Patent application title: AADC POLYNUCLEOTIDES FOR THE TREATMENT OF PARKINSON'S DISEASE
Inventors:
IPC8 Class: AA61K3851FI
USPC Class:
1 1
Class name:
Publication date: 2019-01-10
Patent application number: 20190008931
Abstract:
The disclosure relates to compositions and methods for the preparation,
manufacture and therapeutic use of polynucleotides encoding AADC for the
treatment of Parkinson's Disease.Claims:
1. An AAV vector genome comprising, in order: a) a 5' inverted terminal
repeat (ITR), wherein said 5' ITR is 141 nucleotides in length; b) an
AADC sequence region, said AADC sequence region comprising a nucleotide
sequence encoding SEQ ID NO: 1, c) a 3' ITR, wherein said 3' ITR is 141
nucleotides in length.
2. The AAV vector genome of claim 1, wherein the 5' ITR and the 3' ITR are derived from AAV2.
3. The AAV vector genome of claim 2, wherein the AAV vector genome comprises a cytomegalovirus (CMV) sequence region derived from a CMV gene; wherein the CMV sequence region comprises an enhancer region and promoter region.
4. The AAV vector genome of claim 3, wherein the CMV sequence region is 507 nucleotides in length.
5. The AAV vector genome of claim 2, wherein the AAV vector genome comprises an immediate early 1 (IE1) sequence region derived from an IE1 gene.
6. The AAV vector genome of claim 5, wherein the IE1 sequence region comprises a nucleotide sequence from IE1 exon1.
7. The AAV vector genome of claim 6, wherein the IE1 sequence region comprises a nucleotide sequence from IE1 intron 1 or a fragment thereof.
8. The AAV vector genome of claim 7, wherein the IE1 sequence region is 166 nucleotides in length.
9. The AAV vector genome of claim 2, wherein the AAV vector genome comprises a human beta globin (BB) sequence region derived from a HB gene.
10. The AAV vector genome of claim 9, wherein the HB sequence region comprises a nucleotide sequence from HB intron 2.
11. The AAV vector genome of claim 10, wherein the HB sequence region comprises a nucleotide sequence from HB exon 3.
12. The AAV vector genome of claim 11, wherein the HB sequence region is 400 nucleotides in length.
13. The AAV vector genome of claim 2, wherein the AAV vector genome comprises a poly(A) signal sequence region derived from the human growth hormone (hGH) gene.
14. The AAV vector genome of claim 13, wherein the poly(A) signal sequence region is 477 nucleotides in length.
15. The AAV vector genome of claim 1, wherein the AAV vector genome comprises a sequence selected from the group consisting of SEQ ID NO: 10-13, 15, 17-20 and 22 and variants having at least 95% identity thereto.
16. The AAV vector genome of claim 2, wherein, the AADC region comprises a codon optimized nucleotide sequence encoding SEQ ID NO: 1.
17. The AAV vector genome of claim 16, wherein the AAV vector genome comprises a sequence selected from the group consisting of SEQ ID NO: 7 and 12 or variants having at least 95% identity thereto.
18. A recombinant AAV virus comprising the AAV vector genome of claim 1.
19. The recombinant AAV virus of claim 18, comprising a capsid serotype selected from the group consisting of AAV2, AAV1, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV9.47, AAV9(hu14), AAV10, AAV11, AAV12, AAVrh8, AAVrh10, AAV-DJ, and AAV-DJ8.
20. The recombinant AAV virus of claim 19, wherein the capsid serotype is AAV2.
21. A pharmaceutical composition comprising the recombinant AAV virus of claim 20.
22. The pharmaceutical composition of claim 21, wherein at least 70% of the recombinant AAV vectors contain an AAV vector genome.
Description:
CROSS REFERENCE TO RELATED APPLICATIONS
[0001] This application is a continuation application which claims the benefit of U.S. patent application Ser. No. 15/524,986 filed May 5, 2017, and entitled AADC Polynucleotides for the Treatment of Parkinson's Disease; which is a national stage filing under 35 U.S.C. .sctn. 371 of International Application No. PCT/US2015/059201 filed Nov. 5, 2015, and entitled AADC Polynucleotides for the Treatment of Parkinson's Disease; which claims priority to U.S. Provisional Patent Application No. 62/075,298 filed Nov. 5, 2014, entitled AADC Polynucleotides for the Treatment of Parkinson's Disease, and U.S. Provisional Patent Application No. 62/155,692 filed May 1, 2015, entitled AADC Polynucleotides for the Treatment of Parkinson's Disease, and U.S. Provisional Patent Application No. 62/199,578 filed Jul. 31, 2015, entitled AADC Polynucleotides for the Treatment of Parkinson's Disease, and U.S. Provisional Patent Application No. 62/243,537 filed Oct. 19, 2015, entitled AADC Polynucleotides for the Treatment of Parkinson's Disease; the contents of each of which is herein incorporated by reference in its entirety.
REFERENCE TO SEQUENCE LISTING
[0002] The present application includes a Sequence Listing which is filed in electronic format. The Sequence Listing file, entitled 2057-1010USCON_SEQLST.txt, was created on Sep. 20, 2018 and is 178,260 bytes in size. The information in electronic format of the Sequence Listing is incorporated herein by reference in its entirety.
FIELD OF THE DISCLOSURE
[0003] The invention relates to compositions, particularly nucleic acid molecules, e.g., polynucleotides encoding AADC, for use in the treatment of Parkinson's disease. In some embodiments such AADC polynucleotides may be encoded by or within recombinant adeno-associated viruses (AAVs).
BACKGROUND
[0004] Aromatic L-amino acid decarboxylase (AADC) is a homodimeric pyridoxal phosphate-dependent enzyme responsible for the synthesis of dopamine and serotonin. The encoded protein catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (L-DOPA or levodopa) to dopamine; L-5-hydroxytryptophan to serotonin; and L-tryptophan to tryptamine. Defects in this gene are the cause of aromatic L-amino-acid decarboxylase deficiency (AADCD), which is an inborn error in neurotransmitter metabolism leading to combined serotonin and catecholamine deficiency that results in severe motor and autonomic dysfunctions.
[0005] Parkinson's Disease (PD) is a progressive neurodegenerative disease of the central nervous system (CNS) producing sensory and motor symptoms. Dopamine replacement (i.e., levodopa) has been the standard pharmacotherapy for motor impairment in PD. However, the benefit of dopamine therapy becomes less marked over time, due, in part, to the progressive death of dopamine-generating cells and corresponding loss of AADC activity. Furthermore, systemic administration of high-dose dopamine is complicated by side effects, such as fluctuations in motor performance, dyskinesias, and hallucinations, resulting from dopaminergic stimulation of the mesolimbic system. One strategy to restore dopaminergic function and minimize side effects is the use of gene therapy to deliver AADC directly to a targeted region of the CNS.
[0006] The adeno-associated virus (AAV) has emerged as an attractive vector for gene therapy due to its long-term gene expression, the inability to autonomously replicate without a helper virus, the ability to transduce dividing and non-diving cells, and the lack of pathogenicity from wild-type infections (See e.g., Hadaczek et al. Mol. Ther. 18(8), 1458-1461, August 2010). AAV is a helper-dependent DNA parvovirus which belongs to the genus Dependovirus.
[0007] The present invention provides such improved nucleic acid constructs, e.g., polynucleotides, for use with AAV-derived vectors comprising dopa carboxylase ("DDC") gene sequence which encodes a full-length AADC protein for the purpose of gene therapy in the treatment of Parkinson's Disease.
[0008] The nucleic acid constructs described herein comprise at least a 5'-ITR and a 3'-ITR, each or both of which may be derived from an AAV, positioned about a DDC gene sequence, as well as additional components required for gene expression and clone selection.
SUMMARY
[0009] Described herein are compositions, methods, processes, kits and devices for the design, preparation, manufacture and/or formulation of AADC polynucleotides.
[0010] In some embodiments such AADC polynucleotides may be encoded by or contained within plasmids or vectors or recombinant adeno-associated viruses (AAV).
[0011] The details of various embodiments of the invention are set forth in the description below. Other features, objects, and advantages of the invention will be apparent from the description and from the claims.
DETAILED DESCRIPTION
Compositions
[0012] According to the present invention, AADC polynucleotides are provided which function alone or in combination with additional nucleic acid sequence(s) to encode the AADC protein. As used herein an "AADC polynucleotide" is any nucleic acid polymer which encodes an AADC protein and when present in a vector, plasmid or translatable construct, expresses such AADC protein in a cell, tissue, organ or organism.
[0013] AADC polynucleotides include precursor molecules which are processed inside the cell. AADC polynucleotides or the processed forms thereof may be encoded in a plasmid, vector, genome or other nucleic acid expression vector for delivery to a cell.
[0014] In some embodiments AADC polynucleotides are designed as components of AAV viral genomes and packaged in AAV viral particles which are processed within the cell to produce the wild type AADC protein.
[0015] As used herein, the wild type AADC protein may be any of the naturally occurring isoforms or variants from the DDC gene. Multiple alternatively spliced transcript variants encoding different isoforms of AADC have been identified. Specifically, the DDC gene produces seven transcript variants that encode six distinct isoforms. DDC transcript variants 1 and 2 both encode AADC isoform 1. In some embodiments, the AADC polynucleotides encode DDC transcript variant 2, thereby encoding a native AADC isoform 1 (NCBI Reference Sequence: NP_000781.1). This sequence is given here:
TABLE-US-00001 (SEQ ID NO: 1) MNASEFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEP DTFEDIINDVEKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGC IGFSWAASPACTELETVMMDWLGKMLELPKAFLNEKAGEGGGVIQGSASE ATLVALLAARTKVIHRLQAASPELTQAAIMEKLVAYSSDQAHSSVERAGL IGGVKLKAIPSDGNFAMRASALQEALERDKAAGLIPFFMVATLGTTTCCS FDNLLEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFN PHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQ IPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEI CVEVILGLVCFRLKGSNKVNEALLQRINSAKKIHLVPCHLRDKFVLRFAI CSRTVESAHVQRAWEHIKELAADVLRAERE
[0016] The AADC polynucleotides of the invention, may be engineered to contain modular elements and/or sequence motifs assembled to create AADC polynucleotide constructs.
AADC Polynucleotide Constructs
[0017] According to the present invention, AADC polynucleotides are provided. Such polynucleotides comprise nucleic acid polymers which comprise a region of linked nucleosides encoding one or more isoforms or variants of the AADC protein.
[0018] In some embodiments, the AADC polynucleotide comprises a codon optimized transcript encoding an AADC protein.
[0019] In some embodiments, the AADC polynucleotide comprises a sequence region encoding one or more wild type isoforms or variants of an AADC protein. Such polynucleotides may also comprise a sequence region encoding any one or more of the following: a 5' ITR, a cytomegalovirus (CMV) Enhancer, a CMV Promoter, an ie1 exon 1, an ie1 intron1, an hbBglobin intron2, an hBglobin exon 3, a 5' UTR, a 3' UTR, an hGH poly(A) signal, and/or a 3' ITR. Such sequence regions are taught herein or may be any of those known in the art.
[0020] In some embodiments, the AADC polynucleotide comprises a sequence of any of SEQ ID NOs. 2-23.
[0021] In one embodiment, the AADC polynucleotide comprises a sequence which has a percent identity to any of SEQ ID NOs: 2-23. The AADC polynucleotide may have 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or 100% identity to any of SEQ ID NOs: 2-23. The AADC polynucleotide may have 1-10%, 10-20%, 30-40%, 50-60%, 50-70%, 50-80%, 50-90%, 50-99%, 50-100%, 60-70%, 60-80%, 60-90%, 60-99%, 60-100%, 70-80%, 70-90%, 70-99%, 70-100%, 80-85%, 80-90%, 80-95%, 80-99%, 80-100%, 90-95%, 90-99%, or 90-100% to any of SEQ ID NOs: 2-23. As a non-limiting example, the AADC polynucleotide comprises a sequence which as 80% identity to any of SEQ ID NOs 6, 7, 8, 9, 17, 18, 19, 20, 21, 22, and 23. As another non-limiting example, the AADC polynucleotide comprises a sequence which as 85% identity to any of SEQ ID NOs 6, 7, 8, 9, 17, 18, 19, 20, 21, 22, and 23. As another non-limiting example, the AADC polynucleotide comprises a sequence which as 90% identity to any of SEQ ID NOs 6, 7, 8, 9, 17, 18, 19, 20, 21, 22, and 23. As another non-limiting example, the AADC polynucleotide comprises a sequence which as 95% identity to any of SEQ ID NOs 6, 7, 8, 9, 17, 18, 19, 20, 21, 22, and 23. As another non-limiting example, the AADC polynucleotide comprises a sequence which as 99% identity to any of SEQ ID NOs 6, 7, 8, 9, 17, 18, 19, 20, 21, 22, and 23.
[0022] In some embodiments the AADC coding region is 1440 nucleotides in length. Such an AADC polynucleotide may be codon optimized over all or a portion of the polynucleotide.
[0023] In some embodiments the AADC coding region is 1443 nucleotides in length. In such case, an additional codon may be present at the 3' end of the polynucleotide.
[0024] In some embodiments the AADC coding region is 1449 nucleotides in length. In such case, additional codons may be present at the 3' end of the polynucleotide.
[0025] In some embodiments, the AADC polynucleotide comprises any of SEQ ID NOs 6-9, 17-23 but lacking the 5' and/or 3' ITRs. Such a polynucleotide may be incorporated into a plasmid or vector and utilized to express the encoded AADC protein.
[0026] In one embodiment, the AADC polynucleotides may be produced in insect cells (e.g., Sf9 cells).
[0027] In one embodiment, the AADC polynucleotides may be produced using triple transfection.
[0028] In one embodiment, the AADC polynucleotide may comprise a codon optimized open reading frame of an AADC mRNA, at least one 5'ITR and at least one 3'UTR where the one or more of the 5'ITRs may be located at the 5' end of the promoter region and one or more 3' ITRs may be located at the 3' end of the poly(A) signal. The AADC mRNA may comprise a promoter region, a 5'untranslated region (UTR), a 3'UTR and a poly(A) signal. The promoter region may inclue, but is not limited to, enhancer element, a promoter element, a first exon region, a first intron region, a second intron region and a second exon region. As a non-limiting example, the enhancer element and the promoter element are derived from CMV. As another non-limiting example, the first exon region is ie1 exon 1 or fragments thereof, the first intron region is ie1 intron 1 or fragments thereof, the second intron region is hbBglobin intron 2 or fragments thereof and the second exon region is hbBglobin exon 3 or fragments thereof. As yet another non-limiting example, the poly(A) signal is derived from human growth hormone.
[0029] In one embodiment, the AADC polynucleotide is encoded in a plasmid or vector, which may be derived from an adeno-associated virus (AAV). The AAV may be a recombinant AAV virus and may comprise a capsid serotype such as, but not limited to, of AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV9.47, AAV9(hu14), AAV10, AAV11, AAV12, AAVrh8, AAVrh10, AAV-DJ, and AAV-DJ8. As a non-limiting example, the capsid of the recombinant AAV virus is AAV2. As a non-limiting example, the capsid of the recombinant AAV virus is AAVrh10. As a non-limiting example, the capsid of the recombinant AAV virus is AAV9(hu14). As a non-limiting example, the capsid of the recombinant AAV virus is AAV-DJ. As a non-limiting example, the capsid of the recombinant AAV virus is AAV9.47. As a non-limiting example, the capsid of the recombinant AAV virus is AAV-DJ8.
Promoters
[0030] A person skilled in the art may recognize that a target cell may require a specific promoter including but not limited to a promoter that is species specific, inducible, tissue-specific, or cell cycle-specific Parr et al., Nat. Med. 3:1145-9 (1997); the contents of which are herein incorporated by reference in its entirety).
[0031] In one embodiment, the promoter is a promoter deemed to be efficient for the AADC polynucleotide.
[0032] In one embodiment, the promoter is a promoter deemed to be efficient for the cell being targeted.
[0033] In one embodiment, the promoter is a weak promoter which provides expression of a payload for a period of time in targeted tissues such as, but not limited to, nervous system tissues. Expression may be for a period of 1 hour, 2, hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 9 hours, 10 hours, 11 hours, 12 hours, 13 hours, 14 hours, 15 hours, 16 hours, 17 hours, 18 hours, 19 hours, 20 hours, 21 hours, 22 hours, 23 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 1 week, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 2 weeks, 15 days, 16 days, 17 days, 18 days, 19 days, 20 days, 3 weeks, 22 days, 23 days, 24 days, 25 days, 26 days, 27 days, 28 days, 29 days, 30 days, 31 days, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 1 year, 13 months, 14 months, 15 months, 16 months, 17 months, 18 months, 19 months, 20 months, 21 months, 22 months, 23 months, 2 years, 3 years, 4 years, 5 years, 6 years, 7 years, 8 years, 9 years, 10 years or more than 10 years. Expression may be for 1-5 hours, 1-12 hours, 1-2 days, 1-5 days, 1-2 weeks, 1-3 weeks, 1-4 weeks, 1-2 months, 1-4 months, 1-6 months, 2-6 months, 3-6 months, 3-9 months, 4-8 months, 6-12 months, 1-2 years, 1-5 years, 2-5 years, 3-6 years, 3-8 years, 4-8 years or 5-10 years. As a non-limiting example, the promoter is a weak promoter for sustained expression of a payload in nervous tissues. As another non-limiting example, the promoter is a weak promoter for sustained frataxin expression in nervous system tissue such as, but not limited to, neuronal tissue and glial tissue.
[0034] In one embodiment, the FRDA promoter is used with the AADC polynucleotides described herein.
[0035] In one embodiment, there is a region located approximately .about.5 kb upstream of the first exon of the payload. As a non-limiting example, there is a 17 bp region located approximately 4.9 kb upstream of the first exon of the frataxin gene in order to allow for expression with the FRDA promoter (See e.g., Puspasari et al. Long Range Regulation of Human FXN Gene Expression, PLOS ONE, 2011; the contents of which is herein incorporated by reference in its entirety).
[0036] In one embodiment, the promoter may be a promoter which is less than 1 kb. The promoter may have a length of 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, 300, 310, 320, 330, 340, 350, 360, 370, 380, 390, 400, 410, 420, 430, 440, 450, 460, 470, 480, 490, 500, 510, 520, 530, 540, 550, 560, 570, 580, 590, 600, 610, 620, 630, 640, 650, 660, 670, 680, 690, 700, 710, 720, 730, 740, 750, 760, 770, 780, 790, 800 or more than 800. The promoter may have a length between 200-300, 200-400, 200-500, 200-600, 200-700, 200-800, 300-400, 300-500, 300-600, 300-700, 300-800, 400-500, 400-600, 400-700, 400-800, 500-600, 500-700, 500-800, 600-700, 600-800 or 700-800.
[0037] In one embodiment, the promoter may be a combination of two or more components such as, but not limited to, CMV and CBA. Each component may have a length of 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, 300, 310, 320, 330, 340, 350, 360, 370, 380, 381, 382, 383, 384, 385, 386, 387, 388, 389, 390, 400, 410, 420, 430, 440, 450, 460, 470, 480, 490, 500, 510, 520, 530, 540, 550, 560, 570, 580, 590, 600, 610, 620, 630, 640, 650, 660, 670, 680, 690, 700, 710, 720, 730, 740, 750, 760, 770, 780, 790, 800 or more than 800. Each component may have a length between 200-300, 200-400, 200-500, 200-600, 200-700, 200-800, 300-400, 300-500, 300-600, 300-700, 300-800, 400-500, 400-600, 400-700, 400-800, 500-600, 500-700, 500-800, 600-700, 600-800 or 700-800. As a non-limiting example, the promoter is a combination of a 382 nucleotide CMV-enhancer sequence and a 260 nucleotide CBA-promoter sequence.
[0038] In one embodiment, at least one element may be used with the AADC polynucleotides described herein to enhance the transgene target specificity and expression (See e.g., Powell et al. Viral Expression Cassette Elements to Enhance Transgene Target Specificity and Expression in Gene Therapy, 2015; the contents of which are herein incorporated by reference in its entirety). Non-limiting examples of elements to enhance the transgene target specificity and expression include promoters, endogenous miRNAs, post-transcriptional regulatory elements (PREs), polyadenylation (PolyA) signal sequences and upstream enhancers (USEs), CMV enhancers and introns.
[0039] In one embodiment, at least one element may be used with the AADC polynucleotides described herein to enhance the transgene target specificity and expression (See e.g., Powell et al. Viral Expression Cassette Elements to Enhance Transgene Target Specificity and Expression in Gene Therapy, 2015; the contents of which are herein incorporated by reference in its entirety) such as promoters. Promoters for which promote expression in most tissues include, but are not limited to, human elongation factor 1.alpha.-subunit (EF1.alpha.), immediate-early cytomegalovirus (CMV), chicken .beta.-actin (CBA) and its derivative CAG, the .beta. glucuronidase (GUSB), or ubiquitin C (UBC). Tissue-specific expression elements can be used to restrict expression to certain cell types such as, but not limited to, nervous system promoters which can be used to restrict expression to neurons, astrocytes, or oligodendrocytes. Non-limiting example of tissue-specific expression elements for neurons include neuron-specific enolase (NSE), platelet-derived growth factor (PDGF), platelet-derived growth factor B-chain (PDGF-.beta.), the synapsin (Syn), the methyl-CpG binding protein 2 (MeCP2), CaMKII, mGluR2, NFL, NFH, n.beta.2, PPE, Enk and EAAT2 promoters. A non-limiting example of a tissue-specific expression elements for astrocytes include the glial fibrillary acidic protein (GFAP) and EAAT2 promoters. A non-limiting example of a tissue-specific expression element for oligodendrocytes include the myelin basic protein (MBP) promoter.
[0040] In one embodiment, a ubiquitous promoter may be used with the AADC polynucleotides described herein. Non-limiting examples of ubiquitous promoters include CMV, CBA (including derivatives CAG, CBh, etc.), EF-1.alpha., PGK, UBC, GUSB (hGBp), and UCOE (promoter of HNRPA2B1-CBX3). Yu et al. (Molecular Pain 2011, 7:63; the contents of which are herein incorporated by reference in its entirety) evaluated the expression of eGFP under the CAG, EFI.alpha., PGK and UBC promoters in rat DRG cells and primary DRG cells using lentiviral vectors and found that UBC showed weaker expression than the other 3 promoters and there was only 10-12% glia expression seen for all promoters. Soderblom et al. (E. Neuro 2015; the contents of which are herein incorporated by reference in its entirety) the expression of eGFP in AAV8 with CMV and UBC promoters and AAV2 with the CMV promoter after injection in the motor cortex. Intranasal administration of a plasmid containing a UBC or EFI.alpha. promoter showed a sustained airway expression greater than the expression with the CMV promoter (See e.g., Gill et al., Gene Therapy 2001, Vol. 8, 1539-1546; the contents of which are herein incorporated by reference in its entirety). Husain et al. (Gene Therapy 2009; the contents of which are herein incorporated by reference in its entirety) evaluated a H.beta.H construct with a hGUSB promoter, a HSV-1LAT promoter and a NSE promoter and found that the H.beta.H construct showed weaker expression than NSE in mice brain. Passini and Wolfe (J. Virol. 2001, 12382-12392, the contents of which are herein incorporated by reference in its entirety) evaluated the long term effects of the H.beta.H vector following an intraventricular injection in neonatal mice and found that there was sustained expression for at least 1 year. Low expression in all brain regions was found by Xu et al. (Gene Therapy 2001, 8, 1323-1332; the contents of which are herein incorporated by reference in its entirety) when NF-L and NF-H promoters were used as compared to the CMV-lacZ, CMV-luc, EF, GFAP, hENK, nAChR, PPE, PPE+wpre, NSE (0.3 kb), NSE (1.8 kb) and NSE (1.8 kb+wpre). Xu et al. found that the promoter activity in descending order was NSE (1.8 kb), EF, NSE (0.3 kb), GFAP, CMV, hENK, PPE, NFL and NFH. NFL is a 650 nucleotide promoter and NFH is a 920 nucleotide promoter which are both absent in the liver but NFH is abundant in the sensory proprioceptive neurons, brain and spinal cord and NFH is present in the heart. Scn8a is a 470 nucleotide promoter which expresses throughout the DRG, spinal cord and brain with particularly high expression seen in the hippocampal neurons and cerebellar Purkinje cells, cortex, thalamus and hypothalamus (See e.g., Drews et al. 2007 and Raymond et al. 2004; the contents of each of which are herein incorporated by reference in their entireties).
[0041] In one embodiment, an UBC promoter may be used with the AADC polynucleotides described herein. The UBC promoter may have a size of 300-350 nucleotides. As a non-limiting example, the UBC promoter is 332 nucleotides.
[0042] In one embodiment, a GUSB promoter may be used with the AADC polynucleotides described herein. The GUSB promoter may have a size of 350-400 nucleotides. As a non-limiting example, the GUSB promoter is 378 nucleotides. As a non-limiting example, the construct may be AAV-promoter-CMV/globin intron-hFXN-RBG, where the AAV may be self-complementary and the AAV may be the DJ serotype.
[0043] In one embodiment, a NFL promoter may be used with the AADC polynucleotides described herein. The NFL promoter may have a size of 600-700 nucleotides. As a non-limiting example, the NFL promoter is 650 nucleotides. As a non-limiting example, the construct may be AAV-promoter-CMV/globin intron-hFXN-RBG, where the AAV may be self-complementary and the AAV may be the DJ serotype.
[0044] In one embodiment, a NFH promoter may be used with the AADC polynucleotides described herein. The NFH promoter may have a size of 900-950 nucleotides. As a non-limiting example, the NFH promoter is 920 nucleotides. As a non-limiting example, the construct may be AAV-promoter-CMV/globin intron-hFXN-RBG, where the AAV may be self-complementary and the AAV may be the DJ serotype.
[0045] In one embodiment, a scn8a promoter may be used with the AADC polynucleotides described herein. The scn8a promoter may have a size of 450-500 nucleotides. As a non-limiting example, the scn8a promoter is 470 nucleotides. As a non-limiting example, the construct may be AAV-promoter-CMV/globin intron-hFXN-RBG, where the AAV may be self-complementary and the AAV may be the DJ serotype.
[0046] In one embodiment, a FXN promoter may be used with the AADC polynucleotides described herein.
[0047] In one embodiment, a PGK promoter may be used with the AADC polynucleotides described herein.
[0048] In one embodiment, a CBA promote may be used with the AADC polynucleotides described herein.
[0049] In one embodiment, a CMV promoter may be used with the AADC polynucleotides described herein.
[0050] In one embodiment, a liver or a skeletal muscle promoter may be used with the AADC polynucleotides described herein. Non-limiting examples of liver promoters include hAAT and TBG. Non-limiting examples of skeletal muscle promoters include Desmin, MCK and C5-12.
[0051] In one embodiment, an enhancer element, a promoter and/or a 5'UTR intron may be used with the AADC polynucleotides described herein. The enhancer may be, but is not limited to, a CMV enhancer, the promoter may be, but is not limited to, a CMV, CBA, UBC, GUSB, NSE, Sunapsin, MeCP2, and GFAP promoter and the 5'UTR/intron may be, but is not limited to, SV40, and CBA-MVM. As a non-limiting example, the enhancer, promoter and/or intron used in combination may be: (1) CMV enhancer, CMV promoter, SV40 5'UTR intron; (2) CMV enhancer, CBA promoter, SV 40 5'UTR intron; (3) CMV enhancer, CBA promoter, CBA-MVM 5'UTR intron; (4) UBC promoter; (5) GUSB promoter; (6) NSE promoter; (7) Synapsin promoter; (8) MeCP2 promoter and (9) GFAP promoter.
[0052] In one embodiment, an engineered promoter may be used with the AADC polynucleotides described herein.
Introns
[0053] In one embodiment, at least one element may be used with the AADC polynucleotides described herein to enhance the transgene target specificity and expression (See e.g., Powell et al. Viral Expression Cassette Elements to Enhance Transgene Target Specificity and Expression in Gene Therapy, 2015; the contents of which are herein incorporated by reference in its entirety) such as an intron. Non-limiting examples of introns include, MVM (67-97 bps), F.IX truncated intron 1 (300 bps), .beta.-globin SD/immunoglobulin heavy chain splice acceptor (250 bps), adenovirus splice donor/immunoglobin splice acceptor (500 bps), SV40 late splice donor/splice acceptor (19S/16S) (180 bps) and hybrid adenovirus splice donor/IgG splice acceptor (230 bps).
[0054] In one embodiment, the intron may be 100-500 nucleotides in length. The intron may have a length of 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, 300, 310, 320, 330, 340, 350, 360, 370, 380, 390, 400, 410, 420, 430, 440, 450, 460, 470, 480, 490 or 500. The intron may have a length between 80-100, 80-120, 80-140, 80-160, 80-180, 80-200, 80-250, 80-300, 80-350, 80-400, 80-450, 80-500, 200-300, 200-400, 200-500, 300-400, 300-500, or 400-500.
Introduction into Cells
[0055] The AADC polynucleotides of the invention can be introduced into host cells using any of a variety of approaches. Infection with a viral vector comprising the AADC polynucleotide can be effected. Examples of suitable viral vectors include replication defective retroviral vectors, adenoviral vectors, adeno-associated vectors and lentiviral vectors.
[0056] According to the present invention, viral vectors for use in therapeutics and/or diagnostics comprise a virus that has been distilled or reduced to the minimum components necessary for transduction of a nucleic acid payload or cargo of interest.
[0057] In this manner, viral vectors are engineered as vehicles for specific delivery while lacking the deleterious replication and/or integration features found in wild-type virus.
[0058] As used herein, a "vector" is any molecule or moiety which transports, transduces or otherwise acts as a carrier of a heterologous molecule such as the polynucleotides of the invention. A "viral vector" is a vector which comprises one or more polynucleotide regions encoding or comprising payload molecule of interest, e.g., a transgene, a polynucleotide encoding a polypeptide or multi-polypeptide. Viral vectors of the present invention may be produced recombinantly and may be based on adeno-associated virus (AAV) parent or reference sequence. Serotypes which may be useful in the present invention include any of those arising from AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV9.47, AAV9(hu14), AAV10, AAV11, AAV12, AAVrh8, AAVrh10, AAV-DJ, and AAV-DJ8.
[0059] In one embodiment, the serotype which may be useful in the present invention may be AAV-DJ8. The amino acid sequence of AAV-DJ8 may comprise two or more mutations in order to remove the heparin binding domain (HBD). As a non-limiting example, the AAV-DJ sequence described as SEQ ID NO: 1 in U.S. Pat. No. 7,588,772, the contents of which are herein incorporated by reference in its entirety, may comprise two mutations: (1) R587Q where arginine (R; arg) at amino acid 587 is changed to glutamine (Q; gln) and (2) R590T where arginine (R; arg) at amino acid 590 is changed to threonine (T; thr). As another non-limiting example, may comprise three mutations: (1) K406R where lysine (K; lys) at amino acid 406 is changed to arginine (R; arg), (2) R587Q where arginine (R; arg) at amino acid 587 is changed to glutamine (Q; gln) and (3) R590T where arginine (R; arg) at amino acid 590 is changed to threonine (T; thr).
[0060] AAV vectors may also comprise self-complementary AAV vectors (scAAVs). scAAV vectors contain both DNA strands which anneal together to form double stranded DNA. By skipping second strand synthesis, scAAVs allow for rapid expression in the cell.
Pharmaceutical Compositions
[0061] Although the descriptions of pharmaceutical compositions, e.g., those polynucleotides (including the encoding plasmids or expression vectors, such as viruses, e.g., AAV) comprising a payload, e.g., AADC encoding sequences, to be delivered, provided herein are principally directed to pharmaceutical compositions which are suitable for administration to humans, it will be understood by the skilled artisan that such compositions are generally suitable for administration to any other animal, e.g., to non-human animals, e.g. non-human mammals. Modification of pharmaceutical compositions suitable for administration to humans in order to render the compositions suitable for administration to various animals is well understood, and the ordinarily skilled veterinary pharmacologist can design and/or perform such modification with merely ordinary, if any, experimentation. Subjects to which administration of the pharmaceutical compositions is contemplated include, but are not limited to, humans and/or other primates; mammals, including commercially relevant mammals such as cattle, pigs, horses, sheep, cats, dogs, mice, and/or rats; and/or birds, including commercially relevant birds such as poultry, chickens, ducks, geese, and/or turkeys.
[0062] In some embodiments, compositions are administered to humans, human patients or subjects. For the purposes of the present disclosure, the phrase "active ingredient" generally refers either to the viral vector carrying the payload or to the polynucleotide payload molecule delivered by a viral vector as described herein.
[0063] Formulations of the pharmaceutical compositions described herein may be prepared by any method known or hereafter developed in the art of pharmacology. In general, such preparatory methods include the step of bringing the active ingredient into association with an excipient and/or one or more other accessory ingredients, and then, if necessary and/or desirable, dividing, shaping and/or packaging the product into a desired single- or multi-dose unit.
[0064] Relative amounts of the active ingredient, the pharmaceutically acceptable excipient, and/or any additional ingredients in a pharmaceutical composition in accordance with the invention will vary, depending upon the identity, size, and/or condition of the subject treated and further depending upon the route by which the composition is to be administered.
[0065] In one embodiment, the pharmaceutical composition comprises a recombinant adeno-associated virus (AAV) vector comprising an AAV capsid and an AAV vector genome. The AAV vector genome may comprise at least one AADC polynucleotide described herein, such as, but not limited to, SEQ ID NOs 6, 7, 8, 9, 17, 18, 19, 20, 21, 22, and 23 or variants having at least 95% identity thereto. The recombinant AAV vectors in the pharmaceutical composition may have at least 70% which contain an AAV vector genome.
Formulation
[0066] The AADC polynucleotides or viral vectors encoding them can be formulated using one or more excipients to: (1) increase stability; (2) increase cell transfection or transduction; (3) permit the sustained or delayed release; or (4) alter the biodistribution (e.g., target the viral vector to specific tissues or cell types).
[0067] Formulations of the present invention can include, without limitation, saline, lipidoids, liposomes, lipid nanoparticles, polymers, lipoplexes, core-shell nanoparticles, peptides, proteins, cells transfected with viral vectors (e.g., for transplantation into a subject), nanoparticle mimics and combinations thereof. Further, the viral vectors of the present invention may be formulated using self-assembled nucleic acid nanoparticles.
[0068] Formulations of the pharmaceutical compositions described herein may be prepared by any method known or hereafter developed in the art of pharmacology. In general, such preparatory methods include the step of associating the active ingredient with an excipient and/or one or more other accessory ingredients.
[0069] A pharmaceutical composition in accordance with the present disclosure may be prepared, packaged, and/or sold in bulk, as a single unit dose, and/or as a plurality of single unit doses. As used herein, a "unit dose" refers to a discrete amount of the pharmaceutical composition comprising a predetermined amount of the active ingredient. The amount of the active ingredient is generally equal to the dosage of the active ingredient which would be administered to a subject and/or a convenient fraction of such a dosage such as, for example, one-half or one-third of such a dosage.
[0070] Relative amounts of the active ingredient, the pharmaceutically acceptable excipient, and/or any additional ingredients in a pharmaceutical composition in accordance with the present disclosure may vary, depending upon the identity, size, and/or condition of the subject being treated and further depending upon the route by which the composition is to be administered. For example, the composition may comprise between 0.1% and 99% (w/w) of the active ingredient. By way of example, the composition may comprise between 0.1% and 100%, e.g., between 0.5 and 50%, between 1-30%, between 5-80%, at least 80% (w/w) active ingredient.
[0071] In some embodiments, the formulations described herein may contain at least one payload molecule, e.g., an AADC polynucleotide. As a non-limiting example, the formulations may contain 1, 2, 3, 4 or 5 AADC polynucleotide payload molecules.
[0072] In some embodiments, a pharmaceutically acceptable excipient may be at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% pure. In some embodiments, an excipient is approved for use for humans and for veterinary use. In some embodiments, an excipient may be approved by United States Food and Drug Administration. In some embodiments, an excipient may be of pharmaceutical grade. In some embodiments, an excipient may meet the standards of the United States Pharmacopoeia (USP), the European Pharmacopoeia (EP), the British Pharmacopoeia, and/or the International Pharmacopoeia.
[0073] Excipients, which, as used herein, includes, but is not limited to, any and all solvents, dispersion media, diluents, or other liquid vehicles, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, and the like, as suited to the particular dosage form desired. Various excipients for formulating pharmaceutical compositions and techniques for preparing the composition are known in the art (see Remington: The Science and Practice of Pharmacy, 21.sup.st Edition, A. R. Gennaro, Lippincott, Williams & Wilkins, Baltimore, Md., 2006; incorporated herein by reference in its entirety). The use of a conventional excipient medium may be contemplated within the scope of the present disclosure, except insofar as any conventional excipient medium may be incompatible with a substance or its derivatives, such as by producing any undesirable biological effect or otherwise interacting in a deleterious manner with any other component(s) of the pharmaceutical composition.
[0074] Exemplary diluents include, but are not limited to, calcium carbonate, sodium carbonate, calcium phosphate, dicalcium phosphate, calcium sulfate, calcium hydrogen phosphate, sodium phosphate lactose, sucrose, cellulose, microcrystalline cellulose, kaolin, mannitol, sorbitol, inositol, sodium chloride, dry starch, cornstarch, powdered sugar, etc., and/or combinations thereof.
[0075] In one embodiment, the AADC polynucleotides may be formulated in a hydrogel prior to administration. Hydrogels have a degree of flexibility which is similar to natural tissue as a result of their significant water content.
[0076] In another embodiment, a hydrogel may be administered to a subject prior to the administration of an AADC polynucleotide formulation. As a non-limiting example, the site of administration of the hydrogel may be within 3 inches (e.g., within 2.9, 2.8, 2.7, 2.6, 2.5, 2.4, 2.3, 2.2, 2.1, 2.0, 1.9, 1.8, 1.7, 1.6, 1.5, 1.4, 1.3, 1.2, 1.1, 1.0, 0.9, 0.8, 0.7, 0.6, 0.5, 0.4, 0.3, 0.2, 0.1 or less than 0.1 inches) of the site of administration of the AADC polynucleotide formulation.
[0077] In one embodiment, the AADC polynucleotides may be administered in saline. As a non-limiting example, the formulation may be phosphate buffered saline (PBS) with 0.001% Pluronic acid (F-68). Additionally the formulation may be sterilized.
Inactive Ingredients
[0078] In some embodiments, AADC polynucleotide formulations may comprise at least one excipient which is an inactive ingredient. As used herein, the term "inactive ingredient" refers to one or more inactive agents included in formulations. In some embodiments, all, none or some of the inactive ingredients which may be used in the formulations of the present invention may be approved by the US Food and Drug Administration (FDA).
[0079] Formulations of viral vectors carrying AADC polynucleotides disclosed herein may include cations or anions. In one embodiment, the formulations include metal cations such as, but not limited to, Zn2+, Ca2+, Cu2+, Mg+ and combinations thereof. As a non-limiting example, formulations may include polymers and AADC polynucleotides complexed with a metal cation (See e.g., U.S. Pat. Nos. 6,265,389 and 6,555,525, each of which is herein incorporated by reference in its entirety).
Administration
[0080] The viral vectors comprising AADC polynucleotides of the present invention may be administered by any route which results in a therapeutically effective outcome. These include, but are not limited to epidural (into the dura matter), oral (by way of the mouth), transdermal, peridural, intracerebral (into the cerebrum), intracerebroventricular (into the cerebral ventricles), subcutaneous (under the skin), nasal administration (through the nose), intravenous (into a vein), intravenous bolus, intravenous drip, intraarterial (into an artery), intrathecal (into the spinal canal), endocervical, intracaudal (within the cauda equine), intracisternal (within the cisterna magna cerebellomedularis), intradiscal (within a disc), intradural (within or beneath the dura), intrameningeal (within the meninges), intrapleural (within the pleura), intraspinal (within the vertebral column), intrathecal (within the cerebrospinal fluid at any level of the cerebrospinal axis), intrathoracic (within the thorax), intrastriatal (within the striatum, caudate nucleus and/or putamen), caudal block, nerve block, or spinal. In specific embodiments, compositions may be administered in a way which allows them cross the blood-brain barrier, vascular barrier, or other epithelial barrier. In one embodiment, a formulation for a route of administration may include at least one inactive ingredient.
[0081] In one embodiment, the viral vectors comprising AADC polynucleotides of the present invention may be administered to the right putamen and/or the left putamen. The administration may be at one or more sites in the putamen such as, but not limited to, 2 sites, 3 sites, 4 sites or more than 4 sites. As a non-limiting example, the viral vectors comprising AADC polynucleotides of the present invention are delivered to 2 sites in the left putamen and 2 sites in the right putamen.
[0082] In one embodiment, the administration of the formulation of the viral vectors comprising the AADC polynucleotides of the present invention to a subject provides coverage of the putamen of a subject (e.g., the left and/or right putamen). In one aspect, the administration of the viral vectors comprising the AADC polynucleotides may provide at least 8%, 9%, 10%, 13%, 14%, 15%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more than 95% to the left and/or right putamen of a subject. As a non-limiting example, the coverage is at least 20%. As a non-limiting example, the coverage is at least 40%. In another aspect, the administration of the viral vectors comprising the AADC polynucleotides may provide at least 8%, 9%, 10%, 13%, 14%, 15%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more than 95% coverage of the surface area of the left and/or right putamen of a subject. As a non-limiting example, the total coverage is at least 20%. As a non-limiting example, the total coverage is at least 40%. In yet another aspect, the administration of the viral vectors comprising the AADC polynucleotides may provide 10-40%, 20-40%, 20-30%, 20-35%, 20-50%, 30-40%, 35-40%, 30-60%, 40-70%, 50-80% or 60-90% coverage to the left and/or right putamen of a subject or to the total surface area of the left and/or right putamen of a subject.
[0083] In one embodiment, the administration of the formulation of the viral vectors comprising the AADC polynucleotides of the present invention to a subject provides coverage of the posterior putamen of a subject (e.g., the left and/or right posterior putamen). In one aspect, the administration of the viral vectors comprising the AADC polynucleotides may provide at least 10%, 15%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more than 95% to the left and/or right posterior putamen of a subject. As a non-limiting example, the coverage is at least 20%. As a non-limiting example, the coverage is at least 40%. In another aspect, the administration of the viral vectors comprising the AADC polynucleotides may provide at least 10%, 15%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more than 95% coverage of the surface area of the left and/or right posterior putamen of a subject. As a non-limiting example, the total coverage is at least 20%. As a non-limiting example, the total coverage is at least 40%. In yet another aspect, the administration of the viral vectors comprising the AADC polynucleotides may provide 10-40%, 20-50%, 30-60%, 40-70%, 50-80% or 60-90% coverage to the left and/or right posterior putamen of a subject or to the total surface area of the left and/or right putamen of a subject.
[0084] In one embodiment, a subject may be administered the viral-vectors comprising AADC polynucleotides of the present invention safely delivered to substantia nigra pars compacta (SNpc) and ventral tegmental area (VTA) via bilateral infusions, or alternatively, intrastriatally (into the caudate nucleus and putamen), or into the subthalamic nucleus (STN).
[0085] In one embodiment, the AADC polynucleotides described herein may be administered using acute bilateral placement of catheters into each putamen. The placement may use magnetic resonance image (MRI)-guided stereotactic neurosurgical techniques known in the art or described herein. Additionally, a contrast agent such as, but not limited to a gadolinium based contrast agent (e.g., PROHANCE.RTM.) may be used in the formulation to monitor and confirm the distribution of the formulation.
[0086] In one embodiment, a subject may be administered the viral vectors comprising AADC polynucleotides of the present invention in a bilateral stereotactic CED-assisted step infusion into the putamen (e.g., the post commissural putamen).
[0087] In one embodiment, delivery of viral vector pharmaceutical compositions in accordance with the present invention to cells of the central nervous system (e.g., parenchyma) comprises a rate of delivery defined by [VG/hour=mL/hour*VG/mL] wherein VG is viral genomes, VG/mL is composition concentration, and mL/hour is rate of prolonged infusion.
[0088] In one embodiment, delivery of viral vector pharmaceutical compositions in accordance with the present invention to cells of the central nervous system (e.g., parenchyma) comprises infusion of up to 1 mL. In one embodiment, delivery of viral vector pharmaceutical compositions in accordance with the present invention to cells of the central nervous system (e.g., parenchyma) may comprise infusion of 0.001, 0.002, 0.003, 0.004, 0.005, 0.010, 0.015, 0.020, 0.025, 0.030, 0.040, 0.050, 0.060, 0.070, 0.080, 0.090, 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, or 0.9 mL.
[0089] In one embodiment, delivery of viral vector pharmaceutical compositions in accordance with the present invention to cells of the central nervous system (e.g., parenchyma) comprises infusion of between about 1 mL to about 120 mL. In one embodiment, delivery of viral vector pharmaceutical compositions in accordance with the present invention to cells of the central nervous system (e.g., parenchyma) may comprise infusion of 0.1, 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, or 120 mL. In one embodiment, delivery of AAV particles to cells of the central nervous system (e.g., parenchyma) comprises infusion of at least 3 mL. In one embodiment, delivery of AAV particles to cells of the central nervous system (e.g., parenchyma) consists of infusion of 3 mL. In one embodiment, delivery of AAV particles to cells of the central nervous system (e.g., parenchyma) comprises infusion of at least 10 mL. In one embodiment, delivery of AAV particles to cells of the central nervous system (e.g., parenchyma) consists of infusion of 10 mL.
[0090] In one embodiment, the volume of the viral vector pharmaceutical composition delivered to the cells of the central nervous system (e.g., parenchyma) of a subject is 50 ul, 100 ul, 200 ul, 300 ul, 400 ul, 500 ul, 600 ul, 700 ul, 800 ul, 900 ul, 1000 ul, 1100 ul, 1200 ul, 1300 ul, 1400 ul, 1500 ul, 1600 ul, 1700 ul, 1800 ul, 1900 ul, 2000 ul or more than 2000 ul.
[0091] In one embodiment, the volume of the viral vector pharmaceutical composition delivered to a region in both hemispheres of a subject brain is 50 ul, 100 ul, 200 ul, 300 ul, 400 ul, 500 ul, 600 ul, 700 ul, 800 ul, 900 ul, 1000 ul, 1100 ul, 1200 ul, 1300 ul, 1400 ul, 1500 ul, 1600 ul, 1700 ul, 1800 ul, 1900 ul, 2000 ul or more than 2000 ul. As a non-limiting example, the volume delivered to a region in both hemispheres is 200 ul. As another non-limiting example, the volume delivered to a region in both hemispheres is 900 ul. As yet another non-limiting example, the volume delivered to a region in both hemispheres is 1800 ul.
[0092] In one embodiment, the volume of the viral vector pharmaceutical composition delivered to the putamen in both hemispheres of a subject brain is 50 ul, 100 ul, 200 ul, 300 ul, 400 ul, 450 ul, 500 ul, 600 ul, 700 ul, 800 ul, 900 ul, 1000 ul, 1100 ul, 1200 ul, 1300 ul, 1400 ul, 1500 ul, 1600 ul, 1700 ul, 1800 ul, 1900 ul, 2000 ul or more than 2000 ul. As a non-limiting example, the volume delivered to the putamen in both hemispheres is 100 ul. As another non-limiting example, the volume delivered to the putamen in both hemispheres is 200 ul. As a non-limiting example, the volume delivered to the putamen in both hemispheres is 300 ul. As another non-limiting example, the volume delivered to the putamen in both hemispheres is 450 ul. As another non-limiting example, the volume delivered to the putamen in both hemispheres is 900 ul. As yet another non-limiting example, the volume delivered to the putamen both hemispheres is 1800 ul.
[0093] In one embodiment, the total volume delivered to a subject may be split between one or more administration sites e.g., 1, 2, 3, 4, 5 or more than 5 sites. As a non-limiting example, the total volume is split between administration to the left and right putamen. As another non-limiting example, the total volume is split between two sites of administration to each of the left and right putamen.
[0094] In one embodiment, the viral vector pharmaceutical composition is administered using a fenestrated needle. Non-limiting examples of fenestrated needles are described in U.S. Pat. Nos. 8,333,734, 7,135,010, 7,575,572, 7,699,852, 4,411,657, 6,890,319, 6,613,026, 6,726,659, 6,565,572, 6,520,949, 6,382,212, 5,848,996, 5,759,179, 5,674,267, 5,588,960, 5,484,401, 5,199,441, 5,012,818, 4,474,569, 3,766,907, 3,552,394, the contents of each of which are herein incorporated by reference in its entirety.
[0095] In one embodiment, a composition comprises AADC polynucleotides described herein and the AADC polynucleotides are components of an AAV viral genome packaged in an AAV viral particle. The percent (%) ratio of AAV viral particles comprising the AADC polynucleotide (also referred to herein and AADC particles) to the AAV viral particles without the AADC polynucleotide (also referred to herein as empty capsids) in the composition may be 0:100, 1:99, 0:90, 15:85, 25:75, 30:70, 50:50, 70:30, 85:15, 90:10, 99:1 or 100:0. As a non-limiting example, the percent ratio of AADC particles to empty capsids is 50:50. As another non-limiting example, the percent ratio of AADC particles to empty capsids is 70:30. As another non-limiting example, the percent ratio of AADC particles to empty capsids is 85:15. As another non-limiting example, the percent ratio of AADC particles to empty capsids is 100:0.
[0096] In one embodiment, the composition described herein comprises at least 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 51, 52, 53, 54, 55, 60, 65, 70, 75, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 or greater than 99% AADC particles. As a non-limiting example, the composition comprises at least 50% AADC particles. As another non-limiting example, the composition comprises at least 52% AADC particles. As another non-limiting example, the composition comprises at least 58% AADC particles. As another non-limiting example, the composition comprises at least 70% AADC particles. As another non-limiting example, the composition comprises at least 83% AADC particles. As another non-limiting example, the composition comprises at least 85% AADC particles. As another non-limiting example, the composition comprises at least 99% AADC particles. As another non-limiting example, the composition comprises 100% AADC particles.
[0097] In one embodiment, the composition described herein comprises 1-10%, 10-20%, 30-40%, 50-60%, 50-70%, 50-80%, 50-90%, 50-99%, 50-100%, 60-70%, 60-80%, 60-90%, 60-99%, 60-100%, 70-80%, 70-90%, 70-99%, 70-100%, 80-85%, 80-90%, 80-95%, 80-99%, 80-100%, 90-95%, 90-99%, or 90-100% AADC particles. As a non-limiting example, the composition described herein comprises 50-100% AADC particles. As another non-limiting example, the composition described herein comprises 50-60% AADC particles. As another non-limiting example, the composition described herein comprises 80-99% AADC particles. As another non-limiting example, the composition described herein comprises 80-90% AADC particles. As a non-limiting example, the composition described herein comprises 80-95% AADC particles. As a non-limiting example, the composition described herein comprises 80-85% AADC particles.
[0098] In one embodiment, the composition described herein comprises less than 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 51, 52, 53, 54, 55, 60, 65, 70, 75, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 or 100% empty particles. As a non-limiting example, the composition comprises less than 50% empty particles. As a non-limiting example, the composition comprises less than 45% empty particles. As a non-limiting example, the composition comprises less than 40% empty particles. As a non-limiting example, the composition comprises less than 35% empty particles. As a non-limiting example, the composition comprises less than 30% empty particles. As a non-limiting example, the composition comprises less than 25% empty particles. As a non-limiting example, the composition comprises less than 20% empty particles. As a non-limiting example, the composition comprises less than 15% empty particles. As a non-limiting example, the composition comprises less than 10% empty particles. As a non-limiting example, the composition comprises less than 5% empty particles. As a non-limiting example, the composition comprises less than 1% empty particles.
[0099] In the composition described herein comprises 1-10%, 10-20%, 30-40%, 50-60%, 50-70%, 50-80%, 50-90%, 50-99%, 50-100%, 60-70%, 60-80%, 60-90%, 60-99%, 60-100%, 70-80%, 70-90%, 70-99%, 70-100%, 80-85%, 80-90%, 80-95%, 80-99%, 80-100%, 90-95%, 90-99%, or 90-100% empty particles. As a non-limiting example, the composition described herein comprises 30-40% empty particles. As another non-limiting example, the composition described herein comprises 30-50% empty particles. As another non-limiting example, the composition described herein comprises 30-60% empty particles. As another non-limiting example, the composition described herein comprises 30-70% empty particles. As a non-limiting example, the composition described herein comprises 30-80% empty particles. As a non-limiting example, the composition described herein comprises 30-90% empty particles.
[0100] In one embodiment, the AADC polynucleotides described herein may be administered to a subject who is also undergoing levodopa therapy. As a non-limiting example, the subject may have a positive response to levodopa therapy and at least one symptom of PD is reduced. As another non-limiting example, the subject may have a response to levodopa therapy where the symptoms of PD experienced by the subject are stable. As yet another non-limiting example, the subject may have a negative response to levodopa therapy where the symptoms of PD experienced by the subject are increasing.
[0101] In one embodiment, the dose of levodopa administered to the subject prior to the AADC polynucleotides is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 or more than 25 mg/kg. As a non-limiting example, the dose is 3 mg/kg. As another non-limiting example, the dose is 10 mg/kg. As yet another non-limiting example, the dose is 20 mg/kg. The subject's response (e.g., behavioral response) to levodopa may be assessed prior to administration of the AADC polynucleotides. Additionally, the subject may be administered levodopa again after the administration of the AADC polynucleotides (e.g., 1 week, 2, weeks, 3 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 1 year or more than 1 year after the administration of AADC polynucleotides). The behavioral response can be re-assessed and compared to the initial response to determine the effects of the AADC polynucleotides. The subject may have 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or 100% behavioral improvement.
[0102] In one embodiment, Levodopa may be administered multiple times after the administration of the AADC polynucleotides. Levodopa may be administered on a repeating schedule (e.g., every 5 days, weekly, every 10 days, every 15 days, every 30 days, monthly, bimonthly, every 3 months, every 4 months, every 5 months, every 6 months, every 7 months, every 8 months, every 9 months, every 10 months, every 11 months or yearly) or as symptoms arise. As a non-limiting example, 3 years post administration of AADC polynucleotides a subject may have 1-10%, 5-15%, 10-20%, 15-30%, 20-40%, 25-50%, 30-50%, 40-50%, 40-60%, 50-70%, 50- 80%, 60-70%, 60-75%, 60-80%, 60-90%, 70-80%, 70-90%, 75-90%, 80-90%, 90-100% of the striatal neurons within the infused region of the putamen to be AADC-immunoreactive. As a non-limiting example, 6 years post administration of AADC polynucleotides a subject may have 1-10%, 5-15%, 10-20%, 15-30%, 20-40%, 25-50%, 30-50%, 40-50%, 40-60%, 50-70%, 50-80%, 60-70%, 60-75%, 60-80%, 60-90%, 70-80%, 70-90%, 75-90%, 80-90%, 90-100% of the striatal neurons within the infused region of the putamen to be AADC-immunoreactive. As a non-limiting example, 9 years post administration of AADC polynucleotides a subject may have 1-10%, 5-15%, 10-20%, 15-30%, 20-40%, 25-50%, 30-50%, 40-50%, 40-60%, 50-70%, 50-80%, 60-70%, 60-75%, 60-80%, 60-90%, 70-80%, 70-90%, 75-90%, 80-90%, 90-100% of the striatal neurons within the infused region of the putamen to be AADC-immunoreactive.
[0103] In one embodiment, a subject who may be administered the AADC polynucleotides described herein have a documented response to levodopa therapy but have medically refractory fluctuations and are considered good surgical candidates. The determination if a subject is a good surgical candidate may be made by the physician treating the subject for PD or the physician administering the AADC polynucleotides who takes into consideration the overall risk to benefit ratio for the patient for the surgical intervention required for delivery of the AADC polynucleotides.
[0104] In one embodiment, the ratio of distribution volume in the parenchyma of an area of a subject to the infusion volume of an area of a subject may be 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3.0, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4.0, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, 4.9, 5.0, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6.0 or more than 6.0. As a non-limiting example, the ratio of distribution volume in the parenchyma to infusion volume was 1.6 in the caudate nucleus. As a non-limiting example, the ratio of distribution volume in the parenchyma to infusion volume was 3.1 in the putamen. As a non-limiting example, the distribution of the AADC polynucleotides in the putamen may be 2-3 times the volume infused.
Dosing
[0105] The present invention provides methods comprising administering viral vectors and their AADC polynucleotide payload or complexes in accordance with the invention to a subject in need thereof. Viral vector pharmaceutical, imaging, diagnostic, or prophylactic compositions thereof, may be administered to a subject using any amount and any route of administration effective for preventing, treating, diagnosing, or imaging a disease, disorder, and/or condition (e.g., a disease, disorder, and/or condition relating to working memory deficits). The exact amount required will vary from subject to subject, depending on the species, age, and general condition of the subject, the severity of the disease, the particular composition, its mode of administration, its mode of activity, and the like. Compositions in accordance with the invention are typically formulated in unit dosage form for ease of administration and uniformity of dosage. It will be understood, however, that the total daily usage of the compositions of the present invention may be decided by the attending physician within the scope of sound medical judgment. The specific therapeutically effective, prophylactically effective, or appropriate imaging dose level for any particular patient will depend upon a variety of factors including the disorder being treated and the severity of the disorder; the activity of the specific compound employed; the specific composition employed; the age, body weight, general health, sex and diet of the patient; the time of administration, route of administration, and rate of excretion of the specific polynucleotide payload employed; the duration of the treatment; drugs used in combination or coincidental with the specific compound employed; and like factors well known in the medical arts.
[0106] In certain embodiments, viral vector pharmaceutical compositions in accordance with the present invention may be administered at AADC polynucleotide dosage levels sufficient to deliver from about 0.0001 mg/kg to about 100 mg/kg, from about 0.001 mg/kg to about 0.05 mg/kg, from about 0.005 mg/kg to about 0.05 mg/kg, from about 0.001 mg/kg to about 0.005 mg/kg, from about 0.05 mg/kg to about 0.5 mg/kg, from about 0.01 mg/kg to about 50 mg/kg, from about 0.1 mg/kg to about 40 mg/kg, from about 0.5 mg/kg to about 30 mg/kg, from about 0.01 mg/kg to about 10 mg/kg, from about 0.1 mg/kg to about 10 mg/kg, or from about 1 mg/kg to about 25 mg/kg, of subject body weight per day, one or more times a day, to obtain the desired therapeutic, diagnostic, prophylactic, or imaging effect. The desired AADC polynucleotide dosage may be delivered three times in a single day, two times in a single day, once in a single day or in a period of 24 hours the dosage may be delivered once, twice, three times or more than three times. In certain embodiments, the desired AADC polynucleotide dosage may be delivered using multiple administrations (e.g., two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, or more administrations). When multiple administrations are employed, split dosing regimens such as those described herein may be used. As used herein, a "split dose" is the division of single unit dose or total dose into two or more doses, e.g., two or more administrations of the single unit dose. As used herein, a "single unit dose" is a dose of any polynucleotide therapeutic administered in one dose/at one time/single route/single point of contact, i.e., single administration event. As used herein, a "total daily dose" is an amount given or prescribed in 24 hr period. It may be administered as a single unit dose. In one embodiment, the viral vectors comprising the AADC polynucleotides of the present invention are administered to a subject in split doses. They may be formulated in buffer only or in a formulation described herein.
[0107] In one embodiment, delivery of viral vector pharmaceutical compositions in accordance with the present invention to cells of the central nervous system (e.g., parenchyma) may comprise a total concentration between about 1.times.10.sup.6 VG/mL and about 1.times.10.sup.16 VG/mL. In some embodiments, delivery may comprise a composition concentration of about 1.times.10.sup.6, 2.times.10.sup.6, 3.times.10.sup.6, 4.times.10.sup.6, 5.times.10.sup.6, 6.times.10.sup.6, 7.times.10.sup.6, 8.times.10.sup.6, 9.times.10.sup.6, 1.times.10.sup.7, 2.times.10.sup.7, 3.times.10.sup.7, 4.times.10.sup.7, 5.times.10.sup.7, 6.times.10.sup.7, 7.times.10.sup.7, 8.times.10.sup.7, 9.times.10.sup.7, 1.times.10.sup.8, 2.times.10.sup.8, 3.times.10.sup.8, 4.times.10.sup.8, 5.times.10.sup.8, 6.times.10.sup.8, 7.times.10.sup.8, 8.times.10.sup.8, 9.times.10.sup.8, 1.times.10.sup.9, 2.times.10.sup.9, 3.times.10.sup.9, 4.times.10.sup.9, 5.times.10.sup.9, 6.times.10.sup.9, 7.times.10.sup.9, 8.times.10.sup.9, 9.times.10.sup.9, 1.times.10.sup.10, 2.times.10.sup.10, 3.times.10.sup.10, 4.times.10.sup.10, 5.times.10.sup.10, 6.times.10.sup.10, 7.times.10.sup.10, 8.times.10.sup.10, 9.times.10.sup.10, 1.times.10.sup.11, 1.8.times.10.sup.11, 2.times.10.sup.11, 3.times.10.sup.11, 4.times.10.sup.11, 5.times.10.sup.11, 5.5.times.10.sup.11, 6.times.10.sup.11, 7.times.10.sup.11, 8.times.10.sup.11, 9.times.10.sup.11, 0.8.times.10.sup.12, 0.83.times.10.sup.12, 1.times.10.sup.12, 1.1.times.10.sup.12, 1.2.times.10.sup.12, 1.3.times.10.sup.12, 1.4.times.10.sup.12, 1.5.times.10.sup.12, 1.6.times.10.sup.12, 1.7.times.10.sup.12, 1.8.times.10.sup.12, 1.9.times.10.sup.12, 2.times.10.sup.12, 2.1.times.10.sup.12, 2.2.times.10.sup.12, 2.3.times.10.sup.12, 2.4.times.10.sup.12, 2.5.times.10.sup.12, 2.6.times.10.sup.12, 2.7.times.10.sup.12, 2.8.times.10.sup.12, 2.9.times.10.sup.12, 3.times.10.sup.12, 3.1.times.10.sup.12, 3.2.times.10.sup.12, 3.3.times.10.sup.12, 3.4.times.10.sup.12, 3.5.times.10.sup.12, 3.6.times.10.sup.12, 3.7.times.10.sup.12, 3.8.times.10.sup.12, 3.9.times.10.sup.12, 4.times.10.sup.12, 4.1.times.10.sup.12, 4.2.times.10.sup.12, 4.3.times.10.sup.12, 4.4.times.10.sup.12, 4.5.times.10.sup.12, 4.6.times.10.sup.12, 4.7.times.10.sup.12, 4.8.times.10.sup.12, 4.9.times.10.sup.12, 5.times.10.sup.12, 6.times.10.sup.12, 7.times.10.sup.12, 8.times.10.sup.12, 9.times.10.sup.12, 1.times.10.sup.13, 2.times.10.sup.13, 3.times.10.sup.13, 4.times.10.sup.13, 5.times.10.sup.13, 6.times.10.sup.13, 7.times.10.sup.13, 8.times.10.sup.13, 9.times.10.sup.13, 1.times.10.sup.14, 2.times.10.sup.14, 3.times.10.sup.14, 4.times.10.sup.14, 5.times.10.sup.14, 6.times.10.sup.14, 7.times.10.sup.14, 8.times.10.sup.14, 9.times.10.sup.14, 1.times.10.sup.15, 2.times.10.sup.15, 3.times.10.sup.15, 4.times.10.sup.15, 5.times.10.sup.15, 6.times.10.sup.15, 7.times.10.sup.15, 8.times.10.sup.15, 9.times.10.sup.15, or 1.times.10.sup.16 VG/mL. In one embodiment, the concentration of the viral vector in the composition is 1.times.10.sup.13 VG/mL. In one embodiment, the concentration of the viral vector in the composition is 3.times.10.sup.12 VG/mL. In one embodiment, the concentration of the viral vector in the composition is 1.1.times.10.sup.12 VG/mL. In one embodiment, the concentration of the viral vector in the composition is 3.7.times.10.sup.12 VG/mL. In one embodiment, the concentration of the viral vector in the composition is 8.times.10.sup.11 VG/mL. In one embodiment, the concentration of the viral vector in the composition is 2.6.times.10.sup.12 VG/mL. In one embodiment, the concentration of the viral vector in the composition is 4.9.times.10.sup.12 VG/mL. In one embodiment, the concentration of the viral vector in the composition is 0.8.times.10.sup.12 VG/mL. In one embodiment, the concentration of the viral vector in the composition is 0.83.times.10.sup.12 VG/mL. In one embodiment, the concentration of the viral vector in the composition is the maximum final dose which can be contained in a vial.
[0108] In one embodiment, delivery of viral vector pharmaceutical compositions in accordance with the present invention to cells of the central nervous system (e.g., parenchyma) may comprise a total concentration per subject between about 1.times.10.sup.6 VG and about 1.times.10.sup.16 VG. In some embodiments, delivery may comprise a composition concentration of about 1.times.10.sup.6, 2.times.10.sup.6, 3.times.10.sup.6, 4.times.10.sup.6, 5.times.10.sup.6, 6.times.10.sup.6, 7.times.10.sup.6, 8.times.10.sup.6, 9.times.10.sup.6, 1.times.10.sup.7, 2.times.10.sup.7, 3.times.10.sup.7, 4.times.10.sup.7, 5.times.10.sup.7, 6.times.10.sup.7, 7.times.10.sup.7, 8.times.10.sup.7, 9.times.10.sup.7, 1.times.10.sup.8, 2.times.10.sup.8, 3.times.10.sup.8, 4.times.10.sup.8, 5.times.10.sup.8, 6.times.10.sup.8, 7.times.10.sup.8, 8.times.10.sup.8, 9.times.10.sup.8, 1.times.10.sup.9, 2.times.10.sup.9, 3.times.10.sup.9, 4.times.10.sup.9, 5.times.10.sup.9, 6.times.10.sup.9, 7.times.10.sup.9, 8.times.10.sup.9, 9.times.10.sup.9, 1.times.10.sup.10, 1.5.times.10.sup.10, 2.times.10.sup.10, 3.times.10.sup.10, 4.times.10.sup.10, 5.times.10.sup.10, 6.times.10.sup.10, 7.times.10.sup.10, 8.times.10.sup.1.degree., 9.times.10.sup.10, 1.times.10.sup.11, 1.3.times.10.sup.11, 2.times.10.sup.11, 2.1.times.10.sup.11, 2.2.times.10.sup.11, 2.3.times.10.sup.11, 2.4.times.10.sup.11, 2.5.times.10.sup.11, 2.6.times.10.sup.11, 2.7.times.10.sup.11, 2.8.times.10.sup.11, 2.9.times.10.sup.11, 3.times.10.sup.11, 4.times.10.sup.11, 5.times.10.sup.11, 5.4.times.10.sup.11, 6.times.10.sup.11, 7.times.10.sup.11, 7.1.times.10.sup.11, 7.2.times.10.sup.11, 7.3.times.10.sup.11, 7.4.times.10.sup.11, 7.5.times.10.sup.11, 7.6.times.10.sup.11, 7.7.times.10.sup.11, 7.8.times.10.sup.11, 7.9.times.10.sup.11, 8.times.10.sup.11, 9.times.10.sup.11, 9.4.times.10.sup.11, 1.times.10.sup.12, 1.1.times.10.sup.12, 1.2.times.10.sup.12, 1.3.times.10.sup.12, 1.4.times.10.sup.12, 1.5.times.10.sup.12, 1.6.times.10.sup.12, 1.7.times.10.sup.12, 1.8.times.10.sup.12, 1.9.times.10.sup.12, 2.times.10.sup.12, 2.3.times.10.sup.12, 2.4.times.10.sup.12, 3.times.10.sup.12, 4.times.10.sup.12, 4.1.times.10.sup.12, 4.2.times.10.sup.12, 4.3.times.10.sup.12, 4.4.times.10.sup.12, 4.5.times.10.sup.12, 4.6.times.10.sup.12, 4.7.times.10.sup.12, 4.8.times.10.sup.12, 4.9.times.10.sup.12, 5.times.10.sup.12, 6.times.10.sup.12, 7.times.10.sup.12, 8.times.10.sup.12, 8.1.times.10.sup.12, 8.2.times.10.sup.12, 8.3.times.10.sup.12, 8.4.times.10.sup.12, 8.5.times.10.sup.12, 8.6.times.10.sup.12, 8.7.times.10.sup.12, 8.8.times.10.sup.12, 8.9.times.10.sup.12, 9.times.10.sup.12, 1.times.10.sup.13, 2.times.10.sup.13, 3.times.10.sup.13, 4.times.10.sup.13, 5.times.10.sup.13, 6.times.10.sup.13, 7.times.10.sup.13, 8.times.10.sup.13, 9.times.10.sup.13, 1.times.10.sup.14, 2.times.10.sup.14, 3.times.10.sup.14, 4.times.10.sup.14, 5.times.10.sup.14, 6.times.10.sup.14, 7.times.10.sup.14, 8.times.10.sup.14, 9.times.10.sup.14, 1.times.10.sup.15, 2.times.10.sup.15, 3.times.10.sup.15, 4.times.10.sup.15, 5.times.10.sup.15, 6.times.10.sup.15, 7.times.10.sup.15, 8.times.10.sup.15, 9.times.10.sup.15, or 1.times.10.sup.16 VG/subject. In one embodiment, the concentration of the viral vector in the composition is 1.times.10.sup.13 VG/subject. In one embodiment, the concentration of the viral vector in the composition is 3.times.10.sup.12 VG/subject. As a non-limiting example, the composition administered to the subject has a concentration of about 3.times.10.sup.11 VG/subject. As a non-limiting example, the composition administered to the subject has a concentration of about 9.times.10.sup.11 VG/subject. In one embodiment, the concentration of the viral vector in the composition is 2.3.times.10.sup.11 VG/subject. In one embodiment, the concentration of the viral vector in the composition is 7.2.times.10.sup.11 VG/subject. In one embodiment, the concentration of the viral vector in the composition is 7.5.times.10.sup.11 VG/subject. In one embodiment, the concentration of the viral vector in the composition is 1.4.times.10.sup.12 VG/subject. In one embodiment, the concentration of the viral vector in the composition is 4.8.times.10.sup.12 VG/subject. In one embodiment, the concentration of the viral vector in the composition is 8.8.times.10.sup.12 VG/subject. In one embodiment, the concentration of the viral vector in the composition is 2.3.times.10.sup.12 VG/subject.
[0109] In one embodiment, the effectiveness of the dose, route of administration and/or volume of administration may be evaluated using various methods described herein such as, but not limited to, PET imaging, L-DOPA challenge test (e.g., see Forsayeth et al. 2006, Mol. Ther. 14(4): 571-577), UPDRS scores and patient diaries. As a non-limiting example, a subject may have decreased dyskinesia or periods of decreased dyskinesia after administration of the AADC polynucleotide composition. As another non-limiting example, a subject may have a decrease in Parkinson's Disease related symptoms including limited mobility and dyskinesia. As yet another non-limiting example, a subject may show improvement in off time and motor fluctuations. The improvement may be at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90% or greater than 90%. The improvement may last for minutes (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55 or more than 55), hours (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23 or more than 24), days (e.g., 1, 2, 3, 4, 5, 6 or more than 7), weeks (1, 2, 3, 4, 5, 6, 7 or more than 7), months (1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 or more than 11) or years (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9 or more than 9).
[0110] In one embodiment, the selection of subjects for administration of the viral vectors described herein and/or the effectiveness of the dose, route of administration and/or volume of administration may be evaluated using imaging of the perivascular spaces (PVS) which are also known as Virchow-Robin spaces. PVS surround the arterioles and venules as they perforate brain parenchyma and are filled with cerebrospinal fluid (CSF)/interstitial fluid. PVS are common in the midbrain, BG, and centrum semiovale. While not wishing to be bound by theory, PVS may play a role in the normal clearance of metabolites and have been associated with worse cognition and several disease states including Parkinson's disease. PVS are usually normal in size but they can increase in size in a number of disease states. Potter et al. (Cerebrovasc Dis. 2015 January; 39(4): 224-231; the contents of which are herein incorporated by reference in its entirety) developed a grading method where they studied a full range of PVS and rated basal ganglia, centrum semiovale and midbrain PVS. They used the frequency and range of PVS used by Mac and Lullich et al. (J Neurol Neurosurg Psychiatry. 2004 November; 75(11):1519-23; the contents of which are herein incorporated by reference in its entirety) and Potter et al. gave 5 ratings to basal ganglia and centrum semiovale PVS: 0 (none), 1 (1-10), 2 (11-20), 3 (21-40) and 4 (>40) and 2 ratings to midbrain PVS: 0 (non visible) or 1 (visible). The user guide for the rating system by Potter et al. can be found at: www.sbirc.ed.ac.uk/documents/epvs-rating-scale-user-guide.pdf.
[0111] In one embodiment, the selection of subjects for administration of the viral vectors described herein and/or the effectiveness of the dose, route of administration and/or volume of administration may be evaluated using positron emission tomography (PET) measurements of neuroimaging biomarkers such as, but not limited to [.sup.18F]FDOPA. Neuroimaging biomarkers such as [.sup.18F]FDOPA may be used to identify affected individuals and/or may be used to detect a nigrostriatal defect prior to the onset of clinical manifestations. Further, PET-based criteria may be used to categorize subjects based on their nigrostriatal neuronal integrity (e.g., abnormal, normal or uncertain nigrostriatal neuronal integrity) (Rachette et al. Am J Med Genet B Neuropsychiatr Genet. 2006 Apr. 5; 141B(3): 245-249; the contents of which are herein incorporated by reference in its entirety).
[0112] In one embodiment, a subject who may be administered a dose of the AADC polynucleotides described herein may have advanced PD and still respond to levodopa therapy but the subject also experiences medically refractory motor complications (e.g., sever motor fluctuations and/or dyskinesias that occur during levodopa and other dopaminergic therapies despite adjustments in and optimization of medication). The subject may be healthy enough to undergo a neurosurgical procedure which may be determined by methods known in the art. As a non-limiting example, the subject may meet the selection criteria for deep brain stimulation (DBS). The subject may have idiopathic PD, younger than 69 years of age, have pronounced responses to levodopa, have medication-refractory symptoms (e.g., motor fluctuation and/or dyskinesia) and/or have little or no cognitive dysfunction.
[0113] In one embodiment, a subject who may be administered a dose of the AADC polynucleotides described herein may also suffer from dementia or cognitive impairment.
[0114] In one embodiment, a subject who may be administered a dose of the AADC polynucleotides described herein may have been previously treated with the same or similar therapeutic. In another embodiment, a subject may have been treated with a therapeutic which has been shown to reduce the symptoms of Parkinson's Disease.
[0115] In one embodiment, a subject who may be administered a dose of the AADC polynucleotides described herein may have failed to derive adequate benefit from standard medical therapy. As a non-limiting example, the subject may not have responded to treatment. As another non-limiting example, a subject may have residual disability despite treatment.
[0116] In one embodiment, a subject who may be administered a dose of the AADC polynucleotides described herein may undergo testing to evaluate the levels of neurotransmitter analytes to determine the effectiveness of the dose. As a non-limiting example, CSF neurotransmitters, plasma AADC activity and/or urine VLA may be analyzed.
[0117] In one embodiment, a subject who may be administered a dose of the AADC polynucleotide described herein may be videotaped or recorded in order to monitor the progress of the subject during the course of treatment.
Combinations
[0118] The viral vectors comprising the AADC polynucleotide may be used in combination with one or more other therapeutic, prophylactic, diagnostic, or imaging agents. By "in combination with," it is not intended to imply that the agents must be administered at the same time and/or formulated for delivery together, although these methods of delivery are within the scope of the present disclosure. Compositions can be administered concurrently with, prior to, or subsequent to, one or more other desired therapeutics or medical procedures. In general, each agent will be administered at a dose and/or on a time schedule determined for that agent. In some embodiments, the present disclosure encompasses the delivery of pharmaceutical, prophylactic, diagnostic, or imaging compositions in combination with agents that may improve their bioavailability, reduce and/or modify their metabolism, inhibit their excretion, and/or modify their distribution within the body.
Delivery
[0119] In one embodiment, the viral vector comprising an AADC polynucleotide may be administered or delivered using the methods for the delivery of AAV virions described in European Patent Application No. EP1857552, the contents of which are herein incorporated by reference in its entirety.
[0120] In one embodiment, the viral vector comprising an AADC polynucleotide may be administered or delivered using the methods for delivering proteins using AAV vectors described in European Patent Application No. EP2678433, the contents of which are herein incorporated by reference in its entirety.
[0121] In one embodiment, the viral vector comprising an AADC polynucleotide may be administered or delivered using the methods for delivering DNA molecules using AAV vectors described in U.S. Pat. No. 5,858,351, the contents of which are herein incorporated by reference in its entirety.
[0122] In one embodiment, the viral vector comprising an AADC polynucleotide may be administered or delivered using the methods for delivering DNA to the bloodstream described in U.S. Pat. No. 6,211,163, the contents of which are herein incorporated by reference in its entirety.
[0123] In one embodiment, the viral vector comprising an AADC polynucleotide may be administered or delivered using the methods for delivering AAV virions described in U.S. Pat. No. 6,325,998, the contents of which are herein incorporated by reference in its entirety.
[0124] In one embodiment, the viral vector comprising an AADC polynucleotide may be administered or delivered using the methods for delivering a payload to the central nervous system described in U.S. Pat. No. 7,588,757, the contents of which are herein incorporated by reference in its entirety.
[0125] In one embodiment, the viral vector comprising an AADC polynucleotide may be administered or delivered using the methods for delivering a payload described in U.S. Pat. No. 8,283,151, the contents of which are herein incorporated by reference in its entirety.
[0126] In one embodiment, the viral vector comprising an AADC polynucleotide may be administered or delivered using the methods for delivering a payload using a glutamic acid decarboxylase (GAD) delivery vector described in International Patent Publication No. WO2001089583, the contents of which are herein incorporated by reference in its entirety.
[0127] In one embodiment, the viral vector comprising an AADC polynucleotide may be administered or delivered using the methods for delivering a payload to neural cells described in International Patent Publication No. WO2012057363, the contents of which are herein incorporated by reference in its entirety.
[0128] The pharmaceutical compositions of viral vectors described herein may be characterized by one or more of bioavailability, therapeutic window and/or volume of distribution.
Bioavailability
[0129] Viral vectors comprising an AADC polynucleotide of the present invention, when formulated into compositions with delivery/formulation agents or vehicles as described herein, may exhibit increased bioavailability as compared to compositions lacking delivery agents as described herein. As used herein, the term "bioavailability" refers to the systemic availability of a given amount of a particular agent administered to a subject. Bioavailability may be assessed by measuring the area under the curve (AUC) or the maximum serum or plasma concentration (C.sub.max) of the unchanged form of a compound following administration of the compound to a mammal. AUC is a determination of the area under the curve plotting the serum or plasma concentration of a compound along the ordinate (Y-axis) against time along the abscissa (X-axis). Generally, the AUC for a particular compound may be calculated using methods known to those of ordinary skill in the art and as described in G. S. Banker, Modern Pharmaceutics, Drugs and the Pharmaceutical Sciences, v. 72, Marcel Dekker, New York, Inc., 1996, the contents of which are herein incorporated by reference in their entirety.
[0130] C.sub.max values are maximum concentrations of compounds achieved in serum or plasma of a subject following administration of compounds to the subject. C.sub.max values of particular compounds may be measured using methods known to those of ordinary skill in the art. As used herein, the phrases "increasing bioavailability" or "improving the pharmacokinetics," refer to actions that may increase the systemic availability of a viral vector of the present invention (as measured by AUC, C.sub.max, or C.sub.min) in a subject. In some embodiments, such actions may comprise co-administration with one or more delivery agents as described herein. In some embodiments, the bioavailability of viral vectors may increase by at least about 2%, at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95% or about 100%.
Therapeutic Window
[0131] Viral vectors comprising an AADC polynucleotide of the present invention, when formulated with one or more delivery agents as described herein, may exhibit increases in the therapeutic window of compound and/or composition administration as compared to the therapeutic window of viral vectors administered without one or more delivery agents as described herein. As used herein, the term "therapeutic window" refers to the range of plasma concentrations, or the range of levels of therapeutically active substance at the site of action, with a high probability of eliciting a therapeutic effect. In some embodiments, therapeutic windows of viral vectors when administered in a formulation may increase by at least about 2%, at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95% or about 100%.
Volume of Distribution
[0132] Viral vectors comprising an AADC polynucleotide of the present invention, when formulated with one or more delivery agents as described herein, may exhibit an improved volume of distribution (V.sub.dist), e.g., reduced or targeted, relative to formulations lacking one or more delivery agents as described herein. V.sub.dist relates the amount of an agent in the body to the concentration of the same agent in the blood or plasma. As used herein, the term "volume of distribution" refers to the fluid volume that would be required to contain the total amount of an agent in the body at the same concentration as in the blood or plasma: V.sub.dist equals the amount of an agent in the body/concentration of the agent in blood or plasma. For example, for a 10 mg dose of a given agent and a plasma concentration of 10 mg/L, the volume of distribution would be 1 liter. The volume of distribution reflects the extent to which an agent is present in the extravascular tissue. Large volumes of distribution reflect the tendency of agents to bind to the tissue components as compared with plasma proteins. In clinical settings, V.sub.dist may be used to determine loading doses to achieve steady state concentrations. In some embodiments, volumes of distribution of viral vector compositions of the present invention when co-administered with one or more delivery agents as described herein may decrease at least about 2%, at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%.
Kits and Devices
[0133] The invention provides a variety of kits for conveniently and/or effectively carrying out methods of the present invention. Typically kits will comprise sufficient amounts and/or numbers of components to allow a user to perform multiple treatments of a subject(s) and/or to perform multiple experiments.
[0134] Any of the AADC vectors, AADC constructs, AADC polynucleotides, or AADC polypeptides of the present invention may be comprised in a kit. In some embodiments, kits may further include reagents and/or instructions for creating and/or synthesizing compounds and/or compositions of the present invention. In some embodiments, kits may also include one or more buffers. In some embodiments, kits of the invention may include components for making protein or nucleic acid arrays or libraries and thus, may include, for example, solid supports.
[0135] In some embodiments, kit components may be packaged either in aqueous media or in lyophilized form. The container means of the kits will generally include at least one vial, test tube, flask, bottle, syringe or other container means, into which a component may be placed, and preferably, suitably aliquoted. Where there are more than one kit component, (labeling reagent and label may be packaged together), kits may also generally contain second, third or other additional containers into which additional components may be separately placed. In some embodiments, kits may also comprise second container means for containing sterile, pharmaceutically acceptable buffers and/or other diluents. In some embodiments, various combinations of components may be comprised in one or more vial. Kits of the present invention may also typically include means for containing compounds and/or compositions of the present invention, e.g., proteins, nucleic acids, and any other reagent containers in close confinement for commercial sale. Such containers may include injection or blow-molded plastic containers into which desired vials are retained.
[0136] In some embodiments, kit components are provided in one and/or more liquid solutions. In some embodiments, liquid solutions are aqueous solutions, with sterile aqueous solutions being particularly preferred. In some embodiments, kit components may be provided as dried powder(s). When reagents and/or components are provided as dry powders, such powders may be reconstituted by the addition of suitable volumes of solvent. In some embodiments, it is envisioned that solvents may also be provided in another container means. In some embodiments, labeling dyes are provided as dried powders. In some embodiments, it is contemplated that 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 120, 120, 130, 140, 150, 160, 170, 180, 190, 200, 300, 400, 500, 600, 700, 800, 900, 1000 micrograms or at least or at most those amounts of dried dye are provided in kits of the invention. In such embodiments, dye may then be resuspended in any suitable solvent, such as DMSO.
[0137] In some embodiments, kits may include instructions for employing kit components as well the use of any other reagent not included in the kit. Instructions may include variations that may be implemented.
Devices
[0138] In some embodiments, AADC compounds and/or AADC compositions of the present invention may be combined with, coated onto or embedded in a device. Devices may include, but are not limited to stents, pumps, and/or other implantable therapeutic device. Additionally AADC compounds and/or AADC compositions may be delivered to a subject while the subject is using a compression device such as, but not limited to, a compression device to reduce the chances of deep vein thrombosis (DVT) in a subject.
[0139] The present invention provides for devices which may incorporate viral vectors that encode one or more AADC polynucleotide payload molecules. These devices contain in a stable formulation the viral vectors which may be immediately delivered to a subject in need thereof, such as a human patient.
[0140] Devices for administration may be employed to deliver the viral vectors comprising an AADC polynucleotide of the present invention according to single, multi- or split-dosing regimens taught herein.
[0141] Method and devices known in the art for multi-administration to cells, organs and tissues are contemplated for use in conjunction with the methods and compositions disclosed herein as embodiments of the present invention. These include, for example, those methods and devices having multiple needles, hybrid devices employing for example lumens or catheters as well as devices utilizing heat, electric current or radiation driven mechanisms.
[0142] In some embodiments, AADC compounds and/or AADC compositions of the present invention may be delivered using a device such as, but not limited to, a stent, a tube, a catheter, a pipe, a straw, needle and/or a duct. Methods of using these devices are described herein and are known in the art.
[0143] In one embodiment, the AADC polynucleotides of the present invention may be administered to a subject using delivery systems which integrate image guided therapy and integrate imaging such as, but not limited to, laser, MRgFUS, endoscopic and robotic surgery devices.
[0144] In one embodiment, the AADC polynucleotides of the present invention may be administered to a subject using the CLEARPOINT.RTM. neuro intervention system by MRI Interventions, Inc. The CLEARPOINT.RTM. neuro intervention system may be used alone or in combination with any of the other administration methods and devices described herein. The CLEARPOINT.RTM. neuro intervention system helps to provide stereotactic guidance in the placement and operation of instruments or devices during the planning and operation of neurological procedures.
[0145] In one embodiment, the AADC polynucleotides of the present invention may be administered to a subject using the NEUROMATE.RTM. stereotactic robot system by Renishaw PLC. The NEUROMATE.RTM. system may be used alone or in combination with any of the other administration methods and devices described herein. As a non-limiting example, the NEUROMATE.RTM. system may be used with head holders, CT image localizers, frame attachments, remote controls and software.
[0146] In one embodiment, the AADC polynucleotides of the present invention may be administered to a subject using the Elekta MICRODRIVE.TM. device by Elekta AB. The MICRODRIVE.TM. device may be used alone or in combination with any of the other administration methods and devices described herein. As a non-limiting example, the MICRODRIVE.TM. device may be used to position electrodes (e.g., for micro electrode recording (MER), macro stimulation and deep brain stimulation (DBS) electrode implantation), implantation of catheters, tubes or DBS electrodes using cross-hair and A-P holders to verify position, biopsies, injections and aspirations, brain lesioning, endoscope guidance and GAMMA KNIFE.RTM. radiosurgery.
[0147] In one embodiment, the AADC polynucleotides of the present invention may be administered to a subject using the AXIIIS.RTM. stereotactic miniframe by MONTERIS.RTM. Medical, Inc. The AXIIIS.RTM. stereotactic miniframe may be used alone or in combination with any of the other administration methods and devices described herein. The AXIIIS.RTM. stereotactic miniframe is a trajectory alignment device which may be used for laser coagulation, biopsies, catheter placement, electrode implant, endoscopy, and clot evacuation. The miniframe allows for 360 degree interface and provides access to multiple intracranial targets with a simple adjustment. Further, the miniframe is compatible with MM.
[0148] In one embodiment, the AADC polynucleotides of the present invention may be administered to a subject using the INTEGRA.TM. CRW.RTM. system by Integra LifeSciences Corporation. The INTEGRA.TM. CRW.RTM. system may be used alone or in combination with any of the other administration methods and devices described herein. The CRW.RTM. system may be used for various applications such as, but not limited to, stereotactic surgery, microsurgery, catheterization and biopsy. The CRW.RTM. system is designed to provide accuracy to those who use the system (e.g., thumb lock screws, Vernier scaling, double bolt fixation, and a solid frame).
[0149] In one embodiment, the AADC polynucleotides of the present invention may be administered to a subject using the EPOCH.RTM. solution system by Stereotaxis, Inc. which may include the NIOBE.RTM. ES magnetic navigation system, the VDRIVE.RTM. robotic navigation system and/or the ODYSSEY.RTM. information solution (all by Stereotaxis, Inc.). The EPOCH.RTM. solution system may be used alone or in combination with any of the other administration methods and devices described herein. As a non-limiting example, the NIOBE.RTM. ES magnetic navigation system may be used to accurately contact a subject. As another non-limiting example the NIOBE.RTM. ES magnetic system may be used with the VDRIVE.RTM. robotic navigation system to provide precise movement and stability.
[0150] In one embodiment, the AADC polynucleotides of the present invention may be administered to a subject using a NeuroStation workstation which uses frameless stereotactic methods to provide image-guidance for applications such as, but not limited to, surgical planning, biopsies, craniotomies, endoscopy, intra-operative ultrasound and radiation therapy.
[0151] In one embodiment, the AADC polynucleotides of the present invention may be administered to a subject using a robotic stereotaxis system such as, but not limited to the device described in U.S. Pat. No. 5,078,140, the contents of which are herein incorporated by reference in its entirety. The robotic arm of the device may be used to precisely orient the surgical tools or other implements used to conduct a procedure.
[0152] In one embodiment, the AADC polynucleotides of the present invention may be administered to a subject using an automatic delivery system such as, but not limited to the device described in U.S. Pat. No. 5,865,744, the contents of which are herein incorporated by reference in its entirety. Based on the images gathered by the delivery system, the computer adjusts the administration of the needle to be the appropriate depth for the particular subject.
[0153] In one embodiment, the AADC polynucleotides of the present invention may be administered to a subject who is simultaneously using during administration, and/or uses for a period of time before and/or after administration a compression device such as, but not limited to, a compression device which reduces the chances of deep vein thrombosis (DVT) in a subject. The compression device may be used for at least 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, or more than 8 hours before a subject is administered the AADC polynucleotides. The compression device may be used for at least 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 9 hours, 10 hours, 11 hours, 12 hours, 13 hours, 14 hours, 15 hours, 16 hours, 17 hours, 18 hours, 19 hours, 20 hours, 21 hours, 22 hours, 23 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 1 week, 2 weeks, 3 weeks or a month after the AADC polynucleotides are administered. As a non-limiting example, the compression device is used simultaneously during the procedure of the delivery of the AADC polynucleotides. As another non-limiting example, the compression device is used before the administration of the AADC polynucleotides. As another non-limiting example, the compression device is used after administration of the AADC polynucleotides. As another non-limiting example, the compression device is used before, during and after administration of the AADC polynucleotides.
[0154] Non-limiting examples, of compression devices include ActiveCare+S.F.T. intermittent compression device, ActiveCare+S.F.T pneumatic compression device, DVTlite's Venowave, KCl system compression pump, Aircast VenaFlow system, SCD Express Compression System or Bio Compression Systems, Inc. pneumatic compression therapy equipment (e.g., the pump may be selected from Model SC-2004, Model SC-2004-FC, Model SC-3004, Model SC-3004-FC, Model SC-2008, Model SC-2008-DL, Model SC-3008-T, the BioCryo system, Model IC-BAP-DL or multi-flo DVT combo IC 1545-DL and the garment used with the pump may be a 4 chamber, 8 chamber, BioCryo, Multi-Flo or BioArterial garment).
CNS Diseases
[0155] The polynucleotides of the present invention may be used in the treatment, prophylaxis or amelioration of any disease or disorder characterized by aberrant or undesired target expression. In one embodiment, the invention relates to compositions, particularly nucleic acid molecules, e.g., polynucleotides encoding AADC, for use in the treatment of Parkinson's disease.
[0156] In some embodiments, the polynucleotides of the invention may be used in the treatment, prophylaxis or amelioration of any disease or disorder characterized by aberrant or undesired target expression wherein the payload, i.e. AADC, is swapped for an alternate payload.
[0157] The present disclosure provides a method for treating a disease, disorder and/or condition in a mammalian subject, including a human subject, comprising administering to the subject any of the viral particles e.g., AAV, AAV polynucleotides or AAV genomes described herein (i.e., viral genomes or "VG") or administering to the subject a particle comprising said AAV polynucleotide or AAV genome, or administering to the subject any of the described compositions, including pharmaceutical compositions.
[0158] In one embodiment, the disease, disorder and/or condition is a neurological disease, disorder and/or condition. The CNS diseases may be diseases that affect any component of the brain (including the cerebral hemispheres, diencephalon, brain stem, and cerebellum) or the spinal cord.
[0159] In some embodiments, viral particles of the present invention, through delivery of a functional payload that is a therapeutic product that can modulate the level or function of a gene product in the CNS, may be used to treat a neurodegenerative diseases and/or diseases or disorders that are characteristic with neurodegeneration, neuromuscular diseases, lysosomal diseases, trauma, bone marrow injuries, pain (including neuropathic pain), cancers of the nervous system, demyelinating diseases, autoimmune diseases of the nervous system, neurotoxic syndromes, sleeping disorders, genetic brain disorders and developmental CNS disorders. A functional payload may alleviate or reduce symptoms that result from abnormal level and/or function of a gene product (e.g., an absence or defect in a protein) in a subject in need thereof or that otherwise confers a benefit to a CNS disorder in a subject in need thereof.
[0160] As non-limiting examples, therapeutic products delivered by viral particles of the present invention may include, but are not limited to, growth and trophic factors, cytokines, hormones, neurotransmitters, enzymes, anti-apoptotic factors, angiogenic factors, and any protein known to be mutated in pathological disorders such as the "survival of motor neuron" protein (SMN); antisense RNA or RNAi targeting messenger RNAs coding for proteins having a therapeutic interest in any of CNS diseases discussed herein; or microRNAs that function in gene silencing and post-transcriptionally regulation of gene expression in the CNS (e.g., brain specific Mir-128.alpha., See Adlakha and Saini, Molecular cancer, 2014, 13:33). For example, an RNAi targeting the superoxide dismutase enzyme may be packaged by viral particles of the present invention, for the treatment of ALS.
[0161] The growth and trophic factors may include, but are not limited to brain-derived growth factor (BDNF), epidermal growth factor (EGF), basic Fibroblast growth factor (bFGF), Ciliary neurotrophic factor (CNTF), corticotropin-releasing factor (CRF), Glial cell line derived growth factor (GDNF), Insulin-like growth factor-1 (IGF-1), nerve growth factor (NGF), neurotrophin-3 (NT-3), neurotrophin-4 (NT-4), and vascular endothelial growth factor (VEGF). Cytokines may include interleukin-10 (IL-10), interleukin-6, Interleukin-8, chemokine CXCL12 (SDF-1), TGF-beta, and Growth and differentiation factor (GDF-1/10).
[0162] In some embodiments, the neurological disorders may be neurodegenerative disorders including, but not limited to, Alzheimer's Diseases (AD); Amyotrophic lateral sclerosis (ALS); Creutzfeldt-Jakob Disease (CJD); Huntingtin's disease (HD); Friedreich's ataxia (FA); Parkinson Disease (PD); Multiple System Atrophy (MSA); Spinal Muscular Atrophy (SMA), Multiple Sclerosis (MS); Primary progressive aphasia; Progressive supranuclear palsy (PSP); Dementia; Brain Cancer, Degenerative Nerve Diseases, Encephalitis, Epilepsy, Genetic Brain Disorders that cause neurodegeneration, Retinitis pigmentosa (RP), Head and Brain Malformations, Hydrocephalus, Stroke, Prion disease, Infantile neuronal ceroid lipofuscinosis (INCL) (a neurodegenerative disease of children caused by a deficiency in the lysosomal enzyme palmitoyl protein thioesterase-1 (PPT1)), and others.
[0163] In some embodiments, viral particles of the present invention may be used to treat diseases that are associated with impairments of the growth and development of the CNS, i.e., neurodevelopmental disorders. In some aspects, such neurodevelopmental disorders may be caused by genetic mutations, including but not limited to, Fragile X syndrome (caused by mutations in FMR1 gene), Down syndrome (caused by trisomy of chromosome 21), Rett syndrome, Williams syndrome, Angelman syndrome, Smith-Magenis syndrome, ATR-X syndrome, Barth syndrome, Immune dysfunction and/or infectious diseases during infancy such as Sydenham's chorea, Schizophrenia Congenital toxoplasmosis, Congenital rubella syndrome, Metabolic disorders such as diabetes mellitus and phenylketonuria; nutritional defects and/or brain trauma, Autism and autism spectrum.
[0164] In some embodiments, viral particles of the present invention, may be used to treat a tumor in the CNS, including but not limited to, acoustic neuroma, Astrocytoma (Grades I, II, III and IV), Chordoma, CNS Lymphoma, Craniopharyngioma, Gliomas (e.g., brain stem glioma, ependymoma, optical nerve glioma, subependymoma), Medulloblastoma, Meningioma, Metastatic brain tumors, Oligodendroglioma, Pituitary Tumors, Primitive neuroectodermal (PNET), and Schwannoma.
[0165] In some embodiments, the neurological disorders may be functional neurological disorders with motor and/or sensory symptoms which have neurological origin in the CNS. As non-limiting examples, functional neurological disorders may be chronic pain, seizures, speech problems, involuntary movements, and sleep disturbances.
[0166] In some embodiments, the neurological disorders may be white matter disorders (a group of diseases that affects nerve fibers in the CNS) including but not limited to, Pelizaeus-Merzbacher disease, Hypomyelination with atrophy of basal ganglia and cerebellum, Aicardi-Goutieres syndrome, Megalencephalic leukoencephalopathy with subcortical cysts, Congenital muscular dystrophies, Myotonic dystrophy, Wilson disease, Lowe syndrome, Sjogren-Larsson syndrome, PIBD or Tay syndrome, Cockayne's disease, erebrotendinous xanthomatosis, Zellweger syndrome, Neonatal adrenoleukodystrophy, Infantile Refsum disease, Zellweger-like syndrome, Pseudo-Zellweger syndrome, Pseudo-neonatal adrenoleukodystrophy, Bifunctional protein deficiency, X-linked adrenoleukodystrophy and adrenomyeloneuropathy and Refsum disease.
[0167] In some embodiments, the neurological disorders may be lysosomal storage disorders (LSDs) caused by the inability of cells in the CNS to break down metabolic end products, including but not limited to Niemann-Pick disease (a LSD resulting from inherited deficiency in acid sphingomyelinase (ASM); Metachromatic leukodystrophy (MLD) (a LSD characterized by accumulation of sulfatides in glial cells and neurons, the result of an inherited deficiency of arylsulfatase A (ARSA)); Globoid-cell leukodystrophy (GLD) (a LSD caused by mutations in galactosylceramidase); Fabry disease (a LSD caused by mutations in the alpha-galactosidase A (GLA) gene); Gaucher disease (caused by mutations in the beta-glucocerebrosidase (GBA) gene); GM1/GM2 gangliosidosis; Mucopolysaccharidoses disorder; Pompe disease; and Neuronal ceroid lipofuscinosis.
[0168] In one embodiment, the neurological disease, disorder and/or condition is Parkinson's disease. In one embodiment the polynucleotide used to treat Parkinson's disease comprises any one of SEQ ID NOs 2-23, such as, but not limited to SEQ ID NOs: 6-9 and 17-23, wherein the payload is replaced by AADC or any other payload known in the art for treating Parkinson's disease. As a non-limiting example, the condition is early stage Parkinson's disease. As another non-limiting example, the condition is late stage Parkinson's disease.
[0169] In one embodiment, the subject is a human patient who has a minimum motor score of about 30 to a maximum score of about 100, about 10 to a maximum score of about 100, about 20 to a maximum score of about 100 in the Unified Parkinson's Disease Rating Scale.
[0170] In one embodiment, the subject has been diagnosed with Parkinson's disease within the past 5 years prior to treatment with the compositions described herein. As a non-limiting example, the subject may have been diagnosed with Parkinson's disease within a week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 12 months, 13 months, 14 months, 15 months, 16 months, 17 months, 18 months, 1 year, 2 years, 3 years, 4 years or less than 5 years prior to treatment with the compositions described herein.
[0171] In one embodiment, the subject has been diagnosed with Parkinson's disease between 5 and 10 years prior to treatment with the compositions described herein. As a non-limiting example, the subject may have been diagnosed with Parkinson's disease 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5 or years prior to treatment with the compositions described herein.
[0172] In one embodiment, the subject has been diagnosed with Parkinson's disease more than 10 years prior to treatment with the compositions described herein. As a non-limiting example, the subject may have been diagnosed with Parkinson's disease 10.5, 11, 11.5, 12, 12.5, 13, 13.5, 14, 14.5, 15, 15.5, 16, 16.5, 17, 17.5, 18, 18.5, 19, 19.5, 20, 20.5, 21, 21.5, 22, 22.5, 23, 23.5, 24 or more than 24 years prior to treatment with the compositions described herein.
[0173] In one embodiment, a subject has seen a change in motor symptoms such as tremors and movements prior to administration of the composition described herein. Non-limiting examples of tremors include, unilateral or bilateral mild tremors, bilateral or midline moderate tremors or intractable tremors. Non-limiting examples of movements include mild bradykinesia, moderate bradykinesia, severe bradykinesia and morning akinesia.
[0174] In one embodiment, a subject may have changes in balance such as, but not limited to, impaired balance, impaired righting reflexes, significant balance disorder or falling.
[0175] In one embodiment, a subject may have a reduced quality of life. As a non-limiting example, the subject may have a moderate impact on their quality of life such as experiencing some limitations to activities of daily living. As another non-limiting example, the subject may have a quality of life which has been diminished by illness.
[0176] In one embodiment, a subject has seen a change in non-motor symptoms prior to administration of the composition described herein. As a non-limiting example, the subject may have mild to moderate cognitive impairment prior to administration to the composition described herein. As another non-limiting example, the subject may have significant cognitive impairment such as dementia which may also include behavioral disturbances such as hallucinations.
[0177] In one embodiment, a subject may have a satisfactory response with limited fluctuations on one or more dopaminergic medications prior to administration of the compositions described herein.
[0178] In one embodiment, a subject may have motor fluctuations causing mild to moderate disability on one or more dopaminergic medications prior to administration of the compositions described herein.
[0179] In one embodiment, a subject may have medically refractory motor fluctuations consisting of "wearing off" and/or levodopa-induced dyskinesias causing significant disability prior to administration of the compositions described herein.
[0180] In one embodiment, a subject may have mild symptoms associated with Parkinson's disease such as, but not limited to, no cognitive impairment, diagnosed within the past 5 years, satisfactory response with limited fluctuations on one or more dopaminergic medications, unilateral or bilateral mild tremors, little to no impact on the quality of life, and/or no balance impairment.
[0181] In one embodiment, a subject may have moderate symptoms associated with Parkinson's disease such as, but not limited to, mild to moderate cognitive impairment, first signs of impaired balance and righting reflexes, motor fluctuations causing mild-moderate disability on one or more dopaminergic medications, diagnosed within the past 5 to 10 years, bilateral or midline moderate tremors, moderate bradykinesia and/or subject experiencing some limitations to activities of daily living.
[0182] In one embodiment, a subject may have advanced symptoms associated with Parkinson's disease such as, but not limited to, being diagnosed with Parkinson's more than 10 years, medium refractory motor fluctuations wearing off and/or levodopa-induced dyskinesia causing significant disability, intractable tremors, significant balance disorder and/or falling, significant cognitive impairment (such as dementia with or without behavioral disturbances), sever bradykinesia, quality of life markedly diminished by illness and/or morning akinesia.
[0183] In one embodiment, a subject has been referred to a movement disorder specialist (MDS) but has not undergone deep brain stimulation.
[0184] In one embodiment, a subject is using DUOPA.TM. in combination with the compositions described herein. As a non-limiting example, the subject may have success with using DUOPA.TM. alone. As a non-limiting example, the subject may not have any success or limited success using DUOPA.TM. alone.
[0185] In another embodiment, the neurological disease, disorder and/or condition is Friedreich's Ataxia. In one embodiment the polynucleotide used to treat Friedreich's Ataxia comprises any one of SEQ ID NOs 2-23, such as, but not limited to SEQ ID NOs: 6-9 and 17-23, wherein the payload is replaced by Frataxin or any other payload known in the art for treating Friedreich's Ataxia.
[0186] In another embodiment, the neurological disease, disorder and/or condition is Amyotrophic lateral sclerosis (ALS). In one embodiment the polynucleotide used to treat ALS comprises any one of SEQ ID NOs 2-23, such as, but not limited to SEQ ID NOs: 6-9 and 17-23, wherein the payload is replaced by an shRNA, miRNA, siRNA, RNAi for SOD1 or any other payload known in the art for treating ALS.
[0187] In another embodiment, the neurological disease, disorder and/or condition is Huntington's disease. In one embodiment the polynucleotide used to treat Huntington's disease comprises any one of SEQ ID NOs 2-23, such as, but not limited to SEQ ID NOs: 6-9 and 17-23, wherein the payload is replaced by an shRNA, miRNA, siRNA, RNAi for Htt or any other payload known in the art for treating Huntington's disease.
[0188] In another embodiment, the neurological disease, disorder or condition is spinal muscular atrophy (SMA). In one embodiment the polynucleotide used to treat SMA comprises any one of SEQ ID NOs 2-23, such as, but not limited to SEQ ID NOs: 6-9 and 17-23, wherein the payload is replaced by SMN or any other payload known in the art for treating SMA.
Circadian Rhythm and Sleep-Wake Cycles
[0189] Circadian rhythms are physical, mental and behavioral changes that tend to follow a 24 hour cycle. Circadian rhythms can influence sleep-wake cycles, hormone release, body temperature and other bodily functions. Changes in the circadian rhythm can cause conditions and/or disorder such as, but not limited to sleep disorders (e.g., insomnia), depression, bipolar disorder, seasonal affective disorder, obesity and diabetes.
[0190] In one embodiment, the AADC polynucleotides described herein may be used to treat insomnia.
[0191] The sleep-wake cycle comprises periods of sleep and periods of wake. Generally, in a 24 hour period the total hours of sleep are less than the total hours of wakefulness. As a non-limiting example, the sleep-wake cycle comprises 7-9 hours of sleep and 15-17 hours of wakefulness. As a non-limiting example, the sleep-wake cycle comprises 8 hours of sleep and 16 hours of wakefulness. As a non-limiting example, the sleep-wake cycle comprises 8-10 hours of sleep and 14-16 hours of wakefulness.
[0192] In one embodiment, the sleep-wake cycle of a subject is improved by administered to the subject the AADC polynucleotides described herein.
[0193] In one embodiment, the sleep-wake cycle of a subject is regulated by administering to the subject the AADC polynucleotides described herein. As a non-limiting example, the regulation may be the correction of more periods of sleep occurring at night and less periods of sleep occurring
[0194] In one embodiment, the sleep-wake cycle of a subject administered the AADC polynucleotides described herein improves as compared to the sleep-wake cycle of the subject prior to administration of the AADC polynucleotides. As a non-limiting example, the subject has an increased period of sleep and a decreased period of wakefulness. As another non-limiting example, the subject has a decreased period of sleep and an increased period of wakefulness.
[0195] In one embodiment, the sleep-wake cycle of a subject administered the AADC polynucleotides described herein is regulated as compared to the sleep-wake cycle of the subject prior to administration of the AADC polynucleotides. As a non-limiting example, the length of the periods of sleep and the periods of wakefulness may be about the same (e.g., +/-1 hour) for at least 2 days. As another non-limiting example, the length of the periods of sleep and the periods of wakefulness if a 24 hours period may be within 10 minutes, 15 minutes, 20 minutes, 25 minutes, 30 minutes, 35 minutes, 40 minutes, 45 minutes, 50 minutes, 55 minutes, 1 hour, 1.5 hours, or 2 hours of the previous 24 hour period.
[0196] In one embodiment, the amount of rapid eye movement (REM) sleep a subject experiences in a 24 hour period is altered after the subject is administered the AADC polynucleotides described herein. REM sleep is generally considered an active period of sleep marked by intense brain activity where brain waves are fast and desynchronized. An adult, on average, spends about 20-25% of their total daily sleep period in REM sleep. As a non-limiting example, the amount of REM sleep is decreased by 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65% or more than 65%. As a non-limiting example, the amount of REM sleep is decreased by 1-10%, 5-10%, 5-15%, 10-15%, 15-20%, 15-25%, 20-25%, 20-30%, 25-30%, 25-35%, 30-35%, 30-40%, 35-40%, 40-50% or 40-60%. As a non-limiting example, the amount of REM sleep is increased by 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65% or more than 65%. As a non-limiting example, the amount of REM sleep is increased by 1-5%, 1-10%, 5-10%, 5-15%, 10-15%, 15-20%, 15-25%, 20-25%, 20-30%, 25-30%, 25-35%, 30-35%, 30-40%, 35-40%, 40-50% or 40-60%.
[0197] In one embodiment, the amount of non-REM (NREM) sleep a subject experiences in a 24 hour period is altered after the subject is administered the AADC polynucleotides described herein. NREM sleep is generally characterized by a reduction in physiological activity since as the brain waves, measured by EEG, get slower and have greater amplitude. NREM has four stages: Stage 1 is the time of drowsiness or transition from being awake to falling asleep where the brain waves and muscle activity begin to slow; Stage 2 is a period of light sleep during which eye movements stop and brain waves become slower with occasional bursts of rapid waves (sometimes called sleep spindles); Stage 3 and Stage 4 (collectively referred to as slow wave sleep) are characterized by the presence of slow brain waves (delta waves) interspersed with smaller faster waves where there are no eye movements. An adult, on average, spends about 75-80% of their total daily sleep period in NREM sleep with about half of their total daily sleep time in NREM stage 2 sleep.
[0198] In one embodiment, the amount of NREM sleep a subject experiences is altered after the subject is administered the AADC polynucleotides described herein. As a non-limiting example, the amount of NREM sleep is decreased by 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65% or more than 65%. As a non-limiting example, the amount of NREM sleep is decreased by 1-10%, 5-10%, 5-15%, 10-15%, 15-20%, 15-25%, 20-25%, 20-30%, 25-30%, 25-35%, 30-35%, 30-40%, 35-40%, 40-50% or 40-60%. As a non-limiting example, the amount of NREM sleep is increased by 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65% or more than 65%. As a non-limiting example, the amount of NREM sleep is increased by 1-5%, 1-10%, 5-10%, 5-15%, 10-15%, 15-20%, 15-25%, 20-25%, 20-30%, 25-30%, 25-35%, 30-35%, 30-40%, 35-40%, 40-50% or 40-60%.
[0199] In one embodiment, the amount of NREM Stage 1 sleep a subject experiences is altered after the subject is administered the AADC polynucleotides described herein. As a non-limiting example, the amount of NREM Stage 1 sleep is decreased by 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65% or more than 65%. As a non-limiting example, the amount of NREM Stage 1 sleep is decreased by 1-10%, 5-10%, 5-15%, 10-15%, 15-20%, 15-25%, 20-25%, 20-30%, 25-30%, 25-35%, 30- 35%, 30-40%, 35-40%, 40-50% or 40-60%. As a non-limiting example, the amount of NREM Stage 1 sleep is increased by 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65% or more than 65%. As a non-limiting example, the amount of NREM Stage 1 sleep is increased by 1-5%, 1-10%, 5-10%, 5-15%, 10-15%, 15-20%, 15-25%, 20-25%, 20-30%, 25-30%, 25-35%, 30-35%, 30-40%, 35-40%, 40-50% or 40-60%.
[0200] In one embodiment, the amount of NREM Stage 2 sleep a subject experiences is altered after the subject is administered the AADC polynucleotides described herein. As a non-limiting example, the amount of NREM Stage 2 sleep is decreased by 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65% or more than 65%. As a non-limiting example, the amount of NREM Stage 2 sleep is decreased by 1-10%, 5-10%, 5-15%, 10-15%, 15-20%, 15-25%, 20-25%, 20-30%, 25-30%, 25-35%, 30- 35%, 30-40%, 35-40%, 40-50% or 40-60%. As a non-limiting example, the amount of NREM Stage 2 sleep is increased by 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65% or more than 65%. As a non-limiting example, the amount of NREM Stage 2 sleep is increased by 1-5%, 1-10%, 5-10%, 5-15%, 10-15%, 15-20%, 15-25%, 20-25%, 20-30%, 25-30%, 25-35%, 30-35%, 30-40%, 35-40%, 40-50% or 40-60%.
[0201] In one embodiment, the amount of NREM Stage 3 and 4 sleep a subject experiences is altered after the subject is administered the AADC polynucleotides described herein. As a non-limiting example, the amount of NREM Stage 3 and 4 sleep is decreased by 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65% or more than 65%. As a non-limiting example, the amount of NREM Stage 3 and 4 sleep is decreased by 1-10%, 5-10%, 5-15%, 10-15%, 15-20%, 15-25%, 20-25%, 20-30%, 25-30%, 25-35%, 30-35%, 30-40%, 35-40%, 40-50% or 40-60%. As a non-limiting example, the amount of NREM Stage 3 and 4 sleep is increased by 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65% or more than 65%. As a non-limiting example, the amount of NREM Stage 3 and 4 sleep is increased by 1-5%, 1-10%, 5-10%, 5-15%, 10-15%, 15-20%, 15-25%, 20-25%, 20-30%, 25-30%, 25-35%, 30-35%, 30-40%, 35-40%, 40-50% or 40-60%.
[0202] In one embodiment, periods of NREM and REM cycles are more consistent in a subject after the subject is administered the AADC polynucleotides described herein. Generally NREM and REM cycles alternate every 90 to 110 minutes four to six times per night.
Definitions
[0203] At various places in the present specification, substituents of compounds of the present disclosure are disclosed in groups or in ranges. It is specifically intended that the present disclosure include each and every individual subcombination of the members of such groups and ranges.
[0204] About: As used herein, the term "about" means+/-10% of the recited value.
[0205] Activity: As used herein, the term "activity" refers to the condition in which things are happening or being done. Compositions described herein may have activity and this activity may involve one or more biological events.
[0206] Adeno-associated virus: The term "adeno-associated virus" or "AAV" as used herein refers to members of the dependovirus genus comprising any particle, sequence, gene, protein, or component derived therefrom. The term "AAV particle" as used herein comprises a capsid and a polynucleotide. The AAV particle may be derived from any serotype, described herein or known in the art, including combinations of serotypes (i.e., "pseudotyped" AAV) or from various genomes (e.g., single stranded or self-complementary). In addition, the AAV particle may be replication defective and/or targeted.
[0207] Administered in combination: As used herein, the term "administered in combination" or "combined administration" means that two or more agents (e.g., AAV) are administered to a subject at the same time or within an interval such that there may be an overlap of an effect of each agent on the patient and/or the subject is at some point in time simultaneously exposed to both. In some embodiments, they are administered within about 60, 30, 15, 10, 5, or 1 minutes of one another or within about 24 hours, 12 hours, 6 hours, 3 hours of at least one dose of one or more other agents. In some embodiments, administration occurs in overlapping dosage regimens. As used herein, the term "dosage regimen" refers to a plurality of doses spaced apart in time. Such doses may occur at regular intervals or may include one or more hiatus in administration. In some embodiments, the administrations of the agents are spaced sufficiently closely together such that a combinatorial (e.g., a synergistic) effect is achieved.
[0208] Amelioration: As used herein, the term "amelioration" or "ameliorating" refers to a lessening of severity of at least one indicator of a condition or disease. For example, in the context of neurodegeneration disorder, amelioration includes the reduction of neuron loss.
[0209] Animal: As used herein, the term "animal" refers to any member of the animal kingdom. In some embodiments, "animal" refers to humans at any stage of development. In some embodiments, "animal" refers to non-human animals at any stage of development. In certain embodiments, the non-human animal is a mammal (e.g., a rodent, a mouse, a rat, a rabbit, a monkey, a dog, a cat, a sheep, cattle, a primate, or a pig). In some embodiments, animals include, but are not limited to, mammals, birds, reptiles, amphibians, fish, and worms. In some embodiments, the animal is a transgenic animal, genetically-engineered animal, or a clone.
[0210] Antisense strand: As used herein, the term "the antisense strand" or "the first strand" or "the guide strand" of a siRNA molecule refers to a strand that is substantially complementary to a section of about 10-50 nucleotides, e.g., about 15-30, 16-25, 18-23 or 19-22 nucleotides of the mRNA of the gene targeted for silencing. The antisense strand or first strand has sequence sufficiently complementary to the desired target mRNA sequence to direct target-specific silencing, e.g., complementarity sufficient to trigger the destruction of the desired target mRNA by the RNAi machinery or process.
[0211] Approximately: As used herein, the term "approximately" or "about," as applied to one or more values of interest, refers to a value that is similar to a stated reference value. In certain embodiments, the term "approximately" or "about" refers to a range of values that fall within 25%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value).
[0212] Associated with: As used herein, the terms "associated with," "conjugated," "linked," "attached," and "tethered," when used with respect to two or more moieties, means that the moieties are physically associated or connected with one another, either directly or via one or more additional moieties that serves as a linking agent, to form a structure that is sufficiently stable so that the moieties remain physically associated under the conditions in which the structure is used, e.g., physiological conditions. An "association" need not be strictly through direct covalent chemical bonding. It may also suggest ionic or hydrogen bonding or a hybridization based connectivity sufficiently stable such that the "associated" entities remain physically associated.
[0213] Bifunctional: As used herein, the term "bifunctional" refers to any substance, molecule or moiety which is capable of or maintains at least two functions. The functions may affect the same outcome or a different outcome. The structure that produces the function may be the same or different.
[0214] Biologically active: As used herein, the phrase "biologically active" refers to a characteristic of any substance (e.g., AAV) that has activity in a biological system and/or organism. For instance, a substance that, when administered to an organism, has a biological effect on that organism, is considered to be biologically active. In particular embodiments, a polynucleotide of the present invention may be considered biologically active if even a portion of the polynucleotides is biologically active or mimics an activity considered biologically relevant.
[0215] Biological system: As used herein, the term "biological system" refers to a group of organs, tissues, cells, intracellular components, proteins, nucleic acids, molecules (including, but not limited to biomolecules) that function together to perform a certain biological task within cellular membranes, cellular compartments, cells, tissues, organs, organ systems, multicellular organisms, or any biological entity. In some embodiments, biological systems are cell signaling pathways comprising intracellular and/or extracellular cell signaling biomolecules. In some embodiments, biological systems comprise growth factor signaling events within the extracellular/cellular matrix and/or cellular niches.
[0216] Biomolecule: As used herein, the term "biomolecule" is any natural molecule which is amino acid-based, nucleic acid-based, carbohydrate-based or lipid-based, and the like.
[0217] Complementary and substantially complementary: As used herein, the term "complementary" refers to the ability of polynucleotides to form base pairs with one another. Base pairs are typically formed by hydrogen bonds between nucleotide units in antiparallel polynucleotide strands. Complementary polynucleotide strands can form base pairs in the Watson-Crick manner (e.g., A to T, A to U, C to G), or in any other manner that allows for the formation of duplexes. As persons skilled in the art are aware, when using RNA as opposed to DNA, uracil rather than thymine is the base that is considered to be complementary to adenosine. However, when a U is denoted in the context of the present invention, the ability to substitute a T is implied, unless otherwise stated. Perfect complementarity or 100% complementarity refers to the situation in which each nucleotide unit of one polynucleotide strand can form a hydrogen bond with a nucleotide unit of a second polynucleotide strand. Less than perfect complementarity refers to the situation in which some, but not all, nucleotide units of two strands can form hydrogen bonds with each other. For example, for two 20-mers, if only two base pairs on each strand can form hydrogen bonds with each other, the polynucleotide strands exhibit 10% complementarity. In the same example, if 18 base pairs on each strand can form hydrogen bonds with each other, the polynucleotide strands exhibit 90% complementarity. As used herein, the term "substantially complementary" means that the siRNA has a sequence (e.g., in the antisense strand) which is sufficient to bind the desired target mRNA, and to trigger the RNA silencing of the target mRNA.
[0218] Compound: As used herein, the term "compound," refers to a distinct chemical entity. In some embodiments, a particular compound may exist in one or more isomeric or isotopic forms (including, but not limited to stereoisomers, geometric isomers and isotopes). In some embodiments, a compound is provided or utilized in only a single such form. In some embodiments, a compound is provided or utilized as a mixture of two or more such forms (including, but not limited to a racemic mixture of stereoisomers). Those of skill in the art appreciate that some compounds exist in different such forms, show different properties and/or activities (including, but not limited to biological activities). In such cases it is within the ordinary skill of those in the art to select or avoid particular forms of the compound for use in accordance with the present invention. For example, compounds that contain asymmetrically substituted carbon atoms can be isolated in optically active or racemic forms. Methods on how to prepare optically active forms from optically active starting materials are known in the art, such as by resolution of racemic mixtures or by stereoselective synthesis. Many geometric isomers of olefins, C.dbd.N double bonds, and the like can also be present in the compounds described herein, and all such stable isomers are contemplated in the present disclosure. Cis and trans geometric isomers of the compounds of the present disclosure are described and may be isolated as a mixture of isomers or as separated isomeric forms.
[0219] Compounds of the present disclosure also include tautomeric forms. Tautomeric forms result from the swapping of a single bond with an adjacent double bond and the concomitant migration of a proton. Tautomeric forms include prototropic tautomers which are isomeric protonation states having the same empirical formula and total charge.
[0220] Compounds of the present disclosure also include all of the isotopes of the atoms occurring in the intermediate or final compounds. "Isotopes" refers to atoms having the same atomic number but different mass numbers resulting from a different number of neutrons in the nuclei. For example, isotopes of hydrogen include tritium and deuterium.
[0221] The compounds and salts of the present disclosure can be prepared in combination with solvent or water molecules to form solvates and hydrates by routine methods.
[0222] Conserved: As used herein, the term "conserved" refers to nucleotides or amino acid residues of a polynucleotide sequence or polypeptide sequence, respectively, that are those that occur unaltered in the same position of two or more sequences being compared. Nucleotides or amino acids that are relatively conserved are those that are conserved amongst more related sequences than nucleotides or amino acids appearing elsewhere in the sequences.
[0223] In some embodiments, two or more sequences are said to be "completely conserved" if they are 100% identical to one another. In some embodiments, two or more sequences are said to be "highly conserved" if they are at least 70% identical, at least 80% identical, at least 90% identical, or at least 95% identical to one another. In some embodiments, two or more sequences are said to be "highly conserved" if they are about 70% identical, about 80% identical, about 90% identical, about 95%, about 98%, or about 99% identical to one another. In some embodiments, two or more sequences are said to be "conserved" if they are at least 30% identical, at least 40% identical, at least 50% identical, at least 60% identical, at least 70% identical, at least 80% identical, at least 90% identical, or at least 95% identical to one another. In some embodiments, two or more sequences are said to be "conserved" if they are about 30% identical, about 40% identical, about 50% identical, about 60% identical, about 70% identical, about 80% identical, about 90% identical, about 95% identical, about 98% identical, or about 99% identical to one another. Conservation of sequence may apply to the entire length of an oligonucleotide, a polynucleotide or polypeptide or may apply to a portion, region or feature thereof.
[0224] In one embodiment, conserved sequences are not contiguous. Those skilled in the art are able to appreciate how to achieve alignment when gaps in contiguous alignment are present between sequences, and to align corresponding residues not withstanding insertions or deletions present.
[0225] In one embodiment, conserved sequences are not contiguous. Those skilled in the art are able to appreciate how to achieve alignment when gaps in contiguous alignment are present between sequences, and to align corresponding residues not withstanding insertions or deletions present.
[0226] Delivery: As used herein, "delivery" refers to the act or manner of delivering a compound such as a parvovirus, e.g. an AAV and/or AAV compound, substance, entity, moiety, cargo or payload to a target. Such target may be a cell, tissue, organ, organism, or system (whether biological or production).
[0227] Delivery Agent: As used herein, "delivery agent" refers to any agent or substance which facilitates, at least in part, the in vivo and/or in vitro delivery of a polynucleotide and/or one or more substances (including, but not limited to a compounds and/or compositions of the present invention, e.g., viral particles or expression vectors) to targeted cells.
[0228] Destabilized: As used herein, the term "destable," "destabilize," or "destabilizing region" means a region or molecule that is less stable than a starting, reference, wild-type or native form of the same region or molecule.
[0229] Detectable label: As used herein, "detectable label" refers to one or more markers, signals, or moieties which are attached, incorporated or associated with another entity that is readily detected by methods known in the art including radiography, fluorescence, chemiluminescence, enzymatic activity, absorbance immunological detection, and the like. Detectable labels may include radioisotopes, fluorophores, chromophores, enzymes, dyes, metal ions, ligands such as biotin, avidin, streptavidin and haptens, quantum dots, and the like. Detectable labels may be located at any position in the entity with which they are attached, incorporated or associated. For example, when attached, incorporated in or associated with a peptide or protein, they may be within the amino acids, the peptides, or proteins, or located at the N- or C-termini.
[0230] Dosing regimen: As used herein, a "dosing regimen" is a schedule of administration or physician determined regimen of treatment, prophylaxis, or palliative care.
[0231] Effective Amount: As used herein, the term "effective amount" of an agent is that amount sufficient to effect beneficial or desired results, for example, upon single or multiple dose administration to a subject cell, in curing, alleviating, relieving or improving one or more symptoms of a disorder, clinical results, and, as such, an "effective amount" depends upon the context in which it is being applied. For example, in the context of administering an agent that treats Parkinson's Disease, an effective amount of an agent is, for example, an amount sufficient to achieve treatment, as defined herein, of Parkinson's Disease, as compared to the response obtained without administration of the agent.
[0232] Encapsulate: As used herein, the term "encapsulate" means to enclose, surround or encase.
[0233] Engineered: As used herein, embodiments are "engineered" when they are designed to have a feature or property, whether structural or chemical, that varies from a starting point, wild-type or native molecule. Thus, engineered agents or entities are those whose design and/or production include an act of the hand of man.
[0234] Epitope: As used herein, an "epitope" refers to a surface or region on a molecule that is capable of interacting with a biomolecule. For example a protein may contain one or more amino acids, e.g., an epitope, which interacts with an antibody, e.g., a biomolecule. In some embodiments, when referring to a protein or protein module, an epitope may comprise a linear stretch of amino acids or a three dimensional structure formed by folded amino acid chains.
[0235] Expression: As used herein, "expression" of a nucleic acid sequence refers to one or more of the following events: (1) production of an RNA template from a DNA sequence (e.g., by transcription); (2) processing of an RNA transcript (e.g., by splicing, editing, 5' cap formation, and/or 3' end processing); (3) translation of an RNA into a polypeptide or protein; (4) folding of a polypeptide or protein; and (5) post-translational modification of a polypeptide or protein.
[0236] Feature: As used herein, a "feature" refers to a characteristic, a property, or a distinctive element.
[0237] Formulation: As used herein, a "formulation" includes at least one polynucleotide and/or compound and/or composition of the present disclosure (e.g., a vector, AAV particle, etc.) and a delivery agent.
[0238] Fragment: A "fragment," as used herein, refers to a contiguous portion of a whole. For example, fragments of proteins may comprise polypeptides obtained by digesting full-length protein isolated from cultured cells. In some embodiments, a fragment of a protein includes at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 150, 200, 250 or more amino acids. In some embodiments, fragments of an antibody include portions of an antibody subjected to enzymatic digestion or synthesized as such.
[0239] Functional: As used herein, a "functional" biological molecule is a biological molecule and/or entity with a structure and in a form in which it exhibits a property and/or activity by which it is characterized.
[0240] Gene expression: The term "gene expression" refers to the process by which a nucleic acid sequence undergoes successful transcription and in most instances translation to produce a protein or peptide. For clarity, when reference is made to measurement of "gene expression", this should be understood to mean that measurements may be of the nucleic acid product of transcription, e.g., RNA or mRNA or of the amino acid product of translation, e.g., polypeptides or peptides. Methods of measuring the amount or levels of RNA, mRNA, polypeptides and peptides are well known in the art.
[0241] Homology: As used herein, the term "homology" refers to the overall relatedness between polymeric molecules, e.g. between nucleic acid molecules (e.g. DNA molecules and/or RNA molecules) and/or between polypeptide molecules. In some embodiments, polymeric molecules are considered to be "homologous" to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical or similar. The term "homologous" necessarily refers to a comparison between at least two sequences (polynucleotide or polypeptide sequences). In accordance with the invention, two polynucleotide sequences are considered to be homologous if the polypeptides they encode are at least about 50%, 60%, 70%, 80%, 90%, 95%, or even 99% for at least one stretch of at least about 20 amino acids. In some embodiments, homologous polynucleotide sequences are characterized by the ability to encode a stretch of at least 4-5 uniquely specified amino acids. For polynucleotide sequences less than 60 nucleotides in length, homology is typically determined by the ability to encode a stretch of at least 4-5 uniquely specified amino acids. In accordance with the invention, two protein sequences are considered to be homologous if the proteins are at least about 50%, 60%, 70%, 80%, or 90% identical for at least one stretch of at least about 20 amino acids. In many embodiments, homologous protein may show a large overall degree of homology and a high degree of homology over at least one short stretch of at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50 or more amino acids. In many embodiments, homologous proteins share one or more characteristic sequence elements. As used herein, the term "characteristic sequence element" refers to a motif present in related proteins. In some embodiments, the presence of such motifs correlates with a particular activity (such as biological activity).
[0242] Identity: As used herein, the term "identity" refers to the overall relatedness between polymeric molecules, e.g., between oligonucleotide and/or polynucleotide molecules (e.g. DNA molecules and/or RNA molecules) and/or between polypeptide molecules. Calculation of the percent identity of two polynucleotide sequences, for example, may be performed by aligning the two sequences for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second nucleic acid sequences for optimal alignment and non-identical sequences can be disregarded for comparison purposes). In certain embodiments, the length of a sequence aligned for comparison purposes is at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or 100% of the length of the reference sequence. The nucleotides at corresponding nucleotide positions are then compared. When a position in the first sequence is occupied by the same nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which needs to be introduced for optimal alignment of the two sequences. The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. For example, the percent identity between two nucleotide sequences can be determined using methods such as those described in Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D. W., ed., Academic Press, New York, 1993; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; Computer Analysis of Sequence Data, Part I, Griffin, A. M., and Griffin, H. G., eds., Humana Press, New Jersey, 1994; and Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M Stockton Press, New York, 1991; each of which is incorporated herein by reference in its entirety. For example, the percent identity between two nucleotide sequences can be determined, for example using the algorithm of Meyers and Miller (CABIOS, 1989, 4:11-17), which has been incorporated into the ALIGN program (version 2.0) using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4. The percent identity between two nucleotide sequences can, alternatively, be determined using the GAP program in the GCG software package using an NWSgapdna.CMP matrix. Methods commonly employed to determine percent identity between sequences include, but are not limited to those disclosed in Carillo, H., and Lipman, D., SIAM J Applied Math., 48:1073 (1988); incorporated herein by reference in its entirety. Techniques for determining identity are codified in publicly available computer programs. Exemplary computer software to determine homology between two sequences include, but are not limited to, GCG program package, Devereux, J., et al., Nucleic Acids Research, 12(1), 387 (1984)), BLASTP, BLASTN, and FASTA Altschul, S. F. et al., J. Molec. Biol., 215, 403 (1990)).
[0243] Inhibit expression of a gene: As used herein, the phrase "inhibit expression of a gene" means to cause a reduction in the amount of an expression product of the gene. The expression product may be RNA transcribed from the gene (e.g. mRNA) or a polypeptide translated from mRNA transcribed from the gene. Typically a reduction in the level of mRNA results in a reduction in the level of a polypeptide translated therefrom. The level of expression may be determined using standard techniques for measuring mRNA or protein.
[0244] In vitro: As used herein, the term "in vitro" refers to events that occur in an artificial environment, e.g., in a test tube or reaction vessel, in cell culture, in a Petri dish, etc., rather than within an organism (e.g., animal, plant, or microbe).
[0245] In vivo: As used herein, the term "in vivo" refers to events that occur within an organism (e.g., animal, plant, or microbe or cell or tissue thereof).
[0246] Isolated: As used herein, the term "isolated" is synonymous with "separated", but carries with it the inference separation was carried out by the hand of man. In one embodiment, an isolated substance or entity is one that has been separated from at least some of the components with which it was previously associated (whether in nature or in an experimental setting). Isolated substances may have varying levels of purity in reference to the substances from which they have been associated. Isolated substances and/or entities may be separated from at least about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, or more of the other components with which they were initially associated. In some embodiments, isolated agents are more than about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or more than about 99% pure. As used herein, a substance is "pure" if it is substantially free of other components.
[0247] Substantially isolated: By "substantially isolated" is meant that the compound is substantially separated from the environment in which it was formed or detected. Partial separation can include, for example, a composition enriched in the compound of the present disclosure. Substantial separation can include compositions containing at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% by weight of the compound of the present disclosure, or salt thereof. Methods for isolating compounds and their salts are routine in the art. In some embodiments, isolation of a substance or entity includes disruption of chemical associations and/or bonds. In some embodiments, isolation includes only the separation from components with which the isolated substance or entity was previously combined and does not include such disruption.
[0248] Modified: As used herein, the term "modified" refers to a changed state or structure of a molecule or entity of the invention as compared with a parent or reference molecule or entity. Molecules may be modified in many ways including chemically, structurally, and functionally. In some embodiments, compounds and/or compositions of the present disclosure are modified by the introduction of non-natural amino acids, or non-natural nucleotides.
[0249] Mutation: As used herein, the term "mutation" refers to a change and/or alteration. In some embodiments, mutations may be changes and/or alterations to proteins (including peptides and polypeptides) and/or nucleic acids (including polynucleic acids). In some embodiments, mutations comprise changes and/or alterations to a protein and/or nucleic acid sequence. Such changes and/or alterations may comprise the addition, substitution and or deletion of one or more amino acids (in the case of proteins and/or peptides) and/or nucleotides (in the case of nucleic acids and or polynucleic acids). In embodiments wherein mutations comprise the addition and/or substitution of amino acids and/or nucleotides, such additions and/or substitutions may comprise 1 or more amino acid and/or nucleotide residues and may include modified amino acids and/or nucleotides.
[0250] Naturally occurring: As used herein, "naturally occurring" means existing in nature without artificial aid or involvement of the hand of man
[0251] Non-human vertebrate: As used herein, a "non-human vertebrate" includes all vertebrates except Homo sapiens, including wild and domesticated species. Examples of non-human vertebrates include, but are not limited to, mammals, such as alpaca, banteng, bison, camel, cat, cattle, deer, dog, donkey, gayal, goat, guinea pig, horse, llama, mule, pig, rabbit, reindeer, sheep water buffalo, and yak.
[0252] Nucleic acid: As used herein, the term "nucleic acid", "polynucleotide" and `oligonucleotide" refer to any nucleic acid polymers composed of either polydeoxyribonucleotides (containing 2-deoxy-D-ribose), or polyribonucleotides (containing D-ribose), or any other type of polynucleotide which is an N glycoside of a purine or pyrimidine base, or modified purine or pyrimidine bases. There is no intended distinction in length between the term "nucleic acid", "polynucleotide" and "oligonucleotide", and these terms will be used interchangeably. These terms refer only to the primary structure of the molecule. Thus, these terms include double- and single-stranded DNA, as well as double- and single stranded RNA.
[0253] Off-target: As used herein, "off target" refers to any unintended effect on any one or more target, gene and/or cellular transcript.
[0254] Open reading frame: As used herein, "open reading frame" or "ORF" refers to a sequence which does not contain a stop codon in a given reading frame.
[0255] Operably linked: As used herein, the phrase "operably linked" refers to a functional connection between two or more molecules, constructs, transcripts, entities, moieties or the like.
[0256] Particle: As used herein, a "particle" is a virus comprised of at least two components, a protein capsid and a polynucleotide sequence enclosed within the capsid.
[0257] Patient: As used herein, "patient" refers to a subject who may seek or be in need of treatment, requires treatment, is receiving treatment, will receive treatment, or a subject who is under care by a trained professional for a particular disease or condition, such as for example Parkinson's Disease.
[0258] Payload: As used herein, "payload" refers to one or more polynucleotides or polynucleotide regions encoded by or within a viral genome or an expression product of such polynucleotide or polynucleotide region, e.g., a transgene, a polynucleotide encoding a polypeptide or multi-polypeptide or a modulatory nucleic acid or regulatory nucleic acid.
[0259] Payload construct: As used herein, "payload construct" is one or more polynucleotide regions encoding or comprising a payload that is flanked on one or both sides by an inverted terminal repeat (ITR) sequence. The payload construct is a template that is replicated in a viral production cell to produce a viral genome.
[0260] Payload construct vector: As used herein, "payload construct vector" is a vector encoding or comprising a payload construct, and regulatory regions for replication and expression in bacterial cells.
[0261] Payload construct expression vector: As used herein, a "payload construct expression vector" is a vector encoding or comprising a payload construct and which further comprises one or more polynucleotide regions encoding or comprising components for viral expression in a viral replication cell.
[0262] Peptide: As used herein, "peptide" is less than or equal to 50 amino acids long, e.g., about 5, 10, 15, 20, 25, 30, 35, 40, 45, or 50 amino acids long.
[0263] Pharmaceutically acceptable: The phrase "pharmaceutically acceptable" is employed herein to refer to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
[0264] Pharmaceutically acceptable excipients: The phrase "pharmaceutically acceptable excipient," as used herein, refers to any ingredient other than the compounds and/or active agents (e.g. as described herein) present in pharmaceutical compositions and having the properties of being substantially nontoxic and non-inflammatory in a subject such as a patient. In some embodiments, pharmaceutically acceptable excipients are vehicles capable of suspending and/or dissolving active agents. Excipients may include, for example: antiadherents, antioxidants, binders, coatings, compression aids, disintegrants, dyes (colors), emollients, emulsifiers, fillers (diluents), film formers or coatings, flavors, fragrances, glidants (flow enhancers), lubricants, preservatives, printing inks, sorbents, suspension or dispersing agents, sweeteners, and waters of hydration. Exemplary excipients include, but are not limited to: butylated hydroxytoluene (BHT), calcium carbonate, calcium phosphate (dibasic), calcium stearate, croscarmellose, crosslinked polyvinyl pyrrolidone, citric acid, crospovidone, cysteine, ethylcellulose, gelatin, hydroxypropyl cellulose, hydroxypropyl methylcellulose, lactose, magnesium stearate, maltitol, mannitol, methionine, methylcellulose, methyl paraben, microcrystalline cellulose, polyethylene glycol, polyvinyl pyrrolidone, povidone, pregelatinized starch, propyl paraben, retinyl palmitate, shellac, silicon dioxide, sodium carboxymethyl cellulose, sodium citrate, sodium starch glycolate, sorbitol, starch (corn), stearic acid, sucrose, talc, titanium dioxide, vitamin A, vitamin E, vitamin C, and xylitol.
[0265] Pharmaceutically acceptable salts: Pharmaceutically acceptable salts of the compounds described herein. As used herein, "pharmaceutically acceptable salts" refers to derivatives or forms of the disclosed compounds wherein the parent compound is modified by converting an existing acid or base moiety to its salt form (e.g., as generated by reacting the free base group with a suitable organic acid). Examples of pharmaceutically acceptable salts include, but are not limited to, mineral or organic acid salts of basic residues such as amines; alkali or organic salts of acidic residues such as carboxylic acids; and the like. Representative acid addition salts include acetate, acetic acid, adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzene sulfonic acid, benzoate, bisulfate, borate, butyrate, camphorate, camphorsulfonate, citrate, cyclopentanepropionate, digluconate, dodecylsulfate, ethanesulfonate, fumarate, glucoheptonate, glycerophosphate, hemisulfate, heptonate, hexanoate, hydrobromide, hydrochloride, hydroiodide, 2-hydroxy-ethanesulfonate, lactobionate, lactate, laurate, lauryl sulfate, malate, maleate, malonate, methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate, oleate, oxalate, palmitate, pamoate, pectinate, persulfate, 3-phenylpropionate, phosphate, picrate, pivalate, propionate, stearate, succinate, sulfate, tartrate, thiocyanate, toluenesulfonate, undecanoate, valerate salts, and the like. Representative alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, magnesium, and the like, as well as nontoxic ammonium, quaternary ammonium, and amine cations, including, but not limited to ammonium, tetramethylammonium, tetraethylammonium, methylamine, dimethylamine, trimethylamine, triethylamine, ethylamine, and the like. The pharmaceutically acceptable salts of the present disclosure include the conventional non-toxic salts of the parent compound formed, for example, from non-toxic inorganic or organic acids. In some embodiments a pharmaceutically acceptable salt of the present disclosure can be synthesized salt prepared from the parent compound which contains a basic or acidic moiety by conventional chemical methods. Generally, such salts can be prepared by reacting the free acid or base forms of these compounds with a stoichiometric amount of the appropriate base or acid in water or in an organic solvent, or in a mixture of the two; generally, nonaqueous media like ether, ethyl acetate, ethanol, isopropanol, or acetonitrile are preferred. Lists of suitable salts are found in Remington's Pharmaceutical Sciences, 17th ed., Mack Publishing Company, Easton, Pa., 1985, p. 1418, Pharmaceutical Salts: Properties, Selection, and Use, P. H. Stahl and C. G. Wermuth (eds.), Wiley-VCH, 2008, and Berge et al., Journal of Pharmaceutical Science, 66, 1-19 (1977), each of which is incorporated herein by reference in its entirety.
[0266] Pharmaceutically acceptable solvate: The term "pharmaceutically acceptable solvate," as used herein, refers to a crystalline form of a compound of the invention wherein molecules of a suitable solvent are incorporated in the crystal lattice. A suitable solvent is physiologically tolerable at the dosage administered. For example, solvates may be prepared by crystallization, recrystallization, or precipitation from a solution that includes organic solvents, water, or a mixture thereof. Examples of suitable solvents are ethanol, water (for example, mono-, di-, and tri-hydrates), N-methylpyrrolidinone (NMP), dimethyl sulfoxide (DMSO), N,N'-dimethylformamide (DMF), N,N'-dimethylacetamide (DMAC), 1,3-dimethyl-2-imidazolidinone (DMEU), 1,3-dimethyl-3,4,5,6-tetrahydro-2-(1H)-pyrimidinone (DMPU), acetonitrile (ACN), propylene glycol, ethyl acetate, benzyl alcohol, 2-pyrrolidone, benzyl benzoate, and the like. When water is the solvent, the solvate is referred to as a "hydrate." In some embodiments, the solvent incorporated into a solvate is of a type or at a level that is physiologically tolerable to an organism to which the solvate is administered (e.g., in a unit dosage form of a pharmaceutical composition).
[0267] Pharmacokinetic: As used herein, "pharmacokinetic" refers to any one or more properties of a molecule or compound as it relates to the determination of the fate of substances administered to a living organism. Pharmacokinetics is divided into several areas including the extent and rate of absorption, distribution, metabolism and excretion. This is commonly referred to as ADME where: (A) Absorption is the process of a substance entering the blood circulation; (D) Distribution is the dispersion or dissemination of substances throughout the fluids and tissues of the body; (M) Metabolism (or Biotransformation) is the irreversible transformation of parent compounds into daughter metabolites; and (E) Excretion (or Elimination) refers to the elimination of the substances from the body. In rare cases, some drugs irreversibly accumulate in body tissue.
[0268] Physicochemical: As used herein, "physicochemical" means of or relating to a physical and/or chemical property.
[0269] Preventing: As used herein, the term "preventing" refers to partially or completely delaying onset of an infection, disease, disorder and/or condition; partially or completely delaying onset of one or more symptoms, features, or clinical manifestations of a particular infection, disease, disorder, and/or condition; partially or completely delaying onset of one or more symptoms, features, or manifestations of a particular infection, disease, disorder, and/or condition; partially or completely delaying progression from an infection, a particular disease, disorder and/or condition; and/or decreasing the risk of developing pathology associated with the infection, the disease, disorder, and/or condition, such as for example Parkinson's Disease.
[0270] Prodrug: The present disclosure also includes prodrugs of the compounds described herein. As used herein, "prodrugs" refer to any substance, molecule or entity which is in a form predicate for that substance, molecule or entity to act as a therapeutic upon chemical or physical alteration. Prodrugs may by covalently bonded or sequestered in some way and which release or are converted into the active drug moiety prior to, upon or after administered to a mammalian subject. Preparation and use of prodrugs is discussed in T. Higuchi and V. Stella, "Pro-drugs as Novel Delivery Systems," Vol. 14 of the A.C.S. Symposium Series, and in Bioreversible Carriers in Drug Design, ed. Edward B. Roche, American Pharmaceutical Association and Pergamon Press, 1987, both of which are hereby incorporated by reference in their entirety.
[0271] Proliferate: As used herein, the term "proliferate" means to grow, expand, replicate or increase or cause to grow, expand, replicate or increase. "Proliferative" means having the ability to proliferate. "Anti-proliferative" means having properties counter to or in opposition to proliferative properties.
[0272] Prophylactic: As used herein, "prophylactic" refers to a therapeutic or course of action used to prevent the spread of disease.
[0273] Prophylaxis: As used herein, a "prophylaxis" refers to a measure taken to maintain health and prevent the spread of disease.
[0274] Protein of interest: As used herein, the terms "proteins of interest" or "desired proteins" include those provided herein and fragments, mutants, variants, and alterations thereof.
[0275] Purified: As used herein, "purify," "purified," "purification" means to make substantially pure or clear from unwanted components, material defilement, admixture or imperfection. "Purified" refers to the state of being pure. "Purification" refers to the process of making pure.
[0276] Region: As used herein, the term "region" refers to a zone or general area. In some embodiments, when referring to a protein or protein module, a region may comprise a linear sequence of amino acids along the protein or protein module or may comprise a three dimensional area, an epitope and/or a cluster of epitopes. In some embodiments, regions comprise terminal regions. As used herein, the term "terminal region" refers to regions located at the ends or termini of a given agent. When referring to proteins, terminal regions may comprise N- and/or C-termini. N-termini refer to the end of a protein comprising an amino acid with a free amino group. C-termini refer to the end of a protein comprising an amino acid with a free carboxyl group. N- and/or C-terminal regions may therefore comprise the N- and/or C-termini as well as surrounding amino acids. In some embodiments, N- and/or C-terminal regions comprise from about 3 amino acid to about 30 amino acids, from about 5 amino acids to about 40 amino acids, from about 10 amino acids to about 50 amino acids, from about 20 amino acids to about 100 amino acids and/or at least 100 amino acids. In some embodiments, N-terminal regions may comprise any length of amino acids that includes the N-terminus, but does not include the C-terminus. In some embodiments, C-terminal regions may comprise any length of amino acids, which include the C-terminus, but do not comprise the N-terminus.
[0277] In some embodiments, when referring to a polynucleotide, a region may comprise a linear sequence of nucleic acids along the polynucleotide or may comprise a three dimensional area, secondary structure, or tertiary structure. In some embodiments, regions comprise terminal regions. As used herein, the term "terminal region" refers to regions located at the ends or termini of a given agent. When referring to polynucleotides, terminal regions may comprise 5' and 3' termini. 5' termini refer to the end of a polynucleotide comprising a nucleic acid with a free phosphate group. 3' termini refer to the end of a polynucleotide comprising a nucleic acid with a free hydroxyl group. 5' and 3' regions may therefore comprise the 5' and 3' termini as well as surrounding nucleic acids. In some embodiments, 5' and 3' terminal regions comprise from about 9 nucleic acids to about 90 nucleic acids, from about 15 nucleic acids to about 120 nucleic acids, from about 30 nucleic acids to about 150 nucleic acids, from about 60 nucleic acids to about 300 nucleic acids and/or at least 300 nucleic acids. In some embodiments, 5' regions may comprise any length of nucleic acids that includes the 5' terminus, but does not include the 3' terminus. In some embodiments, 3' regions may comprise any length of nucleic acids, which include the 3' terminus, but does not comprise the 5' terminus.
[0278] RNA or RNA molecule: As used herein, the term "RNA" or "RNA molecule" or "ribonucleic acid molecule" refers to a polymer of ribonucleotides; the term "DNA" or "DNA molecule" or "deoxyribonucleic acid molecule" refers to a polymer of deoxyribonucleotides. DNA and RNA can be synthesized naturally, e.g., by DNA replication and transcription of DNA, respectively; or be chemically synthesized. DNA and RNA can be single-stranded (i.e., ssRNA or ssDNA, respectively) or multi-stranded (e.g., double stranded, i.e., dsRNA and dsDNA, respectively). The term "mRNA" or "messenger RNA", as used herein, refers to a single stranded RNA that encodes the amino acid sequence of one or more polypeptide chains.
[0279] RNA interference: As used herein, the term "RNA interference" or "RNAi" refers to a sequence specific regulatory mechanism mediated by RNA molecules which results in the inhibition or interference or "silencing" of the expression of a corresponding protein-coding gene.
[0280] Sample: As used herein, the term "sample" refers to an aliquot, subset or portion taken from a source and/or provided for analysis or processing. In some embodiments, a sample is from a biological source such as a tissue, cell or component part (e.g. a body fluid, including but not limited to blood, mucus, lymphatic fluid, synovial fluid, cerebrospinal fluid, saliva, amniotic fluid, amniotic cord blood, urine, vaginal fluid and semen). In some embodiments, a sample may be or comprise a homogenate, lysate or extract prepared from a whole organism or a subset of its tissues, cells or component parts, or a fraction or portion thereof, including but not limited to, for example, plasma, serum, spinal fluid, lymph fluid, the external sections of the skin, respiratory, intestinal, and genitourinary tracts, tears, saliva, milk, blood cells, tumors, or organs. In some embodiments, a sample is or comprises a medium, such as a nutrient broth or gel, which may contain cellular components, such as proteins or nucleic acid molecule. In some embodiments, a "primary" sample is an aliquot of the source. In some embodiments, a primary sample is subjected to one or more processing (e.g., separation, purification, etc.) steps to prepare a sample for analysis or other use.
[0281] Self-complementary viral particle: As used herein, a "self-complementary viral particle" is a particle comprised of at least two components, a protein capsid and a polynucleotide sequence encoding a self-complementary genome enclosed within the capsid.
[0282] Sense strand: As used herein, the term "the sense strand" or "the second strand" or "the passenger strand" of a siRNA molecule refers to a strand that is complementary to the antisense strand or first strand. The antisense and sense strands of a siRNA molecule are hybridized to form a duplex structure. As used herein, a "siRNA duplex" includes a siRNA strand having sufficient complementarity to a section of about 10-50 nucleotides of the mRNA of the gene targeted for silencing and a siRNA strand having sufficient complementarity to form a duplex with the siRNA strand.
[0283] Signal Sequences: As used herein, the phrase "signal sequences" refers to a sequence which can direct the transport or localization.
[0284] Single unit dose: As used herein, a "single unit dose" is a dose of any therapeutic administered in one dose/at one time/single route/single point of contact, i.e., single administration event. In some embodiments, a single unit dose is provided as a discrete dosage form (e.g., a tablet, capsule, patch, loaded syringe, vial, etc.).
[0285] Similarity: As used herein, the term "similarity" refers to the overall relatedness between polymeric molecules, e.g. between polynucleotide molecules (e.g. DNA molecules and/or RNA molecules) and/or between polypeptide molecules. Calculation of percent similarity of polymeric molecules to one another can be performed in the same manner as a calculation of percent identity, except that calculation of percent similarity takes into account conservative substitutions as is understood in the art.
[0286] Small/short interfering RNA: As used herein, the term "small/short interfering RNA" or "siRNA" refers to an RNA molecule (or RNA analog) comprising between about 5-60 nucleotides (or nucleotide analogs) which is capable of directing or mediating RNAi. Preferably, a siRNA molecule comprises between about 15-30 nucleotides or nucleotide analogs, more preferably between about 16-25 nucleotides (or nucleotide analogs), even more preferably between about 18-23 nucleotides (or nucleotide analogs), and even more preferably between about 19-22 nucleotides (or nucleotide analogs) (e.g., 19, 20, 21 or 22 nucleotides or nucleotide analogs). The term "short" siRNA refers to a siRNA comprising 5-23 nucleotides, preferably 21 nucleotides (or nucleotide analogs), for example, 19, 20, 21 or 22 nucleotides. The term "long" siRNA refers to a siRNA comprising 24-60 nucleotides, preferably about 24-25 nucleotides, for example, 23, 24, 25 or 26 nucleotides. Short siRNAs may, in some instances, include fewer than 19 nucleotides, e.g., 16, 17 or 18 nucleotides, or as few as 5 nucleotides, provided that the shorter siRNA retains the ability to mediate RNAi. Likewise, long siRNAs may, in some instances, include more than 26 nucleotides, e.g., 27, 28, 29, 30, 35, 40, 45, 50, 55, or even 60 nucleotides, provided that the longer siRNA retains the ability to mediate RNAi or translational repression absent further processing, e.g., enzymatic processing, to a short siRNA. siRNAs can be single stranded RNA molecules (ss-siRNAs) or double stranded RNA molecules (ds-siRNAs) comprising a sense strand and an antisense strand which hybridized to form a duplex structure called siRNA duplex.
[0287] Split dose: As used herein, a "split dose" is the division of single unit dose or total daily dose into two or more doses.
[0288] Stable: As used herein "stable" refers to a compound or entity that is sufficiently robust to survive isolation to a useful degree of purity from a reaction mixture, and preferably capable of formulation into an efficacious therapeutic agent.
[0289] Stabilized: As used herein, the term "stabilize", "stabilized," "stabilized region" means to make or become stable. In some embodiments, stability is measured relative to an absolute value. In some embodiments, stability is measured relative to a reference compound or entity.
[0290] Subject: As used herein, the term "subject" or "patient" refers to any organism to which a composition in accordance with the invention may be administered, e.g., for experimental, diagnostic, prophylactic, and/or therapeutic purposes. Typical subjects include animals (e.g., mammals such as mice, rats, rabbits, non-human primates, and humans) and/or plants. In some embodiments, the subject may be an infant, neonate, or a child under the age of 12 years old. In some embodiments, the subject may be in utero.
[0291] Substantially: As used herein, the term "substantially" refers to the qualitative condition of exhibiting total or near-total extent or degree of a characteristic or property of interest. One of ordinary skill in the biological arts will understand that biological and chemical phenomena rarely, if ever, go to completion and/or proceed to completeness or achieve or avoid an absolute result. The term "substantially" is therefore used herein to capture the potential lack of completeness inherent in many biological and chemical phenomena.
[0292] Substantially equal: As used herein as it relates to time differences between doses, the term means plus/minus 2%.
[0293] Substantially simultaneously: As used herein and as it relates to plurality of doses, the term typically means within about 2 seconds.
[0294] Suffering from: An individual who is "suffering from" a disease, disorder, and/or condition has been diagnosed with or displays one or more symptoms of a disease, disorder, and/or condition such as for example Parkinson's Disease.
[0295] Susceptible to: An individual who is "susceptible to" a disease, disorder, and/or condition has not been diagnosed with and/or may not exhibit symptoms of the disease, disorder, and/or condition but harbors a propensity to develop a disease or its symptoms. In some embodiments, an individual who is susceptible to a disease, disorder, and/or condition (for example, cancer) may be characterized by one or more of the following: (1) a genetic mutation associated with development of the disease, disorder, and/or condition; (2) a genetic polymorphism associated with development of the disease, disorder, and/or condition; (3) increased and/or decreased expression and/or activity of a protein and/or nucleic acid associated with the disease, disorder, and/or condition; (4) habits and/or lifestyles associated with development of the disease, disorder, and/or condition; (5) a family history of the disease, disorder, and/or condition; and (6) exposure to and/or infection with a microbe associated with development of the disease, disorder, and/or condition. In some embodiments, an individual who is susceptible to a disease, disorder, and/or condition will develop the disease, disorder, and/or condition. In some embodiments, an individual who is susceptible to a disease, disorder, and/or condition will not develop the disease, disorder, and/or condition.
[0296] Sustained release: As used herein, the term "sustained release" refers to a pharmaceutical composition or compound release profile that conforms to a release rate over a specific period of time.
[0297] Synthetic: The term "synthetic" means produced, prepared, and/or manufactured by the hand of man. Synthesis of polynucleotides or polypeptides or other molecules of the present invention may be chemical or enzymatic.
[0298] Targeting: As used herein, "targeting" means the process of design and selection of nucleic acid sequence that will hybridize to a target nucleic acid and induce a desired effect.
[0299] Targeted Cells: As used herein, "targeted cells" refers to any one or more cells of interest. The cells may be found in vitro, in vivo, in situ or in the tissue or organ of an organism. The organism may be an animal, preferably a mammal, more preferably a human and most preferably a patient.
[0300] Therapeutic Agent: The term "therapeutic agent" refers to any agent that, when administered to a subject, has a therapeutic, diagnostic, and/or prophylactic effect and/or elicits a desired biological and/or pharmacological effect.
[0301] Therapeutically effective amount: As used herein, the term "therapeutically effective amount" means an amount of an agent to be delivered (e.g., nucleic acid, drug, therapeutic agent, diagnostic agent, prophylactic agent, etc.) that is sufficient, when administered to a subject suffering from or susceptible to an infection, disease, disorder, and/or condition, to treat, improve symptoms of, diagnose, prevent, and/or delay the onset of the infection, disease, disorder, and/or condition such as for example Parkinson's Disease. In some embodiments, a therapeutically effective amount is provided in a single dose. In some embodiments, a therapeutically effective amount is administered in a dosage regimen comprising a plurality of doses. Those skilled in the art will appreciate that in some embodiments, a unit dosage form may be considered to comprise a therapeutically effective amount of a particular agent or entity if it comprises an amount that is effective when administered as part of such a dosage regimen.
[0302] Therapeutically effective outcome: As used herein, the term "therapeutically effective outcome" means an outcome that is sufficient in a subject suffering from or susceptible to an infection, disease, disorder, and/or condition, to treat, improve symptoms of, diagnose, prevent, and/or delay the onset of the infection, disease, disorder, and/or condition.
[0303] Total daily dose: As used herein, a "total daily dose" is an amount given or prescribed in 24 hr period. It may be administered as a single unit dose.
[0304] Transfection: As used herein, the term "transfection" refers to methods to introduce exogenous nucleic acids into a cell. Methods of transfection include, but are not limited to, chemical methods, physical treatments and cationic lipids or mixtures.
[0305] Treating: As used herein, the term "treating" refers to partially or completely alleviating, ameliorating, improving, relieving, delaying onset of, inhibiting progression of, reducing severity of, and/or reducing incidence of one or more symptoms or features of a particular infection, disease, disorder, and/or condition. For example, "treating" cancer may refer to inhibiting survival, growth, and/or spread of a tumor. Treatment may be administered to a subject who does not exhibit signs of a disease, disorder, and/or condition and/or to a subject who exhibits only early signs of a disease, disorder, and/or condition for the purpose of decreasing the risk of developing pathology associated with the disease, disorder, and/or condition such as for example Parkinson's Disease.
[0306] Unmodified: As used herein, "unmodified" refers to any substance, compound or molecule prior to being changed in any way. Unmodified may, but does not always, refer to the wild type or native form of a biomolecule or entity. Molecules or entities may undergo a series of modifications whereby each modified substance, compound, molecule or entity may serve as the "unmodified" starting molecule for a subsequent modification.
[0307] Vector: As used herein, a "vector" is any molecule or moiety which transports, transduces or otherwise acts as a carrier of a heterologous molecule. Vectors of the present disclosure may be produced recombinantly and may be based on and/or may comprise adeno-associated virus (AAV) parent or reference sequence. Such parent or reference AAV sequences may serve as an original, second, third or subsequent sequence for engineering vectors. In non-limiting examples, such parent or reference AAV sequences may comprise any one or more of the following sequences: a polynucleotide sequence encoding a polypeptide or multi-polypeptide, which sequence may be wild-type or modified from wild-type and which sequence may encode full-length or partial sequence of a protein, protein domain, or one or more subunits of a protein; a polynucleotide comprising a modulatory or regulatory nucleic acid which sequence may be wild-type or modified from wild-type; and a transgene that may or may not be modified from wild-type sequence. These AAV sequences may serve as either the "donor" sequence of one or more codons (at the nucleic acid level) or amino acids (at the polypeptide level) or "acceptor" sequences of one or more codons (at the nucleic acid level) or amino acids (at the polypeptide level).
[0308] Viral construct vector: As used herein, a "viral construct vector" is a vector which comprises one or more polynucleotide regions encoding or comprising Rep and or Cap protein.
[0309] Viral construct expression vector: As used herein, a "viral construct expression vector" is a vector which comprises one or more polynucleotide regions encoding or comprising Rep and or Cap that further comprises one or more polynucleotide regions encoding or comprising components for viral expression in a viral replication cell.
[0310] Viral genome: As used herein, a "viral genome" is a polynucleotide encoding at least one inverted terminal repeat (ITR), at least one regulatory sequence, and at least one payload. The viral genome is derived by replication of a payload construct from the payload construct expression vector. A viral genome encodes at least one copy of the payload construct.
EQUIVALENTS AND SCOPE
[0311] Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments in accordance with the invention described herein. The scope of the present invention is not intended to be limited to the above Description, but rather is as set forth in the appended claims.
[0312] In the claims, articles such as "a," "an," and "the" may mean one or more than one unless indicated to the contrary or otherwise evident from the context. Claims or descriptions that include "or" between one or more members of a group are considered satisfied if one, more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process unless indicated to the contrary or otherwise evident from the context. The invention includes embodiments in which exactly one member of the group is present in, employed in, or otherwise relevant to a given product or process. The invention includes embodiments in which more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process.
[0313] It is also noted that the term "comprising" is intended to be open and permits but does not require the inclusion of additional elements or steps. When the term "comprising" is used herein, the term "consisting of" is thus also encompassed and disclosed.
[0314] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Methods and materials are described herein for use in the present disclosure; other, suitable methods and materials known in the art can also be used.
[0315] Where ranges are given, endpoints are included. Furthermore, it is to be understood that unless otherwise indicated or otherwise evident from the context and understanding of one of ordinary skill in the art, values that are expressed as ranges can assume any specific value or subrange within the stated ranges in different embodiments of the invention, to the tenth of the unit of the lower limit of the range, unless the context clearly dictates otherwise.
[0316] In addition, it is to be understood that any particular embodiment of the present invention that falls within the prior art may be explicitly excluded from any one or more of the claims. Since such embodiments are deemed to be known to one of ordinary skill in the art, they may be excluded even if the exclusion is not set forth explicitly herein. Any particular embodiment of the compositions of the invention (e.g., any nucleic acid or protein encoded thereby; any method of production; any method of use; etc.) can be excluded from any one or more claims, for any reason, whether or not related to the existence of prior art.
[0317] All cited sources, for example, references, publications, databases, database entries, and art cited herein, are incorporated into this application by reference, even if not expressly stated in the citation. In case of conflicting statements of a cited source and the instant application, the statement in the instant application shall control.
[0318] Section and table headings are not intended to be limiting.
EXAMPLES
Example 1. Design of AADC Polynucleotides
[0319] AADC polynucleotides are designed to comprise at a minimum a nucleic acid sequence encoding an AADC protein.
[0320] Once designed, the sequence is engineered or synthesized or inserted in a plasmid or vector and administered to a cell or organism. Suitable plasmids or vectors are any which transduce or transfect the target cell.
[0321] Adeno-associated viral vectors (AAV), viral particles or entire viruses may be used.
[0322] Administration results in the processing of the AADC polynucleotide to generate the AADC protein which alters the etiology of the disease, in this case Parkinson's Disease.
[0323] In one non-limiting example, plasmids containing an AADC polynucleotide of the invention are given in Table 1. These AADC polynucleotides in the table are contained in a Fastback plasmid and have a CMV promoter and encode AADC. In some embodiments the open reading frame of the AADC protein mRNA is codon optimized (e.g., codop).
TABLE-US-00002 TABLE 1 AADC polynucleotide-containing plasmids/vectors. SEQ ID Construct NO pFB CMV hAADC-1 2 pFB CMV hAADC-2 3 pFB CMV hAADC-3 4 pFB CMV hAADC-4 5
Example 2. AADC Polynucleotides: ITR to ITR
[0324] AADC polynucleotides suitable for use in an AAV viral vector include those in Table 2.
[0325] Given in Table 2 are the ITR to ITR sequences from Table 1.
TABLE-US-00003 TABLE 2 ITR to ITR AADC polynucleotides SEQ ID Construct NO pFB CMV hAADC-1 (ITR to ITR) 6 pFB CMV hAADC-2 (ITR to ITR) 7 pFB CMV hAADC-3 (ITR to ITR) 8 pFB CMV hAADC-4 (ITR to ITR) 9
Example 3. Relative to the ITR to ITR Parent Sequence
[0326] AADC polynucleotides are designed according to Table 3 and Table 4. The start and stop positions given are relative to the ITR to ITR AADC polynucleotides described in Table 2.
TABLE-US-00004 TABLE 3 Component modules or sequence regions of AADC polynucleotides pFB CMV pFB CMV pFB CMV pFB CMV hAADC-1 hAADC-2 hAADC-3 hAADC-4 (ITR to ITR) (ITR to ITR) (ITR to ITR) (ITR to ITR) Start Stop Start Stop Start Stop Start Stop 5' ITR 1 130 1 130 1 130 1 130 CMV Enhancer 263 566 263 566 263 566 296 599 CMV Promoter 567 769 567 769 567 769 600 802 ie1 exon 1 784 917 784 917 784 917 817 950 ie1 intron1 918 949 918 949 918 949 951 982 hbBglobin 950 1296 950 1296 950 1296 983 1329 intron2 hBglobin 1297 1349 1297 1349 1297 1349 1330 1382 exon 3 5' UTR -- -- -- -- -- -- 1398 1468 hAADC 1374 2822 -- -- 1374 2822 1473 2921 hAADC codop -- -- 1374 2816 -- -- -- -- 3' UTR -- -- -- -- 2823 3221 2922 3361 hGH poly(A) 2841 3317 2835 3311 3240 3716 3380 3856 signal 3' ITR 3417 3535 3416 3534 3822 3940 3961 4079
TABLE-US-00005 TABLE 4 Component modules or sequence regions of AADC polynucleotides hAADC_1k hAADC_2k hAADC_3k hAADC_4 Start Stop Start Stop Start Stop Start Stop 5' ITR 1 141 1 141 1 141 1 141 CMV Enhancer 245 548 245 548 245 548 245 548 CMV Promoter 549 751 549 751 549 751 549 751 ie1 exon 1 766 899 766 899 766 899 766 899 ie1 intron1 900 931 900 931 900 931 900 931 hbBglobin 932 1278 932 1278 932 1278 932 1278 intron2 hBglobin 1279 1331 1279 1331 1279 1331 1279 1331 exon 3 5' UTR -- -- -- -- -- -- 1347 3310 hAADC 1356 2804 1356 2804 -- -- 1422 2864 hAADC codop -- -- -- -- 1356 2798 -- -- 3' UTR -- -- -- -- -- -- 2865 3310 hGH poly(A) 2823 3299 2823 3299 2817 3293 3329 3805 signal 3' ITR 3357 3497 3357 3497 3351 3491 3863 4003
TABLE-US-00006 TABLE 5 Component modules or sequence regions of AADC polynucleotides hAADC_5k hAADC_6k hAADC_9k Start Stop Start Stop Start Stop 5' ITR 1 145 1 141 1 130 CMV Enhancer 249 552 245 548 234 537 CMV Promoter 553 755 549 751 538 740 ie1 exon 1 770 903 766 899 755 888 ie1 intron1 904 935 900 931 889 920 hbBglobin intron2 936 1282 932 1278 921 1267 hBglobin exon 3 1283 1335 1279 1331 1268 1320 5' UTR -- -- -- -- -- -- hAADC 1356 2798 1345 2793 hAADC codop 1360 2802 -- -- -- -- 3' UTR -- -- 2799 3203 -- -- hGH poly(A) signal 2821 3297 3222 3698 2812 3288 3' ITR 3355 3499 3756 3896 3346 3475
Example 4. Design of AADC Polynucleotides
[0327] AADC polynucleotides are designed to comprise at a minimum a nucleic acid sequence encoding an AADC protein.
[0328] Once designed, the sequence is engineered or synthesized or inserted in a plasmid or vector and administered to a cell or organism. Suitable plasmids or vectors are any which transduce or transfect the target cell.
[0329] Adeno-associated viral vectors (AAV), viral particles or entire viruses may be used.
[0330] Administration results in the processing of the AADC polynucleotide to generate the AADC protein which alters the etiology of the disease, in this case Parkinson's Disease.
[0331] In one non-limiting example, plasmids containing an AADC polynucleotide of the invention are given in Table 6. These AADC polynucleotides in the table are contained in a Fastback plasmid and have a CMV promoter and encode AADC. In some embodiments the open reading frame of the AADC protein mRNA is codon optimized (e.g., codop).
TABLE-US-00007 TABLE 6 AADC polynucleotide-containing plasmids/vectors. SEQ ID Construct NO phAADC_1k 10 phAADC_2k 11 phAADC_3k 12 phAADC_4 13 phAADC_5k 14 phAADC_6k 15 phAADC_9k 16
[0332] Given in Table 7 are the ITR to ITR sequences from Table 6.
TABLE-US-00008 TABLE 7 ITR to ITR AADC polynucleotides SEQ ID Construct NO phAADC_1k (ITR to ITR) 17 phAADC_2k (ITR to ITR) 18 phAADC_3k (ITR to ITR) 19 phAADC_4 (ITR to ITR) 20 phAADC_5k (ITR to ITR) 21 phAADC_6k (ITR to ITR) 22 phAADC_9k (ITR to ITR) 23
Example 5. Administration of AADC Polynucleotide Compositions to Patients for Gene Therapy
[0333] AADC polynucleotide-containing recombinant AAV vector compositions are infused into the substantia nigra, and in particular, the substantia nigra pars compacta (SNpc) and ventral tegmental area (VTA) of patients having Parkinson's Disease and identified as qualified for treatment according to methods known in the art.
[0334] One method of administration contemplated for use in the methods described herein is real-time convection-enhanced delivery (RCD) of AADC polynucleotide-containing AAV vector compositions by co-infusion of gadoteridol (a magnetic resonance (MR) contrast agent) and T1 or T2 magnetic resonance imaging (MRI), which can predict areas of subsequent AADC gene expression. As described in Richardson, et al., 2011, the accuracy of cannula placement and initial infusate distribution may be safely determined by saline infusion without significantly altering the subsequent distribution of the tracer agent (Richardson, et al., 2011, Neurosurgery, 69(1):154-163). T2 RCD provides detection of intraparenchymal convection-enhanced delivery in the uninjured brain and may predict subsequent distribution of a transgene after viral vector infusion. Subjects undergo saline infusion/T2 acquisition, immediately followed by gadoteridol infusion/T1 acquisition in the putamen and brainstem. Distribution volumes and spatial patterns are analyzed. Gadoteridol and AAV-encoded AADC are co-infused under alternating T2/T1 acquisition in the thalamus, and hyperintense areas are compared with areas of subsequent transgene expression. Ratios of distribution volume to infusion volume are expected to be similar between saline and gadoteridol RCD. Spatial overlap should correlate well between T2 and T1 images. The second infusate will follow a spatiotemporal pattern similar to that of the first, filling the target area before developing extra-target distribution. Areas of AADC expression should correlate well with areas of both T1 and T2 hyperintensity observed during RCD (Richardson, et al., 2011, Neurosurgery, 69(1):154-163).
[0335] Convection-enhanced delivery (CED) of macromolecules directly into the brain parenchyma has been known for over two decades. CED is a term that denotes the use of a pressure gradient to generate bulk flow within the brain parenchyma, i.e. convection of macromolecules within the interstitial fluid driven by infusing a solution through a cannula placed directly in the targeted structure. This method allows therapeutic agents to be homogenously distributed through large volumes of brain tissue by bypassing the blood brain barrier and surpassing simple diffusion (Richardson, et al., 2011, Stereotact. Funct. Neurosurg. 89:141-151).
[0336] Salegio, et al. recently demonstrated the distribution of nanoparticles of different sizes, including micelles (.about.15 nm in size), AAV (.about.20-25 nm) and liposomes (.about.65 nm), within the CNS of rodents and NHPs (Salegio et al., 2014, Frontiers in Neuroanatomy, vol. 8, article 9: pp. 1-8). Simple injections cannot engage the perivascular system, and specialized infusion cannulae are required, enabling constant pressures to be exerted at the tip of the cannula such that the interstitial hydrostatic pressure is exceeded and infusate can flow out into the tissue. Simple needles generate significant reflux; thus, reflux-resistant cannulas have been developed to counter this tendency. The advent of platforms for MM-guided convection-enhanced infusions further refined understanding of the mechanics of perivascular flow, and it was demonstrated that perivascular distribution of liposomes was linear with respect to time, the slope of the curve was increased in myelinated regions, and cessation of infusion prevented further expansion in the volume of distribution. (Richardson, et al., 2011, Stereotact. Funct. Neurosurg. 89:141-151; Salegio et al., 2014, Frontiers in Neuroanatomy, vol. 8, article 9: pp. 1-8).
[0337] Intraparenchymal rAAV injections are known to result in robust but relatively local transduction. Such local delivery methods are advantageous when attempting gene therapy for neurological disorders that result from neuropathology that is localized to a specific anatomical region or anatomical circuitry such as in the case of Parkinson's disease. However, in treatments requiring more widespread CNS transduction, intraparenchymal injections are impractical. Treatment of neurological disorders attributable to inborn errors of metabolism and/or single-gene defects, or those that affect motor neurons of the spinal cord can require transduction of large proportions of the brain or spinal cord, respectively. Development of less invasive trans-BBB delivery methods for vectors is an extremely important endeavor. Numerous attempts to use molecules that are known to interact with various active transport mechanisms (probably receptor-mediated) to convey proteins across the BBB have been reported with varying results. Given the large number of AAV serotypes available, one or more serotypes may bind a cell-entry receptor capable of transporting the AAV capsid across the BBB (Manfredsson, et al., 2009, "AAV9: a potential blood-brain barrier buster." Molecular Therapy 17(3):403-405).
Vector and Stereotaxic Infusion
[0338] A stereotactic approach may be used to surgically deliver the AADC polynucleotides. Although individuals with AADC deficiency lack epinephrine and norepinephrine, these patients should maintain stable blood pressure and heart rates during the surgery. There should be no notable intracerebral hemorrhages in the postoperative computed tomography (CT) or MRI scans. The needle tracts, as shown on the MM scans, should show accurate injection into the substantia nigra pars compacta (SNpc) and ventral tegmental area (VTA). The patients will be discharged from the hospital about one week after the surgery (Hwu, W. L., et al., 2012. Gene therapy for aromatic L-amino acid decarboxylase deficiency. Sci. Transl. Med. Vol. 4, 134ra61).
[0339] Subjects of treatment receive the AAV-vector composition vector, safely delivered to substantia nigra pars compacta (SNpc) and ventral tegmental area (VTA) via bilateral infusions, or alternatively, intrastriatally (into the caudate nucleus and putamen), or into the subthalamic nucleus (STN), for example optionally using the FDA-approved SMARTFLOW.RTM. neuroventricular cannula (SurgiVision, Inc.) specifically designed for clinical application, with or without the aid of the CLEARPOINT.RTM. system to help the treating neurosurgeon(s) target and observe the delivery of the therapeutic agent in the brain (See, for example, San Sebastian, et al., 2014, Mol. Ther. Methods Clin. Dev. 3: 14049; See, for example, Feng and Maguire-Zeiss, 2010, CNS Drugs 24(3):177-192).
[0340] For example, during the surgery, two target points are determined in the substantia nigra pars compacta (SNpc) and ventral tegmental area (VTA) that are sufficiently separated from each other in dorsolateral directions and identified on a magnetic resonance image. One burr hole is trepanned in each side of the cranial bone, through which the vector is injected into the two target points via the two-track insertion route. The AAV-vector-containing solution is prepared to a concentration of 1.5.times.10.sup.12 vector genome/ml, and 50 .mu.l per point of the solution is injected at 1 .mu.l/min; each patient receives 3.times.10.sup.11 vector genome of the AAV-vector construct.
[0341] Neutralizing antibody titers against AAV2 are determined by measuring .beta.-galactosidase activities in HEK293 cells transduced with 5.times.10.sup.3 vector genome/cell of AAV2 vectors expressing .beta.-galactosidase in various dilutions of sera.
PET
[0342] The AADC expression level in the substantia nigra are assessed on PET imaging with FMT six days before surgery and at one- and six-months after gene transfer. All patients cease taking dopaminergic medications 18 hours before PET and take 2.5 mg/kg of carbidopa orally one hour before FMT injection. Subsequently, 0.12 mCi/kg of FMT in saline is infused into an antecubital vein, and a 90-minute dynamic acquisition sequence is obtained. The PET and magnetic resonance imaging data are co-registered with a fusion processing program (Syntegra; Philips, Amsterdam, The Netherlands) to produce the fusion images. Radioactivities within volumes of interest drawn in the nigrostriatal pathway are calculated between 80 and 90 minutes after tracer injection. A change in nigrostriatal pathway FMT uptake from baseline to 24 weeks is assessed using the sub stantia nigra to striatal ratio of radioactivities.
Statistical Analysis
[0343] Values at baseline and 6 months after gene transfer are compared using Student's t-test (paired analyses). A two-sided P value <0.05 is taken to indicate significant differences. Two-way analysis of variance with Bonferroni correction of P values is used for the short-duration response to levodopa. (See, for example, Muramatsu, et al., 2010, "A phase I study of aromatic L-amino acid decarboxylase gene therapy for Parkinson's disease." Mol. Ther. 18:1731-1735).
[0344] Safety and tolerability of bilateral administration of AAV-vector compositions using real-time image-guided infusion into the brains of Parkinson's Disease subjects may be monitored for up to or after 9 months post-surgery. Broad coverage of targeted areas (substantia nigra pars compacta (SNpc) and ventral tegmental area (VTA)) and widespread AADC protein distribution in the striatum should be achieved without inducing any adverse effects.
[0345] Changes in Growth and Motor Skills:
[0346] The patients should gain weight and exhibit improvement in their motor scores after gene transfer, within a year, post-treatment. Weight will be measured at 3 to 6 months after gene transfer. All patients initially should have raw scores of zero on the Alberta Infant Motor Scale (AIMS) and very low raw scores for the Peabody Developmental Motor Scale, Second Edition (PDMS-II). After the gene transfer, all of the patients should show continuous increases in their raw scores on these two scales, which indicates that their motor functions have improved. The Comprehensive Developmental Inventory for Infants and Toddlers (CDIIT) covers both cognition and motor development. All of the patients should show low raw CDIIT scores before gene transfer, and the subsequent increase in scores demonstrate improvement in both motor and cognitive functions.
Subjective Improvements after Gene Transfer
[0347] To document the symptoms that are more difficult to quantify, spouses, guardians or caretakers of the patients are asked to fill out a questionnaire at the end of the study. The symptoms of the oculogyric crises should lessen, and eye deviations and sleep disruptions, for example, are some mild symptoms of the oculogyric crises that may remain after gene therapy. Subjects may experience increased emotional stability, and/or some improvements in sweating and hyperthermia (a common manifestation of body temperature instability in hot weather). There should be no detectable abnormality in heart rate variability as assessed by 24-hour Holter monitoring either before or after gene transfer. Before gene therapy, patients that were bedridden and showed little spontaneous movement may exhibit less severe ptosis (drooping of the upper eyelid) one to two weeks after the gene transfer. According to previous studies, dyskinesia may occur one month after gene transfer, but upon observation of a decrease in dyskinesia, motor development should start (Hwu, W. L., et al., 2012. Gene therapy for aromatic L-amino acid decarboxylase deficiency. Sci. Transl. Med. Vol. 4, 134ra61). Subjects may exhibit increased head control after three months, sitting with support after six to nine months, sitting up from the prone position after thirteen months, and holding toys and standing with support sixteen months after the gene transfer, for example. Anti-AAV2 antibodies should be negative in the patients before gene therapy, and the titers may increase slightly after gene transfer.
PET Scans and CSF Analyses
[0348] PET scans and CSF analyses are completed for the treated patients. Six months after gene transfer, PET scans should reveal that uptake of 6-[18F] fluorodopa (FDOPA) increase from baseline in the combined (right and left) treatment sites. The CSF analysis should reveal increases in the levels of homovanillic acid (HVA, a metabolite of dopamine) and 5-hydroxyindoleacetic acid (HIAA, a metabolite of serotonin). However, the levels of L-DOPA and 3-O-methyldopa may remain elevated (Hwu, W. L., et al., 2012. Gene therapy for aromatic L-amino acid decarboxylase deficiency. Sci. Transl. Med. Vol. 4, 134ra61).
Example 6. Administration of AADC Polynucleotides
[0349] AADC polynucleotide-containing recombinant AAV vector compositions are infused into the putamen of patients having Parkinson's Disease using the administration methods described in Example 5. The dose, number of patients and volume are outlined in Table 8.
TABLE-US-00009 TABLE 8 Study Design Number of Study No. Patients Dose Volume 1 6 3 .times. 10.sup.11 vg 100 ul per putamen 2 6 9 .times. 10.sup.11 vg 300 ul per putamen 3 10 2.3 .times. 10.sup.11 vg 100 ul per putamen 4 10 7.5 .times. 10.sup.11 vg 100 ul per putamen 5 5 7.5 .times. 10.sup.11 vg 450 ul per putamen 6 Up to 20 1.4 .times. 10.sup.12 vg Up to 900 ul per putamen 7 Up to 20 4.8 .times. 10.sup.12 vg Up to 900 ul per putamen 8 Up to 20 8.8 .times. 10.sup.12 vg Up to 900 ul per putamen
[0350] During the course of the study the safety and tolerability of the infusion of the AADC polynucleotide-containing recombinant adeno-associated virus (AAV) vector compositions in human patients diagnosed with Parkinson's Disease is evaluated. Patients are evaluated preoperatively and monthly postoperatively for six months, using multiple measures, including the Global Systonia Scale (GDS) (see Comella, et al., 2003, Movement Disorders, 18(3):303-312), L-DOPA challenge test, UPDRS scores, motor state diaries, and laboratory tests. Using diaries that separate the day into half-hour segments, the caregivers of the patients will record their mobility during the four days before admission and for another four days at six months after admission to the study site. The patient caregivers are trained to rate subject's condition as sleeping, immobile, mobile without troublesome dyskinesias, or mobile with troublesome dyskinesias. The total number of hours spent in each of these categories is calculated, and the differences between the baseline and the six-month scores are compared between the groups. The short-duration response to levodopa is evaluated at baseline and 6 months after gene transfer; subjects take 100 mg of levodopa orally with 25 mg benserazide after 20 hours without dopaminergic medication. Motor symptoms based on GDS and plasma levodopa concentrations are assessed at baseline and 30 minutes, 1, 2, 3, and 4 hours after levodopa intake (See, for example, Muramatsu, et al., 2010, "A phase I study of aromatic L-amino acid decarboxylase gene therapy for Parkinson's disease." Mol. Ther. 18:1731-1735).
Example 7. In Vivo Administration of AADC Polynucleotides
[0351] Two AADC polynucleotide-containing recombinant AAV vector compositions (plasmid SEQ ID NO: 10 and 12; ITR to ITR SEQ ID NO: 17 and 19), a control and a standard were administered to rats (n=5) by bilateral intrastriation (10 ul/side) at a dose level of 2.times.10.sup.12 vg/ml. The expression of AADC in rat striatum was determined by ELISA after 4 and 8 weeks. Variation was seen between the animals and the hemispheres due to variable delivery between the infusion sites. Both constructs expressed AADC, but the phAADC_3k construct (plasmid SEQ ID NO: 12; ITR to ITR SEQ ID NO: 19) showed up to 200% increase of expression as compared to the standard construct.
Example 8. Dose Response Study of AADC Polynucleotides
[0352] Compositions of AADC polynucleotide-containing recombinant AAV vectors (plasmid SEQ ID NO: 10; ITR to ITR SEQ ID NO: 17) at five different dose levels ranging from 1.times.10.sup.11 vg/ml to 1.times.10.sup.13 vg/ml and a control are administered to 6-OHDA lesioned rats. The behavioral response to low-dose levodopa administration is quantified before and after (week 3 and 4) delivery of the composition. 5 weeks after dosing, necropsy is conducted and the AADC enzymatic activity is measured in ex vivo striatal tissue assay and the distribution of AADC in the brain is determined by immunohistochemical (IHC) staining.
Example 9. Effect of Empty Particles on Intrastriatal Transduction
[0353] Adult rats (n=6) were administered varying ratios of full:empty vector particles at: 0% full, 50% full, 85% full or 99% full. AADC polynucleotide-containing recombinant AAV vector (plasmid SEQ ID NO: 10; ITR to ITR SEQ ID NO: 17) at a constant dose and volume (5 ul and 1.times.10 vg) was administered intrastriatally. The rats were evaluated 4 weeks after administration. The low vector dose resulted in limited AADC vector expression. The volume of distribution for the particles is shown in Table 9 (ELISA) and the striatal levels of AADC expression is shown in Table 10 (Histology).
TABLE-US-00010 TABLE 9 Volume of Distribution % Ratio of full AAV2-AADC Approximate Volume of particle to empty capsids Distribution (mm.sup.3) 50:50 2 70:30 2.4 85:15 2.5 100:0 3
TABLE-US-00011 TABLE 10 Striatal Levels % full of AAV2-AADC particles AADC pg/ug protein 0 0.4 52 1.1 58 1.7 83 2 >99 2.1
[0354] Distribution was comparable for all groups. Relatively low vector dose resulted in limited AADC expression. There was also a trend to lower AADC expression levels with >30% empty particles.
[0355] While the present invention has been described at some length and with some particularity with respect to the several described embodiments, it is not intended that it should be limited to any such particulars or embodiments or any particular embodiment, but it is to be construed with references to the appended claims so as to provide the broadest possible interpretation of such claims in view of the prior art and, therefore, to effectively encompass the intended scope of the invention.
[0356] All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including definitions, will control. In addition, section headings, the materials, methods, and examples are illustrative only and not intended to be limiting.
Sequence CWU
1
1
231480PRTHomo sapiens 1Met Asn Ala Ser Glu Phe Arg Arg Arg Gly Lys Glu Met
Val Asp Tyr 1 5 10 15
Val Ala Asn Tyr Met Glu Gly Ile Glu Gly Arg Gln Val Tyr Pro Asp
20 25 30 Val Glu Pro Gly
Tyr Leu Arg Pro Leu Ile Pro Ala Ala Ala Pro Gln 35
40 45 Glu Pro Asp Thr Phe Glu Asp Ile Ile
Asn Asp Val Glu Lys Ile Ile 50 55
60 Met Pro Gly Val Thr His Trp His Ser Pro Tyr Phe Phe
Ala Tyr Phe 65 70 75
80 Pro Thr Ala Ser Ser Tyr Pro Ala Met Leu Ala Asp Met Leu Cys Gly
85 90 95 Ala Ile Gly Cys
Ile Gly Phe Ser Trp Ala Ala Ser Pro Ala Cys Thr 100
105 110 Glu Leu Glu Thr Val Met Met Asp Trp
Leu Gly Lys Met Leu Glu Leu 115 120
125 Pro Lys Ala Phe Leu Asn Glu Lys Ala Gly Glu Gly Gly Gly
Val Ile 130 135 140
Gln Gly Ser Ala Ser Glu Ala Thr Leu Val Ala Leu Leu Ala Ala Arg 145
150 155 160 Thr Lys Val Ile His
Arg Leu Gln Ala Ala Ser Pro Glu Leu Thr Gln 165
170 175 Ala Ala Ile Met Glu Lys Leu Val Ala Tyr
Ser Ser Asp Gln Ala His 180 185
190 Ser Ser Val Glu Arg Ala Gly Leu Ile Gly Gly Val Lys Leu Lys
Ala 195 200 205 Ile
Pro Ser Asp Gly Asn Phe Ala Met Arg Ala Ser Ala Leu Gln Glu 210
215 220 Ala Leu Glu Arg Asp Lys
Ala Ala Gly Leu Ile Pro Phe Phe Met Val 225 230
235 240 Ala Thr Leu Gly Thr Thr Thr Cys Cys Ser Phe
Asp Asn Leu Leu Glu 245 250
255 Val Gly Pro Ile Cys Asn Lys Glu Asp Ile Trp Leu His Val Asp Ala
260 265 270 Ala Tyr
Ala Gly Ser Ala Phe Ile Cys Pro Glu Phe Arg His Leu Leu 275
280 285 Asn Gly Val Glu Phe Ala Asp
Ser Phe Asn Phe Asn Pro His Lys Trp 290 295
300 Leu Leu Val Asn Phe Asp Cys Ser Ala Met Trp Val
Lys Lys Arg Thr 305 310 315
320 Asp Leu Thr Gly Ala Phe Arg Leu Asp Pro Thr Tyr Leu Lys His Ser
325 330 335 His Gln Asp
Ser Gly Leu Ile Thr Asp Tyr Arg His Trp Gln Ile Pro 340
345 350 Leu Gly Arg Arg Phe Arg Ser Leu
Lys Met Trp Phe Val Phe Arg Met 355 360
365 Tyr Gly Val Lys Gly Leu Gln Ala Tyr Ile Arg Lys His
Val Gln Leu 370 375 380
Ser His Glu Phe Glu Ser Leu Val Arg Gln Asp Pro Arg Phe Glu Ile 385
390 395 400 Cys Val Glu Val
Ile Leu Gly Leu Val Cys Phe Arg Leu Lys Gly Ser 405
410 415 Asn Lys Val Asn Glu Ala Leu Leu Gln
Arg Ile Asn Ser Ala Lys Lys 420 425
430 Ile His Leu Val Pro Cys His Leu Arg Asp Lys Phe Val Leu
Arg Phe 435 440 445
Ala Ile Cys Ser Arg Thr Val Glu Ser Ala His Val Gln Arg Ala Trp 450
455 460 Glu His Ile Lys Glu
Leu Ala Ala Asp Val Leu Arg Ala Glu Arg Glu 465 470
475 480 28150DNAArtificial SequenceDescription
of Artificial Sequence Synthetic polynucleotide 2cattcgccat
tcaggctgca aataagcgtt gatattcagt caattacaaa cattaataac 60gaagagatga
cagaaaaatt ttcattctgt gacagagaaa aagtagccga agatgacggt 120ttgtcacatg
gagttggcag gatgtttgat taaaaacata acaggaagaa aaatgccccg 180ctgtgggcgg
acaaaatagt tgggaactgg gaggggtgga aatggagttt ttaaggatta 240tttagggaag
agtgacaaaa tagatgggaa ctgggtgtag cgtcgtaagc taatacgaaa 300attaaaaatg
acaaaatagt ttggaactag atttcactta tctggttcgg atctcctagg 360cgatatcagt
gatcagatcc agacatgata agatacattg atgagtttgg acaaaccaca 420actagaatgc
agtgaaaaaa atgctttatt tgtgaaattt gtgatgctat tgctttattt 480gtaaccatta
taagctgcaa taaacaagtt aacaacaaca attgcattca ttttatgttt 540caggttcagg
gggaggtgtg ggaggttttt taaagcaagt aaaacctcta caaatgtggt 600atggctgatt
atgatcctct agtacttctc gacaagctta cattattgaa gcatttatca 660gggttattgt
ctcagacctg caggcagctg cgcgctcgct cgctcactga ggccgcccgg 720gcaaagcccg
ggcgtcgggc gacctttggt cgcccggcct cagtgagcga gcgagcgcgc 780agagagggag
tggccaactc catcactagg ggttccttgt agttaatgat taacccgcca 840tgctacttat
ctacgtagcc atgctctaga gcggccgcac gcgtggagct agttattaat 900agtaatcaat
tacggggtca ttagttcata gcccatatat ggagttccgc gttacataac 960ttacggtaaa
tggcccgcct ggctgaccgc ccaacgaccc ccgcccattg acgtcaataa 1020tgacgtatgt
tcccatagta acgtcaatag ggactttcca ttgacgtcaa tgggtggagt 1080atttacggta
aactgcccac ttggcagtac atcaagtgta tcatatgcca agtacgcccc 1140ctattgacgt
caatgacggt aaatggcccg cctggcatta tgcccagtac atgaccttat 1200gggactttcc
tacttggcag tacatctacg tattagtcat cgctattacc atggtgatgc 1260ggttttggca
gtacatcaat gggcgtggat agcggtttga ctcacgggga tttccaagtc 1320tccaccccat
tgacgtcaat gggagtttgt tttgcaccaa aatcaacggg actttccaaa 1380atgtcgtaac
aactccgccc cattgacgca aatgggcggt aggcgtgtac ggtgggaggt 1440ctatataagc
agagctcgtt tagtgaaccg tcagatcgcc tggagacgcc atccacgctg 1500ttttgacctc
catagaagac accgggaccg atccagcctc cgcggattcg aatcccggcc 1560gggaacggtg
cattggaacg cggattcccc gtgccaagag tgacgtaagt accgcctata 1620gagtctatag
gcccacaaaa aatgctttct tcttttaata tacttttttg tttatcttat 1680ttctaatact
ttccctaatc tctttctttc agggcaataa tgatacaatg tatcatgcct 1740ctttgcacca
ttctaaagaa taacagtgat aatttctggg ttaaggcaat agcaatattt 1800ctgcatataa
atatttctgc atataaattg taactgatgt aagaggtttc atattgctaa 1860tagcagctac
aatccagcta ccattctgct tttattttat ggttgggata aggctggatt 1920attctgagtc
caagctaggc ccttttgcta atcatgttca tacctcttat cttcctccca 1980cagctcctgg
gcaacgtgct ggtctgtgtg ctggcccatc actttggcaa agaattggga 2040ttcgaacatc
ggccgccacc atgaacgcaa gtgaattccg aaggagaggg aaggagatgg 2100tggattacgt
ggccaactac atggaaggca ttgagggacg ccaggtctac cctgacgtgg 2160agcccgggta
cctgcggccg ctgatccctg ccgctgcccc tcaggagcca gacacgtttg 2220aggacatcat
caacgacgtt gagaagataa tcatgcctgg ggtgacgcac tggcacagcc 2280cctacttctt
cgcctacttc cccactgcca gctcgtaccc ggccatgctt gcggacatgc 2340tgtgcggggc
cattggctgc atcggcttct cctgggcggc aagcccagca tgcacagagc 2400tggagactgt
gatgatggac tggctcggga agatgctgga actaccaaag gcatttttga 2460atgagaaagc
tggagaaggg ggaggagtga tccagggaag tgccagtgaa gccaccctgg 2520tggccctgct
ggccgctcgg accaaagtga tccatcggct gcaggcagcg tccccagagc 2580tcacacaggc
cgctatcatg gagaagctgg tggcttactc atccgatcag gcacactcct 2640cagtggaaag
agctgggtta attggtggag tgaaattaaa agccatcccc tcagatggca 2700acttcgccat
gcgtgcgtct gccctgcagg aagccctgga gagagacaaa gcggctggcc 2760tgattccttt
ctttatggtt gccaccctgg ggaccacaac atgctgctcc tttgacaatc 2820tcttagaagt
cggtcctatc tgcaacaagg aagacatatg gctgcacgtt gatgcagcct 2880acgcaggcag
tgcattcatc tgccctgagt tccggcacct tctgaatgga gtggagtttg 2940cagattcatt
caactttaat ccccacaaat ggctattggt gaattttgac tgttctgcca 3000tgtgggtgaa
aaagagaaca gacttaacgg gagcctttag actggacccc acttacctga 3060agcacagcca
tcaggattca gggcttatca ctgactaccg gcattggcag ataccactgg 3120gcagaagatt
tcgctctttg aaaatgtggt ttgtatttag gatgtatgga gtcaaaggac 3180tgcaggctta
tatccgcaag catgtccagc tgtcccatga gtttgagtca ctggtgcgcc 3240aggatccccg
ctttgaaatc tgtgtggaag tcattctggg gcttgtctgc tttcggctaa 3300agggttccaa
caaagtgaat gaagctcttc tgcaaagaat aaacagtgcc aaaaaaatcc 3360acttggttcc
atgtcacctc agggacaagt ttgtcctgcg ctttgccatc tgttctcgca 3420cggtggaatc
tgcccatgtg cagcgggcct gggaacacat caaagagctg gcggccgacg 3480tgctgcgagc
agagagggag taggagtgag ctgctcgaga gatctacggg tggcatccct 3540gtgacccctc
cccagtgcct ctcctggccc tggaagttgc cactccagtg cccaccagcc 3600ttgtcctaat
aaaattaagt tgcatcattt tgtctgacta ggtgtccttc tataatatta 3660tggggtggag
gggggtggta tggagcaagg ggcaagttgg gaagacaacc tgtagggcct 3720gcggggtcta
ttgggaacca agctggagtg cagtggcaca atcttggctc actgcaatct 3780ccgcctcctg
ggttcaagcg attctcctgc ctcagcctcc cgagttgttg ggattccagg 3840catgcatgac
caggctcagc taatttttgt ttttttggta gagacggggt ttcaccatat 3900tggccaggct
ggtctccaac tcctaatctc aggtgatcta cccaccttgg cctcccaaat 3960tgctgggatt
acaggcgtga accactgctc ccttccctgt ccttctgatt ttgtaggtaa 4020ccccggacca
cgtgcggacc gagcggccgc tctagagcat ggctacgtag ataagtagca 4080tggcgggtta
atcattaact acaaggaacc cctagtgatg gagttggcca ctccctctct 4140gcgcgctcgc
tcgctcactg aggccgggcg accaaaggtc gcccgacgcc cgggcggcct 4200cagtgagcga
gcgagcgcgc agctgcctgc aggtctgaga caataaccct gataaatgct 4260tcaataatgt
agccaaccac tagaactata gctagagtcc tgggcgaaca aacgatgctc 4320gccttccaga
aaaccgagga tgcgaaccac ttcatccggg gtcagcacca ccggcaagcg 4380ccgcgacggc
cgaggtcttc cgatctcctg aagccagggc agatccgtgc acagcacctt 4440gccgtagaag
aacagcaagg ccgccaatgc ctgacgatgc gtggagaccg aaaccttgcg 4500ctcgttcgcc
agccaggaca gaaatgcctc gacttcgctg ctgcccaagg ttgccgggtg 4560acgcacaccg
tggaaacgga tgaaggcacg aacccagttg acataagcct gttcggttcg 4620taaactgtaa
tgcaagtagc gtatgcgctc acgcaactgg tccagaacct tgaccgaacg 4680cagcggtggt
aacggcgcag tggcggtttt catggcttgt tatgactgtt tttttgtaca 4740gtctatgcct
cgggcatcca agcagcaagc gcgttacgcc gtgggtcgat gtttgatgtt 4800atggagcagc
aacgatgtta cgcagcagca acgatgttac gcagcagggc agtcgcccta 4860aaacaaagtt
aggtggctca agtatgggca tcattcgcac atgtaggctc ggccctgacc 4920aagtcaaatc
catgcgggct gctcttgatc ttttcggtcg tgagttcgga gacgtagcca 4980cctactccca
acatcagccg gactccgatt acctcgggaa cttgctccgt agtaagacat 5040tcatcgcgct
tgctgccttc gaccaagaag cggttgttgg cgctctcgcg gcttacgttc 5100tgcccaagtt
tgagcagccg cgtagtgaga tctatatcta tgatctcgca gtctccggcg 5160agcaccggag
gcagggcatt gccaccgcgc tcatcaatct cctcaagcat gaggccaacg 5220cgcttggtgc
ttatgtgatc tacgtgcaag cagattacgg tgacgatccc gcagtggctc 5280tctatacaaa
gttgggcata cgggaagaag tgatgcactt tgatatcgac ccaagtaccg 5340ccacctaaca
attcgttcaa gccgagatcg gcttcccggc cgcggagttg ttcggtaaat 5400tgtcacaacg
ccgcgaatat agtctttacc atgcccttgg ccacgcccct ctttaatacg 5460acgggcaatt
tgcacttcag aaaatgaaga gtttgcttta gccataacaa aagtccagta 5520tgctttttca
cagcataact ggactgattt cagtttacaa ctattctgtc tagtttaaga 5580ctttattgtc
atagtttaga tctattttgt tcagtttaag actttattgt ccgcccacac 5640ccgcttacgc
agggcatcca tttattactc aaccgtaacc gattttgcca ggttacgcgg 5700ctggtctatg
cggtgtgaaa taccgcacag atgcgtaagg agaaaatacc gcatcaggcg 5760ctcttccgct
tcctcgctca ctgactcgct gcgctcggtc gttcggctgc ggcgagcggt 5820atcagctcac
tcaaaggcgg taatacggtt atccacagaa tcaggggata acgcaggaaa 5880gaacatgtga
gcaaaaggcc agcaaaaggc caggaaccgt aaaaaggccg cgttgctggc 5940gtttttccat
aggctccgcc cccctgacga gcatcacaaa aatcgacgct caagtcagag 6000gtggcgaaac
ccgacaggac tataaagata ccaggcgttt ccccctggaa gctccctcgt 6060gcgctctcct
gttccgaccc tgccgcttac cggatacctg tccgcctttc tcccttcggg 6120aagcgtggcg
ctttctcata gctcacgctg taggtatctc agttcggtgt aggtcgttcg 6180ctccaagctg
ggctgtgtgc acgaaccccc cgttcagccc gaccgctgcg ccttatccgg 6240taactatcgt
cttgagtcca acccggtaag acacgactta tcgccactgg cagcagccac 6300tggtaacagg
attagcagag cgaggtatgt aggcggtgct acagagttct tgaagtggtg 6360gcctaactac
ggctacacta gaagaacagt atttggtatc tgcgctctgc tgaagccagt 6420taccttcgga
aaaagagttg gtagctcttg atccggcaaa caaaccaccg ctggtagcgg 6480tggttttttt
gtttgcaagc agcagattac gcgcagaaaa aaaggatctc aagaagatcc 6540tttgatcttt
tctacggggt ctgacgctca gtggaacgaa aactcacgtt aagggatttt 6600ggtcatgaga
ttatcaaaaa ggatcttcac ctagatcctt ttaaattaaa aatgaagttt 6660taaatcaatc
taaagtatat atgagtaaac ttggtctgac agttaccaat gcttaatcag 6720tgaggcacct
atctcagcga tctgtctatt tcgttcatcc atagttgcct gactccccgt 6780cgtgtagata
actacgatac gggagggctt accatctggc cccagtgctg caatgatacc 6840gcgagaccca
cgctcaccgg ctccagattt atcagcaata aaccagccag ccggaagggc 6900cgagcgcaga
agtggtcctg caactttatc cgcctccatc cagtctatta attgttgccg 6960ggaagctaga
gtaagtagtt cgccagttaa tagtttgcgc aacgttgttg ccattgctac 7020aggcatcgtg
gtgtcacgct cgtcgtttgg tatggcttca ttcagctccg gttcccaacg 7080atcaaggcga
gttacatgat cccccatgtt gtgcaaaaaa gcggttagct ccttcggtcc 7140tccgatcgtt
gtcagaagta agttggccgc agtgttatca ctcatggtta tggcagcact 7200gcataattct
cttactgtca tgccatccgt aagatgcttt tctgtgactg gtgagtactc 7260aaccaagtca
ttctgagaat agtgtatgcg gcgaccgagt tgctcttgcc cggcgtcaat 7320acgggataat
accgcgccac atagcagaac tttaaaagtg ctcatcattg gaaaacgttc 7380ttcggggcga
aaactctcaa ggatcttacc gctgttgaga tccagttcga tgtaacccac 7440tcgtgcaccc
aactgatctt cagcatcttt tactttcacc agcgtttctg ggtgagcaaa 7500aacaggaagg
caaaatgccg caaaaaaggg aataagggcg acacggaaat gttgaatact 7560catactcttc
ctttttcaat attattgaag catttatcag ggttattgtc tcatgagcgg 7620atacatattt
gaatgtattt agaaaaataa acaaataggg gttccgcgca catttccccg 7680aaaagtgcca
cctaaattgt aagcgttaat attttgttaa aattcgcgtt aaatttttgt 7740taaatcagct
cattttttaa ccaataggcc gaaatcggca aaatccctta taaatcaaaa 7800gaatagaccg
agatagggtt gagtgttgtt ccagtttgga acaagagtcc actattaaag 7860aacgtggact
ccaacgtcaa agggcgaaaa accgtctatc agggcgatgg cccactacgt 7920gaaccatcac
cctaatcaag ttttttgggg tcgaggtgcc gtaaagcact aaatcggaac 7980cctaaaggga
gcccccgatt tagagcttga cggggaaagc cggcgaacgt ggcgagaaag 8040gaagggaaga
aagcgaaagg agcgggcgct agggcgctgg caagtgtagc ggtcacgctg 8100cgcgtaacca
ccacacccgc cgcgcttaat gcgccgctac agggcgcgtc
815038149DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 3cattcgccat tcaggctgca aataagcgtt
gatattcagt caattacaaa cattaataac 60gaagagatga cagaaaaatt ttcattctgt
gacagagaaa aagtagccga agatgacggt 120ttgtcacatg gagttggcag gatgtttgat
taaaaacata acaggaagaa aaatgccccg 180ctgtgggcgg acaaaatagt tgggaactgg
gaggggtgga aatggagttt ttaaggatta 240tttagggaag agtgacaaaa tagatgggaa
ctgggtgtag cgtcgtaagc taatacgaaa 300attaaaaatg acaaaatagt ttggaactag
atttcactta tctggttcgg atctcctagg 360cgatatcagt gatcagatcc agacatgata
agatacattg atgagtttgg acaaaccaca 420actagaatgc agtgaaaaaa atgctttatt
tgtgaaattt gtgatgctat tgctttattt 480gtaaccatta taagctgcaa taaacaagtt
aacaacaaca attgcattca ttttatgttt 540caggttcagg gggaggtgtg ggaggttttt
taaagcaagt aaaacctcta caaatgtggt 600atggctgatt atgatcctct agtacttctc
gacaagctta cattattgaa gcatttatca 660gggttattgt ctcagacctg caggcagctg
cgcgctcgct cgctcactga ggccgcccgg 720gcaaagcccg ggcgtcgggc gacctttggt
cgcccggcct cagtgagcga gcgagcgcgc 780agagagggag tggccaactc catcactagg
ggttccttgt agttaatgat taacccgcca 840tgctacttat ctacgtagcc atgctctaga
gcggccgcac gcgtggagct agttattaat 900agtaatcaat tacggggtca ttagttcata
gcccatatat ggagttccgc gttacataac 960ttacggtaaa tggcccgcct ggctgaccgc
ccaacgaccc ccgcccattg acgtcaataa 1020tgacgtatgt tcccatagta acgtcaatag
ggactttcca ttgacgtcaa tgggtggagt 1080atttacggta aactgcccac ttggcagtac
atcaagtgta tcatatgcca agtacgcccc 1140ctattgacgt caatgacggt aaatggcccg
cctggcatta tgcccagtac atgaccttat 1200gggactttcc tacttggcag tacatctacg
tattagtcat cgctattacc atggtgatgc 1260ggttttggca gtacatcaat gggcgtggat
agcggtttga ctcacgggga tttccaagtc 1320tccaccccat tgacgtcaat gggagtttgt
tttgcaccaa aatcaacggg actttccaaa 1380atgtcgtaac aactccgccc cattgacgca
aatgggcggt aggcgtgtac ggtgggaggt 1440ctatataagc agagctcgtt tagtgaaccg
tcagatcgcc tggagacgcc atccacgctg 1500ttttgacctc catagaagac accgggaccg
atccagcctc cgcggattcg aatcccggcc 1560gggaacggtg cattggaacg cggattcccc
gtgccaagag tgacgtaagt accgcctata 1620gagtctatag gcccacaaaa aatgctttct
tcttttaata tacttttttg tttatcttat 1680ttctaatact ttccctaatc tctttctttc
agggcaataa tgatacaatg tatcatgcct 1740ctttgcacca ttctaaagaa taacagtgat
aatttctggg ttaaggcaat agcaatattt 1800ctgcatataa atatttctgc atataaattg
taactgatgt aagaggtttc atattgctaa 1860tagcagctac aatccagcta ccattctgct
tttattttat ggttgggata aggctggatt 1920attctgagtc caagctaggc ccttttgcta
atcatgttca tacctcttat cttcctccca 1980cagctcctgg gcaacgtgct ggtctgtgtg
ctggcccatc actttggcaa agaattggga 2040ttcgaacatc ggccgccacc atgaacgcca
gcgagttcag gaggaggggc aaggagatgg 2100tggactacgt ggccaactac atggagggca
tcgagggcag gcaggtgtac cccgacgtgg 2160agcccggcta cctgaggccc ctgatccccg
ccgccgcccc ccaggagccc gacaccttcg 2220aggacatcat caacgacgtg gagaagatca
tcatgcccgg cgtgacccac tggcacagcc 2280cctacttctt cgcctacttc cccaccgcca
gcagctaccc cgccatgctg gccgacatgc 2340tgtgcggcgc catcggctgc atcggcttca
gctgggccgc cagccccgcc tgcaccgagc 2400tggagaccgt gatgatggac tggctgggca
agatgctgga gctgcccaag gccttcctga 2460acgagaaggc cggcgagggc ggcggcgtga
tccagggcag cgccagcgag gccaccctgg 2520tggccctgct ggccgccagg accaaggtga
tccacaggct gcaggccgcc agccccgagc 2580tgacccaggc cgccatcatg gagaagctgg
tggcctacag cagcgaccag gcccacagca 2640gcgtggagag ggccggcctg atcggcggcg
tgaagctgaa ggccatcccc agcgacggca 2700acttcgccat gagggccagc gccctgcagg
aggccctgga gagggacaag gccgccggcc 2760tgatcccctt cttcatggtg gccaccctgg
gcaccaccac ctgctgcagc ttcgacaacc 2820tgctggaggt gggccccatc tgcaacaagg
aggacatctg gctgcacgtg gacgccgcct 2880acgccggcag cgccttcatc tgccccgagt
tcaggcacct gctgaacggc gtggagttcg 2940ccgacagctt caacttcaac ccccacaagt
ggctgctggt gaacttcgac tgcagcgcca 3000tgtgggtgaa gaagaggacc gacctgaccg
gcgccttcag gctggacccc acctacctga 3060agcacagcca ccaggacagc ggcctgatca
ccgactacag gcactggcag atccccctgg 3120gcaggaggtt caggagcctg aagatgtggt
tcgtgttcag gatgtacggc gtgaagggcc 3180tgcaggccta catcaggaag cacgtgcagc
tgagccacga gttcgagagc ctggtgaggc 3240aggaccccag gttcgagatc tgcgtggagg
tgatcctggg cctggtgtgc ttcaggctga 3300agggcagcaa caaggtgaac gaggccctgc
tgcagaggat caacagcgcc aagaagatcc 3360acctggtgcc ctgccacctg agggacaagt
tcgtgctgag gttcgccatc tgcagcagga 3420ccgtggagag cgcccacgtg cagagggcct
gggagcacat caaggagctg gccgccgacg 3480tgctgagggc cgagagggag tgagctgctc
gagagatcta cgggtggcat ccctgtgacc 3540cctccccagt gcctctcctg gccctggaag
ttgccactcc agtgcccacc agccttgtcc 3600taataaaatt aagttgcatc attttgtctg
actaggtgtc cttctataat attatggggt 3660ggaggggggt ggtatggagc aaggggcaag
ttgggaagac aacctgtagg gcctgcgggg 3720tctattggga accaagctgg agtgcagtgg
cacaatcttg gctcactgca atctccgcct 3780cctgggttca agcgattctc ctgcctcagc
ctcccgagtt gttgggattc caggcatgca 3840tgaccaggct cagctaattt ttgttttttt
ggtagagacg gggtttcacc atattggcca 3900ggctggtctc caactcctaa tctcaggtga
tctacccacc ttggcctccc aaattgctgg 3960gattacaggc gtgaaccact gctcccttcc
ctgtccttct gattttgtag gtaacgtaac 4020cccggaccac gtgcggaccg agcggccgct
ctagagcatg gctacgtaga taagtagcat 4080ggcgggttaa tcattaacta caaggaaccc
ctagtgatgg agttggccac tccctctctg 4140cgcgctcgct cgctcactga ggccgggcga
ccaaaggtcg cccgacgccc gggcggcctc 4200agtgagcgag cgagcgcgca gctgcctgca
ggtctgagac aataaccctg ataaatgctt 4260caataatgta gccaaccact agaactatag
ctagagtcct gggcgaacaa acgatgctcg 4320ccttccagaa aaccgaggat gcgaaccact
tcatccgggg tcagcaccac cggcaagcgc 4380cgcgacggcc gaggtcttcc gatctcctga
agccagggca gatccgtgca cagcaccttg 4440ccgtagaaga acagcaaggc cgccaatgcc
tgacgatgcg tggagaccga aaccttgcgc 4500tcgttcgcca gccaggacag aaatgcctcg
acttcgctgc tgcccaaggt tgccgggtga 4560cgcacaccgt ggaaacggat gaaggcacga
acccagttga cataagcctg ttcggttcgt 4620aaactgtaat gcaagtagcg tatgcgctca
cgcaactggt ccagaacctt gaccgaacgc 4680agcggtggta acggcgcagt ggcggttttc
atggcttgtt atgactgttt ttttgtacag 4740tctatgcctc gggcatccaa gcagcaagcg
cgttacgccg tgggtcgatg tttgatgtta 4800tggagcagca acgatgttac gcagcagcaa
cgatgttacg cagcagggca gtcgccctaa 4860aacaaagtta ggtggctcaa gtatgggcat
cattcgcaca tgtaggctcg gccctgacca 4920agtcaaatcc atgcgggctg ctcttgatct
tttcggtcgt gagttcggag acgtagccac 4980ctactcccaa catcagccgg actccgatta
cctcgggaac ttgctccgta gtaagacatt 5040catcgcgctt gctgccttcg accaagaagc
ggttgttggc gctctcgcgg cttacgttct 5100gcccaagttt gagcagccgc gtagtgagat
ctatatctat gatctcgcag tctccggcga 5160gcaccggagg cagggcattg ccaccgcgct
catcaatctc ctcaagcatg aggccaacgc 5220gcttggtgct tatgtgatct acgtgcaagc
agattacggt gacgatcccg cagtggctct 5280ctatacaaag ttgggcatac gggaagaagt
gatgcacttt gatatcgacc caagtaccgc 5340cacctaacaa ttcgttcaag ccgagatcgg
cttcccggcc gcggagttgt tcggtaaatt 5400gtcacaacgc cgcgaatata gtctttacca
tgcccttggc cacgcccctc tttaatacga 5460cgggcaattt gcacttcaga aaatgaagag
tttgctttag ccataacaaa agtccagtat 5520gctttttcac agcataactg gactgatttc
agtttacaac tattctgtct agtttaagac 5580tttattgtca tagtttagat ctattttgtt
cagtttaaga ctttattgtc cgcccacacc 5640cgcttacgca gggcatccat ttattactca
accgtaaccg attttgccag gttacgcggc 5700tggtctatgc ggtgtgaaat accgcacaga
tgcgtaagga gaaaataccg catcaggcgc 5760tcttccgctt cctcgctcac tgactcgctg
cgctcggtcg ttcggctgcg gcgagcggta 5820tcagctcact caaaggcggt aatacggtta
tccacagaat caggggataa cgcaggaaag 5880aacatgtgag caaaaggcca gcaaaaggcc
aggaaccgta aaaaggccgc gttgctggcg 5940tttttccata ggctccgccc ccctgacgag
catcacaaaa atcgacgctc aagtcagagg 6000tggcgaaacc cgacaggact ataaagatac
caggcgtttc cccctggaag ctccctcgtg 6060cgctctcctg ttccgaccct gccgcttacc
ggatacctgt ccgcctttct cccttcggga 6120agcgtggcgc tttctcatag ctcacgctgt
aggtatctca gttcggtgta ggtcgttcgc 6180tccaagctgg gctgtgtgca cgaacccccc
gttcagcccg accgctgcgc cttatccggt 6240aactatcgtc ttgagtccaa cccggtaaga
cacgacttat cgccactggc agcagccact 6300ggtaacagga ttagcagagc gaggtatgta
ggcggtgcta cagagttctt gaagtggtgg 6360cctaactacg gctacactag aagaacagta
tttggtatct gcgctctgct gaagccagtt 6420accttcggaa aaagagttgg tagctcttga
tccggcaaac aaaccaccgc tggtagcggt 6480ggtttttttg tttgcaagca gcagattacg
cgcagaaaaa aaggatctca agaagatcct 6540ttgatctttt ctacggggtc tgacgctcag
tggaacgaaa actcacgtta agggattttg 6600gtcatgagat tatcaaaaag gatcttcacc
tagatccttt taaattaaaa atgaagtttt 6660aaatcaatct aaagtatata tgagtaaact
tggtctgaca gttaccaatg cttaatcagt 6720gaggcaccta tctcagcgat ctgtctattt
cgttcatcca tagttgcctg actccccgtc 6780gtgtagataa ctacgatacg ggagggctta
ccatctggcc ccagtgctgc aatgataccg 6840cgagacccac gctcaccggc tccagattta
tcagcaataa accagccagc cggaagggcc 6900gagcgcagaa gtggtcctgc aactttatcc
gcctccatcc agtctattaa ttgttgccgg 6960gaagctagag taagtagttc gccagttaat
agtttgcgca acgttgttgc cattgctaca 7020ggcatcgtgg tgtcacgctc gtcgtttggt
atggcttcat tcagctccgg ttcccaacga 7080tcaaggcgag ttacatgatc ccccatgttg
tgcaaaaaag cggttagctc cttcggtcct 7140ccgatcgttg tcagaagtaa gttggccgca
gtgttatcac tcatggttat ggcagcactg 7200cataattctc ttactgtcat gccatccgta
agatgctttt ctgtgactgg tgagtactca 7260accaagtcat tctgagaata gtgtatgcgg
cgaccgagtt gctcttgccc ggcgtcaata 7320cgggataata ccgcgccaca tagcagaact
ttaaaagtgc tcatcattgg aaaacgttct 7380tcggggcgaa aactctcaag gatcttaccg
ctgttgagat ccagttcgat gtaacccact 7440cgtgcaccca actgatcttc agcatctttt
actttcacca gcgtttctgg gtgagcaaaa 7500acaggaaggc aaaatgccgc aaaaaaggga
ataagggcga cacggaaatg ttgaatactc 7560atactcttcc tttttcaata ttattgaagc
atttatcagg gttattgtct catgagcgga 7620tacatatttg aatgtattta gaaaaataaa
caaatagggg ttccgcgcac atttccccga 7680aaagtgccac ctaaattgta agcgttaata
ttttgttaaa attcgcgtta aatttttgtt 7740aaatcagctc attttttaac caataggccg
aaatcggcaa aatcccttat aaatcaaaag 7800aatagaccga gatagggttg agtgttgttc
cagtttggaa caagagtcca ctattaaaga 7860acgtggactc caacgtcaaa gggcgaaaaa
ccgtctatca gggcgatggc ccactacgtg 7920aaccatcacc ctaatcaagt tttttggggt
cgaggtgccg taaagcacta aatcggaacc 7980ctaaagggag cccccgattt agagcttgac
ggggaaagcc ggcgaacgtg gcgagaaagg 8040aagggaagaa agcgaaagga gcgggcgcta
gggcgctggc aagtgtagcg gtcacgctgc 8100gcgtaaccac cacacccgcc gcgcttaatg
cgccgctaca gggcgcgtc 814948555DNAArtificial
SequenceDescription of Artificial Sequence Synthetic polynucleotide
4cattcgccat tcaggctgca aataagcgtt gatattcagt caattacaaa cattaataac
60gaagagatga cagaaaaatt ttcattctgt gacagagaaa aagtagccga agatgacggt
120ttgtcacatg gagttggcag gatgtttgat taaaaacata acaggaagaa aaatgccccg
180ctgtgggcgg acaaaatagt tgggaactgg gaggggtgga aatggagttt ttaaggatta
240tttagggaag agtgacaaaa tagatgggaa ctgggtgtag cgtcgtaagc taatacgaaa
300attaaaaatg acaaaatagt ttggaactag atttcactta tctggttcgg atctcctagg
360cgatatcagt gatcagatcc agacatgata agatacattg atgagtttgg acaaaccaca
420actagaatgc agtgaaaaaa atgctttatt tgtgaaattt gtgatgctat tgctttattt
480gtaaccatta taagctgcaa taaacaagtt aacaacaaca attgcattca ttttatgttt
540caggttcagg gggaggtgtg ggaggttttt taaagcaagt aaaacctcta caaatgtggt
600atggctgatt atgatcctct agtacttctc gacaagctta cattattgaa gcatttatca
660gggttattgt ctcagacctg caggcagctg cgcgctcgct cgctcactga ggccgcccgg
720gcaaagcccg ggcgtcgggc gacctttggt cgcccggcct cagtgagcga gcgagcgcgc
780agagagggag tggccaactc catcactagg ggttccttgt agttaatgat taacccgcca
840tgctacttat ctacgtagcc atgctctaga gcggccgcac gcgtggagct agttattaat
900agtaatcaat tacggggtca ttagttcata gcccatatat ggagttccgc gttacataac
960ttacggtaaa tggcccgcct ggctgaccgc ccaacgaccc ccgcccattg acgtcaataa
1020tgacgtatgt tcccatagta acgtcaatag ggactttcca ttgacgtcaa tgggtggagt
1080atttacggta aactgcccac ttggcagtac atcaagtgta tcatatgcca agtacgcccc
1140ctattgacgt caatgacggt aaatggcccg cctggcatta tgcccagtac atgaccttat
1200gggactttcc tacttggcag tacatctacg tattagtcat cgctattacc atggtgatgc
1260ggttttggca gtacatcaat gggcgtggat agcggtttga ctcacgggga tttccaagtc
1320tccaccccat tgacgtcaat gggagtttgt tttgcaccaa aatcaacggg actttccaaa
1380atgtcgtaac aactccgccc cattgacgca aatgggcggt aggcgtgtac ggtgggaggt
1440ctatataagc agagctcgtt tagtgaaccg tcagatcgcc tggagacgcc atccacgctg
1500ttttgacctc catagaagac accgggaccg atccagcctc cgcggattcg aatcccggcc
1560gggaacggtg cattggaacg cggattcccc gtgccaagag tgacgtaagt accgcctata
1620gagtctatag gcccacaaaa aatgctttct tcttttaata tacttttttg tttatcttat
1680ttctaatact ttccctaatc tctttctttc agggcaataa tgatacaatg tatcatgcct
1740ctttgcacca ttctaaagaa taacagtgat aatttctggg ttaaggcaat agcaatattt
1800ctgcatataa atatttctgc atataaattg taactgatgt aagaggtttc atattgctaa
1860tagcagctac aatccagcta ccattctgct tttattttat ggttgggata aggctggatt
1920attctgagtc caagctaggc ccttttgcta atcatgttca tacctcttat cttcctccca
1980cagctcctgg gcaacgtgct ggtctgtgtg ctggcccatc actttggcaa agaattggga
2040ttcgaacatc ggccgccacc atgaacgcaa gtgaattccg aaggagaggg aaggagatgg
2100tggattacgt ggccaactac atggaaggca ttgagggacg ccaggtctac cctgacgtgg
2160agcccgggta cctgcggccg ctgatccctg ccgctgcccc tcaggagcca gacacgtttg
2220aggacatcat caacgacgtt gagaagataa tcatgcctgg ggtgacgcac tggcacagcc
2280cctacttctt cgcctacttc cccactgcca gctcgtaccc ggccatgctt gcggacatgc
2340tgtgcggggc cattggctgc atcggcttct cctgggcggc aagcccagca tgcacagagc
2400tggagactgt gatgatggac tggctcggga agatgctgga actaccaaag gcatttttga
2460atgagaaagc tggagaaggg ggaggagtga tccagggaag tgccagtgaa gccaccctgg
2520tggccctgct ggccgctcgg accaaagtga tccatcggct gcaggcagcg tccccagagc
2580tcacacaggc cgctatcatg gagaagctgg tggcttactc atccgatcag gcacactcct
2640cagtggaaag agctgggtta attggtggag tgaaattaaa agccatcccc tcagatggca
2700acttcgccat gcgtgcgtct gccctgcagg aagccctgga gagagacaaa gcggctggcc
2760tgattccttt ctttatggtt gccaccctgg ggaccacaac atgctgctcc tttgacaatc
2820tcttagaagt cggtcctatc tgcaacaagg aagacatatg gctgcacgtt gatgcagcct
2880acgcaggcag tgcattcatc tgccctgagt tccggcacct tctgaatgga gtggagtttg
2940cagattcatt caactttaat ccccacaaat ggctattggt gaattttgac tgttctgcca
3000tgtgggtgaa aaagagaaca gacttaacgg gagcctttag actggacccc acttacctga
3060agcacagcca tcaggattca gggcttatca ctgactaccg gcattggcag ataccactgg
3120gcagaagatt tcgctctttg aaaatgtggt ttgtatttag gatgtatgga gtcaaaggac
3180tgcaggctta tatccgcaag catgtccagc tgtcccatga gtttgagtca ctggtgcgcc
3240aggatccccg ctttgaaatc tgtgtggaag tcattctggg gcttgtctgc tttcggctaa
3300agggttccaa caaagtgaat gaagctcttc tgcaaagaat aaacagtgcc aaaaaaatcc
3360acttggttcc atgtcacctc agggacaagt ttgtcctgcg ctttgccatc tgttctcgca
3420cggtggaatc tgcccatgtg cagcgggcct gggaacacat caaagagctg gcggccgacg
3480tgctgcgagc agagagggag taggagtgaa gccagctgca ggaatcaaaa attgaagaga
3540gatatatctg aaaactggaa taagaagcaa ataaatatca tcctgccttc atggaactca
3600gctgtctgtg gcttcccatg tctttctcca aagttatcca gagggttgtg attttgtctg
3660cttagtatct catcaacaaa gaaatattat ttgctaatta aaaagttaat cttcatggcc
3720atagctttta ttcattagct gtgatttttg ttgattaaaa cattatagat tttcatgttc
3780ttgcagtcat cagaagtggt aggaaagcct cactgatata ttttccaggg caatcaatgt
3840tcacgcaact tgaaattata tctgtggtct tcaaattgtc ttttgtcatg tggctaaatg
3900cctaataagc tgctcgagag atctacgggt ggcatccctg tgacccctcc ccagtgcctc
3960tcctggccct ggaagttgcc actccagtgc ccaccagcct tgtcctaata aaattaagtt
4020gcatcatttt gtctgactag gtgtccttct ataatattat ggggtggagg ggggtggtat
4080ggagcaaggg gcaagttggg aagacaacct gtagggcctg cggggtctat tgggaaccaa
4140gctggagtgc agtggcacaa tcttggctca ctgcaatctc cgcctcctgg gttcaagcga
4200ttctcctgcc tcagcctccc gagttgttgg gattccaggc atgcatgacc aggctcagct
4260aatttttgtt tttttggtag agacggggtt tcaccatatt ggccaggctg gtctccaact
4320cctaatctca ggtgatctac ccaccttggc ctcccaaatt gctgggatta caggcgtgaa
4380ccactgctcc cttccctgtc cttctgattt tgtaggtaac cgtaaccccg gaccacgtgc
4440ggaccgagcg gccgctctag agcatggcta cgtagataag tagcatggcg ggttaatcat
4500taactacaag gaacccctag tgatggagtt ggccactccc tctctgcgcg ctcgctcgct
4560cactgaggcc gggcgaccaa aggtcgcccg acgcccgggc ggcctcagtg agcgagcgag
4620cgcgcagctg cctgcaggtc tgagacaata accctgataa atgcttcaat aatgtagcca
4680accactagaa ctatagctag agtcctgggc gaacaaacga tgctcgcctt ccagaaaacc
4740gaggatgcga accacttcat ccggggtcag caccaccggc aagcgccgcg acggccgagg
4800tcttccgatc tcctgaagcc agggcagatc cgtgcacagc accttgccgt agaagaacag
4860caaggccgcc aatgcctgac gatgcgtgga gaccgaaacc ttgcgctcgt tcgccagcca
4920ggacagaaat gcctcgactt cgctgctgcc caaggttgcc gggtgacgca caccgtggaa
4980acggatgaag gcacgaaccc agttgacata agcctgttcg gttcgtaaac tgtaatgcaa
5040gtagcgtatg cgctcacgca actggtccag aaccttgacc gaacgcagcg gtggtaacgg
5100cgcagtggcg gttttcatgg cttgttatga ctgttttttt gtacagtcta tgcctcgggc
5160atccaagcag caagcgcgtt acgccgtggg tcgatgtttg atgttatgga gcagcaacga
5220tgttacgcag cagcaacgat gttacgcagc agggcagtcg ccctaaaaca aagttaggtg
5280gctcaagtat gggcatcatt cgcacatgta ggctcggccc tgaccaagtc aaatccatgc
5340gggctgctct tgatcttttc ggtcgtgagt tcggagacgt agccacctac tcccaacatc
5400agccggactc cgattacctc gggaacttgc tccgtagtaa gacattcatc gcgcttgctg
5460ccttcgacca agaagcggtt gttggcgctc tcgcggctta cgttctgccc aagtttgagc
5520agccgcgtag tgagatctat atctatgatc tcgcagtctc cggcgagcac cggaggcagg
5580gcattgccac cgcgctcatc aatctcctca agcatgaggc caacgcgctt ggtgcttatg
5640tgatctacgt gcaagcagat tacggtgacg atcccgcagt ggctctctat acaaagttgg
5700gcatacggga agaagtgatg cactttgata tcgacccaag taccgccacc taacaattcg
5760ttcaagccga gatcggcttc ccggccgcgg agttgttcgg taaattgtca caacgccgcg
5820aatatagtct ttaccatgcc cttggccacg cccctcttta atacgacggg caatttgcac
5880ttcagaaaat gaagagtttg ctttagccat aacaaaagtc cagtatgctt tttcacagca
5940taactggact gatttcagtt tacaactatt ctgtctagtt taagacttta ttgtcatagt
6000ttagatctat tttgttcagt ttaagacttt attgtccgcc cacacccgct tacgcagggc
6060atccatttat tactcaaccg taaccgattt tgccaggtta cgcggctggt ctatgcggtg
6120tgaaataccg cacagatgcg taaggagaaa ataccgcatc aggcgctctt ccgcttcctc
6180gctcactgac tcgctgcgct cggtcgttcg gctgcggcga gcggtatcag ctcactcaaa
6240ggcggtaata cggttatcca cagaatcagg ggataacgca ggaaagaaca tgtgagcaaa
6300aggccagcaa aaggccagga accgtaaaaa ggccgcgttg ctggcgtttt tccataggct
6360ccgcccccct gacgagcatc acaaaaatcg acgctcaagt cagaggtggc gaaacccgac
6420aggactataa agataccagg cgtttccccc tggaagctcc ctcgtgcgct ctcctgttcc
6480gaccctgccg cttaccggat acctgtccgc ctttctccct tcgggaagcg tggcgctttc
6540tcatagctca cgctgtaggt atctcagttc ggtgtaggtc gttcgctcca agctgggctg
6600tgtgcacgaa ccccccgttc agcccgaccg ctgcgcctta tccggtaact atcgtcttga
6660gtccaacccg gtaagacacg acttatcgcc actggcagca gccactggta acaggattag
6720cagagcgagg tatgtaggcg gtgctacaga gttcttgaag tggtggccta actacggcta
6780cactagaaga acagtatttg gtatctgcgc tctgctgaag ccagttacct tcggaaaaag
6840agttggtagc tcttgatccg gcaaacaaac caccgctggt agcggtggtt tttttgtttg
6900caagcagcag attacgcgca gaaaaaaagg atctcaagaa gatcctttga tcttttctac
6960ggggtctgac gctcagtgga acgaaaactc acgttaaggg attttggtca tgagattatc
7020aaaaaggatc ttcacctaga tccttttaaa ttaaaaatga agttttaaat caatctaaag
7080tatatatgag taaacttggt ctgacagtta ccaatgctta atcagtgagg cacctatctc
7140agcgatctgt ctatttcgtt catccatagt tgcctgactc cccgtcgtgt agataactac
7200gatacgggag ggcttaccat ctggccccag tgctgcaatg ataccgcgag acccacgctc
7260accggctcca gatttatcag caataaacca gccagccgga agggccgagc gcagaagtgg
7320tcctgcaact ttatccgcct ccatccagtc tattaattgt tgccgggaag ctagagtaag
7380tagttcgcca gttaatagtt tgcgcaacgt tgttgccatt gctacaggca tcgtggtgtc
7440acgctcgtcg tttggtatgg cttcattcag ctccggttcc caacgatcaa ggcgagttac
7500atgatccccc atgttgtgca aaaaagcggt tagctccttc ggtcctccga tcgttgtcag
7560aagtaagttg gccgcagtgt tatcactcat ggttatggca gcactgcata attctcttac
7620tgtcatgcca tccgtaagat gcttttctgt gactggtgag tactcaacca agtcattctg
7680agaatagtgt atgcggcgac cgagttgctc ttgcccggcg tcaatacggg ataataccgc
7740gccacatagc agaactttaa aagtgctcat cattggaaaa cgttcttcgg ggcgaaaact
7800ctcaaggatc ttaccgctgt tgagatccag ttcgatgtaa cccactcgtg cacccaactg
7860atcttcagca tcttttactt tcaccagcgt ttctgggtga gcaaaaacag gaaggcaaaa
7920tgccgcaaaa aagggaataa gggcgacacg gaaatgttga atactcatac tcttcctttt
7980tcaatattat tgaagcattt atcagggtta ttgtctcatg agcggataca tatttgaatg
8040tatttagaaa aataaacaaa taggggttcc gcgcacattt ccccgaaaag tgccacctaa
8100attgtaagcg ttaatatttt gttaaaattc gcgttaaatt tttgttaaat cagctcattt
8160tttaaccaat aggccgaaat cggcaaaatc ccttataaat caaaagaata gaccgagata
8220gggttgagtg ttgttccagt ttggaacaag agtccactat taaagaacgt ggactccaac
8280gtcaaagggc gaaaaaccgt ctatcagggc gatggcccac tacgtgaacc atcaccctaa
8340tcaagttttt tggggtcgag gtgccgtaaa gcactaaatc ggaaccctaa agggagcccc
8400cgatttagag cttgacgggg aaagccggcg aacgtggcga gaaaggaagg gaagaaagcg
8460aaaggagcgg gcgctagggc gctggcaagt gtagcggtca cgctgcgcgt aaccaccaca
8520cccgccgcgc ttaatgcgcc gctacagggc gcgtc
855558694DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 5cattcgccat tcaggctgca aataagcgtt
gatattcagt caattacaaa cattaataac 60gaagagatga cagaaaaatt ttcattctgt
gacagagaaa aagtagccga agatgacggt 120ttgtcacatg gagttggcag gatgtttgat
taaaaacata acaggaagaa aaatgccccg 180ctgtgggcgg acaaaatagt tgggaactgg
gaggggtgga aatggagttt ttaaggatta 240tttagggaag agtgacaaaa tagatgggaa
ctgggtgtag cgtcgtaagc taatacgaaa 300attaaaaatg acaaaatagt ttggaactag
atttcactta tctggttcgg atctcctagg 360cgatatcagt gatcagatcc agacatgata
agatacattg atgagtttgg acaaaccaca 420actagaatgc agtgaaaaaa atgctttatt
tgtgaaattt gtgatgctat tgctttattt 480gtaaccatta taagctgcaa taaacaagtt
aacaacaaca attgcattca ttttatgttt 540caggttcagg gggaggtgtg ggaggttttt
taaagcaagt aaaacctcta caaatgtggt 600atggctgatt atgatcctct agtacttctc
gacaagctta cattattgaa gcatttatca 660gggttattgt ctcagacctg caggcagctg
cgcgctcgct cgctcactga ggccgcccgg 720gcaaagcccg ggcgtcgggc gacctttggt
cgcccggcct cagtgagcga gcgagcgcgc 780agagagggag tggccaactc catcactagg
ggttccttgt agttaatgat taacccgcca 840tgctacttat ctacgtagcc atgctctaga
gcggccgcaa cgcgtaaact tcgtcgacga 900tctgcggccg cacgcgtgga gctagttatt
aatagtaatc aattacgggg tcattagttc 960atagcccata tatggagttc cgcgttacat
aacttacggt aaatggcccg cctggctgac 1020cgcccaacga cccccgccca ttgacgtcaa
taatgacgta tgttcccata gtaacgtcaa 1080tagggacttt ccattgacgt caatgggtgg
agtatttacg gtaaactgcc cacttggcag 1140tacatcaagt gtatcatatg ccaagtacgc
cccctattga cgtcaatgac ggtaaatggc 1200ccgcctggca ttatgcccag tacatgacct
tatgggactt tcctacttgg cagtacatct 1260acgtattagt catcgctatt accatggtga
tgcggttttg gcagtacatc aatgggcgtg 1320gatagcggtt tgactcacgg ggatttccaa
gtctccaccc cattgacgtc aatgggagtt 1380tgttttgcac caaaatcaac gggactttcc
aaaatgtcgt aacaactccg ccccattgac 1440gcaaatgggc ggtaggcgtg tacggtggga
ggtctatata agcagagctc gtttagtgaa 1500ccgtcagatc gcctggagac gccatccacg
ctgttttgac ctccatagaa gacaccggga 1560ccgatccagc ctccgcggat tcgaatcccg
gccgggaacg gtgcattgga acgcggattc 1620cccgtgccaa gagtgacgta agtaccgcct
atagagtcta taggcccaca aaaaatgctt 1680tcttctttta atatactttt ttgtttatct
tatttctaat actttcccta atctctttct 1740ttcagggcaa taatgataca atgtatcatg
cctctttgca ccattctaaa gaataacagt 1800gataatttct gggttaaggc aatagcaata
tttctgcata taaatatttc tgcatataaa 1860ttgtaactga tgtaagaggt ttcatattgc
taatagcagc tacaatccag ctaccattct 1920gcttttattt tatggttggg ataaggctgg
attattctga gtccaagcta ggcccttttg 1980ctaatcatgt tcatacctct tatcttcctc
ccacagctcc tgggcaacgt gctggtctgt 2040gtgctggccc atcactttgg caaagaattg
ggattcgaac atcgaattcg ggcacgaggg 2100aggacagaga gcaagtcact cccggctgcc
tttttcacct ctgacagagc ccagacacca 2160tgaacgcaag tgaattccga aggagaggga
aggagatggt ggattacgtg gccaactaca 2220tggaaggcat tgagggacgc caggtctacc
ctgacgtgga gcccgggtac ctgcggccgc 2280tgatccctgc cgctgcccct caggagccag
acacgtttga ggacatcatc aacgacgttg 2340agaagataat catgcctggg gtgacgcact
ggcacagccc ctacttcttc gcctacttcc 2400ccactgccag ctcgtacccg gccatgcttg
cggacatgct gtgcggggcc attggctgca 2460tcggcttctc ctgggcggca agcccagcat
gcacagagct ggagactgtg atgatggact 2520ggctcgggaa gatgctggaa ctaccaaagg
catttttgaa tgagaaagct ggagaagggg 2580gaggagtgat ccagggaagt gccagtgaag
ccaccctggt ggccctgctg gccgctcgga 2640ccaaagtgat ccatcggctg caggcagcgt
ccccagagct cacacaggcc gctatcatgg 2700agaagctggt ggcttactca tccgatcagg
cacactcctc agtggaaaga gctgggttaa 2760ttggtggagt gaaattaaaa gccatcccct
cagatggcaa cttcgccatg cgtgcgtctg 2820ccctgcagga agccctggag agagacaaag
cggctggcct gattcctttc tttatggttg 2880ccaccctggg gaccacaaca tgctgctcct
ttgacaatct cttagaagtc ggtcctatct 2940gcaacaagga agacatatgg ctgcacgttg
atgcagccta cgcaggcagt gcattcatct 3000gccctgagtt ccggcacctt ctgaatggag
tggagtttgc agattcattc aactttaatc 3060cccacaaatg gctattggtg aattttgact
gttctgccat gtgggtgaaa aagagaacag 3120acttaacggg agcctttaga ctggacccca
cttacctgaa gcacagccat caggattcag 3180ggcttatcac tgactaccgg cattggcaga
taccactggg cagaagattt cgctctttga 3240aaatgtggtt tgtatttagg atgtatggag
tcaaaggact gcaggcttat atccgcaagc 3300atgtccagct gtcccatgag tttgagtcac
tggtgcgcca ggatccccgc tttgaaatct 3360gtgtggaagt cattctgggg cttgtctgct
ttcggctaaa gggttccaac aaagtgaatg 3420aagctcttct gcaaagaata aacagtgcca
aaaaaatcca cttggttcca tgtcacctca 3480gggacaagtt tgtcctgcgc tttgccatct
gttctcgcac ggtggaatct gcccatgtgc 3540agcgggcctg ggaacacatc aaagagctgg
cggccgacgt gctgcgagca gagagggagt 3600aggagtgaag ccagctgcag gaatcaaaaa
ttgaagagag atatatctga aaactggaat 3660aagaagcaaa taaatatcat cctgccttca
tggaactcag ctgtctgtgg cttcccatgt 3720ctttctccaa agttatccag agggttgtga
ttttgtctgc ttagtatctc atcaacaaag 3780aaatattatt tgctaattaa aaagttaatc
ttcatggcca tagcttttat tcattagctg 3840tgatttttgt tgattaaaac attatagatt
ttcatgttct tgcagtcatc agaagtggta 3900ggaaagcctc actgatatat tttccagggc
aatcaatgtt cacgcaactt gaaattatat 3960ctgtggtctt caaattgtct tttgtcatgt
ggctaaatgc ctaataaaca attcaagtga 4020aatactaaaa aaaaaaaaaa aaaaaaaagc
tgctcgagag atctacgggt ggcatccctg 4080tgacccctcc ccagtgcctc tcctggccct
ggaagttgcc actccagtgc ccaccagcct 4140tgtcctaata aaattaagtt gcatcatttt
gtctgactag gtgtccttct ataatattat 4200ggggtggagg ggggtggtat ggagcaaggg
gcaagttggg aagacaacct gtagggcctg 4260cggggtctat tgggaaccaa gctggagtgc
agtggcacaa tcttggctca ctgcaatctc 4320cgcctcctgg gttcaagcga ttctcctgcc
tcagcctccc gagttgttgg gattccaggc 4380atgcatgacc aggctcagct aatttttgtt
tttttggtag agacggggtt tcaccatatt 4440ggccaggctg gtctccaact cctaatctca
ggtgatctac ccaccttggc ctcccaaatt 4500gctgggatta caggcgtgaa ccactgctcc
cttccctgtc cttctgattt tgtaggtaac 4560gtaaccccgg accacgtgcg gaccgagcgg
ccgctctaga gcatggctac gtagataagt 4620agcatggcgg gttaatcatt aactacaagg
aacccctagt gatggagttg gccactccct 4680ctctgcgcgc tcgctcgctc actgaggccg
ggcgaccaaa ggtcgcccga cgcccgggcg 4740gcctcagtga gcgagcgagc gcgcagctgc
ctgcaggtct gagacaataa ccctgataaa 4800tgcttcaata atgtagccaa ccactagaac
tatagctaga gtcctgggcg aacaaacgat 4860gctcgccttc cagaaaaccg aggatgcgaa
ccacttcatc cggggtcagc accaccggca 4920agcgccgcga cggccgaggt cttccgatct
cctgaagcca gggcagatcc gtgcacagca 4980ccttgccgta gaagaacagc aaggccgcca
atgcctgacg atgcgtggag accgaaacct 5040tgcgctcgtt cgccagccag gacagaaatg
cctcgacttc gctgctgccc aaggttgccg 5100ggtgacgcac accgtggaaa cggatgaagg
cacgaaccca gttgacataa gcctgttcgg 5160ttcgtaaact gtaatgcaag tagcgtatgc
gctcacgcaa ctggtccaga accttgaccg 5220aacgcagcgg tggtaacggc gcagtggcgg
ttttcatggc ttgttatgac tgtttttttg 5280tacagtctat gcctcgggca tccaagcagc
aagcgcgtta cgccgtgggt cgatgtttga 5340tgttatggag cagcaacgat gttacgcagc
agcaacgatg ttacgcagca gggcagtcgc 5400cctaaaacaa agttaggtgg ctcaagtatg
ggcatcattc gcacatgtag gctcggccct 5460gaccaagtca aatccatgcg ggctgctctt
gatcttttcg gtcgtgagtt cggagacgta 5520gccacctact cccaacatca gccggactcc
gattacctcg ggaacttgct ccgtagtaag 5580acattcatcg cgcttgctgc cttcgaccaa
gaagcggttg ttggcgctct cgcggcttac 5640gttctgccca agtttgagca gccgcgtagt
gagatctata tctatgatct cgcagtctcc 5700ggcgagcacc ggaggcaggg cattgccacc
gcgctcatca atctcctcaa gcatgaggcc 5760aacgcgcttg gtgcttatgt gatctacgtg
caagcagatt acggtgacga tcccgcagtg 5820gctctctata caaagttggg catacgggaa
gaagtgatgc actttgatat cgacccaagt 5880accgccacct aacaattcgt tcaagccgag
atcggcttcc cggccgcgga gttgttcggt 5940aaattgtcac aacgccgcga atatagtctt
taccatgccc ttggccacgc ccctctttaa 6000tacgacgggc aatttgcact tcagaaaatg
aagagtttgc tttagccata acaaaagtcc 6060agtatgcttt ttcacagcat aactggactg
atttcagttt acaactattc tgtctagttt 6120aagactttat tgtcatagtt tagatctatt
ttgttcagtt taagacttta ttgtccgccc 6180acacccgctt acgcagggca tccatttatt
actcaaccgt aaccgatttt gccaggttac 6240gcggctggtc tatgcggtgt gaaataccgc
acagatgcgt aaggagaaaa taccgcatca 6300ggcgctcttc cgcttcctcg ctcactgact
cgctgcgctc ggtcgttcgg ctgcggcgag 6360cggtatcagc tcactcaaag gcggtaatac
ggttatccac agaatcaggg gataacgcag 6420gaaagaacat gtgagcaaaa ggccagcaaa
aggccaggaa ccgtaaaaag gccgcgttgc 6480tggcgttttt ccataggctc cgcccccctg
acgagcatca caaaaatcga cgctcaagtc 6540agaggtggcg aaacccgaca ggactataaa
gataccaggc gtttccccct ggaagctccc 6600tcgtgcgctc tcctgttccg accctgccgc
ttaccggata cctgtccgcc tttctccctt 6660cgggaagcgt ggcgctttct catagctcac
gctgtaggta tctcagttcg gtgtaggtcg 6720ttcgctccaa gctgggctgt gtgcacgaac
cccccgttca gcccgaccgc tgcgccttat 6780ccggtaacta tcgtcttgag tccaacccgg
taagacacga cttatcgcca ctggcagcag 6840ccactggtaa caggattagc agagcgaggt
atgtaggcgg tgctacagag ttcttgaagt 6900ggtggcctaa ctacggctac actagaagaa
cagtatttgg tatctgcgct ctgctgaagc 6960cagttacctt cggaaaaaga gttggtagct
cttgatccgg caaacaaacc accgctggta 7020gcggtggttt ttttgtttgc aagcagcaga
ttacgcgcag aaaaaaagga tctcaagaag 7080atcctttgat cttttctacg gggtctgacg
ctcagtggaa cgaaaactca cgttaaggga 7140ttttggtcat gagattatca aaaaggatct
tcacctagat ccttttaaat taaaaatgaa 7200gttttaaatc aatctaaagt atatatgagt
aaacttggtc tgacagttac caatgcttaa 7260tcagtgaggc acctatctca gcgatctgtc
tatttcgttc atccatagtt gcctgactcc 7320ccgtcgtgta gataactacg atacgggagg
gcttaccatc tggccccagt gctgcaatga 7380taccgcgaga cccacgctca ccggctccag
atttatcagc aataaaccag ccagccggaa 7440gggccgagcg cagaagtggt cctgcaactt
tatccgcctc catccagtct attaattgtt 7500gccgggaagc tagagtaagt agttcgccag
ttaatagttt gcgcaacgtt gttgccattg 7560ctacaggcat cgtggtgtca cgctcgtcgt
ttggtatggc ttcattcagc tccggttccc 7620aacgatcaag gcgagttaca tgatccccca
tgttgtgcaa aaaagcggtt agctccttcg 7680gtcctccgat cgttgtcaga agtaagttgg
ccgcagtgtt atcactcatg gttatggcag 7740cactgcataa ttctcttact gtcatgccat
ccgtaagatg cttttctgtg actggtgagt 7800actcaaccaa gtcattctga gaatagtgta
tgcggcgacc gagttgctct tgcccggcgt 7860caatacggga taataccgcg ccacatagca
gaactttaaa agtgctcatc attggaaaac 7920gttcttcggg gcgaaaactc tcaaggatct
taccgctgtt gagatccagt tcgatgtaac 7980ccactcgtgc acccaactga tcttcagcat
cttttacttt caccagcgtt tctgggtgag 8040caaaaacagg aaggcaaaat gccgcaaaaa
agggaataag ggcgacacgg aaatgttgaa 8100tactcatact cttccttttt caatattatt
gaagcattta tcagggttat tgtctcatga 8160gcggatacat atttgaatgt atttagaaaa
ataaacaaat aggggttccg cgcacatttc 8220cccgaaaagt gccacctaaa ttgtaagcgt
taatattttg ttaaaattcg cgttaaattt 8280ttgttaaatc agctcatttt ttaaccaata
ggccgaaatc ggcaaaatcc cttataaatc 8340aaaagaatag accgagatag ggttgagtgt
tgttccagtt tggaacaaga gtccactatt 8400aaagaacgtg gactccaacg tcaaagggcg
aaaaaccgtc tatcagggcg atggcccact 8460acgtgaacca tcaccctaat caagtttttt
ggggtcgagg tgccgtaaag cactaaatcg 8520gaaccctaaa gggagccccc gatttagagc
ttgacgggga aagccggcga acgtggcgag 8580aaaggaaggg aagaaagcga aaggagcggg
cgctagggcg ctggcaagtg tagcggtcac 8640gctgcgcgta accaccacac ccgccgcgct
taatgcgccg ctacagggcg cgtc 869463535DNAArtificial
SequenceDescription of Artificial Sequence Synthetic polynucleotide
6ctgcgcgctc gctcgctcac tgaggccgcc cgggcaaagc ccgggcgtcg ggcgaccttt
60ggtcgcccgg cctcagtgag cgagcgagcg cgcagagagg gagtggccaa ctccatcact
120aggggttcct tgtagttaat gattaacccg ccatgctact tatctacgta gccatgctct
180agagcggccg cacgcgtgga gctagttatt aatagtaatc aattacgggg tcattagttc
240atagcccata tatggagttc cgcgttacat aacttacggt aaatggcccg cctggctgac
300cgcccaacga cccccgccca ttgacgtcaa taatgacgta tgttcccata gtaacgtcaa
360tagggacttt ccattgacgt caatgggtgg agtatttacg gtaaactgcc cacttggcag
420tacatcaagt gtatcatatg ccaagtacgc cccctattga cgtcaatgac ggtaaatggc
480ccgcctggca ttatgcccag tacatgacct tatgggactt tcctacttgg cagtacatct
540acgtattagt catcgctatt accatggtga tgcggttttg gcagtacatc aatgggcgtg
600gatagcggtt tgactcacgg ggatttccaa gtctccaccc cattgacgtc aatgggagtt
660tgttttgcac caaaatcaac gggactttcc aaaatgtcgt aacaactccg ccccattgac
720gcaaatgggc ggtaggcgtg tacggtggga ggtctatata agcagagctc gtttagtgaa
780ccgtcagatc gcctggagac gccatccacg ctgttttgac ctccatagaa gacaccggga
840ccgatccagc ctccgcggat tcgaatcccg gccgggaacg gtgcattgga acgcggattc
900cccgtgccaa gagtgacgta agtaccgcct atagagtcta taggcccaca aaaaatgctt
960tcttctttta atatactttt ttgtttatct tatttctaat actttcccta atctctttct
1020ttcagggcaa taatgataca atgtatcatg cctctttgca ccattctaaa gaataacagt
1080gataatttct gggttaaggc aatagcaata tttctgcata taaatatttc tgcatataaa
1140ttgtaactga tgtaagaggt ttcatattgc taatagcagc tacaatccag ctaccattct
1200gcttttattt tatggttggg ataaggctgg attattctga gtccaagcta ggcccttttg
1260ctaatcatgt tcatacctct tatcttcctc ccacagctcc tgggcaacgt gctggtctgt
1320gtgctggccc atcactttgg caaagaattg ggattcgaac atcggccgcc accatgaacg
1380caagtgaatt ccgaaggaga gggaaggaga tggtggatta cgtggccaac tacatggaag
1440gcattgaggg acgccaggtc taccctgacg tggagcccgg gtacctgcgg ccgctgatcc
1500ctgccgctgc ccctcaggag ccagacacgt ttgaggacat catcaacgac gttgagaaga
1560taatcatgcc tggggtgacg cactggcaca gcccctactt cttcgcctac ttccccactg
1620ccagctcgta cccggccatg cttgcggaca tgctgtgcgg ggccattggc tgcatcggct
1680tctcctgggc ggcaagccca gcatgcacag agctggagac tgtgatgatg gactggctcg
1740ggaagatgct ggaactacca aaggcatttt tgaatgagaa agctggagaa gggggaggag
1800tgatccaggg aagtgccagt gaagccaccc tggtggccct gctggccgct cggaccaaag
1860tgatccatcg gctgcaggca gcgtccccag agctcacaca ggccgctatc atggagaagc
1920tggtggctta ctcatccgat caggcacact cctcagtgga aagagctggg ttaattggtg
1980gagtgaaatt aaaagccatc ccctcagatg gcaacttcgc catgcgtgcg tctgccctgc
2040aggaagccct ggagagagac aaagcggctg gcctgattcc tttctttatg gttgccaccc
2100tggggaccac aacatgctgc tcctttgaca atctcttaga agtcggtcct atctgcaaca
2160aggaagacat atggctgcac gttgatgcag cctacgcagg cagtgcattc atctgccctg
2220agttccggca ccttctgaat ggagtggagt ttgcagattc attcaacttt aatccccaca
2280aatggctatt ggtgaatttt gactgttctg ccatgtgggt gaaaaagaga acagacttaa
2340cgggagcctt tagactggac cccacttacc tgaagcacag ccatcaggat tcagggctta
2400tcactgacta ccggcattgg cagataccac tgggcagaag atttcgctct ttgaaaatgt
2460ggtttgtatt taggatgtat ggagtcaaag gactgcaggc ttatatccgc aagcatgtcc
2520agctgtccca tgagtttgag tcactggtgc gccaggatcc ccgctttgaa atctgtgtgg
2580aagtcattct ggggcttgtc tgctttcggc taaagggttc caacaaagtg aatgaagctc
2640ttctgcaaag aataaacagt gccaaaaaaa tccacttggt tccatgtcac ctcagggaca
2700agtttgtcct gcgctttgcc atctgttctc gcacggtgga atctgcccat gtgcagcggg
2760cctgggaaca catcaaagag ctggcggccg acgtgctgcg agcagagagg gagtaggagt
2820gagctgctcg agagatctac gggtggcatc cctgtgaccc ctccccagtg cctctcctgg
2880ccctggaagt tgccactcca gtgcccacca gccttgtcct aataaaatta agttgcatca
2940ttttgtctga ctaggtgtcc ttctataata ttatggggtg gaggggggtg gtatggagca
3000aggggcaagt tgggaagaca acctgtaggg cctgcggggt ctattgggaa ccaagctgga
3060gtgcagtggc acaatcttgg ctcactgcaa tctccgcctc ctgggttcaa gcgattctcc
3120tgcctcagcc tcccgagttg ttgggattcc aggcatgcat gaccaggctc agctaatttt
3180tgtttttttg gtagagacgg ggtttcacca tattggccag gctggtctcc aactcctaat
3240ctcaggtgat ctacccacct tggcctccca aattgctggg attacaggcg tgaaccactg
3300ctcccttccc tgtccttctg attttgtagg taaccccgga ccacgtgcgg accgagcggc
3360cgctctagag catggctacg tagataagta gcatggcggg ttaatcatta actacaagga
3420acccctagtg atggagttgg ccactccctc tctgcgcgct cgctcgctca ctgaggccgg
3480gcgaccaaag gtcgcccgac gcccgggcgg cctcagtgag cgagcgagcg cgcag
353573534DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 7ctgcgcgctc gctcgctcac tgaggccgcc
cgggcaaagc ccgggcgtcg ggcgaccttt 60ggtcgcccgg cctcagtgag cgagcgagcg
cgcagagagg gagtggccaa ctccatcact 120aggggttcct tgtagttaat gattaacccg
ccatgctact tatctacgta gccatgctct 180agagcggccg cacgcgtgga gctagttatt
aatagtaatc aattacgggg tcattagttc 240atagcccata tatggagttc cgcgttacat
aacttacggt aaatggcccg cctggctgac 300cgcccaacga cccccgccca ttgacgtcaa
taatgacgta tgttcccata gtaacgtcaa 360tagggacttt ccattgacgt caatgggtgg
agtatttacg gtaaactgcc cacttggcag 420tacatcaagt gtatcatatg ccaagtacgc
cccctattga cgtcaatgac ggtaaatggc 480ccgcctggca ttatgcccag tacatgacct
tatgggactt tcctacttgg cagtacatct 540acgtattagt catcgctatt accatggtga
tgcggttttg gcagtacatc aatgggcgtg 600gatagcggtt tgactcacgg ggatttccaa
gtctccaccc cattgacgtc aatgggagtt 660tgttttgcac caaaatcaac gggactttcc
aaaatgtcgt aacaactccg ccccattgac 720gcaaatgggc ggtaggcgtg tacggtggga
ggtctatata agcagagctc gtttagtgaa 780ccgtcagatc gcctggagac gccatccacg
ctgttttgac ctccatagaa gacaccggga 840ccgatccagc ctccgcggat tcgaatcccg
gccgggaacg gtgcattgga acgcggattc 900cccgtgccaa gagtgacgta agtaccgcct
atagagtcta taggcccaca aaaaatgctt 960tcttctttta atatactttt ttgtttatct
tatttctaat actttcccta atctctttct 1020ttcagggcaa taatgataca atgtatcatg
cctctttgca ccattctaaa gaataacagt 1080gataatttct gggttaaggc aatagcaata
tttctgcata taaatatttc tgcatataaa 1140ttgtaactga tgtaagaggt ttcatattgc
taatagcagc tacaatccag ctaccattct 1200gcttttattt tatggttggg ataaggctgg
attattctga gtccaagcta ggcccttttg 1260ctaatcatgt tcatacctct tatcttcctc
ccacagctcc tgggcaacgt gctggtctgt 1320gtgctggccc atcactttgg caaagaattg
ggattcgaac atcggccgcc accatgaacg 1380ccagcgagtt caggaggagg ggcaaggaga
tggtggacta cgtggccaac tacatggagg 1440gcatcgaggg caggcaggtg taccccgacg
tggagcccgg ctacctgagg cccctgatcc 1500ccgccgccgc cccccaggag cccgacacct
tcgaggacat catcaacgac gtggagaaga 1560tcatcatgcc cggcgtgacc cactggcaca
gcccctactt cttcgcctac ttccccaccg 1620ccagcagcta ccccgccatg ctggccgaca
tgctgtgcgg cgccatcggc tgcatcggct 1680tcagctgggc cgccagcccc gcctgcaccg
agctggagac cgtgatgatg gactggctgg 1740gcaagatgct ggagctgccc aaggccttcc
tgaacgagaa ggccggcgag ggcggcggcg 1800tgatccaggg cagcgccagc gaggccaccc
tggtggccct gctggccgcc aggaccaagg 1860tgatccacag gctgcaggcc gccagccccg
agctgaccca ggccgccatc atggagaagc 1920tggtggccta cagcagcgac caggcccaca
gcagcgtgga gagggccggc ctgatcggcg 1980gcgtgaagct gaaggccatc cccagcgacg
gcaacttcgc catgagggcc agcgccctgc 2040aggaggccct ggagagggac aaggccgccg
gcctgatccc cttcttcatg gtggccaccc 2100tgggcaccac cacctgctgc agcttcgaca
acctgctgga ggtgggcccc atctgcaaca 2160aggaggacat ctggctgcac gtggacgccg
cctacgccgg cagcgccttc atctgccccg 2220agttcaggca cctgctgaac ggcgtggagt
tcgccgacag cttcaacttc aacccccaca 2280agtggctgct ggtgaacttc gactgcagcg
ccatgtgggt gaagaagagg accgacctga 2340ccggcgcctt caggctggac cccacctacc
tgaagcacag ccaccaggac agcggcctga 2400tcaccgacta caggcactgg cagatccccc
tgggcaggag gttcaggagc ctgaagatgt 2460ggttcgtgtt caggatgtac ggcgtgaagg
gcctgcaggc ctacatcagg aagcacgtgc 2520agctgagcca cgagttcgag agcctggtga
ggcaggaccc caggttcgag atctgcgtgg 2580aggtgatcct gggcctggtg tgcttcaggc
tgaagggcag caacaaggtg aacgaggccc 2640tgctgcagag gatcaacagc gccaagaaga
tccacctggt gccctgccac ctgagggaca 2700agttcgtgct gaggttcgcc atctgcagca
ggaccgtgga gagcgcccac gtgcagaggg 2760cctgggagca catcaaggag ctggccgccg
acgtgctgag ggccgagagg gagtgagctg 2820ctcgagagat ctacgggtgg catccctgtg
acccctcccc agtgcctctc ctggccctgg 2880aagttgccac tccagtgccc accagccttg
tcctaataaa attaagttgc atcattttgt 2940ctgactaggt gtccttctat aatattatgg
ggtggagggg ggtggtatgg agcaaggggc 3000aagttgggaa gacaacctgt agggcctgcg
gggtctattg ggaaccaagc tggagtgcag 3060tggcacaatc ttggctcact gcaatctccg
cctcctgggt tcaagcgatt ctcctgcctc 3120agcctcccga gttgttggga ttccaggcat
gcatgaccag gctcagctaa tttttgtttt 3180tttggtagag acggggtttc accatattgg
ccaggctggt ctccaactcc taatctcagg 3240tgatctaccc accttggcct cccaaattgc
tgggattaca ggcgtgaacc actgctccct 3300tccctgtcct tctgattttg taggtaacgt
aaccccggac cacgtgcgga ccgagcggcc 3360gctctagagc atggctacgt agataagtag
catggcgggt taatcattaa ctacaaggaa 3420cccctagtga tggagttggc cactccctct
ctgcgcgctc gctcgctcac tgaggccggg 3480cgaccaaagg tcgcccgacg cccgggcggc
ctcagtgagc gagcgagcgc gcag 353483940DNAArtificial
SequenceDescription of Artificial Sequence Synthetic polynucleotide
8ctgcgcgctc gctcgctcac tgaggccgcc cgggcaaagc ccgggcgtcg ggcgaccttt
60ggtcgcccgg cctcagtgag cgagcgagcg cgcagagagg gagtggccaa ctccatcact
120aggggttcct tgtagttaat gattaacccg ccatgctact tatctacgta gccatgctct
180agagcggccg cacgcgtgga gctagttatt aatagtaatc aattacgggg tcattagttc
240atagcccata tatggagttc cgcgttacat aacttacggt aaatggcccg cctggctgac
300cgcccaacga cccccgccca ttgacgtcaa taatgacgta tgttcccata gtaacgtcaa
360tagggacttt ccattgacgt caatgggtgg agtatttacg gtaaactgcc cacttggcag
420tacatcaagt gtatcatatg ccaagtacgc cccctattga cgtcaatgac ggtaaatggc
480ccgcctggca ttatgcccag tacatgacct tatgggactt tcctacttgg cagtacatct
540acgtattagt catcgctatt accatggtga tgcggttttg gcagtacatc aatgggcgtg
600gatagcggtt tgactcacgg ggatttccaa gtctccaccc cattgacgtc aatgggagtt
660tgttttgcac caaaatcaac gggactttcc aaaatgtcgt aacaactccg ccccattgac
720gcaaatgggc ggtaggcgtg tacggtggga ggtctatata agcagagctc gtttagtgaa
780ccgtcagatc gcctggagac gccatccacg ctgttttgac ctccatagaa gacaccggga
840ccgatccagc ctccgcggat tcgaatcccg gccgggaacg gtgcattgga acgcggattc
900cccgtgccaa gagtgacgta agtaccgcct atagagtcta taggcccaca aaaaatgctt
960tcttctttta atatactttt ttgtttatct tatttctaat actttcccta atctctttct
1020ttcagggcaa taatgataca atgtatcatg cctctttgca ccattctaaa gaataacagt
1080gataatttct gggttaaggc aatagcaata tttctgcata taaatatttc tgcatataaa
1140ttgtaactga tgtaagaggt ttcatattgc taatagcagc tacaatccag ctaccattct
1200gcttttattt tatggttggg ataaggctgg attattctga gtccaagcta ggcccttttg
1260ctaatcatgt tcatacctct tatcttcctc ccacagctcc tgggcaacgt gctggtctgt
1320gtgctggccc atcactttgg caaagaattg ggattcgaac atcggccgcc accatgaacg
1380caagtgaatt ccgaaggaga gggaaggaga tggtggatta cgtggccaac tacatggaag
1440gcattgaggg acgccaggtc taccctgacg tggagcccgg gtacctgcgg ccgctgatcc
1500ctgccgctgc ccctcaggag ccagacacgt ttgaggacat catcaacgac gttgagaaga
1560taatcatgcc tggggtgacg cactggcaca gcccctactt cttcgcctac ttccccactg
1620ccagctcgta cccggccatg cttgcggaca tgctgtgcgg ggccattggc tgcatcggct
1680tctcctgggc ggcaagccca gcatgcacag agctggagac tgtgatgatg gactggctcg
1740ggaagatgct ggaactacca aaggcatttt tgaatgagaa agctggagaa gggggaggag
1800tgatccaggg aagtgccagt gaagccaccc tggtggccct gctggccgct cggaccaaag
1860tgatccatcg gctgcaggca gcgtccccag agctcacaca ggccgctatc atggagaagc
1920tggtggctta ctcatccgat caggcacact cctcagtgga aagagctggg ttaattggtg
1980gagtgaaatt aaaagccatc ccctcagatg gcaacttcgc catgcgtgcg tctgccctgc
2040aggaagccct ggagagagac aaagcggctg gcctgattcc tttctttatg gttgccaccc
2100tggggaccac aacatgctgc tcctttgaca atctcttaga agtcggtcct atctgcaaca
2160aggaagacat atggctgcac gttgatgcag cctacgcagg cagtgcattc atctgccctg
2220agttccggca ccttctgaat ggagtggagt ttgcagattc attcaacttt aatccccaca
2280aatggctatt ggtgaatttt gactgttctg ccatgtgggt gaaaaagaga acagacttaa
2340cgggagcctt tagactggac cccacttacc tgaagcacag ccatcaggat tcagggctta
2400tcactgacta ccggcattgg cagataccac tgggcagaag atttcgctct ttgaaaatgt
2460ggtttgtatt taggatgtat ggagtcaaag gactgcaggc ttatatccgc aagcatgtcc
2520agctgtccca tgagtttgag tcactggtgc gccaggatcc ccgctttgaa atctgtgtgg
2580aagtcattct ggggcttgtc tgctttcggc taaagggttc caacaaagtg aatgaagctc
2640ttctgcaaag aataaacagt gccaaaaaaa tccacttggt tccatgtcac ctcagggaca
2700agtttgtcct gcgctttgcc atctgttctc gcacggtgga atctgcccat gtgcagcggg
2760cctgggaaca catcaaagag ctggcggccg acgtgctgcg agcagagagg gagtaggagt
2820gaagccagct gcaggaatca aaaattgaag agagatatat ctgaaaactg gaataagaag
2880caaataaata tcatcctgcc ttcatggaac tcagctgtct gtggcttccc atgtctttct
2940ccaaagttat ccagagggtt gtgattttgt ctgcttagta tctcatcaac aaagaaatat
3000tatttgctaa ttaaaaagtt aatcttcatg gccatagctt ttattcatta gctgtgattt
3060ttgttgatta aaacattata gattttcatg ttcttgcagt catcagaagt ggtaggaaag
3120cctcactgat atattttcca gggcaatcaa tgttcacgca acttgaaatt atatctgtgg
3180tcttcaaatt gtcttttgtc atgtggctaa atgcctaata agctgctcga gagatctacg
3240ggtggcatcc ctgtgacccc tccccagtgc ctctcctggc cctggaagtt gccactccag
3300tgcccaccag ccttgtccta ataaaattaa gttgcatcat tttgtctgac taggtgtcct
3360tctataatat tatggggtgg aggggggtgg tatggagcaa ggggcaagtt gggaagacaa
3420cctgtagggc ctgcggggtc tattgggaac caagctggag tgcagtggca caatcttggc
3480tcactgcaat ctccgcctcc tgggttcaag cgattctcct gcctcagcct cccgagttgt
3540tgggattcca ggcatgcatg accaggctca gctaattttt gtttttttgg tagagacggg
3600gtttcaccat attggccagg ctggtctcca actcctaatc tcaggtgatc tacccacctt
3660ggcctcccaa attgctggga ttacaggcgt gaaccactgc tcccttccct gtccttctga
3720ttttgtaggt aaccgtaacc ccggaccacg tgcggaccga gcggccgctc tagagcatgg
3780ctacgtagat aagtagcatg gcgggttaat cattaactac aaggaacccc tagtgatgga
3840gttggccact ccctctctgc gcgctcgctc gctcactgag gccgggcgac caaaggtcgc
3900ccgacgcccg ggcggcctca gtgagcgagc gagcgcgcag
394094079DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 9ctgcgcgctc gctcgctcac tgaggccgcc
cgggcaaagc ccgggcgtcg ggcgaccttt 60ggtcgcccgg cctcagtgag cgagcgagcg
cgcagagagg gagtggccaa ctccatcact 120aggggttcct tgtagttaat gattaacccg
ccatgctact tatctacgta gccatgctct 180agagcggccg caacgcgtaa acttcgtcga
cgatctgcgg ccgcacgcgt ggagctagtt 240attaatagta atcaattacg gggtcattag
ttcatagccc atatatggag ttccgcgtta 300cataacttac ggtaaatggc ccgcctggct
gaccgcccaa cgacccccgc ccattgacgt 360caataatgac gtatgttccc atagtaacgt
caatagggac tttccattga cgtcaatggg 420tggagtattt acggtaaact gcccacttgg
cagtacatca agtgtatcat atgccaagta 480cgccccctat tgacgtcaat gacggtaaat
ggcccgcctg gcattatgcc cagtacatga 540ccttatggga ctttcctact tggcagtaca
tctacgtatt agtcatcgct attaccatgg 600tgatgcggtt ttggcagtac atcaatgggc
gtggatagcg gtttgactca cggggatttc 660caagtctcca ccccattgac gtcaatggga
gtttgttttg caccaaaatc aacgggactt 720tccaaaatgt cgtaacaact ccgccccatt
gacgcaaatg ggcggtaggc gtgtacggtg 780ggaggtctat ataagcagag ctcgtttagt
gaaccgtcag atcgcctgga gacgccatcc 840acgctgtttt gacctccata gaagacaccg
ggaccgatcc agcctccgcg gattcgaatc 900ccggccggga acggtgcatt ggaacgcgga
ttccccgtgc caagagtgac gtaagtaccg 960cctatagagt ctataggccc acaaaaaatg
ctttcttctt ttaatatact tttttgttta 1020tcttatttct aatactttcc ctaatctctt
tctttcaggg caataatgat acaatgtatc 1080atgcctcttt gcaccattct aaagaataac
agtgataatt tctgggttaa ggcaatagca 1140atatttctgc atataaatat ttctgcatat
aaattgtaac tgatgtaaga ggtttcatat 1200tgctaatagc agctacaatc cagctaccat
tctgctttta ttttatggtt gggataaggc 1260tggattattc tgagtccaag ctaggccctt
ttgctaatca tgttcatacc tcttatcttc 1320ctcccacagc tcctgggcaa cgtgctggtc
tgtgtgctgg cccatcactt tggcaaagaa 1380ttgggattcg aacatcgaat tcgggcacga
gggaggacag agagcaagtc actcccggct 1440gcctttttca cctctgacag agcccagaca
ccatgaacgc aagtgaattc cgaaggagag 1500ggaaggagat ggtggattac gtggccaact
acatggaagg cattgaggga cgccaggtct 1560accctgacgt ggagcccggg tacctgcggc
cgctgatccc tgccgctgcc cctcaggagc 1620cagacacgtt tgaggacatc atcaacgacg
ttgagaagat aatcatgcct ggggtgacgc 1680actggcacag cccctacttc ttcgcctact
tccccactgc cagctcgtac ccggccatgc 1740ttgcggacat gctgtgcggg gccattggct
gcatcggctt ctcctgggcg gcaagcccag 1800catgcacaga gctggagact gtgatgatgg
actggctcgg gaagatgctg gaactaccaa 1860aggcattttt gaatgagaaa gctggagaag
ggggaggagt gatccaggga agtgccagtg 1920aagccaccct ggtggccctg ctggccgctc
ggaccaaagt gatccatcgg ctgcaggcag 1980cgtccccaga gctcacacag gccgctatca
tggagaagct ggtggcttac tcatccgatc 2040aggcacactc ctcagtggaa agagctgggt
taattggtgg agtgaaatta aaagccatcc 2100cctcagatgg caacttcgcc atgcgtgcgt
ctgccctgca ggaagccctg gagagagaca 2160aagcggctgg cctgattcct ttctttatgg
ttgccaccct ggggaccaca acatgctgct 2220cctttgacaa tctcttagaa gtcggtccta
tctgcaacaa ggaagacata tggctgcacg 2280ttgatgcagc ctacgcaggc agtgcattca
tctgccctga gttccggcac cttctgaatg 2340gagtggagtt tgcagattca ttcaacttta
atccccacaa atggctattg gtgaattttg 2400actgttctgc catgtgggtg aaaaagagaa
cagacttaac gggagccttt agactggacc 2460ccacttacct gaagcacagc catcaggatt
cagggcttat cactgactac cggcattggc 2520agataccact gggcagaaga tttcgctctt
tgaaaatgtg gtttgtattt aggatgtatg 2580gagtcaaagg actgcaggct tatatccgca
agcatgtcca gctgtcccat gagtttgagt 2640cactggtgcg ccaggatccc cgctttgaaa
tctgtgtgga agtcattctg gggcttgtct 2700gctttcggct aaagggttcc aacaaagtga
atgaagctct tctgcaaaga ataaacagtg 2760ccaaaaaaat ccacttggtt ccatgtcacc
tcagggacaa gtttgtcctg cgctttgcca 2820tctgttctcg cacggtggaa tctgcccatg
tgcagcgggc ctgggaacac atcaaagagc 2880tggcggccga cgtgctgcga gcagagaggg
agtaggagtg aagccagctg caggaatcaa 2940aaattgaaga gagatatatc tgaaaactgg
aataagaagc aaataaatat catcctgcct 3000tcatggaact cagctgtctg tggcttccca
tgtctttctc caaagttatc cagagggttg 3060tgattttgtc tgcttagtat ctcatcaaca
aagaaatatt atttgctaat taaaaagtta 3120atcttcatgg ccatagcttt tattcattag
ctgtgatttt tgttgattaa aacattatag 3180attttcatgt tcttgcagtc atcagaagtg
gtaggaaagc ctcactgata tattttccag 3240ggcaatcaat gttcacgcaa cttgaaatta
tatctgtggt cttcaaattg tcttttgtca 3300tgtggctaaa tgcctaataa acaattcaag
tgaaatacta aaaaaaaaaa aaaaaaaaaa 3360agctgctcga gagatctacg ggtggcatcc
ctgtgacccc tccccagtgc ctctcctggc 3420cctggaagtt gccactccag tgcccaccag
ccttgtccta ataaaattaa gttgcatcat 3480tttgtctgac taggtgtcct tctataatat
tatggggtgg aggggggtgg tatggagcaa 3540ggggcaagtt gggaagacaa cctgtagggc
ctgcggggtc tattgggaac caagctggag 3600tgcagtggca caatcttggc tcactgcaat
ctccgcctcc tgggttcaag cgattctcct 3660gcctcagcct cccgagttgt tgggattcca
ggcatgcatg accaggctca gctaattttt 3720gtttttttgg tagagacggg gtttcaccat
attggccagg ctggtctcca actcctaatc 3780tcaggtgatc tacccacctt ggcctcccaa
attgctggga ttacaggcgt gaaccactgc 3840tcccttccct gtccttctga ttttgtaggt
aacgtaaccc cggaccacgt gcggaccgag 3900cggccgctct agagcatggc tacgtagata
agtagcatgg cgggttaatc attaactaca 3960aggaacccct agtgatggag ttggccactc
cctctctgcg cgctcgctcg ctcactgagg 4020ccgggcgacc aaaggtcgcc cgacgcccgg
gcggcctcag tgagcgagcg agcgcgcag 4079109266DNAArtificial
SequenceDescription of Artificial Sequence Synthetic polynucleotide
10gagaggcggt ttgcgtattg ggcgctcttc cgcttcctcg ctcactgact cgctgcgctc
60ggtcgttcgg ctgcggcgag cggtatcagc tcactcaaag gcggtaatac ggttatccac
120agaatcaggg gataacgcag gaaagaacat gtgagcaaaa ggccagcaaa aggccaggaa
180ccgtaaaaag gccgcgttgc tggcgttttg agatcctttt tttctgcgcg taatctgctg
240cttgcaaaca aaaaaaccac cgctaccagc ggtggtttgt ttgccggatc aagagctacc
300aactcttttt ccgaaggtaa ctggcttcag cagagcgcag ataccaaata ctgttcttct
360agtgtagccg tagttaggcc accacttcaa gaactctgta gcaccgccta catacctcgc
420tctgctaatc ctgttaccag tggctgctgc cagtggcgat aagtcgtgtc ttaccgggtt
480ggactcaaga cgatagttac cggataaggc gcagcggtcg ggctgaacgg ggggttcgtg
540cacacagccc agcttggagc gaacgaccta caccgaactg agatacctac agcgtgagct
600atgagaaagc gccacgcttc ccgaagggag aaaggcggac aggtatccgg taagcggcag
660ggtcggaaca ggagagcgca cgagggagct tccaggggga aacgcctggt atctttatag
720tcctgtcggg tttcgccacc tctgacttga gcgtcgattt ttgtgatgct cgtcaggggg
780gcggagccta tggaaagaag atcctttgat cttttctacg gggtctgacg ctcagtggaa
840cgaaaactca cgttaaggga ttttggtcat gagattatca aaaaggatct tcacctagat
900ccttttaaat taaaaatgaa gttttaaatc aagcccaatc tgaataatgt tacaaccaat
960taaccaattc tgaaaacgcg cgatgcagct ctggcccgtg tctcaaaatc tctgatgtta
1020cattgcacaa gataaaaata tatcatcatg aacaataaaa ctgtctgctt acataaacag
1080taatacaagg ggtgttatga gccatattca acgggaaacg tcgaggccgc gattaaattc
1140caacatggat gctgatttat atgggtataa atgggctcgc gataatgtcg ggcaatcagg
1200tgcgacaatc tatcgcttgt atgggaagcc cgatgcgcca gagttgtttc tgaaacatgg
1260caaaggtagc gttgccaatg atgttacaga tgagatggtc agactaaact ggctgacgga
1320atttatgcct cttccgacca tcaagcattt tatccgtact cctgatgatg catggttact
1380caccactgcg atccccggaa aaacagcatt ccaggtatta gaagaatatc ctgattcagg
1440tgaaaatatt gttgatgcgc tggcagtgtt cctgcgccgg ttgcattcga ttcctgtttg
1500taattgtcct tttaacagcg atcgcgtatt tcgtctcgct caggcgcaat cacgaatgaa
1560taacggtttg gttgatgcga gtgattttga tgacgagcgt aatggctggc ctgttgaaca
1620agtctggaaa gaaatgcata aacttttgcc attctcaccg gattcagtcg tcactcatgg
1680tgatttctca cttgataacc ttatttttga cgaggggaaa ttaataggtt gtattgatgt
1740tggacgagtc ggaatcgcag accgatacca ggatcttgcc atcctatgga actgcctcgg
1800tgagttttct ccttcattac agaaacggct ttttcaaaaa tatggtattg ataatcctga
1860tatgaataaa ttgcagtttc atttgatgct cgatgagttt ttctaatcag aattggttaa
1920ttggttgtaa cattattcag attgggcttg atttaaaact tcatttttaa tttaaaagga
1980tctaggtgaa gatccttttt gataatctca tgaccaaaat cccttaacgt gagttttcgt
2040tccactgagc gtcagacccc gtagaaaaga tcaaaggatc ttcaacaccc cttgtattac
2100tgtttatgta agcagacagt tttattgttc atgatgatat atttttatct tgtgcaatgt
2160aacatcagag attttgagac acgggccaga gctgcatcgc gcgtttcggt gatgacggtg
2220aaaacctctg acacatgcag ctcccgtatc tggaggctat aaatgattac gatacttcga
2280aaacatcctt atcctggaaa actccccgtt catttcccac tctcctgcca ttcgacactc
2340gtgcgtccat tcaagtctgt gctaatttct acgcatttcc ctctgccatt gactttgctt
2400gcgtgggata ataactatta agccaacttg attcaactca ggcattcaaa aggcattttg
2460attagtcgaa aagtggcacg gctgacgagt ggagctgcca tttcacgttt atttcgaact
2520tttgattaca tggtatattt agtaatacac atatttttta gccagcaggt taatacttca
2580aagttgtttc gattttcaac gaataaaagg aatttggcat ggtgtttttt ctggtctttg
2640gtattgacaa atcagggata tacaatatgt attaacaaaa ttggattgct acatatattt
2700aatgattttc attattagaa tgggtggaat aaagttttaa attacattat taatttcatt
2760agggttggct gattgattac tatttcctca ttgaattgca ttcgatatta gcagtattta
2820tctggcccat tttggaagtt acttaaattt cgaaccttaa gtcattatta gagctaatat
2880acaacagagt tgtcaacttg gtttgatcag cattgaaatt aaactgattt cttgttcgtt
2940cttatttcgt ttggttttgt atctcgtatt ttatatgcag gagggcatat attggcacaa
3000gacaaataat cacagcaccc attctcaact ttgtcctgtt tctcagttta gtgtaaatag
3060aatgttgcaa aaaattgaat ataagcatta tcatagtgtc aaattcgaga ggatgagttt
3120gctgtgggtc ttcgaggttc tttccctgtg tttgccacgg ttcgttgcac gttgccactg
3180attggacaca tgtccgcagt gaaaaatcta cggtcaggta ccacccaact aaaccggaag
3240gcggcacgtg tgtgggcgtt gagcggtgtg ggcgtggcag ccatataatg agacatttat
3300ttaaaaagaa cattcgaaca tttttgatgg gccatatctt ggcttgtcaa gctccagggc
3360agacattttc ctcgactcca ccgccttttt catttgaatg gaggaggtgt agggcacaaa
3420aaacgtttcc tgccttttta agcagcacaa aggatatgag ccattaaatt agttaatttc
3480gagtgcattt cattttaaat aagtgttgga aagggaataa aaaagcgact gatagaaaag
3540ttgcagacac caagagaatg ttaaatattt taataatagc tacatttttc tatctctgtg
3600acaaggcctg tgtactttaa tgttatatta cttctttgtg tttgatttct gttaaaagtt
3660tatgattttg gcatgtacaa atcttacaac ccttttttgt catcatgaca aaatcaaaat
3720cgtgcaatat ttccattctc atcttttagc cgattcataa cattcgtaga aattaatatg
3780aaatcaatca tgtataattt tcatgcacgt tatgccgatt tggtatcgtc gatttgccgg
3840ctcatcgtcg ccattgtgtt aatggaaaag ttatgctttt cgcaggaaaa aagagttgaa
3900aattccaatt tttgtcatgc tcatcaaaat gttatacatt cggtaatttg agctggccaa
3960acgttaaccc cttatcgccc cgcgcaagca ttcattaact gcccccagag cgtaattaat
4020ctctttctcg cagaatttcc ttcacagcca cgtcttgggt aaaagtcacc cctcaaagtg
4080gcagttgcat gttgtaaatt agattttcgt ccgtcatgac aaccctcgtg cgagggttgc
4140tgcagcattt gaatgcaaaa ctgcttttgg tcattaacct gtctgaggca ctttgctgca
4200aaacttctat tagaattcgg tttggactcg aattcggatt tcttccccca aaatgcgatg
4260gctacagcaa aatgctttca gcttccgaag ttttgcaacc ccaaagtcca gagtttccac
4320gctgtcacga ttccaaagcg gcgccatttt tggctcacgc aaaacttatt aatgaacttt
4380aagcagacta cgaggaaagg gctataatgg ccacacaaaa gggttaagca agtgttaagg
4440gctggtggga gggaaaaatc atcaatcata ttttctgcat agctgaatca tttgcgccga
4500tcagttgggg ttacttaatg ggtttatttc aagaagaaaa ctgtgggaaa ctaactgact
4560ctaaacttaa tcagattaaa tgtaacctgg agatgatttt caaaatatta aaagagtttt
4620atggaggtaa ttttaaagaa aactgaaaaa ctttgaagaa gtctataata gatccagtct
4680taatcgtagc actgattatt tgtttttaaa ttggaaaaaa ttaaatgata catcatgctt
4740aaatgcgatg tccaacaaat cccaagacgg taatttccgt gcgttccaaa ctcatctgaa
4800gaatcttaca aatacatttc gtgtatcccc aggctcagcg tgcaaataaa tcttttggat
4860ctttgcaaat gcgaaatgct tatttttatg cgttttcaat gccaattcga tggcaaaacc
4920aacaaaatca catggaaata atggaaaagc aatttccatt tctacaaggg aggcagtgag
4980acacaagagc agcgtataca attccccagc agcgatttga ccattaaaat tatacccaca
5040ggacgagcag gcataaaaag cagaggatgc gaggtgttca ggggactgtc tatatctcca
5100acttgaatat atgaaatcgt ttggaaatag ccaagcgacc aaattggcat ttggaaaatt
5160gcacaacgac agaagaagat gtttgaaaag agaaattgaa ataataaacc aagatatatg
5220taaacggttg gtcacatttg ggttctgaga cggtcacagc ttgtctgtaa gcggatgccg
5280ggagcagaca agcccgtcag ggcgcgtcag cgggtgttgg cgggtgtcgg ggctggctta
5340actatgcggc atcagagcag attgtactga gagtgcacca tatgcggtgt gaaataccgc
5400acagatgcgt aaggagaaaa taccgcatca ggcgccattc gccattcagg ctgcgcaact
5460gttgggaagg gcgatcggtg cgggcctctt cgctattacg ccagctggcg aaagggggat
5520gtgctgcaag gcgattaagt tgggtaacgc cagggttttc ccagtcacga cgttgtaaaa
5580cgacggccag tgaattcgag ctcggtacca tttaaatcgt cttggccact ccctctctgc
5640gcgctcgctc gctcactgag gccgcccggg caaagcccgg gcgtcgggcg acctttggtc
5700gcccggcctc agtgagcgag cgagcgcgca gagagggagt ggccaactcc atcactaggg
5760gttccttcgc gagcttaatt aactgcggcc gctcggtccg cacgtggtta cctacaaaat
5820cagaaggaca gggaagggag cagtggttca cgcctgtaat cccagcaatt tgggaggcca
5880aggtgggtag atcacctgag attaggagtt ggagaccagc ctggccaata tggtgaaacc
5940ccgtctctac caaaaaaaca aaaattagct gagcctggtc atgcatgcct ggaatcccaa
6000caactcggga ggctgaggca ggagaatcgc ttgaacccag gaggcggaga ttgcagtgag
6060ccaagattgt gccactgcac tccagcttgg ttcccaatag accccgcagg ccctacaggt
6120tgtcttccca acttgcccct tgctccatac cacccccctc caccccataa tattatagaa
6180ggacacctag tcagacaaaa tgatgcaact taattttatt aggacaaggc tggtgggcac
6240tggagtggca acttccaggg ccaggagagg cactggggag gggtcacagg gatgccaccc
6300gtagatctct cgagcagctc actcctactc cctctctgct cgcagcacgt cggccgccag
6360ctctttgatg tgttcccagg cccgctgcac atgggcagat tccaccgtgc gagaacagat
6420ggcaaagcgc aggacaaact tgtccctgag gtgacatgga accaagtgga tttttttggc
6480actgtttatt ctttgcagaa gagcttcatt cactttgttg gaacccttta gccgaaagca
6540gacaagcccc agaatgactt ccacacagat ttcaaagcgg ggatcctggc gcaccagtga
6600ctcaaactca tgggacagct ggacatgctt gcggatataa gcctgcagtc ctttgactcc
6660atacatccta aatacaaacc acattttcaa agagcgaaat cttctgccca gtggtatctg
6720ccaatgccgg tagtcagtga taagccctga atcctgatgg ctgtgcttca ggtaagtggg
6780gtccagtcta aaggctcccg ttaagtctgt tctctttttc acccacatgg cagaacagtc
6840aaaattcacc aatagccatt tgtggggatt aaagttgaat gaatctgcaa actccactcc
6900attcagaagg tgccggaact cagggcagat gaatgcactg cctgcgtagg ctgcatcaac
6960gtgcagccat atgtcttcct tgttgcagat aggaccgact tctaagagat tgtcaaagga
7020gcagcatgtt gtggtcccca gggtggcaac cataaagaaa ggaatcaggc cagccgcttt
7080gtctctctcc agggcttcct gcagggcaga cgcacgcatg gcgaagttgc catctgaggg
7140gatggctttt aatttcactc caccaattaa cccagctctt tccactgagg agtgtgcctg
7200atcggatgag taagccacca gcttctccat gatagcggcc tgtgtgagct ctggggacgc
7260tgcctgcagc cgatggatca ctttggtccg agcggccagc agggccacca gggtggcttc
7320actggcactt ccctggatca ctcctccccc ttctccagct ttctcattca aaaatgcctt
7380tggtagttcc agcatcttcc cgagccagtc catcatcaca gtctccagct ctgtgcatgc
7440tgggcttgcc gcccaggaga agccgatgca gccaatggcc ccgcacagca tgtccgcaag
7500catggccggg tacgagctgg cagtggggaa gtaggcgaag aagtaggggc tgtgccagtg
7560cgtcacccca ggcatgatta tcttctcaac gtcgttgatg atgtcctcaa acgtgtctgg
7620ctcctgaggg gcagcggcag ggatcagcgg ccgcaggtac ccgggctcca cgtcagggta
7680gacctggcgt ccctcaatgc cttccatgta gttggccacg taatccacca tctccttccc
7740tctccttcgg aattcacttg cgttcatggt ggcggccgat gttcgaatcc caattctttg
7800ccaaagtgat gggccagcac acagaccagc acgttgccca ggagctgtgg gaggaagata
7860agaggtatga acatgattag caaaagggcc tagcttggac tcagaataat ccagccttat
7920cccaaccata aaataaaagc agaatggtag ctggattgta gctgctatta gcaatatgaa
7980acctcttaca tcagttacaa tttatatgca gaaatattta tatgcagaaa tattgctatt
8040gccttaaccc agaaattatc actgttattc tttagaatgg tgcaaagagg catgatacat
8100tgtatcatta ttgccctgaa agaaagagat tagggaaagt attagaaata agataaacaa
8160aaaagtatat taaaagaaga aagcattttt tgtgggccta tagactctat aggcggtact
8220tacgtcactc ttggcacggg gaatccgcgt tccaatgcac cgttcccggc cgggattcga
8280atccgcggag gctggatcgg tcccggtgtc ttctatggag gtcaaaacag cgtggatggc
8340gtctccaggc gatctgacgg ttcactaaac gagctctgct tatatagacc tcccaccgta
8400cacgcctacc gcccatttgc gtcaatgggg cggagttgtt acgacatttt ggaaagtccc
8460gttgattttg gtgcaaaaca aactcccatt gacgtcaatg gggtggagac ttggaaatcc
8520ccgtgagtca aaccgctatc cacgcccatt gatgtactgc caaaaccgca tcaccatggt
8580aatagcgatg actaatacgt agatgtactg ccaagtagga aagtcccata aggtcatgta
8640ctgggcataa tgccaggcgg gccatttacc gtcattgacg tcaatagggg gcgtacttgg
8700catatgatac acttgatgta ctgccaagtg ggcagtttac cgtaaatact ccacccattg
8760acgtcaatgg aaagtcccta ttgacgttac tatgggaaca tacgtcatta ttgacgtcaa
8820tgggcggggg tcgttgggcg gtcagccagg cgggccattt accgtaagtt atgtaacgcg
8880gaactccata tatgggctat gaactaatga ccccgtaatt gattactatt aataactagc
8940tccacgcgtg cggccgcaga tcgtcgacga agtttaaact caggaacccc tagtgatgga
9000gttggccact ccctctctgc gcgctcgctc gctcactgag gccgcccggg caaagcccgg
9060gcgtcgggcg acctttggtc gcccggcctc agtgagcgag cgagcgcgca gagagggagt
9120ggccaacgtc atttaaatgc atgcaagctt ggcgtaatca tggtcatagc tgtttcctgt
9180gtgaaaattg cgttgcgctc actgcccgct ttccagtcgg gaaacctgtc gtgccagctg
9240cattaatgaa tcggccaacg cgcggg
9266119236DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 11cccgcgcgtt ggccgattca ttaatgcagc
tggcacgaca ggtttcccga ctggaaagcg 60ggcagtgagc gcaacgcaat tttcacacag
gaaacagcta tgaccatgat tacgccaagc 120ttgcatgcat ttaaatgacg cagctgcgcg
ctcgctcgct cactgaggcc gcccgggcaa 180agcccgggcg tcgggcgacc tttggtcgcc
cggcctcagt gagcgagcga gcgcgcagag 240agggagtggc caactccatc actaggggtt
gagtttaaac ttcgtcgacg atctgcggcc 300gcacgcgtgg agctagttat taatagtaat
caattacggg gtcattagtt catagcccat 360atatggagtt ccgcgttaca taacttacgg
taaatggccc gcctggctga ccgcccaacg 420acccccgccc attgacgtca ataatgacgt
atgttcccat agtaacgtca atagggactt 480tccattgacg tcaatgggtg gagtatttac
ggtaaactgc ccacttggca gtacatcaag 540tgtatcatat gccaagtacg ccccctattg
acgtcaatga cggtaaatgg cccgcctggc 600attatgccca gtacatgacc ttatgggact
ttcctacttg gcagtacatc tacgtattag 660tcatcgctat taccatggtg atgcggtttt
ggcagtacat caatgggcgt ggatagcggt 720ttgactcacg gggatttcca agtctccacc
ccattgacgt caatgggagt ttgttttgca 780ccaaaatcaa cgggactttc caaaatgtcg
taacaactcc gccccattga cgcaaatggg 840cggtaggcgt gtacggtggg aggtctatat
aagcagagct cgtttagtga accgtcagat 900cgcctggaga cgccatccac gctgttttga
cctccataga agacaccggg accgatccag 960cctccgcgga ttcgaatccc ggccgggaac
ggtgcattgg aacgcggatt ccccgtgcca 1020agagtgacgt aagtaccgcc tatagagtct
ataggcccac aaaaaatgct ttcttctttt 1080aatatacttt tttgtttatc ttatttctaa
tactttccct aatctctttc tttcagggca 1140ataatgatac aatgtatcat gcctctttgc
accattctaa agaataacag tgataatttc 1200tgggttaagg caatagcaat atttctgcat
ataaatattt ctgcatataa attgtaactg 1260atgtaagagg tttcatattg ctaatagcag
ctacaatcca gctaccattc tgcttttatt 1320ttatggttgg gataaggctg gattattctg
agtccaagct aggccctttt gctaatcatg 1380ttcatacctc ttatcttcct cccacagctc
ctgggcaacg tgctggtctg tgtgctggcc 1440catcactttg gcaaagaatt gggattcgaa
catcggccgc caccatgaac gcaagtgaat 1500tccgaaggag agggaaggag atggtggatt
acgtggccaa ctacatggaa ggcattgagg 1560gacgccaggt ctaccctgac gtggagcccg
ggtacctgcg gccgctgatc cctgccgctg 1620cccctcagga gccagacacg tttgaggaca
tcatcaacga cgttgagaag ataatcatgc 1680ctggggtgac gcactggcac agcccctact
tcttcgccta cttccccact gccagctcgt 1740acccggccat gcttgcggac atgctgtgcg
gggccattgg ctgcatcggc ttctcctggg 1800cggcaagccc agcatgcaca gagctggaga
ctgtgatgat ggactggctc gggaagatgc 1860tggaactacc aaaggcattt ttgaatgaga
aagctggaga agggggagga gtgatccagg 1920gaagtgccag tgaagccacc ctggtggccc
tgctggccgc tcggaccaaa gtgatccatc 1980ggctgcaggc agcgtcccca gagctcacac
aggccgctat catggagaag ctggtggctt 2040actcatccga tcaggcacac tcctcagtgg
aaagagctgg gttaattggt ggagtgaaat 2100taaaagccat cccctcagat ggcaacttcg
ccatgcgtgc gtctgccctg caggaagccc 2160tggagagaga caaagcggct ggcctgattc
ctttctttat ggttgccacc ctggggacca 2220caacatgctg ctcctttgac aatctcttag
aagtcggtcc tatctgcaac aaggaagaca 2280tatggctgca cgttgatgca gcctacgcag
gcagtgcatt catctgccct gagttccggc 2340accttctgaa tggagtggag tttgcagatt
cattcaactt taatccccac aaatggctat 2400tggtgaattt tgactgttct gccatgtggg
tgaaaaagag aacagactta acgggagcct 2460ttagactgga ccccacttac ctgaagcaca
gccatcagga ttcagggctt atcactgact 2520accggcattg gcagatacca ctgggcagaa
gatttcgctc tttgaaaatg tggtttgtat 2580ttaggatgta tggagtcaaa ggactgcagg
cttatatccg caagcatgtc cagctgtccc 2640atgagtttga gtcactggtg cgccaggatc
cccgctttga aatctgtgtg gaagtcattc 2700tggggcttgt ctgctttcgg ctaaagggtt
ccaacaaagt gaatgaagct cttctgcaaa 2760gaataaacag tgccaaaaaa atccacttgg
ttccatgtca cctcagggac aagtttgtcc 2820tgcgctttgc catctgttct cgcacggtgg
aatctgccca tgtgcagcgg gcctgggaac 2880acatcaaaga gctggcggcc gacgtgctgc
gagcagagag ggagtaggag tgagctgctc 2940gagagatcta cgggtggcat ccctgtgacc
cctccccagt gcctctcctg gccctggaag 3000ttgccactcc agtgcccacc agccttgtcc
taataaaatt aagttgcatc attttgtctg 3060actaggtgtc cttctataat attatggggt
ggaggggggt ggtatggagc aaggggcaag 3120ttgggaagac aacctgtagg gcctgcgggg
tctattggga accaagctgg agtgcagtgg 3180cacaatcttg gctcactgca atctccgcct
cctgggttca agcgattctc ctgcctcagc 3240ctcccgagtt gttgggattc caggcatgca
tgaccaggct cagctaattt ttgttttttt 3300ggtagagacg gggtttcacc atattggcca
ggctggtctc caactcctaa tctcaggtga 3360tctacccacc ttggcctccc aaattgctgg
gattacaggc gtgaaccact gctcccttcc 3420ctgtccttct gattttgtag gtaaccacgt
gcggaccgag cggccgcagt taattaagct 3480cgcgaaaccc ctagtgatgg agttggccac
tccctctctg cgcgctcgct cgctcactga 3540ggccgggcga ccaaaggtcg cccgacgccc
gggctttgcc cgggcggcct cagtgagcga 3600gcgagcgcgc agctggacga tttaaatggt
accgagctcg aattcactgg ccgtcgtttt 3660acaacgtcgt gactgggaaa accctggcgt
tacccaactt aatcgccttg cagcacatcc 3720ccctttcgcc agctggcgta atagcgaaga
ggcccgcacc gatcgccctt cccaacagtt 3780gcgcagcctg aatggcgaat ggcgcctgat
gcggtatttt ctccttacgc atctgtgcgg 3840tatttcacac cgcatatggt gcactctcag
tacaatctgc tctgatgccg catagttaag 3900ccagccccga cacccgccaa cacccgctga
cgcgccctga cgggcttgtc tgctcccggc 3960atccgcttac agacaagctg tgaccgtctc
agaacccaaa tgtgaccaac cgtttacata 4020tatcttggtt tattatttca atttctcttt
tcaaacatct tcttctgtcg ttgtgcaatt 4080ttccaaatgc caatttggtc gcttggctat
ttccaaacga tttcatatat tcaagttgga 4140gatatagaca gtcccctgaa cacctcgcat
cctctgcttt ttatgcctgc tcgtcctgtg 4200ggtataattt taatggtcaa atcgctgctg
gggaattgta tacgctgctc ttgtgtctca 4260ctgcctccct tgtagaaatg gaaattgctt
ttccattatt tccatgtgat tttgttggtt 4320ttgccatcga attggcattg aaaacgcata
aaaataagca tttcgcattt gcaaagatcc 4380aaaagattta tttgcacgct gagcctgggg
atacacgaaa tgtatttgta agattcttca 4440gatgagtttg gaacgcacgg aaattaccgt
cttgggattt gttggacatc gcatttaagc 4500atgatgtatc atttaatttt ttccaattta
aaaacaaata atcagtgcta cgattaagac 4560tggatctatt atagacttct tcaaagtttt
tcagttttct ttaaaattac ctccataaaa 4620ctcttttaat attttgaaaa tcatctccag
gttacattta atctgattaa gtttagagtc 4680agttagtttc ccacagtttt cttcttgaaa
taaacccatt aagtaacccc aactgatcgg 4740cgcaaatgat tcagctatgc agaaaatatg
attgatgatt tttccctccc accagccctt 4800aacacttgct taaccctttt gtgtggccat
tatagccctt tcctcgtagt ctgcttaaag 4860ttcattaata agttttgcgt gagccaaaaa
tggcgccgct ttggaatcgt gacagcgtgg 4920aaactctgga ctttggggtt gcaaaacttc
ggaagctgaa agcattttgc tgtagccatc 4980gcattttggg ggaagaaatc cgaattcgag
tccaaaccga attctaatag aagttttgca 5040gcaaagtgcc tcagacaggt taatgaccaa
aagcagtttt gcattcaaat gctgcagcaa 5100ccctcgcacg agggttgtca tgacggacga
aaatctaatt tacaacatgc aactgccact 5160ttgaggggtg acttttaccc aagacgtggc
tgtgaaggaa attctgcgag aaagagatta 5220attacgctct gggggcagtt aatgaatgct
tgcgcggggc gataaggggt taacgtttgg 5280ccagctcaaa ttaccgaatg tataacattt
tgatgagcat gacaaaaatt ggaattttca 5340actctttttt cctgcgaaaa gcataacttt
tccattaaca caatggcgac gatgagccgg 5400caaatcgacg ataccaaatc ggcataacgt
gcatgaaaat tatacatgat tgatttcata 5460ttaatttcta cgaatgttat gaatcggcta
aaagatgaga atggaaatat tgcacgattt 5520tgattttgtc atgatgacaa aaaagggttg
taagatttgt acatgccaaa atcataaact 5580tttaacagaa atcaaacaca aagaagtaat
ataacattaa agtacacagg ccttgtcaca 5640gagatagaaa aatgtagcta ttattaaaat
atttaacatt ctcttggtgt ctgcaacttt 5700tctatcagtc gcttttttat tccctttcca
acacttattt aaaatgaaat gcactcgaaa 5760ttaactaatt taatggctca tatcctttgt
gctgcttaaa aaggcaggaa acgttttttg 5820tgccctacac ctcctccatt caaatgaaaa
aggcggtgga gtcgaggaaa atgtctgccc 5880tggagcttga caagccaaga tatggcccat
caaaaatgtt cgaatgttct ttttaaataa 5940atgtctcatt atatggctgc cacgcccaca
ccgctcaacg cccacacacg tgccgccttc 6000cggtttagtt gggtggtacc tgaccgtaga
tttttcactg cggacatgtg tccaatcagt 6060ggcaacgtgc aacgaaccgt ggcaaacaca
gggaaagaac ctcgaagacc cacagcaaac 6120tcatcctctc gaatttgaca ctatgataat
gcttatattc aattttttgc aacattctat 6180ttacactaaa ctgagaaaca ggacaaagtt
gagaatgggt gctgtgatta tttgtcttgt 6240gccaatatat gccctcctgc atataaaata
cgagatacaa aaccaaacga aataagaacg 6300aacaagaaat cagtttaatt tcaatgctga
tcaaaccaag ttgacaactc tgttgtatat 6360tagctctaat aatgacttaa ggttcgaaat
ttaagtaact tccaaaatgg gccagataaa 6420tactgctaat atcgaatgca attcaatgag
gaaatagtaa tcaatcagcc aaccctaatg 6480aaattaataa tgtaatttaa aactttattc
cacccattct aataatgaaa atcattaaat 6540atatgtagca atccaatttt gttaatacat
attgtatatc cctgatttgt caataccaaa 6600gaccagaaaa aacaccatgc caaattcctt
ttattcgttg aaaatcgaaa caactttgaa 6660gtattaacct gctggctaaa aaatatgtgt
attactaaat ataccatgta atcaaaagtt 6720cgaaataaac gtgaaatggc agctccactc
gtcagccgtg ccacttttcg actaatcaaa 6780atgccttttg aatgcctgag ttgaatcaag
ttggcttaat agttattatc ccacgcaagc 6840aaagtcaatg gcagagggaa atgcgtagaa
attagcacag acttgaatgg acgcacgagt 6900gtcgaatggc aggagagtgg gaaatgaacg
gggagttttc caggataagg atgttttcga 6960agtatcgtaa tcatttatag cctccagata
cgggagctgc atgtgtcaga ggttttcacc 7020gtcatcaccg aaacgcgcga tgcagctctg
gcccgtgtct caaaatctct gatgttacat 7080tgcacaagat aaaaatatat catcatgaac
aataaaactg tctgcttaca taaacagtaa 7140tacaaggggt gttgaagatc ctttgatctt
ttctacgggg tctgacgctc agtggaacga 7200aaactcacgt taagggattt tggtcatgag
attatcaaaa aggatcttca cctagatcct 7260tttaaattaa aaatgaagtt ttaaatcaag
cccaatctga ataatgttac aaccaattaa 7320ccaattctga ttagaaaaac tcatcgagca
tcaaatgaaa ctgcaattta ttcatatcag 7380gattatcaat accatatttt tgaaaaagcc
gtttctgtaa tgaaggagaa aactcaccga 7440ggcagttcca taggatggca agatcctggt
atcggtctgc gattccgact cgtccaacat 7500caatacaacc tattaatttc ccctcgtcaa
aaataaggtt atcaagtgag aaatcaccat 7560gagtgacgac tgaatccggt gagaatggca
aaagtttatg catttctttc cagacttgtt 7620caacaggcca gccattacgc tcgtcatcaa
aatcactcgc atcaaccaaa ccgttattca 7680ttcgtgattg cgcctgagcg agacgaaata
cgcgatcgct gttaaaagga caattacaaa 7740caggaatcga atgcaaccgg cgcaggaaca
ctgccagcgc atcaacaata ttttcacctg 7800aatcaggata ttcttctaat acctggaatg
ctgtttttcc ggggatcgca gtggtgagta 7860accatgcatc atcaggagta cggataaaat
gcttgatggt cggaagaggc ataaattccg 7920tcagccagtt tagtctgacc atctcatctg
taacatcatt ggcaacgcta cctttgccat 7980gtttcagaaa caactctggc gcatcgggct
tcccatacaa gcgatagatt gtcgcacctg 8040attgcccgac attatcgcga gcccatttat
acccatataa atcagcatcc atgttggaat 8100ttaatcgcgg cctcgacgtt tcccgttgaa
tatggctcat aacacccctt gtattactgt 8160ttatgtaagc agacagtttt attgttcatg
atgatatatt tttatcttgt gcaatgtaac 8220atcagagatt ttgagacacg ggccagagct
gcatcgcgcg ttttcagaat tggttaattg 8280gttgtaacat tattcagatt gggcttgatt
taaaacttca tttttaattt aaaaggatct 8340aggtgaagat cctttttgat aatctcatga
ccaaaatccc ttaacgtgag ttttcgttcc 8400actgagcgtc agaccccgta gaaaagatca
aaggatcttc tttccatagg ctccgccccc 8460ctgacgagca tcacaaaaat cgacgctcaa
gtcagaggtg gcgaaacccg acaggactat 8520aaagatacca ggcgtttccc cctggaagct
ccctcgtgcg ctctcctgtt ccgaccctgc 8580cgcttaccgg atacctgtcc gcctttctcc
cttcgggaag cgtggcgctt tctcatagct 8640cacgctgtag gtatctcagt tcggtgtagg
tcgttcgctc caagctgggc tgtgtgcacg 8700aaccccccgt tcagcccgac cgctgcgcct
tatccggtaa ctatcgtctt gagtccaacc 8760cggtaagaca cgacttatcg ccactggcag
cagccactgg taacaggatt agcagagcga 8820ggtatgtagg cggtgctaca gagttcttga
agtggtggcc taactacggc tacactagaa 8880gaacagtatt tggtatctgc gctctgctga
agccagttac cttcggaaaa agagttggta 8940gctcttgatc cggcaaacaa accaccgctg
gtagcggtgg tttttttgtt tgcaagcagc 9000agattacgcg cagaaaaaaa ggatctcaaa
acgccagcaa cgcggccttt ttacggttcc 9060tggccttttg ctggcctttt gctcacatgt
tctttcctgc gttatcccct gattctgtgg 9120ataaccgtat taccgccttt gagtgagctg
ataccgctcg ccgcagccga acgaccgagc 9180gcagcgagtc agtgagcgag gaagcggaag
agcgcccaat acgcaaaccg cctctc 9236126260DNAArtificial
SequenceDescription of Artificial Sequence Synthetic polynucleotide
12cccgcgcgtt ggccgattca ttaatgcagc tggcacgaca ggtttcccga ctggaaagcg
60ggcagtgagc gcaacgcaat tttcacacag gaaacagcta tgaccatgat tacgccaagc
120ttgcatgcat ttaaatgacg ttggccactc cctctctgcg cgctcgctcg ctcactgagg
180ccgggcgacc aaaggtcgcc cgacgcccgg gctttgcccg ggcggcctca gtgagcgagc
240gagcgcgcag agagggagtg gccaactcca tcactagggg ttcctgagtt taaacttcgt
300cgacgatctg cggccgcacg cgtggagcta gttattaata gtaatcaatt acggggtcat
360tagttcatag cccatatatg gagttccgcg ttacataact tacggtaaat ggcccgcctg
420gctgaccgcc caacgacccc cgcccattga cgtcaataat gacgtatgtt cccatagtaa
480cgtcaatagg gactttccat tgacgtcaat gggtggagta tttacggtaa actgcccact
540tggcagtaca tcaagtgtat catatgccaa gtacgccccc tattgacgtc aatgacggta
600aatggcccgc ctggcattat gcccagtaca tgaccttatg ggactttcct acttggcagt
660acatctacgt attagtcatc gctattacca tggtgatgcg gttttggcag tacatcaatg
720ggcgtggata gcggtttgac tcacggggat ttccaagtct ccaccccatt gacgtcaatg
780ggagtttgtt ttgcaccaaa atcaacggga ctttccaaaa tgtcgtaaca actccgcccc
840attgacgcaa atgggcggta ggcgtgtacg gtgggaggtc tatataagca gagctcgttt
900agtgaaccgt cagatcgcct ggagacgcca tccacgctgt tttgacctcc atagaagaca
960ccgggaccga tccagcctcc gcggattcga atcccggccg ggaacggtgc attggaacgc
1020ggattccccg tgccaagagt gacgtaagta ccgcctatag agtctatagg cccacaaaaa
1080atgctttctt cttttaatat acttttttgt ttatcttatt tctaatactt tccctaatct
1140ctttctttca gggcaataat gatacaatgt atcatgcctc tttgcaccat tctaaagaat
1200aacagtgata atttctgggt taaggcaata gcaatatttc tgcatataaa tatttctgca
1260tataaattgt aactgatgta agaggtttca tattgctaat agcagctaca atccagctac
1320cattctgctt ttattttatg gttgggataa ggctggatta ttctgagtcc aagctaggcc
1380cttttgctaa tcatgttcat acctcttatc ttcctcccac agctcctggg caacgtgctg
1440gtctgtgtgc tggcccatca ctttggcaaa gaattgggat tcgaacatcg gccgccacca
1500tgaacgccag cgagttcagg aggaggggca aggagatggt ggactacgtg gccaactaca
1560tggagggcat cgagggcagg caggtgtacc ccgacgtgga gcccggctac ctgaggcccc
1620tgatccccgc cgccgccccc caggagcccg acaccttcga ggacatcatc aacgacgtgg
1680agaagatcat catgcccggc gtgacccact ggcacagccc ctacttcttc gcctacttcc
1740ccaccgccag cagctacccc gccatgctgg ccgacatgct gtgcggcgcc atcggctgca
1800tcggcttcag ctgggccgcc agccccgcct gcaccgagct ggagaccgtg atgatggact
1860ggctgggcaa gatgctggag ctgcccaagg ccttcctgaa cgagaaggcc ggcgagggcg
1920gcggcgtgat ccagggcagc gccagcgagg ccaccctggt ggccctgctg gccgccagga
1980ccaaggtgat ccacaggctg caggccgcca gccccgagct gacccaggcc gccatcatgg
2040agaagctggt ggcctacagc agcgaccagg cccacagcag cgtggagagg gccggcctga
2100tcggcggcgt gaagctgaag gccatcccca gcgacggcaa cttcgccatg agggccagcg
2160ccctgcagga ggccctggag agggacaagg ccgccggcct gatccccttc ttcatggtgg
2220ccaccctggg caccaccacc tgctgcagct tcgacaacct gctggaggtg ggccccatct
2280gcaacaagga ggacatctgg ctgcacgtgg acgccgccta cgccggcagc gccttcatct
2340gccccgagtt caggcacctg ctgaacggcg tggagttcgc cgacagcttc aacttcaacc
2400cccacaagtg gctgctggtg aacttcgact gcagcgccat gtgggtgaag aagaggaccg
2460acctgaccgg cgccttcagg ctggacccca cctacctgaa gcacagccac caggacagcg
2520gcctgatcac cgactacagg cactggcaga tccccctggg caggaggttc aggagcctga
2580agatgtggtt cgtgttcagg atgtacggcg tgaagggcct gcaggcctac atcaggaagc
2640acgtgcagct gagccacgag ttcgagagcc tggtgaggca ggaccccagg ttcgagatct
2700gcgtggaggt gatcctgggc ctggtgtgct tcaggctgaa gggcagcaac aaggtgaacg
2760aggccctgct gcagaggatc aacagcgcca agaagatcca cctggtgccc tgccacctga
2820gggacaagtt cgtgctgagg ttcgccatct gcagcaggac cgtggagagc gcccacgtgc
2880agagggcctg ggagcacatc aaggagctgg ccgccgacgt gctgagggcc gagagggagt
2940gagctgctcg agagatctac gggtggcatc cctgtgaccc ctccccagtg cctctcctgg
3000ccctggaagt tgccactcca gtgcccacca gccttgtcct aataaaatta agttgcatca
3060ttttgtctga ctaggtgtcc ttctataata ttatggggtg gaggggggtg gtatggagca
3120aggggcaagt tgggaagaca acctgtaggg cctgcggggt ctattgggaa ccaagctgga
3180gtgcagtggc acaatcttgg ctcactgcaa tctccgcctc ctgggttcaa gcgattctcc
3240tgcctcagcc tcccgagttg ttgggattcc aggcatgcat gaccaggctc agctaatttt
3300tgtttttttg gtagagacgg ggtttcacca tattggccag gctggtctcc aactcctaat
3360ctcaggtgat ctacccacct tggcctccca aattgctggg attacaggcg tgaaccactg
3420ctcccttccc tgtccttctg attttgtagg taaccacgtg cggaccgagc ggccgcagtt
3480aattaagctc gcgaaggaac ccctagtgat ggagttggcc actccctctc tgcgcgctcg
3540ctcgctcact gaggccgggc gaccaaaggt cgcccgacgc ccgggctttg cccgggcggc
3600ctcagtgagc gagcgagcgc gcagagaggg agtggccaag acgatttaaa tggtaccgag
3660ctcgaattca ctggccgtcg ttttacaacg tcgtgactgg gaaaaccctg gcgttaccca
3720acttaatcgc cttgcagcac atcccccttt cgccagctgg cgtaatagcg aagaggcccg
3780caccgatcgc ccttcccaac agttgcgcag cctgaatggc gaatggcgcc tgatgcggta
3840ttttctcctt acgcatctgt gcggtatttc acaccgcata tggtgcactc tcagtacaat
3900ctgctctgat gccgcatagt taagccagcc ccgacacccg ccaacacccg ctgacgcgcc
3960ctgacgggct tgtctgctcc cggcatccgc ttacagacaa gctgtgaccg tctccgggag
4020ctgcatgtgt cagaggtttt caccgtcatc accgaaacgc gcgatgcagc tctggcccgt
4080gtctcaaaat ctctgatgtt acattgcaca agataaaaat atatcatcat gaacaataaa
4140actgtctgct tacataaaca gtaatacaag gggtgttgaa gatcctttga tcttttctac
4200ggggtctgac gctcagtgga acgaaaactc acgttaaggg attttggtca tgagattatc
4260aaaaaggatc ttcacctaga tccttttaaa ttaaaaatga agttttaaat caagcccaat
4320ctgaataatg ttacaaccaa ttaaccaatt ctgattagaa aaactcatcg agcatcaaat
4380gaaactgcaa tttattcata tcaggattat caataccata tttttgaaaa agccgtttct
4440gtaatgaagg agaaaactca ccgaggcagt tccataggat ggcaagatcc tggtatcggt
4500ctgcgattcc gactcgtcca acatcaatac aacctattaa tttcccctcg tcaaaaataa
4560ggttatcaag tgagaaatca ccatgagtga cgactgaatc cggtgagaat ggcaaaagtt
4620tatgcatttc tttccagact tgttcaacag gccagccatt acgctcgtca tcaaaatcac
4680tcgcatcaac caaaccgtta ttcattcgtg attgcgcctg agcgagacga aatacgcgat
4740cgctgttaaa aggacaatta caaacaggaa tcgaatgcaa ccggcgcagg aacactgcca
4800gcgcatcaac aatattttca cctgaatcag gatattcttc taatacctgg aatgctgttt
4860ttccggggat cgcagtggtg agtaaccatg catcatcagg agtacggata aaatgcttga
4920tggtcggaag aggcataaat tccgtcagcc agtttagtct gaccatctca tctgtaacat
4980cattggcaac gctacctttg ccatgtttca gaaacaactc tggcgcatcg ggcttcccat
5040acaagcgata gattgtcgca cctgattgcc cgacattatc gcgagcccat ttatacccat
5100ataaatcagc atccatgttg gaatttaatc gcggcctcga cgtttcccgt tgaatatggc
5160tcataacacc ccttgtatta ctgtttatgt aagcagacag ttttattgtt catgatgata
5220tatttttatc ttgtgcaatg taacatcaga gattttgaga cacgggccag agctgcatcg
5280cgcgttttca gaattggtta attggttgta acattattca gattgggctt gatttaaaac
5340ttcattttta atttaaaagg atctaggtga agatcctttt tgataatctc atgaccaaaa
5400tcccttaacg tgagttttcg ttccactgag cgtcagaccc cgtagaaaag atcaaaggat
5460cttctttcca taggctccgc ccccctgacg agcatcacaa aaatcgacgc tcaagtcaga
5520ggtggcgaaa cccgacagga ctataaagat accaggcgtt tccccctgga agctccctcg
5580tgcgctctcc tgttccgacc ctgccgctta ccggatacct gtccgccttt ctcccttcgg
5640gaagcgtggc gctttctcat agctcacgct gtaggtatct cagttcggtg taggtcgttc
5700gctccaagct gggctgtgtg cacgaacccc ccgttcagcc cgaccgctgc gccttatccg
5760gtaactatcg tcttgagtcc aacccggtaa gacacgactt atcgccactg gcagcagcca
5820ctggtaacag gattagcaga gcgaggtatg taggcggtgc tacagagttc ttgaagtggt
5880ggcctaacta cggctacact agaagaacag tatttggtat ctgcgctctg ctgaagccag
5940ttaccttcgg aaaaagagtt ggtagctctt gatccggcaa acaaaccacc gctggtagcg
6000gtggtttttt tgtttgcaag cagcagatta cgcgcagaaa aaaaggatct caaaacgcca
6060gcaacgcggc ctttttacgg ttcctggcct tttgctggcc ttttgctcac atgttctttc
6120ctgcgttatc ccctgattct gtggataacc gtattaccgc ctttgagtga gctgataccg
6180ctcgccgcag ccgaacgacc gagcgcagcg agtcagtgag cgaggaagcg gaagagcgcc
6240caatacgcaa accgcctctc
6260136442DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 13cccgcgcgtt ggccgattca ttaatgcagc
tggcacgaca ggtttcccga ctggaaagcg 60ggcagtgagc gcaacgcaat tttcacacag
gaaacagcta tgaccatgat tacgccaagc 120ttgcatgcat ttaaatgacg cagctgcgcg
ctcgctcgct cactgaggcc gcccgggcaa 180agcccgggcg tcgggcgacc tttggtcgcc
cggcctcagt gagcgagcga gcgcgcagag 240agggagtggc caactccatc actaggggtt
gagtttaaac ttcgtcgacg atctgcggcc 300gcacgcgtgg agctagttat taatagtaat
caattacggg gtcattagtt catagcccat 360atatggagtt ccgcgttaca taacttacgg
taaatggccc gcctggctga ccgcccaacg 420acccccgccc attgacgtca ataatgacgt
atgttcccat agtaacgtca atagggactt 480tccattgacg tcaatgggtg gagtatttac
ggtaaactgc ccacttggca gtacatcaag 540tgtatcatat gccaagtacg ccccctattg
acgtcaatga cggtaaatgg cccgcctggc 600attatgccca gtacatgacc ttatgggact
ttcctacttg gcagtacatc tacgtattag 660tcatcgctat taccatggtg atgcggtttt
ggcagtacat caatgggcgt ggatagcggt 720ttgactcacg gggatttcca agtctccacc
ccattgacgt caatgggagt ttgttttgca 780ccaaaatcaa cgggactttc caaaatgtcg
taacaactcc gccccattga cgcaaatggg 840cggtaggcgt gtacggtggg aggtctatat
aagcagagct cgtttagtga accgtcagat 900cgcctggaga cgccatccac gctgttttga
cctccataga agacaccggg accgatccag 960cctccgcgga ttcgaatccc ggccgggaac
ggtgcattgg aacgcggatt ccccgtgcca 1020agagtgacgt aagtaccgcc tatagagtct
ataggcccac aaaaaatgct ttcttctttt 1080aatatacttt tttgtttatc ttatttctaa
tactttccct aatctctttc tttcagggca 1140ataatgatac aatgtatcat gcctctttgc
accattctaa agaataacag tgataatttc 1200tgggttaagg caatagcaat atttctgcat
ataaatattt ctgcatataa attgtaactg 1260atgtaagagg tttcatattg ctaatagcag
ctacaatcca gctaccattc tgcttttatt 1320ttatggttgg gataaggctg gattattctg
agtccaagct aggccctttt gctaatcatg 1380ttcatacctc ttatcttcct cccacagctc
ctgggcaacg tgctggtctg tgtgctggcc 1440catcactttg gcaaagaatt gggattcgaa
catcgaattc gggcacgagg gaggacagag 1500agcaagtcac tcccggctgc ctttttcacc
tctgacagag cccagacacc atgaacgcaa 1560gtgaattccg aaggagaggg aaggagatgg
tggattacgt ggccaactac atggaaggca 1620ttgagggacg ccaggtctac cctgacgtgg
agcccgggta cctgcggccg ctgatccctg 1680ccgctgcccc tcaggagcca gacacgtttg
aggacatcat caacgacgtt gagaagataa 1740tcatgcctgg ggtgacgcac tggcacagcc
cctacttctt cgcctacttc cccactgcca 1800gctcgtaccc ggccatgctt gcggacatgc
tgtgcggggc cattggctgc atcggcttct 1860cctgggcggc aagcccagca tgcacagagc
tggagactgt gatgatggac tggctcggga 1920agatgctgga actaccaaag gcatttttga
atgagaaagc tggagaaggg ggaggagtga 1980tccagggaag tgccagtgaa gccaccctgg
tggccctgct ggccgctcgg accaaagtga 2040tccatcggct gcaggcagcg tccccagagc
tcacacaggc cgctatcatg gagaagctgg 2100tggcttactc atccgatcag gcacactcct
cagtggaaag agctgggtta attggtggag 2160tgaaattaaa agccatcccc tcagatggca
acttcgccat gcgtgcgtct gccctgcagg 2220aagccctgga gagagacaaa gcggctggcc
tgattccttt ctttatggtt gccaccctgg 2280ggaccacaac atgctgctcc tttgacaatc
tcttagaagt cggtcctatc tgcaacaagg 2340aagacatatg gctgcacgtt gatgcagcct
acgcaggcag tgcattcatc tgccctgagt 2400tccggcacct tctgaatgga gtggagtttg
cagattcatt caactttaat ccccacaaat 2460ggctattggt gaattttgac tgttctgcca
tgtgggtgaa aaagagaaca gacttaacgg 2520gagcctttag actggacccc acttacctga
agcacagcca tcaggattca gggcttatca 2580ctgactaccg gcattggcag ataccactgg
gcagaagatt tcgctctttg aaaatgtggt 2640ttgtatttag gatgtatgga gtcaaaggac
tgcaggctta tatccgcaag catgtccagc 2700tgtcccatga gtttgagtca ctggtgcgcc
aggatccccg ctttgaaatc tgtgtggaag 2760tcattctggg gcttgtctgc tttcggctaa
agggttccaa caaagtgaat gaagctcttc 2820tgcaaagaat aaacagtgcc aaaaaaatcc
acttggttcc atgtcacctc agggacaagt 2880ttgtcctgcg ctttgccatc tgttctcgca
cggtggaatc tgcccatgtg cagcgggcct 2940gggaacacat caaagagctg gcggccgacg
tgctgcgagc agagagggag taggagtgaa 3000gccagctgca ggaatcaaaa attgaagaga
gatatatctg aaaactggaa taagaagcaa 3060ataaatatca tcctgccttc atggaactca
gctgtctgtg gcttcccatg tctttctcca 3120aagttatcca gagggttgtg attttgtctg
cttagtatct catcaacaaa gaaatattat 3180ttgctaatta aaaagttaat cttcatggcc
atagctttta ttcattagct gtgatttttg 3240ttgattaaaa cattatagat tttcatgttc
ttgcagtcat cagaagtggt aggaaagcct 3300cactgatata ttttccaggg caatcaatgt
tcacgcaact tgaaattata tctgtggtct 3360tcaaattgtc ttttgtcatg tggctaaatg
cctaataaac aattcaagtg aaatactaaa 3420aaaaaaaaaa aaaaaaaaag ctgctcgaga
gatctacggg tggcatccct gtgacccctc 3480cccagtgcct ctcctggccc tggaagttgc
cactccagtg cccaccagcc ttgtcctaat 3540aaaattaagt tgcatcattt tgtctgacta
ggtgtccttc tataatatta tggggtggag 3600gggggtggta tggagcaagg ggcaagttgg
gaagacaacc tgtagggcct gcggggtcta 3660ttgggaacca agctggagtg cagtggcaca
atcttggctc actgcaatct ccgcctcctg 3720ggttcaagcg attctcctgc ctcagcctcc
cgagttgttg ggattccagg catgcatgac 3780caggctcagc taatttttgt ttttttggta
gagacggggt ttcaccatat tggccaggct 3840ggtctccaac tcctaatctc aggtgatcta
cccaccttgg cctcccaaat tgctgggatt 3900acaggcgtga accactgctc ccttccctgt
ccttctgatt ttgtaggtaa ccacgtgcgg 3960accgagcggc cgcagttaat taagctcgcg
aaacccctag tgatggagtt ggccactccc 4020tctctgcgcg ctcgctcgct cactgaggcc
gggcgaccaa aggtcgcccg acgcccgggc 4080tttgcccggg cggcctcagt gagcgagcga
gcgcgcagct ggacgattta aatggtaccg 4140agctcgaatt cactggccgt cgttttacaa
cgtcgtgact gggaaaaccc tggcgttacc 4200caacttaatc gccttgcagc acatccccct
ttcgccagct ggcgtaatag cgaagaggcc 4260cgcaccgatc gcccttccca acagttgcgc
agcctgaatg gcgaatggcg cctgatgcgg 4320tattttctcc ttacgcatct gtgcggtatt
tcacaccgca tatggtgcac tctcagtaca 4380atctgctctg atgccgcata gttaagccag
ccccgacacc cgccaacacc cgctgacgcg 4440ccctgacggg cttgtctgct cccggcatcc
gcttacagac aagctgtgac cgtctccggg 4500agctgcatgt gtcagaggtt ttcaccgtca
tcaccgaaac gcgcgatgca gctctggccc 4560gtgtctcaaa atctctgatg ttacattgca
caagataaaa atatatcatc atgaacaata 4620aaactgtctg cttacataaa cagtaataca
aggggtgtta tgagccatat tcaacgggaa 4680acgtcgaggc cgcgattaaa ttccaacatg
gatgctgatt tatatgggta taaatgggct 4740cgcgataatg tcgggcaatc aggtgcgaca
atctatcgct tgtatgggaa gcccgatgcg 4800ccagagttgt ttctgaaaca tggcaaaggt
agcgttgcca atgatgttac agatgagatg 4860gtcagactaa actggctgac ggaatttatg
cctcttccga ccatcaagca ttttatccgt 4920actcctgatg atgcatggtt actcaccact
gcgatccccg gaaaaacagc attccaggta 4980ttagaagaat atcctgattc aggtgaaaat
attgttgatg cgctggcagt gttcctgcgc 5040cggttgcatt cgattcctgt ttgtaattgt
ccttttaaca gcgatcgcgt atttcgtctc 5100gctcaggcgc aatcacgaat gaataacggt
ttggttgatg cgagtgattt tgatgacgag 5160cgtaatggct ggcctgttga acaagtctgg
aaagaaatgc ataaactttt gccattctca 5220ccggattcag tcgtcactca tggtgatttc
tcacttgata accttatttt tgacgagggg 5280aaattaatag gttgtattga tgttggacga
gtcggaatcg cagaccgata ccaggatctt 5340gccatcctat ggaactgcct cggtgagttt
tctccttcat tacagaaacg gctttttcaa 5400aaatatggta ttgataatcc tgatatgaat
aaattgcagt ttcatttgat gctcgatgag 5460tttttctaat cagaattggt taattggttg
taacattatt cagattgggc ttgatttaaa 5520acttcatttt taatttaaaa ggatctaggt
gaagatcctt tttgataatc tcatgaccaa 5580aatcccttaa cgtgagtttt cgttccactg
agcgtcagac cccgtagaaa agatcaaagg 5640atcttcttga gatccttttt ttctgcgcgt
aatctgctgc ttgcaaacaa aaaaaccacc 5700gctaccagcg gtggtttgtt tgccggatca
agagctacca actctttttc cgaaggtaac 5760tggcttcagc agagcgcaga taccaaatac
tgttcttcta gtgtagccgt agttaggcca 5820ccacttcaag aactctgtag caccgcctac
atacctcgct ctgctaatcc tgttaccagt 5880ggctgctgcc agtggcgata agtcgtgtct
taccgggttg gactcaagac gatagttacc 5940ggataaggcg cagcggtcgg gctgaacggg
gggttcgtgc acacagccca gcttggagcg 6000aacgacctac accgaactga gatacctaca
gcgtgagcta tgagaaagcg ccacgcttcc 6060cgaagggaga aaggcggaca ggtatccggt
aagcggcagg gtcggaacag gagagcgcac 6120gagggagctt ccagggggaa acgcctggta
tctttatagt cctgtcgggt ttcgccacct 6180ctgacttgag cgtcgatttt tgtgatgctc
gtcagggggg cggagcctat ggaaaaacgc 6240cagcaacgcg gcctttttac ggttcctggc
cttttgctgg ccttttgctc acatgttctt 6300tcctgcgtta tcccctgatt ctgtggataa
ccgtattacc gcctttgagt gagctgatac 6360cgctcgccgc agccgaacga ccgagcgcag
cgagtcagtg agcgaggaag cggaagagcg 6420cccaatacgc aaaccgcctc tc
6442149260DNAArtificial
SequenceDescription of Artificial Sequence Synthetic polynucleotide
14cccgcgcgtt ggccgattca ttaatgcagc tggcacgaca ggtttcccga ctggaaagcg
60ggcagtgagc gcaacgcaat tttcacacag gaaacagcta tgaccatgat tacgccaagc
120ttgcatgcat ttaaatgacg ttggccactc cctctctgcg cgctcgctcg ctcactgagg
180ccgggcgacc aaaggtcgcc cgacgcccgg gctttgcccg ggcggcctca gtgagcgagc
240gagcgcgcag agagggagtg gccaactcca tcactagggg ttcctgagtt taaacttcgt
300cgacgatctg cggccgcacg cgtggagcta gttattaata gtaatcaatt acggggtcat
360tagttcatag cccatatatg gagttccgcg ttacataact tacggtaaat ggcccgcctg
420gctgaccgcc caacgacccc cgcccattga cgtcaataat gacgtatgtt cccatagtaa
480cgtcaatagg gactttccat tgacgtcaat gggtggagta tttacggtaa actgcccact
540tggcagtaca tcaagtgtat catatgccaa gtacgccccc tattgacgtc aatgacggta
600aatggcccgc ctggcattat gcccagtaca tgaccttatg ggactttcct acttggcagt
660acatctacgt attagtcatc gctattacca tggtgatgcg gttttggcag tacatcaatg
720ggcgtggata gcggtttgac tcacggggat ttccaagtct ccaccccatt gacgtcaatg
780ggagtttgtt ttgcaccaaa atcaacggga ctttccaaaa tgtcgtaaca actccgcccc
840attgacgcaa atgggcggta ggcgtgtacg gtgggaggtc tatataagca gagctcgttt
900agtgaaccgt cagatcgcct ggagacgcca tccacgctgt tttgacctcc atagaagaca
960ccgggaccga tccagcctcc gcggattcga atcccggccg ggaacggtgc attggaacgc
1020ggattccccg tgccaagagt gacgtaagta ccgcctatag agtctatagg cccacaaaaa
1080atgctttctt cttttaatat acttttttgt ttatcttatt tctaatactt tccctaatct
1140ctttctttca gggcaataat gatacaatgt atcatgcctc tttgcaccat tctaaagaat
1200aacagtgata atttctgggt taaggcaata gcaatatttc tgcatataaa tatttctgca
1260tataaattgt aactgatgta agaggtttca tattgctaat agcagctaca atccagctac
1320cattctgctt ttattttatg gttgggataa ggctggatta ttctgagtcc aagctaggcc
1380cttttgctaa tcatgttcat acctcttatc ttcctcccac agctcctggg caacgtgctg
1440gtctgtgtgc tggcccatca ctttggcaaa gaattgggat tcgaacatcg gccgccacca
1500tgaacgccag cgagttcagg aggaggggca aggagatggt ggactacgtg gccaactaca
1560tggagggcat cgagggcagg caggtgtacc ccgacgtgga gcccggctac ctgaggcccc
1620tgatccccgc cgccgccccc caggagcccg acaccttcga ggacatcatc aacgacgtgg
1680agaagatcat catgcccggc gtgacccact ggcacagccc ctacttcttc gcctacttcc
1740ccaccgccag cagctacccc gccatgctgg ccgacatgct gtgcggcgcc atcggctgca
1800tcggcttcag ctgggccgcc agccccgcct gcaccgagct ggagaccgtg atgatggact
1860ggctgggcaa gatgctggag ctgcccaagg ccttcctgaa cgagaaggcc ggcgagggcg
1920gcggcgtgat ccagggcagc gccagcgagg ccaccctggt ggccctgctg gccgccagga
1980ccaaggtgat ccacaggctg caggccgcca gccccgagct gacccaggcc gccatcatgg
2040agaagctggt ggcctacagc agcgaccagg cccacagcag cgtggagagg gccggcctga
2100tcggcggcgt gaagctgaag gccatcccca gcgacggcaa cttcgccatg agggccagcg
2160ccctgcagga ggccctggag agggacaagg ccgccggcct gatccccttc ttcatggtgg
2220ccaccctggg caccaccacc tgctgcagct tcgacaacct gctggaggtg ggccccatct
2280gcaacaagga ggacatctgg ctgcacgtgg acgccgccta cgccggcagc gccttcatct
2340gccccgagtt caggcacctg ctgaacggcg tggagttcgc cgacagcttc aacttcaacc
2400cccacaagtg gctgctggtg aacttcgact gcagcgccat gtgggtgaag aagaggaccg
2460acctgaccgg cgccttcagg ctggacccca cctacctgaa gcacagccac caggacagcg
2520gcctgatcac cgactacagg cactggcaga tccccctggg caggaggttc aggagcctga
2580agatgtggtt cgtgttcagg atgtacggcg tgaagggcct gcaggcctac atcaggaagc
2640acgtgcagct gagccacgag ttcgagagcc tggtgaggca ggaccccagg ttcgagatct
2700gcgtggaggt gatcctgggc ctggtgtgct tcaggctgaa gggcagcaac aaggtgaacg
2760aggccctgct gcagaggatc aacagcgcca agaagatcca cctggtgccc tgccacctga
2820gggacaagtt cgtgctgagg ttcgccatct gcagcaggac cgtggagagc gcccacgtgc
2880agagggcctg ggagcacatc aaggagctgg ccgccgacgt gctgagggcc gagagggagt
2940gagctgctcg agagatctac gggtggcatc cctgtgaccc ctccccagtg cctctcctgg
3000ccctggaagt tgccactcca gtgcccacca gccttgtcct aataaaatta agttgcatca
3060ttttgtctga ctaggtgtcc ttctataata ttatggggtg gaggggggtg gtatggagca
3120aggggcaagt tgggaagaca acctgtaggg cctgcggggt ctattgggaa ccaagctgga
3180gtgcagtggc acaatcttgg ctcactgcaa tctccgcctc ctgggttcaa gcgattctcc
3240tgcctcagcc tcccgagttg ttgggattcc aggcatgcat gaccaggctc agctaatttt
3300tgtttttttg gtagagacgg ggtttcacca tattggccag gctggtctcc aactcctaat
3360ctcaggtgat ctacccacct tggcctccca aattgctggg attacaggcg tgaaccactg
3420ctcccttccc tgtccttctg attttgtagg taaccacgtg cggaccgagc ggccgcagtt
3480aattaagctc gcgaaggaac ccctagtgat ggagttggcc actccctctc tgcgcgctcg
3540ctcgctcact gaggccgggc gaccaaaggt cgcccgacgc ccgggctttg cccgggcggc
3600ctcagtgagc gagcgagcgc gcagagaggg agtggccaag acgatttaaa tggtaccgag
3660ctcgaattca ctggccgtcg ttttacaacg tcgtgactgg gaaaaccctg gcgttaccca
3720acttaatcgc cttgcagcac atcccccttt cgccagctgg cgtaatagcg aagaggcccg
3780caccgatcgc ccttcccaac agttgcgcag cctgaatggc gaatggcgcc tgatgcggta
3840ttttctcctt acgcatctgt gcggtatttc acaccgcata tggtgcactc tcagtacaat
3900ctgctctgat gccgcatagt taagccagcc ccgacacccg ccaacacccg ctgacgcgcc
3960ctgacgggct tgtctgctcc cggcatccgc ttacagacaa gctgtgaccg tctcagaacc
4020caaatgtgac caaccgttta catatatctt ggtttattat ttcaatttct cttttcaaac
4080atcttcttct gtcgttgtgc aattttccaa atgccaattt ggtcgcttgg ctatttccaa
4140acgatttcat atattcaagt tggagatata gacagtcccc tgaacacctc gcatcctctg
4200ctttttatgc ctgctcgtcc tgtgggtata attttaatgg tcaaatcgct gctggggaat
4260tgtatacgct gctcttgtgt ctcactgcct cccttgtaga aatggaaatt gcttttccat
4320tatttccatg tgattttgtt ggttttgcca tcgaattggc attgaaaacg cataaaaata
4380agcatttcgc atttgcaaag atccaaaaga tttatttgca cgctgagcct ggggatacac
4440gaaatgtatt tgtaagattc ttcagatgag tttggaacgc acggaaatta ccgtcttggg
4500atttgttgga catcgcattt aagcatgatg tatcatttaa ttttttccaa tttaaaaaca
4560aataatcagt gctacgatta agactggatc tattatagac ttcttcaaag tttttcagtt
4620ttctttaaaa ttacctccat aaaactcttt taatattttg aaaatcatct ccaggttaca
4680tttaatctga ttaagtttag agtcagttag tttcccacag ttttcttctt gaaataaacc
4740cattaagtaa ccccaactga tcggcgcaaa tgattcagct atgcagaaaa tatgattgat
4800gatttttccc tcccaccagc ccttaacact tgcttaaccc ttttgtgtgg ccattatagc
4860cctttcctcg tagtctgctt aaagttcatt aataagtttt gcgtgagcca aaaatggcgc
4920cgctttggaa tcgtgacagc gtggaaactc tggactttgg ggttgcaaaa cttcggaagc
4980tgaaagcatt ttgctgtagc catcgcattt tgggggaaga aatccgaatt cgagtccaaa
5040ccgaattcta atagaagttt tgcagcaaag tgcctcagac aggttaatga ccaaaagcag
5100ttttgcattc aaatgctgca gcaaccctcg cacgagggtt gtcatgacgg acgaaaatct
5160aatttacaac atgcaactgc cactttgagg ggtgactttt acccaagacg tggctgtgaa
5220ggaaattctg cgagaaagag attaattacg ctctgggggc agttaatgaa tgcttgcgcg
5280gggcgataag gggttaacgt ttggccagct caaattaccg aatgtataac attttgatga
5340gcatgacaaa aattggaatt ttcaactctt ttttcctgcg aaaagcataa cttttccatt
5400aacacaatgg cgacgatgag ccggcaaatc gacgatacca aatcggcata acgtgcatga
5460aaattataca tgattgattt catattaatt tctacgaatg ttatgaatcg gctaaaagat
5520gagaatggaa atattgcacg attttgattt tgtcatgatg acaaaaaagg gttgtaagat
5580ttgtacatgc caaaatcata aacttttaac agaaatcaaa cacaaagaag taatataaca
5640ttaaagtaca caggccttgt cacagagata gaaaaatgta gctattatta aaatatttaa
5700cattctcttg gtgtctgcaa cttttctatc agtcgctttt ttattccctt tccaacactt
5760atttaaaatg aaatgcactc gaaattaact aatttaatgg ctcatatcct ttgtgctgct
5820taaaaaggca ggaaacgttt tttgtgccct acacctcctc cattcaaatg aaaaaggcgg
5880tggagtcgag gaaaatgtct gccctggagc ttgacaagcc aagatatggc ccatcaaaaa
5940tgttcgaatg ttctttttaa ataaatgtct cattatatgg ctgccacgcc cacaccgctc
6000aacgcccaca cacgtgccgc cttccggttt agttgggtgg tacctgaccg tagatttttc
6060actgcggaca tgtgtccaat cagtggcaac gtgcaacgaa ccgtggcaaa cacagggaaa
6120gaacctcgaa gacccacagc aaactcatcc tctcgaattt gacactatga taatgcttat
6180attcaatttt ttgcaacatt ctatttacac taaactgaga aacaggacaa agttgagaat
6240gggtgctgtg attatttgtc ttgtgccaat atatgccctc ctgcatataa aatacgagat
6300acaaaaccaa acgaaataag aacgaacaag aaatcagttt aatttcaatg ctgatcaaac
6360caagttgaca actctgttgt atattagctc taataatgac ttaaggttcg aaatttaagt
6420aacttccaaa atgggccaga taaatactgc taatatcgaa tgcaattcaa tgaggaaata
6480gtaatcaatc agccaaccct aatgaaatta ataatgtaat ttaaaacttt attccaccca
6540ttctaataat gaaaatcatt aaatatatgt agcaatccaa ttttgttaat acatattgta
6600tatccctgat ttgtcaatac caaagaccag aaaaaacacc atgccaaatt ccttttattc
6660gttgaaaatc gaaacaactt tgaagtatta acctgctggc taaaaaatat gtgtattact
6720aaatatacca tgtaatcaaa agttcgaaat aaacgtgaaa tggcagctcc actcgtcagc
6780cgtgccactt ttcgactaat caaaatgcct tttgaatgcc tgagttgaat caagttggct
6840taatagttat tatcccacgc aagcaaagtc aatggcagag ggaaatgcgt agaaattagc
6900acagacttga atggacgcac gagtgtcgaa tggcaggaga gtgggaaatg aacggggagt
6960tttccaggat aaggatgttt tcgaagtatc gtaatcattt atagcctcca gatacgggag
7020ctgcatgtgt cagaggtttt caccgtcatc accgaaacgc gcgatgcagc tctggcccgt
7080gtctcaaaat ctctgatgtt acattgcaca agataaaaat atatcatcat gaacaataaa
7140actgtctgct tacataaaca gtaatacaag gggtgttgaa gatcctttga tcttttctac
7200ggggtctgac gctcagtgga acgaaaactc acgttaaggg attttggtca tgagattatc
7260aaaaaggatc ttcacctaga tccttttaaa ttaaaaatga agttttaaat caagcccaat
7320ctgaataatg ttacaaccaa ttaaccaatt ctgattagaa aaactcatcg agcatcaaat
7380gaaactgcaa tttattcata tcaggattat caataccata tttttgaaaa agccgtttct
7440gtaatgaagg agaaaactca ccgaggcagt tccataggat ggcaagatcc tggtatcggt
7500ctgcgattcc gactcgtcca acatcaatac aacctattaa tttcccctcg tcaaaaataa
7560ggttatcaag tgagaaatca ccatgagtga cgactgaatc cggtgagaat ggcaaaagtt
7620tatgcatttc tttccagact tgttcaacag gccagccatt acgctcgtca tcaaaatcac
7680tcgcatcaac caaaccgtta ttcattcgtg attgcgcctg agcgagacga aatacgcgat
7740cgctgttaaa aggacaatta caaacaggaa tcgaatgcaa ccggcgcagg aacactgcca
7800gcgcatcaac aatattttca cctgaatcag gatattcttc taatacctgg aatgctgttt
7860ttccggggat cgcagtggtg agtaaccatg catcatcagg agtacggata aaatgcttga
7920tggtcggaag aggcataaat tccgtcagcc agtttagtct gaccatctca tctgtaacat
7980cattggcaac gctacctttg ccatgtttca gaaacaactc tggcgcatcg ggcttcccat
8040acaagcgata gattgtcgca cctgattgcc cgacattatc gcgagcccat ttatacccat
8100ataaatcagc atccatgttg gaatttaatc gcggcctcga cgtttcccgt tgaatatggc
8160tcataacacc ccttgtatta ctgtttatgt aagcagacag ttttattgtt catgatgata
8220tatttttatc ttgtgcaatg taacatcaga gattttgaga cacgggccag agctgcatcg
8280cgcgttttca gaattggtta attggttgta acattattca gattgggctt gatttaaaac
8340ttcattttta atttaaaagg atctaggtga agatcctttt tgataatctc atgaccaaaa
8400tcccttaacg tgagttttcg ttccactgag cgtcagaccc cgtagaaaag atcaaaggat
8460cttctttcca taggctccgc ccccctgacg agcatcacaa aaatcgacgc tcaagtcaga
8520ggtggcgaaa cccgacagga ctataaagat accaggcgtt tccccctgga agctccctcg
8580tgcgctctcc tgttccgacc ctgccgctta ccggatacct gtccgccttt ctcccttcgg
8640gaagcgtggc gctttctcat agctcacgct gtaggtatct cagttcggtg taggtcgttc
8700gctccaagct gggctgtgtg cacgaacccc ccgttcagcc cgaccgctgc gccttatccg
8760gtaactatcg tcttgagtcc aacccggtaa gacacgactt atcgccactg gcagcagcca
8820ctggtaacag gattagcaga gcgaggtatg taggcggtgc tacagagttc ttgaagtggt
8880ggcctaacta cggctacact agaagaacag tatttggtat ctgcgctctg ctgaagccag
8940ttaccttcgg aaaaagagtt ggtagctctt gatccggcaa acaaaccacc gctggtagcg
9000gtggtttttt tgtttgcaag cagcagatta cgcgcagaaa aaaaggatct caaaacgcca
9060gcaacgcggc ctttttacgg ttcctggcct tttgctggcc ttttgctcac atgttctttc
9120ctgcgttatc ccctgattct gtggataacc gtattaccgc ctttgagtga gctgataccg
9180ctcgccgcag ccgaacgacc gagcgcagcg agtcagtgag cgaggaagcg gaagagcgcc
9240caatacgcaa accgcctctc
9260159665DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 15cccgcgcgtt ggccgattca ttaatgcagc
tggcacgaca ggtttcccga ctggaaagcg 60ggcagtgagc gcaacgcaat tttcacacag
gaaacagcta tgaccatgat tacgccaagc 120ttgcatgcat ttaaatgacg ttggccactc
cctctctgcg cgctcgctcg ctcactgagg 180ccgggcgacc aaaggtcgcc cgacgcccgg
gctttgcccg ggcggcctca gtgagcgagc 240gagcgcgcag agagggagtg gccaactcca
tcactagggg ttcctgagtt taaacttcgt 300cgacgatctg cggccgcacg cgtggagcta
gttattaata gtaatcaatt acggggtcat 360tagttcatag cccatatatg gagttccgcg
ttacataact tacggtaaat ggcccgcctg 420gctgaccgcc caacgacccc cgcccattga
cgtcaataat gacgtatgtt cccatagtaa 480cgtcaatagg gactttccat tgacgtcaat
gggtggagta tttacggtaa actgcccact 540tggcagtaca tcaagtgtat catatgccaa
gtacgccccc tattgacgtc aatgacggta 600aatggcccgc ctggcattat gcccagtaca
tgaccttatg ggactttcct acttggcagt 660acatctacgt attagtcatc gctattacca
tggtgatgcg gttttggcag tacatcaatg 720ggcgtggata gcggtttgac tcacggggat
ttccaagtct ccaccccatt gacgtcaatg 780ggagtttgtt ttgcaccaaa atcaacggga
ctttccaaaa tgtcgtaaca actccgcccc 840attgacgcaa atgggcggta ggcgtgtacg
gtgggaggtc tatataagca gagctcgttt 900agtgaaccgt cagatcgcct ggagacgcca
tccacgctgt tttgacctcc atagaagaca 960ccgggaccga tccagcctcc gcggattcga
atcccggccg ggaacggtgc attggaacgc 1020ggattccccg tgccaagagt gacgtaagta
ccgcctatag agtctatagg cccacaaaaa 1080atgctttctt cttttaatat acttttttgt
ttatcttatt tctaatactt tccctaatct 1140ctttctttca gggcaataat gatacaatgt
atcatgcctc tttgcaccat tctaaagaat 1200aacagtgata atttctgggt taaggcaata
gcaatatttc tgcatataaa tatttctgca 1260tataaattgt aactgatgta agaggtttca
tattgctaat agcagctaca atccagctac 1320cattctgctt ttattttatg gttgggataa
ggctggatta ttctgagtcc aagctaggcc 1380cttttgctaa tcatgttcat acctcttatc
ttcctcccac agctcctggg caacgtgctg 1440gtctgtgtgc tggcccatca ctttggcaaa
gaattgggat tcgaacatcg gccgccacca 1500tgaacgcaag tgaattccga aggagaggga
aggagatggt ggattacgtg gccaactaca 1560tggaaggcat tgagggacgc caggtctacc
ctgacgtgga gcccgggtac ctgcggccgc 1620tgatccctgc cgctgcccct caggagccag
acacgtttga ggacatcatc aacgacgttg 1680agaagataat catgcctggg gtgacgcact
ggcacagccc ctacttcttc gcctacttcc 1740ccactgccag ctcgtacccg gccatgcttg
cggacatgct gtgcggggcc attggctgca 1800tcggcttctc ctgggcggca agcccagcat
gcacagagct ggagactgtg atgatggact 1860ggctcgggaa gatgctggaa ctaccaaagg
catttttgaa tgagaaagct ggagaagggg 1920gaggagtgat ccagggaagt gccagtgaag
ccaccctggt ggccctgctg gccgctcgga 1980ccaaagtgat ccatcggctg caggcagcgt
ccccagagct cacacaggcc gctatcatgg 2040agaagctggt ggcttactca tccgatcagg
cacactcctc agtggaaaga gctgggttaa 2100ttggtggagt gaaattaaaa gccatcccct
cagatggcaa cttcgccatg cgtgcgtctg 2160ccctgcagga agccctggag agagacaaag
cggctggcct gattcctttc tttatggttg 2220ccaccctggg gaccacaaca tgctgctcct
ttgacaatct cttagaagtc ggtcctatct 2280gcaacaagga agacatatgg ctgcacgttg
atgcagccta cgcaggcagt gcattcatct 2340gccctgagtt ccggcacctt ctgaatggag
tggagtttgc agattcattc aactttaatc 2400cccacaaatg gctattggtg aattttgact
gttctgccat gtgggtgaaa aagagaacag 2460acttaacggg agcctttaga ctggacccca
cttacctgaa gcacagccat caggattcag 2520ggcttatcac tgactaccgg cattggcaga
taccactggg cagaagattt cgctctttga 2580aaatgtggtt tgtatttagg atgtatggag
tcaaaggact gcaggcttat atccgcaagc 2640atgtccagct gtcccatgag tttgagtcac
tggtgcgcca ggatccccgc tttgaaatct 2700gtgtggaagt cattctgggg cttgtctgct
ttcggctaaa gggttccaac aaagtgaatg 2760aagctcttct gcaaagaata aacagtgcca
aaaaaatcca cttggttcca tgtcacctca 2820gggacaagtt tgtcctgcgc tttgccatct
gttctcgcac ggtggaatct gcccatgtgc 2880agcgggcctg ggaacacatc aaagagctgg
cggccgacgt gctgcgagca gagagggagt 2940aggagtgaag ccagctgcag gaatcaaaaa
ttgaagagag atatatctga aaactggaat 3000aagaagcaaa taaatatcat cctgccttca
tggaactcag ctgtctgtgg cttcccatgt 3060ctttctccaa agttatccag agggttgtga
ttttgtctgc ttagtatctc atcaacaaag 3120aaatattatt tgctaattaa aaagttaatc
ttcatggcca tagcttttat tcattagctg 3180tgatttttgt tgattaaaac attatagatt
ttcatgttct tgcagtcatc agaagtggta 3240ggaaagcctc actgatatat tttccagggc
aatcaatgtt cacgcaactt gaaattatat 3300ctgtggtctt caaattgtct tttgtcatgt
ggctaaatgc ctaataagct gctcgagaga 3360tctacgggtg gcatccctgt gacccctccc
cagtgcctct cctggccctg gaagttgcca 3420ctccagtgcc caccagcctt gtcctaataa
aattaagttg catcattttg tctgactagg 3480tgtccttcta taatattatg gggtggaggg
gggtggtatg gagcaagggg caagttggga 3540agacaacctg tagggcctgc ggggtctatt
gggaaccaag ctggagtgca gtggcacaat 3600cttggctcac tgcaatctcc gcctcctggg
ttcaagcgat tctcctgcct cagcctcccg 3660agttgttggg attccaggca tgcatgacca
ggctcagcta atttttgttt ttttggtaga 3720gacggggttt caccatattg gccaggctgg
tctccaactc ctaatctcag gtgatctacc 3780caccttggcc tcccaaattg ctgggattac
aggcgtgaac cactgctccc ttccctgtcc 3840ttctgatttt gtaggtaacc acgtgcggac
cgagcggccg cagttaatta agctcgcgaa 3900ggaaccccta gtgatggagt tggccactcc
ctctctgcgc gctcgctcgc tcactgaggc 3960cgggcgacca aaggtcgccc gacgcccggg
ctttgcccgg gcggcctcag tgagcgagcg 4020agcgcgcaga gagggagtgg ccaagacgat
ttaaatggta ccgagctcga attcactggc 4080cgtcgtttta caacgtcgtg actgggaaaa
ccctggcgtt acccaactta atcgccttgc 4140agcacatccc cctttcgcca gctggcgtaa
tagcgaagag gcccgcaccg atcgcccttc 4200ccaacagttg cgcagcctga atggcgaatg
gcgcctgatg cggtattttc tccttacgca 4260tctgtgcggt atttcacacc gcatatggtg
cactctcagt acaatctgct ctgatgccgc 4320atagttaagc cagccccgac acccgccaac
acccgctgac gcgccctgac gggcttgtct 4380gctcccggca tccgcttaca gacaagctgt
gaccgtctca gaacccaaat gtgaccaacc 4440gtttacatat atcttggttt attatttcaa
tttctctttt caaacatctt cttctgtcgt 4500tgtgcaattt tccaaatgcc aatttggtcg
cttggctatt tccaaacgat ttcatatatt 4560caagttggag atatagacag tcccctgaac
acctcgcatc ctctgctttt tatgcctgct 4620cgtcctgtgg gtataatttt aatggtcaaa
tcgctgctgg ggaattgtat acgctgctct 4680tgtgtctcac tgcctccctt gtagaaatgg
aaattgcttt tccattattt ccatgtgatt 4740ttgttggttt tgccatcgaa ttggcattga
aaacgcataa aaataagcat ttcgcatttg 4800caaagatcca aaagatttat ttgcacgctg
agcctgggga tacacgaaat gtatttgtaa 4860gattcttcag atgagtttgg aacgcacgga
aattaccgtc ttgggatttg ttggacatcg 4920catttaagca tgatgtatca tttaattttt
tccaatttaa aaacaaataa tcagtgctac 4980gattaagact ggatctatta tagacttctt
caaagttttt cagttttctt taaaattacc 5040tccataaaac tcttttaata ttttgaaaat
catctccagg ttacatttaa tctgattaag 5100tttagagtca gttagtttcc cacagttttc
ttcttgaaat aaacccatta agtaacccca 5160actgatcggc gcaaatgatt cagctatgca
gaaaatatga ttgatgattt ttccctccca 5220ccagccctta acacttgctt aacccttttg
tgtggccatt atagcccttt cctcgtagtc 5280tgcttaaagt tcattaataa gttttgcgtg
agccaaaaat ggcgccgctt tggaatcgtg 5340acagcgtgga aactctggac tttggggttg
caaaacttcg gaagctgaaa gcattttgct 5400gtagccatcg cattttgggg gaagaaatcc
gaattcgagt ccaaaccgaa ttctaataga 5460agttttgcag caaagtgcct cagacaggtt
aatgaccaaa agcagttttg cattcaaatg 5520ctgcagcaac cctcgcacga gggttgtcat
gacggacgaa aatctaattt acaacatgca 5580actgccactt tgaggggtga cttttaccca
agacgtggct gtgaaggaaa ttctgcgaga 5640aagagattaa ttacgctctg ggggcagtta
atgaatgctt gcgcggggcg ataaggggtt 5700aacgtttggc cagctcaaat taccgaatgt
ataacatttt gatgagcatg acaaaaattg 5760gaattttcaa ctcttttttc ctgcgaaaag
cataactttt ccattaacac aatggcgacg 5820atgagccggc aaatcgacga taccaaatcg
gcataacgtg catgaaaatt atacatgatt 5880gatttcatat taatttctac gaatgttatg
aatcggctaa aagatgagaa tggaaatatt 5940gcacgatttt gattttgtca tgatgacaaa
aaagggttgt aagatttgta catgccaaaa 6000tcataaactt ttaacagaaa tcaaacacaa
agaagtaata taacattaaa gtacacaggc 6060cttgtcacag agatagaaaa atgtagctat
tattaaaata tttaacattc tcttggtgtc 6120tgcaactttt ctatcagtcg cttttttatt
ccctttccaa cacttattta aaatgaaatg 6180cactcgaaat taactaattt aatggctcat
atcctttgtg ctgcttaaaa aggcaggaaa 6240cgttttttgt gccctacacc tcctccattc
aaatgaaaaa ggcggtggag tcgaggaaaa 6300tgtctgccct ggagcttgac aagccaagat
atggcccatc aaaaatgttc gaatgttctt 6360tttaaataaa tgtctcatta tatggctgcc
acgcccacac cgctcaacgc ccacacacgt 6420gccgccttcc ggtttagttg ggtggtacct
gaccgtagat ttttcactgc ggacatgtgt 6480ccaatcagtg gcaacgtgca acgaaccgtg
gcaaacacag ggaaagaacc tcgaagaccc 6540acagcaaact catcctctcg aatttgacac
tatgataatg cttatattca attttttgca 6600acattctatt tacactaaac tgagaaacag
gacaaagttg agaatgggtg ctgtgattat 6660ttgtcttgtg ccaatatatg ccctcctgca
tataaaatac gagatacaaa accaaacgaa 6720ataagaacga acaagaaatc agtttaattt
caatgctgat caaaccaagt tgacaactct 6780gttgtatatt agctctaata atgacttaag
gttcgaaatt taagtaactt ccaaaatggg 6840ccagataaat actgctaata tcgaatgcaa
ttcaatgagg aaatagtaat caatcagcca 6900accctaatga aattaataat gtaatttaaa
actttattcc acccattcta ataatgaaaa 6960tcattaaata tatgtagcaa tccaattttg
ttaatacata ttgtatatcc ctgatttgtc 7020aataccaaag accagaaaaa acaccatgcc
aaattccttt tattcgttga aaatcgaaac 7080aactttgaag tattaacctg ctggctaaaa
aatatgtgta ttactaaata taccatgtaa 7140tcaaaagttc gaaataaacg tgaaatggca
gctccactcg tcagccgtgc cacttttcga 7200ctaatcaaaa tgccttttga atgcctgagt
tgaatcaagt tggcttaata gttattatcc 7260cacgcaagca aagtcaatgg cagagggaaa
tgcgtagaaa ttagcacaga cttgaatgga 7320cgcacgagtg tcgaatggca ggagagtggg
aaatgaacgg ggagttttcc aggataagga 7380tgttttcgaa gtatcgtaat catttatagc
ctccagatac gggagctgca tgtgtcagag 7440gttttcaccg tcatcaccga aacgcgcgat
gcagctctgg cccgtgtctc aaaatctctg 7500atgttacatt gcacaagata aaaatatatc
atcatgaaca ataaaactgt ctgcttacat 7560aaacagtaat acaaggggtg ttgaagatcc
tttgatcttt tctacggggt ctgacgctca 7620gtggaacgaa aactcacgtt aagggatttt
ggtcatgaga ttatcaaaaa ggatcttcac 7680ctagatcctt ttaaattaaa aatgaagttt
taaatcaagc ccaatctgaa taatgttaca 7740accaattaac caattctgat tagaaaaact
catcgagcat caaatgaaac tgcaatttat 7800tcatatcagg attatcaata ccatattttt
gaaaaagccg tttctgtaat gaaggagaaa 7860actcaccgag gcagttccat aggatggcaa
gatcctggta tcggtctgcg attccgactc 7920gtccaacatc aatacaacct attaatttcc
cctcgtcaaa aataaggtta tcaagtgaga 7980aatcaccatg agtgacgact gaatccggtg
agaatggcaa aagtttatgc atttctttcc 8040agacttgttc aacaggccag ccattacgct
cgtcatcaaa atcactcgca tcaaccaaac 8100cgttattcat tcgtgattgc gcctgagcga
gacgaaatac gcgatcgctg ttaaaaggac 8160aattacaaac aggaatcgaa tgcaaccggc
gcaggaacac tgccagcgca tcaacaatat 8220tttcacctga atcaggatat tcttctaata
cctggaatgc tgtttttccg gggatcgcag 8280tggtgagtaa ccatgcatca tcaggagtac
ggataaaatg cttgatggtc ggaagaggca 8340taaattccgt cagccagttt agtctgacca
tctcatctgt aacatcattg gcaacgctac 8400ctttgccatg tttcagaaac aactctggcg
catcgggctt cccatacaag cgatagattg 8460tcgcacctga ttgcccgaca ttatcgcgag
cccatttata cccatataaa tcagcatcca 8520tgttggaatt taatcgcggc ctcgacgttt
cccgttgaat atggctcata acaccccttg 8580tattactgtt tatgtaagca gacagtttta
ttgttcatga tgatatattt ttatcttgtg 8640caatgtaaca tcagagattt tgagacacgg
gccagagctg catcgcgcgt tttcagaatt 8700ggttaattgg ttgtaacatt attcagattg
ggcttgattt aaaacttcat ttttaattta 8760aaaggatcta ggtgaagatc ctttttgata
atctcatgac caaaatccct taacgtgagt 8820tttcgttcca ctgagcgtca gaccccgtag
aaaagatcaa aggatcttct ttccataggc 8880tccgcccccc tgacgagcat cacaaaaatc
gacgctcaag tcagaggtgg cgaaacccga 8940caggactata aagataccag gcgtttcccc
ctggaagctc cctcgtgcgc tctcctgttc 9000cgaccctgcc gcttaccgga tacctgtccg
cctttctccc ttcgggaagc gtggcgcttt 9060ctcatagctc acgctgtagg tatctcagtt
cggtgtaggt cgttcgctcc aagctgggct 9120gtgtgcacga accccccgtt cagcccgacc
gctgcgcctt atccggtaac tatcgtcttg 9180agtccaaccc ggtaagacac gacttatcgc
cactggcagc agccactggt aacaggatta 9240gcagagcgag gtatgtaggc ggtgctacag
agttcttgaa gtggtggcct aactacggct 9300acactagaag aacagtattt ggtatctgcg
ctctgctgaa gccagttacc ttcggaaaaa 9360gagttggtag ctcttgatcc ggcaaacaaa
ccaccgctgg tagcggtggt ttttttgttt 9420gcaagcagca gattacgcgc agaaaaaaag
gatctcaaaa cgccagcaac gcggcctttt 9480tacggttcct ggccttttgc tggccttttg
ctcacatgtt ctttcctgcg ttatcccctg 9540attctgtgga taaccgtatt accgcctttg
agtgagctga taccgctcgc cgcagccgaa 9600cgaccgagcg cagcgagtca gtgagcgagg
aagcggaaga gcgcccaata cgcaaaccgc 9660ctctc
9665166236DNAArtificial
SequenceDescription of Artificial Sequence Synthetic polynucleotide
16cccgcgcgtt ggccgattca ttaatgcagc tggcacgaca ggtttcccga ctggaaagcg
60ggcagtgagc gcaacgcaat tttcacacag gaaacagcta tgaccatgat tacgccaagc
120ttgcatgcat ttaaatgacg cagctgcgcg ctcgctcgct cactgaggcc gcccgggcaa
180agcccgggcg tcgggcgacc tttggtcgcc cggcctcagt gagcgagcga gcgcgcagag
240agggagtggc caactccatc actaggggtt gagtttaaac ttcgtcgacg atctgcggcc
300gcacgcgtgg agctagttat taatagtaat caattacggg gtcattagtt catagcccat
360atatggagtt ccgcgttaca taacttacgg taaatggccc gcctggctga ccgcccaacg
420acccccgccc attgacgtca ataatgacgt atgttcccat agtaacgtca atagggactt
480tccattgacg tcaatgggtg gagtatttac ggtaaactgc ccacttggca gtacatcaag
540tgtatcatat gccaagtacg ccccctattg acgtcaatga cggtaaatgg cccgcctggc
600attatgccca gtacatgacc ttatgggact ttcctacttg gcagtacatc tacgtattag
660tcatcgctat taccatggtg atgcggtttt ggcagtacat caatgggcgt ggatagcggt
720ttgactcacg gggatttcca agtctccacc ccattgacgt caatgggagt ttgttttgca
780ccaaaatcaa cgggactttc caaaatgtcg taacaactcc gccccattga cgcaaatggg
840cggtaggcgt gtacggtggg aggtctatat aagcagagct cgtttagtga accgtcagat
900cgcctggaga cgccatccac gctgttttga cctccataga agacaccggg accgatccag
960cctccgcgga ttcgaatccc ggccgggaac ggtgcattgg aacgcggatt ccccgtgcca
1020agagtgacgt aagtaccgcc tatagagtct ataggcccac aaaaaatgct ttcttctttt
1080aatatacttt tttgtttatc ttatttctaa tactttccct aatctctttc tttcagggca
1140ataatgatac aatgtatcat gcctctttgc accattctaa agaataacag tgataatttc
1200tgggttaagg caatagcaat atttctgcat ataaatattt ctgcatataa attgtaactg
1260atgtaagagg tttcatattg ctaatagcag ctacaatcca gctaccattc tgcttttatt
1320ttatggttgg gataaggctg gattattctg agtccaagct aggccctttt gctaatcatg
1380ttcatacctc ttatcttcct cccacagctc ctgggcaacg tgctggtctg tgtgctggcc
1440catcactttg gcaaagaatt gggattcgaa catcggccgc caccatgaac gcaagtgaat
1500tccgaaggag agggaaggag atggtggatt acgtggccaa ctacatggaa ggcattgagg
1560gacgccaggt ctaccctgac gtggagcccg ggtacctgcg gccgctgatc cctgccgctg
1620cccctcagga gccagacacg tttgaggaca tcatcaacga cgttgagaag ataatcatgc
1680ctggggtgac gcactggcac agcccctact tcttcgccta cttccccact gccagctcgt
1740acccggccat gcttgcggac atgctgtgcg gggccattgg ctgcatcggc ttctcctggg
1800cggcaagccc agcatgcaca gagctggaga ctgtgatgat ggactggctc gggaagatgc
1860tggaactacc aaaggcattt ttgaatgaga aagctggaga agggggagga gtgatccagg
1920gaagtgccag tgaagccacc ctggtggccc tgctggccgc tcggaccaaa gtgatccatc
1980ggctgcaggc agcgtcccca gagctcacac aggccgctat catggagaag ctggtggctt
2040actcatccga tcaggcacac tcctcagtgg aaagagctgg gttaattggt ggagtgaaat
2100taaaagccat cccctcagat ggcaacttcg ccatgcgtgc gtctgccctg caggaagccc
2160tggagagaga caaagcggct ggcctgattc ctttctttat ggttgccacc ctggggacca
2220caacatgctg ctcctttgac aatctcttag aagtcggtcc tatctgcaac aaggaagaca
2280tatggctgca cgttgatgca gcctacgcag gcagtgcatt catctgccct gagttccggc
2340accttctgaa tggagtggag tttgcagatt cattcaactt taatccccac aaatggctat
2400tggtgaattt tgactgttct gccatgtggg tgaaaaagag aacagactta acgggagcct
2460ttagactgga ccccacttac ctgaagcaca gccatcagga ttcagggctt atcactgact
2520accggcattg gcagatacca ctgggcagaa gatttcgctc tttgaaaatg tggtttgtat
2580ttaggatgta tggagtcaaa ggactgcagg cttatatccg caagcatgtc cagctgtccc
2640atgagtttga gtcactggtg cgccaggatc cccgctttga aatctgtgtg gaagtcattc
2700tggggcttgt ctgctttcgg ctaaagggtt ccaacaaagt gaatgaagct cttctgcaaa
2760gaataaacag tgccaaaaaa atccacttgg ttccatgtca cctcagggac aagtttgtcc
2820tgcgctttgc catctgttct cgcacggtgg aatctgccca tgtgcagcgg gcctgggaac
2880acatcaaaga gctggcggcc gacgtgctgc gagcagagag ggagtaggag tgagctgctc
2940gagagatcta cgggtggcat ccctgtgacc cctccccagt gcctctcctg gccctggaag
3000ttgccactcc agtgcccacc agccttgtcc taataaaatt aagttgcatc attttgtctg
3060actaggtgtc cttctataat attatggggt ggaggggggt ggtatggagc aaggggcaag
3120ttgggaagac aacctgtagg gcctgcgggg tctattggga accaagctgg agtgcagtgg
3180cacaatcttg gctcactgca atctccgcct cctgggttca agcgattctc ctgcctcagc
3240ctcccgagtt gttgggattc caggcatgca tgaccaggct cagctaattt ttgttttttt
3300ggtagagacg gggtttcacc atattggcca ggctggtctc caactcctaa tctcaggtga
3360tctacccacc ttggcctccc aaattgctgg gattacaggc gtgaaccact gctcccttcc
3420ctgtccttct gattttgtag gtaaccacgt gcggaccgag cggccgcagt taattaagct
3480cgcgaaaccc ctagtgatgg agttggccac tccctctctg cgcgctcgct cgctcactga
3540ggccgggcga ccaaaggtcg cccgacgccc gggctttgcc cgggcggcct cagtgagcga
3600gcgagcgcgc agctggacga tttaaatggt accgagctcg aattcactgg ccgtcgtttt
3660acaacgtcgt gactgggaaa accctggcgt tacccaactt aatcgccttg cagcacatcc
3720ccctttcgcc agctggcgta atagcgaaga ggcccgcacc gatcgccctt cccaacagtt
3780gcgcagcctg aatggcgaat ggcgcctgat gcggtatttt ctccttacgc atctgtgcgg
3840tatttcacac cgcatatggt gcactctcag tacaatctgc tctgatgccg catagttaag
3900ccagccccga cacccgccaa cacccgctga cgcgccctga cgggcttgtc tgctcccggc
3960atccgcttac agacaagctg tgaccgtctc cgggagctgc atgtgtcaga ggttttcacc
4020gtcatcaccg aaacgcgcga tgcagctctg gcccgtgtct caaaatctct gatgttacat
4080tgcacaagat aaaaatatat catcatgaac aataaaactg tctgcttaca taaacagtaa
4140tacaaggggt gttgaagatc ctttgatctt ttctacgggg tctgacgctc agtggaacga
4200aaactcacgt taagggattt tggtcatgag attatcaaaa aggatcttca cctagatcct
4260tttaaattaa aaatgaagtt ttaaatcaag cccaatctga ataatgttac aaccaattaa
4320ccaattctga ttagaaaaac tcatcgagca tcaaatgaaa ctgcaattta ttcatatcag
4380gattatcaat accatatttt tgaaaaagcc gtttctgtaa tgaaggagaa aactcaccga
4440ggcagttcca taggatggca agatcctggt atcggtctgc gattccgact cgtccaacat
4500caatacaacc tattaatttc ccctcgtcaa aaataaggtt atcaagtgag aaatcaccat
4560gagtgacgac tgaatccggt gagaatggca aaagtttatg catttctttc cagacttgtt
4620caacaggcca gccattacgc tcgtcatcaa aatcactcgc atcaaccaaa ccgttattca
4680ttcgtgattg cgcctgagcg agacgaaata cgcgatcgct gttaaaagga caattacaaa
4740caggaatcga atgcaaccgg cgcaggaaca ctgccagcgc atcaacaata ttttcacctg
4800aatcaggata ttcttctaat acctggaatg ctgtttttcc ggggatcgca gtggtgagta
4860accatgcatc atcaggagta cggataaaat gcttgatggt cggaagaggc ataaattccg
4920tcagccagtt tagtctgacc atctcatctg taacatcatt ggcaacgcta cctttgccat
4980gtttcagaaa caactctggc gcatcgggct tcccatacaa gcgatagatt gtcgcacctg
5040attgcccgac attatcgcga gcccatttat acccatataa atcagcatcc atgttggaat
5100ttaatcgcgg cctcgacgtt tcccgttgaa tatggctcat aacacccctt gtattactgt
5160ttatgtaagc agacagtttt attgttcatg atgatatatt tttatcttgt gcaatgtaac
5220atcagagatt ttgagacacg ggccagagct gcatcgcgcg ttttcagaat tggttaattg
5280gttgtaacat tattcagatt gggcttgatt taaaacttca tttttaattt aaaaggatct
5340aggtgaagat cctttttgat aatctcatga ccaaaatccc ttaacgtgag ttttcgttcc
5400actgagcgtc agaccccgta gaaaagatca aaggatcttc tttccatagg ctccgccccc
5460ctgacgagca tcacaaaaat cgacgctcaa gtcagaggtg gcgaaacccg acaggactat
5520aaagatacca ggcgtttccc cctggaagct ccctcgtgcg ctctcctgtt ccgaccctgc
5580cgcttaccgg atacctgtcc gcctttctcc cttcgggaag cgtggcgctt tctcatagct
5640cacgctgtag gtatctcagt tcggtgtagg tcgttcgctc caagctgggc tgtgtgcacg
5700aaccccccgt tcagcccgac cgctgcgcct tatccggtaa ctatcgtctt gagtccaacc
5760cggtaagaca cgacttatcg ccactggcag cagccactgg taacaggatt agcagagcga
5820ggtatgtagg cggtgctaca gagttcttga agtggtggcc taactacggc tacactagaa
5880gaacagtatt tggtatctgc gctctgctga agccagttac cttcggaaaa agagttggta
5940gctcttgatc cggcaaacaa accaccgctg gtagcggtgg tttttttgtt tgcaagcagc
6000agattacgcg cagaaaaaaa ggatctcaaa acgccagcaa cgcggccttt ttacggttcc
6060tggccttttg ctggcctttt gctcacatgt tctttcctgc gttatcccct gattctgtgg
6120ataaccgtat taccgccttt gagtgagctg ataccgctcg ccgcagccga acgaccgagc
6180gcagcgagtc agtgagcgag gaagcggaag agcgcccaat acgcaaaccg cctctc
6236173497DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 17cctgcaggca gctgcgcgct cgctcgctca
ctgaggccgc ccgggcaaag cccgggcgtc 60gggcgacctt tggtcgcccg gcctcagtga
gcgagcgagc gcgcagagag ggagtggcca 120actccatcac taggggttcc tgagtttaaa
cttcgtcgac gatctgcggc cgcacgcgtg 180gagctagtta ttaatagtaa tcaattacgg
ggtcattagt tcatagccca tatatggagt 240tccgcgttac ataacttacg gtaaatggcc
cgcctggctg accgcccaac gacccccgcc 300cattgacgtc aataatgacg tatgttccca
tagtaacgtc aatagggact ttccattgac 360gtcaatgggt ggagtattta cggtaaactg
cccacttggc agtacatcaa gtgtatcata 420tgccaagtac gccccctatt gacgtcaatg
acggtaaatg gcccgcctgg cattatgccc 480agtacatgac cttatgggac tttcctactt
ggcagtacat ctacgtatta gtcatcgcta 540ttaccatggt gatgcggttt tggcagtaca
tcaatgggcg tggatagcgg tttgactcac 600ggggatttcc aagtctccac cccattgacg
tcaatgggag tttgttttgc accaaaatca 660acgggacttt ccaaaatgtc gtaacaactc
cgccccattg acgcaaatgg gcggtaggcg 720tgtacggtgg gaggtctata taagcagagc
tcgtttagtg aaccgtcaga tcgcctggag 780acgccatcca cgctgttttg acctccatag
aagacaccgg gaccgatcca gcctccgcgg 840attcgaatcc cggccgggaa cggtgcattg
gaacgcggat tccccgtgcc aagagtgacg 900taagtaccgc ctatagagtc tataggccca
caaaaaatgc tttcttcttt taatatactt 960ttttgtttat cttatttcta atactttccc
taatctcttt ctttcagggc aataatgata 1020caatgtatca tgcctctttg caccattcta
aagaataaca gtgataattt ctgggttaag 1080gcaatagcaa tatttctgca tataaatatt
tctgcatata aattgtaact gatgtaagag 1140gtttcatatt gctaatagca gctacaatcc
agctaccatt ctgcttttat tttatggttg 1200ggataaggct ggattattct gagtccaagc
taggcccttt tgctaatcat gttcatacct 1260cttatcttcc tcccacagct cctgggcaac
gtgctggtct gtgtgctggc ccatcacttt 1320ggcaaagaat tgggattcga acatcggccg
ccaccatgaa cgcaagtgaa ttccgaagga 1380gagggaagga gatggtggat tacgtggcca
actacatgga aggcattgag ggacgccagg 1440tctaccctga cgtggagccc gggtacctgc
ggccgctgat ccctgccgct gcccctcagg 1500agccagacac gtttgaggac atcatcaacg
acgttgagaa gataatcatg cctggggtga 1560cgcactggca cagcccctac ttcttcgcct
acttccccac tgccagctcg tacccggcca 1620tgcttgcgga catgctgtgc ggggccattg
gctgcatcgg cttctcctgg gcggcaagcc 1680cagcatgcac agagctggag actgtgatga
tggactggct cgggaagatg ctggaactac 1740caaaggcatt tttgaatgag aaagctggag
aagggggagg agtgatccag ggaagtgcca 1800gtgaagccac cctggtggcc ctgctggccg
ctcggaccaa agtgatccat cggctgcagg 1860cagcgtcccc agagctcaca caggccgcta
tcatggagaa gctggtggct tactcatccg 1920atcaggcaca ctcctcagtg gaaagagctg
ggttaattgg tggagtgaaa ttaaaagcca 1980tcccctcaga tggcaacttc gccatgcgtg
cgtctgccct gcaggaagcc ctggagagag 2040acaaagcggc tggcctgatt cctttcttta
tggttgccac cctggggacc acaacatgct 2100gctcctttga caatctctta gaagtcggtc
ctatctgcaa caaggaagac atatggctgc 2160acgttgatgc agcctacgca ggcagtgcat
tcatctgccc tgagttccgg caccttctga 2220atggagtgga gtttgcagat tcattcaact
ttaatcccca caaatggcta ttggtgaatt 2280ttgactgttc tgccatgtgg gtgaaaaaga
gaacagactt aacgggagcc tttagactgg 2340accccactta cctgaagcac agccatcagg
attcagggct tatcactgac taccggcatt 2400ggcagatacc actgggcaga agatttcgct
ctttgaaaat gtggtttgta tttaggatgt 2460atggagtcaa aggactgcag gcttatatcc
gcaagcatgt ccagctgtcc catgagtttg 2520agtcactggt gcgccaggat ccccgctttg
aaatctgtgt ggaagtcatt ctggggcttg 2580tctgctttcg gctaaagggt tccaacaaag
tgaatgaagc tcttctgcaa agaataaaca 2640gtgccaaaaa aatccacttg gttccatgtc
acctcaggga caagtttgtc ctgcgctttg 2700ccatctgttc tcgcacggtg gaatctgccc
atgtgcagcg ggcctgggaa cacatcaaag 2760agctggcggc cgacgtgctg cgagcagaga
gggagtagga gtgagctgct cgagagatct 2820acgggtggca tccctgtgac ccctccccag
tgcctctcct ggccctggaa gttgccactc 2880cagtgcccac cagccttgtc ctaataaaat
taagttgcat cattttgtct gactaggtgt 2940ccttctataa tattatgggg tggagggggg
tggtatggag caaggggcaa gttgggaaga 3000caacctgtag ggcctgcggg gtctattggg
aaccaagctg gagtgcagtg gcacaatctt 3060ggctcactgc aatctccgcc tcctgggttc
aagcgattct cctgcctcag cctcccgagt 3120tgttgggatt ccaggcatgc atgaccaggc
tcagctaatt tttgtttttt tggtagagac 3180ggggtttcac catattggcc aggctggtct
ccaactccta atctcaggtg atctacccac 3240cttggcctcc caaattgctg ggattacagg
cgtgaaccac tgctcccttc cctgtccttc 3300tgattttgta ggtaaccacg tgcggaccga
gcggccgcag ttaattaagc tcgcgaagga 3360acccctagtg atggagttgg ccactccctc
tctgcgcgct cgctcgctca ctgaggccgg 3420gcgaccaaag gtcgcccgac gcccgggctt
tgcccgggcg gcctcagtga gcgagcgagc 3480gcgcagctgc ctgcagg
3497183497DNAArtificial
SequenceDescription of Artificial Sequence Synthetic polynucleotide
18cctgcaggca gctgcgcgct cgctcgctca ctgaggccgc ccgggcaaag cccgggcgtc
60gggcgacctt tggtcgcccg gcctcagtga gcgagcgagc gcgcagagag ggagtggcca
120actccatcac taggggttcc tgagtttaaa cttcgtcgac gatctgcggc cgcacgcgtg
180gagctagtta ttaatagtaa tcaattacgg ggtcattagt tcatagccca tatatggagt
240tccgcgttac ataacttacg gtaaatggcc cgcctggctg accgcccaac gacccccgcc
300cattgacgtc aataatgacg tatgttccca tagtaacgtc aatagggact ttccattgac
360gtcaatgggt ggagtattta cggtaaactg cccacttggc agtacatcaa gtgtatcata
420tgccaagtac gccccctatt gacgtcaatg acggtaaatg gcccgcctgg cattatgccc
480agtacatgac cttatgggac tttcctactt ggcagtacat ctacgtatta gtcatcgcta
540ttaccatggt gatgcggttt tggcagtaca tcaatgggcg tggatagcgg tttgactcac
600ggggatttcc aagtctccac cccattgacg tcaatgggag tttgttttgc accaaaatca
660acgggacttt ccaaaatgtc gtaacaactc cgccccattg acgcaaatgg gcggtaggcg
720tgtacggtgg gaggtctata taagcagagc tcgtttagtg aaccgtcaga tcgcctggag
780acgccatcca cgctgttttg acctccatag aagacaccgg gaccgatcca gcctccgcgg
840attcgaatcc cggccgggaa cggtgcattg gaacgcggat tccccgtgcc aagagtgacg
900taagtaccgc ctatagagtc tataggccca caaaaaatgc tttcttcttt taatatactt
960ttttgtttat cttatttcta atactttccc taatctcttt ctttcagggc aataatgata
1020caatgtatca tgcctctttg caccattcta aagaataaca gtgataattt ctgggttaag
1080gcaatagcaa tatttctgca tataaatatt tctgcatata aattgtaact gatgtaagag
1140gtttcatatt gctaatagca gctacaatcc agctaccatt ctgcttttat tttatggttg
1200ggataaggct ggattattct gagtccaagc taggcccttt tgctaatcat gttcatacct
1260cttatcttcc tcccacagct cctgggcaac gtgctggtct gtgtgctggc ccatcacttt
1320ggcaaagaat tgggattcga acatcggccg ccaccatgaa cgcaagtgaa ttccgaagga
1380gagggaagga gatggtggat tacgtggcca actacatgga aggcattgag ggacgccagg
1440tctaccctga cgtggagccc gggtacctgc ggccgctgat ccctgccgct gcccctcagg
1500agccagacac gtttgaggac atcatcaacg acgttgagaa gataatcatg cctggggtga
1560cgcactggca cagcccctac ttcttcgcct acttccccac tgccagctcg tacccggcca
1620tgcttgcgga catgctgtgc ggggccattg gctgcatcgg cttctcctgg gcggcaagcc
1680cagcatgcac agagctggag actgtgatga tggactggct cgggaagatg ctggaactac
1740caaaggcatt tttgaatgag aaagctggag aagggggagg agtgatccag ggaagtgcca
1800gtgaagccac cctggtggcc ctgctggccg ctcggaccaa agtgatccat cggctgcagg
1860cagcgtcccc agagctcaca caggccgcta tcatggagaa gctggtggct tactcatccg
1920atcaggcaca ctcctcagtg gaaagagctg ggttaattgg tggagtgaaa ttaaaagcca
1980tcccctcaga tggcaacttc gccatgcgtg cgtctgccct gcaggaagcc ctggagagag
2040acaaagcggc tggcctgatt cctttcttta tggttgccac cctggggacc acaacatgct
2100gctcctttga caatctctta gaagtcggtc ctatctgcaa caaggaagac atatggctgc
2160acgttgatgc agcctacgca ggcagtgcat tcatctgccc tgagttccgg caccttctga
2220atggagtgga gtttgcagat tcattcaact ttaatcccca caaatggcta ttggtgaatt
2280ttgactgttc tgccatgtgg gtgaaaaaga gaacagactt aacgggagcc tttagactgg
2340accccactta cctgaagcac agccatcagg attcagggct tatcactgac taccggcatt
2400ggcagatacc actgggcaga agatttcgct ctttgaaaat gtggtttgta tttaggatgt
2460atggagtcaa aggactgcag gcttatatcc gcaagcatgt ccagctgtcc catgagtttg
2520agtcactggt gcgccaggat ccccgctttg aaatctgtgt ggaagtcatt ctggggcttg
2580tctgctttcg gctaaagggt tccaacaaag tgaatgaagc tcttctgcaa agaataaaca
2640gtgccaaaaa aatccacttg gttccatgtc acctcaggga caagtttgtc ctgcgctttg
2700ccatctgttc tcgcacggtg gaatctgccc atgtgcagcg ggcctgggaa cacatcaaag
2760agctggcggc cgacgtgctg cgagcagaga gggagtagga gtgagctgct cgagagatct
2820acgggtggca tccctgtgac ccctccccag tgcctctcct ggccctggaa gttgccactc
2880cagtgcccac cagccttgtc ctaataaaat taagttgcat cattttgtct gactaggtgt
2940ccttctataa tattatgggg tggagggggg tggtatggag caaggggcaa gttgggaaga
3000caacctgtag ggcctgcggg gtctattggg aaccaagctg gagtgcagtg gcacaatctt
3060ggctcactgc aatctccgcc tcctgggttc aagcgattct cctgcctcag cctcccgagt
3120tgttgggatt ccaggcatgc atgaccaggc tcagctaatt tttgtttttt tggtagagac
3180ggggtttcac catattggcc aggctggtct ccaactccta atctcaggtg atctacccac
3240cttggcctcc caaattgctg ggattacagg cgtgaaccac tgctcccttc cctgtccttc
3300tgattttgta ggtaaccacg tgcggaccga gcggccgcag ttaattaagc tcgcgaagga
3360acccctagtg atggagttgg ccactccctc tctgcgcgct cgctcgctca ctgaggccgg
3420gcgaccaaag gtcgcccgac gcccgggctt tgcccgggcg gcctcagtga gcgagcgagc
3480gcgcagctgc ctgcagg
3497193491DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 19cctgcaggca gctgcgcgct cgctcgctca
ctgaggccgc ccgggcaaag cccgggcgtc 60gggcgacctt tggtcgcccg gcctcagtga
gcgagcgagc gcgcagagag ggagtggcca 120actccatcac taggggttcc tgagtttaaa
cttcgtcgac gatctgcggc cgcacgcgtg 180gagctagtta ttaatagtaa tcaattacgg
ggtcattagt tcatagccca tatatggagt 240tccgcgttac ataacttacg gtaaatggcc
cgcctggctg accgcccaac gacccccgcc 300cattgacgtc aataatgacg tatgttccca
tagtaacgtc aatagggact ttccattgac 360gtcaatgggt ggagtattta cggtaaactg
cccacttggc agtacatcaa gtgtatcata 420tgccaagtac gccccctatt gacgtcaatg
acggtaaatg gcccgcctgg cattatgccc 480agtacatgac cttatgggac tttcctactt
ggcagtacat ctacgtatta gtcatcgcta 540ttaccatggt gatgcggttt tggcagtaca
tcaatgggcg tggatagcgg tttgactcac 600ggggatttcc aagtctccac cccattgacg
tcaatgggag tttgttttgc accaaaatca 660acgggacttt ccaaaatgtc gtaacaactc
cgccccattg acgcaaatgg gcggtaggcg 720tgtacggtgg gaggtctata taagcagagc
tcgtttagtg aaccgtcaga tcgcctggag 780acgccatcca cgctgttttg acctccatag
aagacaccgg gaccgatcca gcctccgcgg 840attcgaatcc cggccgggaa cggtgcattg
gaacgcggat tccccgtgcc aagagtgacg 900taagtaccgc ctatagagtc tataggccca
caaaaaatgc tttcttcttt taatatactt 960ttttgtttat cttatttcta atactttccc
taatctcttt ctttcagggc aataatgata 1020caatgtatca tgcctctttg caccattcta
aagaataaca gtgataattt ctgggttaag 1080gcaatagcaa tatttctgca tataaatatt
tctgcatata aattgtaact gatgtaagag 1140gtttcatatt gctaatagca gctacaatcc
agctaccatt ctgcttttat tttatggttg 1200ggataaggct ggattattct gagtccaagc
taggcccttt tgctaatcat gttcatacct 1260cttatcttcc tcccacagct cctgggcaac
gtgctggtct gtgtgctggc ccatcacttt 1320ggcaaagaat tgggattcga acatcggccg
ccaccatgaa cgccagcgag ttcaggagga 1380ggggcaagga gatggtggac tacgtggcca
actacatgga gggcatcgag ggcaggcagg 1440tgtaccccga cgtggagccc ggctacctga
ggcccctgat ccccgccgcc gccccccagg 1500agcccgacac cttcgaggac atcatcaacg
acgtggagaa gatcatcatg cccggcgtga 1560cccactggca cagcccctac ttcttcgcct
acttccccac cgccagcagc taccccgcca 1620tgctggccga catgctgtgc ggcgccatcg
gctgcatcgg cttcagctgg gccgccagcc 1680ccgcctgcac cgagctggag accgtgatga
tggactggct gggcaagatg ctggagctgc 1740ccaaggcctt cctgaacgag aaggccggcg
agggcggcgg cgtgatccag ggcagcgcca 1800gcgaggccac cctggtggcc ctgctggccg
ccaggaccaa ggtgatccac aggctgcagg 1860ccgccagccc cgagctgacc caggccgcca
tcatggagaa gctggtggcc tacagcagcg 1920accaggccca cagcagcgtg gagagggccg
gcctgatcgg cggcgtgaag ctgaaggcca 1980tccccagcga cggcaacttc gccatgaggg
ccagcgccct gcaggaggcc ctggagaggg 2040acaaggccgc cggcctgatc cccttcttca
tggtggccac cctgggcacc accacctgct 2100gcagcttcga caacctgctg gaggtgggcc
ccatctgcaa caaggaggac atctggctgc 2160acgtggacgc cgcctacgcc ggcagcgcct
tcatctgccc cgagttcagg cacctgctga 2220acggcgtgga gttcgccgac agcttcaact
tcaaccccca caagtggctg ctggtgaact 2280tcgactgcag cgccatgtgg gtgaagaaga
ggaccgacct gaccggcgcc ttcaggctgg 2340accccaccta cctgaagcac agccaccagg
acagcggcct gatcaccgac tacaggcact 2400ggcagatccc cctgggcagg aggttcagga
gcctgaagat gtggttcgtg ttcaggatgt 2460acggcgtgaa gggcctgcag gcctacatca
ggaagcacgt gcagctgagc cacgagttcg 2520agagcctggt gaggcaggac cccaggttcg
agatctgcgt ggaggtgatc ctgggcctgg 2580tgtgcttcag gctgaagggc agcaacaagg
tgaacgaggc cctgctgcag aggatcaaca 2640gcgccaagaa gatccacctg gtgccctgcc
acctgaggga caagttcgtg ctgaggttcg 2700ccatctgcag caggaccgtg gagagcgccc
acgtgcagag ggcctgggag cacatcaagg 2760agctggccgc cgacgtgctg agggccgaga
gggagtgagc tgctcgagag atctacgggt 2820ggcatccctg tgacccctcc ccagtgcctc
tcctggccct ggaagttgcc actccagtgc 2880ccaccagcct tgtcctaata aaattaagtt
gcatcatttt gtctgactag gtgtccttct 2940ataatattat ggggtggagg ggggtggtat
ggagcaaggg gcaagttggg aagacaacct 3000gtagggcctg cggggtctat tgggaaccaa
gctggagtgc agtggcacaa tcttggctca 3060ctgcaatctc cgcctcctgg gttcaagcga
ttctcctgcc tcagcctccc gagttgttgg 3120gattccaggc atgcatgacc aggctcagct
aatttttgtt tttttggtag agacggggtt 3180tcaccatatt ggccaggctg gtctccaact
cctaatctca ggtgatctac ccaccttggc 3240ctcccaaatt gctgggatta caggcgtgaa
ccactgctcc cttccctgtc cttctgattt 3300tgtaggtaac cacgtgcgga ccgagcggcc
gcagttaatt aagctcgcga aggaacccct 3360agtgatggag ttggccactc cctctctgcg
cgctcgctcg ctcactgagg ccgggcgacc 3420aaaggtcgcc cgacgcccgg gctttgcccg
ggcggcctca gtgagcgagc gagcgcgcag 3480ctgcctgcag g
3491204003DNAArtificial
SequenceDescription of Artificial Sequence Synthetic polynucleotide
20cctgcaggca gctgcgcgct cgctcgctca ctgaggccgc ccgggcaaag cccgggcgtc
60gggcgacctt tggtcgcccg gcctcagtga gcgagcgagc gcgcagagag ggagtggcca
120actccatcac taggggttcc tgagtttaaa cttcgtcgac gatctgcggc cgcacgcgtg
180gagctagtta ttaatagtaa tcaattacgg ggtcattagt tcatagccca tatatggagt
240tccgcgttac ataacttacg gtaaatggcc cgcctggctg accgcccaac gacccccgcc
300cattgacgtc aataatgacg tatgttccca tagtaacgtc aatagggact ttccattgac
360gtcaatgggt ggagtattta cggtaaactg cccacttggc agtacatcaa gtgtatcata
420tgccaagtac gccccctatt gacgtcaatg acggtaaatg gcccgcctgg cattatgccc
480agtacatgac cttatgggac tttcctactt ggcagtacat ctacgtatta gtcatcgcta
540ttaccatggt gatgcggttt tggcagtaca tcaatgggcg tggatagcgg tttgactcac
600ggggatttcc aagtctccac cccattgacg tcaatgggag tttgttttgc accaaaatca
660acgggacttt ccaaaatgtc gtaacaactc cgccccattg acgcaaatgg gcggtaggcg
720tgtacggtgg gaggtctata taagcagagc tcgtttagtg aaccgtcaga tcgcctggag
780acgccatcca cgctgttttg acctccatag aagacaccgg gaccgatcca gcctccgcgg
840attcgaatcc cggccgggaa cggtgcattg gaacgcggat tccccgtgcc aagagtgacg
900taagtaccgc ctatagagtc tataggccca caaaaaatgc tttcttcttt taatatactt
960ttttgtttat cttatttcta atactttccc taatctcttt ctttcagggc aataatgata
1020caatgtatca tgcctctttg caccattcta aagaataaca gtgataattt ctgggttaag
1080gcaatagcaa tatttctgca tataaatatt tctgcatata aattgtaact gatgtaagag
1140gtttcatatt gctaatagca gctacaatcc agctaccatt ctgcttttat tttatggttg
1200ggataaggct ggattattct gagtccaagc taggcccttt tgctaatcat gttcatacct
1260cttatcttcc tcccacagct cctgggcaac gtgctggtct gtgtgctggc ccatcacttt
1320ggcaaagaat tgggattcga acatcgaatt cgggcacgag ggaggacaga gagcaagtca
1380ctcccggctg cctttttcac ctctgacaga gcccagacac catgaacgca agtgaattcc
1440gaaggagagg gaaggagatg gtggattacg tggccaacta catggaaggc attgagggac
1500gccaggtcta ccctgacgtg gagcccgggt acctgcggcc gctgatccct gccgctgccc
1560ctcaggagcc agacacgttt gaggacatca tcaacgacgt tgagaagata atcatgcctg
1620gggtgacgca ctggcacagc ccctacttct tcgcctactt ccccactgcc agctcgtacc
1680cggccatgct tgcggacatg ctgtgcgggg ccattggctg catcggcttc tcctgggcgg
1740caagcccagc atgcacagag ctggagactg tgatgatgga ctggctcggg aagatgctgg
1800aactaccaaa ggcatttttg aatgagaaag ctggagaagg gggaggagtg atccagggaa
1860gtgccagtga agccaccctg gtggccctgc tggccgctcg gaccaaagtg atccatcggc
1920tgcaggcagc gtccccagag ctcacacagg ccgctatcat ggagaagctg gtggcttact
1980catccgatca ggcacactcc tcagtggaaa gagctgggtt aattggtgga gtgaaattaa
2040aagccatccc ctcagatggc aacttcgcca tgcgtgcgtc tgccctgcag gaagccctgg
2100agagagacaa agcggctggc ctgattcctt tctttatggt tgccaccctg gggaccacaa
2160catgctgctc ctttgacaat ctcttagaag tcggtcctat ctgcaacaag gaagacatat
2220ggctgcacgt tgatgcagcc tacgcaggca gtgcattcat ctgccctgag ttccggcacc
2280ttctgaatgg agtggagttt gcagattcat tcaactttaa tccccacaaa tggctattgg
2340tgaattttga ctgttctgcc atgtgggtga aaaagagaac agacttaacg ggagccttta
2400gactggaccc cacttacctg aagcacagcc atcaggattc agggcttatc actgactacc
2460ggcattggca gataccactg ggcagaagat ttcgctcttt gaaaatgtgg tttgtattta
2520ggatgtatgg agtcaaagga ctgcaggctt atatccgcaa gcatgtccag ctgtcccatg
2580agtttgagtc actggtgcgc caggatcccc gctttgaaat ctgtgtggaa gtcattctgg
2640ggcttgtctg ctttcggcta aagggttcca acaaagtgaa tgaagctctt ctgcaaagaa
2700taaacagtgc caaaaaaatc cacttggttc catgtcacct cagggacaag tttgtcctgc
2760gctttgccat ctgttctcgc acggtggaat ctgcccatgt gcagcgggcc tgggaacaca
2820tcaaagagct ggcggccgac gtgctgcgag cagagaggga gtaggagtga agccagctgc
2880aggaatcaaa aattgaagag agatatatct gaaaactgga ataagaagca aataaatatc
2940atcctgcctt catggaactc agctgtctgt ggcttcccat gtctttctcc aaagttatcc
3000agagggttgt gattttgtct gcttagtatc tcatcaacaa agaaatatta tttgctaatt
3060aaaaagttaa tcttcatggc catagctttt attcattagc tgtgattttt gttgattaaa
3120acattataga ttttcatgtt cttgcagtca tcagaagtgg taggaaagcc tcactgatat
3180attttccagg gcaatcaatg ttcacgcaac ttgaaattat atctgtggtc ttcaaattgt
3240cttttgtcat gtggctaaat gcctaataaa caattcaagt gaaatactaa aaaaaaaaaa
3300aaaaaaaaaa gctgctcgag agatctacgg gtggcatccc tgtgacccct ccccagtgcc
3360tctcctggcc ctggaagttg ccactccagt gcccaccagc cttgtcctaa taaaattaag
3420ttgcatcatt ttgtctgact aggtgtcctt ctataatatt atggggtgga ggggggtggt
3480atggagcaag gggcaagttg ggaagacaac ctgtagggcc tgcggggtct attgggaacc
3540aagctggagt gcagtggcac aatcttggct cactgcaatc tccgcctcct gggttcaagc
3600gattctcctg cctcagcctc ccgagttgtt gggattccag gcatgcatga ccaggctcag
3660ctaatttttg tttttttggt agagacgggg tttcaccata ttggccaggc tggtctccaa
3720ctcctaatct caggtgatct acccaccttg gcctcccaaa ttgctgggat tacaggcgtg
3780aaccactgct cccttccctg tccttctgat tttgtaggta accacgtgcg gaccgagcgg
3840ccgcagttaa ttaagctcgc gaaggaaccc ctagtgatgg agttggccac tccctctctg
3900cgcgctcgct cgctcactga ggccgggcga ccaaaggtcg cccgacgccc gggctttgcc
3960cgggcggcct cagtgagcga gcgagcgcgc agctgcctgc agg
4003213499DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 21ttggccactc cctctctgcg cgctcgctcg
ctcactgagg ccgggcgacc aaaggtcgcc 60cgacgcccgg gctttgcccg ggcggcctca
gtgagcgagc gagcgcgcag agagggagtg 120gccaactcca tcactagggg ttcctgagtt
taaacttcgt cgacgatctg cggccgcacg 180cgtggagcta gttattaata gtaatcaatt
acggggtcat tagttcatag cccatatatg 240gagttccgcg ttacataact tacggtaaat
ggcccgcctg gctgaccgcc caacgacccc 300cgcccattga cgtcaataat gacgtatgtt
cccatagtaa cgtcaatagg gactttccat 360tgacgtcaat gggtggagta tttacggtaa
actgcccact tggcagtaca tcaagtgtat 420catatgccaa gtacgccccc tattgacgtc
aatgacggta aatggcccgc ctggcattat 480gcccagtaca tgaccttatg ggactttcct
acttggcagt acatctacgt attagtcatc 540gctattacca tggtgatgcg gttttggcag
tacatcaatg ggcgtggata gcggtttgac 600tcacggggat ttccaagtct ccaccccatt
gacgtcaatg ggagtttgtt ttgcaccaaa 660atcaacggga ctttccaaaa tgtcgtaaca
actccgcccc attgacgcaa atgggcggta 720ggcgtgtacg gtgggaggtc tatataagca
gagctcgttt agtgaaccgt cagatcgcct 780ggagacgcca tccacgctgt tttgacctcc
atagaagaca ccgggaccga tccagcctcc 840gcggattcga atcccggccg ggaacggtgc
attggaacgc ggattccccg tgccaagagt 900gacgtaagta ccgcctatag agtctatagg
cccacaaaaa atgctttctt cttttaatat 960acttttttgt ttatcttatt tctaatactt
tccctaatct ctttctttca gggcaataat 1020gatacaatgt atcatgcctc tttgcaccat
tctaaagaat aacagtgata atttctgggt 1080taaggcaata gcaatatttc tgcatataaa
tatttctgca tataaattgt aactgatgta 1140agaggtttca tattgctaat agcagctaca
atccagctac cattctgctt ttattttatg 1200gttgggataa ggctggatta ttctgagtcc
aagctaggcc cttttgctaa tcatgttcat 1260acctcttatc ttcctcccac agctcctggg
caacgtgctg gtctgtgtgc tggcccatca 1320ctttggcaaa gaattgggat tcgaacatcg
gccgccacca tgaacgccag cgagttcagg 1380aggaggggca aggagatggt ggactacgtg
gccaactaca tggagggcat cgagggcagg 1440caggtgtacc ccgacgtgga gcccggctac
ctgaggcccc tgatccccgc cgccgccccc 1500caggagcccg acaccttcga ggacatcatc
aacgacgtgg agaagatcat catgcccggc 1560gtgacccact ggcacagccc ctacttcttc
gcctacttcc ccaccgccag cagctacccc 1620gccatgctgg ccgacatgct gtgcggcgcc
atcggctgca tcggcttcag ctgggccgcc 1680agccccgcct gcaccgagct ggagaccgtg
atgatggact ggctgggcaa gatgctggag 1740ctgcccaagg ccttcctgaa cgagaaggcc
ggcgagggcg gcggcgtgat ccagggcagc 1800gccagcgagg ccaccctggt ggccctgctg
gccgccagga ccaaggtgat ccacaggctg 1860caggccgcca gccccgagct gacccaggcc
gccatcatgg agaagctggt ggcctacagc 1920agcgaccagg cccacagcag cgtggagagg
gccggcctga tcggcggcgt gaagctgaag 1980gccatcccca gcgacggcaa cttcgccatg
agggccagcg ccctgcagga ggccctggag 2040agggacaagg ccgccggcct gatccccttc
ttcatggtgg ccaccctggg caccaccacc 2100tgctgcagct tcgacaacct gctggaggtg
ggccccatct gcaacaagga ggacatctgg 2160ctgcacgtgg acgccgccta cgccggcagc
gccttcatct gccccgagtt caggcacctg 2220ctgaacggcg tggagttcgc cgacagcttc
aacttcaacc cccacaagtg gctgctggtg 2280aacttcgact gcagcgccat gtgggtgaag
aagaggaccg acctgaccgg cgccttcagg 2340ctggacccca cctacctgaa gcacagccac
caggacagcg gcctgatcac cgactacagg 2400cactggcaga tccccctggg caggaggttc
aggagcctga agatgtggtt cgtgttcagg 2460atgtacggcg tgaagggcct gcaggcctac
atcaggaagc acgtgcagct gagccacgag 2520ttcgagagcc tggtgaggca ggaccccagg
ttcgagatct gcgtggaggt gatcctgggc 2580ctggtgtgct tcaggctgaa gggcagcaac
aaggtgaacg aggccctgct gcagaggatc 2640aacagcgcca agaagatcca cctggtgccc
tgccacctga gggacaagtt cgtgctgagg 2700ttcgccatct gcagcaggac cgtggagagc
gcccacgtgc agagggcctg ggagcacatc 2760aaggagctgg ccgccgacgt gctgagggcc
gagagggagt gagctgctcg agagatctac 2820gggtggcatc cctgtgaccc ctccccagtg
cctctcctgg ccctggaagt tgccactcca 2880gtgcccacca gccttgtcct aataaaatta
agttgcatca ttttgtctga ctaggtgtcc 2940ttctataata ttatggggtg gaggggggtg
gtatggagca aggggcaagt tgggaagaca 3000acctgtaggg cctgcggggt ctattgggaa
ccaagctgga gtgcagtggc acaatcttgg 3060ctcactgcaa tctccgcctc ctgggttcaa
gcgattctcc tgcctcagcc tcccgagttg 3120ttgggattcc aggcatgcat gaccaggctc
agctaatttt tgtttttttg gtagagacgg 3180ggtttcacca tattggccag gctggtctcc
aactcctaat ctcaggtgat ctacccacct 3240tggcctccca aattgctggg attacaggcg
tgaaccactg ctcccttccc tgtccttctg 3300attttgtagg taaccacgtg cggaccgagc
ggccgcagtt aattaagctc gcgaaggaac 3360ccctagtgat ggagttggcc actccctctc
tgcgcgctcg ctcgctcact gaggccgggc 3420gaccaaaggt cgcccgacgc ccgggctttg
cccgggcggc ctcagtgagc gagcgagcgc 3480gcagagaggg agtggccaa
3499223896DNAArtificial
SequenceDescription of Artificial Sequence Synthetic polynucleotide
22cctgcaggca gctgcgcgct cgctcgctca ctgaggccgc ccgggcaaag cccgggcgtc
60gggcgacctt tggtcgcccg gcctcagtga gcgagcgagc gcgcagagag ggagtggcca
120actccatcac taggggttcc tgagtttaaa cttcgtcgac gatctgcggc cgcacgcgtg
180gagctagtta ttaatagtaa tcaattacgg ggtcattagt tcatagccca tatatggagt
240tccgcgttac ataacttacg gtaaatggcc cgcctggctg accgcccaac gacccccgcc
300cattgacgtc aataatgacg tatgttccca tagtaacgtc aatagggact ttccattgac
360gtcaatgggt ggagtattta cggtaaactg cccacttggc agtacatcaa gtgtatcata
420tgccaagtac gccccctatt gacgtcaatg acggtaaatg gcccgcctgg cattatgccc
480agtacatgac cttatgggac tttcctactt ggcagtacat ctacgtatta gtcatcgcta
540ttaccatggt gatgcggttt tggcagtaca tcaatgggcg tggatagcgg tttgactcac
600ggggatttcc aagtctccac cccattgacg tcaatgggag tttgttttgc accaaaatca
660acgggacttt ccaaaatgtc gtaacaactc cgccccattg acgcaaatgg gcggtaggcg
720tgtacggtgg gaggtctata taagcagagc tcgtttagtg aaccgtcaga tcgcctggag
780acgccatcca cgctgttttg acctccatag aagacaccgg gaccgatcca gcctccgcgg
840attcgaatcc cggccgggaa cggtgcattg gaacgcggat tccccgtgcc aagagtgacg
900taagtaccgc ctatagagtc tataggccca caaaaaatgc tttcttcttt taatatactt
960ttttgtttat cttatttcta atactttccc taatctcttt ctttcagggc aataatgata
1020caatgtatca tgcctctttg caccattcta aagaataaca gtgataattt ctgggttaag
1080gcaatagcaa tatttctgca tataaatatt tctgcatata aattgtaact gatgtaagag
1140gtttcatatt gctaatagca gctacaatcc agctaccatt ctgcttttat tttatggttg
1200ggataaggct ggattattct gagtccaagc taggcccttt tgctaatcat gttcatacct
1260cttatcttcc tcccacagct cctgggcaac gtgctggtct gtgtgctggc ccatcacttt
1320ggcaaagaat tgggattcga acatcggccg ccaccatgaa cgcaagtgaa ttccgaagga
1380gagggaagga gatggtggat tacgtggcca actacatgga aggcattgag ggacgccagg
1440tctaccctga cgtggagccc gggtacctgc ggccgctgat ccctgccgct gcccctcagg
1500agccagacac gtttgaggac atcatcaacg acgttgagaa gataatcatg cctggggtga
1560cgcactggca cagcccctac ttcttcgcct acttccccac tgccagctcg tacccggcca
1620tgcttgcgga catgctgtgc ggggccattg gctgcatcgg cttctcctgg gcggcaagcc
1680cagcatgcac agagctggag actgtgatga tggactggct cgggaagatg ctggaactac
1740caaaggcatt tttgaatgag aaagctggag aagggggagg agtgatccag ggaagtgcca
1800gtgaagccac cctggtggcc ctgctggccg ctcggaccaa agtgatccat cggctgcagg
1860cagcgtcccc agagctcaca caggccgcta tcatggagaa gctggtggct tactcatccg
1920atcaggcaca ctcctcagtg gaaagagctg ggttaattgg tggagtgaaa ttaaaagcca
1980tcccctcaga tggcaacttc gccatgcgtg cgtctgccct gcaggaagcc ctggagagag
2040acaaagcggc tggcctgatt cctttcttta tggttgccac cctggggacc acaacatgct
2100gctcctttga caatctctta gaagtcggtc ctatctgcaa caaggaagac atatggctgc
2160acgttgatgc agcctacgca ggcagtgcat tcatctgccc tgagttccgg caccttctga
2220atggagtgga gtttgcagat tcattcaact ttaatcccca caaatggcta ttggtgaatt
2280ttgactgttc tgccatgtgg gtgaaaaaga gaacagactt aacgggagcc tttagactgg
2340accccactta cctgaagcac agccatcagg attcagggct tatcactgac taccggcatt
2400ggcagatacc actgggcaga agatttcgct ctttgaaaat gtggtttgta tttaggatgt
2460atggagtcaa aggactgcag gcttatatcc gcaagcatgt ccagctgtcc catgagtttg
2520agtcactggt gcgccaggat ccccgctttg aaatctgtgt ggaagtcatt ctggggcttg
2580tctgctttcg gctaaagggt tccaacaaag tgaatgaagc tcttctgcaa agaataaaca
2640gtgccaaaaa aatccacttg gttccatgtc acctcaggga caagtttgtc ctgcgctttg
2700ccatctgttc tcgcacggtg gaatctgccc atgtgcagcg ggcctgggaa cacatcaaag
2760agctggcggc cgacgtgctg cgagcagaga gggagtagga gtgaagccag ctgcaggaat
2820caaaaattga agagagatat atctgaaaac tggaataaga agcaaataaa tatcatcctg
2880ccttcatgga actcagctgt ctgtggcttc ccatgtcttt ctccaaagtt atccagaggg
2940ttgtgatttt gtctgcttag tatctcatca acaaagaaat attatttgct aattaaaaag
3000ttaatcttca tggccatagc ttttattcat tagctgtgat ttttgttgat taaaacatta
3060tagattttca tgttcttgca gtcatcagaa gtggtaggaa agcctcactg atatattttc
3120cagggcaatc aatgttcacg caacttgaaa ttatatctgt ggtcttcaaa ttgtcttttg
3180tcatgtggct aaatgcctaa taagctgctc gagagatcta cgggtggcat ccctgtgacc
3240cctccccagt gcctctcctg gccctggaag ttgccactcc agtgcccacc agccttgtcc
3300taataaaatt aagttgcatc attttgtctg actaggtgtc cttctataat attatggggt
3360ggaggggggt ggtatggagc aaggggcaag ttgggaagac aacctgtagg gcctgcgggg
3420tctattggga accaagctgg agtgcagtgg cacaatcttg gctcactgca atctccgcct
3480cctgggttca agcgattctc ctgcctcagc ctcccgagtt gttgggattc caggcatgca
3540tgaccaggct cagctaattt ttgttttttt ggtagagacg gggtttcacc atattggcca
3600ggctggtctc caactcctaa tctcaggtga tctacccacc ttggcctccc aaattgctgg
3660gattacaggc gtgaaccact gctcccttcc ctgtccttct gattttgtag gtaaccacgt
3720gcggaccgag cggccgcagt taattaagct cgcgaaggaa cccctagtga tggagttggc
3780cactccctct ctgcgcgctc gctcgctcac tgaggccggg cgaccaaagg tcgcccgacg
3840cccgggcttt gcccgggcgg cctcagtgag cgagcgagcg cgcagctgcc tgcagg
3896233475DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 23cagctgcgcg ctcgctcgct cactgaggcc
gcccgggcaa agcccgggcg tcgggcgacc 60tttggtcgcc cggcctcagt gagcgagcga
gcgcgcagag agggagtggc caactccatc 120actaggggtt gagtttaaac ttcgtcgacg
atctgcggcc gcacgcgtgg agctagttat 180taatagtaat caattacggg gtcattagtt
catagcccat atatggagtt ccgcgttaca 240taacttacgg taaatggccc gcctggctga
ccgcccaacg acccccgccc attgacgtca 300ataatgacgt atgttcccat agtaacgtca
atagggactt tccattgacg tcaatgggtg 360gagtatttac ggtaaactgc ccacttggca
gtacatcaag tgtatcatat gccaagtacg 420ccccctattg acgtcaatga cggtaaatgg
cccgcctggc attatgccca gtacatgacc 480ttatgggact ttcctacttg gcagtacatc
tacgtattag tcatcgctat taccatggtg 540atgcggtttt ggcagtacat caatgggcgt
ggatagcggt ttgactcacg gggatttcca 600agtctccacc ccattgacgt caatgggagt
ttgttttgca ccaaaatcaa cgggactttc 660caaaatgtcg taacaactcc gccccattga
cgcaaatggg cggtaggcgt gtacggtggg 720aggtctatat aagcagagct cgtttagtga
accgtcagat cgcctggaga cgccatccac 780gctgttttga cctccataga agacaccggg
accgatccag cctccgcgga ttcgaatccc 840ggccgggaac ggtgcattgg aacgcggatt
ccccgtgcca agagtgacgt aagtaccgcc 900tatagagtct ataggcccac aaaaaatgct
ttcttctttt aatatacttt tttgtttatc 960ttatttctaa tactttccct aatctctttc
tttcagggca ataatgatac aatgtatcat 1020gcctctttgc accattctaa agaataacag
tgataatttc tgggttaagg caatagcaat 1080atttctgcat ataaatattt ctgcatataa
attgtaactg atgtaagagg tttcatattg 1140ctaatagcag ctacaatcca gctaccattc
tgcttttatt ttatggttgg gataaggctg 1200gattattctg agtccaagct aggccctttt
gctaatcatg ttcatacctc ttatcttcct 1260cccacagctc ctgggcaacg tgctggtctg
tgtgctggcc catcactttg gcaaagaatt 1320gggattcgaa catcggccgc caccatgaac
gcaagtgaat tccgaaggag agggaaggag 1380atggtggatt acgtggccaa ctacatggaa
ggcattgagg gacgccaggt ctaccctgac 1440gtggagcccg ggtacctgcg gccgctgatc
cctgccgctg cccctcagga gccagacacg 1500tttgaggaca tcatcaacga cgttgagaag
ataatcatgc ctggggtgac gcactggcac 1560agcccctact tcttcgccta cttccccact
gccagctcgt acccggccat gcttgcggac 1620atgctgtgcg gggccattgg ctgcatcggc
ttctcctggg cggcaagccc agcatgcaca 1680gagctggaga ctgtgatgat ggactggctc
gggaagatgc tggaactacc aaaggcattt 1740ttgaatgaga aagctggaga agggggagga
gtgatccagg gaagtgccag tgaagccacc 1800ctggtggccc tgctggccgc tcggaccaaa
gtgatccatc ggctgcaggc agcgtcccca 1860gagctcacac aggccgctat catggagaag
ctggtggctt actcatccga tcaggcacac 1920tcctcagtgg aaagagctgg gttaattggt
ggagtgaaat taaaagccat cccctcagat 1980ggcaacttcg ccatgcgtgc gtctgccctg
caggaagccc tggagagaga caaagcggct 2040ggcctgattc ctttctttat ggttgccacc
ctggggacca caacatgctg ctcctttgac 2100aatctcttag aagtcggtcc tatctgcaac
aaggaagaca tatggctgca cgttgatgca 2160gcctacgcag gcagtgcatt catctgccct
gagttccggc accttctgaa tggagtggag 2220tttgcagatt cattcaactt taatccccac
aaatggctat tggtgaattt tgactgttct 2280gccatgtggg tgaaaaagag aacagactta
acgggagcct ttagactgga ccccacttac 2340ctgaagcaca gccatcagga ttcagggctt
atcactgact accggcattg gcagatacca 2400ctgggcagaa gatttcgctc tttgaaaatg
tggtttgtat ttaggatgta tggagtcaaa 2460ggactgcagg cttatatccg caagcatgtc
cagctgtccc atgagtttga gtcactggtg 2520cgccaggatc cccgctttga aatctgtgtg
gaagtcattc tggggcttgt ctgctttcgg 2580ctaaagggtt ccaacaaagt gaatgaagct
cttctgcaaa gaataaacag tgccaaaaaa 2640atccacttgg ttccatgtca cctcagggac
aagtttgtcc tgcgctttgc catctgttct 2700cgcacggtgg aatctgccca tgtgcagcgg
gcctgggaac acatcaaaga gctggcggcc 2760gacgtgctgc gagcagagag ggagtaggag
tgagctgctc gagagatcta cgggtggcat 2820ccctgtgacc cctccccagt gcctctcctg
gccctggaag ttgccactcc agtgcccacc 2880agccttgtcc taataaaatt aagttgcatc
attttgtctg actaggtgtc cttctataat 2940attatggggt ggaggggggt ggtatggagc
aaggggcaag ttgggaagac aacctgtagg 3000gcctgcgggg tctattggga accaagctgg
agtgcagtgg cacaatcttg gctcactgca 3060atctccgcct cctgggttca agcgattctc
ctgcctcagc ctcccgagtt gttgggattc 3120caggcatgca tgaccaggct cagctaattt
ttgttttttt ggtagagacg gggtttcacc 3180atattggcca ggctggtctc caactcctaa
tctcaggtga tctacccacc ttggcctccc 3240aaattgctgg gattacaggc gtgaaccact
gctcccttcc ctgtccttct gattttgtag 3300gtaaccacgt gcggaccgag cggccgcagt
taattaagct cgcgaaaccc ctagtgatgg 3360agttggccac tccctctctg cgcgctcgct
cgctcactga ggccgggcga ccaaaggtcg 3420cccgacgccc gggctttgcc cgggcggcct
cagtgagcga gcgagcgcgc agctg 3475
User Contributions:
Comment about this patent or add new information about this topic: