Patent application title: ANTIBODY DIRECTED AGAINST THE ENDOTHELIN RECEPTOR BETA SUB-TYPE
Inventors:
IPC8 Class: AC07K1628FI
USPC Class:
1 1
Class name:
Publication date: 2019-06-20
Patent application number: 20190185574
Abstract:
Antibodies directed against the endothelin receptor sub-type B, in
particular monoclonal antibodies, a fragment or derivative thereof. The
present disclosure also relates to the therapeutic, diagnostic use or as
a research tool of such an antibody in the field of cancers and in
particular glioblastoma.Claims:
1) An antibody directed against the endothelin receptor sub-type B
comprising: a heavy chain variable region comprising a CDR1 (hereinafter
designated CDR1.sub.H), a CDR2 (hereinafter designated CDR2.sub.H) and a
CDR3 (hereinafter designated CDR3.sub.H) such that the ordered
juxtaposition formed by the amino acid sequences of the CDR1.sub.H,
CDR2.sub.H and CDR3.sub.H exhibits at least 80% identity with the
following amino acid sequence: GYTFISYWIDPDSGGTAREGDYAWFAY (SEQ ID NO: 1)
and a light chain variable region comprising a CDR1 (hereinafter
designated CDR1.sub.L), a CDR2 (hereinafter designated CDR2.sub.L) and a
CDR3 (hereinafter designated CDR3.sub.L) such that the ordered
juxtaposition formed by the amino acid sequences of the CDR1.sub.L,
CDR2.sub.L and CDR3.sub.L exhibits at least 80% identity with the
following amino acid sequence:
TABLE-US-00020
(SEQ ID NO: 2)
QSIVHSNGNTYKVSFQGSHVPWT,
a fragment or derivative thereof.
2) The antibody according to claim 1, wherein said antibody comprises: i.sub.1) a heavy chain variable region comprising: a CDR1.sub.H the amino acid sequence of which is GYTFISYW (SEQ ID NO: 5); a CDR2.sub.H the amino acid sequence of which is IDPDSGGT (SEQ ID NO: 10); and a CDR3.sub.H the amino acid sequence of which is AREGDYAWFAY (SEQ ID NO: 15); or ii.sub.1) a heavy chain variable region comprising: a CDR1.sub.H the amino acid sequence of which is GYTFTSYW (SEQ ID NO: 7); a CDR2.sub.H the amino acid sequence of which is IDPDSGGT (SEQ ID NO: 10); and a CDR3.sub.H the amino acid sequence of which is VREGWDAWFVY (SEQ ID NO: 17); or iii.sub.1) a heavy chain variable region comprising: a CDR1.sub.H the amino acid sequence of which is GYTFTSYW (SEQ ID NO: 7); a CDR2.sub.H the amino acid sequence of which is IDPNSGGT (SEQ ID NO: 12); and a CDR3.sub.H the amino acid sequence of which is AREGEFAWFAY (SEQ ID NO: 19).
3) The antibody according to claim 1, wherein said antibody comprises a heavy chain variable region the amino acid sequence of which exhibits at least 80% identity with the following sequence: TABLE-US-00021 (SEQ ID NO: 31) QVQLQQPGAALVKPGASVKLSCKASGYTFISYWMLWVKQRPGRGLEWIGR IDPDSGGTKYNEKFKSKATLTVDKSSSTAYMQLSSLTSEDSAVYYCAREG DYAWFAYWGQGTLVPVSA.
4) The antibody according to claim 1, wherein said antibody comprises: i.sub.2) a light chain variable region comprising: a CDR1.sub.L the amino acid sequence of which is QSIVHSNGNTY (SEQ ID NO: 22); a CDR2.sub.L the amino acid sequence of which is KVS; a CDR3.sub.L the amino acid sequence of which is FQGSHVPWT (SEQ ID NO: 27); or ii.sub.2) a light chain variable region comprising: a CDR1.sub.L the amino acid sequence of which is QSIVHSNGNTY (SEQ ID NO: 22); a CDR2.sub.L the amino acid sequence of which is KVF; a CDR3.sub.L the amino acid sequence of which is FQGSHVPLT (SEQ ID NO: 29); or iii.sub.2) a light chain variable region comprising: a CDR1.sub.L the amino acid sequence of which is QNIVHSNGYTY (SEQ ID NO: 24); a CDR2.sub.L the amino acid sequence of which is KVS; a CDR3.sub.L the amino acid sequence of which is FQGSHVPLT (SEQ ID NO: 29).
5) The antibody according to claim 1, wherein said antibody comprises a light chain variable region the amino acid sequence of which exhibits at least 80% identity with the following sequence: TABLE-US-00022 (SEQ ID NO: 37) DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPK LLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVP WTFGGGTKLEIK.
6) The antibody according to claim 1, wherein said antibody is an IgG1/kappa type or IgG3/kappa type immunoglobulin.
7) The antibody according to claim 1, wherein said antibody is monoclonal.
8) The antibody according to claim 1, wherein said antibody is the monoclonal murine antibody obtained from a hybridoma chosen from the hybridoma deposited with the CNCM on the 19 May 2016 under the accession number CNCM I-5084, the hybridoma deposited with the CNCM on the 7 Jun. 2016 under the accession number CNCM I-5104 and the hybridoma deposited with the CNCM on the 7 Jun. 2016 under the accession number CNCM I-5103.
9) The antibody according to claim 1, wherein said antibody is a chimerized antibody.
10) The antibody according to claim 1, wherein said antibody is a humanized antibody.
11) A hybridoma chosen from the hybridoma deposited with the CNCM on the 19 May 2016 under the accession number CNCM I-5084, the hybridoma deposited with the CNCM on the 7 Jun. 2016 under the accession number CNCM I-5104 and the hybridoma deposited with the CNCM on the 7 Jun. 2016 under the accession number CNCM I-5103.
12) An isolated polynucleotide chosen from the different polynucleotides hereinafter: .alpha.) a polynucleotide encoding an antibody as defined in claim 1; .beta.) a polynucleotide complementary to the polynucleotide as defined in (.alpha.); .gamma.) a polynucleotide of at least 18 nucleotides, capable of hybridizing under high stringency conditions with the polynucleotides as defined in (.alpha.) and (.beta.).
13) A cloning and/or expression vector containing at least one polynucleotide according to claim 12.
14) A host organism transformed by or comprising a polynucleotide according to claim 12.
15) A compound comprising an antibody according to claim 1 conjugated with an element chosen from the group consisting of a cytotoxic group, an easily detectable group, or an effector group.
16) The antibody according to claim 1 for use in medicine.
17) A pharmaceutical composition comprising, as an active ingredient, an antibody according to claim 1 and a pharmaceutically acceptable vehicle.
18) The antibody according to claim 1 for use in the treatment and/or prevention of a disorder or a condition involving a dysfunction, being direct or in association with another physiological route, of the axis comprising an endothelin and at least one of its receptors such as, for example, the endothelin receptor sub-type B.
19) The antibody, the polynucleotide, the compound or the pharmaceutical composition for use according to claim 18, wherein said disorder or said condition is a cancer.
20) A process for diagnosing a cancer such as a glioblastoma in vitro comprising the steps of: a.sub.1') contacting a biological sample taken from a subject with a compound according to claim 15; b.sub.1') detecting the signal emitted by the easily detectable group and c.sub.1') determining the presence or absence of a cancer in said subject based on the signal detected in step (b.sub.1').
21) A host organism transformed by or comprising a vector according to claim 13.
22) The polynucleotide according to claim 12 for use in medicine.
23) The compound according to claim 15 for use in medicine.
24) A pharmaceutical composition comprising, as an active ingredient, a polynucleotide according to claim 12 and a pharmaceutically acceptable vehicle.
25) A pharmaceutical composition comprising, as an active ingredient, a compound according to claim 15 and a pharmaceutically acceptable vehicle.
26) The polynucleotide according to claim 12 for use in the treatment and/or prevention of a disorder or a condition involving a dysfunction, being direct or in association with another physiological route, of the axis comprising an endothelin and at least one of its receptors such as, for example, the endothelin receptor sub-type B.
27) The compound according to claim 15 for use in the treatment and/or prevention of a disorder or a condition involving a dysfunction, being direct or in association with another physiological route, of the axis comprising an endothelin and at least one of its receptors such as, for example, the endothelin receptor sub-type B.
28) The pharmaceutical composition according to claim 17, for use in the treatment and/or prevention of a disorder or a condition involving a dysfunction, being direct or in association with another physiological route, of the axis comprising an endothelin and at least one of its receptors such as, for example, the endothelin receptor sub-type B.
Description:
TECHNICAL FIELD
[0001] The present invention relates to the technical field of antibodies, their therapeutic and diagnostic use as well as their use as a research tool.
[0002] More particularly, the present invention provides antibodies, advantageously monoclonal antibodies, specific to the native and functional conformation of the endothelin receptor sub-type B and in particular human endothelin receptors expressed at the surface of cancer cells such as glioblastoma cells.
[0003] The present invention relates to the use of these antibodies for therapeutic and diagnostic purposes as well as research purposes.
State of Prior Art
[0004] Receptors of different endothelins (designated ET1, ET2 and ET3 in humans) belong to the family of receptors with 7 transmembrane domains also called GPCRs for "G Protein Coupled Receptors". Endothelin receptors have, in humans, two main sub-types which are sub-type A (ETA-R) and sub-type B (ETB-R). The fact that these receptors are classified in the GPCR family provides them with a complex three-dimensional structure. This feature partly explains the difficulty to obtain antibodies recognising the native structure of these receptors which is expressed to the cellular membrane. In fact, the difficulty to obtain monoclonal antibodies specific to the GPCRs is a consequence of problems related to obtaining these receptors, in a native and functional form, outside their membrane context.
[0005] The endothelin axis and its receptors are implied in several physiopathological functions and dysfunctions. By way of non-limiting examples, arterial hypertension, atherosclerosis, coronary artery diseases, liver dysfunctions, cerebrovascular diseases, Crohn's disease, pulmonary fibrosis, asthma, etc. can be mentioned (see for review R. Shah, 2007, "Endothelins in health and disease", Eur. J. Int. Med., vol. 18, pages 272-282).
[0006] Moreover, endothelin receptors also turned out to be associated with the development of many cancers, by promoting proliferation, survival and dissemination of cancer cells as well as angiogenesis (Bagnato & Rosano, 2008, "The endothelin axis in cancer", Int. J. of Biochem. & Cell Biology, vol. 40, pages 1443-1451). As regards the endothelin receptor sub-type B, the latter has a modification of its expression level in particular in melanomas, colon cancer, Kaposi's sarcoma, glioblastomas (brain tumors), and in cases of bladder cancer.
[0007] It is also established that the endothelin receptor sub-type B is involved in the lack of recognition of some cancer cells, in particular of ovary cancer cells by the immune system, by inducing a strong reduction in the lymphocyte infiltration (Buckanovich et al, 2008, "Endothelin B receptor mediates the endothelial barrier to T cell homing to tumors and disables immune therapy", Nature Medecine, vol. 14, pages 28-36).
[0008] Thus, targeting an ETB-R conformational isomer expressed at the surface of cancer cells and in particular glioblastoma cells thereby appears particularly relevant in human clinical biology in terms of a diagnostic tool for the follow-up of the development of these tumors and in particular of these brain tumors and their recurrences after a surgical operation but also for therapeutic applications by targeting these tumor cells. Yet, in the passive immunotherapy arsenal of cancers using monoclonal antibodies (40 antibodies have been approved to date), none of them targets GPCRs.
[0009] Generally, few antibodies targeting endothelin receptors and in particular sub-type ETB-R are described to date.
[0010] Kondoh et al, 1990 ("Isolation of anti-endothelin receptor monoclonal antibodies for use in receptor characterization", BBRC, vol. 172, pages 503-510) describe the binding properties of 4 monoclonal antibodies (A2, G9, E7 and G10) to solubilised complexes of endothelin receptors present at the surface of rat lung membranes. Antibodies G9 and G10 are type G isotype 2a immunoglobulins (IgG2a), whereas antibodies A2 and E7 are IgG1 immunoglobulins. If these 4 antibodies are actually specific to solubilised endothelin receptors, Kondoh et al do not provide any information about the fine specificity of these antibodies (ETA-R and/or ETB-R), as regards the recognition of human origin receptors, nor as regards a possible antagonistic property.
[0011] Yamaguchi et al, 2004 ("Characterization and application of monoclonal antibodies against human endothelin B receptor expressed in insect cells", Biotechnology Letters, vol. 26, pages 293-299) relate to the characterization of the binding properties of 5 mouse monoclonal antibodies obtained after protein immunisation with recombinant human ETB-R produced in insect cells. Four of them have a similar affinity (in the nanomolar range) for ETB-R, whereas the fifth one is 10 times less affine. The epitopic analysis of 3 of them (N-6, N-3 and N-1) revealed that they recognise the ETB-R N-terminal domain and more particularly the sequence corresponding to amino acids 27-35 of the ETB-R for N-6; the sequence corresponding to amino acids 27-41 of the ETB-R for N-3 and the sequence corresponding to amino acids 71-85 for N-1. Finally, these 5 antibodies are capable of recognising COS cells over-expressing ETB-R.
[0012] Patent application US 2010/003240 deposited on behalf of New York University and published on the 7 Jan. 2010 relates to therapeutic protocols and pharmaceutical mixtures within the scope of the treatment and prevention of cancers and in particular melanomas. To that end and more specifically, the use of ETB-R antagonists is claimed. The examples described about these antagonists only relate to modified endothelin-1 forms, but by extension, the use of ETB-R antagonist antibodies is claimed whereas no particular example of such antibodies is described or provided.
[0013] Patent application JP 2012111706 on behalf of Seikisui Chemical Co Ltd and published on the 14 Jun. 2012 relates to a monoclonal antibody called hB07. This is an IgG2a/lambda isotype mouse immunoglobulin, which is specific to the endothelin receptor human sub-type B. The authors have shown that the antibody hB07 is capable of competitively blocking endothelin 1 binding with an efficiency (IC.sub.50) calculated of 1.7 10.sup.-7 M. This antibody the sequences of which are not described thus has antagonistic properties.
[0014] Likewise, a monoclonal antibody antagonist to the pharmacological properties of the endothelin receptor sub-type B and in particular human sub-type B, called Rendomab-B1 has been described in International application WO 2012/045776 on behalf of CEA and published on the 12 Apr. 2012.
[0015] Finally, International application WO 2013/063001 on behalves of Genentech and Hoffmann-La Roche and published on the 2 May 2013 describes a therapeutic antibody conjugated to cytotoxic molecules for the treatment of melanomas, without reference to a conformational isomer preferentially expressed by the tumor cells. This antibody called 5E9 targets the human ETB-R over-expressed at the surface of melanomas. It is to be noted that the antibody 5E9 crosses with the rodent ETB-R as well as the non-human primate receptor as is set out in Asundi et al, 2011 ("An antibody-drug conjugate targeting the endothelin B receptor for the treatment of melanoma", Clinical Cancer Research, vol. 17, pages 965-975).
[0016] The inventors thus set themselves the purpose to obtain antibodies able to target particular conformational isomers of the endothelin receptor sub-type B expressed at the surface of cancer cells.
DISCLOSURE OF THE INVENTION
[0017] The present invention enables technical problems such as those previously defined to be solved and the purpose set by the inventors to be reached.
[0018] In fact, the inventors have developed and used a particular selection immunisation strategy already published in Allard et al, 2011 ("Electroporation-aided DNA immunization generates polyclonal antibodies against the native conformation of human endothelin B receptor", DNA and Cell Biology, vol. 30, pages 727-737). This strategy coupled with a hybridoma screening procedure in ELISA-cell and then by flow cytometry favours the obtention of monoclonal antibodies specific to ETB-R in its native conformation. This approach further has the advantage not to need the extracted and purified receptor of interest, which is still today particularly challenging.
[0019] By this strategy, the inventors have been able to select different monoclonal antibodies directed against the endothelin receptor sub-type B and in particular the human sub-type B, called hereinafter Rendomab-B49, Rendomab-B41 and Rendomab-B36. These antibodies are not only close to each other as regards their nucleotide and peptide sequences but also as regards their properties. Thus, none of these antibodies is an antagonist to the pharmacological properties of the endothelin receptor sub-type B (ETB-R). In other words, the antibodies according to the present invention are not capable of inhibiting or blocking binding of the endothelin ligands and in particular ligands ET1, ET2 and ET3 on ETB-R. On the contrary, the antibodies according to the present invention are capable of recognising the particular conformational isomers of the endothelin receptor sub-type B expressed at the surface of cancer cells and in particular glioblastoma cells.
[0020] The present invention relates to an antibody directed against the endothelin receptor sub-type B, a fragment or derivative thereof.
[0021] Before describing the invention in further detail, the following definitions will be reminded or suggested.
[0022] The terms "antibody" and "immunoglobulin" are equivalent and can be used interchangeably in the present invention.
[0023] An antibody is a glycoprotein comprising at least two heavy chains (H) and at least two light chains (L) connected to each other by one or more disulphide bridges. Each heavy chain comprises a variable region (or domain) (VH) and a constant region comprising 3 domains, usually designated CH1, CH2 and CH3. Each light chain comprises a variable region (or domain) (VL) and a constant region comprising a single domain, usually designated CL. The variable regions of the heavy chains and light chains involved in the antigen recognition can be further subdivided into 3 hypervariable regions, also called "complementarity determining regions" (CDR), surrounded by 4 more conserved regions, also called framework regions (FR). The organisation of each heavy chain (or light chain) variable region is, from the N-terminal end to the C-terminal end, as follows: FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4. Within the scope of the present invention, the definition of CDRs and FRs which has been used is that of IMGT (the international ImMunoGeneTics database http://imgt.cines.fr:8104). The calculations of identity percents of the CDR sequences mentioned and claimed hereinafter are thus to be taken into account based on this annotation.
[0024] Furthermore, the term "antibody" includes, within the scope of the present invention, not only full antibody molecules but also fragments and derivatives thereof.
[0025] By "antibody fragment", it is meant, within the scope of the present invention, both a monovalent fragment which has a single antigen-binding site as well as a divalent fragment which has two antigen-combining sites. Thus, a fragment according to the invention has at least one antigen-binding site. Among these fragments, fragments Fab, F(ab').sub.2, Fv, and other fragments which conserve the antigen-binding site (scFv and diabody) can be mentioned. A fragment Fab is a monovalent fragment consisting of the full light chain and part of the heavy chain (Fd) comprising the domains VH and CH1 as previously defined. A fragment F(ab').sub.2 is a divalent fragment corresponding to the association of two fragments Fab connected by disulphide bridges present at the hinge region of the immunoglobulins located between the constant domains CH1 and CH2. A fragment Fv is a monovalent fragment only consisting of the variable regions VL and VH of the light and heavy chains of an antibody. A fragment scFv is a monovalent polypeptide fragment, only obtained by genetic engineering, corresponding to the variable domains connected by a peptide link. A diabody is a recombinant divalent antibody molecule consisting of two head to tail scFv molecules because of the too short peptide link to enable a scFv to be formed. The fragments according to the invention also cover fragments as previously mentioned the half-life of which has been increased by chemical modification in particular by incorporation in a liposome or introducing a polyalkylene glycol such as a polyethylene glycol (PEG), this technique being called "PEGylation" and giving fragments such as Fab-PEG, F(ab').sub.2-PEG or Fv-PEG. By recombinant route, it is also possible to generate single or fused fragments of the antibody according to the present invention, having more efficient and better controlled properties of penetrability of solid tumors and pharmacokinetics. The antibody fragments useful within the scope of the present invention can be natural or recombinant.
[0026] By "antibody derivative", it is meant, within the scope of the present invention, antibody fragments obtained by genetic engineering such as single chain Fv (scFv) and single domain antibody (dAb) molecules. The term also includes antibody type molecules which can be introduced using phage display techniques or other random selection techniques for molecules which bind to the endothelin receptor sub-type B or to regions specific to this sub-type.
[0027] Thus, the "antibody fragments" and "antibody derivatives" cover all the molecules which contain an advantageously peptide structure, which is part of the recognition site (that is the part of the antibody which binds to or combines to the epitope or antigen) of an antibody according to the present invention. In addition, the antibody fragments and derivatives according to the present invention are capable of recognising particular conformational isomers of the endothelin receptor sub-type B expressed at the surface of cancer cells and in particular glioblastoma cells.
[0028] The present invention relates to an antibody directed against the endothelin receptor sub-type B comprising:
[0029] a heavy chain variable region comprising a CDR1 (hereinafter designated CDR1.sub.H), a CDR2 (hereinafter designated CDR2.sub.H) and a CDR3 (hereinafter designated CDR3.sub.H) such that the ordered juxtaposition formed by the amino acid sequences of the CDR1.sub.H, CDR2.sub.H and CDR3.sub.H exhibits at least 80% identity with the following amino acid sequence: GYTFISYWIDPDSGGTAREGDYAWFAY (SEQ ID NO: 1) and
[0030] a light chain variable region comprising a CDR1 (hereinafter designated CDR1.sub.L), a CDR2 (hereinafter designated CDR2.sub.L) and a CDR3 (hereinafter designated CDR3.sub.L) such that the ordered juxtaposition formed by the amino acid sequences of the CDR1.sub.L, CDR2.sub.L and CDR3.sub.L exhibits at least 80% identity with the following amino acid sequence: QSIVHSNGNTYKVSFQGSHVPWT (SEQ ID NO: 2).
[0031] Within the scope of the present invention, the amino acid sequences are given in accordance with the 1-letter international code.
[0032] By "ordered juxtaposition formed by the amino acid sequences of the CDR1.sub.H, CDR2.sub.H and CDR3.sub.H (or by the amino acid sequences of the CDR1.sub.L, CDR2.sub.L and CDR3.sub.L)", it is meant the artificial amino acid (aa) sequence having the following formula:
aa sequence of the CDR1.sub.H+aa sequence of the CDR2.sub.H+aa sequence of the CDR3.sub.H
(or aa sequence of the CDR1.sub.L+aa sequence of the CDR2.sub.L+aa sequence of the CDR3.sub.L).
[0033] Typically, the ordered juxtaposition formed by the amino acid sequences of the CDR1.sub.H, CDR2.sub.H and CDR3.sub.H has at least 81% identity with the amino acid sequence SEQ ID NO: 1. Further, the ordered juxtaposition formed by the amino acid sequences of the CDR1.sub.L, CDR2.sub.L and CDR3.sub.L has at least 85% identity with the amino acid sequence SEQ ID NO: 2.
[0034] Advantageously, the antibody according to the present invention comprises a heavy chain variable region the CDR1.sub.H of which has the following consensus sequence: GYTFX.sub.1SYW (SEQ ID NO: 3) in which X.sub.1 represents any amino acid. In a particular embodiment, X.sub.1 is either I, or T and the amino acid sequence of the CDR1.sub.H of the heavy chain variable region of the antibody according to the present invention is either GYTFISYW (SEQ ID NO: 5), or GYTFTSYW (SEQ ID NO: 7).
[0035] Further advantageously, the antibody according to the present invention comprises a heavy chain variable region the CDR2.sub.H of which has the following consensus sequence: IDPX.sub.2SGGT (SEQ ID NO: 8) in which X.sub.2 represents any amino acid. In a particular embodiment, X.sub.2 is either D, or N and the amino acid sequence of the CDR2.sub.H of the heavy chain variable region of the antibody according to the present invention is either IDPDSGGT (SEQ ID NO: 10), or IDPNSGGT (SEQ ID NO: 12).
[0036] Further advantageously, the antibody according to the present invention comprises a heavy chain variable region the CDR3.sub.H of which has the following consensus sequence: X.sub.3REGX.sub.4X.sub.5AWFX.sub.6Y (SEQ ID NO: 13) wherein X.sub.3, X.sub.4, X.sub.5 and X.sub.6, being identical or different, represent any amino acid. In a particular embodiment, X.sub.3, X.sub.4, X.sub.5 and X.sub.6, being identical or different, are chosen from the group consisting of A, D, Y, E, F, V and W. In a more particular embodiment, X.sub.3 is either A, or V; X.sub.4 is chosen from the group consisting of D, W and E; X.sub.5 is chosen from the group consisting of Y, D and F and X.sub.6 is either A, or V. In a further more particular embodiment, the amino acid sequence of the CDR3.sub.H of the heavy chain variable region of the antibody according to the present invention is chosen from the group consisting of AREGDYAWFAY (SEQ ID NO: 15), VREGWDAWFVY (SEQ ID NO: 17) and AREGEFAWFAY (SEQ ID NO: 19).
[0037] Advantageously, the antibody according to the present invention comprises a light chain variable region the CDR1.sub.L of which has the following consensus sequence: QX.sub.7IVHSNGX.sub.8TY (SEQ ID NO: 20) wherein X.sub.7 and X.sub.8, being identical or different, represent any amino acid. In a particular embodiment, X.sub.7 and X.sub.8, being identical or different, are chosen from the group consisting of N, Y and S. In a more particular embodiment, X.sub.7 is either N, or S and X.sub.8 is either N, or Y. In a further more particular embodiment, the amino acid sequence of the CDR1.sub.L of the light chain variable region of the antibody according to the present invention is either QSIVHSNGNTY (SEQ ID NO: 22), or QNIVHSNGYTY (SEQ ID NO: 24).
[0038] Further advantageously, the antibody according to the present invention comprises a light chain variable region the CDR2.sub.L of which has the following consensus sequence: KVX.sub.9 wherein X.sub.9 represents any amino acid. In a particular embodiment, X.sub.9 is either S, or F and the amino acid sequence of the CDR2.sub.L of the light chain variable region of the antibody according to the present invention is either KVS, or KVF.
[0039] Further advantageously, the antibody according to the present invention comprises a light chain variable region the CDR3.sub.L of which has the following consensus sequence: FQGSHVPX.sub.10T (SEQ ID NO: 25) wherein X.sub.10 represents any amino acid. In a particular embodiment, X.sub.10 is either W, or L and the amino acid sequence of the CDR3.sub.L of the light chain variable region of the antibody according to the present invention is either FQGSHVPWT (SEQ ID NO: 27), or FQGSHVPLT (SEQ ID NO: 29).
[0040] Advantageously, the antibody according to the present invention comprises:
[0041] i.sub.1) a heavy chain variable region comprising:
[0042] a CDR1.sub.H the amino acid sequence of which is GYTFISYW (SEQ ID NO: 5);
[0043] a CDR2.sub.H the amino acid sequence of which is IDPDSGGT (SEQ ID NO: 10); and
[0044] a CDR3.sub.H the amino acid sequence of which is AREGDYAWFAY (SEQ ID NO: 15);
[0045] or
[0046] ii.sub.1) a heavy chain variable region comprising:
[0047] a CDR1.sub.H the amino acid sequence of which is GYTFTSYW (SEQ ID NO: 7);
[0048] a CDR2.sub.H the amino acid sequence of which is IDPDSGGT (SEQ ID NO: 10); and
[0049] a CDR3.sub.H the amino acid sequence of which is VREGWDAWFVY (SEQ ID NO: 17);
[0050] or
[0051] iii.sub.1) a heavy chain variable region comprising:
[0052] a CDR1.sub.H the amino acid sequence of which is GYTFTSYW (SEQ ID NO: 7);
[0053] a CDR2.sub.H the amino acid sequence of which is IDPNSGGT (SEQ ID NO: 12); and
[0054] a CDR3.sub.H the amino acid sequence of which is AREGEFAWFAY (SEQ ID NO: 19).
[0055] More particularly, the antibody according to the invention comprises a heavy chain variable region the amino acid sequence of which exhibits at least 80% identity with the following sequence:
TABLE-US-00001 (SEQ ID NO: 31) QVQLQQPGAALVKPGASVKLSCKASGYTFISYWMLWVKQRPGRGLEWIGR IDPDSGGTKYNEKFKSKATLTVDKSSSTAYMQLSSLTSEDSAVYYCAREG DYAWFAYWGQGTLVPVSA.
[0056] Thus, the antibody according to the invention comprises a heavy chain variable region the amino acid sequence of which exhibits at least 80% identity and can exhibit at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, or even at least 90% identity with the amino acid sequence SEQ ID NO: 31.
[0057] Further more particularly, the antibody according to the invention comprises a heavy chain variable region the amino acid sequence of which corresponds to, i.e. consists of, the amino acid sequence SEQ ID NO: 31 (case of Rendomab-B49).
[0058] Alternatively (case of Rendomab-B41), the antibody according to the invention comprises a heavy chain variable region the amino acid sequence of which corresponds to, i.e. consists of, the following amino acid sequence:
TABLE-US-00002 (SEQ ID NO: 33) QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGR IDPDSGGTKYNEKFKSKATLTVDKPSNTANMQLSSLTSEDSAVYYCVREG WDAWFVYWGQGTLLTVSA.
[0059] In another alternative (case of Rendomab-B36), the antibody according to the invention comprises a heavy chain variable region the amino acid sequence of which corresponds to, i.e. consists of, the following amino acid sequence:
TABLE-US-00003 (SEQ ID NO: 35) QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWIHWVNQRPGRGLEWIGR IDPNSGGTKYNEKFKSKATLTVDKTSSTAYMQFSSLTSEDSAVYYCAREG EFAWFAYWGQGTLVTVSA.
[0060] Advantageously, the antibody according to the present invention comprises:
[0061] i.sub.2) a light chain variable region comprising:
[0062] a CDR1.sub.L the amino acid sequence of which is QSIVHSNGNTY (SEQ ID NO: 22);
[0063] a CDR2.sub.L the amino acid sequence of which is KVS;
[0064] a CDR3.sub.L the amino acid sequence of which is FQGSHVPWT (SEQ ID NO: 27);
[0065] or
[0066] ii.sub.2) a light chain variable region comprising:
[0067] a CDR1.sub.L the amino acid sequence of which is QSIVHSNGNTY (SEQ ID NO: 22);
[0068] a CDR2.sub.L the amino acid sequence of which is KVF;
[0069] a CDR3.sub.L the amino acid sequence of which is FQGSHVPLT (SEQ ID NO: 29);
[0070] or
[0071] iii.sub.2) a light chain variable region comprising:
[0072] a CDR1.sub.L the amino acid sequence of which is QNIVHSNGYTY (SEQ ID NO: 24);
[0073] a CDR2.sub.L the amino acid sequence of which is KVS;
[0074] a CDR3.sub.L the amino acid sequence of which is FQGSHVPLT (SEQ ID NO: 29).
[0075] More particularly, the antibody according to the invention comprises a light chain variable region the amino acid sequence of which exhibits at least 80% identity with the following sequence:
TABLE-US-00004 (SEQ ID NO: 37) DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPK LLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVP WTFGGGTKLEIK.
[0076] Thus, the antibody according to the invention comprises a light chain variable region the amino acid sequence of which exhibits at least 80% identity and can exhibit at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94% or even at least 95% identity with the amino acid sequence SEQ ID NO: 37.
[0077] Further more particularly, the antibody according to the invention comprises a light chain variable region the amino acid sequence of which corresponds to, i.e. consists of, the amino acid sequence SEQ ID NO: 37 (case of Rendomab-B49).
[0078] Alternatively (case of Rendomab-B41), the antibody according to the invention comprises a light chain variable region the amino acid sequence of which corresponds to, i.e. consists of, the following amino acid sequence:
TABLE-US-00005 (SEQ ID NO: 39) DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPK LLIYKVFNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVP LTFGAGTKLELKR.
[0079] In another alternative (case of Rendomab-B36), the antibody according to the invention comprises a light chain variable region the amino acid sequence of which corresponds to, i.e. consists of, the following amino acid sequence:
TABLE-US-00006 (SEQ ID NO: 41) DVLMTQTPLSLPVSLGDQASISCRSSQNIVHSNGYTYLEWYLQKPGQSPK LLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVP LTFGSGTKLEIKR.
[0080] Advantageously, the antibody according to the invention comprises a light chain variable region and a heavy chain variable region such as previously defined.
[0081] The light chain of the antibody according to the invention is typically a kappa light chain.
[0082] The heavy chain of the antibody according to the invention is in particular a gamma 1 heavy chain or a gamma 3 heavy chain.
[0083] In particular, the antibody according to the present invention is a G type immunoglobulin.
[0084] More particularly, the antibody according to the present invention is an IgG1/kappa type or IgG3 kappa type immunoglobulin.
[0085] The antibody directed against the endothelin receptor sub-type B, which is the subject matter of the present invention, selectively binds extracellular segments of the ETB-R. By "antibody which selectively binds" at least one specified domain or region of the ETB-R in particular of the human ETB-R, it is meant, within the scope of the present invention, an antibody which binds the specific domain(s) with a greater affinity than any other region of the ETB-R. Advantageously, the antibody binds the specified domain(s) of the ETB-R with an affinity at least 2, or at least 5, or at least 10, or at least 50 times higher than that it exhibits for any other region of the ETB-R. This binding can be determined by well-known processes in the field such as flow cytometry, radio-immuno-assay (RIA), confocal microscopy, enzyme-immuno-assay (EIA) labelling by directly or indirectly revealing the antibody to be tested (ELISA).
[0086] The antibody which is the subject matter of the present invention can be obtained from an animal immunised against the endothelin receptor sub-type B or against a fragment of this receptor comprising the epitope(s) recognised by the antibody according to the present invention. The immunised animal can be any animal usually used for producing an antibody such as a mouse, rat, rabbit, goat, dog, horse or camelid such as a camel or lama.
[0087] The antibody which is the subject matter of the present invention can also be obtained from naive recombinant (scFv, Fab, . . . ) libraries expressed at the surface of virus, phages, bacteria, yeasts or other eukaryotic cells, these libraries being built from immunoglobulins of different immunized animals as above disclosed.
[0088] The antibody thus obtained can be purified on an affinity column on which the endothelin receptor sub-type B or one of the sequences specifically recognised by the antibody according to the invention has been immobilised beforehand. This purification can also involve a protein A affinity chromatography.
[0089] Within the scope of the present invention, the antibody can be a polyclonal polyspecific or monospecific antibody, or a monoclonal antibody.
[0090] Advantageously, the antibody of the present invention is monoclonal. A "monoclonal antibody" refers, by usual definition in immunology, to an antibody obtained from a population of substantially homogenous antibodies, i.e. a population of identical antibodies, and a relatively low amount of the same can have possibly a mutation. A monoclonal antibody is obtained from the proliferation of a single clone of cells such as a hybridoma.
[0091] More particularly, the antibody according to the present invention is the murine monoclonal antibody obtained from a hybridoma chosen from the hybridoma deposited with the CNCM on the 19 May 2016 under the accession number CNCM I 5084 (Rendomab-B49), the hybridoma deposited with the CNCM on the 7 Jun. 2016 under the accession number CNCM I-5104 (Rendomab-B41) and the hybridoma deposited with the CNCM on the 7 Jun. 2016 under the accession number CNCM I-5103 (Rendomab-B36). The present invention also relates to such hybridomas.
[0092] Alternatively, the antibody according to the present invention can be a chimeric antibody i.e. an antibody which contains variable regions or hypervariable regions of heavy and light chain(s) derived from an antibody of a given species in combination with the constant regions of heavy and light chain(s) derived from an antibody of another species heterologous to the previous one.
[0093] A first alternative of the present invention corresponds to a chimerized antibody and in particular a chimerized monoclonal antibody, that is an antibody whose previously described variable domains from the murine antibody are associated with constant domains of human origin. It should be reminded that several therapeutic antibodies in use in humans are chimerized antibodies.
[0094] A second particularly interesting alternative can be a humanized antibody and in particular a humanized monoclonal antibody. Indeed, it is preferable to use a humanized antibody, if the latter should be administrated repeatedly to a human subject.
[0095] In the case of a humanized monoclonal antibody according to the present invention, the latter could be prepared by inserting CDRs of a murine antibody and in particular the murine antibody from a hybridoma chosen from the hybridoma deposited with the CNCM on the 19 May 2016 under the accession number CNCM I-5084 (Rendomab-B49), the hybridoma deposited with the CNCM on the 7 Jun. 2016 under the accession number CNCM I-5104 (Rendomab-B41) and the hybridoma deposited with the CNCM on the 7 Jun. 2016 under the accession number CNCM I-5103 (Rendomab-B36) within a human antibody, regardless of its isotype (IgG, IgA, IgM). The humanized antibodies can be made using techniques and approaches described in Verhoeyen et al, 1988 ("Reshaping human antibodies: Grafting an antilysozyme activity", Science, vol. 239, pages 1534-1536) and in U.S. Pat. No. 4,816,567 on behalf of Genentech and published on the 28 Mar. 1989.
[0096] The antibodies can also be human antibodies in that they have the amino acid sequence of anti-ETB-R human antibodies via preparation processes known in the field which do not require human vaccination. For example, such antibodies can be obtained by gene immunisation/cell immunisation boosts of transgenic mice which are available and which contain in essence human immunoglobulin genes (see Vaughan et al, 1998, "Human antibodies by design", Nature Biotechnol. vol. 16, pages 535-539). Alternatively, such antibodies can be obtained by cloning CDNAs coding from human B lymphocytes directed against ETB-R.
[0097] The present invention also relates to isolated polynucleotide chosen from the different polynucleotides hereinafter:
[0098] .alpha.) a polynucleotide encoding an antibody as previously defined;
[0099] .beta.) a polynucleotide complementary to the polynucleotide as defined in (.alpha.);
[0100] .gamma.) a polynucleotide of at least 18 nucleotides, capable of hybridising under high stringency conditions with the polynucleotides as defined in (.alpha.) and (.beta.).
[0101] By "polynucleotide", it is meant, within the scope of the present invention, a nucleic acid, a nucleic sequence, a nucleic acid sequence, an oligonucleotide, a polynucleotide sequence, a nucleotide sequence, a single strand DNA, a double strand DNA or an RNA. A polynucleotide according to the present invention can comprise natural nucleotides and non-natural nucleotides.
[0102] The polynucleotide according to the invention does not correspond to a nucleotide sequence in its natural state i.e. in its natural chromosomal environment. On the contrary, the polynucleotide according to the invention has been isolated and possibly purified, its environment has consequently been modified. The polynucleotide according to the invention can also be obtained by genetic recombination or chemical synthesis.
[0103] The high stringency conditions correspond to temperature and ionic strength conditions which enable a hybridation to be maintained between two complementary nucleotide sequences. Those skilled in the art will be able to determine the most suitable high stringency conditions in particular depending on the size of the nucleotide sequences by referring to the teaching of Sambrook et al, 1989 (Molecular cloning, Noland C. ed., New York: Cold Spring Harbor Laboratory Press).
[0104] The polynucleotide according to the present invention comprises at least one nucleotide sequence coding the CDR1.sub.H chosen from the following nucleotide sequences:
TABLE-US-00007 (SEQ ID NO: 4) GGC TAC ACC TTC ATC AGC TAC TGG and (SEQ ID NO: 6) GGC TAC ACC TTC ACC AGC TAC TGG.
[0105] Advantageously, the polynucleotide according to the present invention comprises at least one nucleotide sequence coding the CDR2.sub.H chosen from the following nucleotide sequences:
TABLE-US-00008 (SEQ ID NO: 9) ATT GAT CCT GAT AGN.sub.1 GGT GGT ACT with N.sub.1 representing either C, or T and (SEQ ID NO: 11) ATT GAT CCT AAT AGT GGT GGC ACT.
[0106] Further advantageously, the polynucleotide according to the present invention comprises at least one nucleotide sequence coding the CDR3.sub.H chosen from the following nucleotide sequences:
TABLE-US-00009 (SEQ ID NO: 14) GCA AGA GAA GGG GAT TAC GCC TGG TTT GCT TAC; (SEQ ID NO: 16) GTA AGA GAA GGG TGG GAC GCC TGG TTT GTT TAC and (SEQ ID NO: 18) GCA AGA GAG GGG GAA TTC GCC TGG TTT GCT TAC.
[0107] Typically, the polynucleotide according to the present invention comprises at least one nucleotide sequence coding the CDR1.sub.L chosen from the following nucleotide sequences:
TABLE-US-00010 (SEQ ID NO: 21) CAG AGC ATT GTA CAT AGT AAT GGA AAC ACC TAT and (SEQ ID NO: 23) CAG AAC ATT GTC CAT AGT AAT GGA TAC ACC TAT.
[0108] In particular, the polynucleotide according to the present invention comprises at least one nucleotide sequence coding the CDR2.sub.L chosen from the following nucleotide sequences:
TABLE-US-00011 AAA GTT TCC and AAA GTT TTC.
[0109] More particularly, the polynucleotide according to the present invention comprises at least one nucleotide sequence coding the CDR3.sub.L chosen from the following nucleotide sequences:
TABLE-US-00012 (SEQ ID NO: 26) TTT CAA GGT TCA CAT GTT CCG TGG ACG and (SEQ ID NO: 28) TTT CAA GGT TCA CAT GTT CCN.sub.2 CTC ACG with N.sub.2 representing either G, or T.
[0110] Advantageously, the polynucleotide according to the present invention comprises at least three nucleotide sequences corresponding to one of the following groups:
[0111] (i.sub.1') the nucleotide sequences SEQ ID NO: 4, SEQ ID NO: 9 with N.sub.1 representing C and SEQ ID NO: 14;
[0112] (ii.sub.1') the nucleotide sequences SEQ ID NO: 6, SEQ ID NO: 9 with N.sub.1 representing T and SEQ ID NO: 16; and
[0113] (iii.sub.1') the nucleotide sequences SEQ ID NO: 6, SEQ ID NO: 11 with N.sub.1 representing T and SEQ ID NO: 18.
[0114] It is clear that, for each of the groups, the three sequences listed above have to be organised with respect to each other such that the polypeptide obtained at the end of the translation of the polynucleotide according to the invention comprises 3 peptide sequences corresponding to the CDR1.sub.H, CDR2.sub.H and CDR3.sub.H.
[0115] More particularly, the polynucleotide according to the present invention comprises at least one nucleotide sequence having at least 80% identity with the following nucleotide sequence:
TABLE-US-00013 (SEQ ID NO: 30) CAGGTCCAACTGCAGCAGCCTGGGGCTGCGCTTGTGAAGCCTGGGGCTTC AGTGAAGCTGTCCTGCAAGGCTTCTGGCTACACCTTCATCAGCTACTGGA TGCTCTGGGTGAAGCAGAGGCCTGGACGAGGCCTTGAGTGGATTGGAAGG ATTGATCCTGATAGCGGTGGTACTAAGTACAATGAGAAGTTCAAGAGCAA GGCCACACTGACTGTAGACAAATCCTCCAGCACAGCCTACATGCAGCTCA GCAGCCTGACATCTGAGGACTCTGCGGTCTATTATTGTGCAAGAGAAGGG GATTACGCCTGGTTTGCTTACTGGGGCCAAGGGACTCTGGTCCCTGTCTC TGCA.
[0116] Thus, the polynucleotide according to the present invention comprises at least one nucleotide sequence having at least 80% identity and can exhibit at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, or even at least 90% identity with the nucleotide sequence SEQ ID NO: 30.
[0117] Further more particularly, the polynucleotide according to the present invention comprises a nucleotide sequence corresponding to the nucleotide sequence SEQ ID NO: 30 (case of Rendomab-B49). Thus, the nucleotide sequence coding the heavy chain variable region of Rendomab-B49 comprises or consists of the nucleotide sequence SEQ ID NO: 30.
[0118] Alternatively (case of Rendomab-B41), the polynucleotide according to the present invention comprises the following nucleotide sequence:
TABLE-US-00014 (SEQ ID NO: 32) CAGGTCCAACTGCAGCAGCCTGGGGCTGAGCTTGTGAAGCCTGGGGCTTC AGTGAAGCTGTCCTGCAAGGCTTCTGGCTACACCTTCACCAGCTACTGGA TGCACTGGGTGAAGCAGAGGCCTGGACGAGGCCTTGAGTGGATTGGAAGG ATTGATCCTGATAGTGGTGGTACTAAATACAATGAGAAGTTCAAGAGCAA GGCCACACTGACTGTAGACAAACCCTCCAACACAGCCAACATGCAGCTCA GCAGCCTGACATCTGAAGACTCTGCGGTCTATTATTGTGTAAGAGAAGGG TGGGACGCCTGGTTTGTTTACTGGGGCCAAGGGACTCTGCTCACTGTCTC TGCA.
[0119] Thus, the nucleotide sequence coding the heavy chain variable region of Rendomab-B41 comprises or consists of the nucleotide sequence SEQ ID NO: 32.
[0120] In another alternative (case of Rendomab-B36), the polynucleotide according to the present invention comprises the following nucleotide sequence:
TABLE-US-00015 (SEQ ID NO: 34) CAGGTCCAACTGCAGCAGCCTGGGGCTGAACTTGTGAAGCCTGGGGCTTC AGTGAAGCTGTCCTGCAAGGCTTCTGGCTACACCTTCACCAGCTACTGGA TACACTGGGTAAATCAGAGGCCTGGACGAGGCCTTGAGTGGATTGGAAGG ATTGATCCTAATAGTGGTGGCACTAAGTACAATGAGAAGTTCAAGAGTAA GGCCACACTGACTGTAGACAAAACCTCCAGCACAGCCTACATGCAGTTCA GCAGCCTGACATCTGAGGACTCTGCGGTCTATTATTGTGCAAGAGAGGGG GAATTCGCCTGGTTTGCTTACTGGGGCCAAGGGACTCTGGTCACTGTCTC TGCA.
[0121] Thus, the nucleotide sequence coding the heavy chain variable region of Rendomab-B36 comprises or consists of the nucleotide sequence SEQ ID NO: 34.
[0122] Advantageously, the polynucleotide according to the present invention comprises at least three nucleotide sequences corresponding to one of the following groups:
[0123] (i.sub.2') the nucleotide sequences SEQ ID NO: 21, AAAGTTTCC and SEQ ID NO: 26;
[0124] (ii.sub.2') the nucleotide sequences SEQ ID NO: 21, AAAGTTTTC and SEQ ID NO: 28 with N.sub.2 representing G; and
[0125] (iii.sub.2') the nucleotide sequences SEQ ID NO: 23, AAAGTTTCC and SEQ ID NO: 28 with N.sub.2 representing T.
[0126] It is clear that, for each of the groups, the three sequences listed above have to be organised with respect to each other such that the polypeptide obtained at the end of the translation of the polynucleotide according to the invention comprises 3 peptide sequences corresponding to the CDR1.sub.L, CDR2.sub.L and CDR3.sub.L.
[0127] More particularly, the polynucleotide according to the present invention comprises at least one nucleotide sequence having at least 80% identity with the following nucleotide sequence:
TABLE-US-00016 (SEQ ID NO: 36) GATGTTTTGATGACCCAAACTCCACTCTCCCTGCCTGTCAGTCTTGGAGA TCAAGCCTCCATCTCTTGCAGATCTAGTCAGAGCATTGTACATAGTAATG GAAACACCTATTTAGAATGGTACCTGCAGAAACCAGGCCAGTCTCCAAAG CTCCTGATCTACAAAGTTTCCAACCGATTTTCTGGGGTCCCAGACAGGTT CAGTGGCAGTGGATCAGGGACAGATTTCACACTCAAGATCAGCAGAGTGG AGGCTGAGGATCTGGGAGTTTATTACTGCTTTCAAGGTTCACATGTTCCG TGGACGTTCGGTGGAGGCACCAAGCTGGAAATCAAA.
[0128] Thus, the polynucleotide according to the present invention comprises at least one nucleotide sequence exhibiting at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94% or even at least 95% identity with the nucleotide sequence SEQ ID NO: 36.
[0129] Further more particularly, the polynucleotide according to the present invention comprises a nucleotide sequence corresponding to the nucleotide sequence SEQ ID NO: 36 (case of Rendomab-B49). Thus, the nucleotide sequence coding the light chain variable region of Rendomab-B49 comprises or consists of the nucleotide sequence SEQ ID NO: 36.
[0130] Alternatively (case of Rendomab-B41), the polynucleotide according to the present invention comprises the following nucleotide sequence:
TABLE-US-00017 (SEQ ID NO: 38) GATGTTTTGATGACCCAAACTCCACTCTCCCTGCCTGTCAGTCTTGGAGA TCAAGCCTCCATCTCTTGCAGATCTAGTCAGAGCATTGTACATAGTAATG GAAACACCTATTTAGAATGGTACTTGCAGAAACCAGGCCAGTCTCCAAAG CTCCTGATCTACAAAGTTTTCAACCGATTTTCTGGGGTCCCAGACAGGTT CAGTGGCAGTGGATCAGGGACAGATTTCACACTCAAGATCAGCAGAGTGG AGGCTGAGGATCTGGGAGTTTATTACTGCTTTCAAGGTTCACATGTTCCG CTCACGTTCGGTGCTGGGACCAAGCTGGAGCTGAAACGG.
[0131] Thus, the nucleotide sequence coding the light chain variable region of Rendomab-B41 comprises or consists of the nucleotide sequence SEQ ID NO: 38.
[0132] In another alternative (case of Rendomab-B36), the polynucleotide according to the present invention comprises the following nucleotide sequence:
TABLE-US-00018 (SEQ ID NO: 40) GATGTTTTGATGACCCAAACTCCACTCTCCCTGCCTGTCAGTCTTGGAGA TCAAGCCTCCATCTCTTGCAGATCTAGTCAGAACATTGTCCATAGTAATG GATACACCTATTTAGAATGGTACCTGCAGAAACCAGGCCAGTCTCCAAAG CTCCTGATCTACAAAGTTTCCAACCGATTTTCTGGGGTCCCAGACAGGTT CAGTGGCAGTGGATCAGGGACAGATTTCACACTCAAGATCAGCAGAGTGG AGGCTGAGGATCTGGGAGTTTATTACTGCTTTCAAGGTTCACATGTTCCT CTCACGTTCGGCTCGGGGACAAAGTTGGAAATAAAACGG.
[0133] Thus, the nucleotide sequence coding the light chain variable region of Rendomab-B36 comprises or consists of the nucleotide sequence SEQ ID NO: 40.
[0134] By "identity percent" between two amino acid sequences (or between two nucleotide sequences), it is meant, within the scope of the present invention, a percent of identical amino acid (or nucleotide) residues between the two sequences being compared, this percent being obtained after implementing the best alignment (optimum alignment) between both sequences. Those skilled in the art know different techniques enabling such an identity percent to be obtained and involving homology algorithms or computer programs such as the program BLAST.
[0135] The identity percent is statistic and the differences between both sequences are randomly distributed along these sequences. The differences between both sequences can consist of different modification types of the sequences: deletions, substitutions or additions of amino acid (or nucleotide) residues.
[0136] In a 1.sup.st embodiment, the modifications implemented in the sequences result in substitutions between equivalent amino acids, i.e. amino acids having structural homologies or not substantially modifying the biological activity of the corresponding antibodies.
[0137] In a 2.sup.nd embodiment, the modifications implemented in the sequences result in substitutions by non-equivalent amino acids, i.e. amino acids not having a structural homology. These modifications are likely to improve the biological properties of the antibody, i.e. improved affinity and/or specificity, widened recognition spectrum, increased stability, reduced immunogenicity etc.
[0138] When applied to both previously set out embodiments, these modifications, insertions or deletions can target a CDR, which is essential or not, to the properties of the antibody according to the invention.
[0139] When applied to both previously set out embodiments, these modifications, insertions or deletions can also target a region FR, given that such regions, within variable domains of the antibodies, can depending on the antibodies also play a role in the expression of the properties of the antibody according to the invention.
[0140] The present invention also relates to a cloning and/or expression vector containing at least one polynucleotide according to the present invention. Such a vector is in particular useful to transform a host organism and express in the latter an antibody according to the present invention.
[0141] The vector according to the present invention further comprises one (or more) element(s) which enable(s) the polynucleotide according to the present invention to be expressed and/or the product resulting from the translation of the polynucleotide according to the present invention to be secreted. Among these elements, a constituent or inducible promoter, a transcription initiation signal or a transcription termination signal, a translation initiation sequence or a translation end signal can be mentioned.
[0142] Advantageously, the vector according to the present invention comprises a promoter, a polynucleotide of the invention and a terminator element which are operationally linked to each other. By "operationally linked to each other", according to the invention, it is meant elements linked to each other such that the functioning of one of the elements is affected by that of another one. By way of example, a promoter is operationally linked to a coding sequence when it is capable of affecting the expression of the same. The peptide transcription, translation and maturation regulating elements that the vector can comprise are known to those skilled in the art who are able to choose them depending on the host organism in which the expression or cloning should be made.
[0143] The vector according to the present invention is advantageously chosen from a plasmid, a cosmid, a bacteriophage and a virus such as a baculovirus. In particular, the vector of the invention is an autonomously replicating vector including elements enabling it to be maintained and replicated in the host organism as a replication origin. Further, the vector can include elements enabling it to be selected in the host organism as, for example, an antibiotic resistant gene or selection gene which ensures complementation with the respective gene deleted in the genome of the host organism. Such cloning and/or expression vectors are well known to those skilled in the art and widely described in the literature.
[0144] The invention also relates to a host organism transformed by or comprising a polynucleotide according to the present invention or a vector according to the present invention.
[0145] By "host organism", it is meant any isolated, single or multi-cell, lower or higher organism, in which a polynucleotide of the invention is introduced for producing an antibody according to the present invention.
[0146] Those skilled in the art know different methods for efficiently introducing a polynucleotide into a host organism in order to produce the antibody coded by said polynucleotide in the host organism. By way of example and in a non-exhaustive way, this method can be an electroporation, lipofection, biological transformation of a plant using Agrobacterium tumefasciens, a heat shock or a chemical process.
[0147] Advantageously, the host organism is a microorganism such as a yeast, bacterium or fungus. The transformation of such microorganisms enables the antibody of the invention to be produced at a semi-industrial or industrial scale.
[0148] Alternatively, the host organism is an animal cell such as mammal cell, plant cell, insect cell, animal except for a human, or a plant.
[0149] Such host organisms can be used to produce an antibody according to the present invention. Indeed, a process for producing an antibody according to the present invention comprises the following steps of:
[0150] a) culturing a host organism according to the present invention and in particular a single-cell host organism in a culture medium and under appropriate conditions;
[0151] b) recovering said antibody from the culture medium of said cultured host organism or from said cultured host organism.
[0152] The antibody according to the present invention is also modifiable in order to i) generate an antibody labelled by a radioactive isotope, by a prodrug, an enzyme or a toxin, and ii) modify the binding specificity and/or affinity, and/or stability, and/or immunogenicity of said antibody ensuring targeting of the cells which over-express ETB-R, in particular cancer cells such as melanomas, glioblastomas etc. . . .
[0153] The antibody according to the present invention is also modifiable in order to couple it chemically or genetically to a peptide molecule; a protein molecule; a nucleic molecule such as a DNA, an RNA, an RNAi, an aptamer, a PNA or an LNA; a lipid molecule; a carbohydrate molecule or a chemical molecule.
[0154] The present invention thus relates to a compound comprising an antibody according to the present invention conjugated with an element chosen from the group consisting of a cytotoxic group, an easily detectable group or an effector group.
[0155] By "cytotoxic group", it is meant a group directly or indirectly toxic for the cells targeted by the antibody according to the present invention. By "directly cytotoxic", it is meant a group which is cytotoxic on its own. By "indirectly cytotoxic", it is meant a group which, although not cytotoxic on its own, can induce a cytotoxicity, for example by its action on another molecule or by a further action on itself.
[0156] In a 1.sup.st implementation form, the cytotoxic group is a cytotoxic chemotherapeutic agent. Those skilled in the art know different cytotoxic chemotherapeutic agents usable within the scope of the present invention. The activity of these agents can be increased under irradiation. By way of illustrating and non-limiting examples, alkylating agents such as mechlorethamine or chlorambucile; methotrexate; 5-fluoro-uracil; vinblastine; gemcitabine; fludarabine; nicotinamide; doxorubicin; mitomycin; L-asparaginase; cisplatin; taxol and analogues/derivatives thereof can be mentioned.
[0157] In a 2.sup.nd implementation form, the cytotoxic group is a cytotoxic (poly)peptide group such as ricin, abrin, Pseudomonas exotoxin, TNF.alpha. and interleukin 2.
[0158] In a 3.sup.rd implementation form, the cytotoxic group is an indirectly cytotoxic chemotherapeutic agent. Such an agent also called a prodrug is little or not cytotoxic as such but is able to give, in particular after an enzymatic reaction or an irradiation, a cytotoxic substance (or drug) in particular as defined in the 1.sup.st implementation form. By way of illustrating and non-limiting examples, methotrexate-alanine; mitomycin phosphate, 5-fluorocytosine; photofrin and capecitabine can be mentioned.
[0159] In a 4.sup.th implementation form, the cytotoxic group is an indirectly cytotoxic (poly)peptide group. By indirectly cytotoxic polypeptide group, it is meant a peptide or polypeptide which exhibits an enzymatic activity and can convert a relatively non toxic prodrug in particular as defined in the 3.sup.rd implementation form into a cytotoxic substance in particular as defined in the 1.sup.st implementation form. Among such indirectly cytotoxic (poly)peptide groups, a peptidase such as a carboxypeptidase, aminopeptidase or endopeptidase; a phosphatase; a sulphatase; an amidase; a kinase; a glycosidase; a deaminase; a reductase; and an oxidase can be mentioned.
[0160] In a 5.sup.th implementation form, the cytotoxic group is a nucleic acid molecule which is directly or indirectly cytotoxic such as an anti-sense oligonucleotide or an aptamer.
[0161] Those skilled in the art know different techniques enabling such groups to be conjugated with an antibody according to the present invention once the latter is obtained or produced.
[0162] These techniques allow a covalent coupling between an antibody according to the invention and a cytotoxic group by taking advantage of particular chemical groups carried by the antibody according to the invention and by the cytotoxic group. Among these particular chemical groups, a thiol group, an ester group, an amino group, an acid group and any chemical element likely to be implemented in "click-chemistry" can be mentioned.
[0163] Alternatively and in particular when the cytotoxic group is a group of peptidic nature, this conjugation can consist in producing the compound according to the invention as a fusion compound by genetic recombination techniques, wherein a polynucleotide comprises respective regions coding the antibody according to the present invention and the cytotoxic group, which are adjacent to each other, juxtaposed or separated by a region coding a peptide linker which does not destroy the desired properties of the final hybrid compound.
[0164] Irrespective of the technique used to conjugate an antibody according to the present invention with a cytotoxic group, the only requirement to meet within the scope of this conjugation is that the conjugated antibody preserves its ETB-R binding specificity and its absence of antagonist properly, which properties are associated to those of the cytotoxic group.
[0165] By "easily detectable group", it is meant, within the scope of the present invention, a group that can be detected by implementing an advantageously non-invasive appropriate detection technique such as microscopy, scintigraphy, positon emission tomography (TEP) and magnetic resonance imaging (MRI). A compound according to the invention comprising such an easily detectable group is particularly suitable for the field of imaging and diagnosis. It enables in particular sites at which the ETB-R is over-expressed to be identified and localised because of the ETB-R binding specificity of the antibody according to the invention present in this compound.
[0166] In a 1.sup.st implementation form, the easily detectable group can be an enzyme or a molecule capable of generating a detectable and possibly quantifiable signal under particular conditions such as when putting into contact with an adapted substrate. By way of illustrating and non-limiting examples, biotin, digoxigenin, 5-bromodeoxiuridin, an alkaline phosphatase, a peroxidase, an acetylcholine esterase (AChE), a glucose amylase and a lysozyme can be mentioned.
[0167] In a 2.sup.nd implementation form, the easily detectable group can be a fluorescent, chemiofluorescent or bioluminescent label such as fluorescein and derivatives thereof, rhodamine and derivatives thereof, GFP (Green Fluorescent Protein) and derivatives thereof and umbelliferone; luminol; luciferase and luciferin.
[0168] In a 3.sup.rd implementation form, the easily detectable group can be a radioactive label or isotope such as iodine-123, iodine-125, iodine-126, iodine-133, indium-111, indium-113m, bromine-77, gallium-67, gallium-68, ruthenium-95, ruthenium-97, technetium-99m, fluorine-19, fluorine-18, carbon-13, nitrogen-15, oxygen-17, scandium-47, tellurium-122m, thulium-165 and yttrium-199. It should be observed that some radioactive atoms used as easily detectable groups can also be cytotoxic groups because of the radioactivity quantity they can deliver.
[0169] All that has been previously explained for the conjugation of the antibody according to the invention with cytotoxic groups is applicable mutatis mutandis to the conjugation of the antibody according to the invention with the easily detectable groups. The conjugation of the antibody according to the invention with the easily detectable groups can also be made in connection with nano-objects, in order to densify the concentration thereof, and thus to improve the emitted signal, contrast or toxicity.
[0170] In the case where this easily detectable group is a radioactive label, the latter can be introduced into the peptide sequence of the antibody according to the invention. This introduction can take place during the synthesis of the antibody by using one or more labelled amino acids. Alternatively, this introduction can take place following this synthesis by binding the radioactive label on residues of the peptide sequence of the synthesized antibody. For example, yttrium-90 can be bound via a lysine residue. Further alternatively, the radioactive label can be indirectly bound to the antibody by known means. For example, EDTA or another chelating agent can be bound to the antibody according to the invention and used to bind indium-111.
[0171] The present invention relates to the use of a compound comprising an antibody and an easily detectable group as a very efficient diagnostic, prognostic and in vivo follow up tool in terms of medical imaging. The antibody format is chosen so as to generate the best signal to noise ratio and the best pharmaco kinetics.
[0172] In other words, the present invention relates to a process for detecting and quantifying in vivo or in vitro the expression or overexpression of the endothelin receptor sub-type B, consisting in:
[0173] a.sub.1) contacting a biological sample with a compound according to the present invention;
[0174] b.sub.1) detecting the possible complex between said compound and said endothelin receptor sub-type B.
[0175] Such a process can be implemented to detect, diagnose, prognose or follow up a state in which the endothelin receptor sub-type B is overexpressed and in particular to detect, diagnose, prognose or follow up a cancer state (presence, size and evolution of cancer tumors). In the case of a process for diagnosing a cancer such as a glioblastoma, the latter comprises the steps of:
[0176] a.sub.1') contacting a biological sample of the subject with a compound according to the present invention;
[0177] b.sub.1') detecting the signal emitted by the easily detectable group and
[0178] c.sub.1') determining the presence or absence of a cancer in said subject based on the signal detected in step (b.sub.1').
[0179] In a particular embodiment, the diagnostic process according to the invention is a process made in vitro for which the biological sample such as a biopsy has been taken from the subject before implementing step (a.sub.1'). Alternatively, this process can correspond to an in vivo imaging process in which an efficient amount of the compound according to the invention has been administrated to the subject beforehand. By "efficient amount", it is meant an amount of the compound according to the present invention which is sufficient for cancer imaging. This amount varies as a function of the administration mode, the formulation administrated, the excipient and the cancer to be diagnosed. However, determining this efficient amount is a routine work for those skilled in the art.
[0180] By "effector group", it is meant, within the scope of the present invention, a group capable of specifically recognising a cancer marker, or which makes it possible to recruit (i) an effector cell of the immune system i.e. NK cells, cytotoxic T cells, macrophages or (ii) the complement system. By "group capable of specifically recognising a cancer marker", it is meant, within the scope of the present invention, a ligand of a cancer marker; an antibody identical to or different from the antibody according to the present invention; a protein; a peptide; or a nucleic molecule such as a DNA, an RNA, an RNAi, an aptamer, a PNA or an LNA. By "cancer label", both an ETB-R and another membrane marker are contemplated.
[0181] In a 1.sup.st implementation form, the effector group recognises a cancer marker which is, identical to or different from ETB-R, expressed at the surface of cancer cells, thus ensuring better recognition specificity and thus increased targeting of cancer cells.
[0182] In a 2.sup.nd implementation form, the effector group exhibits a recognition specificity for a marker specifically present at the surface of effector cells of the immune system, i.e. NK cells, macrophages or cytotoxic T cells. Such a recruitment ensures targeted lysis of the cancer cells recognised by the antibody of the present invention.
[0183] In a 3.sup.rd implementation form, the effector group has a recognition specificity for the complement system and, in particular, for protein C1 or its truncated form C1q, which initiates the cascade of molecular events which result in the death of the targeted cell. Such a recruitment insures targeted lysis of the cancer cells recognised by the antibody of the present invention.
[0184] In a 4.sup.th implementation form, the effector group exhibits a recognition specificity for the complement system and, in particular, for protein C3 or its truncated form C3b, thus ensuring recruitment of effector cells of the immune system, which cells induce the death of the targeted cell. Such a recruitment ensures targeted lysis of the cancer cells recognized by the antibody of the present invention.
[0185] The present invention relates to an antibody according to the present invention, a polynucleotide according to the present invention or a compound according to the present invention for use as a druger medicament.
[0186] Thus, the present invention relates to a pharmaceutical composition comprising, as an active ingredient, an antibody according to the present invention, or a polynucleotide according to the present invention or a compound according to the present invention and a pharmaceutically acceptable vehicle.
[0187] By "pharmaceutically acceptable vehicle", it is meant according to the present invention, any substance which is added to an antibody, polynucleotide or compound according to the present invention to promote its transport, avoid its substantial degradation in said composition and/or increase its half-life. Advantageously, such a pharmaceutically acceptable vehicle is sterile and nonpyrogenic. It is chosen depending on the type of application of the pharmaceutical composition of the invention and in particular as a function of its administration mode.
[0188] Thus, the pharmaceutical composition according to the invention consists of at least one antibody, or polynucleotide or compound according to the present invention in free form or in the form of an addition salt with a pharmaceutically acceptable acid, in pure state or in the form of a composition in which it is associated with any other pharmaceutically compatible product. The pharmaceutical compositions according to the invention can be employed by the systemic route; by the parenteral route, for example the intravenous, intra-arterial, intraperitoneal, intrathecal, intra-ventricular, intrasternal, intracranial, intramuscular or sub-cutaneous route; by topical route; by the oral route; by the rectal route; by the intranasal route or by inhalation.
[0189] As solid compositions for oral administration, tablets, pills, powders, etc. can be used where the antibody, polynucleotide or compound according to the invention is mixed with one or more conventionally used inert diluents, and possibly other substances such as, for example, a lubricant, a colorant, a coating etc.
[0190] As liquid compositions for oral or ocular administration pharmaceutically acceptable, suspensions, solutions, emulsions, syrups containing conventionally used inert diluents, and possibly other substances such as wetting products, sweeteners, thickeners, etc. can be used.
[0191] The sterile compositions for parenteral administration can be aqueous or non aqueous solutions, suspensions or emulsions. As a solvent or vehicle, water, propylene-glycol, plant oils or other suitable organic solvents can be used. These compositions can also contain adjuvants, such as wetting agents, isotonisers, emulsifiers, etc.
[0192] The compositions for topic administration can be for example creams, lotions, oral sprays, nose or eye drops or aerosol.
[0193] The daily dose level of the antibody, polynucleotide or compound according to the present invention is usually from 1 to 1 000 mg per adult (that is about 0.015 to 15 mg/kg), administrated in single or fractionated doses. These doses are given only by way of illustrating purposes. The physician, in any case, will be able to determine the most suitable real dose to a given individual patient and this dose varies depending on the patient's age, weight and response.
[0194] The present invention relates to an antibody according to the present invention, a polynucleotide according to the present invention, a compound according to the present invention or a pharmaceutical composition according to the present invention for use in the treatment and/or prevention of a disorder or condition involving a dysfunction, direct or in association with another physiological route, of the axis comprising an endothelin and at least one of its receptors such as, in particular, the endothelin receptor sub-type B.
[0195] Advantageously, such a disorder or such a condition is a cancer. As cancers, a melanoma, colon cancer, Kaposi's sarcoma, glioblastoma, ovary cancer and bladder cancer can be mentioned. Typically, this disorder is a melanoma or a glioblastoma.
[0196] Still in other words, the present invention relates to a process for treating and/or preventing a disorder or a condition involving a dysfunction, direct or in association with another physiological route, of the axis comprising an endothelin and at least one of its receptors such as, in particular, the endothelin receptor sub-type B in a patient having or likely to have such a disorder or such a condition. This process consists in administrating to said patient an efficient amount of an antibody according to the present invention, a polynucleotide according to the present invention, a compound according to the present invention or a pharmaceutical composition according to the present invention.
[0197] Finally, the present invention relates to the use of an antibody according to the present invention or a compound according to the present invention as a research tool particularly suitable for investigating signalling pathways associated with the endothelin/endothelin receptors axis, as well as for going forward in understanding structural and functional characteristics of these receptor family.
[0198] Further characteristics and advantages of the present invention will better appear to those skilled in the art upon reading examples given below by way of illustrating and non-limiting purposes, in reference to the appended figures.
BRIEF DESCRIPTION OF THE FIGURES
[0199] FIG. 1 shows binding curves of Rendomab-B49 (FIG. 1A), Rendomab-B41 (FIG. 1B) and Rendomab-B36 (FIG. 1C) on CHO cells overexpressing ETB-R with (squares) or without (dots) pre-incubation of the cells in the presence of 300 nM of endothelin 1. In both cases, an affinity in the order of one nanomole has been measured.
[0200] FIG. 2 shows images obtained in confocal microscopy on neurospheres from a biopsy of a patient having a high grade glioblastoma in the presence of 1 .mu.g/mL of labelled Rendomab-B1 (FIG. 2A) or 1 .mu.g/mL of labelled Rendomab-B49 (FIG. 2B). Only the nuclei of DAPI labelled cells are viewed in FIG. 2A.
[0201] FIG. 3 shows images obtained in confocal microscopy on tumor cells from a biopsy of a patient having a low grade glioblastoma in the presence of DAPI (FIG. 3A) or 1 .mu.g/mL of Rendomab-B49 (FIG. 3B).
[0202] FIG. 4 shows images obtained in confocal microscopy on tumor cells from a biopsy of a patient having a glioblastoma in the presence of 1 .mu.g/mL Rendomab-B36.
[0203] FIG. 5 shows the nucleic sequences deduced in amino acids from the variable domains of the light chain (VL) (FIG. 5A) and the heavy chain (VH) (FIG. 5B) of the IgG1/kappa murine antibody Rendomab-B49 specific to the endothelin receptor B.
[0204] FIG. 6 shows the nucleic sequences deduced in amino acids from the variable domains of the light chain (VL) (FIG. 6A) and the heavy chain (VH) (FIG. 6B) of the IgG1/kappa murine antibody Rendomab-B41 specific to the endothelin receptor B.
[0205] FIG. 7 shows the nucleic sequences deduced in amino acids of the variable domains of the light chain (VL) (FIG. 7A) and the heavy chain (VH) (FIG. 7B) of the IgG3/kappa murine antibody Rendomab-B36 specific to the endothelin receptor B.
[0206] FIG. 8 shows the epitopic mapping. FIG. 8A presents the revealed "Pep scan" membrane. FIG. 8B presents the sequences of the peptides recognized by Rendomab-B49 with high intensity (C5, C6, C7, C8, C9 and C10 peptides). FIG. 8C presents the location of the epitope recognized by Rendomab-B49 in the sequence of the human endothelin receptor sub-type B.
DETAILED DISCLOSURE OF PARTICULAR EMBODIMENTS
[0207] I. Materials and Methods
[0208] I.1. Immunisation
[0209] The so-called "gene immunisation" strategy developed in the laboratory of the inventors consists in combining DNA injections with protein boosts as an injection of cells overexpressing ETB-R (Allard et al, 2011, "Electroporation-aided DNA immunisation generates polyclonal antibodies against the native conformation of human endothelin B receptor", DNA and Cell Biology, vol. 30, pages 727-737).
[0210] Briefly, three injections, in a mouse tibial muscle, of 50 .mu.g of plasmid DNA pcDNA3/ETB-R, were made with a periodicity of 14 days. Each DNA injection was followed by an electrostimulation according to the following characteristics: 8 pulses each of 20 ms, 80 Volts, 1 Hz. Three immunisation boosts were then made, by injection by the intra-peritoneal route of 2.10.sup.6 COS cells transiently overexpressing ETB-R.
[0211] The best responder mice were sacrificed in order to conduct cell fusion of the lymphoid cells of their spleens with the murine myeloma NS-1.
[0212] I.2. Screening Hybridomas
[0213] The hybridomas obtained were first screened by ELISA on CHO cells stably expressing ETB-R, with as a negative control, CHO cells expressing the irrelevant receptor NK1 (CHO-WT).
[0214] The hybridomas retained were then screened in flow cytometry (apparatus Guava, Millipore). Three hybridomas called "Rendomab-B49", "Rendomab-B41" and "Rendomab-B36" were finally retained at the end of both these screens. The antibodies secreted were then produced from liquid tumors (ascites) induced in the mouse by injection by the intra-peritoneal route of the selected hybridomas.
[0215] II. Biochemical Characterisation
[0216] After purifying Rendomab-B49, Rendomab-B41 and Rendomab-B36, the characterisation of their biochemical properties was conducted.
[0217] The isotyping of the heavy and light chains of Rendomab-B49 was made using the "Rapid ELISA Mouse mAb Isotyping" kit from Piercell. It is an immunoglobulin of isotype 1, G type, for the heavy chain and kappa for the light chain. Rendomab-B49 is thus an IgG1/kappa type immunoglobulin. Rendomab-B41 and Rendomab-B36 are, an IgG1/kappa type immunoglobulin and an IgG3/kappa type immunoglobulin, respectively.
[0218] After purifying Rendomab-B49, Rendomab-B41 and Rendomab-B36, their binding specificity was established by flow cytometry (Facs Calibur, Becton Dickinson BD Bioscience), by indirect labelling using a commercial fluorescent anti-mouse secondary antibody (Life Technologie: Alexa Fluor.RTM. 488 F(ab')2 fragment of goat anti-mouse IgG (H+L)*2 mg/mL*).
[0219] CHO-ETBR cells were separated into 2 groups. One of the groups was incubated beforehand in a culture medium for 2 h at 37.degree. C. in the presence of endothelin 1 at a final concentration of 300 nM so as to internalise the ETBR receptor for the purpose of demonstrating the recognition specificity of the 3 Rendomab antibodies to ETB-R.
[0220] Then, the cells were aliquoted in a 15 ml falcon tube (300 000 cells/tube) in the presence of an increasing concentration (concentration range from 0.04 nM to 800 nM two by two) of antibody Rendomab-B49. After 2 h incubation at 4.degree. C., the cells are washed three times in a PBS buffer and then incubated for 1 h at 4.degree. C. with the secondary antibody at a final concentration of 4 .mu.g/mL. The cells are then washed 3 times with a PBS buffer and then analyzed with FACs Calibur after counting 30 000 cells.
[0221] III. Binding Properties on Glioblastoma Cells
[0222] III.1. Protocol
[0223] The cells are cultured either in neurospheres (suspended culture) or in adherence on glass slides covered with poly D Lysine/Laminine. The cells are then bound by a 4% paraformaldehyde solution for 15 min at room temperature, and then washed twice with PBS (SigmaAldrich). The non-specific sites are blocked and the cells are permeabilized by a PBS solution+5% donkey serum+0.1% Triton, for 30 min.
[0224] The primary antibody Rendomab-B49, diluted in the previous solution at 1 .mu.g/mL is contacted with the cells overnight at 8.degree. C. After 2 rinses with PBS, the cells are incubated with a commercial secondary antibody at a final concentration of 4 .mu.g/ml either coupled with Alexa 488 (Life Technologie: Alexa Fluor.RTM. 488 F(ab')2 fragment of goat anti-mouse IgG (H+L)*2 mg/mL*) or coupled with Alexa 680 (Life Technologie Alexa Fluor.RTM. 680 F(ab')2 fragment of goat anti-mouse IgG (H+L)*2 mg/mL*) for 2 h according to the recommendations of the provider, and then rinsed twice with PBS.
[0225] The cells are briefly incubated with a 1 .mu.g/ml DAPI (4',6-diamidino-2-phenylindole) solution to view the nuclei, and then after washing with PBS, the coverslips are mounted between slip and slide with an ad hoc assembling medium for observation. The photographs are taken with a Zeiss microscope provided with a 400 magnification apotome module.
[0226] III.2. Results
[0227] The affinity close to the nanomolar range for Rendomab-B49, Rendomab-B41 and Rendomab-B36 and their exclusive specificity for the human endothelin receptor sub-type B are illustrated in FIG. 1.
[0228] The binding curve observed for Rendomab-B49 (FIG. 1A), Rendomab-B41 (FIG. 1B) and Rendomab-B36 (FIG. 1C) is characteristic of the binding of an antibody to its target with a saturation plateau.
[0229] In addition, the pre-incubation of CHO-ETBR cells for 2 h at 37.degree. C. in the presence of 300 nM of endothelin 1 causes the internalisation of ETB-R, which results in a drop of more than 50% of the Rendomab-B49, Rendomab-B41 and Rendomab-B36 binding under these conditions thus demonstrating the binding specificity of these antibodies for ETB-R. The apparent dissociation constant K.sub.D of the antibodies is determined by taking the value of the concentration giving a MFI equal to 50% the value of the MFI at the plateau. This constant is close to 1 nM for the 3 antibodies.
[0230] Then, the absence of binding of Rendomab-B49, Rendomab-B41 and Rendomab-B36 on CHO-WT cells non transfected by ETBR is noted showing that the binding observed on CHO-ETBR cells is not due to a membrane protein of the CHO cells.
[0231] Binding experiments on tumor cells isolated from biopsies of patients with a glioblastoma.
[0232] In FIG. 2, there is an absence of labelling of neurospheres isolated from a high grade glioblastoma tumor with the antibody Rendomab-B1 (FIG. 2A) whereas it is observed, on the same cells, a very strong fluorescent labelling with the antibody Rendomab-B49 (FIG. 2B).
[0233] Likewise, FIG. 3 shows a strong fluorescent labelling by the antibody Rendomab-B49 (FIG. 3B) of tumor cells isolated from a low grade glioblastoma tumor, these cells being also labelled with DAPI (FIG. 3A).
[0234] Comparable results are obtained with the antibodies Rendomab-B41 and Rendomab-B36. To that end, FIG. 4 shows a strong fluorescent labelling with the antibody Rendomab-B36 on tumor cells isolated from a glioblastoma tumor.
[0235] IV. Molecular Cloning
[0236] The cloning of nucleic precursors coding the heavy chain and the light chain of Rendomab-B1 was made using the kits: "Gene-Elute/total RNA" (Sigma) and "RACE-PCR" (Invitrogen).
[0237] The nucleic sequences deduced in amino acids of the variable domains of the light chain (VL) and the heavy chain (VH) of Rendomab-B49, Rendomab-B41 and Rendomab-B36 are given in FIGS. 5 to 7 respectively.
[0238] V. Epitopic Mapping
[0239] V.1. Materials and Methods
[0240] The mapping of the epitope recognised by Rendomab-B49, Rendomab-B41 and Rendomab-B36 at the ETB-R surface was made by a "Pep-scan" technique in collaboration with and according to the protocols developed within UMR 3145 "SysDiag" CNRS/BioRad located in Montpellier (Dr. Claude Granier). The sequence of the human endothelin receptor sub-type B exhibits the following amino acid sequence:
TABLE-US-00019 (SEQ ID NO: 42) MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPT KTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETF KYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLH IVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRY RAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGS YLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEM LRKKSGMQIALNDHLKORREVAKTVFCLVLVFALCWLPLHLSRILKLTLY NQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSC LCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS.
[0241] For this, 144 peptides of the 12 amino acids each offset by one amino acid were used. These peptides correspond to all the ETB-R sequences displayed on the extra-cytoplasmic side of the membrane.
[0242] In order to reveal the epitopic peptide(s) recognized by Rendomab-B49, the "Pep-scan" membrane was treated according to the following protocol:
[0243] humidification of the membrane in an ethanol bath;
[0244] 3 washes in 25 ml of TBS buffer (50 mM Tris, 150 mM NaCl, pH 7.4) for 10 min under agitation at ambient temperature;
[0245] saturation of the membrane with 25 ml of the saturation buffer (TBS, 5% skimmed milk powder, 0.1% Tween 20) for 30 min under agitation at ambient temperature;
[0246] incubation with 25 ml of saturation buffer containing the Rendomab-B49 antibody at a final concentration of 1 .mu.g/ml overnight at 4.degree. C. under agitation;
[0247] 3 short washes (30 seconds) with TBS buffer then 3 washes of 10 min under agitation with 25 ml of TBST buffer (TBST=TBS+0.1% Tween 20);
[0248] incubation with 25 ml of saturation buffer containing the goat anti-mouse secondary antibody diluted at 1/5,000 for 30 min at ambient temperature under agitation;
[0249] 3 short washes (30 seconds) with TBS buffer then 3 washes of 10 min under agitation with 25 ml of TBST buffer;
[0250] revelation of the membrane by immersing it in the revelation solution from Pierce (Pierce ECL Plus Western Blotting Ref: 32132) for 5 min and by the signal acquisition in automatic mode by the system ChemiDoc.TM. of BioRad).
[0251] V.2. Results
[0252] The results of the epitopic analysis of Rendomab-B49 are presented at FIG. 8. The peptide sequences hybridizing with high intensity are C5, C6, C7, C8, C9 and C10 peptides (FIG. 8A).
[0253] Their alignment makes it possible to identify the epitope predominantly recognized by Rendomab-B49: the latter is EVPKGDR corresponding to the sequence from amino acid 70 to amino acid 76 in SEQ ID NO: 42 (FIG. 8B). As soon as the glutamic acid E70 is lacking in peptide C11 of sequence VPKGDRTAGSPP corresponding to the sequence from amino acid 71 to amino acid 82 in SEQ ID NO: 42, the antibody binding decreases significantly (FIG. 8A).
[0254] The location of the epitopic peptide in the sequence of the human endothelin receptor sub-type B is presented at FIG. 8C. This sequence is at the N-terminal end of the receptor.
Sequence CWU
1
1
42127PRTUnknownOrdered juxtaposition of the CDRs of the heavy chain
variable region 1Gly Tyr Thr Phe Ile Ser Tyr Trp Ile Asp Pro Asp Ser Gly
Gly Thr1 5 10 15Ala Arg
Glu Gly Asp Tyr Ala Trp Phe Ala Tyr 20
25223PRTUnknownOrdered juxtaposition of the CDRs of the light chain
variable region 2Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Lys Val Ser
Phe Gln1 5 10 15Gly Ser
His Val Pro Trp Thr 2038PRTunknownConsensus sequence for
CDR1HMISC_FEATURE(5)..(5)X represents any amino acid and, in particular,
either I, or T 3Gly Tyr Thr Phe Xaa Ser Tyr Trp1
5424DNAMus musculusCDS(1)..(24)CDR1H of Rendomab B49 4ggc tac acc ttc atc
agc tac tgg 24Gly Tyr Thr Phe Ile
Ser Tyr Trp1 558PRTMus musculus 5Gly Tyr Thr Phe Ile Ser
Tyr Trp1 5624DNAMus musculusCDS(1)..(24)CDR1H of Rendomab
B41 and Rendomab B36 6ggc tac acc ttc acc agc tac tgg
24Gly Tyr Thr Phe Thr Ser Tyr Trp1
578PRTMus musculus 7Gly Tyr Thr Phe Thr Ser Tyr Trp1
588PRTUnknownConsensus sequence for CDR2HMISC_FEATURE(4)..(4)X represents
any amino acid and, in particular, either D, or N 8Ile Asp Pro Xaa
Ser Gly Gly Thr1 5924DNAMus
musculusmisc_feature(1)..(24)Sequence coding CDR2H of Rendomab B49 (N =
C) or of Rendomab B41 (N = T)misc_feature(15)..(15)N represents
either C, or T 9attgatcctg atagnggtgg tact
24108PRTMus musculusDOMAIN(1)..(8)CDR2H of Rendomab B49 and
of Rendomab B41 10Ile Asp Pro Asp Ser Gly Gly Thr1
51124DNAMus musculusCDS(1)..(24)CDR2H of Rendomab B36 11att gat cct aat
agt ggt ggc act 24Ile Asp Pro Asn
Ser Gly Gly Thr1 5128PRTMus musculus 12Ile Asp Pro Asn Ser
Gly Gly Thr1 51311PRTUnknownConsensus sequence for
CDR3HMISC_FEATURE(1)..(1)X represents any amino acid and, in particular,
is selected from A, D, Y, E, F, V and W and, more particularly,
it is either A, or VMISC_FEATURE(5)..(5)X represents any amino acid and,
in particular, is selected from A, D, Y, E, F, V and W and, more
particularly, is selected from D, W and EMISC_FEATURE(6)..(6)X
represents any amino acid and, in particular, is selected from A, D,
Y, E, F, V and W and, more particularly, is selected from Y, D and
FMISC_FEATURE(10)..(10)X represents any amino acid and, in particular,
is selected from A, D, Y, E, F, V and W and, more particularly, is
either A, or V 13Xaa Arg Glu Gly Xaa Xaa Ala Trp Phe Xaa Tyr1
5 101433DNAMus musculusCDS(1)..(33)CDR3H of Rendomab
B49 14gca aga gaa ggg gat tac gcc tgg ttt gct tac
33Ala Arg Glu Gly Asp Tyr Ala Trp Phe Ala Tyr1 5
101511PRTMus musculus 15Ala Arg Glu Gly Asp Tyr Ala Trp Phe Ala
Tyr1 5 101633DNAMus
musculusCDS(1)..(33)CDR3H of Rendomab B41 16gta aga gaa ggg tgg gac gcc
tgg ttt gtt tac 33Val Arg Glu Gly Trp Asp Ala
Trp Phe Val Tyr1 5 101711PRTMus musculus
17Val Arg Glu Gly Trp Asp Ala Trp Phe Val Tyr1 5
101833DNAMus musculusCDS(1)..(33)CDR3H of Rendomab B36 18gca aga
gag ggg gaa ttc gcc tgg ttt gct tac 33Ala Arg
Glu Gly Glu Phe Ala Trp Phe Ala Tyr1 5
101911PRTMus musculus 19Ala Arg Glu Gly Glu Phe Ala Trp Phe Ala Tyr1
5 102011PRTUnknownConsensus sequence for
CDR1LMISC_FEATURE(2)..(2)X represents any amino acid and, in particular,
is selected from N, Y and S and, more particularly, is either N,
or SMISC_FEATURE(9)..(9)X represents any amino acid and, in particular,
is selected from N, Y and S and, more particularly, is either N,
or Y 20Gln Xaa Ile Val His Ser Asn Gly Xaa Thr Tyr1 5
102133DNAMus musculusCDS(1)..(33)CDR1L of Rendomab B49 and of
Rendomab B41 21cag agc att gta cat agt aat gga aac acc tat
33Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr1 5
102211PRTMus musculus 22Gln Ser Ile Val His Ser Asn Gly
Asn Thr Tyr1 5 102333DNAMus
musculusCDS(1)..(33)CDR1L of Rendomab B36 23cag aac att gtc cat agt aat
gga tac acc tat 33Gln Asn Ile Val His Ser Asn
Gly Tyr Thr Tyr1 5 102411PRTMus musculus
24Gln Asn Ile Val His Ser Asn Gly Tyr Thr Tyr1 5
10259PRTUnknownConsensus sequence for CDR3LMISC_FEATURE(8)..(8)X
represents any amino acid and, in particular, is either W, or L
25Phe Gln Gly Ser His Val Pro Xaa Thr1 52627DNAMus
musculusCDS(1)..(27)CDR3L of Rendomab B49 26ttt caa ggt tca cat gtt ccg
tgg acg 27Phe Gln Gly Ser His Val Pro
Trp Thr1 5279PRTMus musculus 27Phe Gln Gly Ser His Val Pro
Trp Thr1 52827DNAMus musculusmisc_feature(1)..(27)Sequence
coding CDR3L of Rendomab B41 and of Rendomab
B36misc_feature(21)..(21)N represents either G, or T 28tttcaaggtt
cacatgttcc nctcacg 27299PRTMus
musculusDOMAIN(1)..(9)CDR3L of Rendomab B41 and of Rendomab B36 29Phe Gln
Gly Ser His Val Pro Leu Thr1 530354DNAMus
musculusCDS(1)..(354)Heavy chain variable region of Rendomab B49 30cag
gtc caa ctg cag cag cct ggg gct gcg ctt gtg aag cct ggg gct 48Gln
Val Gln Leu Gln Gln Pro Gly Ala Ala Leu Val Lys Pro Gly Ala1
5 10 15tca gtg aag ctg tcc tgc aag
gct tct ggc tac acc ttc atc agc tac 96Ser Val Lys Leu Ser Cys Lys
Ala Ser Gly Tyr Thr Phe Ile Ser Tyr 20 25
30tgg atg ctc tgg gtg aag cag agg cct gga cga ggc ctt gag
tgg att 144Trp Met Leu Trp Val Lys Gln Arg Pro Gly Arg Gly Leu Glu
Trp Ile 35 40 45gga agg att gat
cct gat agc ggt ggt act aag tac aat gag aag ttc 192Gly Arg Ile Asp
Pro Asp Ser Gly Gly Thr Lys Tyr Asn Glu Lys Phe 50 55
60aag agc aag gcc aca ctg act gta gac aaa tcc tcc agc
aca gcc tac 240Lys Ser Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser
Thr Ala Tyr65 70 75
80atg cag ctc agc agc ctg aca tct gag gac tct gcg gtc tat tat tgt
288Met Gln Leu Ser Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys
85 90 95gca aga gaa ggg gat tac
gcc tgg ttt gct tac tgg ggc caa ggg act 336Ala Arg Glu Gly Asp Tyr
Ala Trp Phe Ala Tyr Trp Gly Gln Gly Thr 100
105 110ctg gtc cct gtc tct gca
354Leu Val Pro Val Ser Ala 11531118PRTMus
musculus 31Gln Val Gln Leu Gln Gln Pro Gly Ala Ala Leu Val Lys Pro Gly
Ala1 5 10 15Ser Val Lys
Leu Ser Cys Lys Ala Ser Gly Tyr Thr Phe Ile Ser Tyr 20
25 30Trp Met Leu Trp Val Lys Gln Arg Pro Gly
Arg Gly Leu Glu Trp Ile 35 40
45Gly Arg Ile Asp Pro Asp Ser Gly Gly Thr Lys Tyr Asn Glu Lys Phe 50
55 60Lys Ser Lys Ala Thr Leu Thr Val Asp
Lys Ser Ser Ser Thr Ala Tyr65 70 75
80Met Gln Leu Ser Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr
Tyr Cys 85 90 95Ala Arg
Glu Gly Asp Tyr Ala Trp Phe Ala Tyr Trp Gly Gln Gly Thr 100
105 110Leu Val Pro Val Ser Ala
11532354DNAMus musculusCDS(1)..(354)Heavy chain variable region of
Rendomab B41 32cag gtc caa ctg cag cag cct ggg gct gag ctt gtg aag cct
ggg gct 48Gln Val Gln Leu Gln Gln Pro Gly Ala Glu Leu Val Lys Pro
Gly Ala1 5 10 15tca gtg
aag ctg tcc tgc aag gct tct ggc tac acc ttc acc agc tac 96Ser Val
Lys Leu Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr 20
25 30tgg atg cac tgg gtg aag cag agg cct
gga cga ggc ctt gag tgg att 144Trp Met His Trp Val Lys Gln Arg Pro
Gly Arg Gly Leu Glu Trp Ile 35 40
45gga agg att gat cct gat agt ggt ggt act aaa tac aat gag aag ttc
192Gly Arg Ile Asp Pro Asp Ser Gly Gly Thr Lys Tyr Asn Glu Lys Phe 50
55 60aag agc aag gcc aca ctg act gta gac
aaa ccc tcc aac aca gcc aac 240Lys Ser Lys Ala Thr Leu Thr Val Asp
Lys Pro Ser Asn Thr Ala Asn65 70 75
80atg cag ctc agc agc ctg aca tct gaa gac tct gcg gtc tat
tat tgt 288Met Gln Leu Ser Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr
Tyr Cys 85 90 95gta aga
gaa ggg tgg gac gcc tgg ttt gtt tac tgg ggc caa ggg act 336Val Arg
Glu Gly Trp Asp Ala Trp Phe Val Tyr Trp Gly Gln Gly Thr 100
105 110ctg ctc act gtc tct gca
354Leu Leu Thr Val Ser Ala
11533118PRTMus musculus 33Gln Val Gln Leu Gln Gln Pro Gly Ala Glu Leu Val
Lys Pro Gly Ala1 5 10
15Ser Val Lys Leu Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr
20 25 30Trp Met His Trp Val Lys Gln
Arg Pro Gly Arg Gly Leu Glu Trp Ile 35 40
45Gly Arg Ile Asp Pro Asp Ser Gly Gly Thr Lys Tyr Asn Glu Lys
Phe 50 55 60Lys Ser Lys Ala Thr Leu
Thr Val Asp Lys Pro Ser Asn Thr Ala Asn65 70
75 80Met Gln Leu Ser Ser Leu Thr Ser Glu Asp Ser
Ala Val Tyr Tyr Cys 85 90
95Val Arg Glu Gly Trp Asp Ala Trp Phe Val Tyr Trp Gly Gln Gly Thr
100 105 110Leu Leu Thr Val Ser Ala
11534354DNAMus musculusCDS(1)..(354)Heavy chain variable region of
Rendomab B36 34cag gtc caa ctg cag cag cct ggg gct gaa ctt gtg aag cct
ggg gct 48Gln Val Gln Leu Gln Gln Pro Gly Ala Glu Leu Val Lys Pro
Gly Ala1 5 10 15tca gtg
aag ctg tcc tgc aag gct tct ggc tac acc ttc acc agc tac 96Ser Val
Lys Leu Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr 20
25 30tgg ata cac tgg gta aat cag agg cct
gga cga ggc ctt gag tgg att 144Trp Ile His Trp Val Asn Gln Arg Pro
Gly Arg Gly Leu Glu Trp Ile 35 40
45gga agg att gat cct aat agt ggt ggc act aag tac aat gag aag ttc
192Gly Arg Ile Asp Pro Asn Ser Gly Gly Thr Lys Tyr Asn Glu Lys Phe 50
55 60aag agt aag gcc aca ctg act gta gac
aaa acc tcc agc aca gcc tac 240Lys Ser Lys Ala Thr Leu Thr Val Asp
Lys Thr Ser Ser Thr Ala Tyr65 70 75
80atg cag ttc agc agc ctg aca tct gag gac tct gcg gtc tat
tat tgt 288Met Gln Phe Ser Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr
Tyr Cys 85 90 95gca aga
gag ggg gaa ttc gcc tgg ttt gct tac tgg ggc caa ggg act 336Ala Arg
Glu Gly Glu Phe Ala Trp Phe Ala Tyr Trp Gly Gln Gly Thr 100
105 110ctg gtc act gtc tct gca
354Leu Val Thr Val Ser Ala
11535118PRTMus musculus 35Gln Val Gln Leu Gln Gln Pro Gly Ala Glu Leu Val
Lys Pro Gly Ala1 5 10
15Ser Val Lys Leu Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr
20 25 30Trp Ile His Trp Val Asn Gln
Arg Pro Gly Arg Gly Leu Glu Trp Ile 35 40
45Gly Arg Ile Asp Pro Asn Ser Gly Gly Thr Lys Tyr Asn Glu Lys
Phe 50 55 60Lys Ser Lys Ala Thr Leu
Thr Val Asp Lys Thr Ser Ser Thr Ala Tyr65 70
75 80Met Gln Phe Ser Ser Leu Thr Ser Glu Asp Ser
Ala Val Tyr Tyr Cys 85 90
95Ala Arg Glu Gly Glu Phe Ala Trp Phe Ala Tyr Trp Gly Gln Gly Thr
100 105 110Leu Val Thr Val Ser Ala
11536336DNAMus musculusCDS(1)..(336)Light chain variable region of
Rendomab B49 36gat gtt ttg atg acc caa act cca ctc tcc ctg cct gtc agt
ctt gga 48Asp Val Leu Met Thr Gln Thr Pro Leu Ser Leu Pro Val Ser
Leu Gly1 5 10 15gat caa
gcc tcc atc tct tgc aga tct agt cag agc att gta cat agt 96Asp Gln
Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Ile Val His Ser 20
25 30aat gga aac acc tat tta gaa tgg tac
ctg cag aaa cca ggc cag tct 144Asn Gly Asn Thr Tyr Leu Glu Trp Tyr
Leu Gln Lys Pro Gly Gln Ser 35 40
45cca aag ctc ctg atc tac aaa gtt tcc aac cga ttt tct ggg gtc cca
192Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro 50
55 60gac agg ttc agt ggc agt gga tca ggg
aca gat ttc aca ctc aag atc 240Asp Arg Phe Ser Gly Ser Gly Ser Gly
Thr Asp Phe Thr Leu Lys Ile65 70 75
80agc aga gtg gag gct gag gat ctg gga gtt tat tac tgc ttt
caa ggt 288Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys Phe
Gln Gly 85 90 95tca cat
gtt ccg tgg acg ttc ggt gga ggc acc aag ctg gaa atc aaa 336Ser His
Val Pro Trp Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys 100
105 11037112PRTMus musculus 37Asp Val Leu
Met Thr Gln Thr Pro Leu Ser Leu Pro Val Ser Leu Gly1 5
10 15Asp Gln Ala Ser Ile Ser Cys Arg Ser
Ser Gln Ser Ile Val His Ser 20 25
30Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro Gly Gln Ser
35 40 45Pro Lys Leu Leu Ile Tyr Lys
Val Ser Asn Arg Phe Ser Gly Val Pro 50 55
60Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile65
70 75 80Ser Arg Val Glu
Ala Glu Asp Leu Gly Val Tyr Tyr Cys Phe Gln Gly 85
90 95Ser His Val Pro Trp Thr Phe Gly Gly Gly
Thr Lys Leu Glu Ile Lys 100 105
11038339DNAMus musculusCDS(1)..(339)Light chain variable region of
Rendomab B41 38gat gtt ttg atg acc caa act cca ctc tcc ctg cct gtc agt
ctt gga 48Asp Val Leu Met Thr Gln Thr Pro Leu Ser Leu Pro Val Ser
Leu Gly1 5 10 15gat caa
gcc tcc atc tct tgc aga tct agt cag agc att gta cat agt 96Asp Gln
Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser Ile Val His Ser 20
25 30aat gga aac acc tat tta gaa tgg tac
ttg cag aaa cca ggc cag tct 144Asn Gly Asn Thr Tyr Leu Glu Trp Tyr
Leu Gln Lys Pro Gly Gln Ser 35 40
45cca aag ctc ctg atc tac aaa gtt ttc aac cga ttt tct ggg gtc cca
192Pro Lys Leu Leu Ile Tyr Lys Val Phe Asn Arg Phe Ser Gly Val Pro 50
55 60gac agg ttc agt ggc agt gga tca ggg
aca gat ttc aca ctc aag atc 240Asp Arg Phe Ser Gly Ser Gly Ser Gly
Thr Asp Phe Thr Leu Lys Ile65 70 75
80agc aga gtg gag gct gag gat ctg gga gtt tat tac tgc ttt
caa ggt 288Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys Phe
Gln Gly 85 90 95tca cat
gtt ccg ctc acg ttc ggt gct ggg acc aag ctg gag ctg aaa 336Ser His
Val Pro Leu Thr Phe Gly Ala Gly Thr Lys Leu Glu Leu Lys 100
105 110cgg
339Arg39113PRTMus musculus 39Asp Val Leu
Met Thr Gln Thr Pro Leu Ser Leu Pro Val Ser Leu Gly1 5
10 15Asp Gln Ala Ser Ile Ser Cys Arg Ser
Ser Gln Ser Ile Val His Ser 20 25
30Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro Gly Gln Ser
35 40 45Pro Lys Leu Leu Ile Tyr Lys
Val Phe Asn Arg Phe Ser Gly Val Pro 50 55
60Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile65
70 75 80Ser Arg Val Glu
Ala Glu Asp Leu Gly Val Tyr Tyr Cys Phe Gln Gly 85
90 95Ser His Val Pro Leu Thr Phe Gly Ala Gly
Thr Lys Leu Glu Leu Lys 100 105
110Arg40339DNAMus musculusCDS(1)..(339)Light chain variable region of
Rendomab B36 40gat gtt ttg atg acc caa act cca ctc tcc ctg cct gtc agt
ctt gga 48Asp Val Leu Met Thr Gln Thr Pro Leu Ser Leu Pro Val Ser
Leu Gly1 5 10 15gat caa
gcc tcc atc tct tgc aga tct agt cag aac att gtc cat agt 96Asp Gln
Ala Ser Ile Ser Cys Arg Ser Ser Gln Asn Ile Val His Ser 20
25 30aat gga tac acc tat tta gaa tgg tac
ctg cag aaa cca ggc cag tct 144Asn Gly Tyr Thr Tyr Leu Glu Trp Tyr
Leu Gln Lys Pro Gly Gln Ser 35 40
45cca aag ctc ctg atc tac aaa gtt tcc aac cga ttt tct ggg gtc cca
192Pro Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro 50
55 60gac agg ttc agt ggc agt gga tca ggg
aca gat ttc aca ctc aag atc 240Asp Arg Phe Ser Gly Ser Gly Ser Gly
Thr Asp Phe Thr Leu Lys Ile65 70 75
80agc aga gtg gag gct gag gat ctg gga gtt tat tac tgc ttt
caa ggt 288Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr Tyr Cys Phe
Gln Gly 85 90 95tca cat
gtt cct ctc acg ttc ggc tcg ggg aca aag ttg gaa ata aaa 336Ser His
Val Pro Leu Thr Phe Gly Ser Gly Thr Lys Leu Glu Ile Lys 100
105 110cgg
339Arg41113PRTMus musculus 41Asp Val Leu
Met Thr Gln Thr Pro Leu Ser Leu Pro Val Ser Leu Gly1 5
10 15Asp Gln Ala Ser Ile Ser Cys Arg Ser
Ser Gln Asn Ile Val His Ser 20 25
30Asn Gly Tyr Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro Gly Gln Ser
35 40 45Pro Lys Leu Leu Ile Tyr Lys
Val Ser Asn Arg Phe Ser Gly Val Pro 50 55
60Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile65
70 75 80Ser Arg Val Glu
Ala Glu Asp Leu Gly Val Tyr Tyr Cys Phe Gln Gly 85
90 95Ser His Val Pro Leu Thr Phe Gly Ser Gly
Thr Lys Leu Glu Ile Lys 100 105
110Arg42442PRTHomo sapiensCHAIN(1)..(442)Sequence of the human
endothelin receptor sub-type BCHAIN(1)..(101)Extracellular
regionSIGNAL(1)..(26)Signal peptideMISC_FEATURE(64)..(64)Proteolysis
siteCHAIN(65)..(76)Peptide C5CHAIN(66)..(77)Peptide
C6CHAIN(67)..(78)Peptide C7CHAIN(68)..(79)Peptide
C8CHAIN(69)..(80)Peptide C9CHAIN(70)..(81)Peptide
C10CHAIN(70)..(76)Epitope recognized by
Rendomab-B49CHAIN(71)..(82)Peptide C11CHAIN(72)..(83)Peptide
C12CHAIN(102)..(126)Transmembrane regionCHAIN(127)..(137)Intracellular
regionCHAIN(138)..(163)Transmembrane regionCHAIN(164)..(175)Extracellular
regionCHAIN(176)..(197)Transmembrane regionCHAIN(198)..(218)Intracellular
regionCHAIN(219)..(243)Transmembrane regionCHAIN(244)..(274)Extracellular
regionCHAIN(275)..(296)Transmembrane regionCHAIN(297)..(324)Intracellular
regionCHAIN(325)..(350)Transmembrane regionCHAIN(351)..(362)Extracellular
regionCHAIN(363)..(389)Transmembrane regionCHAIN(390)..(442)Intracellular
region 42Met Gln Pro Pro Pro Ser Leu Cys Gly Arg Ala Leu Val Ala Leu Val1
5 10 15Leu Ala Cys Gly
Leu Ser Arg Ile Trp Gly Glu Glu Arg Gly Phe Pro 20
25 30Pro Asp Arg Ala Thr Pro Leu Leu Gln Thr Ala
Glu Ile Met Thr Pro 35 40 45Pro
Thr Lys Thr Leu Trp Pro Lys Gly Ser Asn Ala Ser Leu Ala Arg 50
55 60Ser Leu Ala Pro Ala Glu Val Pro Lys Gly
Asp Arg Thr Ala Gly Ser65 70 75
80Pro Pro Arg Thr Ile Ser Pro Pro Pro Cys Gln Gly Pro Ile Glu
Ile 85 90 95Lys Glu Thr
Phe Lys Tyr Ile Asn Thr Val Val Ser Cys Leu Val Phe 100
105 110Val Leu Gly Ile Ile Gly Asn Ser Thr Leu
Leu Arg Ile Ile Tyr Lys 115 120
125Asn Lys Cys Met Arg Asn Gly Pro Asn Ile Leu Ile Ala Ser Leu Ala 130
135 140Leu Gly Asp Leu Leu His Ile Val
Ile Asp Ile Pro Ile Asn Val Tyr145 150
155 160Lys Leu Leu Ala Glu Asp Trp Pro Phe Gly Ala Glu
Met Cys Lys Leu 165 170
175Val Pro Phe Ile Gln Lys Ala Ser Val Gly Ile Thr Val Leu Ser Leu
180 185 190Cys Ala Leu Ser Ile Asp
Arg Tyr Arg Ala Val Ala Ser Trp Ser Arg 195 200
205Ile Lys Gly Ile Gly Val Pro Lys Trp Thr Ala Val Glu Ile
Val Leu 210 215 220Ile Trp Val Val Ser
Val Val Leu Ala Val Pro Glu Ala Ile Gly Phe225 230
235 240Asp Ile Ile Thr Met Asp Tyr Lys Gly Ser
Tyr Leu Arg Ile Cys Leu 245 250
255Leu His Pro Val Gln Lys Thr Ala Phe Met Gln Phe Tyr Lys Thr Ala
260 265 270Lys Asp Trp Trp Leu
Phe Ser Phe Tyr Phe Cys Leu Pro Leu Ala Ile 275
280 285Thr Ala Phe Phe Tyr Thr Leu Met Thr Cys Glu Met
Leu Arg Lys Lys 290 295 300Ser Gly Met
Gln Ile Ala Leu Asn Asp His Leu Lys Gln Arg Arg Glu305
310 315 320Val Ala Lys Thr Val Phe Cys
Leu Val Leu Val Phe Ala Leu Cys Trp 325
330 335Leu Pro Leu His Leu Ser Arg Ile Leu Lys Leu Thr
Leu Tyr Asn Gln 340 345 350Asn
Asp Pro Asn Arg Cys Glu Leu Leu Ser Phe Leu Leu Val Leu Asp 355
360 365Tyr Ile Gly Ile Asn Met Ala Ser Leu
Asn Ser Cys Ile Asn Pro Ile 370 375
380Ala Leu Tyr Leu Val Ser Lys Arg Phe Lys Asn Cys Phe Lys Ser Cys385
390 395 400Leu Cys Cys Trp
Cys Gln Ser Phe Glu Glu Lys Gln Ser Leu Glu Glu 405
410 415Lys Gln Ser Cys Leu Lys Phe Lys Ala Asn
Asp His Gly Tyr Asp Asn 420 425
430Phe Arg Ser Ser Asn Lys Tyr Ser Ser Ser 435
440
User Contributions:
Comment about this patent or add new information about this topic: