 370
375 380Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly
Lys385 390 395179379PRTArtificial
sequenceSynthetic polypeptide 179Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu Glu
Glu Pro Lys Ser Ser Asp Lys Thr His Thr Cys Pro Pro145
150 155 160Cys Pro Ala Pro Glu Leu Leu
Gly Gly Pro Ser Val Phe Leu Phe Pro 165
170 175Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr
Pro Glu Val Thr 180 185 190Cys
Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn 195
200 205Trp Tyr Val Asp Gly Val Glu Val His
Asn Ala Lys Thr Lys Pro Arg 210 215
220Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val225
230 235 240Leu His Gln Asp
Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser 245
250 255Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys
Thr Ile Ser Lys Ala Lys 260 265
270Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp
275 280 285Glu Leu Thr Lys Asn Gln Val
Ser Leu Thr Cys Leu Val Lys Gly Phe 290 295
300Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro
Glu305 310 315 320Asn Asn
Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe
325 330 335Phe Leu Tyr Ser Lys Leu Thr
Val Asp Lys Ser Arg Trp Gln Gln Gly 340 345
350Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn
His Tyr 355 360 365Thr Gln Lys Ser
Leu Ser Leu Ser Pro Gly Lys 370 375180380PRTArtificial
sequenceSynthetic polypeptide 180Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu Glu
Trp Glu Pro Lys Ser Ser Asp Lys Thr His Thr Cys Pro145
150 155 160Pro Cys Pro Ala Pro Glu Leu
Leu Gly Gly Pro Ser Val Phe Leu Phe 165
170 175Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg
Thr Pro Glu Val 180 185 190Thr
Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe 195
200 205Asn Trp Tyr Val Asp Gly Val Glu Val
His Asn Ala Lys Thr Lys Pro 210 215
220Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr225
230 235 240Val Leu His Gln
Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val 245
250 255Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu
Lys Thr Ile Ser Lys Ala 260 265
270Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg
275 280 285Asp Glu Leu Thr Lys Asn Gln
Val Ser Leu Thr Cys Leu Val Lys Gly 290 295
300Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln
Pro305 310 315 320Glu Asn
Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser
325 330 335Phe Phe Leu Tyr Ser Lys Leu
Thr Val Asp Lys Ser Arg Trp Gln Gln 340 345
350Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His
Asn His 355 360 365Tyr Thr Gln Lys
Ser Leu Ser Leu Ser Pro Gly Lys 370 375
380181396PRTArtificial sequenceSynthetic polypeptide 181Leu Gln Val Thr
Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1 5
10 15Pro Thr Val Leu Arg Cys His Phe Ser Thr
Ser Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu
35 40 45Ser Leu Gly Met Ser Ser Thr Arg
Ala Gln Ser Leu Ser Lys Arg Asn 50 55
60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65
70 75 80Arg Val Val Ala Ser
Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe 85
90 95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp
Ala Asp Leu Gln Ile 100 105
110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr
115 120 125Thr Pro Asp Asp Leu Glu Gly
Lys Asn Glu Asp Ser Val Glu Leu Leu 130 135
140Val Leu Gly Arg Thr Gly Leu Leu Ala Asp Leu Leu Pro Ser Ala
Ala145 150 155 160Val Glu
Ile Met Glu Pro Lys Ser Ser Asp Lys Thr His Thr Cys Pro
165 170 175Pro Cys Pro Ala Pro Glu Leu
Leu Gly Gly Pro Ser Val Phe Leu Phe 180 185
190Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro
Glu Val 195 200 205Thr Cys Val Val
Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe 210
215 220Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala
Lys Thr Lys Pro225 230 235
240Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr
245 250 255Val Leu His Gln Asp
Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val 260
265 270Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr
Ile Ser Lys Ala 275 280 285Lys Gly
Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg 290
295 300Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr
Cys Leu Val Lys Gly305 310 315
320Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro
325 330 335Glu Asn Asn Tyr
Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser 340
345 350Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys
Ser Arg Trp Gln Gln 355 360 365Gly
Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His 370
375 380Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro
Gly Lys385 390 395182382PRTArtificial
sequenceSynthetic polypeptide 182Leu Gln Val Thr Val Pro Asp Lys Lys Lys
Val Ala Met Leu Phe Gln1 5 10
15Pro Thr Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala
20 25 30Val Val Gln Trp Lys Phe
Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn 50 55 60Leu Glu Trp Asp Pro
Tyr Leu Asp Cys Leu Asp Ser Arg Arg Thr Val65 70
75 80Arg Val Val Ala Ser Lys Gln Gly Ser Thr
Val Thr Leu Gly Asp Phe 85 90
95Tyr Arg Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile
100 105 110Gly Lys Leu Met Trp
Gly Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr 115
120 125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser
Val Glu Leu Leu 130 135 140Val Leu Glu
Trp Val Phe Glu Pro Lys Ser Ser Asp Lys Thr His Thr145
150 155 160Cys Pro Pro Cys Pro Ala Pro
Glu Leu Leu Gly Gly Pro Ser Val Phe 165
170 175Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile
Ser Arg Thr Pro 180 185 190Glu
Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val 195
200 205Lys Phe Asn Trp Tyr Val Asp Gly Val
Glu Val His Asn Ala Lys Thr 210 215
220Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val225
230 235 240Leu Thr Val Leu
His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys 245
250 255Lys Val Ser Asn Lys Ala Leu Pro Ala Pro
Ile Glu Lys Thr Ile Ser 260 265
270Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro
275 280 285Ser Arg Asp Glu Leu Thr Lys
Asn Gln Val Ser Leu Thr Cys Leu Val 290 295
300Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn
Gly305 310 315 320Gln Pro
Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp
325 330 335Gly Ser Phe Phe Leu Tyr Ser
Lys Leu Thr Val Asp Lys Ser Arg Trp 340 345
350Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala
Leu His 355 360 365Asn His Tyr Thr
Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 370 375
380183383PRTArtificial sequenceSynthetic polypeptide 183Leu Gln
Val Thr Val Pro Asp Lys Lys Lys Val Ala Met Leu Phe Gln1 5
10 15Pro Thr Val Leu Arg Cys His Phe
Ser Thr Ser Ser His Gln Pro Ala 20 25
30Val Val Gln Trp Lys Phe Lys Ser Tyr Cys Gln Asp Arg Met Gly
Glu 35 40 45Ser Leu Gly Met Ser
Ser Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn 50 55
60Leu Glu Trp Asp Pro Tyr Leu Asp Cys Leu Asp Ser Arg Arg
Thr Val65 70 75 80Arg
Val Val Ala Ser Lys Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
85 90 95Tyr Arg Gly Arg Glu Ile Thr
Ile Val His Asp Ala Asp Leu Gln Ile 100 105
110Gly Lys Leu Met Trp Gly Asp Ser Gly Leu Tyr Tyr Cys Ile
Ile Thr 115 120 125Thr Pro Asp Asp
Leu Glu Gly Lys Asn Glu Asp Ser Val Glu Leu Leu 130
135 140Val Leu Glu Trp Val Phe Val Glu Pro Lys Ser Ser
Asp Lys Thr His145 150 155
160Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val
165 170 175Phe Leu Phe Pro Pro
Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr 180
185 190Pro Glu Val Thr Cys Val Val Val Asp Val Ser His
Glu Asp Pro Glu 195 200 205Val Lys
Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys 210
215 220Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr
Tyr Arg Val Val Ser225 230 235
240Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys
245 250 255Cys Lys Val Ser
Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile 260
265 270Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln
Val Tyr Thr Leu Pro 275 280 285Pro
Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu 290
295 300Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala
Val Glu Trp Glu Ser Asn305 310 315
320Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp
Ser 325 330 335Asp Gly Ser
Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg 340
345 350Trp Gln Gln Gly Asn Val Phe Ser Cys Ser
Val Met His Glu Ala Leu 355 360
365His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 370
375 380184384PRTArtificial sequenceSynthetic
polypeptide 184Leu Gln Val Thr Val Pro Asp Lys Lys Lys Val Ala Met Leu
Phe Gln1 5 10 15Pro Thr
Val Leu Arg Cys His Phe Ser Thr Ser Ser His Gln Pro Ala 20
25 30Val Val Gln Trp Lys Phe Lys Ser Tyr
Cys Gln Asp Arg Met Gly Glu 35 40
45Ser Leu Gly Met Ser Ser Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn 50
55 60Leu Glu Trp Asp Pro Tyr Leu Asp Cys
Leu Asp Ser Arg Arg Thr Val65 70 75
80Arg Val Val Ala Ser Lys Gln Gly Ser Thr Val Thr Leu Gly
Asp Phe 85 90 95Tyr Arg
Gly Arg Glu Ile Thr Ile Val His Asp Ala Asp Leu Gln Ile 100
105 110Gly Lys Leu Met Trp Gly Asp Ser Gly
Leu Tyr Tyr Cys Ile Ile Thr 115 120
125Thr Pro Asp Asp Leu Glu Gly Lys Asn Glu Asp Ser Val Glu Leu Leu
130 135 140Val Leu Glu Trp Val Phe Val
Gly Glu Pro Lys Ser Ser Asp Lys Thr145 150
155 160His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu
Gly Gly Pro Ser 165 170
175Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg
180 185 190Thr Pro Glu Val Thr Cys
Val Val Val Asp Val Ser His Glu Asp Pro 195 200
205Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His
Asn Ala 210 215 220Lys Thr Lys Pro Arg
Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val225 230
235 240Ser Val Leu Thr Val Leu His Gln Asp Trp
Leu Asn Gly Lys Glu Tyr 245 250
255Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr
260 265 270Ile Ser Lys Ala Lys
Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu 275
280 285Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val
Ser Leu Thr Cys 290 295 300Leu Val Lys
Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser305
310 315 320Asn Gly Gln Pro Glu Asn Asn
Tyr Lys Thr Thr Pro Pro Val Leu Asp 325
330 335Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr
Val Asp Lys Ser 340 345 350Arg
Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala 355
360 365Leu His Asn His Tyr Thr Gln Lys Ser
Leu Ser Leu Ser Pro Gly Lys 370 375
380185373PRTArtificial sequenceSynthetic polypeptide 185Asp Lys Lys Lys
Val Ala Met Leu Phe Gln Pro Thr Val Leu Arg Cys1 5
10 15His Phe Ser Thr Ser Ser His Gln Pro Ala
Val Val Gln Trp Lys Phe 20 25
30Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu Ser Leu Gly Met Ser Ser
35 40 45Thr Arg Ala Gln Ser Leu Ser Lys
Arg Asn Leu Glu Trp Asp Pro Tyr 50 55
60Leu Asp Cys Leu Asp Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65
70 75 80Gln Gly Ser Thr Val
Thr Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile 85
90 95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly
Lys Leu Met Trp Gly 100 105
110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu
115 120 125Gly Lys Asn Glu Asp Ser Val
Glu Leu Leu Val Leu Glu Glu Pro Lys 130 135
140Ser Ser Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu
Leu145 150 155 160Leu Gly
Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr
165 170 175Leu Met Ile Ser Arg Thr Pro
Glu Val Thr Cys Val Val Val Asp Val 180 185
190Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp
Gly Val 195 200 205Glu Val His Asn
Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser 210
215 220Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His
Gln Asp Trp Leu225 230 235
240Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala
245 250 255Pro Ile Glu Lys Thr
Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 260
265 270Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu
Thr Lys Asn Gln 275 280 285Val Ser
Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala 290
295 300Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn
Asn Tyr Lys Thr Thr305 310 315
320Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu
325 330 335Thr Val Asp Lys
Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 340
345 350Val Met His Glu Ala Leu His Asn His Tyr Thr
Gln Lys Ser Leu Ser 355 360 365Leu
Ser Pro Gly Lys 370186374PRTArtificial sequenceSynthetic polypeptide
186Asp Lys Lys Lys Val Ala Met Leu Phe Gln Pro Thr Val Leu Arg Cys1
5 10 15His Phe Ser Thr Ser Ser
His Gln Pro Ala Val Val Gln Trp Lys Phe 20 25
30Lys Ser Tyr Cys Gln Asp Arg Met Gly Glu Ser Leu Gly
Met Ser Ser 35 40 45Thr Arg Ala
Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp Pro Tyr 50
55 60Leu Asp Cys Leu Asp Ser Arg Arg Thr Val Arg Val
Val Ala Ser Lys65 70 75
80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe Tyr Arg Gly Arg Glu Ile
85 90 95Thr Ile Val His Asp Ala
Asp Leu Gln Ile Gly Lys Leu Met Trp Gly 100
105 110Asp Ser Gly Leu Tyr Tyr Cys Ile Ile Thr Thr Pro
Asp Asp Leu Glu 115 120 125Gly Lys
Asn Glu Asp Ser Val Glu Leu Leu Val Leu Glu Trp Glu Pro 130
135 140Lys Ser Ser Asp Lys Thr His Thr Cys Pro Pro
Cys Pro Ala Pro Glu145 150 155
160Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp
165 170 175Thr Leu Met Ile
Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp 180
185 190Val Ser His Glu Asp Pro Glu Val Lys Phe Asn
Trp Tyr Val Asp Gly 195 200 205Val
Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn 210
215 220Ser Thr Tyr Arg Val Val Ser Val Leu Thr
Val Leu His Gln Asp Trp225 230 235
240Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu
Pro 245 250 255Ala Pro Ile
Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu 260
265 270Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg
Asp Glu Leu Thr Lys Asn 275 280
285Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile 290
295 300Ala Val Glu Trp Glu Ser Asn Gly
Gln Pro Glu Asn Asn Tyr Lys Thr305 310
315 320Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe
Leu Tyr Ser Lys 325 330
335Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys
340 345 350Ser Val Met His Glu Ala
Leu His Asn His Tyr Thr Gln Lys Ser Leu 355 360
365Ser Leu Ser Pro Gly Lys 370187375PRTArtificial
sequenceSynthetic polypeptide 187Asp Lys Lys Lys Val Ala Met Leu Phe Gln
Pro Thr Val Leu Arg Cys1 5 10
15His Phe Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe
20 25 30Lys Ser Tyr Cys Gln Asp
Arg Met Gly Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp
Pro Tyr 50 55 60Leu Asp Cys Leu Asp
Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65 70
75 80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
Tyr Arg Gly Arg Glu Ile 85 90
95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly
100 105 110Asp Ser Gly Leu Tyr
Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu 115
120 125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu
Glu Trp Val Glu 130 135 140Pro Lys Ser
Ser Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro145
150 155 160Glu Leu Leu Gly Gly Pro Ser
Val Phe Leu Phe Pro Pro Lys Pro Lys 165
170 175Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr
Cys Val Val Val 180 185 190Asp
Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp 195
200 205Gly Val Glu Val His Asn Ala Lys Thr
Lys Pro Arg Glu Glu Gln Tyr 210 215
220Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp225
230 235 240Trp Leu Asn Gly
Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu 245
250 255Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys
Ala Lys Gly Gln Pro Arg 260 265
270Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys
275 280 285Asn Gln Val Ser Leu Thr Cys
Leu Val Lys Gly Phe Tyr Pro Ser Asp 290 295
300Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr
Lys305 310 315 320Thr Thr
Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser
325 330 335Lys Leu Thr Val Asp Lys Ser
Arg Trp Gln Gln Gly Asn Val Phe Ser 340 345
350Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln
Lys Ser 355 360 365Leu Ser Leu Ser
Pro Gly Lys 370 375188376PRTArtificial
sequenceSynthetic polypeptide 188Asp Lys Lys Lys Val Ala Met Leu Phe Gln
Pro Thr Val Leu Arg Cys1 5 10
15His Phe Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe
20 25 30Lys Ser Tyr Cys Gln Asp
Arg Met Gly Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp
Pro Tyr 50 55 60Leu Asp Cys Leu Asp
Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65 70
75 80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
Tyr Arg Gly Arg Glu Ile 85 90
95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly
100 105 110Asp Ser Gly Leu Tyr
Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu 115
120 125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu
Glu Trp Val Phe 130 135 140Glu Pro Lys
Ser Ser Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala145
150 155 160Pro Glu Leu Leu Gly Gly Pro
Ser Val Phe Leu Phe Pro Pro Lys Pro 165
170 175Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val
Thr Cys Val Val 180 185 190Val
Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val 195
200 205Asp Gly Val Glu Val His Asn Ala Lys
Thr Lys Pro Arg Glu Glu Gln 210 215
220Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln225
230 235 240Asp Trp Leu Asn
Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala 245
250 255Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser
Lys Ala Lys Gly Gln Pro 260 265
270Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr
275 280 285Lys Asn Gln Val Ser Leu Thr
Cys Leu Val Lys Gly Phe Tyr Pro Ser 290 295
300Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn
Tyr305 310 315 320Lys Thr
Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr
325 330 335Ser Lys Leu Thr Val Asp Lys
Ser Arg Trp Gln Gln Gly Asn Val Phe 340 345
350Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr
Gln Lys 355 360 365Ser Leu Ser Leu
Ser Pro Gly Lys 370 375189377PRTArtificial
sequenceSynthetic polypeptide 189Asp Lys Lys Lys Val Ala Met Leu Phe Gln
Pro Thr Val Leu Arg Cys1 5 10
15His Phe Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe
20 25 30Lys Ser Tyr Cys Gln Asp
Arg Met Gly Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp
Pro Tyr 50 55 60Leu Asp Cys Leu Asp
Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65 70
75 80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
Tyr Arg Gly Arg Glu Ile 85 90
95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly
100 105 110Asp Ser Gly Leu Tyr
Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu 115
120 125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu
Glu Trp Val Phe 130 135 140Val Glu Pro
Lys Ser Ser Asp Lys Thr His Thr Cys Pro Pro Cys Pro145
150 155 160Ala Pro Glu Leu Leu Gly Gly
Pro Ser Val Phe Leu Phe Pro Pro Lys 165
170 175Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu
Val Thr Cys Val 180 185 190Val
Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr 195
200 205Val Asp Gly Val Glu Val His Asn Ala
Lys Thr Lys Pro Arg Glu Glu 210 215
220Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His225
230 235 240Gln Asp Trp Leu
Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys 245
250 255Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile
Ser Lys Ala Lys Gly Gln 260 265
270Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu
275 280 285Thr Lys Asn Gln Val Ser Leu
Thr Cys Leu Val Lys Gly Phe Tyr Pro 290 295
300Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn
Asn305 310 315 320Tyr Lys
Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu
325 330 335Tyr Ser Lys Leu Thr Val Asp
Lys Ser Arg Trp Gln Gln Gly Asn Val 340 345
350Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr
Thr Gln 355 360 365Lys Ser Leu Ser
Leu Ser Pro Gly Lys 370 375190378PRTArtificial
sequenceSynthetic polypeptide 190Asp Lys Lys Lys Val Ala Met Leu Phe Gln
Pro Thr Val Leu Arg Cys1 5 10
15His Phe Ser Thr Ser Ser His Gln Pro Ala Val Val Gln Trp Lys Phe
20 25 30Lys Ser Tyr Cys Gln Asp
Arg Met Gly Glu Ser Leu Gly Met Ser Ser 35 40
45Thr Arg Ala Gln Ser Leu Ser Lys Arg Asn Leu Glu Trp Asp
Pro Tyr 50 55 60Leu Asp Cys Leu Asp
Ser Arg Arg Thr Val Arg Val Val Ala Ser Lys65 70
75 80Gln Gly Ser Thr Val Thr Leu Gly Asp Phe
Tyr Arg Gly Arg Glu Ile 85 90
95Thr Ile Val His Asp Ala Asp Leu Gln Ile Gly Lys Leu Met Trp Gly
100 105 110Asp Ser Gly Leu Tyr
Tyr Cys Ile Ile Thr Thr Pro Asp Asp Leu Glu 115
120 125Gly Lys Asn Glu Asp Ser Val Glu Leu Leu Val Leu
Glu Trp Val Phe 130 135 140Val Gly Glu
Pro Lys Ser Ser Asp Lys Thr His Thr Cys Pro Pro Cys145
150 155 160Pro Ala Pro Glu Leu Leu Gly
Gly Pro Ser Val Phe Leu Phe Pro Pro 165
170 175Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro
Glu Val Thr Cys 180 185 190Val
Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp 195
200 205Tyr Val Asp Gly Val Glu Val His Asn
Ala Lys Thr Lys Pro Arg Glu 210 215
220Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu225
230 235 240His Gln Asp Trp
Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn 245
250 255Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr
Ile Ser Lys Ala Lys Gly 260 265
270Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu
275 280 285Leu Thr Lys Asn Gln Val Ser
Leu Thr Cys Leu Val Lys Gly Phe Tyr 290 295
300Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu
Asn305 310 315 320Asn Tyr
Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe
325 330 335Leu Tyr Ser Lys Leu Thr Val
Asp Lys Ser Arg Trp Gln Gln Gly Asn 340 345
350Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His
Tyr Thr 355 360 365Gln Lys Ser Leu
Ser Leu Ser Pro Gly Lys 370 375
User Contributions:
Comment about this patent or add new information about this topic: