REDUCTION OF GASTROINTESTINAL TRACT COLONISATION BY CAMPYLOBACTER

Abstract

Campylobacter are the commonest reported bacterial causes of gastroenteritis in the UK and industrialized worlds. This invention relates to a method of preventing or reducing the colonisation of the gastrointestinal tract of an animal with Campylobacter. Accordingly, the present invention provides a method for disinfection of an animal comprising administering to said animal at least one compound that binds to MOMP or FlaA of Campylobacter in an effective amount to reduce the number of Campylobacter present in the gastrointestinal tract of said animal. The present invention also provides a method of preventing or reducing transmission of Campylobacter from one animal to another.

Description

[0001] This invention relates to a method of preventing or reducing the colonisation of the gastrointestinal tract of an animal with Campylobacter. In particular, it relates to reduction or prevention of colonisation of the gastrointestinal tract of poultry with Campylobacter. It also relates to uses of compounds that bind to adhesins on the surface of Campylobacter to prevent the bacteria from adhering to the wall of the gastrointestinal tract of animals and to treat Campylobacter infection in humans and animals.

[0002] Campylobacter are the commonest reported bacterial causes of gastroenteritis in the UK and industrialized world. Campylobacter jejuni (C. jejuni) is responsible for about 90% of Campylobacter infections, the majority of the remainder being caused by C. coli. Campylobacter form part of the natural gastrointestinal flora of many birds and domestic animals, but chickens are thought to constitute the largest source of human infection. Infected chickens are asymptomatic despite harbouring up to 10.sup.8 colony forming units (cfu) per gram of intestinal content. Meat, in particular chicken meat, is often contaminated with intestinal contents including Campylobacter during slaughter. In humans, Campylobacter species cause diseases that vary in severity from mild watery diarrhoea to bloody dysentery. In a small subgroup of patients, the acute phase disease is followed by serious sequelae, including Guillain-Barre syndrome and reactive arthritis.

[0003] It is therefore of great interest to provide methods for reducing and preventing the risk of contamination of meat with Campylobacter and therefore the risk of human infection with Campylobacter. It is also of interest to provide new treatments for human infection with Campylobacter (campylobacteriosis).

[0004] Accordingly, the present invention provides a method for disinfection of an animal comprising administering to said animal at least one compound that binds to MOMP or FlaA of Campylobacter in an effective amount to reduce the number of Campylobacter present in the gastrointestinal tract of said animal.

[0005] The present invention also provides a method for disinfection of an animal comprising administering to said animal at least one compound that binds to MOMP or FlaA of Campylobacter in an effective amount to prevent said Campylobacter from forming a biofilm in the gastrointestinal tract of said animal or to reduce the amount of biofilm formed by Campylobacter in the intestinal tract of said animal.

[0006] The present invention also provides a method for preventing or reducing transmission of Campylobacter infection from one animal to another, for example preventing or reducing spread of Campylobacter infection within a flock or herd of animals, for example preventing spread of Campylobacter infection within a flock of chickens; said method comprising administering to said animals, for example said herd or flock of animals, for example said flock of chickens, at least one compound that binds to MOMP or FlaA of Campylobacter in an effective amount to prevent said Campylobacter from forming a biofilm in the gastrointestinal tract of said animal or to reduce the amount of biofilm formed by Campylobacter in the intestinal tract of said animal.

[0007] The methods of the present invention may allow disinfection, prevention of biofilm formation and reduction of transmission of Campylobacter between animals by preventing or reducing adherence of Campylobacter of the gastrointestinal tract of said animals. This is advantageous because the fewer Campylobacter that are in the gastrointestinal tract of an animal at the time of slaughter, the lower the risk of contamination of meat from the animal with Campylobacter. The fewer Campylobacter that are in the gastrointestinal tract of an animal the lower the chance of the Campylobacter forming a biofilm in the gastrointestinal tract of the animal. The fewer Campylobacter that are in the gastrointestinal tract of an animal, the lower the chance that the Campylobacter will spread from one animal to another, for example within a herd or flock of animals.

[0008] Method of the present invention may be used to reduce the amount of colonisation of the gastrointestinal tract of any animal with Campylobacter. It is particularly advantageous to provide the compounds to animals that will be slaughtered for human consumption, such as, for example, cattle, sheep, pigs, goats, deer, fish, shellfish and poultry. Poultry includes birds that are used for human consumption such as chickens, geese, turkeys and ducks. It is particularly advantageous to use the compounds of the present invention to reduce or prevent colonisation of the gastrointestinal tract of poultry, in particular chickens, with Campylobacter because chickens are a leading source of human infection with Campylobacter.

[0009] Campylobacter are gram negative, spiral rod shaped bacteria with a single flagellum at one or both poles. They belong to the epsilon proteobacteria class and are closely related to Helicobacter and Wolinella. Although these species are related they have very different culture requirements and different hosts. Campylobacter species usually live in the gut of animals, in particular chickens while Helicobacter lives in the stomach of humans. Although fastidious in their culture requirements, Campylobacter species, particularly C. jejuni and C. coli, are important human pathogens, causing gastroenteritis of varying severity. Under normal circumstances gastroenteritis is self-limiting, but sequelae associated with campylobacteriosis such as Guillain-Barre syndrome are potentially life threatening. There are many different reservoirs for Campylobacter but the most significant is contaminated meat, particularly poultry.

[0010] The number of Campylobacter in the gastrointestinal tracts of animals may be reduced by the methods of the present invention. In one embodiment the number of colony forming units (cfu) of Campylobacter in the gastrointestinal tract of an animal treated with the compounds of the present invention may be reduced by 50%, by 60%, by 70%, by 80%, by 90% or by 100%. In one embodiment Campylobacter may be substantially eradicated from the gastrointestinal tract of animals treated by the method of the present invention.

[0011] 10000 cfu of Campylobacter are enough for successful chicken colonization. 1000 cfu of Campylobacter are enough to infect a human and cause disease in a human. Therefore, an effective amount of a compound of the present invention is enough of the compound to reduce the number of Campylobacter in the gastrointestinal tract of an animal to a number that is unlikely to cause infection in humans. The number of cfu of Campylobacter that would be ingested by a human if they ate meat from an infected animal may be related to the number of Campylobacter in the gastrointestinal tract of the animal at the time of slaughter but also depends on other factors such as the amount of contamination of the meat with the contents of the gastrointestinal tract of the animal at the time of slaughter.

[0012] An effective amount of the compound of the present invention is enough of the compound to prevent colonisation of the gastrointestinal tract of the animal with Campylobacter.

[0013] In one embodiment the compounds of the present invention may make Campylobacter less virulent and less capable of infecting humans even if the total number of Campylobacter in the gastrointestinal tract does not decrease. In this embodiment administering a compound of the present invention to an animal may affect the metabolism of Campylobacter and make them less adaptive to environment so that they can not colonize the gastrointestinal tract and are less likely to be transmitted the other animals or to humans.

[0014] An effective amount of a compound provided to an animal should be enough to provide the required degree of reduction of Campylobacter colonisation. This may depend on the type of compound and/or the size of the animal. In one embodiment an effective amount of the compound may be 0.3 to 32 mg/day/kg bodyweight of the animal.

[0015] The method of the present invention preferably reduces colonisation of the gastrointestinal tract with Campylobacter species, for example Campylobacter jejuni or Campylobacter Coli.

[0016] This is advantageous because Campylobacter jejuni is the commonest reported bacterial cause of gastroenteritis in the UK and industrialized world. Campylobacter jejuni (C. jejuni) is responsible for about 90% of Campylobacter infections, the majority of the remainder being caused by C. coli. Campylobacter form part of the natural gastrointestinal flora of many birds and domestic animals and there is therefore a high risk of contamination of the carcasses of these animals when they are slaughtered.

[0017] The compound used in the method of the present invention is preferably a compound that blocks the interaction of MOMP or FlaA on the surface of Campylobacter with the cells of gastrointestinal tract. Preferably the compound binds to MOMP or FlaA and competitively or non-competitively inhibits the binding of MOMP or FlaA on the Campylobacter with the cells of the gastrointestinal tract. Preferably the compound used in the present invention may bind to MOMP on the surface of Campylobacter jejuni. Preferably the compound used in the method of the present invention specifically binds to at least one of amino acid residues Arg.sup.352, Lys.sup.278, Lys.sup.385, Asn.sup.258, Leu.sup.290, Tyr.sup.294, Phe.sup.395 Ile.sup.337, Arg.sup.381, Asp.sup.261 and Ser.sup.397 of MOMP. In another embodiment the compound of the present invention reduces the interaction between at least one of amino acid residues Arg.sup.352, Lys.sup.278, Lys.sup.385, Asn.sup.258, Leu.sup.290, Tyr.sup.294, Phe.sup.395 Ile.sup.337, Arg.sup.381, Asp.sup.261 and Ser.sup.397 of MOMP and the gastrointestinal tract of an animal.

[0018] In one embodiment the compound used in the method of the present invention may be natural human histo-blood group antigen or a synthetic human-histo blood group antigen.

[0019] Natural human histo blood group antigens are sugars that occur naturally on red blood cells of humans. They are also expressed on the surface of epithelial cells, such as the cells lining the gastrointestinal tract and can be secreted in body fluids such as saliva and breast milk.

[0020] The common human histo blood group antigens (BgAgs) consist of a complex and polymorphic group of carbohydrates expressed on the surface layer of erythrocytes, as well as endothelial and many epithelial cells and secretions. Subtle differences in their structures cause major differences in antigenicity. Their common denominators are the types I and II core glycoconjugates, which are fucosylated in the bone marrow by H-(fucosyl) transferases into H-I and H-II respectively, before being added to the surface of erythrocytes. (11). The fucosylated glycans are the direct substrates for further glycosylation reactions that give rise to the epitopes for the A, B and Lewis blood group antigens. The ABO (or ABH) and Lewis BgAgs have been epidermiologically associated with susceptibility to several infectious agents.

[0021] Human blood group antigens (BgAgs) include H-I antigen, H-II antigen Lewis antigen Le.sup.b and Le.sup.x and Le.sup.y.

[0022] Human histo-blood group antigens, binding to the adherins, for example MOMP or FlaA, on Campylobacter prevent or reduce the ability of the Campylobacter to adhere to the epithelial cells of the gastrointestinal tract.

[0023] A synthetic human histo blood group antigen may be a molecule with the same chemical structure as a natural human histo blood group antigen but it is made outside of the human body, for example it may be made synthetically from suitable reagents or may be made in other organisms, such as bacteria, fungi or eukaryotes and expressed transgenically. In another embodiment a synthetic human histo blood group antigen may be a molecule that binds to the same part of MOMP or FlaA as a natural human histo blood group antigen. A synthetic human histo blood group antigen may be a sugar or a glycoprotein or a glycolypid. The synthetic human histo blood group antigen may be purified using one or more purification steps, for example chromatography steps, before being used in the method of the present invention.

[0024] A synthetic human histo-blood group antigen may be used to inhibit the binding or adhesion between MOMP and/or flaA and epithelial cells. It may bind to MOMP and/or FlaA and prevent or reduces MOMP or FlaA adhesion to epithelial cells and reduce or prevent colonisation of the gastrointestinal tract of an animal with Campylobacter.

[0025] A synthetic human histo-blood group antigen may be a sugar, for example a saccharide having the same structure as a natural human histo-blood group antigen such as for example H-I antigen, H-II antigen, Lewis antigen, Le.sup.b Le.sup.x or Le.sup.y.

[0026] The compound used in the method of the present invention may be a compound that has a structure that is different from a natural human histo-blood group antigen but that adheres to MOMP and/or FlaA and prevents or reduces MOMP or FlaA adhesion to epithelial cells and reduces or prevents colonisation of the gastrointestinal tract with Campylobacter. The compound may be a sugar or an oligosaccharide.

[0027] Preferably the compound is a molecule that adheres to MOMP. Suitably the compound is a molecule that can interact with loop 7 of MOMP in the glycosylated or unglycosylated form.

[0028] The compound used in the method of the present invention may be ferric quinate. The compound used in the method of the present invention may have one of the following structures:

##STR00001## ##STR00002##

[0029] The compound used in the method of the present invention may have a structure similar to that of Ferric Quinnate. The compound used in the present invention may be a compound with a structure similar to the structure of a human histo blood group antigen.

[0030] The compound used in the method of the present invention may be administered orally. This is advantageous because it is easy to administer compounds orally to animals. Oral administration is also a preferred method of administering a compound to ensure that it reaches the gastrointestinal tract.

[0031] Preferably the compound may be administered in an animal's feed or drinking water.

[0032] In the method of the present invention the compound may be administered to the animal at any time during its lifetime. In one embodiment the compound is administered to the animal at least once a day for a period of time before slaughter of the animal. For example the compound may be administered to the animal for between 1 and 10 days, preferably for between 1 and 8 days, between 1 and 6 days, between 1 and 4 days, before slaughter or for 2 or 1 days. In one embodiment a single dose of the compound may be administered to the animal between 1 and 4 days before slaughter. In one embodiment the compound may be administered to the animal every day for 3 days, 4 days or 5 days before slaughter. Chickens are often colonized by Campylobacter between 7 and 10 days before slaughter. Therefore in one embodiment the compound may be administered to a chicken less than 10 days before slaughter to disinfect the chicken and reduce colonisation of the gastrointestinal tract of the chicken before slaughter. In another embodiment the compound of the present invention may be administered to an animal before colonisation of the gastrointestinal tract of the animal with Campylobacter in order to prevent colonisation of the gastrointestinal tract of the animal with Campylobacter. In one embodiment the compound of the present invention is administered to a chicken more than 10 days before slaughter to prevent transmission of Campylobacter within a flock of chickens.

[0033] It is advantageous to administer the compound to the animal a short time before slaughter because the animal the amount of Campylobacter in the gastrointestinal tract of the animal is reduced at the time of slaughter so that there is a lower risk of contamination of the carcass with Campylobacter.

[0034] In one embodiment of the present invention the compound may be administered to an animal at a dosage of 0.3-32 mg/day/kilo as a solution having a range of concentration from 34-340 .mu.M (0.02-0.2 g/L). A concentration of 0.2 g/L has an effect on colonization during the first three days post-infection and also on the binding of Campylobacter to blood group antigens may be reduced by 60%. In another embodiment the compound may be administered at a concentration of 2 g/L, which may prevent Campylobacter colonisation of the gastrointestinal tract of the animal and/or reduce the number of Campylobacter in the gastrointestinal tract of the animal to substantially zero.

[0035] In another embodiment the present invention provides a method for reducing the amount of Campylobacter in meat comprising the steps of:

[0036] Providing an animal with a compound as defined in any one of the preceding claims; and preparing a meat product from the animal. The animal may be any type of animal, preferably a poultry bird, preferably a chicken.

[0037] In another embodiment the present invention provides a method for identifying a compound for use in disinfection of animals, preventing or reducing adhesion of Campylobacter to the gastrointestinal tract or treatment of Campylobacter infection in humans or animals, said method comprising the steps of:

[0038] a) providing a simulation of MOMP or glycosylated MOMP;

[0039] b) selecting a candidate molecule that fits within the cavity between loops 4 and 7 of MOMP or selecting a candidate molecule which interacts with at least one of amino acid residues Arg.sup.352, Lys.sup.278, Lys.sup.385, Asn.sup.258, Leu.sup.290, Tyr.sup.294, Phe.sup.395 Ile.sup.337, Arg.sup.381, Asp.sup.261 and Ser.sup.397 of MOMP.

[0040] Compounds may be selected by docking them into an in silico model of MOMP to find a molecule that fits into the binding site of MOMP where the human histo blood group antigen binds with MOMP.

[0041] Preferably the compound is a molecule that can interact with at least one of amino acid residues Arg.sup.352, Lys.sup.278, Lys.sup.385, Asn.sup.258, Leu.sup.290, Tyr.sup.294, Phe.sup.395 Ile.sup.337, Arg.sup.381, Asp.sup.261 and Ser.sup.397 of MOMP.

[0042] Preferably the compound is a molecule that can interact with at least one or more of amino acid residues Arg.sup.352, Lys.sup.278 and Lys.sup.385 of MOMP or at least one or more of residues Asn.sup.258 and Lys.sup.278 or at least the residues 352 and 385 of MOMP. The compound may interact with at least residues Leu.sup.290, Tyr.sup.294, Phe.sup.395 and/or Ile.sup.337 of MOMP or at least one or more of residues Lys.sup.278, Arg.sup.352 and Arg.sup.381 of MOMP or at least one of Asp.sup.261 and Ser.sup.397 of MOMP.

[0043] The major contributors in the interaction of glycosylated MOMP with Le.sup.b are residues Arg.sup.352,381 and Lys.sup.278, whereas only residues 352 and 278 are involved in the interaction of non-glycosylated MOMP with Le.sup.b. Residues Arg.sup.352,381 are conserved in all sequences examined whilst residue Lys.sup.278 is semi-conserved and is replaced by Arg in some strains. The molecular properties of this amino acid suggests it would be able to mediate BgAg binding through hydrogen bond formation in a similar fashion to residues Arg.sup.352,381.

[0044] The present inventors have constructed an in silico model of glycosylated MOMP. The in silico model of MOMP may be used to identify amino acid residues that are in contact with various human histo-blood group antigens when they bind to MOMP. This in silico model allows the conformational changes that take place in MOMP when it is glycosylated to be studied. This can be advantageous because it allows selection of further compounds that could interact with MOMP, in particular compounds that can bind to the amino acids that have been identified. These compounds can then be tested in vivo or in vitro to check whether they bind to MOMP protein.

[0045] The adhesion of Campylobacter, in particular Campylobacter jejuni (C. jejuni) to human histo-blood group antigens is via the major subunit protein of the flagella (flaA) and the major outer membrane protein (MOMP). MOMP was shown to be glycosylated at Threonine.sup.268. This glycosylation was shown by in silico modelling techniques to have a notable effect on the conformation of MOMP and to increase adhesion of MOMP to human histo-blood group antigens.

[0046] Residues of MOMP that have been identified as binding to various natural human histo-blood group antigens include Arg.sup.352, Lys.sup.278, Lys.sup.385, Asn.sup.258, Leu.sup.290, Tyr.sup.294, Phe.sup.395 Ile.sup.337, Arg.sup.381, Asp261 and Ser.sup.397 of MOMP. It is advantageous to select candidate molecules that may be used in the present invention because they bind to MOMP by interacting with one or more of these residues in the structure of MOMP.

[0047] Once compounds have been selected in silico, they may made and tested to measure the binding to MOMP protein in vitro or in vivo. A quantity of the selected compound can be prepared for use in the methods of the present invention.

[0048] Compounds that are useful in the method of the present invention may be included in animal feed, as a feed ingredient or as a feed supplement. The animal feed, feed ingredient or feed supplement may be suitable for any animal, in particular animals that are to be slaughtered for human consumption, preferably poultry, more preferably chickens.

[0049] Compounds that are useful in the methods of the present invention may be provided to an animal in liquid or solid form or as a powder. They may be included as an ingredient in feed or animal food or as an ingredient in a feed or food supplement. In one embodiment the compounds are provided to chickens in chicken feed or as a feed ingredient mixed with chicken feed.

[0050] A feed may be a food intended for or suitable for consumption by animals. A food or a foodstuff may be a food that is intended or suitable for consumption by humans.

[0051] The present invention provides a method of disinfecting a foodstuff or a food comprising administering a compound as defined in any one of the preceding claims in an effective amount to the foodstuff to reduce the amount of Camylobacter in the foodstuff.

[0052] This is advantageous because it reduces the risk of infection with Campylobacter of humans who consume the foodstuff.

[0053] A foodstuff or a food may be for human consumption, in particular the food may be a meat product, for example a fresh meat product, a processed meat product, a chilled meat product, a frozen meat product or a cooked meat product. The meat product may be, for example a beef, lamb, pork, duck, chicken, goose, turkey, rabbit, fish or shellfish meat product. Preferably the meat product may be a poultry meat product, more preferably a chicken meat product.

[0054] The present invention also provides a compound as defined in the present invention for use in the prophylaxis or treatment of Campylobacter infection in humans. A compound as defined in the present invention may be used in the manufacture of a medicament for the prophylaxis or treatment of Campylobacter infection in humans.

[0055] The compound may be provided to humans to prevent or treat infection of humans with Campylobacter (campylobacteriosos). This is advantageous because the compounds prevent or reduce adhesion of Campylobacter to the epithelial cells in the gastrointestinal tract. This may prevent or reduce infection with Campylobacter because Campylobacter adheres to cells in the human gastrointestinal tract by docking onto human histo-blood group antigens that are expressed on the cells of the gastrointestinal tract. The compounds may compete with natural human histo-blood group antigens that are on the epithelial cells for binding of MOMP and FlaA and therefore reduce the amount of binding of Campylobacter to the cells.

[0056] The in silico model of MOMP may be used to develop or refine a vaccine against Campylobacter for use in humans.

[0057] The in silico model of MOMP may be used to develop or refine a vaccine against Campylobacter for use in birds, preferably poultry, more preferably chickens.

[0058] Subunit (or killed) vaccines have a number of advantages over live vaccines, including safety and ease of production, storage and distribution. To date only limited success has been achieved with subunit vaccines administered orally. The reason for this is assumed to be the lack of oral delivery to the appropriate site for development of immune-mediated protection. The assumption is that the most appropriate site would be the intestinal mucosa. Such delivery requires the presentation of antigen with a mucosal adjuvant. Currently there are no known mucosal adjuvants for birds.

[0059] Recently a number of delivery systems have been developed for mammalian mucosal vaccination regimes. One such system utilises a non-ionic, hydrophilic immunomodulator, Pluronic block copolymer F127, and the polysaccharide chitosan formulated into microspheres (Lee, Da Silva et al. 2008). Chitosan is used in a number of biomedical applications because of its bioavailability, biocompatibility, biodegradability, high charge density and non-toxicity. In addition this material has been shown to weaken the tight junctions of epithelial cell layers allowing the uptake of antigen and to reduce the rate of mucociliary clearance reducing antigen removal. Although this material appeared to be valuable in the development of mammalian vaccines and drug delivery systems it had not been tested in birds.

[0060] The microspheres were made using an ionic gelation process with tripolyphosphate (TPP). Briefly, 0.25% chitosan in 2% acetic acid was added drop-wise to 15 w/v % TPP under magnetic stirring. The mixture was sonicated and the MS beads removed from the TPP solution by centrifugation, washed with distilled water and resuspended in PBS. The antigens were then loaded onto the beads by co-incubating overnight at 37.degree. C. After incubation, the suspension was centrifuged to separate the beads from unloaded antigens (MOMP/FlaA). The levels of antigen uptake were determined by protein concentration assays of protein solutions pre- and post-loading.

[0061] The present invention provides a method of treating or preventing Campylobacter infection in humans comprising administering to the human an effective amount of a compound as defined in any one of the preceding claims.

[0062] The present invention provides a kit comprising:

[0063] a) at least one compound as described in the present invention and optionally instructions for using the kit.

[0064] There now follows by way of example only a detailed description of the present invention with reference to the accompanying drawings, in which;

[0065] FIG. 1 shows the competitive effect of the soluble glycoconjugates, i.e. H-II, Lc.sup.b or Le.sup.y on attachment of strain NCTC11168 to a series of BgAs. A) An ELISA plate was coated with a selection of BgAgs. Specific binding was calculated by subtracting the BSA (negative control) values from the BgAg absorbance. Binding of strain NCTC11168 to BgAgs was inhibited significantly (p<0.05) by pre-incubation of cells with soluble glycoconjugates prior to adding them to the ELISA plate. Error bars; mean of triplicate values.+-.SEM, number of repeating experiments was 3. Each group of bars, from left to right, NCTC11168, NCTC11168-H-II, NCTC11168-Leb, NCTC11168-Ley.

[0066] B) Identification of BgAg-binding proteins from strain NCTC11168 by using Re-Tagging method. Two proteins were identified at sizes of 45 and 59 kDa, corresponding to MOMP and FlaA, respectively.

[0067] FIG. 2 shows A) Inhibition of binding of strain NCTC11168 to H-II glycoconjugate in the absence of an inhibitor (non-treated, NT) and in the presence of purified MOMP of Cj-281 (MOMP(-)), low binder strain, S3--Table 1). Purified MOMP from NCTC11168 (MOMP(+)), and pre-incubation of NCTC11168 bacterial cells with H-II glycoconjugate (H-II). Pre-treatment of all examined MOMP and H-II had significantly reduced (p<0.001, ***) the bacterial binding to H-II antigen. In contrast, MOMP(-) had a lower effect compared with H-II or MOMP(+) due to the lower affinity for the H-II antigen. B) ELISA plate was coated with a selection of BgAgs. Specific binding was calculated by subtracting the BSA (negative control) values from the BgAg absorbance at 405 nm. Strain NCTC11168 and Cj-266 (high binder strain, S3--Table 1), and corresponding .DELTA.flaA mutants, have been examined for binding to Le.sup.b, H-II, H-I, Le.sup.x and Le.sup.a. t-test confirmed the reduction in binding seen with mutants are significant (Le.sup.b; p=2.5E-05, H-II; p=0.012, H-I; p=0.001, Le.sup.x; p=0.029 and Le.sup.a; p=0.000) in strain NCTC11168. However, Cj-266.DELTA.flaA mutation had no effect on binding, which indicates the binding capacity was compensated by MOMP protein. Each group of bars from left to right: NCTC11168, 11168-.DELTA.flaA, Cj-266, Cj-266.DELTA.flaA. C) A double mutant (DM) of .DELTA.flaA and single substitution of glycosylation site in MOMP protein (Thr.sup.268 was substituted with Gly) was constructed in both strain NCTC11168 and Cj-266, and the binding to Le.sup.b H-I and H-II was examined. The binding was significantly reduced in NCTC11168-MOMP.sup.T/G but the reduced binding was not significant in Cj-266-MOMP.sup.T/G. Although, t-test confirmed the reduction in binding seen with NCTC11168-DM and Cj-266-DM the mutants are significant (p<0.05). Each group of bars from left to right: Leb, H-II, H-I.

[0068] FIG. 3 shows an overview of the mass spectrometry analysis by LC-MS/MS for both protein identification and glycosylated peptide characterization. A) Base peak chromatogram: Tryptic peptides are loaded on an on-line coupled C18 column and eluted into the mass spectrometer for analysis. B and C) MS precursor scan of the doubly charged glycosylated peptide at m/z 978.91 C) CID-MS/MS spectrum of the selected ion. D) Detection of glycan constituent of purified MOMP from different strains using biotinylated labeled lectins. GSL II: Griffonia (Bandeiraea) simplicifolia lectin II, DSL: Datura Stramonium lectin, ECL: Erythrina cristagalli lectin, LEL: Lycopersicon esculentum (tomato) lectin, STL: Solanum tuberosum (potato) lectin, VVA: Vicia villosa agglutinin and Jacalin: Artocarpus integrifolia lectin.

[0069] Jacalin lectin showed significant binding to NCTC11168 purified MOMP than the other used lectins. Jacalin lectin specifically recognizes Gal.beta.1-3GalNAc.alpha..sub.1-Ser/Thr (T-antigen) and/or GalNAc. E) Further analysis was revealed by using an antibody against the T-antigen to confirm Jacalin specificity. MOMP(s) purified form strains 255, 281 (low binder clinical isolates) and MOMP.sup.T/G didn't reveal significant binding to either Jacalin lectin or anti-T antigen compared with MOMP purified from strain NCTC11168 wild type. Error bars=mean of triplicate values.+-.SED, No 2. Two independent experiments (P value). For each pair of bars: left hand bar--Jacalin lectin, right hand bar--Anti-Tantigen.

[0070] FIG. 4 shows a representation of MOMP (A, right) and glycosylated MOMP (A, left) in the approximate boundaries of the hydrophobic part of the outer membrane (OM). B), the superimposed lowest energy structure of MOMP (green) on the lowest energy structure of glycosylated MOMP (magenta) with RMSD of 1.291. Loops are shown in colours; .beta. strands are green, L1 (residues 41-60, red), L2 (residues 87-109, magenta), L3 (residues 128-147, orange), L4 (residues 169-200 yellow) L5 (residues 227-233, black), L6 (residues 256-274, blue), L7 (residues 296-333, gray), L8 (residues 360-379, cyan) and L9 (residues 399-414, purple).

[0071] FIG. 5 shows a stereo cartoon of the MOMP backbone viewed from the extracellular side: .beta. strands are green, L1 (red), L2 (magenta), L3 (orange), L4 (yellow) L5 (black) (L5), L6 (blue), L7 (gray), L8 (cyan) and L9 (purple) and its side view. The conformational changes in the glycosylate group induced by introduction of the ligands into the cavity of glycosylated MOMP. The complexes with Le.sup.b (A) and H-II (D). In addition, hydrogen bonds shown in light blue involved in the interactions of MOMP (B and E) and its glycolysated form (C and F) with Le.sup.b and H-II respectively in their active sites.

[0072] FIG. 6 shows examples of compounds that can be used in the present invention.

[0073] FIG. 7 shows the effect of a series of histo blood group antigens on biofilm formation. Comparison of biofilm formation between NCTC11168-WT, and corresponding mutants, .DELTA.fla A and MOMP-T/G in presence and absence of free sugars. A) The most significant decrease in biofilm formation is seen in wild type strain compared to the mutants. However, the biofilm formation of MOMP268T/G strain is comparable to .DELTA.flaA, which indicate that O-glycosylation of MOMP also play important role for this formation. For each group of bars from left to right: NCTC11168, NCTC11168 (sugar), MOMP-T/G, MOMP-T/G(sugar). B) Similar results were observed except for core-II, other examined sugars significantly reduced the biofilm formation. For each group of bars from left to right: NCTC11168, NCTC11168(sugar), .DELTA.fla A, .DELTA.fla A (sugar).

[0074] FIG. 8 shows the lowest energy structure of MOMP from MD simulation with stereo cartoon of the MOMP backbone viewed from the extracellular side. MOMP forms hydrophilic channels through the outer membrane. The folding of .beta.-barrel OMPs promotes trimer assembly and integration of the channel into the outer membrane. Moreover, two-dimensional crystallographic analysis showed that MOMP is structurally related to the family of trimeric bacterial porins.

[0075] CD spectroscopy analysis also demonstrated that the folded monomer mainly comprised .beta.-sheet secondary structure, in agreement with the so called .beta.-barrel structure of porins. MOMP folded monomers are able to form channels in artificial lipid bilayers with the same conductance properties as monomers embedded into trimers, which suggests that the folded monomer is the functional unit of the MOMP porin.

[0076] FIG. 9 shows molecules used in the modelling of molecules that bind to MOMP.

[0077] FIG. 10 shows colonisation levels of chicks challenged with wild-type campylobacter strain NCT11168-O or mutant campylobacter strain MOMP.sup.268T/G.

[0078] FIG. 11 shows Ferric-Quinate 1, 3, 4, 5-Tetrahydroxy Cyclohexan carboxylic acid

[0079] FIG. 12 shows the inhibitory potential of Ferric Quinate Fe(QA)3 on adherence of C. jejuni was analyzed by ELISA using BgAgs (Core-I, Core-II, H-I, H-II, Leb, Ley and Lex).

[0080] FIG. 13 shows the inhibitory potential of Ferric Quinate Fe(QA)3 on adherence of C. jejuni was analyzed by ELISA using BgAgs (Core-I, Core-II, H-I, H-II, Leb, Ley and Lex).

[0081] FIG. 14 shows colonisatin of chicks by C. jejuni 11168-O following FeQ (0.034 mM) treatment.

[0082] FIG. 15 shows colonisatin of chicks by C. jejuni 11168-O following FeQ (0.34 mM) treatment.

[0083] FIG. 16 shows metagenomic analysis of population treated with FeQ Genus/species level.

[0084] FIG. 17 shows metagenomic analysis of population treated with FeQ Phylum level. 1--Ley R, Backhed F, Turnbaugh P, Lozupone C, Knight R, Gordon J (2005). "Obesity alters gut microbial ecology". Proc Natl Acad Sci USA 102 (31): 11070-5. doi:10.1073/pnas.0504978102. PMC 1176910. PMID 16033867 2--Ley R, Turnbaugh P, Klein S, Gordon J (2006). "Microbial ecology: human gut microbes associated with obesity". Nature 444 (7122): 1022-3. doi:10.1038/4441022a. PMID 17183309. 3--Turnbaugh P, Ley R, Mahowald M, Magrini V, Mardis E, Gordon J (2006). "An obesity-associated gut microbiome with increased capacity for energy harvest". Nature 444 (7122): 1027-31. doi:10.1038/nature05414. PMID 17183312.

[0085] Campylobacter jejuni is an important cause of human food-borne gastroenteritis. Despite the high prevalence and medical importance of C. jejuni infection, fundamental aspects of pathogenesis remain poorly understood, in particular the detailed molecular interactions between host and pathogen. Human histo-blood group antigens (BgAgs) are often targeted by mucosal organisms as levers for adherence prior to invasion. Using a retagging approach, the corresponding surface-exposed BgAgs-binding adhesins of C. jejuni were identified as the major subunit protein of the flagella (FlaA) and the major outer membrane protein (MOMP). O-glycosylation of FlaA has previously been reported, and is required for filament assembly and for modulating flagella functionality. Purified MOMP like FlaA was O-glycosylated. The O-glycosylation was localised to Thr.sup.268 and suggested as Gal.sub..beta.1-3-(GalNAc).sub.3-.alpha.1-Thr.sup.268. Site-directed substitution of MOMP Thr.sup.268/Gly led to a significant reduction in binding to BgAgs. Furthermore, molecular dynamics (MD) simulation modelling techniques suggested that O-glycosylation of MOMP has a notable effect on the conformation of the protein.

[0086] Thus, C. jejuni uses O-glycosylation of surface-exposed proteins to modulate the conformation and binding capability.

[0087] Prevention and treatment of human infection with Campylobacter and its consequences are hampered by a poor understanding of the detailed molecular interaction between the host and the pathogen.

[0088] Studies by the present inventors have shown that C. jejuni specifically bind all human BgAgs, and identified the bacterial ligands responsible for binding. These are the flagellin protein FlaA and the major outer membrane protein MOMP.

[0089] The present studies have also found that MOMP is O-glycosylated, and shares a common BgAg binding site with FlaA, which has already been shown to be O-glycosylated. Glycosylation of MOMP causes it to undergo conformational changes which alters its affinity for binding of, and hence recognition of, BgAgs compared with unglycosylated MOMP protein. Conformational MOMP epitopes are important in host immunity, and variation in surface-exposed regions probably occurs as a result of positive immune selection during infection. Identification of the protein glycosylation profile of C. jejuni, in the outer membrane is helpful in understanding the diverse pathogenicity of C. jejuni strains among different hosts.

[0090] The present studies have created an in silico model of glycosylated MOMP, which have been used to identify the amino acids which mediate the bacterial binding to BgAgs. The model and the amino acids that are essential for binding to BgAgs may be used to identify candidate drug targets. The model may also be used to predict which molecules will bind to MOMP and can reduce the adhesion of the Campylobacter carrying MOMP to cell walls.

[0091] The present studies have found that BgAgs can inhibit bacterial adhesion and biofilm formation and have identified molecules that can be used (a) for treatment of humans suffering from Campylobacteriosis; (b) to prevent colonisation of chickens with Campylobacter ssp; and (c) to eliminate chicken colonisation in infected flocks.

[0092] Previous attempts to reduce the risk of human infection with Campylobacter ssp involved the use of vaccines employing nucleic acids encoding Campylobacter proteins, in particular flagellin (US2007/2049553).

[0093] This is completely different from the approach of the present invention which uses specific compounds to block the ligand binding site of the Campylobacter and hence inhibit Campylobacter adherence and colonisation in the chicken gastrointestinal tract. Compounds that are mimetics or synthetic human histo-blood group antigens and synthetic sugars such as Ferric Quinate (Fe-Q) may be used in the present invention.

EXAMPLES

[0094] C. jejuni Binds a Wide Range of Human BgAgs.

[0095] To determine the range and specificity of BgAgs that bind C. jejuni, Core-I, Core-II, H-I, H-II, Le.sup.b, Le.sup.x, and Le.sup.y were immobilised in specialised 96-well ELISA plates and incubated with log-phase digoxigenin (Dig)-labelled C. jejuni strain NCTC11168. The strain bound to all the examined BgAgs, the degree varying only marginally between BgAgs (S1--Fig.).

[0096] Blood group antigens were obtained from IsoSep (Sweden). The lab strain (ATCC11168) was obtained from ATCC bank and the clinical strains from a collection belong to Prof. Julian M. Ketley (Department of Genetics, University of Leicester, Leicester LE1 7RH, UK).

[0097] Pre-incubation of bacteria or coated plates with soluble BgAgs inhibited the binding, confirming specificity (FIG. 1A). In addition, adhesion assays by co-culturing C. jejuni strain NCTC11168 and Caco-II cells was carried out. Soluble H-II caused significant reduction in bacterial binding to the host cells (S2--Fig.). In addition, the same range of immobilized BgAgs was used to test the ability of 39 clinical isolates of C. jejuni. All C. jejuni isolates bound to all examined BgAgs, albeit to a variable degree (S3--Table). Correlation analysis between each sugar and principal component analysis was performed. It enables a visualization of the correlations--the structurally closer (S4--Table) the sugars are to each other, the more similar they are in terms of binding capacity (S4--Fig.).

[0098] The high degree of specificity by H. pylori BgAg-binding adhesions is in contrast to our findings with C. jejuni, which appears to bind to a wide range of related antigens. This may reflect the fact that H. pylori has a very restricted host range (infecting only humans), whereas C. jejuni is able to establish infection in a wide range of birds and mammals and may have gained an evolutionary advantage by broadening its specificity and maximising its survival in different hosts.

[0099] C. jejuni FlaA and MOMP Mediate the Binding to a Wide Range of Human BgAgs.

[0100] For identification and purification of BgAgs-binding bacterial adhesins, a retagging technique was used. Two generated protein bands in FIG. 1B identified by mass spectrometry as the major outer-membrane protein (MOMP, 45 kDa) and FlaA (the major flagella component, 59 kDa), respectively. The C. jejuni MOMP is a multi-functional porin and is essential for bacterial survival; it is predicted to comprise outer membrane-spanning beta stands separating periplasmic and surface-exposed loops. That it is encoded by the porA gene which is extremely genetically diverse and the variability of the porA surface loops provides evidence that immune selection strongly influences the diversity of this protein. Interestingly, the greatest variation in both putative amino acid sequence and length was formed in loop 4.

[0101] MOMP was purified under native conditions from strain NCTC11168 and inhibition ELISA and confocal experiments showed that both purified MOMP and H-II significantly inhibited binding of NCTC11168 to H-II antigen (FIG. 2A). Deletion mutant of .DELTA.flaA in strains NCTC11168 and Cj-266 (a clinical isolate, S3-Table) were constructed. This had significantly reduced the binding capacity to all examined BgAgs except for Le.sup.x in strain NCTC11168 (FIG. 2B). By contrast, .DELTA.flaA deletion in strain Cj-266 didn't exhibit reduced binding to BgAgs (FIG. 2B), which indicated that MOMP per se is sufficient for adherence to BgAgs.

[0102] Invasive properties could be partially restored by centrifugation of the mutants onto the tissue culture cells, indicating that motility is a major, but not the only, factor involved. Here, we identified the corresponding C. jejuni adhesins, which mediate the bacterial binding to BgAgs.

[0103] Ability of MOMP268T/G to Colonise Chicks

[0104] The ability of MOMP268T/G to colonise chicks was determined. 6-weeks old birds (n=10 per group) were challenged with 3.times.103 cfu wild-type strain NCTC11168-O or its isogenic mutant MOMP268T/G by oral gavage. Caecal colonisation levels were determined in birds from each group at 7 days post-challenge. The results show a significant reduction in the geometric mean colonisation levels in the caeca in the MOMP.sup.268T/G group compared to the wild-type (See FIG. 10). In addition, the ability of the mutant strain to invade the chicken's liver was examined. The results showed that MOMP.sup.268T/G was completely unable to invade compared to the wild-type strain. These results confirm the importance and biological relevance of MOMP glycosylation in the establishment of colonisation in vivo. Values less than 100 in FIG. 10 are arbitrary figures, and no campylobacter was recovered.

[0105] Ferric Quinate; an Inhibitor for C. jejuni Adherence

[0106] A number of phenolic compounds, including caffeic and quinic acids (Baqar et al.), have been shown to have high levels of antioxidant activity and other potentially health-promoting effects in vitro. Also, quinic acid occurs in tea, coffee, fruits and vegetables. In particular, plants use the low molecular mass D-(-)-quinic acid (Baqar et al.) for mobilization of Iron and further use of this metal by cellular structures in metabolic pathways (Menelaou et al., 2009).

[0107] Ferric quinate Fe(QA)3 was identified as having promising inhibitory effects in vitro and in vivo on C. jejuni adhesion to BgAgs.

[0108] The inhibitory potential of Ferric Quinate Fe(QA)3 on adherence of C. jejuni was analyzed by ELISA using BgAgs (Core-I, Core-II, H-I, H-II, Leb, Ley and Lex). C. jejuni was pre-incubated with 34 .mu.M Fe(QA)3 and specific inhibition was also analyzed by post-treatment of C. jejuni with Fe(QA)3 which bound to BgAgs at the time. The result showed that Fe(QA)3 conferred a 90% inhibition of binding, while Quinic Acid alone provided no inhibition of C. jejuni binding to all examined BgAgs. In addition the results from the bacterial culture (MH) containing Fe(QA)3 approach also demonstrated reproducible inhibition of microbial adherence. In addition, the sequential passages (P) of bacteria to the new plate containing Fe(QA)3 didn't cause any resistance concerning the binding abilities (see FIGS. 12 and 13).

[0109] To further clarify the growth-effect properties of Fe(QA)3, we investigated the effect of adding Fe(QA)3 to the culture medium. Supplementation with the different concentrations of Fe(QA)3, (34 and 340 .mu.M) did not affect the growth of C. jejuni NCTC11168 strain.

[0110] These inhibitory properties against C. jejuni adherence to BgAgs were analyzed in vivo. Ferric Quinate was used as an additive to water (0.034-0.34 mM) and as an inhibitor of C. jejuni NCTC11168 strain adherence to, and thus colonization, in the chicken intestinal tract. 6-weeks old birds (n=10 per group) were challenged with 3.times.103-5 cfu wild-type strain NCTC11168-O by oral gavage. Caecal colonisation levels were determined in birds from each group at 3 and 7 days post-challenge.

[0111] The complex reduced significantly the adhesion of C. jejuni (2-3 Log at 0.34 mM concentration) to the intestinal mucosa and epithelial lining by inhibiting the binding between bacterial adhesins, such as MOMP (confirmed by model), may FlaA, and the corresponding binding sites in the host intestinal epithelium see FIGS. 14 and 15.

[0112] In A Metagenomic analysis of population treated with FeQ at a Genus/species level a difference can be seen between FeQ treated and non-treated birds at day 7, there is a shift in the population with increase of Bacteriodetes phylum, especially Bacteroides feacalis (1, 2, 3).

[0113] MOMP is O-glycosylated.

[0114] Campylobacter specifically modify their flagellar proteins with O-linked glycans that can constitute up to 10% of the protein mass. These modifications are necessary for flagellum assembly, and thus affect secretion of virulence-modulating proteins, bacterial colonization of the gastrointestinal tract, autoagglutination and biofilm formation.

[0115] MOMP was purified from strains NCTC11168 and Cj-281 under native conditions and analysed by Nanoflow LC-MS/MS FT/ICR following in-gel protein digestion as described in A. Shevchenko, M. Wilm, O. Vorm, M. Mann, Anal Chem 68, 850 (Mar. 1, 1996). The migration of trypsin-digested MOMP peptides from both strains was essentially identical except for one peptide corresponding to amino acids 268-278, corresponding to the predicted loop 6: the strain NCTC11168 peptide showed a greater mass; MS/MS analysis confirmed that glycosylation of Thr-268 with a Hex-(HexN-acetylamine).sub.3 (where Hex can be Glucose or Galactose) was responsible for the observed shift (FIGS. 3A, B and C). FASTA sequence alignment of clinical isolates indicated that Thr-268 on loop 6 of strain NCTC11168 appears to be conserved in 52% of isolates.

[0116] Site-directed substitution of Thr.sup.268 to Gly was carried out on MOMP of strain NCTC11168 and a clinical isolate Cj-266 (yielding MOMP.sup.268T/G, S5--Table). This substitution caused a clear shift in the protein's migration, strongly suggesting the loss of its glycosylation (S5). The ability of this mutant to bind to a range of BgAgs in an ELISA assay was examined and it was shown to have a reduction in binding to each of examined BgAgs (FIG. 2A). Also, a reduced biofilm formation was observed, which indicates that O-glycosylation of MOMP plays an important role in this context (S8--Fig. A and B).

[0117] The Role of PglB and PseD Transferases on MOMP Glycosylation.

[0118] Flagellin is the only O-glycosylated C. jejuni protein to have been reported and glycans constitute ca. 10% to this protein's weight. The predominant O-glycans attached to the Campylobacter flagellum are derivatives of pseudaminic acid or legionaminic acid, which are C9 sugars that are related to sialic acids. In addition, the related human gastric pathogen H. pylori also O-glycosylates its flagella with Pse, similarly to C. jejuni, and modification is required for bacterial motility and flagellar assembly.

[0119] Interestingly, specific loss of Pse5Am due to mutation of the Pse biosynthesis A gene (pseA) in C. jejuni subsp. jejuni 81-176 resulted in loss of auto-agglutination and reduced adherence to and invasion of intestinal epithelial cells in vitro, and reduced virulence in the ferret model.

[0120] Also, PseD as a putative PseAm transferase showed that mutation in pseD lacked PseAm on flagellin and failed to auto-agglutinate.

[0121] The general protein glycosylation (Pgl) pathway involves several key "Pgl" enzymes, of which PglB is critical for protein N-glycosylation i.e. transfer of the first glycan molecules to the target proteins at specific Asn residues.

[0122] In order to evaluate the contribution of PseD and PglB transferases on C. jejuni MOMP glycosylation and its role on bacterial binding activity, a pglB deletion mutant was created in strain Cj81-176 and pseD deletion in strain NCTC11168; pglB deletion had no detectable impact on MOMP gel migration, glycan staining (data not shown), or bacterial binding to any of the examined BgAgs (S7--Fig. A). However, strain NCTC11168 pseD deletion resulted a significant reduction in binding to all examined BgAs and biofilm formation (data not shown).

[0123] These findings indicate that C. jejuni strain NCTC11168 encodes a transferase that is involved in post-translational modification of protein, which plays an important role in bacterial adhesion and reveals unusual post-translational modifications; an O-linked Hex-(HexNAc).sub.3 at Thr.sup.268. These post-translational modifications might undergo phase variation and may also vary in structure from one generation of C. jejuni to the next, and have a function in immune escape.

[0124] Moreover, these findings provide new insights into MOMP structure and resolve long-standing issues regarding the adhesion molecules which mediate the bacterial binding to the BgAgs. The pathogenesis and study the effects on processes such as colonization, invasion, and the ability to stimulate the host inflammatory response remain to be elucidated.

[0125] Determination of MOMP Glycan Composition.

[0126] Lectin kit was used for determination of the MOMP glycosylation constituent. The kit consists of 7 different lectins with overlapping specificity. The purified NCTC11168-MOMP in lectin array revealed significant binding to Jacalin lectin and in a lesser extent to GSL and LEL (FIG. 3D). Among the galactose-specific lectins, the lectin from Artocarpus integrifolia, known in the literature as Jacalin, exhibits specificity toward human tumour specific Thomsen-Friedenreich disaccharide (T-antigen, Gal.beta..sub.1-3GalNAc.alpha..sub.1-Ser/Thr).

[0127] Moreover, to confirm the Jacalin binding specificity, monoclonal anti-T-antigen was used against purified MOMP isolated from different strains (NCTC11168-MOMP, NCTC11168 MOMP.sup.268T/G and two clinical isolates with low binding activity; Cj281 and Cj-255). FIG. 3E shows that anti-T antigen antibody and Jacalin lectin reacted specifically with purified NCTC11168-MOMP. The observation that NCTC11168-MOMP interacts with Jacalin and anti-T antigen but not MOMP isolated from low binder strains and NCTC11168 MOMP.sup.268T/G (FIG. 3E) indicates that strain NCTC11168-MOMP is likely to be the 0-linked trimeric form of T-antigen (Gal.beta..sub.1-3GalNAc.beta..sub.1-4GalNAc.beta..sub.1-4GalNAc.alpha..s- ub.1-Thr.sup.268).

[0128] Glycosylation of MOMP with T-antigen presented herein provides an important insight on the role of glycosylation for C. jejuni binding activity to Lewis antigens and in MOMP immunogenicity. Further determination of the other N- and O-glycosylated outer membrane proteins may shed light into the development of a glycoconjugate based vaccine in the future.

[0129] The role of Glycan in MOMP Binding to BgAgs

[0130] The advances in computer technology and new modelling techniques have facilitated simulations of peptide folding at the atomic level. Although gram-negative bacteria possess quite different homology in primary sequences of their porins, they are remarkably similar in their beta-barrel structure. Hence, we employed the beta-barrel structure from Comamonas acidovorans (1E54.pdb) as a template and constructed our model based on this assumption. In order to understand better the role of MOMP glycosylation in C. jejuni binding to the BgAgs, here we present the construction and molecular dynamic properties of MOMP and its glycosylated form.

[0131] The initial structure was constructed and showed to have 9 loops and 18 beta-strands. The lowest energy structure obtained from molecular dynamics (MD) simulations at 300 Kelvin (K) is represented in S9--Fig. A and B. This structure was glycosylated at residue 268 with a glycosyl group. The lowest energy structure of glycosylated MOMP (gly-MOMP) obtained from MD simulations was superimposed on the lowest energy structure of MOMP to see the conformational changes induced by the introduction of glycosylation as presented in FIG. 4B. It shows that the major changes occur in loops 4, 6 and 7 constructed roughly of 169-200, 256-274 and 296-333 residues where loop 6 bears the glycosyl group. However, it shows that a small change appears in the barrels. The approximate boundaries of two proteins in the hydrophobic part of the outer membrane are indicated by horizontal lines as represented in FIG. 4A. Interestingly, the galactosyl residue has a favourable interaction with Arg.sup.328 residue as indicated in FIG. 4 but upon complex with H-II the glycosylated residue undergoes considerable conformational changes where this interaction vanishes and the group tends to move towards loop 4 to interact with Thr.sup.186 and 187 (FIG. 4A). In contrast, this conformational change did not occur in the case of gly-MOMP with Le.sup.b.

[0132] The MOMP protein has a canal-like cavity as seen in S9--Fig. A and B, which is expected to be capable of accommodating very large molecules. A mimic of Lewis antigen, type-1 Lewis carbohydrate determinant (Le.sup.b) and type-2 H-II antigen (S9--Scheme 2) were docked into the cavity of MOMP and gly-MOMP. These complexes were computed for MD simulations. The average energies derived from MD simulations of complexes are listed in S9--Table. The introduction of the ligands within the cavity of MOMP leads to a remarkable effect on conformational changes in the loops, especially in loops 4 and 7. These two loops are the longest among the rest and obviously undergo significant conformational changes compared with others. Interestingly, it was found that gly-MOMP has a relatively stable structure since it shows that only loop 7 slightly undergoes conformational changes upon this complex. This may mean that glycosylation enhances the stability of the protein and allow it to be immunologically inert through molecular mimicry of its host.

[0133] Corresponding MOMP amino acids, which mediate binding to Le.sup.b and H-II antigens. The interactions involved in the complexes of both proteins with Le.sup.b and H-II are represented in FIG. 5A-F. The channel of these barrel proteins largely contains arginine and lysine residues, which are likely responsible for the recognition of these sugars. It is apparent that gly-MOMP has favourable interactions with Le.sup.b compared to MOMP. The residues Arg.sup.352, Lys.sup.278 and 385 seems to be the major contributor in the interaction of the glycosylated protein with Le.sup.b via hydrogen bonds whereas only the residues Asn.sup.258 and Lys.sup.278 are involved in the interaction of MOMP with Le.sup.b. The residues 352 and 385 are the members of the beta-barrel 7, which are the part of loop 7. This loop, as mentioned earlier, mostly undergoes conformation changes during the molecular dynamic simulation (FIG. 4B). The glycosyl group interacts with this loop, thus leading to favourable conformational change for the interaction, and consequently resulting in a well-orientation of these residues to interact with Le.sup.b. The glycosyl group is sandwiched between loops 4 and 7, probably influencing the dynamics of these loops, thus contributing to the binding ability of the protein. Calculations also show that the glycosylated protein has more favourable van der Waals (vdw) interactions compared with MOMP. It appears that the residues Leu.sup.290, Tyr.sup.294, Phe.sup.395 and Ile.sup.337 are well-located over the hydrophobic surface of Le.sup.b in the complex of gly-MOMP compared with MOMP (FIGS. 5B and C). This is reflected in 67 kcal/mol vdw energy difference between two complexes. It seems that H-II is bound to proteins with a similar mode to Le.sup.b. The residues Lys.sup.278, Arg.sup.352 and 381 are involved in the complex of both proteins with H-II (FIGS. 5E and F). The only difference is in the residues Asp.sup.261 and Ser.sup.397, the first is involved in the complex of MOMP and the second in gly-MOMP. The very large binding energy obtained for the complex of H-II by MMPBSA could not be explained but it still shows that gly-MOMP binds to H-II better than MOMP itself.

[0134] The other outcome gathered from MD calculations is the conformation and alignment of the ligands within the cavities of two proteins. They show that both ligands have different conformational orientations in the active sites of the proteins as indicated in S9--FIGS. 2A,B.

[0135] In conclusion, although MD simulations were carried out in short MD simulation time and in implicit salvation medium, it still shows that glycosylation of major outer membrane proteins provides better conformational changes and consequently affinity for binding and hence recognition of Lewis antigens compared with its parent protein. Conformational MOMP epitopes are important in host immunity, and variation in surface-exposed regions probably occurs as a result of positive immune selection during infection. porA diversity has been exploited in genotyping studies using highly discriminatory nucleotide sequences to identify potentially epidemiologically linked cases of clinical manifestations of C. jejuni infection. Interestingly, the host immune response has been suggested to play a role in defining the more antigenically homogeneous clonal complexes, and this could also reflect niche adaptation. For example, alignment of MOMP sequences isolated from human and chicken associated strains demonstrates that they differ predominantly at loop 4, therefore variation of loop 4 could influence the bacterial binding ability and consequently niche adaptation.

[0136] Moreover, identification of protein glycosylation profile of C. jejuni, mainly those related to outer membrane, are fundamental to understanding the diverse pathogenicity of C. jejuni strains among different hosts. The model can be mined for sub-networks of biological interest, such as essential amino acid that suggest candidate drug targets. Importantly, some low confidence interactions may be found to be biologically significant by experimental validation.

[0137] The model for C. jejuni interaction to Le.sup.b and H-II antigens mediated by MOMP generated here substantially increases our knowledge about the protein and its glycosylation and the role in interactions detected thus far for the C. jejuni outer membrane.

[0138] Thus, the structural glycobiology will play a key role in unravelling other glycan structures that mediate the host-bacteria interaction through MOMP/FlaA proteins, contributing decisively for identification and validation of new glycan receptors for these bacterial lectins. This information will be of major importance for the improvement and design of new therapies to overcome the C. jejuni infection.

[0139] Biofilm Formation

[0140] Auto-agglutination (AAG) has been demonstrated to be critical for virulence for a variety of pathogens, and can play a role in adherence, microcolony formation, biofilm formation, and resistance to acid and phagocytosis. In two previous studies on AAG of C. jejuni (N. Misawa, M. J. Blaser, Infect Immun 68, 6168 (November 2000) and N. J. Golden, D. W. Acheson, Infect Immun 70, 1761 (April 2002)), there appeared to be an association with adherence or invasion of intestinal epithelial cells.

[0141] The impact of flaA mutation and/or MOMP-T/G substitution on biofilm was examined. Biofilms were generated over 48 h on polystyrene plates at 42.degree. C. under microaerophilic conditions, and stained with crystal violet before they were assessed by opacity measurement, using an ELISA reader at A.sub.595. In control samples without sugar added, biofilm formation of strain NCTC11168-.DELTA.flaA deletion and MOMP.sup.T/G were significantly lower than wild type strain (WT). Already known from previous studies, O-linked glycosylation of flagellin is necessary for proper assembly of flagella filaments, also flaA mutation leads to reduction in biofilm formation due to reduced motility. To determine the role of host BgAgs in inhibiting biofilm formation, various antigens were added into the media inoculated with different strains. A reduced biofilm formation was observed in presence of free sugar structures in media; most dramatic drop is seen in WT. For wild type strain, the H-II produced the highest reduction by 90% and followed by Le.sup.b structure with 80% compared with other examined BgAgs. Probably, the greater reduction is due to the higher affinity, which effects the equilibrium equation, and requires longer time for detachment of free sugar from surface molecules and prevents the biofilm formation.

[0142] Although, the stronger binding affinity more interruption in biofilm formation. These data suggest that BgAgs compete with AAG and biofilm determinants on flagellin and MOMP, also confirmed the validity of the model and underlined the critical role of O-glycosylation in biofilm formation (FIG. 7--Figure A and B).

[0143] This experiment was repeated and same pattern was achieved. Taking in account that position of plate might affect growth; we added the samples and its control in identical position on different plates. In addition, we took an aliquot from each sample and grow on CCDA, it showed that growth were equal in all.

[0144] The Lowest Energy Structure of MOMP Protein.

[0145] Functional and structural studies of outer membrane proteins from Gram-negative bacteria are frequently carried out using refolded proteins. Although several structures of bacterial OMPs (outer membrane proteins) are now available, a large number of these proteins are still structurally and functionally poorly characterized. A model was generated for C. jejuni MOMP to study the effect of glycosylation on MOMP conformation and also the role of it in bacterial binding activity. The model may be used for predicting the functions of uncharacterized proteins and for mapping functional pathways in C. jejuni and other prokaryotes. The data can provide a framework for understanding dynamic biological processes, such as the C. jejuni primary attachment to histo-blood group antigens.

[0146] Alignment of porA from Different Bacterial Isolates

[0147] CLUSTAL W (1.81) multiple sequence alignment using BLOSUM weight matrix, of Campylobacter jejuni major outer membrane sequences downloaded from the Uniprot Database (http://www.uniprot.org/). Also, three non-binder (NB) and three high binder (HB) clinical isolates were added into this series (in house sequencing). Amino acid positions refer to positions in strain NCTC11168 (P80672).

[0148] The alignment showed the major contributors of the interaction of the glycosylated MOMP with Le.sup.b via hydrogen bonds are residues 352 (Arg), 381 (Arg), and 278 (Lys), whereas only the residues 352 and 278 are involved in the interaction of non-glycosylated MOMP with Le.sup.b. Amino acid sequence alignments indicating MOMP active sites of C. jejuni isolates from different patients has been sufficiently stable for this purpose. Interestingly, residue 278 (Lys) is semi-conserved in 16 isolates and was substituted by Arg which is able to mediate the binging through hydrogen bond in similar fashion as residues 381(Arg) and 352(Arg).

[0149] In addition, alignment of these sequences also demonstrates that they differ predominantly at loop 4 but the binding pocket between loop 4 and 7 is relatively conserved. A definitive study on MOMP host association would require glycosylation analysis data for isolates from a wide variety of hosts. A complicating factor in exploring these relationships for all C. jejuni may be their ability to colonize multiple hosts and thereby undergo exposure to many different immune responses.

[0150] Moreover, the glycosylation site Thr.sup.268 in the MOMP proteins was conserved in 52% of bacterial isolates aligned in this study, which indicate the importance role of Thr in 268 position.

[0151] Computational Modelling

[0152] All molecular dynamic simulations were conducted by using AMBER (version 10.0) (40) suite of programmes on the Linux/Intel PC cluster of TR-GRID maintained by TUBITAK (Scientific and Technologic Research Council of Turkey). Simulations were initiated using the following amino acid sequence SEQ ID No. 1(MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSG VLRYRYDTGNFDKNFVNNSNLNNSKQDHKYRAQVNFSAAIADNFKAFVQ FDYNAADGGYGANGIKNDQKGLFVRQLYLTYTNEDVATSVIAGKQQLNLI WTDNAIDGLVGTGVKVVNNSIDGLTLAAFAVDSFMAAEQGADLLEHSNIS TTSNQAPFKVDSVGNLYGAAAVGSYDLAGGQFNPQLWLAYWDQVAFFY AVDAAYSTTIFDGINWTLEGAYLGNSLDSELDDKTHANGNLFALKGSIEVN GWDASLGGLYYGDKEKASTVVIEDQGNLGSLLAGEEIFYTTGSRLNGDTG RNIFGYVTGGYTFNETVRVGADFVYGGTKTEAANHLGGGKKLEAVARVD YKYSPKLNFSAFYSYVNLDQGVNTNES ADHSTVRLQALYKF). The model was constructed using the idea of the similarity of secondary structure of these class of proteins. The core structure of MOMP was initiated by using the skeleton of outer membrane protein of anion-selective porin from Comamonas acidovorans (1E54.pdb) and Pseudomonas aeruginosa (2QTK.pdb) as described in S. Biswas, M. M. Mohammad, L. Movileanu, B. van den Berg, Structure 16, 1027 (July 2008), as a template to build the beta-barrels. A combination of HyperChem (HyperChem.TM. Professional 7.51), chimera (UCSF), and the LEaP module as implemented in AMBER was used to build the core and add the loops and turns. The initial structure was heated from 0 Kelvin (K) to 325 K with a restrain of 10 kcal mol.sup.-1 {acute over (.ANG.)}.sup.-2 on residues of beta-barrels to avoid the effect of conformational changes in loops on beta-barrels for a period of 200 ps in four steps, followed by simulations from 0 K to 325 K for another period of 200 ps without any restrains in four steps. The system was further simulated at 300 K for a period of 8 ns. All molecular dynamics (MD) simulations were carried out using pmemd (Particle Mesh Ewald Molecular Dynamics) model of programme as implemented in AMBER. The ff99SB force field was employed and solvation effects were incorporated using the Generalized Born model, as implemented in AMBER. A lower energy structure was chosen and this was glycosylated at the residue 268 (Thr) with Gal(.beta. 1-3)-GalNAc(.beta. 1-4)-GalNAc(.beta. 1-4)-GalNAc-.alpha.-linked to the protein as illustrated in Scheme 1 using xleap as implemented in AMBER. Glycam04 force field was used for carbohydrate unit. The charge on the oxygen of the site chain of Thr was changed from -0.6761 to -0.4599 and the atom type of OS was assigned. The angle and dihedral parameters for dimethylether (CT-OS-CG) and dimethoxymethane (H2-CG-OS-CT) were used for the glycosylated angle and dihedral for the carbohydrate linkage.

[0153] The system was minimized with 500 steps of steepest descent minimization followed by 500 steps of conjugate gradient minimization and heated at 400 K for a period of 10 ps to avoid bad contacts with a restrain of 10 kcal mol.sup.-1 {acute over (.ANG.)}.sup.-2 on the protein backbone and to have the carbohydrate groups in a good shape. The system was heated from 0 K to 325 K for a period of 200 ps without any restrains, followed by simulation at 300 K for a period of 3.5 ns.

[0154] Root-mean-square deviation (RMSD) analysis for the complex system was carried out on the trajectories by the ptraj module of AMBER (v10). 3D structures were displayed using by Chimera (UCSF), and RMSD graphics are shown by XMGRACE package programme.

[0155] Docking calculations were performed to accommodate the Lewis antigen (Le.sup.b) and H-II antigen as seen Scheme 2 within the cavity of the protein. Docking of the Le.sup.b was carried out using DOCK 6.0. Docking was performed with default settings to obtain a population of possible conformations and orientations for Le.sup.b at the binding site. Spheres around the centre of the binding pocket were defined as binding pocket for the docking runs. Since Dock 6.0 program employs sphgen to produce spheres and hence for technical reasons, sphgen cannot handle more than 99999 spheres, the residues forming loops were stripped off and thus the calculations of spheres and grids were only performed with the beta-barrels forming the cavity. Then the coordinates of the Le.sup.b obtained was recorded and AM1-Bcc (Austian model with Bond and charge correction), atomic partial charges and atom types of general amber force field (GAFF) were assigned for it using antechamber as implemented in AMBER. Xleap was used to accommodate the Le.sup.b within the cavity of MOMP with combine command as well as to produce topology/parameter and coordinate files. The atom type of Le.sup.b was changed to those described in Glycam04 force field. The system was minimized, followed by MD simulation at 300 K for about 6.0 ns. The same procedure was applied to the glycosylated protein.

[0156] MM/PBSA Calculations: This study applies a second-generation form of the Mining Minima algorithm, termed M2, to analyze the binding reactions of host-guest complexes in water. The MM-PB/SA module of AMBER (v9) was applied to compute the binding free energy (.DELTA.G.sub.bind) of each complex using the MM/PBSA method. For each complex, a total number of 200 snapshots were extracted from the last 1 ns of the complex trajectories.

[0157] During conformational searching and the evaluation of configuration integrals, Welec is computed with a simplified but fast generalized Born model. The electrostatic solvation energy of each energy-well is then corrected toward a more accurate but time-consuming finite-difference solution of the Poisson equation. The dielectric cavity radius of each atom is set to the mean of the solvent probe radius 1.4 .ANG. for water and the atom's van der Waals radius, and the dielectric boundary between the molecule and the solvent is the solvent-accessible molecular surface. The solvation calculations use a water dielectric constant of 80. The MM/PBSA method can be conceptually summarized as:

.DELTA.G.sub.bind=G.sub.complex-[G.sub.host+G.sub.ligand] (1)

G=E.sub.gas+G.sub.sol-TS (2)

E.sub.gas=E.sub.bond+E.sub.angle+E.sub.torsion+E.sub.vdw+E.sub.ele (3)

G.sub.sol=G.sub.PB+G.sub.SA (4)

H=E.sub.gas+G.sub.sol (5)

G.sub.sol=G.sub.PB+G.sub.SA (.sup.6)

H=E.sub.gas+G.sub.sol (7)

S.sub.tot=S.sub.vib+S.sub.trans+S.sub.rot (8)

.DELTA.G=.DELTA.H-T.DELTA.S (9)

where G.sub.complex, G.sub.host, and G.sub.ligand are the absolute free energies of the complex, host and the ligand species respectively as shown equation (1). Each of them is calculated by summing an internal energy in gas phase (E.sub.gas), a solvation free energy (G.sub.sol), and a vibrational entropy term equation (eq 2). E.sub.gas is Standard force field energy, including strain energies from covalent bonds and torsion angles as well as noncovalent van der Waals and electrostatic energies (eq 3). The solvation free energy, G.sub.sol, is calculated with a PB/SA model, which dissects solvation free energy as the sum of an electrostatic component (GPB) and a nonpolar component (GSA) as shown in eq. 8, S.sub.tot is the total entropy comprising of translational (S.sub.trans), vibrational (S.sub.vib) and rotational (S.sub.rot) entropies as gas phase for each species as shown in eq. 6. In present study the entropy term was not included in calculations.

##STR00003##

##STR00004##

[0158] Building and Developing Amber Parameters for the Inhibitors

[0159] 1) Charge Derivation for the Inhibitor

[0160] The model was divided into two fragments, one included quinate caped with NHMe ((1) in FIG. 9) and another included N,N-bis-(2-aminoethyl)ethane-1,2-diamine core ((2) in FIG. 9), which was further simplified into N,N-dimethylethane-1,2-diamine caped with acetyl ((3) in FIG. 9). The first stage was to optimize quinate amide and acate amide residues. This was done with a QM method at a reasonably high level of theory, which was done with MP2/6-31G* employing Gaussian 03 package programme. The original x-ray structure of quinic acid was used for quinate amide. The next stage was to calculate an ESP for each of the two optimized geometries that can ultimately be read by the RESP programme. HF/6-31G* as the level of theory was used to derive ESP for two structures. The RESP programme implemented in amber was used to derive the charges for each fragment. The capes, acetyl and NHMe were removed from each fragment and the model was built using xleap. ff99SB library was used to build library file for the model, which includes parameters such as atom type, bond, angles and dihedral. The topology and coordinate files were recorded for the model.

[0161] 2) Conformational Search Using Molecular Dynamic Simulation

[0162] The structure was minimized at a total of 1000 steps; 500 of steepest descent (ncyc=500) followed by 500 of conjugate gradient (maxcyc-ncyc) in vacuum, followed by heating from 0 K to 700 K at seven steps each with 100 ps. The system was further run at 700 K for 1 ns. Few conformational minima were chosen and they were and they were cooled down to 300 K, each of which was further run at 300 K for 5 ns. From these runs a few conformations with minimum energy were chosen and they were minimized amber then with quantum mechanical calculation at B3LYP/6-31G* level of theory to locate the structure with the lowest energy.

[0163] Alignment of porA from Different C. jejuni Isolates.

[0164] CLUSTAL W (1.81) multiple sequence alignment using BLOSUM weight matrix, of Campylobacter jejuni major outer membrane sequences downloaded from the Uniprot Database (http://www.uniprot.org/).Also, three non-bind (NB) and three high binder (HB) clinical isolates were added into this series from in house sequencing. Amino acid positions referred to in this application relate to the amino acid positions in strain NCTC11168 (P80672) SEQ ID No 1.

TABLE-US-00001 10 20 30 40 MKLVKLSLVA ALAAGAFSAA NATPLEEAIK DVDVSGVLRY 50 60 70 80 RYDTGNFDKN FVNNSNLNNS KQDHKYRAQV NFSAAIADNF 90 100 110 120 KAFVQFDYNA ADGGYGANGIKNDQKGLFVR QLYLTYTNED 130 140 150 160 VATSVIAGKQ QLNLIWTDNA IDGLVGTGVK VVNNSIDGLT 170 180 190 200 LAAFAVDSFM AAEQGADLLE HSNISTTSNQ APFKVDSVGN 210 220 230 240 LYGAAAVGSY DLAGGQFNPQ LWLAYWDQVA FFYAVDAAYS 250 260 270 280 TTIFDGINWT LEGAYLGNSL DSELDDKTHA NGNLFALKGS 290 300 310 320 IEVNGWDASL GGLYYGDKEK ASTVVIEDQG NLGSLLAGEE 330 340 350 360 IFYTTGSRLN GDTGRNIFGY VTGGYTFNET VRVGADFVYG 370 380 390 400 GTKTEAANHL GGGKKLEAVA RVDYKYSPKL NFSAFYSYVN 410 420 LDQGVNTNES ADHSTVRLQA LYKF

[0165] Annotation with "*", ":", "." refers to identical, conserved, semi-conserved amino acid substitutions respectively.

TABLE-US-00002 Hb1 MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGNFDKNFVN-NSNLNN 59 Q2LAB2 MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGNFDKNFVN-NSNLNN 59 Q2LAB0 MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGNFDKNFVN-NSNLNN 59 Hb2 MKLVKLSLVAALAASAFSAANATPLEEAIKDVDVSGVLRYRYDTGNFDKNFVN-NSNLNN 59 NB1 MKLVKLSLVAALAASAFSAANATPLEEAIKDVDVSGVLRYRYDTGNFDKNFVN-NSNLNN 59 Q9F791 MKLVKLSLVAALAASAFSAANATPLEEAIKDVDVSGVLRYRYDTGNFDKNFVN-NSNLNN 59 Hb3 MKLVKLSLVAALAASAFSAANATPLEEAIKDVDVSGVLRYRYDTGNFDKNFVN-NSNLNN 59 D3FNB0 MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGNFDKNFVN-NSNLNN 59 Q2LAB1 MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGNFDKNFVN-NSNLNN 59 Q2LAB8 MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGNFDKNFVN-NSNLNN 59 Q2LAA5 MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGNFDKNFVN-NSNLNN 59 Q2LAB6 MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGNFDKNFVN-NSNLNN 59 Q2LA95 MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGNFDKNFVN-NSNLNN 59 P80672 (SEQ ID No. 1) MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGNFDKNFVN-NSNLNN 59 Q2LAC5 MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGNFDKNFVN-NSNLNN 59 Q2LAA2 MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGNFDKNFVN-NSNLNN 59 Q2LAB7 MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGNFDKNFVN-NSNLNN 59 Q2LAB9 MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGNFDKNFVN-NSNLNN 59 Q2LA91 MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGNFDKNFVN-NSNLNN 59 NB2 MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGNFDKNFVN-NSNLNN 59 Q2LA98 MKLVKLILVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGNFDKNFVN-NSNLNN 59 A3ZHA2 MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGNFDKNFVN-NSNLNN 59 Q9F792 MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGNFDKNFVN-NSNLNN 59 Q2LAC0 MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGNFDKNFVN-NSNLNN 59 Q0GF63 MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGNFDKNFVN-NSNLNN 59 Q2LAB3 MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGNFDKNFVN-NSNLNN 59 Q2LA93 MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGTFDKNWGTPNSNLND 60 Q2LAA0 MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGTFDKNWGTPNSNLND 60 Q2LAC1 MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGTFDKNWGTPNSNLND 60 Q2LAC4 MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGTFDKNWGTPNSNLND 60 Q2LA94 MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGTFDKNWGTPNSNLND 60 Q2LA92 MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGNFDKNFLN-NSNLNN 59 Q2LAA4 MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGNFDKNFIN-NSNLNN 59 Q2LA89 MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYDTGNFDKNFIN-NSNLNN 59 NB3 MKLVKLSLVAALAAGAFSAANATPLEEAIKDVDVSGVLRYRYETSN-DWSNANFGSGIS- 58 Q2LAA9 MKLVKLSLVAALAAGAFSAANATPLEEAIKDIDVSGVLRYRYETSN-DWSNANFGSGIS- 58 B5QHE5 MKLVKLSLVAALAASAFSAANATPLEEAIKDIDVSGVLRYRYESSN-PWSNANFGSGIS- 58 Q2LA96 MKLVKLSLVAALAASAFSAANATPLEEAIKDIDVSGVLRYRYESSN-PWSNANFGSGIS- 58 Q2LAB4 MKLVKLSLVAALAASAFSAANATPLEEAIKDIDVSGVLRYRYESSN-PWSNANFGSGIS- 58 Q2LA97 MKLVKLSLVAALAASAFSAANATPLEEAIKDIDVSGVLRYRYESSN-PWSNANFGSGIS- 58 Q2LAA7 MKLVKLSLVAALAAGAFSAANATPLEEAIKDIDVSGVLRYRYESSN-PWSNANFGSGIS- 58 Q9F788 MKLVKISLVAALAAGAFSAANATPLEEAIKDIDVSGVLRYRYESSN-PWSNANFGSGIS- 58 Q2LA87 MKLVKLSLVAALAAGAFSAANATPLEEAIKDIDVSGVLRYRYESSN-PWSNANFGSGIS- 58 Q2LA90 MKLVKLSLVAALAAGAFSAANATPLEEAIKDIDVSGVLRYRYESSN-PWSNANFGSGIS- 58 Q2LAA3 MKLVKLSLVAALAAGAFSAANATPLEEAIKDIDVSGVLRYRYESSN-PWSNGNYGSGIS- 58 QOGF62 MKLVKLSLVAALAAGAFSAANATPLEEAIKDIDVSGVLRYRYDTSN-DWNNAGFGSGIS- 58 *****: *******.****************:**********::.. . .*.:. Hb1 SKQDHKYRAQVNFSAAIADNFKAFVQFDYNAADGGY----GANGIKNDQKGLFVRQLYLT 115 Q2LAB2 SKQDHKYRAQVNFSAAIADNFKAFVQFDYNAADGGY----GANGIKNDQKGLFVRQLYLT 115 Q2LAB0 SKQDHKYRAQVNFSAAIADNFKAFVQFDYNAADGGY----GANGIKNDQKGLFVRQLYLT 115 Hb2 SKQDHKYRAQVNFSAAIADNFKAFVQFDYNAADGGY----GANGIKNDQKGLFVRQLYLT 115 NB1 SKQDHKYRAQVNFSAAIADNFKAFVQFDYNAADGGY----GANGIKNDQKGLFVRQLYLT 115 Q9F791 SKQDHKYRAQVNFSAAIADNFKAFVQFDYNAADGGY----GANGIKNDQKGLFVRQLYLT 115 Hb3 SKQDHKYRAQVNFSAAIADNFKAFVQFDYNAADGGY----GANGIKNDQKGLFVRQLYLT 115 D3FNB0 SKQNHKYRAQVNFSAAIADNFKAFIQFDYNAADGGY----GANGIKNDQKGLFVRQLYLT 115 Q2LAB1 SKQDHKYRAQVNFSAAIADNFKAFVQFDYNAADGGY----GANGIKNDQKGLFVRQLYLT 115 Q2LAB8 SKQDHKYRAQVNFSAAIADNFKAFVQFDYNAADGGY----GANGIKNDQKGLFVRQLYLT 115 Q2LAA5 SKQDHKYRAQVNFSAAIADNFKAFVQFDYNAADGGY----GANGIKNDQKGLFVRQLYLT 115 Q2LAB6 SKQDHKYRAQVNFSAAIADNFKAFVQFDYNAADGGY----GANGIKNDQKGLFVRQLYLT 115 Q2LA95 SKQDHKYRAQVNFSAAIADNFKAFVQFDYNAADGGY----GANGIKNDQKGLFVRQLYLT 115 P80672 (SEQ ID No. 1) SKQDHKYRAQVNFSAAIADNFKAFVQFDYNAADGGY----GANGIKNDQKGLFVRQLYLT 115 Q2LAC5 NKQDHKYRAQVNFSAAIADNFKAFIQFDYNAVDGGT----GVNNVKNAEKGLFVRQLYLT 115 Q2LAA2 NKQDHKYRAQVNFSAAIADNFKAFIQFDYNAVDGGT----GVDNVTNAEKGLFVRQLYLT 115 Q2LAB7 NKQDHKYRAQVNFSAAIADDFKAFIQFDYNAVDGGT----GVDNVTNAEKGLFVRQLYLT 115 Q2LAB9 SKQDHKYRAQVNFSAAIADNFKAFIQFDYNAVDGGT----GVDNVTNTEKGLFVRQLYLT 115 Q2LA91 NKQDHKYRAQVNFSAAIADNFKAFIQFDYNAVDGGT----GVDNVTNAEKGLFVRQLYLT 115 NB2 NKQDHKYRAQVNFSAAIADNFKAFIQFDYNAVDGGT----GVDNVTNAEKGLFVRQLYLT 115 Q2LA98 NKQDHKYRAQVNFSAAIADNFKAFIQFDYNAVDGGT----GVDNVTNAEKGLFVRQLYLT 115 A3ZHA2 NKQDHKYRAQVNFGAAIADNFKAFIQFDYNAVDGGT----GVDNVTNAEKGLFVRQLYLT 115 Q9F792 NKQDHKYRAQVNFGAAIADNFKAFIQFDYNAVDGGT----GVDNVTNAEKGLFVRQLYLT 115 Q2LAC0 NKQDHKYRAQVNFGAAIADNFKAFIQFDYNAVDGGT----GVGNVKNAEKGLFVRQLYLT 115 Q0GF63 NKQDHKYRAQVNFSAAIADNFKAFIQFDYNAVDGGT----GVDNVTNAEKGLFVRQLYLT 115 Q2LAB3 NKQDHKYRAQVNFSAAIADNFKAFIQFDYNAVDGGT----GVDNATNAEKGLFVRQLYLT 115 Q2LA93 SKQDHKYRAQVNFSAAIADNFKAFIQFDYNAVDGGT----GVDNKTNAEKGLFVRQLYLT 116 Q2LAA0 SKQDHKYRAQVNFSAAIADNFKAFIQFDYNAVDGGT----GVDNKTNAEKGLFVRQLYLT 116 Q2LAC1 SKQDHKYRAQVNFSAAIADNFKAFVQFDYNAVDGGT----GVDNATNAQKGFFVRQLYLT 116 Q2LAC4 SKQDHKYRAQVNFSAAIADNFKAFVQFDYNAVDGGT----GVDNATNAQKGFFVRQLYLT 116 Q2LA94 SKQDHKYRAQVNFSAAIADNFKAFIQFDYNAVDGGT----GVDNATNAEKGLFVRQLYLT 116 Q2LA92 SKQDHKYRAQVNFSAAIADNFKAFVQFDYNAVDGGT----GVDNATNAEKGLFVRQLYLT 115 Q2LAA4 SKQDHKYRAQVNFSAAIADNFKAFVQFDYNAADGGT----GVDNATNAQKGLFVRQLYLT 115 Q2LA89 SKQDHKYRAQVNFSAAIADNFKAFVQFDYNAADGGY----GANEIKNDQKGLFVRQLYLT 115 NB3 GKQDHKYRAQVNFGAASADNFKAFVQFDYSQADGGY----GADSISNTSDTLSVRQLYLT 114 Q2LAA9 GKQDHKYRAQVNFSGAISDNFKAFVQFDYNSQDGGY----GADSISNTSDTLSVRQLYLT 114 B5QHE5

GKQDHKYRAQVNFSGAISDNFKAFVQFDYNSQDGGY----GADSISNTSDTLSVRQLYLT 114 Q2LA96 GKQDHKYRAQVNFSGAISDNFKAFVQFDYNSQDGGY----GADSISNTSDTLSVRQLYLT 114 Q2LAB4 GKQDHKYRAQVNFSGAISDNFKAFVQFDYNSQDGGY----GTDSISNTSDTLTVRQLYLT 114 Q2LA97 GKQDHKYRAQVNFSGAISDNFKAFVQFDYNSQDGGY----GTDSISNTSDTLTVRQLYLT 114 Q2LAA7 GKQDHKYRAQVNFSGAISDNFKAFVQFDYNSQDGGY----GTDSISNTSDTLTVRQLYLT 114 Q9F788 GKQDHKYRAQVNFSGAISDNFKAFVQFDYNSQDGGY----GTDSISNTSDTLTVRQLYLT 114 Q2LA87 GKQDHKYRAQVNFSGAISDNFKAFVQFDYNSQDGGY----GTDSISNTSDTLTVRQLYLT 114 Q2LA90 GKQDHKYRAQVNFSGAISDNFKAFVQFDYNSQDGGY----GADSISNTSDTLTVRQLYLT 114 Q2LAA3 GKQDHKYRAQVNFNTAIADNFKAFVQFDYNSKDGGY----GENSISNTSDTLSVRQLYLT 114 QOGF62 GKQTHNYRAQINFSGAIADNFKAFVQFDYAAVDGGYNVTNGTGNQRNDQNSLTVRQLYLT 118 .** *:****:**. * :*:****:**** *** * . * .. : ******* Hb1 YTNEDVATSVIAGKQQLNLIWTDNAIDGLVGTGVKVVNNSIDGLTLAAFAVDSFMAAEQG 175 Q2LAB2 YTNEDVATSVIAGKQQLNLIWTDNAIDGLVGTGVKVVNNSIDGLTLAAFAVDSFMAAEQG 175 Q2LAB0 YTNEDVATSVIAGKQQLNLIWTDNAIDGLVGTGVKVVNNSIDGLTLAAFAVDSFMAAEQG 175 Hb2 YTNEDVATSVIAGKQQLNTIWTDNGVDGLVGTGIKVVNNSIDGLTLAAFAVDSFMAEEQG 175 NB1 YTNEDVATSVIAGKQQLNTIWTDNGVDGLVGTGIKVVNNSIDGLTLAAFAVDSFMAEEQG 175 Q9F791 YTNEDVATSVIAGKQQLNTIWTDNGVDGLVGTGIKVVNNSIDGLTLAAFAVDSFMAEEQG 175 Hb3 YTNEDVATSVIAGKQQLNTIWTDNGVDGLVGTGIKVANNSIDGLTLAAFAVDSFMAEEQG 175 D3FNB0 YTNEDVATSVIAGKQQLNTIWTDNGVDGLVGTGIKVVNNSIDGLTLAAFAVDSFMAEEQG 175 Q2LAB1 YTNEDVATSVIAGKQQLNTIWTDNGVDGLVGTGIKVVNNSIDGLTLAAFAVDSFMAEEQG 175 Q2LAB8 YTNEDVATSVIAGKQQLNTIWTDNGVDGLVGTGIKVVNNSIDGLTLAAFAVDSFMAEEQG 175 Q2LAA5 YTNEDVATSVIAGKQQLNTIWTDNGVDGLVGTGIKVVNNSIDGLTLAAFAVDSFMAEEQG 175 Q2LAB6 YTNEDVATSVIAGKQQLNTIWTDNGVDGLVGTGIKVVNNSIDGLTLAAFAVDSFMAEEQG 175 Q2LA95 YTNEDVATSVIAGKQQLNTIWTDNGVDGLVGTGIKVVNNSIDGLTLAAFAVDSFMAAEQG 175 P80672 (SEQ ID No. 1) YTNEDVATSVIAGKQQLNLIWTDNAIDGLVGTGVKVVNNSIDGLTLAAFAVDSFMAAEQG 175 Q2LAC5 YTNEDVATSVIAGKQQLNLIWTDNAIDGLVGTGVKVVNNSIDGLTLAAFAADSFMAAEQG 175 Q2LAA2 YTNEDVATSVIAGKQQLNLIWTDNAIDGLVGTGVKVVNNSIDGLTLAAFAADSFMAAEQG 175 Q2LAB7 YTNEDVATSVIAGKQQLNLIWTDNAIDGLVGTGVKVVNNSIDGLTLAAFAADSFMAAEQG 175 Q2LAB9 YTNEDVATSVIAGKQQLNLIWTDNAIDGLVGTGVKVVNNSIDGLTLAAFAADSFMAAEQG 175 Q2LA91 YTNEDVATSVIAGKQQLNLIWTDNAIDGLVGTGVKVVNNSIDGLTLAAFAVDSFMAAEQG 175 NB2 YTNEDVATSVIAGKQQLNLIWTDNAIDGLVGTGIKVVNNSIDGLTLAAFAADSFMAAEQG 175 Q2LA98 YTNEDVATSVIAGKQQLNLIWTDNAIDGLVGTGIKVVNNSIDGLTLAAFAADSFMAAEQG 175 A3ZHA2 YTNEDVATSVIAGKQQLNLIWTDNAIDGLVGTGVKVVNNSIDGLTLAAFAADSFMAAEQG 175 Q9F792 YTNEDVATSVIAGKQQLNLIWTDNAIDGLVGTGVKVVNNSIDGLTLAAFAADSFMAAEQG 175 Q2LAC0 YTNEDVATSVIAGKQQLNLIWTDNAIDGLVGTGVKVVNNSIDGLTLAAFAADSFMAAEQG 175 Q0GF63 YTNEDVATSVIAGKQQLNFIWTDNAIDGLVGTGVKVVNNSIDGLTLAAFAVDSFMAAEQG 175 Q2LAB3 YTNEDVATSVIAGKQQLNLIWTDNAIDGLVGTGVKVVNNSIDGLTLAAFAVDSFMTAEQG 175 Q2LA93 YTNEDVATSVIAGKQQLNIIWTDNGVDGLVGTGIKVVNNSIDGLTLAAFAVDSFMAAEQG 176 Q2LAA0 YTNEDVATSVIAGKQQLNIIWTDNGVDGLVGTGIKVVNNSIDGLTLAAFAVDSFMAAEQG 176 Q2LAC1 YTNEDVATSVIAGKQQLNIIWTDNGIDGLVGTGVKVVNNSIDGLTLAAFAVDSFMATEQG 176 Q2LAC4 YTNEDVATSVIAGKQQLNIIWTDNGIDGLVGTGVKVVNNSIDGLTLAAFAVDSFMATEQG 176 Q2LA94 YTNEDVATSVIAGKQQLNTIWTDNGIDGLVGTGVKVVNNSIDGLTLAAFAVDSFMATEQG 176 Q2LA92 YTNEDVATSVIAGKQQLNIIWTDNGVDGLVGTGVKVVNNSIDGLTLAAFAVDSFMATEQG 175 Q2LAA4 YTNEDVATSVIAGKQQLNTIWTDNGIDGLVGTGVKVVNNSIDGLTLAAFAVDSFMAEEQG 175 Q2LA89 YTNEDVATSVIAGKQQLNTIWTDNGIDGLVGTGVKVINNSIDGLTLAAFAVDSFMAAEQG 175 NB3 YTNEDVATSVIAGKQQLNTIWTDNGIDGLVGTGIKVVNNSIDGLTLAAFAMDSFNEEVPA 174 Q2LAA9 YTNEDVATSVIAGKQQLNTIWTDNGIDGLVGTGIKVVNNSIDGLTLAAFAMDSFNEEVPA 174 B5QHE5 YTNEDVATSVIAGKQQLNTIWTDNAIDGLVGTGIKVVNNSIDGLTLAAFAMDSFNEASDT 174 Q2LA96 YTNEDVATSVIAGKQQLNTIWTDNAIDGLVGTGIKVVNNSIDGLTLAAFAMDSFNEASDT 174 Q2LAB4 YTNEDVATSVIAGKQQLNTIWTDNGIDGLVGTGVKVVNNSIDGLTLAAFAMDSFNEASDT 174 Q2LA97 YTNEDVATSVIAGKQQLNTIWTDNGVDGLVGTGIKVVNNSIDGLTLAAFAMDSFNEASDT 174 Q2LAA7 YTNEDVATSVIAGKQQLNTIWTDNGIDGLVGTGVKVVNNSIDGLTLAAFAMDSFNEASDT 174 Q9F788 YTNEDVATSVIAGKQQLNTIWTDNGIDGLVGTGVKVVNNSIDGLTLAAFAMDSFNEASDT 174 Q2LA87 YTNEDVATSVIAGKQQLNTIWTDNAIDGLVGTGVKVVNNSIDGLTLAAFAMDSFNEASDT 174 Q2LA90 YTNEDVATSVIAGKQQLNFIWTDNAIDGLVGTGIKVVNNSIDGLTLAAFAMDSFNEASDT 174 Q2LAA3 YTNEDVATSVIAGKQQLNTIWTDNGVDGLVGTGIKVVNNSIDGLTLAAFAMDSFNEASDT 174 QOGF62 YTNEDVATSVIAGKQQLNTIWTDNDIDGLVGTGIKVVNNSIDGLTLAAFAVDSYNTDE-- 176 ****************** ***** :*******:** ************* **: Hb1 AD----------LLGHS-TTS----TTQKAAPFKVDSVGNLYGAAAVGSYDLAGGQFNPQ 220 Q2LAB2 AD----------LLGHS-TTSTTH-TTQKAAPFKVDSVGNLYGAAAVGSYDLAGGQFNPQ 223 Q2LAB0 AD----------LLGHS-TTS----TTQKAAPFKVDSVGNLYGAAAVGSYDLAGGQFNPQ 220 Hb2 AD----------LLGQS-TIS----TTQNAAPFKVDSVGNLYGAAAVGSYDLAGGQFNPQ 220 NB1 AD----------LLGQS-TIS----TTQNAAPFKVDSVGNLYGAAAVGSYDLAGGQFNPQ 220 Q9F791 AD----------LLGQS-TIS----TTQNAAPFKVDSVGNLYGAAAVGSYDLAGGQFNPQ 220 Hb3 AD----------LLGQS-TIS----TTQNAAPFKVDSVGNLYGAAAVGSYDLAGGQFNPQ 220 D3FNB0 AD----------LLGKS-TIS----TTQKAAPFQADSLGNLYGAAAVGSYDLAGGQFNPQ 220 Q2LAB1 AD----------LLGQS-TIS----TTQKAAPFQADSLGNLYGAAAVGSYDLAGGQFNPQ 220 Q2LAB8 AD----------LLGQS-TIS----TTQKAAPFQADSLGNLYGAAAVGSYDLAGGQFNPQ 220 Q2LAA5 TD----------LLGQS-TIS----TTQNTAPFQADSLGNLYGAAAVGSYDLAGGQFNPQ 220 Q2LAB6 TD----------LLGQS-TIS----TTQNTALFQADSLGNLYGAAAVGSYDLAGGQFNPQ 220 Q2LA95 AD----------LLGHSNTST----ATPNQVPFKVDSVGNLYGAAAVGSYDLAGGQFNPQ 221 P80672 (SEQ ID No. 1) AD----------LLEHS-NIS----TTSNQAPFKVDSVGNLYGAAAVGSYDLAGGQFNPQ 220 Q2LAC5 AD----------LLGHS-NIS----TTSKQAPFKVDSVGNLYGAAAVGSYDLAGGQFNPQ 220 Q2LAA2 AD----------LLGHS-TTSTT----QATAPFKVDSVGNLYGAAAVGSYDLAGGQFNPQ 220 Q2LAB7 AD----------LLGHS-TTSTT----QATAPFKVDSVGNLYGAAAVGSYDLAGGQFNPQ 220 Q2LAB9 AD----------LLEHS-TISTT----QNAAPFKVDSVGNLYGAAAVGSYDLAGGQFNPQ 220 Q2LA91 AD----------LLGHS-NISTT---NANQAPFKVDSVGNLYGAAAVGSYDLAGGQFNPQ 221 NB2 AD----------LLGHS-NIST----TPNQAPFKVDSVGNLYGAAAVGSYDLAGGQFNPQ 220 Q2LA98 AD----------LLGHR-NISTI---TPNQAPFKVDSVGNLYGAAAVGSYDLAGGQFNPQ 221 A3ZHA2 AD----------LLGHS-NISTT---S-NQVPFKVDSVGNLYGAAAVGSYDLAGGQFNPQ 220 Q9F792 AD----------LLGHS-NISTT---S-NQAPFKVDSVGNLYGAAAVGSYDLAGGQFNPQ 220 Q2LAC0 AD----------LLGHS-NTSTA---TPNQAPFKVDSVGNLYGAAAVGSYDLAGGQFNPQ 221 Q0GF63 AE----------LLGHS-NIS----TTSNQAPFKVDSVGNLYGAAAVGSYDLAGGQFNPQ 220 Q2LAB3 AD----------LLGHN------------GSQFNPDSIGNLYGAAAVGSYDLAGGQFNPQ 213 Q2LA93 SD----------LVG------------ANN-TFKVDSIGNLYGAAAVGSYDLAGGQFNPQ 213

Q2LAA0 SD----------LVG------------ANNSTFKVDSIGNLYGAAAVGSYDLAGGQFNPQ 214 Q2LAC1 SD----------LVG------------HNGSQFNPDSIGNLYGAAAVGSYDLAGGQFNPQ 214 Q2LAC4 SD----------LVG------------HNGSQFNPDSIGNLYGAAAVGSYDLAGGQFNPQ 214 Q2LA94 SD----------LVG------------HNGSKFSPDSIGNLYGAAAVGSYDLAGGQFNPQ 214 Q2LA92 SD----------LLGQSTYVSND---KNNNDSFKLDSIGNLYGAAAVGSYDLAGGQFNPQ 222 Q2LAA4 AD----------LLGHS-NIS--S-AN-NSAPFKLDSIGNLYGGAAVGSYEFLGGQFNPQ 220 Q2LA89 AD----------LLGHS-NIS--S-AKPNIAPFKLDSIGNLYGGAAVGSYEFLGGQFNPQ 221 NB3 TT-----------TNG-FNKGNV--NGDGDVSSALDWSKNIYGAAAIGSYDLIGGQFNPQ 220 Q2LAA9 TT-----------TNGNFNKGNV--NGDGDVSSALDWSKNIYGAAAIGSYDIAGGQFNPQ 221 B5QHE5 TVTITQD-NSQKITGVQFNRGNP--KGDSDVSGALDWSKNIYGAAAIGSYDIAGGQFNPQ 231 Q2LA96 TVTITQD-NSQKITGVQFNRGNP--KGDSDVSGALDWSKNIYGATAIGSYDIAGGQFNPQ 231 Q2LAB4 TVTITQD-SNQKITGVQFNRGNP--KGDSDVSGALDWSKNIYGAAAIGSYDIAGGQFNPQ 231 Q2LA97 TVTITQN-SSQKITGVQFNRGNP--KGDGDVSGALDWSKNIYGAAAIGSYDITGGQFNPQ 231 Q2LAA7 TVTITQD-NNQKITGVQFNRGNP--KGDSDVSGALDWSKNIYGAAAIGSYDIAGGQFNPQ 231 Q9F788 TVTITQD-NNQKITGVQFNRGNP--KGDSDVSGALDWSKNIYGAAAIGSYDIAGGQFNPQ 231 Q2LA87 TVTITQD-NNQKITGVQFNRGNP--KGDSDVSGALDWSKNIYGAAAIGSYDIAGGQFNPQ 231 Q2LA90 TVTITQN-GSQKITGVQFNRGNP--KGDGDASGALDWSKNIYGAAAIGSYDLAGGQFNPQ 231 Q2LAA3 TVIITQDPSSNKITGVQFNRGNP--KGDGDVSGALDWSKNIYGAAAIGSYDIAGGQFNPQ 232 QOGF62 -------------QGYKDNNGRPDLTYTGDASQYLTWG-NIYGAAAVGSYDLAGGQFNPQ 222 *:**.:*:***:: ******* (Ser 262) (Thr 268) Hb1 LWLAYWDQVAFFYAVDAAYSTTIFDGINWTLEGAYLGNSLDSELDDKTHAN--------- 271 Q2LAB2 LWLAYWDQVAFFYAVDAAYSTTIFDGINWTLEGAYLGNSLDSELDDKTHAN--------- 274 Q2LAB0 LWLAYWDQVAFFYAVDAAYSTTIFDGINWTLEGAYLGNSLDSELDDKTHAN--------- 271 Hb2 LWLAYWDQVAFFYAVDAAYSTTIFDGINWTLEGAYLGNSLDSELDDKTHAN--------- 271 NB1 LWLAYWDQVAFFYAVDAAYSTTIFDGINWTLEGAYLGNSLDSELDDKTHAN--------- 271 Q9F791 LWLAYWDQVAFFYAVDAAYSTTIFDGINWTLEGAYLGNSLDSELDDKTHAN--------- 271 Hb3 LWLAYWDQVAFFYAVDAAYSTTIFDGINWTLEGAYLGNSLDSELDDKTHAN--------- 271 D3FNB0 LWLAYWDQVAFFYAVDAAYSTTIFDGINWTLEGAYLGNSLDSELNDKRHAN--------- 271 Q2LAB1 LWLAYWDQVAFFYAVDAAYSTTIFDGINWTLEGAYLGNSLDSELDDKRHAN--------- 271 Q2LAB8 LWLAYWDQVAFFYAVDAAYSTTIFDGINWTLEGAYLGNSLDSELDDKTHAN--------- 271 Q2LAA5 LWLAYWDQVAFFYAVDAAYSTTIFDGINWTLEGAYLGNSLDSELDDKRHAN--------- 271 Q2LAB6 LWLAYWDQVAFFYAVDAAYSTTIFDGINWTLEGAYLGNSLDSELDDKRHAN--------- 271 Q2LA95 LWLAYWDQVAFFYAVDAAYSTTIFDGINWTLEGAYLGNSLDSELDDTTHAN--------- 272 P80672 (SEQ ID No. 1) LWLAYWDQVAFFYAVDAAYSTTIFDGINWTLEGAYLGNSLDSELDDKTHAN--------- 271 Q2LAC5 LWLAYWDQVTFFYAVDAAYSTTIFDGINWTLEGAYLGNSLDSELDDKTHAN--------- 271 Q2LAA2 LWLAYWDQVAFFYAVDAAYSTTIFDGINWTLEGAYLGNSLDSELDDKTHAN--------- 271 Q2LAB7 LWLAYWDQVAFFYAVDAAYSTTIFDGINWTLEGAYLGNSLDSELDDKTHAN--------- 271 Q2LAB9 LWLAYWDQVAFFYAVDAAYSTTIFDGINWTLEGAYLGNSLDSELDDKTHAN--------- 271 Q2LA91 LWLAYWDQVAFFYAVDAAYSTTIFDGINWTLEGAYLGNSLDSELDDKTHAN--------- 272 NB2 LWLAYWDQVAFFYAVDAAYSTTIFDGINWTLEGAYLGNSLDSELDDKTHAN--------- 271 Q2LA98 LWLAYWDQVAFFYAVDAAYSTTIFDGINWTLEGAYLGNSLDSELDDKTHAN--------- 272 A3ZHA2 LWLAYWDQVAFFYAVDAAYSTTIFDGINWTLEGAYLGNSLDSELDDKTHAN--------- 271 Q9F792 LWLAYWDQVAFFYAVDAAYSTTIFDGINWTLEGAYLGNSLDSELDDQAHAN--------- 271 Q2LAC0 LWLAYWDQVAFFYAVDAAYSTTIFDGINWTLEGAYLGNSLDSELDDTTHAN--------- 272 QOGF63 LWLAYWDQVAFFYAVDAAYSTTIFDGINWTIEGAYLGNSIDSELDDTTHTN--------- 271 Q2LAB3 LWLAYWDQVAFFYALDASYSTTIFDGINWTLEGAYLGNSVDSDLDSTRYAN--------- 264 Q2LA93 LWLAYWDQVAFFYAVDAAYSTTIFDGINWTLEGAYLGNSVDSDLNSAEHAN--------- 264 Q2LAA0 LWLAYWDQVAFFYALDVSYSTTIFDGINWTLEGAYLGNSLDSELNDKTYAN--------- 265 Q2LAC1 LWLAYWDQVAFFYALDASYSTTIFDGINWTLEGAYLGNSVDSDLDSAKYAN--------- 265 Q2LAC4 LWLAYWDQVAFFYALDASYSTTIFDGINWTLEGAYLGNSVDSDLDSARYAN--------- 265 Q2LA94 LWLAYWDQVAFFYALDASYSTTIFDGINWTLEGAYLGNSVDSDLNSAEYAN--------- 265 Q2LA92 LWLAYWDQVAFFYAVDAAYSTTIFDGINWTLEGAYLGNSLDSELDDRTYAN--------- 273 Q2LAA4 LWLAYWDQVAFFYAVDAAYSTTIFDGINWTLEGAYLGNSIDSELDKTTHTN--------- 271 Q2LA89 LWLAYWDQVAFFYAVDAAYSTTIFDGINWTLEGAYLGNSIDSELDDKTHTN--------- 272 NB3 LWLAYMSDNAFLYALDAAYSTTIFDGINWSIEGAYLGNSVDNKLKDRLDAA--------N 272 Q2LAA9 LWLAYMSDNAFLYALDAAYSTTIFDGINWSIEGAYLGNSVDNKLKDRLDAA--------N 273 B5QHE5 LWLAYMSDNAFLYALDATYSTTIFDGINWTIEGAYLGNSVDNKLKDRLDAA--------N 283 Q2LA96 LWLAYMSDNAFLYALDATYSTTIFDGINWTIEGAYLGNSVDNKLKDRLDAA--------N 283 Q2LAB4 LWLAYMSDNAFLYALDAAYSTTIFDGINWTIEGAYLGNSVDNKLKDRLDAA--------N 283 Q2LA97 LWLAYMSDNAFLYALDAAYSTTIFDGINWSIEGAYLGNSVDNKLKDRLGVA--------N 283 Q2LAA7 LWLAYMSDNAFLYALDAAYSTTIFDGINWTIEGAYLGNSVDNKLKDRLDAA--------N 283 Q9F788 LWLAYMSDNAFLYALDAAYSTTIFDGINWTIEGAYLGNSVDNKLKDRLDAA--------N 283 Q2LA87 LWLAYMSDNAFLYALDAAYSTTIFNGINWTIEGAYLGNSVDNKLKDRLDAA--------N 283 Q2LA90 LWLAYMSDNAFLYALDAAYSTTIFDGINWTIEGAYLGNSVDNKLKDRLNVA--------N 283 Q2LAA3 LWLAYMSDNAFLYALDAAYNTTIFDGINWTIEGAYLGNSVDNKLKDRLDAA--------N 284 QOGF62 LWLAYMSDNAFLYALDLAYNTTIFDGINWSIEGAYLGNSVDNKLKDRFHAAGDPESSAAN 282 ***** .: :*:**:* :*.****:****::********:*..*.. . (Lys 278) Hb1 GNLFALKGSIEVNGWDASLGGLYYGDKEKASTVVIEDQGNLGSLLAGEEIFYTTGSRLNG 331 Q2LAB2 GNLFALXGSIEVNGWDASLGGLYYGDKEKASTVVIEDQGNLGSLLAGEEIFYTTGSRLNG 334 Q2LAB0 GNLFALKGSIEVNGWDASLGGLYYGDKEKASTVVIEDQGNLGSLLAGEEIFYTTGSRLNG 331 Hb2 GNLFALXGSIEVNGWDASLGGLYYGDKEKASTVVIEDQGNLGSLLAGEEIFYTTGSRLNG 331 NB1 GNLFALKGSIEVNGWDASLGGLYYGDKEKASTVVIEDQGNLGSLLAGEEIFYTTGSRLNG 331 Q9F791 GNLFALKGSIEVNGWDASLGGLYYGDKEKASTVVIEDQGNLGSLLAGEEIFYTTGSRLNG 331 Hb3 GNLFALXGSIEVNGWDASLGGLYYGDKEKASTVVIEDQGNLGSLLAGEEIFYTTGSRLNG 331 D3FNB0 GNLFALKGSIEVNGWDASLGGLYYGDKEKASTVVIEDQGNLGSLLAGEEIFYTTGSRLNG 331 Q2LAB1 GNLFALKGSIEVNGWDASLGGLYYGDKEKASTVVIEDQGNLGSLLAGEEIFYTTGSRLNG 331 Q2LAB8 GNLFALXGTIEVNGWDASLGGLYYGDKEKASTVVIEDQGNLGSLLAGEEIFYTTGSRLNG 331 Q2LAA5 GNLFALXGSIEVNGWDASLGGLYYGDKEKASTVVIEDQGNLGSLLAGEEIFYTTGSRLNG 331 Q2LAB6 GNLFALKGSIEVNGWDASLGGLYYGDKEKASTVVIEDQGNLGSLLAGEEIFYTTGSRLNG 331 Q2LA95 GNLFALXGSIEVNGWDASLGGLYYGDKEKASTVVIEDQGNLGSLLAGEEIFYTTGSRLNG 332 P80672 (SEQ ID No. 1) GNLFALKGSIEVNGWDASLGGLYYGDKEKASTVVIEDQGNLGSLLAGEEIFYTTGSRLNG 331 Q2LAC5 GNLFALXGTIEVNGWDASLGGLYYGDKEKASTVVIEDQGNLGSLLAGEEIFYTTGSRLNG 331 Q2LAA2 GNLFALKGSIEVNGWDASLGGLYYGDKEKASTVVIEDQGNLGSLLAGEEIFYTTGSRLNG 331 Q2LAB7

GNLFALXGSIEVNGWDASLGGLYYGDKEKASTVVIEDQGNLGSLLAGEEIFYTTGSRLNG 331 Q2LAB9 GNLFALKGSIEVNGWDASLGGLYYGDKEKASTVVIEDQGNLGSLLAGEEIFYTTGSRLNG 331 Q2LA91 GNLFALXGSIEVNGWDASLGGLYYGDKEKASTVVIEDQGNLGSLLAGEEIFYTTGSRLNG 332 NB2 GNLFALKGSIEVNGWDASLGGLYYGDKEKASTVVIEDQGNLGSLLAGEEIFYTTGSRLNG 331 Q2LA98 GNLFALXGSIEVNGWDASLGGLYYGDKEKASTVVIEDQGNLGSLLAGEEIFYTTGSRLNG 332 A3ZHA2 GNLFALKGSIEVNGWDASLGGLYYGDKEKASTVVIEDQGNLGSLLAGEEIFYTTGSRLNG 331 Q9F792 GNLFALKGSIEVNGWDASLGGLYYGDKEKASTVVIEDQGNLGSLLAGEEIFYTTGSRLNG 331 Q2LAC0 GNLFALXGSIEVNGWDASLGGLYYGDKEKASTVVIEDQGNLGSLLAGEEIFYTTGSRLNG 332 Q0GF63 GNFFALKGGIEVNGWDASLGGLYYGDKEKASTVVIEDQGNLSSLLAGEEIFYTTGSRLNG 331 Q2LAB3 GNFFALKGGIEVNGWDASLGGLYYGDKEKASTVIIDDQGNLSSLLAGEEIFYTTGSRLNG 324 Q2LA93 GNLFALXGSIEVNGWDASLGGLYYGDKEKASTVVIEDQGNLGSLLAGEEIFYTTGSRLNG 324 Q2LAA0 GNLFALKGSIEVNGWDASLGGLYYGDKEKASTVAIEDQGNLGSLLAGEEIFYTTGSRLNG 325 Q2LAC1 GNLFALXGSIEVNGWDASLGGLYYGDKEKASTVVIEDQGNLGSLLAGEEIFYTTGSRLNG 325 Q2LAC4 GNLFALKGSIEVNGWDASLGGLYYGDKEKASTVVIEDQGNLGSLLAGEEIFYTTGSRLNG 325 Q2LA94 GNLFALKGSIEVNGWDASLGGLYYGDKEKASTVVIEDQGNLGSLLAGEEIFYTTGSRLNG 325 Q2LA92 GNLFALXGSIEVNGWDASLGGLYYGDKEKASTVVIEDQGNLGSLLAGEEIFYTTGSRLNG 333 Q2LAA4 GNLFALRGSVELNGWDASLGGLYYGDKEKASTVVIEDQGNIGSLLAGEEIFYTTGSRLNG 331 Q2LA89 GNLFALRGSVELNGWDASLGGLYYGDKEKASTVVIEDQGNIGSLLAGEEIFYTTGSRLNG 332 NB3 GNFFALRGTVEVNGWDASLGGLYYGKKDKATVTTIEDQGNIGSLLAGEEIFYTRGSNLNG 332 Q2LAA9 GNFFALRGTVEVNGWDASLGGLYYGKKDKATVTTIEDQGNIGSLLAGEEIFYTRGSNLNG 333 B5QHE5 GNFFALRGTVEVNGWDASLGGLYYGKKDKITVTTIEDQGNLGSLLAGEEIFYTRGSNLNG 343 Q2LA96 GNFFALRGTVEVNGWDASLGGLYYGKKDKITVTTIEDQGNLGSLLAGEEIFYTRGSNLNG 343 Q2LAB4 GNFFALRGTVEVNGWDASLGGLYYGKKDKITVTTIEDQGNLGSLLAGEEIFYTRGSNLNG 343 Q2LA97 GNFFALRGTVEVNGWDASLGGLYYGKKDKVTVTTIEDQGNLGSLLAGEEIFYTRGSNLNG 343 Q2LAA7 GNFFALRGTVEVNGWDASLGGLYYGKKDKVTLTTIEDQGNLGSLLAGEEIFYTNGSNLNG 343 Q9F788 GNFFALRGTVEVNGWDASLGGLYYGKKDKVTLTTIEDQGNLGSLLAGEEIFYTNGSNLNG 343 Q2LA87 GNFFALRGTVEVNGWDASLGGLYYGKKDKVTLTTIEDQGNLGSLLAGEEIFYTNGSNLNG 343 Q2LA90 GNFFALRGTVEVNGWDATLGGLYYGDKDNLTVTTIEDQGNLGSLLAGEEIFYTRGSNLNG 343 Q2LAA3 GNFFALRGTVEVNGWDASLGGLYYGKKDKATVTTIEDQGNLGSLLAGQEIFYTRGSNLNG 344 Q0GF62 GNFFALRGTVEVNGWDASLGGLYYGKKDKFTVTTIEDQGNLGSLLAGEEIFYTHGSRLNG 342 **:***:* :*:*****:*******.*:: : . *:****:.*****:***** **.*** (Arg 352) (Arg 381) Hb1 DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEAAN-HLGGGKKLEAVARVDYKYSPKL 390 Q2LAB2 DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEAAN-HLGGGKKLEAVARVDYKYSPKL 393 Q2LAB0 DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEAAN-HLGGGKKLEAVARVDYKYSPKL 390 Hb2 DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEAAN-HLGGGKKLEAVARVDYKYSPKL 390 NB1 DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEAAN-HLGGGKKLEAVARVDYKYSPKL 390 Q9F791 DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEAAN-HLGGGKKLEAVARVDYKYSPKL 390 Hb3 DTGRNIFGYVTGGYTFNEIVRVGADFVYGGTKTEAAN-HLGGGKKLEAVARVDYKYSPKL 390 D3FNB0 DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEATN-HLGGGKKLEAVARVDYKYSPKL 390 Q2LAB1 DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEATN-HLGGGKKLEAVARVDYKYSPKL 390 Q2LAB8 DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEATN-HLGGGKKLEAVARVDYKYSPKL 390 Q2LAA5 DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEATN-HLGGGKKLEAVARVDYKYSPKL 390 Q2LAB6 DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEATN-HLGGGKKLEAVARVDYKYSPKL 390 Q2LA95 DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEAAN-HLGGGKKLEAVARVDYKYSPKL 391 P80672 (SEQ ID No. 1) DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEAAN-HLGGGKKLEAVARVDYKYSPKL 390 Q2LAC5 DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEAAANHLGGGKKLEAVARVDYKYSPKL 391 Q2LAA2 DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEAAN-HLGGGKKLEAVARVDYKYSPKL 390 Q2LAB7 DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEAAN-HLGGGKKLEAVARVDYKYSPKL 390 Q2LAB9 DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEAAN-HLGGGKKLEAVARVDYKYSPKL 390 Q2LA91 DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEAAN-HLGGGKKLEAVARVDYKYSPKL 391 NB2 DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEDTA-HVGGGKKLEAVARVNYKYSPKL 390 Q2LA98 DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEDTA-HVGGGKKLEAVARVDYKYSPKL 391 A3ZHA2 DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEAAN-HLGGGKKLEAVARVDYKYSPKL 390 Q9F792 DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEAAN-HLGGGKKLEAVARVDYKYSPKL 390 Q2LAC0 DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEAAS-HLGGGKKLEAVARVDYKYSPKL 391 QOGF63 DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEAAS-HLGGGKKLEAVARVDYKYSPKL 390 Q2LAB3 DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEAAN-HLGGGKKLEAVARVDYKYSPKL 383 Q2LA93 DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEAAS-HLGGGKKLEAVARVDYKYSPKL 383 Q2LAA0 DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEAAG-HLGGGKKLEAVARVDYKYSPKL 384 Q2LAC1 DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEAAN-HLGGGKKLEAVARVDYKYSPKL 384 Q2LAC4 DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEAAN-HLGGGKKLEAVARVDYKYSPKL 384 Q2LA94 DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEATT-HLGGGKKLEAVARVDYKYSPKL 384 Q2LA92 DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEAVG-HLGGGKKLEAVARVDYKYSPKL 392 Q2LAA4 DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTETAG-HLGGGKKLEAVARVDYKYSPKL 390 Q2LA89 DTGRNIFGYVTGGYTFNETVRVGADFVYGGTKTEAAN-HLGGGKKLEAVARVDYKYSPKL 391 NB3 DIGRNIFGYVTGGYTFNETVRVGADFVYGGTKTNIIG---GGGKKLEAVARVDYKYSPKL 389 Q2LAA9 DIGRNIFGYVTGGYTFNETVRVGADFVYGGTKTNIIG---QGGKKLEAVARVDYKYSPKL 390 B5QHE5 DLGRNIFGYVTGGYTFNEAVRVGADFVYGGTKTNIIG---QGGKKLEAVARVDYKYSPKL 400 Q2LA96 DLGRNIFGYVTGGYTFNEAVRVGADFVYGGTKTNIIG---QGGKKLEAVARVDYKYSPKL 400 Q2LAB4 DLGRNIFGYVTGGYTFNEAVRVGADFVYGGTKTNIIG---QGGKKLEAVARVDYKYSPKL 400 Q2LA97 DLGRNIFGYVTGGYTFNEAVRVGADFVYGGTKTNIIG---QGGKKLEAVARVDYKYSPKL 400 Q2LAA7 DIGRNIFGYVTAGYTFNETVRVGADFVYGGTKTNIIG---QGGKKLEAVARVDYKYSPKL 400 Q9F788 DIGRNIFGYVTAGYTFNETVRVGADFVYGGTKTNIIG---QGGKKLEAVARVDYKYSPKL 400 Q2LA87 DIGRNIFGYVTAGYTFNETVRVGADFVYGGTKTNIIG---QGGKKLEAVARVDYKYSPKL 400 Q2LA90 DLGRNIFGYVTGGYTFNEAVSVGADFVYGGTKTNIIG---QGGKKLEAVARVDYKYSPKL 400 Q2LAA3 DLGRNIFGYVTAGYTFNEAVAVGADFVYGGTKTGEIG---NGGKKLEAVARVDYKYSPKL 401 QOGF62 DAGRNIFGYVTGGYTFNETVRVGADFVYGGTKTENVG---EGGKKLEAVARVDYKYSPKL 399 * *********.****** ************** ***********:******* (Ser 397) Hb1 NFSAFYSYVNLDQGVNTNESADHSTVRLQALYKF 424 Q2LAB2 NFSAFYSYVNLDQGVNTNESADHSTVRLQALYKF 427 Q2LAB0 NFSAFYSYVNLDQGVNTNESADHSTVRLQALYKF 424 Hb2 NFSAFYSYVNLDQGVNTNESADHSTVRLQALYKF 424 NB1 NFSAFYSYVNLDQGVNTNESADHSTVRLQALYKF 424 Q9F791 NFSAFYSYVNLDQGVNTNESADHSTVRLQALYKF 424 Hb3 NFSAFYSYVNLDQGVNTNESADHXTVRLQALYKF 424 D3FNB0 NFSAFY3YVNLDQGVNTNESADHSTVRLQALYKF 424 Q2LAB1 NFSAFYSYVNLDQGVNTNESADHSTVRLQALYKF 424 Q2LAB8 NFSAFYSYVNLDQGVNTNESADHSTVRLQALYKF 424

Q2LAA5 NFSAFY3YVNLDQGVNTNESADHSTVRLQALYKF 424 Q2LAB6 NFSAFYSYVNLDQGVNTNESADHSTVRLQALYKF 424 Q2LA95 NFSAFYSYVNLDQGVNTNESADHSTVRLQALYKF 425 P80672 (SEQ ID No. 1) NFSAFYSYVNLDQGVNTNESADHSTVRLQALYKF 424 Q2LAC5 NFSAFYSYVNLDQGVNTNESADHSTVRLQALYKF 425 Q2LAA2 NFSAFYSYVNLDQGVNTNESADHSTVRLQALYKF 424 Q2LAB7 NFSAFYSYVNLDQGVNTNESADHSTVRLQALYKF 424 Q2LAB9 NFSAFYSYVNLDQGVNTNESADHSTVRLQALYKF 424 Q2LA91 NFSAFYSYVNLDQGANTNESADHSTVRLQALYKF 425 NB2 NFSAFYSYVNLDQGVNTNESADHSTVRLQALYKF 424 Q2LA98 NFSAFYSYVNLDQGVNTNESADHSTVKLQALYKF 425 A3ZHA2 NFSAFYSYVNLDQGVNTNESADHSTVRLQALYKF 424 Q9F792 NFSAFY3YVNLDQGVNTNESADHSTVRLQALYKF 424 Q2LAC0 NFSAFYSYVNLDQGVNTNESADHSTVRLQALYKF 425 QOGF63 NFSAFYSYVNLDQGVNTNESADHSTVRLQALYKF 424 Q2LAB3 NFSAFYSYVNLDQGVNTNESADHSTVRLQALYKF 417 Q2LA93 NFSAFYSYVNLDQGVNTNESADHSTVRLQALYKF 417 Q2LAA0 NFSAFYSYVNLDQGVNTNESADHSTVRLQALYKF 418 Q2LAC1 NFSAFYSYVNLDQGVNTNESADHSTVRLQALYKF 418 Q2LAC4 NFSAFYSYVNLDQGVNTNESADHSTVRLQALYKF 418 Q2LA94 NFSAFYSYVNLDQGVNTNESADHSTVRLQALYKF 418 Q2LA92 NFSAFYSYVNLDQGVNTNESADHSTVRLQALYKF 426 Q2LAA4 NFSAFYSYVNLDEGVNTKESADHSTVRLQALYKF 424 Q2LA89 NFSAFYSYVNLDEGVNTKESADHSTVRLQALYKF 425 NB3 NFSAFYSYVNVDT---DPESTHHDAVRLQALYKF 420 Q2LAA9 NFSAFYSYVNVDT---DPESTHHDAVRLQALYKF 421 B5QHE5 NFSAFYSYVNVDT---DPESTHHDAVRLQALYKF 431 Q2LA96 NFSAFYSYVNVDT---DPESTHHDAVKLQALYKF 431 Q2LAB4 NFSAFY3YVNVDT---DPESTHHDAVRLQALYKF 431 Q2LA97 NFSAFYSYVNVDT---DPESTHHDAVRLQALYKF 431 Q2LAA7 NFSAFYSYVNVDT---DPESTHHDAVRLQALYKF 431 Q9F788 NFSAFY3YVNVDT---DPESTHHDAVRLQALYKF 431 Q2LA87 NFSAFYSYVNVDT---DPESTHHDAVRLQALYKF 431 Q2LA90 NFSAFYSYVNVDT---DPESTHHDAVRLQALYKF 431 Q2LAA3 NFSAFY3YVNVDT---DPESTHHDAVRLQALYKF 432 QOGF62 NFSAFYSYVNVDR---DPESTHHDAVRLQALYKF 430 **********:* **:.* :*:*******

[0166] The major contributors in the interaction of glycosylated MOMP with Le.sup.b are residues Arg.sup.352,381 and Lys.sup.278, whereas only residues 352 and 278 are involved in the interaction of non-glycosylated MOMP with Le.sup.b; FIG. 5 (paper). Residues Arg.sup.352,381 are conserved in all sequences examined, whilst residue Lys.sup.278 is semi-conserved and is replaced by Arg in some strains. The molecular properties of this amino acid suggests it would be able to mediate BgAg binding through hydrogen bond formation in a similar fashion to residues Arg.sup.352,381.

Sequence CWU 1

1

461424PRTCampylobacter jejuni 1Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Asn Phe Asp 35 40 45Lys Asn Phe Val Asn Asn Ser Asn Leu Asn Asn Ser Lys Gln Asp His 50 55 60Lys Tyr Arg Ala Gln Val Asn Phe Ser Ala Ala Ile Ala Asp Asn Phe65 70 75 80Lys Ala Phe Val Gln Phe Asp Tyr Asn Ala Ala Asp Gly Gly Tyr Gly 85 90 95Ala Asn Gly Ile Lys Asn Asp Gln Lys Gly Leu Phe Val Arg Gln Leu 100 105 110Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly 115 120 125Lys Gln Gln Leu Asn Leu Ile Trp Thr Asp Asn Ala Ile Asp Gly Leu 130 135 140Val Gly Thr Gly Val Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr145 150 155 160Leu Ala Ala Phe Ala Val Asp Ser Phe Met Ala Ala Glu Gln Gly Ala 165 170 175Asp Leu Leu Glu His Ser Asn Ile Ser Thr Thr Ser Asn Gln Ala Pro 180 185 190Phe Lys Val Asp Ser Val Gly Asn Leu Tyr Gly Ala Ala Ala Val Gly 195 200 205Ser Tyr Asp Leu Ala Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala 210 215 220Tyr Trp Asp Gln Val Ala Phe Phe Tyr Ala Val Asp Ala Ala Tyr Ser225 230 235 240Thr Thr Ile Phe Asp Gly Ile Asn Trp Thr Leu Glu Gly Ala Tyr Leu 245 250 255Gly Asn Ser Leu Asp Ser Glu Leu Asp Asp Lys Thr His Ala Asn Gly 260 265 270Asn Leu Phe Ala Leu Lys Gly Ser Ile Glu Val Asn Gly Trp Asp Ala 275 280 285Ser Leu Gly Gly Leu Tyr Tyr Gly Asp Lys Glu Lys Ala Ser Thr Val 290 295 300Val Ile Glu Asp Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu305 310 315 320Ile Phe Tyr Thr Thr Gly Ser Arg Leu Asn Gly Asp Thr Gly Arg Asn 325 330 335Ile Phe Gly Tyr Val Thr Gly Gly Tyr Thr Phe Asn Glu Thr Val Arg 340 345 350Val Gly Ala Asp Phe Val Tyr Gly Gly Thr Lys Thr Glu Ala Ala Asn 355 360 365His Leu Gly Gly Gly Lys Lys Leu Glu Ala Val Ala Arg Val Asp Tyr 370 375 380Lys Tyr Ser Pro Lys Leu Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn385 390 395 400Leu Asp Gln Gly Val Asn Thr Asn Glu Ser Ala Asp His Ser Thr Val 405 410 415Arg Leu Gln Ala Leu Tyr Lys Phe 4202424PRTCampylobacter jejuni 2Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Asn Phe Asp 35 40 45Lys Asn Phe Val Asn Asn Ser Asn Leu Asn Asn Ser Lys Gln Asp His 50 55 60Lys Tyr Arg Ala Gln Val Asn Phe Ser Ala Ala Ile Ala Asp Asn Phe65 70 75 80Lys Ala Phe Val Gln Phe Asp Tyr Asn Ala Ala Asp Gly Gly Tyr Gly 85 90 95Ala Asn Gly Ile Lys Asn Asp Gln Lys Gly Leu Phe Val Arg Gln Leu 100 105 110Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly 115 120 125Lys Gln Gln Leu Asn Leu Ile Trp Thr Asp Asn Ala Ile Asp Gly Leu 130 135 140Val Gly Thr Gly Val Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr145 150 155 160Leu Ala Ala Phe Ala Val Asp Ser Phe Met Ala Ala Glu Gln Gly Ala 165 170 175Asp Leu Leu Gly His Ser Thr Thr Ser Thr Thr Gln Lys Ala Ala Pro 180 185 190Phe Lys Val Asp Ser Val Gly Asn Leu Tyr Gly Ala Ala Ala Val Gly 195 200 205Ser Tyr Asp Leu Ala Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala 210 215 220Tyr Trp Asp Gln Val Ala Phe Phe Tyr Ala Val Asp Ala Ala Tyr Ser225 230 235 240Thr Thr Ile Phe Asp Gly Ile Asn Trp Thr Leu Glu Gly Ala Tyr Leu 245 250 255Gly Asn Ser Leu Asp Ser Glu Leu Asp Asp Lys Thr His Ala Asn Gly 260 265 270Asn Leu Phe Ala Leu Lys Gly Ser Ile Glu Val Asn Gly Trp Asp Ala 275 280 285Ser Leu Gly Gly Leu Tyr Tyr Gly Asp Lys Glu Lys Ala Ser Thr Val 290 295 300Val Ile Glu Asp Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu305 310 315 320Ile Phe Tyr Thr Thr Gly Ser Arg Leu Asn Gly Asp Thr Gly Arg Asn 325 330 335Ile Phe Gly Tyr Val Thr Gly Gly Tyr Thr Phe Asn Glu Thr Val Arg 340 345 350Val Gly Ala Asp Phe Val Tyr Gly Gly Thr Lys Thr Glu Ala Ala Asn 355 360 365His Leu Gly Gly Gly Lys Lys Leu Glu Ala Val Ala Arg Val Asp Tyr 370 375 380Lys Tyr Ser Pro Lys Leu Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn385 390 395 400Leu Asp Gln Gly Val Asn Thr Asn Glu Ser Ala Asp His Ser Thr Val 405 410 415Arg Leu Gln Ala Leu Tyr Lys Phe 4203486PRTCampylobacter jejuni 3Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Asn Phe Asp 35 40 45Lys Asn Phe Val Asn Asn Ser Asn Leu Asn Asn Met Lys Leu Val Lys 50 55 60Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala Phe Ser Ala Ala Asn65 70 75 80Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val Asp Val Ser Gly Val 85 90 95Leu Arg Tyr Arg Tyr Asp Thr Gly Asn Phe Asp Lys Asn Phe Val Asn 100 105 110Asn Ser Asn Leu Asn Asn Ser Lys Gln Asp His Lys Tyr Arg Ala Gln 115 120 125Val Asn Phe Ser Ala Ala Ile Ala Asp Asn Phe Lys Ala Phe Val Gln 130 135 140Phe Asp Tyr Asn Ala Ala Asp Gly Gly Tyr Gly Ala Asn Gly Ile Lys145 150 155 160Asn Asp Gln Lys Gly Leu Phe Val Arg Gln Leu Tyr Leu Thr Tyr Thr 165 170 175Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly Lys Gln Gln Leu Asn 180 185 190Leu Ile Trp Thr Asp Asn Ala Ile Asp Gly Leu Val Gly Thr Gly Val 195 200 205Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr Leu Ala Ala Phe Ala 210 215 220Val Asp Ser Phe Met Ala Ala Glu Gln Gly Ala Asp Leu Leu Gly His225 230 235 240Ser Thr Thr Ser Thr Thr His Thr Thr Gln Lys Ala Ala Pro Phe Lys 245 250 255Val Asp Ser Val Gly Asn Leu Tyr Gly Ala Ala Ala Val Gly Ser Tyr 260 265 270Asp Leu Ala Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala Tyr Trp 275 280 285Asp Gln Val Ala Phe Phe Tyr Ala Val Asp Ala Ala Tyr Ser Thr Thr 290 295 300Ile Phe Asp Gly Ile Asn Trp Thr Leu Glu Gly Ala Tyr Leu Gly Asn305 310 315 320Ser Leu Asp Ser Glu Leu Asp Asp Lys Thr His Ala Asn Gly Asn Leu 325 330 335Phe Ala Leu Lys Gly Ser Ile Glu Val Asn Gly Trp Asp Ala Ser Leu 340 345 350Gly Gly Leu Tyr Tyr Gly Asp Lys Glu Lys Ala Ser Thr Val Val Ile 355 360 365Glu Asp Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu Ile Phe 370 375 380Tyr Thr Thr Gly Ser Arg Leu Asn Gly Asp Thr Gly Arg Asn Ile Phe385 390 395 400Gly Tyr Val Thr Gly Gly Tyr Thr Phe Asn Glu Thr Val Arg Val Gly 405 410 415Ala Asp Phe Val Tyr Gly Gly Thr Lys Thr Glu Ala Ala Asn His Leu 420 425 430Gly Gly Gly Lys Lys Leu Glu Ala Val Ala Arg Val Asp Tyr Lys Tyr 435 440 445Ser Pro Lys Leu Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn Leu Asp 450 455 460Gln Gly Val Asn Thr Asn Glu Ser Ala Asp His Ser Thr Val Arg Leu465 470 475 480Gln Ala Leu Tyr Lys Phe 4854424PRTCampylobacter jejuni 4Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Asn Phe Asp 35 40 45Lys Asn Phe Val Asn Asn Ser Asn Leu Asn Asn Ser Lys Gln Asp His 50 55 60Lys Tyr Arg Ala Gln Val Asn Phe Ser Ala Ala Ile Ala Asp Asn Phe65 70 75 80Lys Ala Phe Val Gln Phe Asp Tyr Asn Ala Ala Asp Gly Gly Tyr Gly 85 90 95Ala Asn Gly Ile Lys Asn Asp Gln Lys Gly Leu Phe Val Arg Gln Leu 100 105 110Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly 115 120 125Lys Gln Gln Leu Asn Leu Ile Trp Thr Asp Asn Ala Ile Asp Gly Leu 130 135 140Val Gly Thr Gly Val Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr145 150 155 160Leu Ala Ala Phe Ala Val Asp Ser Phe Met Ala Ala Glu Gln Gly Ala 165 170 175Asp Leu Leu Gly His Ser Thr Thr Ser Thr Thr Gln Lys Ala Ala Pro 180 185 190Phe Lys Val Asp Ser Val Gly Asn Leu Tyr Gly Ala Ala Ala Val Gly 195 200 205Ser Tyr Asp Leu Ala Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala 210 215 220Tyr Trp Asp Gln Val Ala Phe Phe Tyr Ala Val Asp Ala Ala Tyr Ser225 230 235 240Thr Thr Ile Phe Asp Gly Ile Asn Trp Thr Leu Glu Gly Ala Tyr Leu 245 250 255Gly Asn Ser Leu Asp Ser Glu Leu Asp Asp Lys Thr His Ala Asn Gly 260 265 270Asn Leu Phe Ala Leu Lys Gly Ser Ile Glu Val Asn Gly Trp Asp Ala 275 280 285Ser Leu Gly Gly Leu Tyr Tyr Gly Asp Lys Glu Lys Ala Ser Thr Val 290 295 300Val Ile Glu Asp Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu305 310 315 320Ile Phe Tyr Thr Thr Gly Ser Arg Leu Asn Gly Asp Thr Gly Arg Asn 325 330 335Ile Phe Gly Tyr Val Thr Gly Gly Tyr Thr Phe Asn Glu Thr Val Arg 340 345 350Val Gly Ala Asp Phe Val Tyr Gly Gly Thr Lys Thr Glu Ala Ala Asn 355 360 365His Leu Gly Gly Gly Lys Lys Leu Glu Ala Val Ala Arg Val Asp Tyr 370 375 380Lys Tyr Ser Pro Lys Leu Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn385 390 395 400Leu Asp Gln Gly Val Asn Thr Asn Glu Ser Ala Asp His Ser Thr Val 405 410 415Arg Leu Gln Ala Leu Tyr Lys Phe 4205424PRTCampylobacter jejuni 5Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Ser Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Asn Phe Asp 35 40 45Lys Asn Phe Val Asn Asn Ser Asn Leu Asn Asn Ser Lys Gln Asp His 50 55 60Lys Tyr Arg Ala Gln Val Asn Phe Ser Ala Ala Ile Ala Asp Asn Phe65 70 75 80Lys Ala Phe Val Gln Phe Asp Tyr Asn Ala Ala Asp Gly Gly Tyr Gly 85 90 95Ala Asn Gly Ile Lys Asn Asp Gln Lys Gly Leu Phe Val Arg Gln Leu 100 105 110Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly 115 120 125Lys Gln Gln Leu Asn Thr Ile Trp Thr Asp Asn Gly Val Asp Gly Leu 130 135 140Val Gly Thr Gly Ile Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr145 150 155 160Leu Ala Ala Phe Ala Val Asp Ser Phe Met Ala Glu Glu Gln Gly Ala 165 170 175Asp Leu Leu Gly Gln Ser Thr Ile Ser Thr Thr Gln Asn Ala Ala Pro 180 185 190Phe Lys Val Asp Ser Val Gly Asn Leu Tyr Gly Ala Ala Ala Val Gly 195 200 205Ser Tyr Asp Leu Ala Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala 210 215 220Tyr Trp Asp Gln Val Ala Phe Phe Tyr Ala Val Asp Ala Ala Tyr Ser225 230 235 240Thr Thr Ile Phe Asp Gly Ile Asn Trp Thr Leu Glu Gly Ala Tyr Leu 245 250 255Gly Asn Ser Leu Asp Ser Glu Leu Asp Asp Lys Thr His Ala Asn Gly 260 265 270Asn Leu Phe Ala Leu Lys Gly Ser Ile Glu Val Asn Gly Trp Asp Ala 275 280 285Ser Leu Gly Gly Leu Tyr Tyr Gly Asp Lys Glu Lys Ala Ser Thr Val 290 295 300Val Ile Glu Asp Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu305 310 315 320Ile Phe Tyr Thr Thr Gly Ser Arg Leu Asn Gly Asp Thr Gly Arg Asn 325 330 335Ile Phe Gly Tyr Val Thr Gly Gly Tyr Thr Phe Asn Glu Thr Val Arg 340 345 350Val Gly Ala Asp Phe Val Tyr Gly Gly Thr Lys Thr Glu Ala Ala Asn 355 360 365His Leu Gly Gly Gly Lys Lys Leu Glu Ala Val Ala Arg Val Asp Tyr 370 375 380Lys Tyr Ser Pro Lys Leu Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn385 390 395 400Leu Asp Gln Gly Val Asn Thr Asn Glu Ser Ala Asp His Ser Thr Val 405 410 415Arg Leu Gln Ala Leu Tyr Lys Phe 4206424PRTCampylobacter jejuni 6Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Ser Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Asn Phe Asp 35 40 45Lys Asn Phe Val Asn Asn Ser Asn Leu Asn Asn Ser Lys Gln Asp His 50 55 60Lys Tyr Arg Ala Gln Val Asn Phe Ser Ala Ala Ile Ala Asp Asn Phe65 70 75 80Lys Ala Phe Val Gln Phe Asp Tyr Asn Ala Ala Asp Gly Gly Tyr Gly 85 90 95Ala Asn Gly Ile Lys Asn Asp Gln Lys Gly Leu Phe Val Arg Gln Leu 100 105 110Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly 115 120 125Lys Gln Gln Leu Asn Thr Ile Trp Thr Asp Asn Gly Val Asp Gly Leu 130 135 140Val Gly Thr Gly Ile Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr145 150 155 160Leu Ala Ala Phe Ala Val Asp Ser Phe Met Ala Glu Glu Gln Gly Ala 165 170 175Asp Leu Leu Gly Gln Ser Thr Ile Ser Thr Thr Gln Asn Ala Ala Pro 180 185 190Phe Lys Val Asp Ser Val Gly Asn Leu Tyr Gly Ala Ala Ala Val Gly 195 200 205Ser Tyr Asp Leu Ala Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala 210 215 220Tyr Trp Asp Gln Val Ala Phe Phe Tyr Ala Val Asp Ala Ala Tyr Ser225 230 235 240Thr Thr Ile Phe Asp Gly Ile Asn Trp Thr Leu Glu Gly Ala Tyr Leu 245 250 255Gly Asn Ser Leu Asp Ser Glu Leu Asp Asp Lys Thr His Ala Asn Gly 260 265 270Asn Leu Phe Ala Leu Lys Gly Ser Ile Glu Val

Asn Gly Trp Asp Ala 275 280 285Ser Leu Gly Gly Leu Tyr Tyr Gly Asp Lys Glu Lys Ala Ser Thr Val 290 295 300Val Ile Glu Asp Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu305 310 315 320Ile Phe Tyr Thr Thr Gly Ser Arg Leu Asn Gly Asp Thr Gly Arg Asn 325 330 335Ile Phe Gly Tyr Val Thr Gly Gly Tyr Thr Phe Asn Glu Thr Val Arg 340 345 350Val Gly Ala Asp Phe Val Tyr Gly Gly Thr Lys Thr Glu Ala Ala Asn 355 360 365His Leu Gly Gly Gly Lys Lys Leu Glu Ala Val Ala Arg Val Asp Tyr 370 375 380Lys Tyr Ser Pro Lys Leu Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn385 390 395 400Leu Asp Gln Gly Val Asn Thr Asn Glu Ser Ala Asp His Ser Thr Val 405 410 415Arg Leu Gln Ala Leu Tyr Lys Phe 4207424PRTCampylobacter jejuni 7Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Ser Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Asn Phe Asp 35 40 45Lys Asn Phe Val Asn Asn Ser Asn Leu Asn Asn Ser Lys Gln Asp His 50 55 60Lys Tyr Arg Ala Gln Val Asn Phe Ser Ala Ala Ile Ala Asp Asn Phe65 70 75 80Lys Ala Phe Val Gln Phe Asp Tyr Asn Ala Ala Asp Gly Gly Tyr Gly 85 90 95Ala Asn Gly Ile Lys Asn Asp Gln Lys Gly Leu Phe Val Arg Gln Leu 100 105 110Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly 115 120 125Lys Gln Gln Leu Asn Thr Ile Trp Thr Asp Asn Gly Val Asp Gly Leu 130 135 140Val Gly Thr Gly Ile Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr145 150 155 160Leu Ala Ala Phe Ala Val Asp Ser Phe Met Ala Glu Glu Gln Gly Ala 165 170 175Asp Leu Leu Gly Gln Ser Thr Ile Ser Thr Thr Gln Asn Ala Ala Pro 180 185 190Phe Lys Val Asp Ser Val Gly Asn Leu Tyr Gly Ala Ala Ala Val Gly 195 200 205Ser Tyr Asp Leu Ala Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala 210 215 220Tyr Trp Asp Gln Val Ala Phe Phe Tyr Ala Val Asp Ala Ala Tyr Ser225 230 235 240Thr Thr Ile Phe Asp Gly Ile Asn Trp Thr Leu Glu Gly Ala Tyr Leu 245 250 255Gly Asn Ser Leu Asp Ser Glu Leu Asp Asp Lys Thr His Ala Asn Gly 260 265 270Asn Leu Phe Ala Leu Lys Gly Ser Ile Glu Val Asn Gly Trp Asp Ala 275 280 285Ser Leu Gly Gly Leu Tyr Tyr Gly Asp Lys Glu Lys Ala Ser Thr Val 290 295 300Val Ile Glu Asp Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu305 310 315 320Ile Phe Tyr Thr Thr Gly Ser Arg Leu Asn Gly Asp Thr Gly Arg Asn 325 330 335Ile Phe Gly Tyr Val Thr Gly Gly Tyr Thr Phe Asn Glu Thr Val Arg 340 345 350Val Gly Ala Asp Phe Val Tyr Gly Gly Thr Lys Thr Glu Ala Ala Asn 355 360 365His Leu Gly Gly Gly Lys Lys Leu Glu Ala Val Ala Arg Val Asp Tyr 370 375 380Lys Tyr Ser Pro Lys Leu Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn385 390 395 400Leu Asp Gln Gly Val Asn Thr Asn Glu Ser Ala Asp His Ser Thr Val 405 410 415Arg Leu Gln Ala Leu Tyr Lys Phe 4208424PRTCampylobacter jejuniMISC_FEATURE(414)..(414)Xaa = any amino acid 8Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Ser Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Asn Phe Asp 35 40 45Lys Asn Phe Val Asn Asn Ser Asn Leu Asn Asn Ser Lys Gln Asp His 50 55 60Lys Tyr Arg Ala Gln Val Asn Phe Ser Ala Ala Ile Ala Asp Asn Phe65 70 75 80Lys Ala Phe Val Gln Phe Asp Tyr Asn Ala Ala Asp Gly Gly Tyr Gly 85 90 95Ala Asn Gly Ile Lys Asn Asp Gln Lys Gly Leu Phe Val Arg Gln Leu 100 105 110Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly 115 120 125Lys Gln Gln Leu Asn Thr Ile Trp Thr Asp Asn Gly Val Asp Gly Leu 130 135 140Val Gly Thr Gly Ile Lys Val Ala Asn Asn Ser Ile Asp Gly Leu Thr145 150 155 160Leu Ala Ala Phe Ala Val Asp Ser Phe Met Ala Glu Glu Gln Gly Ala 165 170 175Asp Leu Leu Gly Gln Ser Thr Ile Ser Thr Thr Gln Asn Ala Ala Pro 180 185 190Phe Lys Val Asp Ser Val Gly Asn Leu Tyr Gly Ala Ala Ala Val Gly 195 200 205Ser Tyr Asp Leu Ala Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala 210 215 220Tyr Trp Asp Gln Val Ala Phe Phe Tyr Ala Val Asp Ala Ala Tyr Ser225 230 235 240Thr Thr Ile Phe Asp Gly Ile Asn Trp Thr Leu Glu Gly Ala Tyr Leu 245 250 255Gly Asn Ser Leu Asp Ser Glu Leu Asp Asp Lys Thr His Ala Asn Gly 260 265 270Asn Leu Phe Ala Leu Lys Gly Ser Ile Glu Val Asn Gly Trp Asp Ala 275 280 285Ser Leu Gly Gly Leu Tyr Tyr Gly Asp Lys Glu Lys Ala Ser Thr Val 290 295 300Val Ile Glu Asp Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu305 310 315 320Ile Phe Tyr Thr Thr Gly Ser Arg Leu Asn Gly Asp Thr Gly Arg Asn 325 330 335Ile Phe Gly Tyr Val Thr Gly Gly Tyr Thr Phe Asn Glu Ile Val Arg 340 345 350Val Gly Ala Asp Phe Val Tyr Gly Gly Thr Lys Thr Glu Ala Ala Asn 355 360 365His Leu Gly Gly Gly Lys Lys Leu Glu Ala Val Ala Arg Val Asp Tyr 370 375 380Lys Tyr Ser Pro Lys Leu Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn385 390 395 400Leu Asp Gln Gly Val Asn Thr Asn Glu Ser Ala Asp His Xaa Thr Val 405 410 415Arg Leu Gln Ala Leu Tyr Lys Phe 4209424PRTCampylobacter jejuni 9Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Asn Phe Asp 35 40 45Lys Asn Phe Val Asn Asn Ser Asn Leu Asn Asn Ser Lys Gln Asn His 50 55 60Lys Tyr Arg Ala Gln Val Asn Phe Ser Ala Ala Ile Ala Asp Asn Phe65 70 75 80Lys Ala Phe Ile Gln Phe Asp Tyr Asn Ala Ala Asp Gly Gly Tyr Gly 85 90 95Ala Asn Gly Ile Lys Asn Asp Gln Lys Gly Leu Phe Val Arg Gln Leu 100 105 110Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly 115 120 125Lys Gln Gln Leu Asn Thr Ile Trp Thr Asp Asn Gly Val Asp Gly Leu 130 135 140Val Gly Thr Gly Ile Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr145 150 155 160Leu Ala Ala Phe Ala Val Asp Ser Phe Met Ala Glu Glu Gln Gly Ala 165 170 175Asp Leu Leu Gly Lys Ser Thr Ile Ser Thr Thr Gln Lys Ala Ala Pro 180 185 190Phe Gln Ala Asp Ser Leu Gly Asn Leu Tyr Gly Ala Ala Ala Val Gly 195 200 205Ser Tyr Asp Leu Ala Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala 210 215 220Tyr Trp Asp Gln Val Ala Phe Phe Tyr Ala Val Asp Ala Ala Tyr Ser225 230 235 240Thr Thr Ile Phe Asp Gly Ile Asn Trp Thr Leu Glu Gly Ala Tyr Leu 245 250 255Gly Asn Ser Leu Asp Ser Glu Leu Asn Asp Lys Arg His Ala Asn Gly 260 265 270Asn Leu Phe Ala Leu Lys Gly Ser Ile Glu Val Asn Gly Trp Asp Ala 275 280 285Ser Leu Gly Gly Leu Tyr Tyr Gly Asp Lys Glu Lys Ala Ser Thr Val 290 295 300Val Ile Glu Asp Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu305 310 315 320Ile Phe Tyr Thr Thr Gly Ser Arg Leu Asn Gly Asp Thr Gly Arg Asn 325 330 335Ile Phe Gly Tyr Val Thr Gly Gly Tyr Thr Phe Asn Glu Thr Val Arg 340 345 350Val Gly Ala Asp Phe Val Tyr Gly Gly Thr Lys Thr Glu Ala Thr Asn 355 360 365His Leu Gly Gly Gly Lys Lys Leu Glu Ala Val Ala Arg Val Asp Tyr 370 375 380Lys Tyr Ser Pro Lys Leu Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn385 390 395 400Leu Asp Gln Gly Val Asn Thr Asn Glu Ser Ala Asp His Ser Thr Val 405 410 415Arg Leu Gln Ala Leu Tyr Lys Phe 42010424PRTCampylobacter jejuni 10Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Asn Phe Asp 35 40 45Lys Asn Phe Val Asn Asn Ser Asn Leu Asn Asn Ser Lys Gln Asp His 50 55 60Lys Tyr Arg Ala Gln Val Asn Phe Ser Ala Ala Ile Ala Asp Asn Phe65 70 75 80Lys Ala Phe Val Gln Phe Asp Tyr Asn Ala Ala Asp Gly Gly Tyr Gly 85 90 95Ala Asn Gly Ile Lys Asn Asp Gln Lys Gly Leu Phe Val Arg Gln Leu 100 105 110Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly 115 120 125Lys Gln Gln Leu Asn Thr Ile Trp Thr Asp Asn Gly Val Asp Gly Leu 130 135 140Val Gly Thr Gly Ile Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr145 150 155 160Leu Ala Ala Phe Ala Val Asp Ser Phe Met Ala Glu Glu Gln Gly Ala 165 170 175Asp Leu Leu Gly Gln Ser Thr Ile Ser Thr Thr Gln Lys Ala Ala Pro 180 185 190Phe Gln Ala Asp Ser Leu Gly Asn Leu Tyr Gly Ala Ala Ala Val Gly 195 200 205Ser Tyr Asp Leu Ala Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala 210 215 220Tyr Trp Asp Gln Val Ala Phe Phe Tyr Ala Val Asp Ala Ala Tyr Ser225 230 235 240Thr Thr Ile Phe Asp Gly Ile Asn Trp Thr Leu Glu Gly Ala Tyr Leu 245 250 255Gly Asn Ser Leu Asp Ser Glu Leu Asp Asp Lys Arg His Ala Asn Gly 260 265 270Asn Leu Phe Ala Leu Lys Gly Ser Ile Glu Val Asn Gly Trp Asp Ala 275 280 285Ser Leu Gly Gly Leu Tyr Tyr Gly Asp Lys Glu Lys Ala Ser Thr Val 290 295 300Val Ile Glu Asp Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu305 310 315 320Ile Phe Tyr Thr Thr Gly Ser Arg Leu Asn Gly Asp Thr Gly Arg Asn 325 330 335Ile Phe Gly Tyr Val Thr Gly Gly Tyr Thr Phe Asn Glu Thr Val Arg 340 345 350Val Gly Ala Asp Phe Val Tyr Gly Gly Thr Lys Thr Glu Ala Thr Asn 355 360 365His Leu Gly Gly Gly Lys Lys Leu Glu Ala Val Ala Arg Val Asp Tyr 370 375 380Lys Tyr Ser Pro Lys Leu Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn385 390 395 400Leu Asp Gln Gly Val Asn Thr Asn Glu Ser Ala Asp His Ser Thr Val 405 410 415Arg Leu Gln Ala Leu Tyr Lys Phe 42011423PRTCampylobacter jejuni 11Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Asn Phe Asp 35 40 45Lys Asn Phe Val Asn Asn Ser Asn Leu Asn Asn Ser Lys Gln Asp His 50 55 60Lys Tyr Arg Ala Gln Val Asn Phe Ser Ala Ala Ile Ala Asp Asn Phe65 70 75 80Lys Ala Phe Val Gln Phe Asp Tyr Asn Ala Ala Asp Gly Gly Tyr Gly 85 90 95Ala Asn Gly Ile Lys Asn Asp Gln Lys Gly Leu Phe Val Arg Gln Leu 100 105 110Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly 115 120 125Lys Gln Gln Leu Asn Thr Ile Trp Thr Asp Asn Gly Val Asp Gly Leu 130 135 140Val Gly Thr Gly Ile Lys Trp Asn Asn Ser Ile Asp Gly Leu Thr Leu145 150 155 160Ala Ala Phe Ala Val Asp Ser Phe Met Ala Glu Glu Gln Gly Ala Asp 165 170 175Leu Leu Gly Gln Ser Thr Ile Ser Thr Thr Gln Lys Ala Ala Pro Phe 180 185 190Gln Ala Asp Ser Leu Gly Asn Leu Tyr Gly Ala Ala Ala Val Gly Ser 195 200 205Tyr Asp Leu Ala Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala Tyr 210 215 220Trp Asp Gln Val Ala Phe Phe Tyr Ala Val Asp Ala Ala Tyr Ser Thr225 230 235 240Thr Ile Phe Asp Gly Ile Asn Trp Thr Leu Glu Gly Ala Tyr Leu Gly 245 250 255Asn Ser Leu Asp Ser Glu Leu Asp Asp Lys Thr His Ala Asn Gly Asn 260 265 270Leu Phe Ala Leu Lys Gly Thr Ile Glu Val Asn Gly Trp Asp Ala Ser 275 280 285Leu Gly Gly Leu Tyr Tyr Gly Asp Lys Glu Lys Ala Ser Thr Val Val 290 295 300Ile Glu Asp Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu Ile305 310 315 320Phe Tyr Thr Thr Gly Ser Arg Leu Asn Gly Asp Thr Gly Arg Asn Ile 325 330 335Phe Gly Tyr Val Thr Gly Gly Tyr Thr Phe Asn Glu Thr Val Arg Val 340 345 350Gly Ala Asp Phe Val Tyr Gly Gly Thr Lys Thr Glu Ala Thr Asn His 355 360 365Leu Gly Gly Gly Lys Lys Leu Glu Ala Val Ala Arg Val Asp Tyr Lys 370 375 380Tyr Ser Pro Lys Leu Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn Leu385 390 395 400Asp Gln Gly Val Asn Thr Asn Glu Ser Ala Asp His Ser Thr Val Arg 405 410 415Leu Gln Ala Leu Tyr Lys Phe 42012424PRTCampylobacter jejuni 12Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Asn Phe Asp 35 40 45Lys Asn Phe Val Asn Asn Ser Asn Leu Asn Asn Ser Lys Gln Asp His 50 55 60Lys Tyr Arg Ala Gln Val Asn Phe Ser Ala Ala Ile Ala Asp Asn Phe65 70 75 80Lys Ala Phe Val Gln Phe Asp Tyr Asn Ala Ala Asp Gly Gly Tyr Gly 85 90 95Ala Asn Gly Ile Lys Asn Asp Gln Lys Gly Leu Phe Val Arg Gln Leu 100 105 110Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly 115 120 125Lys Gln Gln Leu Asn Thr Ile Trp Thr Asp Asn Gly Val Asp Gly Leu 130 135 140Val Gly Thr Gly Ile Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr145 150 155 160Leu Ala Ala Phe Ala Val Asp Ser Phe Met Ala Glu Glu Gln Gly Thr 165 170 175Asp Leu Leu Gly Gln Ser Thr Ile Ser Thr Thr Gln Asn Thr Ala Pro 180

185 190Phe Gln Ala Asp Ser Leu Gly Asn Leu Tyr Gly Ala Ala Ala Val Gly 195 200 205Ser Tyr Asp Leu Ala Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala 210 215 220Tyr Trp Asp Gln Val Ala Phe Phe Tyr Ala Val Asp Ala Ala Tyr Ser225 230 235 240Thr Thr Ile Phe Asp Gly Ile Asn Trp Thr Leu Glu Gly Ala Tyr Leu 245 250 255Gly Asn Ser Leu Asp Ser Glu Leu Asp Asp Lys Arg His Ala Asn Gly 260 265 270Asn Leu Phe Ala Leu Lys Gly Ser Ile Glu Val Asn Gly Trp Asp Ala 275 280 285Ser Leu Gly Gly Leu Tyr Tyr Gly Asp Lys Glu Lys Ala Ser Thr Val 290 295 300Val Ile Glu Asp Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu305 310 315 320Ile Phe Tyr Thr Thr Gly Ser Arg Leu Asn Gly Asp Thr Gly Arg Asn 325 330 335Ile Phe Gly Tyr Val Thr Gly Gly Tyr Thr Phe Asn Glu Thr Val Arg 340 345 350Val Gly Ala Asp Phe Val Tyr Gly Gly Thr Lys Thr Glu Ala Thr Asn 355 360 365His Leu Gly Gly Gly Lys Lys Leu Glu Ala Val Ala Arg Val Asp Tyr 370 375 380Lys Tyr Ser Pro Lys Leu Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn385 390 395 400Leu Asp Gln Gly Val Asn Thr Asn Glu Ser Ala Asp His Ser Thr Val 405 410 415Arg Leu Gln Ala Leu Tyr Lys Phe 42013424PRTCampylobacter jejuni 13Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Asn Phe Asp 35 40 45Lys Asn Phe Val Asn Asn Ser Asn Leu Asn Asn Ser Lys Gln Asp His 50 55 60Lys Tyr Arg Ala Gln Val Asn Phe Ser Ala Ala Ile Ala Asp Asn Phe65 70 75 80Lys Ala Phe Val Gln Phe Asp Tyr Asn Ala Ala Asp Gly Gly Tyr Gly 85 90 95Ala Asn Gly Ile Lys Asn Asp Gln Lys Gly Leu Phe Val Arg Gln Leu 100 105 110Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly 115 120 125Lys Gln Gln Leu Asn Thr Ile Trp Thr Asp Asn Gly Val Asp Gly Leu 130 135 140Val Gly Thr Gly Ile Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr145 150 155 160Leu Ala Ala Phe Ala Val Asp Ser Phe Met Ala Glu Glu Gln Gly Thr 165 170 175Asp Leu Leu Gly Gln Ser Thr Ile Ser Thr Thr Gln Asn Thr Ala Leu 180 185 190Phe Gln Ala Asp Ser Leu Gly Asn Leu Tyr Gly Ala Ala Ala Val Gly 195 200 205Ser Tyr Asp Leu Ala Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala 210 215 220Tyr Trp Asp Gln Val Ala Phe Phe Tyr Ala Val Asp Ala Ala Tyr Ser225 230 235 240Thr Thr Ile Phe Asp Gly Ile Asn Trp Thr Leu Glu Gly Ala Tyr Leu 245 250 255Gly Asn Ser Leu Asp Ser Glu Leu Asp Asp Lys Arg His Ala Asn Gly 260 265 270Asn Leu Phe Ala Leu Lys Gly Ser Ile Glu Val Asn Gly Trp Asp Ala 275 280 285Ser Leu Gly Gly Leu Tyr Tyr Gly Asp Lys Glu Lys Ala Ser Thr Val 290 295 300Val Ile Glu Asp Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu305 310 315 320Ile Phe Tyr Thr Thr Gly Ser Arg Leu Asn Gly Asp Thr Gly Arg Asn 325 330 335Ile Phe Gly Tyr Val Thr Gly Gly Tyr Thr Phe Asn Glu Thr Val Arg 340 345 350Val Gly Ala Asp Phe Val Tyr Gly Gly Thr Lys Thr Glu Ala Thr Asn 355 360 365His Leu Gly Gly Gly Lys Lys Leu Glu Ala Val Ala Arg Val Asp Tyr 370 375 380Lys Tyr Ser Pro Lys Leu Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn385 390 395 400Leu Asp Gln Gly Val Asn Thr Asn Glu Ser Ala Asp His Ser Thr Val 405 410 415Arg Leu Gln Ala Leu Tyr Lys Phe 42014425PRTCampylobacter jejuni 14Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Asn Phe Asp 35 40 45Lys Asn Phe Val Asn Asn Ser Asn Leu Asn Asn Ser Lys Gln Asp His 50 55 60Lys Tyr Arg Ala Gln Val Asn Phe Ser Ala Ala Ile Ala Asp Asn Phe65 70 75 80Lys Ala Phe Val Gln Phe Asp Tyr Asn Ala Ala Asp Gly Gly Tyr Gly 85 90 95Ala Asn Gly Ile Lys Asn Asp Gln Lys Gly Leu Phe Val Arg Gln Leu 100 105 110Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly 115 120 125Lys Gln Gln Leu Asn Thr Ile Trp Thr Asp Asn Gly Val Asp Gly Leu 130 135 140Val Gly Thr Gly Ile Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr145 150 155 160Leu Ala Ala Phe Ala Val Asp Ser Phe Met Ala Ala Glu Gln Gly Ala 165 170 175Asp Leu Leu Gly His Ser Asn Thr Ser Thr Ala Thr Pro Asn Gln Val 180 185 190Pro Phe Lys Val Asp Ser Val Gly Asn Leu Tyr Gly Ala Ala Ala Val 195 200 205Gly Ser Tyr Asp Leu Ala Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu 210 215 220Ala Tyr Trp Asp Gln Val Ala Phe Phe Tyr Ala Val Asp Ala Ala Tyr225 230 235 240Ser Thr Thr Ile Phe Asp Gly Ile Asn Trp Thr Leu Glu Gly Ala Tyr 245 250 255Leu Gly Asn Ser Leu Asp Ser Glu Leu Asp Asp Thr Thr His Ala Asn 260 265 270Gly Asn Leu Phe Ala Leu Lys Gly Ser Ile Glu Val Asn Gly Trp Asp 275 280 285Ala Ser Leu Gly Gly Leu Tyr Tyr Gly Asp Lys Glu Lys Ala Ser Thr 290 295 300Val Val Ile Glu Asp Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu305 310 315 320Glu Ile Phe Tyr Thr Thr Gly Ser Arg Leu Asn Gly Asp Thr Gly Arg 325 330 335Asn Ile Phe Gly Tyr Val Thr Gly Gly Tyr Thr Phe Asn Glu Thr Val 340 345 350Arg Val Gly Ala Asp Phe Val Tyr Gly Gly Thr Lys Thr Glu Ala Ala 355 360 365Asn His Leu Gly Gly Gly Lys Lys Leu Glu Ala Val Ala Arg Val Asp 370 375 380Tyr Lys Tyr Ser Pro Lys Leu Asn Phe Ser Ala Phe Tyr Ser Tyr Val385 390 395 400Asn Leu Asp Gln Gly Val Asn Thr Asn Glu Ser Ala Asp His Ser Thr 405 410 415Val Arg Leu Gln Ala Leu Tyr Lys Phe 420 42515425PRTCampylobacter 15Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Asn Phe Asp 35 40 45Lys Asn Phe Val Asn Asn Ser Asn Leu Asn Asn Asn Lys Gln Asp His 50 55 60Lys Tyr Arg Ala Gln Val Asn Phe Ser Ala Ala Ile Ala Asp Asn Phe65 70 75 80Lys Ala Phe Ile Gln Phe Asp Tyr Asn Ala Val Asp Gly Gly Thr Gly 85 90 95Val Asn Asn Val Lys Asn Ala Glu Lys Gly Leu Phe Val Arg Gln Leu 100 105 110Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly 115 120 125Lys Gln Gln Leu Asn Leu Ile Trp Thr Asp Asn Ala Ile Asp Gly Leu 130 135 140Val Gly Thr Gly Val Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr145 150 155 160Leu Ala Ala Phe Ala Ala Asp Ser Phe Met Ala Ala Glu Gln Gly Ala 165 170 175Asp Leu Leu Gly His Ser Asn Ile Ser Thr Thr Ser Lys Gln Ala Pro 180 185 190Phe Lys Val Asp Ser Val Gly Asn Leu Tyr Gly Ala Ala Ala Val Gly 195 200 205Ser Tyr Asp Leu Ala Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala 210 215 220Tyr Trp Asp Gln Val Thr Phe Phe Tyr Ala Val Asp Ala Ala Tyr Ser225 230 235 240Thr Thr Ile Phe Asp Gly Ile Asn Trp Thr Leu Glu Gly Ala Tyr Leu 245 250 255Gly Asn Ser Leu Asp Ser Glu Leu Asp Asp Lys Thr His Ala Asn Gly 260 265 270Asn Leu Phe Ala Leu Lys Gly Thr Ile Glu Val Asn Gly Trp Asp Ala 275 280 285Ser Leu Gly Gly Leu Tyr Tyr Gly Asp Lys Glu Lys Ala Ser Thr Val 290 295 300Val Ile Glu Asp Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu305 310 315 320Ile Phe Tyr Thr Thr Gly Ser Arg Leu Asn Gly Asp Thr Gly Arg Asn 325 330 335Ile Phe Gly Tyr Val Thr Gly Gly Tyr Thr Phe Asn Glu Thr Val Arg 340 345 350Val Gly Ala Asp Phe Val Tyr Gly Gly Thr Lys Thr Glu Ala Ala Ala 355 360 365Asn His Leu Gly Gly Gly Lys Lys Leu Glu Ala Val Ala Arg Val Asp 370 375 380Tyr Lys Tyr Ser Pro Lys Leu Asn Phe Ser Ala Phe Tyr Ser Tyr Val385 390 395 400Asn Leu Asp Gln Gly Val Asn Thr Asn Glu Ser Ala Asp His Ser Thr 405 410 415Val Arg Leu Gln Ala Leu Tyr Lys Phe 420 42516424PRTCampylobacter jejuni 16Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Asn Phe Asp 35 40 45Lys Asn Phe Val Asn Asn Ser Asn Leu Asn Asn Asn Lys Gln Asp His 50 55 60Lys Tyr Arg Ala Gln Val Asn Phe Ser Ala Ala Ile Ala Asp Asn Phe65 70 75 80Lys Ala Phe Ile Gln Phe Asp Tyr Asn Ala Val Asp Gly Gly Thr Gly 85 90 95Val Asp Asn Val Thr Asn Ala Glu Lys Gly Leu Phe Val Arg Gln Leu 100 105 110Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly 115 120 125Lys Gln Gln Leu Asn Leu Ile Trp Thr Asp Asn Ala Ile Asp Gly Leu 130 135 140Val Gly Thr Gly Val Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr145 150 155 160Leu Ala Ala Phe Ala Ala Asp Ser Phe Met Ala Ala Glu Gln Gly Ala 165 170 175Asp Leu Leu Gly His Ser Thr Thr Ser Thr Thr Gln Ala Thr Ala Pro 180 185 190Phe Lys Val Asp Ser Val Gly Asn Leu Tyr Gly Ala Ala Ala Val Gly 195 200 205Ser Tyr Asp Leu Ala Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala 210 215 220Tyr Trp Asp Gln Val Ala Phe Phe Tyr Ala Val Asp Ala Ala Tyr Ser225 230 235 240Thr Thr Ile Phe Asp Gly Ile Asn Trp Thr Leu Glu Gly Ala Tyr Leu 245 250 255Gly Asn Ser Leu Asp Ser Glu Leu Asp Asp Lys Thr His Ala Asn Gly 260 265 270Asn Leu Phe Ala Leu Lys Gly Ser Ile Glu Val Asn Gly Trp Asp Ala 275 280 285Ser Leu Gly Gly Leu Tyr Tyr Gly Asp Lys Glu Lys Ala Ser Thr Val 290 295 300Val Ile Glu Asp Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu305 310 315 320Ile Phe Tyr Thr Thr Gly Ser Arg Leu Asn Gly Asp Thr Gly Arg Asn 325 330 335Ile Phe Gly Tyr Val Thr Gly Gly Tyr Thr Phe Asn Glu Thr Val Arg 340 345 350Val Gly Ala Asp Phe Val Tyr Gly Gly Thr Lys Thr Glu Ala Ala Asn 355 360 365His Leu Gly Gly Gly Lys Lys Leu Glu Ala Val Ala Arg Val Asp Tyr 370 375 380Lys Tyr Ser Pro Lys Leu Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn385 390 395 400Leu Asp Gln Gly Val Asn Thr Asn Glu Ser Ala Asp His Ser Thr Val 405 410 415Arg Leu Gln Ala Leu Tyr Lys Phe 42017424PRTCampylobacter jejuni 17Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Asn Phe Asp 35 40 45Lys Asn Phe Val Asn Asn Ser Asn Leu Asn Asn Asn Lys Gln Asp His 50 55 60Lys Tyr Arg Ala Gln Val Asn Phe Ser Ala Ala Ile Ala Asp Asp Phe65 70 75 80Lys Ala Phe Ile Gln Phe Asp Tyr Asn Ala Val Asp Gly Gly Thr Gly 85 90 95Val Asp Asn Val Thr Asn Ala Glu Lys Gly Leu Phe Val Arg Gln Leu 100 105 110Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly 115 120 125Lys Gln Gln Leu Asn Leu Ile Trp Thr Asp Asn Ala Ile Asp Gly Leu 130 135 140Val Gly Thr Gly Val Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr145 150 155 160Leu Ala Ala Phe Ala Ala Asp Ser Phe Met Ala Ala Glu Gln Gly Ala 165 170 175Asp Leu Leu Gly His Ser Thr Thr Ser Thr Thr Gln Ala Thr Ala Pro 180 185 190Phe Lys Val Asp Ser Val Gly Asn Leu Tyr Gly Ala Ala Ala Val Gly 195 200 205Ser Tyr Asp Leu Ala Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala 210 215 220Tyr Trp Asp Gln Val Ala Phe Phe Tyr Ala Val Asp Ala Ala Tyr Ser225 230 235 240Thr Thr Ile Phe Asp Gly Ile Asn Trp Thr Leu Glu Gly Ala Tyr Leu 245 250 255Gly Asn Ser Leu Asp Ser Glu Leu Asp Asp Lys Thr His Ala Asn Gly 260 265 270Asn Leu Phe Ala Leu Lys Gly Ser Ile Glu Val Asn Gly Trp Asp Ala 275 280 285Ser Leu Gly Gly Leu Tyr Tyr Gly Asp Lys Glu Lys Ala Ser Thr Val 290 295 300Val Ile Glu Asp Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu305 310 315 320Ile Phe Tyr Thr Thr Gly Ser Arg Leu Asn Gly Asp Thr Gly Arg Asn 325 330 335Ile Phe Gly Tyr Val Thr Gly Gly Tyr Thr Phe Asn Glu Thr Val Arg 340 345 350Val Gly Ala Asp Phe Val Tyr Gly Gly Thr Lys Thr Glu Ala Ala Asn 355 360 365His Leu Gly Gly Gly Lys Lys Leu Glu Ala Val Ala Arg Val Asp Tyr 370 375 380Lys Tyr Ser Pro Lys Leu Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn385 390 395 400Leu Asp Gln Gly Val Asn Thr Asn Glu Ser Ala Asp His Ser Thr Val 405 410 415Arg Leu Gln Ala Leu Tyr Lys Phe 42018424PRTCampylobacter jejuni 18Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Asn Phe Asp 35 40 45Lys Asn Phe Val Asn Asn Ser Asn Leu Asn Asn Ser Lys Gln Asp His 50 55 60Lys Tyr Arg Ala Gln Val Asn Phe Ser Ala Ala Ile Ala Asp Asn Phe65 70 75 80Lys Ala Phe Ile Gln Phe Asp Tyr Asn Ala Val Asp Gly Gly Thr Gly 85

90 95Val Asp Asn Val Thr Asn Thr Glu Lys Gly Leu Phe Val Arg Gln Leu 100 105 110Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly 115 120 125Lys Gln Gln Leu Asn Leu Ile Trp Thr Asp Asn Ala Ile Asp Gly Leu 130 135 140Val Gly Thr Gly Val Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr145 150 155 160Leu Ala Ala Phe Ala Ala Asp Ser Phe Met Ala Ala Glu Gln Gly Ala 165 170 175Asp Leu Leu Glu His Ser Thr Ile Ser Thr Thr Gln Asn Ala Ala Pro 180 185 190Phe Lys Val Asp Ser Val Gly Asn Leu Tyr Gly Ala Ala Ala Val Gly 195 200 205Ser Tyr Asp Leu Ala Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala 210 215 220Tyr Trp Asp Gln Val Ala Phe Phe Tyr Ala Val Asp Ala Ala Tyr Ser225 230 235 240Thr Thr Ile Phe Asp Gly Ile Asn Trp Thr Leu Glu Gly Ala Tyr Leu 245 250 255Gly Asn Ser Leu Asp Ser Glu Leu Asp Asp Lys Thr His Ala Asn Gly 260 265 270Asn Leu Phe Ala Leu Lys Gly Ser Ile Glu Val Asn Gly Trp Asp Ala 275 280 285Ser Leu Gly Gly Leu Tyr Tyr Gly Asp Lys Glu Lys Ala Ser Thr Val 290 295 300Val Ile Glu Asp Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu305 310 315 320Ile Phe Tyr Thr Thr Gly Ser Arg Leu Asn Gly Asp Thr Gly Arg Asn 325 330 335Ile Phe Gly Tyr Val Thr Gly Gly Tyr Thr Phe Asn Glu Thr Val Arg 340 345 350Val Gly Ala Asp Phe Val Tyr Gly Gly Thr Lys Thr Glu Ala Ala Asn 355 360 365His Leu Gly Gly Gly Lys Lys Leu Glu Ala Val Ala Arg Val Asp Tyr 370 375 380Lys Tyr Ser Pro Lys Leu Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn385 390 395 400Leu Asp Gln Gly Val Asn Thr Asn Glu Ser Ala Asp His Ser Thr Val 405 410 415Arg Leu Gln Ala Leu Tyr Lys Phe 42019425PRTCampylobacter jejuni 19Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Asn Phe Asp 35 40 45Lys Asn Phe Val Asn Asn Ser Asn Leu Asn Asn Asn Lys Gln Asp His 50 55 60Lys Tyr Arg Ala Gln Val Asn Phe Ser Ala Ala Ile Ala Asp Asn Phe65 70 75 80Lys Ala Phe Ile Gln Phe Asp Tyr Asn Ala Val Asp Gly Gly Thr Gly 85 90 95Val Asp Asn Val Thr Asn Ala Glu Lys Gly Leu Phe Val Arg Gln Leu 100 105 110Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly 115 120 125Lys Gln Gln Leu Asn Leu Ile Trp Thr Asp Asn Ala Ile Asp Gly Leu 130 135 140Val Gly Thr Gly Val Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr145 150 155 160Leu Ala Ala Phe Ala Val Asp Ser Phe Met Ala Ala Glu Gln Gly Ala 165 170 175Asp Leu Leu Gly His Ser Asn Ile Ser Thr Thr Asn Ala Asn Gln Ala 180 185 190Pro Phe Lys Val Asp Ser Val Gly Asn Leu Tyr Gly Ala Ala Ala Val 195 200 205Gly Ser Tyr Asp Leu Ala Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu 210 215 220Ala Tyr Trp Asp Gln Val Ala Phe Phe Tyr Ala Val Asp Ala Ala Tyr225 230 235 240Ser Thr Thr Ile Phe Asp Gly Ile Asn Trp Thr Leu Glu Gly Ala Tyr 245 250 255Leu Gly Asn Ser Leu Asp Ser Glu Leu Asp Asp Lys Thr His Ala Asn 260 265 270Gly Asn Leu Phe Ala Leu Lys Gly Ser Ile Glu Val Asn Gly Trp Asp 275 280 285Ala Ser Leu Gly Gly Leu Tyr Tyr Gly Asp Lys Glu Lys Ala Ser Thr 290 295 300Val Val Ile Glu Asp Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu305 310 315 320Glu Ile Phe Tyr Thr Thr Gly Ser Arg Leu Asn Gly Asp Thr Gly Arg 325 330 335Asn Ile Phe Gly Tyr Val Thr Gly Gly Tyr Thr Phe Asn Glu Thr Val 340 345 350Arg Val Gly Ala Asp Phe Val Tyr Gly Gly Thr Lys Thr Glu Ala Ala 355 360 365Asn His Leu Gly Gly Gly Lys Lys Leu Glu Ala Val Ala Arg Val Asp 370 375 380Tyr Lys Tyr Ser Pro Lys Leu Asn Phe Ser Ala Phe Tyr Ser Tyr Val385 390 395 400Asn Leu Asp Gln Gly Ala Asn Thr Asn Glu Ser Ala Asp His Ser Thr 405 410 415Val Arg Leu Gln Ala Leu Tyr Lys Phe 420 42520424PRTCampylobacter jejuni 20Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Asn Phe Asp 35 40 45Lys Asn Phe Val Asn Asn Ser Asn Leu Asn Asn Asn Lys Gln Asp His 50 55 60Lys Tyr Arg Ala Gln Val Asn Phe Ser Ala Ala Ile Ala Asp Asn Phe65 70 75 80Lys Ala Phe Ile Gln Phe Asp Tyr Asn Ala Val Asp Gly Gly Thr Gly 85 90 95Val Asp Asn Val Thr Asn Ala Glu Lys Gly Leu Phe Val Arg Gln Leu 100 105 110Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly 115 120 125Lys Gln Gln Leu Asn Leu Ile Trp Thr Asp Asn Ala Ile Asp Gly Leu 130 135 140Val Gly Thr Gly Ile Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr145 150 155 160Leu Ala Ala Phe Ala Ala Asp Ser Phe Met Ala Ala Glu Gln Gly Ala 165 170 175Asp Leu Leu Gly His Ser Asn Ile Ser Thr Thr Pro Asn Gln Ala Pro 180 185 190Phe Lys Val Asp Ser Val Gly Asn Leu Tyr Gly Ala Ala Ala Val Gly 195 200 205Ser Tyr Asp Leu Ala Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala 210 215 220Tyr Trp Asp Gln Val Ala Phe Phe Tyr Ala Val Asp Ala Ala Tyr Ser225 230 235 240Thr Thr Ile Phe Asp Gly Ile Asn Trp Thr Leu Glu Gly Ala Tyr Leu 245 250 255Gly Asn Ser Leu Asp Ser Glu Leu Asp Asp Lys Thr His Ala Asn Gly 260 265 270Asn Leu Phe Ala Leu Lys Gly Ser Ile Glu Val Asn Gly Trp Asp Ala 275 280 285Ser Leu Gly Gly Leu Tyr Tyr Gly Asp Lys Glu Lys Ala Ser Thr Val 290 295 300Val Ile Glu Asp Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu305 310 315 320Ile Phe Tyr Thr Thr Gly Ser Arg Leu Asn Gly Asp Thr Gly Arg Asn 325 330 335Ile Phe Gly Tyr Val Thr Gly Gly Tyr Thr Phe Asn Glu Thr Val Arg 340 345 350Val Gly Ala Asp Phe Val Tyr Gly Gly Thr Lys Thr Glu Asp Thr Ala 355 360 365His Val Gly Gly Gly Lys Lys Leu Glu Ala Val Ala Arg Val Asn Tyr 370 375 380Lys Tyr Ser Pro Lys Leu Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn385 390 395 400Leu Asp Gln Gly Val Asn Thr Asn Glu Ser Ala Asp His Ser Thr Val 405 410 415Arg Leu Gln Ala Leu Tyr Lys Phe 42021425PRTCampylobacter jejuni 21Met Lys Leu Val Lys Leu Ile Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Asn Phe Asp 35 40 45Lys Asn Phe Val Asn Asn Ser Asn Leu Asn Asn Asn Lys Gln Asp His 50 55 60Lys Tyr Arg Ala Gln Val Asn Phe Ser Ala Ala Ile Ala Asp Asn Phe65 70 75 80Lys Ala Phe Ile Gln Phe Asp Tyr Asn Ala Val Asp Gly Gly Thr Gly 85 90 95Val Asp Asn Val Thr Asn Ala Glu Lys Gly Leu Phe Val Arg Gln Leu 100 105 110Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly 115 120 125Lys Gln Gln Leu Asn Leu Ile Trp Thr Asp Asn Ala Ile Asp Gly Leu 130 135 140Val Gly Thr Gly Ile Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr145 150 155 160Leu Ala Ala Phe Ala Ala Asp Ser Phe Met Ala Ala Glu Gln Gly Ala 165 170 175Asp Leu Leu Gly His Arg Asn Ile Ser Thr Ile Thr Pro Asn Gln Ala 180 185 190Pro Phe Lys Val Asp Ser Val Gly Asn Leu Tyr Gly Ala Ala Ala Val 195 200 205Gly Ser Tyr Asp Leu Ala Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu 210 215 220Ala Tyr Trp Asp Gln Val Ala Phe Phe Tyr Ala Val Asp Ala Ala Tyr225 230 235 240Ser Thr Thr Ile Phe Asp Gly Ile Asn Trp Thr Leu Glu Gly Ala Tyr 245 250 255Leu Gly Asn Ser Leu Asp Ser Glu Leu Asp Asp Lys Thr His Ala Asn 260 265 270Gly Asn Leu Phe Ala Leu Lys Gly Ser Ile Glu Val Asn Gly Trp Asp 275 280 285Ala Ser Leu Gly Gly Leu Tyr Tyr Gly Asp Lys Glu Lys Ala Ser Thr 290 295 300Val Val Ile Glu Asp Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu305 310 315 320Glu Ile Phe Tyr Thr Thr Gly Ser Arg Leu Asn Gly Asp Thr Gly Arg 325 330 335Asn Ile Phe Gly Tyr Val Thr Gly Gly Tyr Thr Phe Asn Glu Thr Val 340 345 350Arg Val Gly Ala Asp Phe Val Tyr Gly Gly Thr Lys Thr Glu Asp Thr 355 360 365Ala His Val Gly Gly Gly Lys Lys Leu Glu Ala Val Ala Arg Val Asp 370 375 380Tyr Lys Tyr Ser Pro Lys Leu Asn Phe Ser Ala Phe Tyr Ser Tyr Val385 390 395 400Asn Leu Asp Gln Gly Val Asn Thr Asn Glu Ser Ala Asp His Ser Thr 405 410 415Val Lys Leu Gln Ala Leu Tyr Lys Phe 420 42522424PRTCampylobacter jejuni 22Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Asn Phe Asp 35 40 45Lys Asn Phe Val Asn Asn Ser Asn Leu Asn Asn Asn Lys Gln Asp His 50 55 60Lys Tyr Arg Ala Gln Val Asn Phe Gly Ala Ala Ile Ala Asp Asn Phe65 70 75 80Lys Ala Phe Ile Gln Phe Asp Tyr Asn Ala Val Asp Gly Gly Thr Gly 85 90 95Val Asp Asn Val Thr Asn Ala Glu Lys Gly Leu Phe Val Arg Gln Leu 100 105 110Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly 115 120 125Lys Gln Gln Leu Asn Leu Ile Trp Thr Asp Asn Ala Ile Asp Gly Leu 130 135 140Val Gly Thr Gly Val Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr145 150 155 160Leu Ala Ala Phe Ala Ala Asp Ser Phe Met Ala Ala Glu Gln Gly Ala 165 170 175Asp Leu Leu Gly His Ser Asn Ile Ser Thr Thr Ser Asn Gln Val Pro 180 185 190Phe Lys Val Asp Ser Val Gly Asn Leu Tyr Gly Ala Ala Ala Val Gly 195 200 205Ser Tyr Asp Leu Ala Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala 210 215 220Tyr Trp Asp Gln Val Ala Phe Phe Tyr Ala Val Asp Ala Ala Tyr Ser225 230 235 240Thr Thr Ile Phe Asp Gly Ile Asn Trp Thr Leu Glu Gly Ala Tyr Leu 245 250 255Gly Asn Ser Leu Asp Ser Glu Leu Asp Asp Lys Thr His Ala Asn Gly 260 265 270Asn Leu Phe Ala Leu Lys Gly Ser Ile Glu Val Asn Gly Trp Asp Ala 275 280 285Ser Leu Gly Gly Leu Tyr Tyr Gly Asp Lys Glu Lys Ala Ser Thr Val 290 295 300Val Ile Glu Asp Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu305 310 315 320Ile Phe Tyr Thr Thr Gly Ser Arg Leu Asn Gly Asp Thr Gly Arg Asn 325 330 335Ile Phe Gly Tyr Val Thr Gly Gly Tyr Thr Phe Asn Glu Thr Val Arg 340 345 350Val Gly Ala Asp Phe Val Tyr Gly Gly Thr Lys Thr Glu Ala Ala Asn 355 360 365His Leu Gly Gly Gly Lys Lys Leu Glu Ala Val Ala Arg Val Asp Tyr 370 375 380Lys Tyr Ser Pro Lys Leu Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn385 390 395 400Leu Asp Gln Gly Val Asn Thr Asn Glu Ser Ala Asp His Ser Thr Val 405 410 415Arg Leu Gln Ala Leu Tyr Lys Phe 42023424PRTCampylobacter jejuni 23Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Asn Phe Asp 35 40 45Lys Asn Phe Val Asn Asn Ser Asn Leu Asn Asn Asn Lys Gln Asp His 50 55 60Lys Tyr Arg Ala Gln Val Asn Phe Gly Ala Ala Ile Ala Asp Asn Phe65 70 75 80Lys Ala Phe Ile Gln Phe Asp Tyr Asn Ala Val Asp Gly Gly Thr Gly 85 90 95Val Asp Asn Val Thr Asn Ala Glu Lys Gly Leu Phe Val Arg Gln Leu 100 105 110Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly 115 120 125Lys Gln Gln Leu Asn Leu Ile Trp Thr Asp Asn Ala Ile Asp Gly Leu 130 135 140Val Gly Thr Gly Val Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr145 150 155 160Leu Ala Ala Phe Ala Ala Asp Ser Phe Met Ala Ala Glu Gln Gly Ala 165 170 175Asp Leu Leu Gly His Ser Asn Ile Ser Thr Thr Ser Asn Gln Ala Pro 180 185 190Phe Lys Val Asp Ser Val Gly Asn Leu Tyr Gly Ala Ala Ala Val Gly 195 200 205Ser Tyr Asp Leu Ala Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala 210 215 220Tyr Trp Asp Gln Val Ala Phe Phe Tyr Ala Val Asp Ala Ala Tyr Ser225 230 235 240Thr Thr Ile Phe Asp Gly Ile Asn Trp Thr Leu Glu Gly Ala Tyr Leu 245 250 255Gly Asn Ser Leu Asp Ser Glu Leu Asp Asp Gln Ala His Ala Asn Gly 260 265 270Asn Leu Phe Ala Leu Lys Gly Ser Ile Glu Val Asn Gly Trp Asp Ala 275 280 285Ser Leu Gly Gly Leu Tyr Tyr Gly Asp Lys Glu Lys Ala Ser Thr Val 290 295 300Val Ile Glu Asp Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu305 310 315 320Ile Phe Tyr Thr Thr Gly Ser Arg Leu Asn Gly Asp Thr Gly Arg Asn 325 330 335Ile Phe Gly Tyr Val Thr Gly Gly Tyr Thr Phe Asn Glu Thr Val Arg 340 345 350Val Gly Ala Asp Phe Val Tyr Gly Gly Thr Lys Thr Glu Ala Ala Asn 355 360 365His Leu Gly Gly Gly Lys Lys Leu Glu Ala Val Ala Arg Val Asp Tyr 370 375 380Lys Tyr Ser Pro Lys Leu Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn385 390 395 400Leu Asp Gln Gly Val Asn Thr Asn Glu Ser Ala Asp His Ser Thr Val 405 410 415Arg Leu Gln Ala Leu Tyr Lys Phe 42024425PRTCampylobacter jejuni 24Met Lys

Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Asn Phe Asp 35 40 45Lys Asn Phe Val Asn Asn Ser Asn Leu Asn Asn Asn Lys Gln Asp His 50 55 60Lys Tyr Arg Ala Gln Val Asn Phe Gly Ala Ala Ile Ala Asp Asn Phe65 70 75 80Lys Ala Phe Ile Gln Phe Asp Tyr Asn Ala Val Asp Gly Gly Thr Gly 85 90 95Val Gly Asn Val Lys Asn Ala Glu Lys Gly Leu Phe Val Arg Gln Leu 100 105 110Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly 115 120 125Lys Gln Gln Leu Asn Leu Ile Trp Thr Asp Asn Ala Ile Asp Gly Leu 130 135 140Val Gly Thr Gly Val Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr145 150 155 160Leu Ala Ala Phe Ala Ala Asp Ser Phe Met Ala Ala Glu Gln Gly Ala 165 170 175Asp Leu Leu Gly His Ser Asn Thr Ser Thr Ala Thr Pro Asn Gln Ala 180 185 190Pro Phe Lys Val Asp Ser Val Gly Asn Leu Tyr Gly Ala Ala Ala Val 195 200 205Gly Ser Tyr Asp Leu Ala Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu 210 215 220Ala Tyr Trp Asp Gln Val Ala Phe Phe Tyr Ala Val Asp Ala Ala Tyr225 230 235 240Ser Thr Thr Ile Phe Asp Gly Ile Asn Trp Thr Leu Glu Gly Ala Tyr 245 250 255Leu Gly Asn Ser Leu Asp Ser Glu Leu Asp Asp Thr Thr His Ala Asn 260 265 270Gly Asn Leu Phe Ala Leu Lys Gly Ser Ile Glu Val Asn Gly Trp Asp 275 280 285Ala Ser Leu Gly Gly Leu Tyr Tyr Gly Asp Lys Glu Lys Ala Ser Thr 290 295 300Val Val Ile Glu Asp Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu305 310 315 320Glu Ile Phe Tyr Thr Thr Gly Ser Arg Leu Asn Gly Asp Thr Gly Arg 325 330 335Asn Ile Phe Gly Tyr Val Thr Gly Gly Tyr Thr Phe Asn Glu Thr Val 340 345 350Arg Val Gly Ala Asp Phe Val Tyr Gly Gly Thr Lys Thr Glu Ala Ala 355 360 365Ser His Leu Gly Gly Gly Lys Lys Leu Glu Ala Val Ala Arg Val Asp 370 375 380Tyr Lys Tyr Ser Pro Lys Leu Asn Phe Ser Ala Phe Tyr Ser Tyr Val385 390 395 400Asn Leu Asp Gln Gly Val Asn Thr Asn Glu Ser Ala Asp His Ser Thr 405 410 415Val Arg Leu Gln Ala Leu Tyr Lys Phe 420 42525424PRTCampylobacter jejuni 25Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Asn Phe Asp 35 40 45Lys Asn Phe Val Asn Asn Ser Asn Leu Asn Asn Asn Lys Gln Asp His 50 55 60Lys Tyr Arg Ala Gln Val Asn Phe Ser Ala Ala Ile Ala Asp Asn Phe65 70 75 80Lys Ala Phe Ile Gln Phe Asp Tyr Asn Ala Val Asp Gly Gly Thr Gly 85 90 95Val Asp Asn Val Thr Asn Ala Glu Lys Gly Leu Phe Val Arg Gln Leu 100 105 110Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly 115 120 125Lys Gln Gln Leu Asn Phe Ile Trp Thr Asp Asn Ala Ile Asp Gly Leu 130 135 140Val Gly Thr Gly Val Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr145 150 155 160Leu Ala Ala Phe Ala Val Asp Ser Phe Met Ala Ala Glu Gln Gly Ala 165 170 175Glu Leu Leu Gly His Ser Asn Ile Ser Thr Thr Ser Asn Gln Ala Pro 180 185 190Phe Lys Val Asp Ser Val Gly Asn Leu Tyr Gly Ala Ala Ala Val Gly 195 200 205Ser Tyr Asp Leu Ala Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala 210 215 220Tyr Trp Asp Gln Val Ala Phe Phe Tyr Ala Val Asp Ala Ala Tyr Ser225 230 235 240Thr Thr Ile Phe Asp Gly Ile Asn Trp Thr Ile Glu Gly Ala Tyr Leu 245 250 255Gly Asn Ser Ile Asp Ser Glu Leu Asp Asp Thr Thr His Thr Asn Gly 260 265 270Asn Phe Phe Ala Leu Lys Gly Gly Ile Glu Val Asn Gly Trp Asp Ala 275 280 285Ser Leu Gly Gly Leu Tyr Tyr Gly Asp Lys Glu Lys Ala Ser Thr Val 290 295 300Val Ile Glu Asp Gln Gly Asn Leu Ser Ser Leu Leu Ala Gly Glu Glu305 310 315 320Ile Phe Tyr Thr Thr Gly Ser Arg Leu Asn Gly Asp Thr Gly Arg Asn 325 330 335Ile Phe Gly Tyr Val Thr Gly Gly Tyr Thr Phe Asn Glu Thr Val Arg 340 345 350Val Gly Ala Asp Phe Val Tyr Gly Gly Thr Lys Thr Glu Ala Ala Ser 355 360 365His Leu Gly Gly Gly Lys Lys Leu Glu Ala Val Ala Arg Val Asp Tyr 370 375 380Lys Tyr Ser Pro Lys Leu Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn385 390 395 400Leu Asp Gln Gly Val Asn Thr Asn Glu Ser Ala Asp His Ser Thr Val 405 410 415Arg Leu Gln Ala Leu Tyr Lys Phe 42026417PRTCampylobacter jejuni 26Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Asn Phe Asp 35 40 45Lys Asn Phe Val Asn Asn Ser Asn Leu Asn Asn Asn Lys Gln Asp His 50 55 60Lys Tyr Arg Ala Gln Val Asn Phe Ser Ala Ala Ile Ala Asp Asn Phe65 70 75 80Lys Ala Phe Ile Gln Phe Asp Tyr Asn Ala Val Asp Gly Gly Thr Gly 85 90 95Val Asp Asn Ala Thr Asn Ala Glu Lys Gly Leu Phe Val Arg Gln Leu 100 105 110Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly 115 120 125Lys Gln Gln Leu Asn Leu Ile Trp Thr Asp Asn Ala Ile Asp Gly Leu 130 135 140Val Gly Thr Gly Val Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr145 150 155 160Leu Ala Ala Phe Ala Val Asp Ser Phe Met Thr Ala Glu Gln Gly Ala 165 170 175Asp Leu Leu Gly His Asn Gly Ser Gln Phe Asn Pro Asp Ser Ile Gly 180 185 190Asn Leu Tyr Gly Ala Ala Ala Val Gly Ser Tyr Asp Leu Ala Gly Gly 195 200 205Gln Phe Asn Pro Gln Leu Trp Leu Ala Tyr Trp Asp Gln Val Ala Phe 210 215 220Phe Tyr Ala Leu Asp Ala Ser Tyr Ser Thr Thr Ile Phe Asp Gly Ile225 230 235 240Asn Trp Thr Leu Glu Gly Ala Tyr Leu Gly Asn Ser Val Asp Ser Asp 245 250 255Leu Asp Ser Thr Arg Tyr Ala Asn Gly Asn Phe Phe Ala Leu Lys Gly 260 265 270Gly Ile Glu Val Asn Gly Trp Asp Ala Ser Leu Gly Gly Leu Tyr Tyr 275 280 285Gly Asp Lys Glu Lys Ala Ser Thr Val Ile Ile Asp Asp Gln Gly Asn 290 295 300Leu Ser Ser Leu Leu Ala Gly Glu Glu Ile Phe Tyr Thr Thr Gly Ser305 310 315 320Arg Leu Asn Gly Asp Thr Gly Arg Asn Ile Phe Gly Tyr Val Thr Gly 325 330 335Gly Tyr Thr Phe Asn Glu Thr Val Arg Val Gly Ala Asp Phe Val Tyr 340 345 350Gly Gly Thr Lys Thr Glu Ala Ala Asn His Leu Gly Gly Gly Lys Lys 355 360 365Leu Glu Ala Val Ala Arg Val Asp Tyr Lys Tyr Ser Pro Lys Leu Asn 370 375 380Phe Ser Ala Phe Tyr Ser Tyr Val Asn Leu Asp Gln Gly Val Asn Thr385 390 395 400Asn Glu Ser Ala Asp His Ser Thr Val Arg Leu Gln Ala Leu Tyr Lys 405 410 415Phe27417PRTCampylobacter jejuni 27Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Thr Phe Asp 35 40 45Lys Asn Trp Gly Thr Pro Asn Ser Asn Leu Asn Asp Ser Lys Gln Asp 50 55 60His Lys Tyr Arg Ala Gln Val Asn Phe Ser Ala Ala Ile Ala Asp Asn65 70 75 80Phe Lys Ala Phe Ile Gln Phe Asp Tyr Asn Ala Val Asp Gly Gly Thr 85 90 95Gly Val Asp Asn Lys Thr Asn Ala Glu Lys Gly Leu Phe Val Arg Gln 100 105 110Leu Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala 115 120 125Gly Lys Gln Gln Leu Asn Ile Ile Trp Thr Asp Asn Gly Val Asp Gly 130 135 140Leu Val Gly Thr Gly Ile Lys Val Val Asn Asn Ser Ile Asp Gly Leu145 150 155 160Thr Leu Ala Ala Phe Ala Val Asp Ser Phe Met Ala Ala Glu Gln Gly 165 170 175Ser Asp Leu Val Gly Ala Asn Asn Thr Phe Lys Val Asp Ser Ile Gly 180 185 190Asn Leu Tyr Gly Ala Ala Ala Val Gly Ser Tyr Asp Leu Ala Gly Gly 195 200 205Gln Phe Asn Pro Gln Leu Trp Leu Ala Tyr Trp Asp Gln Val Ala Phe 210 215 220Phe Tyr Ala Val Asp Ala Ala Tyr Ser Thr Thr Ile Phe Asp Gly Ile225 230 235 240Asn Trp Thr Leu Glu Gly Ala Tyr Leu Gly Asn Ser Val Asp Ser Asp 245 250 255Leu Asn Ser Ala Glu His Ala Asn Gly Asn Leu Phe Ala Leu Lys Gly 260 265 270Ser Ile Glu Val Asn Gly Trp Asp Ala Ser Leu Gly Gly Leu Tyr Tyr 275 280 285Gly Asp Lys Glu Lys Ala Ser Thr Val Val Ile Glu Asp Gln Gly Asn 290 295 300Leu Gly Ser Leu Leu Ala Gly Glu Glu Ile Phe Tyr Thr Thr Gly Ser305 310 315 320Arg Leu Asn Gly Asp Thr Gly Arg Asn Ile Phe Gly Tyr Val Thr Gly 325 330 335Gly Tyr Thr Phe Asn Glu Thr Val Arg Val Gly Ala Asp Phe Val Tyr 340 345 350Gly Gly Thr Lys Thr Glu Ala Ala Ser His Leu Gly Gly Gly Lys Lys 355 360 365Leu Glu Ala Val Ala Arg Val Asp Tyr Lys Tyr Ser Pro Lys Leu Asn 370 375 380Phe Ser Ala Phe Tyr Ser Tyr Val Asn Leu Asp Gln Gly Val Asn Thr385 390 395 400Asn Glu Ser Ala Asp His Ser Thr Val Arg Leu Gln Ala Leu Tyr Lys 405 410 415Phe28418PRTCampylobacter jejuni 28Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Thr Phe Asp 35 40 45Lys Asn Trp Gly Thr Pro Asn Ser Asn Leu Asn Asp Ser Lys Gln Asp 50 55 60His Lys Tyr Arg Ala Gln Val Asn Phe Ser Ala Ala Ile Ala Asp Asn65 70 75 80Phe Lys Ala Phe Ile Gln Phe Asp Tyr Asn Ala Val Asp Gly Gly Thr 85 90 95Gly Val Asp Asn Lys Thr Asn Ala Glu Lys Gly Leu Phe Val Arg Gln 100 105 110Leu Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala 115 120 125Gly Lys Gln Gln Leu Asn Ile Ile Trp Thr Asp Asn Gly Val Asp Gly 130 135 140Leu Val Gly Thr Gly Ile Lys Val Val Asn Asn Ser Ile Asp Gly Leu145 150 155 160Thr Leu Ala Ala Phe Ala Val Asp Ser Phe Met Ala Ala Glu Gln Gly 165 170 175Ser Asp Leu Val Gly Ala Asn Asn Ser Thr Phe Lys Val Asp Ser Ile 180 185 190Gly Asn Leu Tyr Gly Ala Ala Ala Val Gly Ser Tyr Asp Leu Ala Gly 195 200 205Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala Tyr Trp Asp Gln Val Ala 210 215 220Phe Phe Tyr Ala Leu Asp Val Ser Tyr Ser Thr Thr Ile Phe Asp Gly225 230 235 240Ile Asn Trp Thr Leu Glu Gly Ala Tyr Leu Gly Asn Ser Leu Asp Ser 245 250 255Glu Leu Asn Asp Lys Thr Tyr Ala Asn Gly Asn Leu Phe Ala Leu Lys 260 265 270Gly Ser Ile Glu Val Asn Gly Trp Asp Ala Ser Leu Gly Gly Leu Tyr 275 280 285Tyr Gly Asp Lys Glu Lys Ala Ser Thr Val Ala Ile Glu Asp Gln Gly 290 295 300Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu Ile Phe Tyr Thr Thr Gly305 310 315 320Ser Arg Leu Asn Gly Asp Thr Gly Arg Asn Ile Phe Gly Tyr Val Thr 325 330 335Gly Gly Tyr Thr Phe Asn Glu Thr Val Arg Val Gly Ala Asp Phe Val 340 345 350Tyr Gly Gly Thr Lys Thr Glu Ala Ala Gly His Leu Gly Gly Gly Lys 355 360 365Lys Leu Glu Ala Val Ala Arg Val Asp Tyr Lys Tyr Ser Pro Lys Leu 370 375 380Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn Leu Asp Gln Gly Val Asn385 390 395 400Thr Asn Glu Ser Ala Asp His Ser Thr Val Arg Leu Gln Ala Leu Tyr 405 410 415Lys Phe29418PRTCampylobacter jejuni 29Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Thr Phe Asp 35 40 45Lys Asn Trp Gly Thr Pro Asn Ser Asn Leu Asn Asp Ser Lys Gln Asp 50 55 60His Lys Tyr Arg Ala Gln Val Asn Phe Ser Ala Ala Ile Ala Asp Asn65 70 75 80Phe Lys Ala Phe Val Gln Phe Asp Tyr Asn Ala Val Asp Gly Gly Thr 85 90 95Gly Val Asp Asn Ala Thr Asn Ala Gln Lys Gly Phe Phe Val Arg Gln 100 105 110Leu Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala 115 120 125Gly Lys Gln Gln Leu Asn Ile Ile Trp Thr Asp Asn Gly Ile Asp Gly 130 135 140Leu Val Gly Thr Gly Val Lys Val Val Asn Asn Ser Ile Asp Gly Leu145 150 155 160Thr Leu Ala Ala Phe Ala Val Asp Ser Phe Met Ala Thr Glu Gln Gly 165 170 175Ser Asp Leu Val Gly His Asn Gly Ser Gln Phe Asn Pro Asp Ser Ile 180 185 190Gly Asn Leu Tyr Gly Ala Ala Ala Val Gly Ser Tyr Asp Leu Ala Gly 195 200 205Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala Tyr Trp Asp Gln Val Ala 210 215 220Phe Phe Tyr Ala Leu Asp Ala Ser Tyr Ser Thr Thr Ile Phe Asp Gly225 230 235 240Ile Asn Trp Thr Leu Glu Gly Ala Tyr Leu Gly Asn Ser Val Asp Ser 245 250 255Asp Leu Asp Ser Ala Lys Tyr Ala Asn Gly Asn Leu Phe Ala Leu Lys 260 265 270Gly Ser Ile Glu Val Asn Gly Trp Asp Ala Ser Leu Gly Gly Leu Tyr 275 280 285Tyr Gly Asp Lys Glu Lys Ala Ser Thr Val Val Ile Glu Asp Gln Gly 290 295 300Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu Ile Phe Tyr Thr Thr Gly305 310 315 320Ser Arg Leu Asn Gly Asp Thr Gly Arg Asn Ile Phe Gly Tyr Val Thr 325 330 335Gly Gly Tyr Thr Phe Asn Glu Thr Val Arg Val Gly Ala Asp Phe Val 340 345

350Tyr Gly Gly Thr Lys Thr Glu Ala Ala Asn His Leu Gly Gly Gly Lys 355 360 365Lys Leu Glu Ala Val Ala Arg Val Asp Tyr Lys Tyr Ser Pro Lys Leu 370 375 380Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn Leu Asp Gln Gly Val Asn385 390 395 400Thr Asn Glu Ser Ala Asp His Ser Thr Val Arg Leu Gln Ala Leu Tyr 405 410 415Lys Phe30418PRTCampylobacter jejuni 30Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Thr Phe Asp 35 40 45Lys Asn Trp Gly Thr Pro Asn Ser Asn Leu Asn Asp Ser Lys Gln Asp 50 55 60His Lys Tyr Arg Ala Gln Val Asn Phe Ser Ala Ala Ile Ala Asp Asn65 70 75 80Phe Lys Ala Phe Val Gln Phe Asp Tyr Asn Ala Val Asp Gly Gly Thr 85 90 95Gly Val Asp Asn Ala Thr Asn Ala Gln Lys Gly Phe Phe Val Arg Gln 100 105 110Leu Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala 115 120 125Gly Lys Gln Gln Leu Asn Ile Ile Trp Thr Asp Asn Gly Ile Asp Gly 130 135 140Leu Val Gly Thr Gly Val Lys Val Val Asn Asn Ser Ile Asp Gly Leu145 150 155 160Thr Leu Ala Ala Phe Ala Val Asp Ser Phe Met Ala Thr Glu Gln Gly 165 170 175Ser Asp Leu Val Gly His Asn Gly Ser Gln Phe Asn Pro Asp Ser Ile 180 185 190Gly Asn Leu Tyr Gly Ala Ala Ala Val Gly Ser Tyr Asp Leu Ala Gly 195 200 205Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala Tyr Trp Asp Gln Val Ala 210 215 220Phe Phe Tyr Ala Leu Asp Ala Ser Tyr Ser Thr Thr Ile Phe Asp Gly225 230 235 240Ile Asn Trp Thr Leu Glu Gly Ala Tyr Leu Gly Asn Ser Val Asp Ser 245 250 255Asp Leu Asp Ser Ala Arg Tyr Ala Asn Gly Asn Leu Phe Ala Leu Lys 260 265 270Gly Ser Ile Glu Val Asn Gly Trp Asp Ala Ser Leu Gly Gly Leu Tyr 275 280 285Tyr Gly Asp Lys Glu Lys Ala Ser Thr Val Val Ile Glu Asp Gln Gly 290 295 300Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu Ile Phe Tyr Thr Thr Gly305 310 315 320Ser Arg Leu Asn Gly Asp Thr Gly Arg Asn Ile Phe Gly Tyr Val Thr 325 330 335Gly Gly Tyr Thr Phe Asn Glu Thr Val Arg Val Gly Ala Asp Phe Val 340 345 350Tyr Gly Gly Thr Lys Thr Glu Ala Ala Asn His Leu Gly Gly Gly Lys 355 360 365Lys Leu Glu Ala Val Ala Arg Val Asp Tyr Lys Tyr Ser Pro Lys Leu 370 375 380Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn Leu Asp Gln Gly Val Asn385 390 395 400Thr Asn Glu Ser Ala Asp His Ser Thr Val Arg Leu Gln Ala Leu Tyr 405 410 415Lys Phe31418PRTCampylobacter jejuni 31Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Thr Phe Asp 35 40 45Lys Asn Trp Gly Thr Pro Asn Ser Asn Leu Asn Asp Ser Lys Gln Asp 50 55 60His Lys Tyr Arg Ala Gln Val Asn Phe Ser Ala Ala Ile Ala Asp Asn65 70 75 80Phe Lys Ala Phe Ile Gln Phe Asp Tyr Asn Ala Val Asp Gly Gly Thr 85 90 95Gly Val Asp Asn Ala Thr Asn Ala Glu Lys Gly Leu Phe Val Arg Gln 100 105 110Leu Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala 115 120 125Gly Lys Gln Gln Leu Asn Thr Ile Trp Thr Asp Asn Gly Ile Asp Gly 130 135 140Leu Val Gly Thr Gly Val Lys Val Val Asn Asn Ser Ile Asp Gly Leu145 150 155 160Thr Leu Ala Ala Phe Ala Val Asp Ser Phe Met Ala Thr Glu Gln Gly 165 170 175Ser Asp Leu Val Gly His Asn Gly Ser Lys Phe Ser Pro Asp Ser Ile 180 185 190Gly Asn Leu Tyr Gly Ala Ala Ala Val Gly Ser Tyr Asp Leu Ala Gly 195 200 205Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala Tyr Trp Asp Gln Val Ala 210 215 220Phe Phe Tyr Ala Leu Asp Ala Ser Tyr Ser Thr Thr Ile Phe Asp Gly225 230 235 240Ile Asn Trp Thr Leu Glu Gly Ala Tyr Leu Gly Asn Ser Val Asp Ser 245 250 255Asp Leu Asn Ser Ala Glu Tyr Ala Asn Gly Asn Leu Phe Ala Leu Lys 260 265 270Gly Ser Ile Glu Val Asn Gly Trp Asp Ala Ser Leu Gly Gly Leu Tyr 275 280 285Tyr Gly Asp Lys Glu Lys Ala Ser Thr Val Val Ile Glu Asp Gln Gly 290 295 300Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu Ile Phe Tyr Thr Thr Gly305 310 315 320Ser Arg Leu Asn Gly Asp Thr Gly Arg Asn Ile Phe Gly Tyr Val Thr 325 330 335Gly Gly Tyr Thr Phe Asn Glu Thr Val Arg Val Gly Ala Asp Phe Val 340 345 350Tyr Gly Gly Thr Lys Thr Glu Ala Thr Thr His Leu Gly Gly Gly Lys 355 360 365Lys Leu Glu Ala Val Ala Arg Val Asp Tyr Lys Tyr Ser Pro Lys Leu 370 375 380Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn Leu Asp Gln Gly Val Asn385 390 395 400Thr Asn Glu Ser Ala Asp His Ser Thr Val Arg Leu Gln Ala Leu Tyr 405 410 415Lys Phe32425PRTCampylobacter jejuni 32Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Asn Phe Asp 35 40 45Lys Asn Phe Leu Asn Asn Ser Asn Leu Asn Asn Ser Lys Gln Asp His 50 55 60Lys Tyr Arg Ala Gln Val Asn Phe Ser Ala Ala Ile Ala Asp Asn Phe65 70 75 80Lys Ala Phe Val Gln Phe Asp Tyr Asn Ala Val Asp Gly Gly Thr Gly 85 90 95Val Asp Asn Ala Thr Asn Ala Glu Lys Gly Leu Phe Val Arg Gln Leu 100 105 110Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly 115 120 125Lys Gln Gln Leu Asn Ile Ile Trp Thr Asp Asn Gly Val Asp Gly Leu 130 135 140Val Gly Thr Gly Val Lys Trp Asn Asn Ser Ile Asp Gly Leu Thr Leu145 150 155 160Ala Ala Phe Ala Val Asp Ser Phe Met Ala Thr Glu Gln Gly Ser Asp 165 170 175Leu Leu Gly Gln Ser Thr Tyr Val Ser Asn Asp Lys Asn Asn Asn Asp 180 185 190Ser Phe Lys Leu Asp Ser Ile Gly Asn Leu Tyr Gly Ala Ala Ala Val 195 200 205Gly Ser Tyr Asp Leu Ala Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu 210 215 220Ala Tyr Trp Asp Gln Val Ala Phe Phe Tyr Ala Val Asp Ala Ala Tyr225 230 235 240Ser Thr Thr Ile Phe Asp Gly Ile Asn Trp Thr Leu Glu Gly Ala Tyr 245 250 255Leu Gly Asn Ser Leu Asp Ser Glu Leu Asp Asp Arg Thr Tyr Ala Asn 260 265 270Gly Asn Leu Phe Ala Leu Lys Gly Ser Ile Glu Val Asn Gly Trp Asp 275 280 285Ala Ser Leu Gly Gly Leu Tyr Tyr Gly Asp Lys Glu Lys Ala Ser Thr 290 295 300Val Val Ile Glu Asp Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu305 310 315 320Glu Ile Phe Tyr Thr Thr Gly Ser Arg Leu Asn Gly Asp Thr Gly Arg 325 330 335Asn Ile Phe Gly Tyr Val Thr Gly Gly Tyr Thr Phe Asn Glu Thr Val 340 345 350Arg Val Gly Ala Asp Phe Val Tyr Gly Gly Thr Lys Thr Glu Ala Val 355 360 365Gly His Leu Gly Gly Gly Lys Lys Leu Glu Ala Val Ala Arg Val Asp 370 375 380Tyr Lys Tyr Ser Pro Lys Leu Asn Phe Ser Ala Phe Tyr Ser Tyr Val385 390 395 400Asn Leu Asp Gln Gly Val Asn Thr Asn Glu Ser Ala Asp His Ser Thr 405 410 415Val Arg Leu Gln Ala Leu Tyr Lys Phe 420 42533424PRTCampylobacter jejuni 33Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Asn Phe Asp 35 40 45Lys Asn Phe Ile Asn Asn Ser Asn Leu Asn Asn Ser Lys Gln Asp His 50 55 60Lys Tyr Arg Ala Gln Val Asn Phe Ser Ala Ala Ile Ala Asp Asn Phe65 70 75 80Lys Ala Phe Val Gln Phe Asp Tyr Asn Ala Ala Asp Gly Gly Thr Gly 85 90 95Val Asp Asn Ala Thr Asn Ala Gln Lys Gly Leu Phe Val Arg Gln Leu 100 105 110Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly 115 120 125Lys Gln Gln Leu Asn Thr Ile Trp Thr Asp Asn Gly Ile Asp Gly Leu 130 135 140Val Gly Thr Gly Val Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr145 150 155 160Leu Ala Ala Phe Ala Val Asp Ser Phe Met Ala Glu Glu Gln Gly Ala 165 170 175Asp Leu Leu Gly His Ser Asn Ile Ser Ser Ala Asn Asn Ser Ala Pro 180 185 190Phe Lys Leu Asp Ser Ile Gly Asn Leu Tyr Gly Gly Ala Ala Val Gly 195 200 205Ser Tyr Glu Phe Leu Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala 210 215 220Tyr Trp Asp Gln Val Ala Phe Phe Tyr Ala Val Asp Ala Ala Tyr Ser225 230 235 240Thr Thr Ile Phe Asp Gly Ile Asn Trp Thr Leu Glu Gly Ala Tyr Leu 245 250 255Gly Asn Ser Ile Asp Ser Glu Leu Asp Lys Thr Thr His Thr Asn Gly 260 265 270Asn Leu Phe Ala Leu Arg Gly Ser Val Glu Leu Asn Gly Trp Asp Ala 275 280 285Ser Leu Gly Gly Leu Tyr Tyr Gly Asp Lys Glu Lys Ala Ser Thr Val 290 295 300Val Ile Glu Asp Gln Gly Asn Ile Gly Ser Leu Leu Ala Gly Glu Glu305 310 315 320Ile Phe Tyr Thr Thr Gly Ser Arg Leu Asn Gly Asp Thr Gly Arg Asn 325 330 335Ile Phe Gly Tyr Val Thr Gly Gly Tyr Thr Phe Asn Glu Thr Val Arg 340 345 350Val Gly Ala Asp Phe Val Tyr Gly Gly Thr Lys Thr Glu Thr Ala Gly 355 360 365His Leu Gly Gly Gly Lys Lys Leu Glu Ala Val Ala Arg Val Asp Tyr 370 375 380Lys Tyr Ser Pro Lys Leu Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn385 390 395 400Leu Asp Glu Gly Val Asn Thr Lys Glu Ser Ala Asp His Ser Thr Val 405 410 415Arg Leu Gln Ala Leu Tyr Lys Phe 42034425PRTCampylobacter jejuni 34Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Gly Asn Phe Asp 35 40 45Lys Asn Phe Ile Asn Asn Ser Asn Leu Asn Asn Ser Lys Gln Asp His 50 55 60Lys Tyr Arg Ala Gln Val Asn Phe Ser Ala Ala Ile Ala Asp Asn Phe65 70 75 80Lys Ala Phe Val Gln Phe Asp Tyr Asn Ala Ala Asp Gly Gly Tyr Gly 85 90 95Ala Asn Glu Ile Lys Asn Asp Gln Lys Gly Leu Phe Val Arg Gln Leu 100 105 110Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly 115 120 125Lys Gln Gln Leu Asn Thr Ile Trp Thr Asp Asn Gly Ile Asp Gly Leu 130 135 140Val Gly Thr Gly Val Lys Val Ile Asn Asn Ser Ile Asp Gly Leu Thr145 150 155 160Leu Ala Ala Phe Ala Val Asp Ser Phe Met Ala Ala Glu Gln Gly Ala 165 170 175Asp Leu Leu Gly His Ser Asn Ile Ser Ser Ala Lys Pro Asn Ile Ala 180 185 190Pro Phe Lys Leu Asp Ser Ile Gly Asn Leu Tyr Gly Gly Ala Ala Val 195 200 205Gly Ser Tyr Glu Phe Leu Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu 210 215 220Ala Tyr Trp Asp Gln Val Ala Phe Phe Tyr Ala Val Asp Ala Ala Tyr225 230 235 240Ser Thr Thr Ile Phe Asp Gly Ile Asn Trp Thr Leu Glu Gly Ala Tyr 245 250 255Leu Gly Asn Ser Ile Asp Ser Glu Leu Asp Asp Lys Thr His Thr Asn 260 265 270Gly Asn Leu Phe Ala Leu Arg Gly Ser Val Glu Leu Asn Gly Trp Asp 275 280 285Ala Ser Leu Gly Gly Leu Tyr Tyr Gly Asp Lys Glu Lys Ala Ser Thr 290 295 300Val Val Ile Glu Asp Gln Gly Asn Ile Gly Ser Leu Leu Ala Gly Glu305 310 315 320Glu Ile Phe Tyr Thr Thr Gly Ser Arg Leu Asn Gly Asp Thr Gly Arg 325 330 335Asn Ile Phe Gly Tyr Val Thr Gly Gly Tyr Thr Phe Asn Glu Thr Val 340 345 350Arg Val Gly Ala Asp Phe Val Tyr Gly Gly Thr Lys Thr Glu Ala Ala 355 360 365Asn His Leu Gly Gly Gly Lys Lys Leu Glu Ala Val Ala Arg Val Asp 370 375 380Tyr Lys Tyr Ser Pro Lys Leu Asn Phe Ser Ala Phe Tyr Ser Tyr Val385 390 395 400Asn Leu Asp Glu Gly Val Asn Thr Lys Glu Ser Ala Asp His Ser Thr 405 410 415Val Arg Leu Gln Ala Leu Tyr Lys Phe 420 42535420PRTCampylobacter jejuni 35Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Val 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Glu Thr Ser Asn Asp Trp 35 40 45Ser Asn Ala Asn Phe Gly Ser Gly Ile Ser Gly Lys Gln Asp His Lys 50 55 60Tyr Arg Ala Gln Val Asn Phe Gly Ala Ala Ser Ala Asp Asn Phe Lys65 70 75 80Ala Phe Val Gln Phe Asp Tyr Ser Gln Ala Asp Gly Gly Tyr Gly Ala 85 90 95Asp Ser Ile Ser Asn Thr Ser Asp Thr Leu Ser Val Arg Gln Leu Tyr 100 105 110Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly Lys 115 120 125Gln Gln Leu Asn Thr Ile Trp Thr Asp Asn Gly Ile Asp Gly Leu Val 130 135 140Gly Thr Gly Ile Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr Leu145 150 155 160Ala Ala Phe Ala Met Asp Ser Phe Asn Glu Glu Val Pro Ala Thr Thr 165 170 175Thr Asn Gly Phe Asn Lys Gly Asn Val Asn Gly Asp Gly Asp Val Ser 180 185 190Ser Ala Leu Asp Trp Ser Lys Asn Ile Tyr Gly Ala Ala Ala Ile Gly 195 200 205Ser Tyr Asp Leu Ile Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala 210 215 220Tyr Met Ser Asp Asn Ala Phe Leu Tyr Ala Leu Asp Ala Ala Tyr Ser225 230 235 240Thr Thr Ile Phe Asp Gly Ile Asn Trp Ser Ile Glu Gly Ala Tyr Leu 245 250 255Gly Asn Ser Val Asp Asn Lys Leu Lys Asp Arg Leu Asp Ala Ala Asn

260 265 270Gly Asn Phe Phe Ala Leu Arg Gly Thr Val Glu Val Asn Gly Trp Asp 275 280 285Ala Ser Leu Gly Gly Leu Tyr Tyr Gly Lys Lys Asp Lys Ala Thr Val 290 295 300Thr Thr Ile Glu Asp Gln Gly Asn Ile Gly Ser Leu Leu Ala Gly Glu305 310 315 320Glu Ile Phe Tyr Thr Arg Gly Ser Asn Leu Asn Gly Asp Ile Gly Arg 325 330 335Asn Ile Phe Gly Tyr Val Thr Gly Gly Tyr Thr Phe Asn Glu Thr Val 340 345 350Arg Val Gly Ala Asp Phe Val Tyr Gly Gly Thr Lys Thr Asn Ile Ile 355 360 365Gly Gly Gly Gly Lys Lys Leu Glu Ala Val Ala Arg Val Asp Tyr Lys 370 375 380Tyr Ser Pro Lys Leu Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn Val385 390 395 400Asp Thr Asp Pro Glu Ser Thr His His Asp Ala Val Arg Leu Gln Ala 405 410 415Leu Tyr Lys Phe 42036421PRTCampylobacter jejuni 36Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Ile 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Glu Thr Ser Asn Asp Trp 35 40 45Ser Asn Ala Asn Phe Gly Ser Gly Ile Ser Gly Lys Gln Asp His Lys 50 55 60Tyr Arg Ala Gln Val Asn Phe Ser Gly Ala Ile Ser Asp Asn Phe Lys65 70 75 80Ala Phe Val Gln Phe Asp Tyr Asn Ser Gln Asp Gly Gly Tyr Gly Ala 85 90 95Asp Ser Ile Ser Asn Thr Ser Asp Thr Leu Ser Val Arg Gln Leu Tyr 100 105 110Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly Lys 115 120 125Gln Gln Leu Asn Thr Ile Trp Thr Asp Asn Gly Ile Asp Gly Leu Val 130 135 140Gly Thr Gly Ile Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr Leu145 150 155 160Ala Ala Phe Ala Met Asp Ser Phe Asn Glu Glu Val Pro Ala Thr Thr 165 170 175Thr Asn Gly Asn Phe Asn Lys Gly Asn Val Asn Gly Asp Gly Asp Val 180 185 190Ser Ser Ala Leu Asp Trp Ser Lys Asn Ile Tyr Gly Ala Ala Ala Ile 195 200 205Gly Ser Tyr Asp Ile Ala Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu 210 215 220Ala Tyr Met Ser Asp Asn Ala Phe Leu Tyr Ala Leu Asp Ala Ala Tyr225 230 235 240Ser Thr Thr Ile Phe Asp Gly Ile Asn Trp Ser Ile Glu Gly Ala Tyr 245 250 255Leu Gly Asn Ser Val Asp Asn Lys Leu Lys Asp Arg Leu Asp Ala Ala 260 265 270Asn Gly Asn Phe Phe Ala Leu Arg Gly Thr Val Glu Val Asn Gly Trp 275 280 285Asp Ala Ser Leu Gly Gly Leu Tyr Tyr Gly Lys Lys Asp Lys Ala Thr 290 295 300Val Thr Thr Ile Glu Asp Gln Gly Asn Ile Gly Ser Leu Leu Ala Gly305 310 315 320Glu Glu Ile Phe Tyr Thr Arg Gly Ser Asn Leu Asn Gly Asp Ile Gly 325 330 335Arg Asn Ile Phe Gly Tyr Val Thr Gly Gly Tyr Thr Phe Asn Glu Thr 340 345 350Val Arg Val Gly Ala Asp Phe Val Tyr Gly Gly Thr Lys Thr Asn Ile 355 360 365Ile Gly Gln Gly Gly Lys Lys Leu Glu Ala Val Ala Arg Val Asp Tyr 370 375 380Lys Tyr Ser Pro Lys Leu Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn385 390 395 400Val Asp Thr Asp Pro Glu Ser Thr His His Asp Ala Val Arg Leu Gln 405 410 415Ala Leu Tyr Lys Phe 42037431PRTCampylobacter jejuni 37Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Ser Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Ile 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Glu Ser Ser Asn Pro Trp 35 40 45Ser Asn Ala Asn Phe Gly Ser Gly Ile Ser Gly Lys Gln Asp His Lys 50 55 60Tyr Arg Ala Gln Val Asn Phe Ser Gly Ala Ile Ser Asp Asn Phe Lys65 70 75 80Ala Phe Val Gln Phe Asp Tyr Asn Ser Gln Asp Gly Gly Tyr Gly Ala 85 90 95Asp Ser Ile Ser Asn Thr Ser Asp Thr Leu Ser Val Arg Gln Leu Tyr 100 105 110Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly Lys 115 120 125Gln Gln Leu Asn Thr Ile Trp Thr Asp Asn Ala Ile Asp Gly Leu Val 130 135 140Gly Thr Gly Ile Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr Leu145 150 155 160Ala Ala Phe Ala Met Asp Ser Phe Asn Glu Ala Ser Asp Thr Thr Val 165 170 175Thr Ile Thr Gln Asp Asn Ser Gln Lys Ile Thr Gly Val Gln Phe Asn 180 185 190Arg Gly Asn Pro Lys Gly Asp Ser Asp Val Ser Gly Ala Leu Asp Trp 195 200 205Ser Lys Asn Ile Tyr Gly Ala Ala Ala Ile Gly Ser Tyr Asp Ile Ala 210 215 220Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala Tyr Met Ser Asp Asn225 230 235 240Ala Phe Leu Tyr Ala Leu Asp Ala Thr Tyr Ser Thr Thr Ile Phe Asp 245 250 255Gly Ile Asn Trp Thr Ile Glu Gly Ala Tyr Leu Gly Asn Ser Val Asp 260 265 270Asn Lys Leu Lys Asp Arg Leu Asp Ala Ala Asn Gly Asn Phe Phe Ala 275 280 285Leu Arg Gly Thr Val Glu Val Asn Gly Trp Asp Ala Ser Leu Gly Gly 290 295 300Leu Tyr Tyr Gly Lys Lys Asp Lys Ile Thr Val Thr Thr Ile Glu Asp305 310 315 320Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu Ile Phe Tyr Thr 325 330 335Arg Gly Ser Asn Leu Asn Gly Asp Leu Gly Arg Asn Ile Phe Gly Tyr 340 345 350Val Thr Gly Gly Tyr Thr Phe Asn Glu Ala Val Arg Val Gly Ala Asp 355 360 365Phe Val Tyr Gly Gly Thr Lys Thr Asn Ile Ile Gly Gln Gly Gly Lys 370 375 380Lys Leu Glu Ala Val Ala Arg Val Asp Tyr Lys Tyr Ser Pro Lys Leu385 390 395 400Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn Val Asp Thr Asp Pro Glu 405 410 415Ser Thr His His Asp Ala Val Arg Leu Gln Ala Leu Tyr Lys Phe 420 425 43038430PRTCampylobacter jejuni 38Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Ser Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Ile 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Glu Ser Ser Asn Pro Trp 35 40 45Ser Asn Ala Asn Phe Gly Ser Gly Ile Ser Gly Lys Gln Asp His Lys 50 55 60Tyr Arg Ala Gln Val Asn Phe Ser Gly Ala Ile Ser Asp Asn Phe Lys65 70 75 80Ala Phe Val Gln Phe Asp Tyr Asn Ser Gln Asp Gly Gly Tyr Gly Ala 85 90 95Asp Ser Ile Ser Asn Thr Ser Asp Thr Leu Ser Val Arg Gln Leu Tyr 100 105 110Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly Lys 115 120 125Gln Gln Leu Asn Thr Ile Trp Thr Asp Asn Ala Ile Asp Gly Leu Val 130 135 140Gly Thr Gly Ile Lys Trp Asn Asn Ser Ile Asp Gly Leu Thr Leu Ala145 150 155 160Ala Phe Ala Met Asp Ser Phe Asn Glu Ala Ser Asp Thr Thr Val Thr 165 170 175Ile Thr Gln Asp Asn Ser Gln Lys Ile Thr Gly Val Gln Phe Asn Arg 180 185 190Gly Asn Pro Lys Gly Asp Ser Asp Val Ser Gly Ala Leu Asp Trp Ser 195 200 205Lys Asn Ile Tyr Gly Ala Thr Ala Ile Gly Ser Tyr Asp Ile Ala Gly 210 215 220Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala Tyr Met Ser Asp Asn Ala225 230 235 240Phe Leu Tyr Ala Leu Asp Ala Thr Tyr Ser Thr Thr Ile Phe Asp Gly 245 250 255Ile Asn Trp Thr Ile Glu Gly Ala Tyr Leu Gly Asn Ser Val Asp Asn 260 265 270Lys Leu Lys Asp Arg Leu Asp Ala Ala Asn Gly Asn Phe Phe Ala Leu 275 280 285Arg Gly Thr Val Glu Val Asn Gly Trp Asp Ala Ser Leu Gly Gly Leu 290 295 300Tyr Tyr Gly Lys Lys Asp Lys Ile Thr Val Thr Thr Ile Glu Asp Gln305 310 315 320Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu Ile Phe Tyr Thr Arg 325 330 335Gly Ser Asn Leu Asn Gly Asp Leu Gly Arg Asn Ile Phe Gly Tyr Val 340 345 350Thr Gly Gly Tyr Thr Phe Asn Glu Ala Val Arg Val Gly Ala Asp Phe 355 360 365Val Tyr Gly Gly Thr Lys Thr Asn Ile Ile Gly Gln Gly Gly Lys Lys 370 375 380Leu Glu Ala Val Ala Arg Val Asp Tyr Lys Tyr Ser Pro Lys Leu Asn385 390 395 400Phe Ser Ala Phe Tyr Ser Tyr Val Asn Val Asp Thr Asp Pro Glu Ser 405 410 415Thr His His Asp Ala Val Lys Leu Gln Ala Leu Tyr Lys Phe 420 425 43039431PRTCampylobacter jejuni 39Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Ser Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Ile 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Glu Ser Ser Asn Pro Trp 35 40 45Ser Asn Ala Asn Phe Gly Ser Gly Ile Ser Gly Lys Gln Asp His Lys 50 55 60Tyr Arg Ala Gln Val Asn Phe Ser Gly Ala Ile Ser Asp Asn Phe Lys65 70 75 80Ala Phe Val Gln Phe Asp Tyr Asn Ser Gln Asp Gly Gly Tyr Gly Thr 85 90 95Asp Ser Ile Ser Asn Thr Ser Asp Thr Leu Thr Val Arg Gln Leu Tyr 100 105 110Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly Lys 115 120 125Gln Gln Leu Asn Thr Ile Trp Thr Asp Asn Gly Ile Asp Gly Leu Val 130 135 140Gly Thr Gly Val Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr Leu145 150 155 160Ala Ala Phe Ala Met Asp Ser Phe Asn Glu Ala Ser Asp Thr Thr Val 165 170 175Thr Ile Thr Gln Asp Ser Asn Gln Lys Ile Thr Gly Val Gln Phe Asn 180 185 190Arg Gly Asn Pro Lys Gly Asp Ser Asp Val Ser Gly Ala Leu Asp Trp 195 200 205Ser Lys Asn Ile Tyr Gly Ala Ala Ala Ile Gly Ser Tyr Asp Ile Ala 210 215 220Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala Tyr Met Ser Asp Asn225 230 235 240Ala Phe Leu Tyr Ala Leu Asp Ala Ala Tyr Ser Thr Thr Ile Phe Asp 245 250 255Gly Ile Asn Trp Thr Ile Glu Gly Ala Tyr Leu Gly Asn Ser Val Asp 260 265 270Asn Lys Leu Lys Asp Arg Leu Asp Ala Ala Asn Gly Asn Phe Phe Ala 275 280 285Leu Arg Gly Thr Val Glu Val Asn Gly Trp Asp Ala Ser Leu Gly Gly 290 295 300Leu Tyr Tyr Gly Lys Lys Asp Lys Ile Thr Val Thr Thr Ile Glu Asp305 310 315 320Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu Ile Phe Tyr Thr 325 330 335Arg Gly Ser Asn Leu Asn Gly Asp Leu Gly Arg Asn Ile Phe Gly Tyr 340 345 350Val Thr Gly Gly Tyr Thr Phe Asn Glu Ala Val Arg Val Gly Ala Asp 355 360 365Phe Val Tyr Gly Gly Thr Lys Thr Asn Ile Ile Gly Gln Gly Gly Lys 370 375 380Lys Leu Glu Ala Val Ala Arg Val Asp Tyr Lys Tyr Ser Pro Lys Leu385 390 395 400Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn Val Asp Thr Asp Pro Glu 405 410 415Ser Thr His His Asp Ala Val Arg Leu Gln Ala Leu Tyr Lys Phe 420 425 43040431PRTCampylobacter jejuni 40Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Ser Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Ile 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Glu Ser Ser Asn Pro Trp 35 40 45Ser Asn Ala Asn Phe Gly Ser Gly Ile Ser Gly Lys Gln Asp His Lys 50 55 60Tyr Arg Ala Gln Val Asn Phe Ser Gly Ala Ile Ser Asp Asn Phe Lys65 70 75 80Ala Phe Val Gln Phe Asp Tyr Asn Ser Gln Asp Gly Gly Tyr Gly Thr 85 90 95Asp Ser Ile Ser Asn Thr Ser Asp Thr Leu Thr Val Arg Gln Leu Tyr 100 105 110Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly Lys 115 120 125Gln Gln Leu Asn Thr Ile Trp Thr Asp Asn Gly Val Asp Gly Leu Val 130 135 140Gly Thr Gly Ile Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr Leu145 150 155 160Ala Ala Phe Ala Met Asp Ser Phe Asn Glu Ala Ser Asp Thr Thr Val 165 170 175Thr Ile Thr Gln Asn Ser Ser Gln Lys Ile Thr Gly Val Gln Phe Asn 180 185 190Arg Gly Asn Pro Lys Gly Asp Gly Asp Val Ser Gly Ala Leu Asp Trp 195 200 205Ser Lys Asn Ile Tyr Gly Ala Ala Ala Ile Gly Ser Tyr Asp Ile Thr 210 215 220Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala Tyr Met Ser Asp Asn225 230 235 240Ala Phe Leu Tyr Ala Leu Asp Ala Ala Tyr Ser Thr Thr Ile Phe Asp 245 250 255Gly Ile Asn Trp Ser Ile Glu Gly Ala Tyr Leu Gly Asn Ser Val Asp 260 265 270Asn Lys Leu Lys Asp Arg Leu Gly Val Ala Asn Gly Asn Phe Phe Ala 275 280 285Leu Arg Gly Thr Val Glu Val Asn Gly Trp Asp Ala Ser Leu Gly Gly 290 295 300Leu Tyr Tyr Gly Lys Lys Asp Lys Val Thr Val Thr Thr Ile Glu Asp305 310 315 320Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu Ile Phe Tyr Thr 325 330 335Arg Gly Ser Asn Leu Asn Gly Asp Leu Gly Arg Asn Ile Phe Gly Tyr 340 345 350Val Thr Gly Gly Tyr Thr Phe Asn Glu Ala Val Arg Val Gly Ala Asp 355 360 365Phe Val Tyr Gly Gly Thr Lys Thr Asn Ile Ile Gly Gln Gly Gly Lys 370 375 380Lys Leu Glu Ala Val Ala Arg Val Asp Tyr Lys Tyr Ser Pro Lys Leu385 390 395 400Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn Val Asp Thr Asp Pro Glu 405 410 415Ser Thr His His Asp Ala Val Arg Leu Gln Ala Leu Tyr Lys Phe 420 425 43041431PRTCampylobacter jejuni 41Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Ile 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Glu Ser Ser Asn Pro Trp 35 40 45Ser Asn Ala Asn Phe Gly Ser Gly Ile Ser Gly Lys Gln Asp His Lys 50 55 60Tyr Arg Ala Gln Val Asn Phe Ser Gly Ala Ile Ser Asp Asn Phe Lys65 70 75 80Ala Phe Val Gln Phe Asp Tyr Asn Ser Gln Asp Gly Gly Tyr Gly Thr 85 90 95Asp Ser Ile Ser Asn Thr Ser Asp Thr Leu Thr Val Arg Gln Leu Tyr 100 105 110Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly Lys 115 120 125Gln Gln Leu Asn Thr Ile Trp Thr Asp Asn Gly Ile Asp Gly Leu Val 130 135 140Gly Thr Gly Val Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr

Leu145 150 155 160Ala Ala Phe Ala Met Asp Ser Phe Asn Glu Ala Ser Asp Thr Thr Val 165 170 175Thr Ile Thr Gln Asp Asn Asn Gln Lys Ile Thr Gly Val Gln Phe Asn 180 185 190Arg Gly Asn Pro Lys Gly Asp Ser Asp Val Ser Gly Ala Leu Asp Trp 195 200 205Ser Lys Asn Ile Tyr Gly Ala Ala Ala Ile Gly Ser Tyr Asp Ile Ala 210 215 220Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala Tyr Met Ser Asp Asn225 230 235 240Ala Phe Leu Tyr Ala Leu Asp Ala Ala Tyr Ser Thr Thr Ile Phe Asp 245 250 255Gly Ile Asn Trp Thr Ile Glu Gly Ala Tyr Leu Gly Asn Ser Val Asp 260 265 270Asn Lys Leu Lys Asp Arg Leu Asp Ala Ala Asn Gly Asn Phe Phe Ala 275 280 285Leu Arg Gly Thr Val Glu Val Asn Gly Trp Asp Ala Ser Leu Gly Gly 290 295 300Leu Tyr Tyr Gly Lys Lys Asp Lys Val Thr Leu Thr Thr Ile Glu Asp305 310 315 320Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu Ile Phe Tyr Thr 325 330 335Asn Gly Ser Asn Leu Asn Gly Asp Ile Gly Arg Asn Ile Phe Gly Tyr 340 345 350Val Thr Ala Gly Tyr Thr Phe Asn Glu Thr Val Arg Val Gly Ala Asp 355 360 365Phe Val Tyr Gly Gly Thr Lys Thr Asn Ile Ile Gly Gln Gly Gly Lys 370 375 380Lys Leu Glu Ala Val Ala Arg Val Asp Tyr Lys Tyr Ser Pro Lys Leu385 390 395 400Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn Val Asp Thr Asp Pro Glu 405 410 415Ser Thr His His Asp Ala Val Arg Leu Gln Ala Leu Tyr Lys Phe 420 425 43042431PRTCampylobacter jejuni 42Met Lys Leu Val Lys Ile Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Ile 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Glu Ser Ser Asn Pro Trp 35 40 45Ser Asn Ala Asn Phe Gly Ser Gly Ile Ser Gly Lys Gln Asp His Lys 50 55 60Tyr Arg Ala Gln Val Asn Phe Ser Gly Ala Ile Ser Asp Asn Phe Lys65 70 75 80Ala Phe Val Gln Phe Asp Tyr Asn Ser Gln Asp Gly Gly Tyr Gly Thr 85 90 95Asp Ser Ile Ser Asn Thr Ser Asp Thr Leu Thr Val Arg Gln Leu Tyr 100 105 110Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly Lys 115 120 125Gln Gln Leu Asn Thr Ile Trp Thr Asp Asn Gly Ile Asp Gly Leu Val 130 135 140Gly Thr Gly Val Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr Leu145 150 155 160Ala Ala Phe Ala Met Asp Ser Phe Asn Glu Ala Ser Asp Thr Thr Val 165 170 175Thr Ile Thr Gln Asp Asn Asn Gln Lys Ile Thr Gly Val Gln Phe Asn 180 185 190Arg Gly Asn Pro Lys Gly Asp Ser Asp Val Ser Gly Ala Leu Asp Trp 195 200 205Ser Lys Asn Ile Tyr Gly Ala Ala Ala Ile Gly Ser Tyr Asp Ile Ala 210 215 220Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala Tyr Met Ser Asp Asn225 230 235 240Ala Phe Leu Tyr Ala Leu Asp Ala Ala Tyr Ser Thr Thr Ile Phe Asp 245 250 255Gly Ile Asn Trp Thr Ile Glu Gly Ala Tyr Leu Gly Asn Ser Val Asp 260 265 270Asn Lys Leu Lys Asp Arg Leu Asp Ala Ala Asn Gly Asn Phe Phe Ala 275 280 285Leu Arg Gly Thr Val Glu Val Asn Gly Trp Asp Ala Ser Leu Gly Gly 290 295 300Leu Tyr Tyr Gly Lys Lys Asp Lys Val Thr Leu Thr Thr Ile Glu Asp305 310 315 320Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu Ile Phe Tyr Thr 325 330 335Asn Gly Ser Asn Leu Asn Gly Asp Ile Gly Arg Asn Ile Phe Gly Tyr 340 345 350Val Thr Ala Gly Tyr Thr Phe Asn Glu Thr Val Arg Val Gly Ala Asp 355 360 365Phe Val Tyr Gly Gly Thr Lys Thr Asn Ile Ile Gly Gln Gly Gly Lys 370 375 380Lys Leu Glu Ala Val Ala Arg Val Asp Tyr Lys Tyr Ser Pro Lys Leu385 390 395 400Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn Val Asp Thr Asp Pro Glu 405 410 415Ser Thr His His Asp Ala Val Arg Leu Gln Ala Leu Tyr Lys Phe 420 425 43043431PRTCampylobacter jejuni 43Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Ile 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Glu Ser Ser Asn Pro Trp 35 40 45Ser Asn Ala Asn Phe Gly Ser Gly Ile Ser Gly Lys Gln Asp His Lys 50 55 60Tyr Arg Ala Gln Val Asn Phe Ser Gly Ala Ile Ser Asp Asn Phe Lys65 70 75 80Ala Phe Val Gln Phe Asp Tyr Asn Ser Gln Asp Gly Gly Tyr Gly Thr 85 90 95Asp Ser Ile Ser Asn Thr Ser Asp Thr Leu Thr Val Arg Gln Leu Tyr 100 105 110Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly Lys 115 120 125Gln Gln Leu Asn Thr Ile Trp Thr Asp Asn Ala Ile Asp Gly Leu Val 130 135 140Gly Thr Gly Val Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr Leu145 150 155 160Ala Ala Phe Ala Met Asp Ser Phe Asn Glu Ala Ser Asp Thr Thr Val 165 170 175Thr Ile Thr Gln Asp Asn Asn Gln Lys Ile Thr Gly Val Gln Phe Asn 180 185 190Arg Gly Asn Pro Lys Gly Asp Ser Asp Val Ser Gly Ala Leu Asp Trp 195 200 205Ser Lys Asn Ile Tyr Gly Ala Ala Ala Ile Gly Ser Tyr Asp Ile Ala 210 215 220Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala Tyr Met Ser Asp Asn225 230 235 240Ala Phe Leu Tyr Ala Leu Asp Ala Ala Tyr Ser Thr Thr Ile Phe Asn 245 250 255Gly Ile Asn Trp Thr Ile Glu Gly Ala Tyr Leu Gly Asn Ser Val Asp 260 265 270Asn Lys Leu Lys Asp Arg Leu Asp Ala Ala Asn Gly Asn Phe Phe Ala 275 280 285Leu Arg Gly Thr Val Glu Val Asn Gly Trp Asp Ala Ser Leu Gly Gly 290 295 300Leu Tyr Tyr Gly Lys Lys Asp Lys Val Thr Leu Thr Thr Ile Glu Asp305 310 315 320Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu Ile Phe Tyr Thr 325 330 335Asn Gly Ser Asn Leu Asn Gly Asp Ile Gly Arg Asn Ile Phe Gly Tyr 340 345 350Val Thr Ala Gly Tyr Thr Phe Asn Glu Thr Val Arg Val Gly Ala Asp 355 360 365Phe Val Tyr Gly Gly Thr Lys Thr Asn Ile Ile Gly Gln Gly Gly Lys 370 375 380Lys Leu Glu Ala Val Ala Arg Val Asp Tyr Lys Tyr Ser Pro Lys Leu385 390 395 400Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn Val Asp Thr Asp Pro Glu 405 410 415Ser Thr His His Asp Ala Val Arg Leu Gln Ala Leu Tyr Lys Phe 420 425 43044431PRTCampylobacter jejuni 44Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Ile 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Glu Ser Ser Asn Pro Trp 35 40 45Ser Asn Ala Asn Phe Gly Ser Gly Ile Ser Gly Lys Gln Asp His Lys 50 55 60Tyr Arg Ala Gln Val Asn Phe Ser Gly Ala Ile Ser Asp Asn Phe Lys65 70 75 80Ala Phe Val Gln Phe Asp Tyr Asn Ser Gln Asp Gly Gly Tyr Gly Ala 85 90 95Asp Ser Ile Ser Asn Thr Ser Asp Thr Leu Thr Val Arg Gln Leu Tyr 100 105 110Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly Lys 115 120 125Gln Gln Leu Asn Phe Ile Trp Thr Asp Asn Ala Ile Asp Gly Leu Val 130 135 140Gly Thr Gly Ile Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr Leu145 150 155 160Ala Ala Phe Ala Met Asp Ser Phe Asn Glu Ala Ser Asp Thr Thr Val 165 170 175Thr Ile Thr Gln Asn Gly Ser Gln Lys Ile Thr Gly Val Gln Phe Asn 180 185 190Arg Gly Asn Pro Lys Gly Asp Gly Asp Ala Ser Gly Ala Leu Asp Trp 195 200 205Ser Lys Asn Ile Tyr Gly Ala Ala Ala Ile Gly Ser Tyr Asp Leu Ala 210 215 220Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala Tyr Met Ser Asp Asn225 230 235 240Ala Phe Leu Tyr Ala Leu Asp Ala Ala Tyr Ser Thr Thr Ile Phe Asp 245 250 255Gly Ile Asn Trp Thr Ile Glu Gly Ala Tyr Leu Gly Asn Ser Val Asp 260 265 270Asn Lys Leu Lys Asp Arg Leu Asn Val Ala Asn Gly Asn Phe Phe Ala 275 280 285Leu Arg Gly Thr Val Glu Val Asn Gly Trp Asp Ala Thr Leu Gly Gly 290 295 300Leu Tyr Tyr Gly Asp Lys Asp Asn Leu Thr Val Thr Thr Ile Glu Asp305 310 315 320Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu Ile Phe Tyr Thr 325 330 335Arg Gly Ser Asn Leu Asn Gly Asp Leu Gly Arg Asn Ile Phe Gly Tyr 340 345 350Val Thr Gly Gly Tyr Thr Phe Asn Glu Ala Val Arg Val Gly Ala Asp 355 360 365Phe Val Tyr Gly Gly Thr Lys Thr Asn Ile Ile Gly Gln Gly Gly Lys 370 375 380Lys Leu Glu Ala Val Ala Arg Val Asp Tyr Lys Tyr Ser Pro Lys Leu385 390 395 400Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn Val Asp Thr Asp Pro Glu 405 410 415Ser Thr His His Asp Ala Val Arg Leu Gln Ala Leu Tyr Lys Phe 420 425 43045432PRTCampylobacter jejuni 45Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Ile 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Glu Ser Ser Asn Pro Trp 35 40 45Ser Asn Gly Asn Tyr Gly Ser Gly Ile Ser Gly Lys Gln Asp His Lys 50 55 60Tyr Arg Ala Gln Val Asn Phe Asn Thr Ala Ile Ala Asp Asn Phe Lys65 70 75 80Ala Phe Val Gln Phe Asp Tyr Asn Ser Lys Asp Gly Gly Tyr Gly Glu 85 90 95Asn Ser Ile Ser Asn Thr Ser Asp Thr Leu Ser Val Arg Gln Leu Tyr 100 105 110Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val Ile Ala Gly Lys 115 120 125Gln Gln Leu Asn Thr Ile Trp Thr Asp Asn Gly Val Asp Gly Leu Val 130 135 140Gly Thr Gly Ile Lys Val Val Asn Asn Ser Ile Asp Gly Leu Thr Leu145 150 155 160Ala Ala Phe Ala Met Asp Ser Phe Asn Glu Ala Ser Asp Thr Thr Val 165 170 175Ile Ile Thr Gln Asp Pro Ser Ser Asn Lys Ile Thr Gly Val Gln Phe 180 185 190Asn Arg Gly Asn Pro Lys Gly Asp Gly Asp Val Ser Gly Ala Leu Asp 195 200 205Trp Ser Lys Asn Ile Tyr Gly Ala Ala Ala Ile Gly Ser Tyr Asp Ile 210 215 220Ala Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu Ala Tyr Met Ser Asp225 230 235 240Asn Ala Phe Leu Tyr Ala Leu Asp Ala Ala Tyr Asn Thr Thr Ile Phe 245 250 255Asp Gly Ile Asn Trp Thr Ile Glu Gly Ala Tyr Leu Gly Asn Ser Val 260 265 270Asp Asn Lys Leu Lys Asp Arg Leu Asp Ala Ala Asn Gly Asn Phe Phe 275 280 285Ala Leu Arg Gly Thr Val Glu Val Asn Gly Trp Asp Ala Ser Leu Gly 290 295 300Gly Leu Tyr Tyr Gly Lys Lys Asp Lys Ala Thr Val Thr Thr Ile Glu305 310 315 320Asp Gln Gly Asn Leu Gly Ser Leu Leu Ala Gly Gln Glu Ile Phe Tyr 325 330 335Thr Arg Gly Ser Asn Leu Asn Gly Asp Leu Gly Arg Asn Ile Phe Gly 340 345 350Tyr Val Thr Ala Gly Tyr Thr Phe Asn Glu Ala Val Arg Val Gly Ala 355 360 365Asp Phe Val Tyr Gly Gly Thr Lys Thr Gly Glu Ile Gly Asn Gly Gly 370 375 380Lys Lys Leu Glu Ala Val Ala Arg Val Asp Tyr Lys Tyr Ser Pro Lys385 390 395 400Leu Asn Phe Ser Ala Phe Tyr Ser Tyr Val Asn Val Asp Thr Asp Pro 405 410 415Glu Ser Thr His His Asp Ala Val Arg Leu Gln Ala Leu Tyr Lys Phe 420 425 43046429PRTCampylobacter jejuni 46Met Lys Leu Val Lys Leu Ser Leu Val Ala Ala Leu Ala Ala Gly Ala1 5 10 15Phe Ser Ala Ala Asn Ala Thr Pro Leu Glu Glu Ala Ile Lys Asp Ile 20 25 30Asp Val Ser Gly Val Leu Arg Tyr Arg Tyr Asp Thr Ser Asn Asp Trp 35 40 45Asn Asn Ala Gly Phe Gly Ser Gly Ile Ser Gly Lys Gln Thr His Asn 50 55 60Tyr Arg Ala Gln Ile Asn Phe Ser Gly Ala Ile Ala Asp Asn Phe Lys65 70 75 80Ala Phe Val Gln Phe Asp Tyr Ala Ala Val Asp Gly Gly Tyr Asn Val 85 90 95Thr Asn Gly Thr Gly Asn Gln Arg Asn Asp Gln Asn Ser Leu Thr Val 100 105 110Arg Gln Leu Tyr Leu Thr Tyr Thr Asn Glu Asp Val Ala Thr Ser Val 115 120 125Ile Ala Gly Lys Gln Gln Leu Asn Thr Ile Trp Thr Asp Asn Asp Ile 130 135 140Asp Gly Leu Val Gly Thr Gly Ile Lys Trp Asn Asn Ser Ile Asp Gly145 150 155 160Leu Thr Leu Ala Ala Phe Ala Val Asp Ser Tyr Asn Thr Asp Glu Gln 165 170 175Gly Tyr Lys Asp Asn Asn Gly Arg Pro Asp Leu Thr Tyr Thr Gly Asp 180 185 190Ala Ser Gln Tyr Leu Thr Trp Gly Asn Ile Tyr Gly Ala Ala Ala Val 195 200 205Gly Ser Tyr Asp Leu Ala Gly Gly Gln Phe Asn Pro Gln Leu Trp Leu 210 215 220Ala Tyr Met Ser Asp Asn Ala Phe Leu Tyr Ala Leu Asp Leu Ala Tyr225 230 235 240Asn Thr Thr Ile Phe Asp Gly Ile Asn Trp Ser Ile Glu Gly Ala Tyr 245 250 255Leu Gly Asn Ser Val Asp Asn Lys Leu Lys Asp Arg Phe His Ala Ala 260 265 270Gly Asp Pro Glu Ser Ser Ala Ala Asn Gly Asn Phe Phe Ala Leu Arg 275 280 285Gly Thr Val Glu Val Asn Gly Trp Asp Ala Ser Leu Gly Gly Leu Tyr 290 295 300Tyr Gly Lys Lys Asp Lys Phe Thr Val Thr Thr Ile Glu Asp Gln Gly305 310 315 320Asn Leu Gly Ser Leu Leu Ala Gly Glu Glu Ile Phe Tyr Thr His Gly 325 330 335Ser Arg Leu Asn Gly Asp Ala Gly Arg Asn Ile Phe Gly Tyr Val Thr 340 345 350Gly Gly Tyr Thr Phe Asn Glu Thr Val Arg Val Gly Ala Asp Phe Val 355 360 365Tyr Gly Gly Thr Lys Thr Glu Asn Val Gly Glu Gly Gly Lys Lys Leu 370 375 380Glu Ala Val Ala Arg Val Asp Tyr Lys Tyr Ser Pro Lys Leu Asn Phe385 390 395 400Ser Ala Phe Tyr Ser Tyr Val Asn Val Asp Arg Asp Pro Glu Ser Thr 405 410 415His His Asp Ala Val Arg Leu Gln Ala Leu Tyr Lys Phe 420 425

Claims

1-29. (canceled)

30. A composition comprising ferric quinate, complex of a 3,4-dihydroxyphenylalanine or tyrosine with Fe III or a compound with a structure selected from the group consisting of: ##STR00005## in an effective amount to reduce the number of Campylobacter present in the gastrointestinal tract of a human subject.

31. The composition of claim 30, wherein the composition is a food supplement, drinking water or drinking water supplement.

32. The composition of claim 30, wherein the compound is present in a concentration range between 34 to 340 .mu.M.

33. The composition of claim 30, wherein the compound specifically binds to at least one amino acid residue selected from the group consisting of Arg.sup.3S2, Thr.sup.268, Lys.sup.278, Lys.sup.385, Asn.sup.258, Leu.sup.290, Tyr.sup.294, Phe.sup.395, Ile.sup.337, Arg.sup.381, Asp.sup.261, and Ser.sup.397 of MOMP (SEQ ID NO:1).

34. The composition of claim 33, wherein the compound specifically binds to at least amino acid residue Thr.sup.268 of MOMP (SEQ ID NO.1).

35. The composition of claim 30, wherein the compound reduces the campylobacter colony forming units in the gastrointestinal tract of the animal by at least 50%.

36. The composition of claim 30, the Campylobacter is Campylobacter jejuni or Campylobacter coli.

37. The composition of claim 30, wherein the compound is a complex of Fe III with 3,4-dihydroxyphenylalanine or tyrosine.

38. The composition of claim 30, wherein the compound is ferric quinate.

39. A method for treating or reducing Campylobacter colonization in a human subject comprising administering to the human the composition of claim 1.

40. The method of claim 39, wherein the Campylobacter is Campylobacter jejuni or Campylobacter Coli.

41. The method of claim 39, wherein the compound is administered orally.

42. The method of claim 39, wherein the compound specifically binds to at least one amino acid residue selected from the group consisting of Arg.sup.3S2, Thr.sup.268, Lys.sup.278, Lys.sup.385, Asn.sup.258, Leu.sup.290, Tyr.sup.294, Phe.sup.395, Ile.sup.337, Arg.sup.381, Asp.sup.261, and Ser.sup.397 of MOMP (SEQ ID NO:1).

43. The method of claim 39, wherein the compound specifically binds to at least amino acid residue Thr.sup.268 of MOMP (SEQ ID NO.1).

44. The method of claim 39, wherein the compound reduces the campylobacter colony forming units in the gastrointestinal tract of the animal by at least 50%.

45. The method of claim 39, wherein the compound is a complex of Fe III with 3,4-dihydroxyphenylalanine or tyrosine.

46. The method of claim 39, wherein the compound is ferric quinate.