TRANSGENIC MICROORGANISMS AND SYNTHESIS OF PIPERAZIC ACID, PIPERAZIC ACID CONTAINING PRODUCTS, AND DERIVATIVES THEREOF

Abstract

Among the various aspects of the present disclosure is the provision of a biological and biochemical production of piperazic acid derived from the newly discovered production pathway for L-piperazic acid. One aspect of the present disclosure includes a transgenic microorganism (e.g., bacteria) engineered to accumulate piperazic acid and derivatives thereof, including a piperazic acid (Piz)-containing product. Another aspect of the present disclosure includes biochemical and biological methods for producing piperazic acid and derivatives thereof, including a piperazic acid (Piz)-containing product. Another aspect of the present disclosure includes compositions and methods of using isotopically labeled piperazic acid and derivatives thereof, including a piperazic acid (Piz)-containing product.

Description

CROSS-REFERENCE TO RELATED APPLICATIONS

[0001] This application claims priority from U.S. Provisional Application Ser. No. 62/527,586 filed on 30 Jun. 2017, which is incorporated herein by reference in its entirety.

STATEMENT REGARDING FEDERALLY SPONSORED RESEARCH OR DEVELOPMENT

[0002] Not Applicable.

MATERIAL INCORPORATED-BY-REFERENCE

[0003] The Sequence Listing, which is a part of the present disclosure, includes a computer readable form comprising nucleotide and/or amino acid sequences of the present invention. The subject matter of the Sequence Listing is incorporated herein by reference in its entirety.

FIELD OF THE INVENTION

[0004] The present disclosure generally relates to the synthesis of piperazic acid.

BACKGROUND OF THE INVENTION

[0005] Piperazic acid (Piz) is a nonproteinogenic amino acid that contains a characteristic and biochemically unusual N--N bond. Piz is a proline structural mimic, and Piz-containing compounds are of significant interest for drug discovery. Piz itself is not bioactive, but peptidic compounds incorporating Piz as a building block include antibacterial, antiviral, immunomodulatory, and anticancer drug leads. Intriguingly, all naturally-occurring Piz containing compounds discovered thus far have been bioactive.

SUMMARY OF THE INVENTION

[0006] Among the various aspects of the present disclosure is the provision of a biological and biochemical production of enantiopure piperazic acid derived from the newly discovered production pathway for L-piperazic acid. For example, the present disclosure provides for a transgenic microorganism for the synthesis of L-piperazic acid and derivatives thereof and additional biosynthetic processes for the production of L-piperazic acid and derivatives thereof.

[0007] Briefly, therefore, the present disclosure is directed to methods of producing piperazic acid, especially L-piperazic acid and derivatives thereof. Synthesis of enantiopure L-Piz has been elusive and expensive. The methods and transgenic organisms as described herein have overcome many of the challenges currently faced regarding the synthesis of enantiopure L-Piz. L-Piz and derivatives thereof can be used as a starting material for a large range of bioactive molecules, including many currently known therapeutics and can be isotopically labeled for use in drug discovery analyses and imaging modalities. The new synthetic routes can give access to isotope (e.g., .sup.15N, .sup.13C, .sup.2H) or radioisotopically-labeled piperazic acid for which no synthetic pathways are currently reported.

[0008] One aspect of the present disclosure includes transgenic microorganisms (e.g., bacteria) engineered to accumulate piperazic acid and derivatives thereof, including a piperazic acid (Piz)-containing product.

[0009] Another aspect of the present disclosure includes biochemical and biological methods for producing piperazic acid and derivatives thereof, including a piperazic acid (Piz)-containing product.

[0010] Another aspect of the present disclosure includes compositions and methods of using isotopically labeled piperazic acid and derivatives thereof, including a piperazic acid (Piz)-containing product.

[0011] Another aspect of the present disclosure provides for a method for preparing a piperazic acid (Piz)-containing product. In some embodiments, the method comprises: (i) providing N.sup.5--OH-Ornithine or derivative thereof; (ii) providing a suitable enzyme comprising a N.sup.5--OH Ornithine cyclase/dehydratase; or (iii) optionally, buffer salts, a NADPH cofactor, Fe.sup.+2 salts, and a catalytic Flavin Adenine Dinucleotide (FAD) cofactor.

[0012] In some embodiments, the method further comprises: (i) providing an ornithine or a derivative thereof; or (ii) providing a suitable enzyme comprising an ornithine N.sup.5 hydroxylase.

[0013] In some embodiments, the (i) the N.sup.5--OH-Ornithine or derivative thereof is an enantiopure L-Ornithine or derivative thereof; (ii) the enzyme comprising N.sup.5--OH Ornithine cyclase/dehydratase is a L-N.sup.5--OH Ornithine cyclase/dehydratase or a PzbB enzyme; or (iii) the enzyme comprising ornithine N.sup.5 hydroxylase is an L-ornithine N.sup.5--OHase or a PzbA enzyme.

[0014] In some embodiments, the method is carried out in the absence of O.sub.2, substantially no O.sub.2, or in the presence of low O.sub.2.

[0015] In some embodiments, the method comprises a coupled enzyme assay.

[0016] In some embodiments, the piperazic acid (Piz)-containing product comprises a compound of formula:

##STR00001##

where R.sup.5 is a hydrogen, an alkyl, a piperazic acid, an acetyl, or a carboxyl protecting group; each R.sup.1 and R.sup.2 are independently selected from hydrogen or an amino protecting group, wherein R.sup.1 and R.sup.2 may be taken together to form a fused bicyclic or tricyclic amino protecting group; or each R.sup.3 and R.sup.4 are independently selected from a hydrogen, a halo (e.g., a chloro, a fluoro, a bromo, a iodo), or a hydroxyl. In some embodiments, R.sup.1 and R.sup.2 are not simultaneously hydrogen.

[0017] In some embodiments, the piperazic acid (Piz)-containing product is used as a starting material in a synthetic method of making a bioactive Piz-containing composition selected from the group consisting of: (i) an antibacterial agent, an antibiotic agent, an antitumor agent, an antiviral agent, an immunomodulatory agent, or an anti-inflammatory agent; (ii) a molecular probe, anticancer drug, or drug lead; (ii) a metalloprotease inhibitor, a caspase inhibitor, an angiotensin converting enzyme (ACE) inhibitor, an inflammatory peptide C5a antagonist, an oxytocin receptor antagonist, or a matylastin type-IV collagenase inhibitor; (iii) a dehydropiperazic acid; a chloropiperazic acid; a hydroxypiperazic acid; a monamycin, an aurantimycin, an antrimycin, an azinothricin, a luzopeptin, a kettapeptin, a quinoxapeptin, a lydiamycin, a piperazimycin, or a sangamide; or (iv) sanglifehrin A, pandanamide A, azinothricin, Sch392583, luzopeptin A, kutzernide 2, piperazic acid, L-piperazic acid, antrimycin, kettapeptin, GE3, A83586C, chloptosin, himastatin, luzopeptin, quinoxapeptin, lydiamycin, piperazimycin, sanglifehrin, sangamide NVP018, sangamide NVP019, sanglifehrin, Sch 382583; chloptosin, himastatin, verucopeptin, luzopeptin A, L-156,602, aurantimycin A, or L-156,373.

[0018] Another aspect of the present disclosure provides for a transgenic microorganism comprising an artificial DNA construct. In some embodiments, the transgenic microorganism comprises, as operably associated components in the 5' to 3' direction of transcription: (I)(a) a promoter functional in the microorganism; (b)(i) a first polynucleotide comprising a nucleotide sequence encoding a first polypeptide having a L-Ornithine N.sup.5 hydroxylase activity; (ii) a second polynucleotide comprising a nucleotide sequence encoding a second polypeptide having a L-Ornithine N.sup.5 cyclase activity or L-Ornithine N.sup.5 dehydratase activity; or (iii) a third polynucleotide comprising a nucleotide sequence encoding a third polypeptide having a L-Ornithine N.sup.5 hydroxylase activity and a L-Ornithine N.sup.5 cyclase activity or L-Ornithine N.sup.5 dehydratase activity; or (c) a transcriptional termination sequence; or (II)(a) a promoter functional in the microorganism; (b)(i) a first polynucleotide comprising a nucleotide sequence encoding a first polypeptide having PzbA activity; (ii) a second polynucleotide comprising a nucleotide sequence encoding a second polypeptide having PzbB activity; or (iii) a third polynucleotide comprising a nucleotide sequence encoding a first polypeptide having PzbA activity and PzbB activity; or (c) a transcriptional termination sequence. In some embodiments, the transgenic microorganism accumulates increased levels of a piperazic acid (Piz)-containing product, optionally L-Piz, compared to a microorganism not comprising the DNA construct.

[0019] In some embodiments, the microorganism comprises (a)(i) a nucleotide sequence encoding a polypeptide selected from SEQ ID NO: 1-SEQ ID NO: 81 or SEQ ID NO: 167-SEQ ID NO: 176 or a sequence at least 25% identical thereto having L-Ornithine N.sup.5 hydroxylase activity; or (ii) a nucleotide sequence encoding a polypeptide selected from SEQ ID NO: 82-SEQ ID NO: 166 or SEQ ID NO: 167-SEQ ID NO: 176 or a sequence at least 25% identical thereto having L-Ornithine N.sup.5 cyclase activity and L-Ornithine N.sup.5 dehydratase activity; or (b) a nucleotide sequence encoding a polypeptide selected from SEQ ID NO: 167-SEQ ID NO: 176 or a sequence at least 25% identical thereto having L-Ornithine N.sup.5 hydroxylase activity, L-Ornithine N.sup.5 cyclase activity, and L-Ornithine N.sup.5 dehydratase activity.

[0020] In some embodiments, the microorganism comprises: (i) a PzbA ortholog with at least about 25% identity to SEQ ID NO: 1-SEQ ID NO: 81 or SEQ ID NO: 167-SEQ ID NO: 176 and has PzbA activity to produce a piperazic acid (Piz)-containing product; (ii) a PzbB ortholog with at least about 25% identity to SEQ ID NO: 82-SEQ ID NO: 166 or SEQ ID NO: 167-SEQ ID NO: 176 and has PzbB activity to produce a piperazic acid (Piz)-containing product; or (iii) a PzbAB ortholog with at least about 25% identity to or SEQ ID NO: 167-SEQ ID NO: 176 and has PzbA and PzbB activity to produce a piperazic acid (Piz)-containing product.

[0021] In some embodiments, the microorganism is an Actinobacteria selected from the group consisting of Streptomyces, Corynebacterium, Kutzneria, and Actinomadura; is a heterologous population of microorganisms; is an Actinobacteria (optionally, an actinomycete); or is selected from the group consisting of Streptomyces lividans or Corynebacterium glutamicum, optionally carrying one or more copies of a native or non-native pzbA and optionally carrying one or more copies of pzbB.

[0022] In some embodiments, the transgenic microorganism overproduces L-Ornithine; the pzbA or the pzbB are cloned from a sanglifehrin biosynthetic locus of Streptomyces flaveolus; or a piperazic acid (Piz)-containing product accumulates within the microorganism.

[0023] Another aspect of the present disclosure provides for a method for producing a piperazic acid (Piz)-containing product. In some embodiments, the method comprises: (i) providing a transgenic microorganism capable of accumulating a piperazic acid (Piz)-containing product; (ii) cultivating the microorganism; or (iii) isolating accumulated piperazic acid (Piz)-containing product.

[0024] In some embodiments, the method comprises providing a transgenic microorganism and providing a feedstock, wherein the transgenic microorganism comprises at least one copy of pzbA and at least one copy of pzbB under a constitutive promoter; or the at least one pzbA is optionally a native copy.

[0025] In some embodiments, the transgenic microorganism is (i) a heterologous population of microorganisms; (ii) an Actinobacteria (optionally, an actinomycete); or (ii) selected from the group consisting of Streptomyces lividans or Corynebacterium glutamicum, optionally carrying one or more copies of a native or non-native pzbA and optionally carrying one or more copies of pzbB.

[0026] In some embodiments, the pzbA or pzbB are cloned from a sanglifehrin biosynthetic locus of Streptomyces flaveolus; or a piperazic acid (Piz)-containing product accumulates within the microorganism.

[0027] In some embodiments, the method is carried out in the absence of O.sub.2, substantially no O.sub.2, or in the presence of low O.sub.2.

[0028] In some embodiments, the piperazic acid (Piz)-containing product comprises a compound of formula:

##STR00002##

where: R.sup.5 is a hydrogen, an alkyl, a piperazic acid, an acetyl, or a carboxyl protecting group; each R.sup.1 and R.sup.2 are independently selected from hydrogen or an amino protecting group, wherein R.sup.1 and R.sup.2 may be taken together to form a fused bicyclic or tricyclic amino protecting group; or each R.sup.3 and R.sup.4 are independently selected from a hydrogen, a halo (e.g., a chloro, a fluoro, a bromo, a iodo), or hydroxyl. In some embodiments, R.sup.1 and R.sup.2 are not simultaneously hydrogen.

[0029] In some embodiments, the piperazic acid (Piz)-containing product is used as a starting material in the synthesis of a bioactive Piz-containing composition selected from the group consisting of: (i) an antibacterial agent, an antibiotic agent, an antitumor agent, an antiviral agent, an immunomodulatory agent, or an anti-inflammatory agent; (ii) a molecular probe, anticancer drug, or drug lead; (iii) a metalloprotease inhibitor, a caspase inhibitor, an angiotensin converting enzyme (ACE) inhibitor, an inflammatory peptide C5a antagonist, an oxytocin receptor antagonist, or a matylastin type-IV collagenase inhibitor; (iv) a dehydropiperazic acid; a chloropiperazic acid; a hydroxypiperazic acid; a monamycin, an aurantimycin, an antrimycin, an azinothricin, a luzopeptin, a kettapeptin, a quinoxapeptin, a lydiamycin, a piperazimycin, or a sangamide; or (v) sanglifehrin A, pandanamide A, azinothricin, Sch392583, luzopeptin A, kutzernide 2, piperazic acid, L-piperazic acid, antrimycin, kettapeptin, GE3, A83586C, chloptosin, himastatin, luzopeptin, quinoxapeptin, lydiamycin, piperazimycin, sanglifehrin, sangamide NVP018, sangamide NVP019, sanglifehrin, Sch 382583; chloptosin, himastatin, verucopeptin, luzopeptin A, L-156,602, aurantimycin A, or L-156,373.

[0030] Another aspect of the present disclosure provides for a composition comprising a radiolabeled piperazic acid-containing product or a pharmaceutically acceptable salt, solvate, or polymorph thereof, including all tautomers and stereoisomers thereof, optionally in combination with one or more pharmaceutically acceptable excipients.

[0031] Another aspect of the present disclosure provides for a method comprising a process for preparation of a radiolabeled piperazic acid-containing product comprising: (i) providing a radiolabeled N.sup.5--OH-Ornithine or derivative thereof; (ii) providing a suitable N.sup.5--OH Ornithine cyclase/dehydratase; or (iii) optionally, buffer salts, a NADPH cofactor, Fe.sup.+2 salts, and a catalytic Flavin Adenine Dinucleotide (FAD) cofactor.

[0032] In some embodiments, the method comprises: (i) providing a radiolabeled ornithine or a derivative thereof; or (ii) providing a suitable ornithine N.sup.5 hydroxylase.

[0033] In some embodiments, (i) the radiolabeled N.sup.5--OH-Ornithine or derivative thereof is an enantiopure radiolabeled L-Ornithine or derivative thereof; (ii) the enzyme comprising N.sup.5--OH Ornithine cyclase/dehydratase is L-N.sup.5--OH Ornithine cyclase/dehydratase or the enzyme PzbB, or (iii) the enzyme comprising ornithine N.sup.5 hydroxylase is a L-ornithine N.sup.5--OHase or the enzyme PzbA.

[0034] In some embodiments, the method comprises a coupled enzyme assay.

[0035] Another aspect of the present disclosure provides for a method of detecting radiolabeled piperazic acid-containing product. In some embodiments, the method comprises: (i) providing a microorganism; (ii) contacting the microorganism with a radiolabeled piperazic acid-containing product; or (iii) detecting a radiolabeled natural product, a radiolabeled biocatalysis product, or a radiolabeled metabolite.

[0036] Another aspect of the present disclosure provides for a the radiolabeled piperazic acid-containing product is: (i) labeled for use as a biologically active molecular probe as a drug discovery agent; or (ii) labeled for use in detecting a natural product drug lead compound.

[0037] Another aspect of the present disclosure provides for a piperazic acid (Piz)-containing product comprises: (i) a single radiolabel; (ii) a radiolabel selected from the group consisting of .sup.2H (D or deuterium), .sup.3H (T or tritium), .sup.11C, .sup.13C, .sup.14C, .sup.13N, .sup.15N, .sup.15O, .sup.17O, .sup.18O, .sup.18F, .sup.35S, .sup.36Cl, .sup.82Br, .sup.75Br, .sup.76Br, .sup.77Br, .sup.123I, .sup.124I, .sup.125I, and .sup.131I; (iii) a radiolabel selected from the group consisting of .sup.15N, .sup.13C, and .sup.2H; or (iv) a radiolabeled L-Piz or L-Piz derivative.

[0038] In some embodiments, the composition can be used in mass spectrometry, gamma imaging, magnetic resonance imaging, magnetic resonance spectroscopy, or fluorescence spectroscopy.

[0039] Other objects and features will be in part apparent and in part pointed out hereinafter.

DESCRIPTION OF THE DRAWINGS

[0040] Those of skill in the art will understand that the drawings, described below, are for illustrative purposes only. The drawings are not intended to limit the scope of the present teachings in any way.

[0041] FIG. 1 is a series of chemical structures showing examples of piperazic acid (Piz) family natural products. Piz and modified Piz (dehydropiperazic, chloropiperazic and hydroxypiperazic acid) molecular components are shown in red. All of these molecules are bioactive, with sanglifehrin (top left) under consideration as an immunosuppressant and Hepatitis-C antiviral. The small molecule in the center (Sch 382583) is a member of an emerging group of Piz containing metalloprotease inhibitors with clinical relevance as metastatic cancer and antibacterial antibiotic leads. All of these molecules are currently thought to be exclusively produced by actinobacteria. Piz and modified Piz (dehydropiperazic, chloropiperazic and hydroxypiperazic acid) molecular components are shown in red.

[0042] FIG. 2 shows orthologs of both PzbA (yellow) and PzbB (red) are found within biosynthetic gene clusters for known Piz-containing antibiotics. As these clusters encode molecules that are structurally dissimilar except for the incorporation of Piz, parsimony suggests both pzbA and pzbB (previously unrecognized) are involved in Piz biosynthesis.

[0043] FIG. 3 shows HPLC-ESI-MS detection of products and substrates with assay time points at time 0 min, 15 min, and 30 min showing the consumption of L-Orn, accumulation of the known intermediate N.sup.5--OH-Orn, and the concomitant formation of Piz. In vitro reconstitution of L-Piz production from L-Orn in a coupled enzymatic reaction containing purified PzbA, PzbB buffer salts, NADPH cofactor, Fe.sup.+2 salts, and catalytic FAD (Flavin Adenine Dinucleotide) cofactor according to Scheme 2. Not shown: In the same assay lacking PzbB, the enzyme product is N.sup.5--OH-Orn and no Piz is formed.

[0044] FIG. 4 is a series of LC/MS spectra of biosynthetic Piz compared against an authentic L-Piz standard (top row) showing in vivo production of L-Piz in a heterologous bacterial host, Streptomyces lividans. S. lividans (WT parent, no Piz production) is compared against S. lividans harboring a single copy of pzbA (sfaB) alone, pzbB (sfaC) alone, or co-expressing pzbA and pzbB (sfaBC) cloned from the sanglifehrin biosynthetic locus of Streptomyces flaveolus. LC/MS detection of biosynthetic Piz was compared against an authentic L-Piz standard (top row). In contrast with the in vitro data above, pzbA is dispensable in the heterologous system because S. lividans encodes a native copy of the gene as part of a siderophore biosynthetic pathway unrelated to Piz production. Thus, pzbA remains required for Piz production, but its role in bacteria is not limited to Piz anabolism. In contrast, it is currently thought that pzbB is only found associated with Piz production.

[0045] FIG. 5 is a series of LC/MS spectra showing the detection of sanglifehrin, a Piz-containing compound produced by Streptomyces flaveolus. Four major isobaric isomers of sanglifehrin A detected in WT S. flaveolus fermentation extracts. As expected from the results above, an unmarked gene deletion of pzbB (sfaC) from S. flaveolus abrogates sanglifehrin production. Genetic complementation of this mutant with an additional copy of pzbB, or exogenously supplied 50 .mu.M authentic L-Piz (top), restored the production of the four sanglifehrin A isobars. L-Piz is therefore cell penetrant and qualitatively nontoxic. These data additionally link pzbB function with Piz production in vivo, which agrees with the in vitro assay data.

[0046] FIG. 6 is a Marfey's derivatization analysis of the product of PzbB in an assay with L-N5 hydroxy Ornithine substrate (the product of PzbA) showing that the synthesized compound is enantiopure L-Piz.

[0047] FIG. 7 is a graph showing L-Piz production from various Streptomyces strains. Randomly selected environmental Streptomyces isolates were transformed with pYH015 via intergeneric conjugation as described for S. lividans.

DETAILED DESCRIPTION OF THE INVENTION

[0048] The present disclosure is based, at least in part, on the discovery of a complete biosynthetic pathway to L-Piz from the central metabolite L-Orn (the complete biosynthetic pathway not previously known). As shown herein, the present disclosure provides for biological and biochemical production of enantiopure L-piperazic acid. For example, the present disclosure provides for in vitro coupled enzyme assay furnished L-Piz or d.sub.7-L-Piz. As another example, the present disclosure provides for in vivo L-Piz production using genetically engineered S. lividans (natively containing pzbA-gene, pzbB engineered), and data indicating incorporation of L-Piz in L-Piz containing sanglifehrin.

[0049] Advantages of the methods as described herein include a more cost-effective method of producing L-Piz; the methods as described herein avoid the multi-step synthetic processes currently known in the art; the enzyme catalysts are typically stereospecific providing enantiopure products.

[0050] One aspect of the present disclosure provides for green biocatalysis of L-Piz in vitro, where no organic solvents and fewer reagents are used (see e.g., Example 2). Another aspect of the present disclosure provides an enzymatic route to heavy isotope-labelled Piz (see e.g., Example 3). Another aspect of the present disclosure provides green biocatalysis of L-Piz in vivo (see e.g., Example 4). Another aspect of the present disclosure provides Directed discovery of drugs and drug-like compounds using heavy isotope L-Piz (see e.g., Example 5). The processes as described herein enable a more efficient and less expensive means to produce L-Piz or isotopically labeled L-Piz. Also provided herein are genes or enzymes encoding Piz production.

[0051] Piperazic Acid-Containing Products

[0052] As described herein, piperazic acid (Piz)-containing products can be produced using a biochemical or biological approach.

[0053] A piperazic acid (Piz)-containing product can be piperazic acid or a derivative thereof (e.g., L-piperazic acid (L-Piz)).

[0054] Piperazic acid (Piz) (aka hexahydropyridazine-3-carboxylic acid) is a nonproteinogenic amino acid that contains a characteristic and biochemically unusual N--N bond.

##STR00003##

[0055] Piz is a proline structural mimic, and Piz-containing compounds are of significant interest for drug discovery. Piz itself is not bioactive, but peptidic compounds incorporating Piz as a building block include antibacterial, antiviral, immunomodulatory, and anticancer drug leads (see e.g., Oelke et al. 2011 Nat. Prod. Rep. (28) 1445-1471. Especially therapeutically interesting are Piz-containing metalloprotease inhibitors for drugging bacterial N-formylpeptidases, validated targets for antibiotic development. Intriguingly, all known naturally-occurring Piz containing compounds discovered thus far are bioactive. Beyond Piz natural products (i.e., naturally occurring compounds produced by live organisms), synthetic chemists are attracted to Piz as a synthetic building block for incorporation into drug-like compounds, molecular probes, and the like. As described herein, there are many bioactive piperazic acid-containing products.

[0056] For example, a piperazic acid-containing product can be any product comprising a piperazic acid, piperazic acid moiety, a piperazic add dipeptide fragment, or a derivative thereof.

[0057] In some embodiments, a piperazic acid-containing product can be Piz, L-Piz, a Piz derivative, a modified Piz, or a Piz-containing compound. For example, a Piz-containing compound or Piz derivative-containing compound can be:

##STR00004## ##STR00005##

[0058] As another example, a Piz derivative can be a dehydropiperazic acid, a chloropiperazic acid, or a hydroxypiperazic acid. As another example, a Piz derivative can be sanglifehrin or Sch 382583.

[0059] As another example, a Piz derivative can be:

##STR00006##

[0060] A starting material comprising Piz or a Pi-z derivative (e.g., L-Piz) can be a useful reagent for expanding chemical space in small molecule library, molecular analog construction, and molecular probes.

[0061] Previous synthetic routes (see e.g., U.S. Pat. No. 6,632,942, incorporated herein by reference) have a lower yield (.about.80%) than the processes as described herein (.about.100%). Furthermore, the previous methods require multi-step synthetic procedures (6 steps).

[0062] As an example, a Piz-containing product can be a monamycin. Exemplary monomycins are shown below.

TABLE-US-00001 ##STR00007## Compound R.sup.1 R.sup.2 R.sup.3 R.sup.4 Monamycin A H H Me H Monamycin B.sub.1 H H Me H Monamycin B.sub.2 H Me H H Monemycin B.sub.3 Me H H H Monamycin C Me H Me H Monamycin D.sub.1 Me H Me H Monamycin D.sub.2 H Me Me H Monamycin E Me Me Me H Monamycin F Me Me Me H Monamycin G.sub.1 H H Me Cl Monamycin G.sub.2 H Me H Cl Monamycin G.sub.3 Me H H Cl Monamycin H.sub.1 Me H Me Cl Monamycin H.sub.2 H Me Me Cl Monamycin I Me Me Me Cl

[0063] As another example, a Piz-containing product can be an antrimycin. Exemplary antrimycins are shown below.

TABLE-US-00002 ##STR00008## Compound R.sup.1 R.sup.2 Antrimycin A Me Et Antrimycin B Et Et Antrimycin C n-Pr Et Antrimycin D i-Bu Et Antrimycin Av Me Me Antrimycin Bv Et Me Antrimycin Cv n-Pr Me Antrimycin Dv i-Bu Me

[0064] As another example, a Piz-containing product can be an azinothricin. Exemplary azinothricins are shown below.

TABLE-US-00003 ##STR00009## Compound R.sup.1 R.sup.2 R.sup.3 R.sup.4 Azinothricin OMe Me H Me Kettapeptin OMe H H Me A38586C H H H Me GE3 H H i-Pr H

[0065] As another example, a Piz-containing product can be chloptosin or himastatin.

##STR00010##

[0066] As another example, a Piz-containing product can be a luzopeptin or a quinoxapeptin. Exemplary luzopeptins and quinoxapeptins are shown below.

TABLE-US-00004 ##STR00011## Compound R.sup.1 R.sup.2 Luzopeptin A Ac Ac Luzopeptin B H Ac Luzopeptin C H H ##STR00012## ##STR00013## Compound R.sup.1 R.sup.2 Quinoxapeptin A ##STR00014## ##STR00015## Quinoxapeptin B Ac ##STR00016## Quinoxapeptin C H H

[0067] As another example, a Piz-containing product can be a lydiamycin. Exemplary lydiamycins are shown below.

TABLE-US-00005 ##STR00017## Compound R.sup.1 R.sup.2 X--Y Lydiamycin A H H CH.sub.2--NH Lydiamycin B OH H CH.sub.2--NH Lydiamycin C H H CH.dbd.N Lydiamycin D OH OH CH.sub.2--NH

[0068] As another example, a Piz-containing product can be a piperazimycin. Exemplary piperazimycins are shown below.

TABLE-US-00006 ##STR00018## Compound R.sup.1 R.sup.2 Piperazimycin A OH Me Piperazimycin B H Me Piperazimycin C OH Et

[0069] As another example, a Piz-containing product can be a sanglifehrin. Exemplary sanglifehrins are shown below.

##STR00019##

[0070] Piperazic acid-containing products can be antibacterial, antiviral, immunomodulatory, or anticancer drug leads. Piperazic acid-containing products can be caspase (apoptosis, cytokine activation) inhibitors, angiotensin converting enzyme (ACE) inhibitors, anti-inflammatory agents (e.g., sanglifehrin), antitumor antibiotics (e.g., azinothricin, verucopeptin, himastatin, luzopeptin A, immunosuppressants (e.g., L-156,602 an inflammatory peptide C5a antagonist), antibiotics (e.g., Aurantimycin A (inhibits Gram-positive bacteria growth), monamycins), oxytocin receptor antagonist (e.g., L-156,373) (modulate behaviors), or Matylastin type-IV collagenase inhibitors. Piperazic acid-containing products can be antivirals (e.g., sangamides NVP018, NVP019 against chronic Hepatitis B).

[0071] In some embodiments the Piz-containing product can have the formula:

##STR00020##

wherein: R.sup.5 is a hydrogen, alkyl, a piperazic acid, acetyl, or carboxyl protecting group; and each R.sup.1 and R.sup.2 are independently selected from hydrogen or an amino protecting group, wherein R.sup.1 and R.sup.2 may be taken together to form a fused bicyclic or tricyclic amino protecting group; and each R.sup.3 and R.sup.4 are independently selected from hydrogen, halo (e.g., chloro, fluoro, etc.), or hydroxyl.

[0072] R groups (e.g., R.sup.1, R.sup.2, R.sup.3, R.sup.4, R.sup.5) or formula (I) can be optionally substituted with one or more groups independently selected from the group consisting of hydroxyl; hydroxyl; amine; C.sub.1-10carboxylic acid; C.sub.1-10carboxyl, straight chain or branched C.sub.1-10alkyl, optionally containing unsaturation; a C.sub.2-6 cycloalkyl optionally containing unsaturation or one oxygen or nitrogen atom; straight chain or branched C.sub.1-10alkyl amine; heterocyclyl; heterocyclic amine; and aryl comprising a phenyl; heteroaryl containing from 1 to 4 N, O, or S atoms; unsubstituted phenyl ring; substituted phenyl ring; unsubstituted heterocyclyl; and substituted heterocyclyl, wherein the unsubstituted phenyl ring or substituted phenyl ring can be optionally substituted with one or more groups independently selected from the group consisting of hydroxyl; hydroxyl; amine; C.sub.1-10carboxylic acid; C.sub.1-10carboxyl, straight chain or branched C.sub.1-10alkyl, optionally containing unsaturation; straight chain or branched C.sub.1-10alkyl amine, optionally containing unsaturation; a C.sub.2-6 cycloalkyl optionally containing unsaturation or one oxygen or nitrogen atom; straight chain or branched C.sub.1-10alkyl amine; heterocyclyl; heterocyclic amine; aryl comprising a phenyl; and heteroaryl containing from 1 to 4 N, O, or S atoms; and the unsubstituted heterocyclyl or substituted heterocyclyl can be optionally substituted with one or more groups independently selected from the group consisting of hydroxyl; hydroxyl; amine; C.sub.1-10carboxylic acid; C.sub.1-10carboxyl; straight chain or branched C.sub.1-10alkyl, optionally containing unsaturation; straight chain or branched C.sub.1-10alkyl amine, optionally containing unsaturation; a C.sub.2-6 cycloalkyl optionally containing unsaturation or one oxygen or nitrogen atom; heterocyclyl; straight chain or branched C.sub.1-10alkyl amine; heterocyclic amine; and aryl comprising a phenyl; and heteroaryl containing from 1 to 4 N, O, or S atoms.

[0073] The term "imine" or "imino", as used herein, unless otherwise indicated, includes a functional group or chemical compound containing a carbon-nitrogen double bond. The expression "imino compound", as used herein, unless otherwise indicated, refers to a compound that includes an "imine" or an "imino" group as defined herein.

[0074] The term "hydroxyl", as used herein, unless otherwise indicated, includes --OH.

[0075] The terms "halogen" and "halo", as used herein, unless otherwise indicated, include a chlorine, chloro, Cl; fluorine, fluoro, F; bromine, bromo, Br; or iodine, iodo, or I.

[0076] The term "aryl", as used herein, unless otherwise indicated, include a carbocyclic aromatic group. Examples of aryl groups include, but are not limited to, phenyl, benzyl, naphthyl, or anthracenyl.

[0077] The terms "amine" and "amino", as used herein, unless otherwise indicated, include a functional group that contains a nitrogen atom with a lone pair of electrons and wherein one or more hydrogen atoms have been replaced by a substituent such as, but not limited to, an alkyl group or an aryl group.

[0078] The term "alkyl", as used herein, unless otherwise indicated, includes saturated monovalent hydrocarbon radicals having straight or branched moieties, such as but not limited to, methyl, ethyl, propyl, butyl, pentyl, hexyl, octyl groups, etc. Representative straight-chain lower alkyl groups include, but are not limited to, -methyl, -ethyl, -n-propyl, -n-butyl, -n-pentyl, -n-hexyl, -n-heptyl and -n-octyl; while branched lower alkyl groups include, but are not limited to, -isopropyl, -sec-butyl, -isobutyl, -tert-butyl, -isopentyl, 2-methylbutyl, 2-methylpentyl, 3-methylpentyl, 2,2-dimethylbutyl, 2,3-dimethylbutyl, 2,2-dimethylpentyl, 2,3-dimethylpentyl, 3,3-dimethylpentyl, 2,3,4-trimethylpentyl, 3-methylhexyl, 2,2-dimethylhexyl, 2,4-dimethylhexyl, 2,5-dimethylhexyl, 3,5-dimethylhexyl, 2,4-dimethylpentyl, 2-methylheptyl, 3-methylheptyl, unsaturated C.sub.1-C.sub.8 alkyls include, but are not limited to, -vinyl, -allyl, -1-butenyl, -2-butenyl, -isobutylenyl, -1-pentenyl, -2-pentenyl, -3-methyl-1-butenyl, -2-methyl-2-butenyl, -2,3-dimethyl-2-butenyl, 1-hexyl, 2-hexyl, 3-hexyl, -acetylenyl, -propynyl, -1-butynyl, -2-butynyl, -1-pentynyl, -2-pentynyl, or -3-methyl-1 butynyl. An alkyl can be saturated, partially saturated, or unsaturated.

[0079] The term "carboxyl", as used herein, unless otherwise indicated, includes a functional group consisting of a carbon atom double bonded to an oxygen atom and single bonded to a hydroxyl group (--COOH).

[0080] The term "alkenyl", as used herein, unless otherwise indicated, includes alkyl moieties having at least one carbon-carbon double bond wherein alkyl is as defined above and including E and Z isomers of said alkenyl moiety. An alkenyl can be partially saturated or unsaturated.

[0081] The term "alkynyl", as used herein, unless otherwise indicated, includes alkyl moieties having at least one carbon-carbon triple bond wherein alkyl is as defined above. An alkynyl can be partially saturated or unsaturated.

[0082] The term "acyl", as used herein, unless otherwise indicated, includes a functional group derived from an aliphatic carboxylic acid, by removal of the hydroxyl (--OH) group.

[0083] The term "alkoxyl", as used herein, unless otherwise indicated, includes O-alkyl groups wherein alkyl is as defined above and O represents oxygen. Representative alkoxyl groups include, but are not limited to, --O-methyl, --O-ethyl, --O-n-propyl, --O-n-butyl, --O-n-pentyl, --O-n-hexyl, --O-n-heptyl, --O-n-octyl, --O-isopropyl, --O-sec-butyl, --O-isobutyl, --O-tert-butyl, --O-isopentyl, --O-2-methylbutyl, --O-2-methylpentyl, --O-3-methylpentyl, --O-2,2-dimethylbutyl, --O-2,3-dimethylbutyl, --O-2,2-dimethylpentyl, --O-2,3-dimethylpentyl, --O-3,3-dimethylpentyl, --O-2,3,4-trimethylpentyl, --O-3-methylhexyl, --O-2,2-dimethylhexyl, --O-2,4-dimethylhexyl, --O-2,5-dimethylhexyl, --O-3,5-dimethylhexyl, --O-2,4dimethylpentyl, --O-2-methylheptyl, --O-3-methylheptyl, --O-vinyl, --O-allyl, --O-1-butenyl, --O-2-butenyl, --O-isobutylenyl, --O-1-pentenyl, --O-2-pentenyl, --O-3-methyl-1-butenyl, --O-2-methyl-2-butenyl, --O-2,3-dimethyl-2-butenyl, --O-1-hexyl, --O-2-hexyl, --O-3-hexyl, --O-acetylenyl, --O-propynyl, --O-1-butynyl, --O-2-butynyl, --O-1-pentynyl, --O-2-pentynyl and --O-3-methyl-1-butynyl, --O-cyclopropyl, --O-cyclobutyl, --O-cyclopentyl, --O-cyclohexyl, --O-cycloheptyl, --O-cyclooctyl, --O-cyclononyl and --O-cyclodecyl, --O--CH.sub.2-cyclopropyl, --O--CH.sub.2-cyclobutyl, --O--CH.sub.2-cyclopentyl, --O--CH.sub.2-cyclohexyl, --O--CH.sub.2-cycloheptyl, --O--CH.sub.2-cyclooctyl, --O--CH.sub.2-cyclononyl, --O--CH.sub.2-cyclodecyl, --O--(CH.sub.2).sub.2-cyclopropyl, --O--(CH.sub.2).sub.2-cyclobutyl, --O--(CH.sub.2).sub.2-cyclopentyl, --O--(CH.sub.2).sub.2-cyclohexyl, --O--(CH.sub.2).sub.2-cycloheptyl, --O--(CH.sub.2).sub.2-cyclooctyl, --O--(CH.sub.2).sub.2-cyclononyl, or --O--(CH.sub.2).sub.2-cyclodecyl. An alkoxyl can be saturated, partially saturated, or unsaturated.

[0084] The term "cycloalkyl", as used herein, unless otherwise indicated, includes a non-aromatic, saturated, partially saturated, or unsaturated, monocyclic or fused, spiro or unfused bicyclic or tricyclic hydrocarbon referred to herein containing a total of from 3 to 10 carbon atoms, preferably 3 to 8 ring carbon atoms. Examples of cycloalkyls include, but are not limited to, C.sub.3-C.sub.8 cycloalkyl groups include, but are not limited to, -cyclopropyl, -cyclobutyl, -cyclopentyl, -cyclopentadienyl, -cyclohexyl, -cyclohexenyl, -1,3-cyclohexadienyl, -1,4-cyclohexadienyl, -cycloheptyl, -1,3-cycloheptadienyl, -1,3,5-cycloheptatrienyl, -cyclooctyl, and -cyclooctadienyl.

[0085] The term "cycloalkyl" also includes -lower alkyl-cycloalkyl, wherein lower alkyl and cycloalkyl are as defined herein. Examples of -lower alkyl-cycloalkyl groups include, but are not limited to, --CH.sub.2-cyclopropyl, --CH.sub.2-cyclobutyl, --CH.sub.2-cyclopentyl, --CH.sub.2-cyclopentadienyl, --CH.sub.2-cyclohexyl, --CH.sub.2-cycloheptyl, or --CH.sub.2-cyclooctyl.

[0086] The term "heterocyclic", as used herein, unless otherwise indicated, includes an aromatic or non-aromatic cycloalkyl in which one to four of the ring carbon atoms are independently replaced with a heteroatom from the group consisting of O, S and N. Representative examples of a heterocycle include, but are not limited to, benzofuranyl, benzothiophene, indolyl, benzopyrazolyl, coumarinyl, isoquinolinyl, pyrrolyl, pyrrolidinyl, thiophenyl, furanyl, thiazolyl, imidazolyl, pyrazolyl, triazolyl, quinolinyl, pyrimidinyl, pyridinyl, pyridonyl, pyrazinyl, pyridazinyl, isothiazolyl, isoxazolyl, (1,4)-dioxane, (1,3)-dioxolane, 4,5-dihydro-1H-imidazolyl, or tetrazolyl. Heterocycles can be substituted or unsubstituted. Heterocycles can also be bonded at any ring atom (i.e., at any carbon atom or heteroatom of the heterocyclic ring). A heterocyclic can be saturated, partially saturated, or unsaturated.

[0087] The term "cyano", as used herein, unless otherwise indicated, includes a --CN group.

[0088] The term "alcohol", as used herein, unless otherwise indicated, includes a compound in which the hydroxyl functional group (--OH) is bound to a carbon atom. In particular, this carbon center should be saturated, having single bonds to three other atoms.

[0089] The term "solvate" is intended to mean a solvate form of a specified compound that retains the effectiveness of such compound. Examples of solvates include compounds of the invention in combination with, for example: water, isopropanol, ethanol, methanol, dimethylsulfoxide (DMSO), ethyl acetate, acetic acid, or ethanolamine.

[0090] The term "mmol", as used herein, is intended to mean millimole. The term "equiv", as used herein, is intended to mean equivalent. The term "mL", as used herein, is intended to mean milliliter. The term "g", as used herein, is intended to mean gram. The term "kg", as used herein, is intended to mean kilogram. The term ".mu.g", as used herein, is intended to mean micrograms. The term "h", as used herein, is intended to mean hour. The term "min", as used herein, is intended to mean minute. The term "M", as used herein, is intended to mean molar. The term ".mu.L", as used herein, is intended to mean microliter. The term ".mu.M", as used herein, is intended to mean micromolar. The term "nM", as used herein, is intended to mean nanomolar. The term "N", as used herein, is intended to mean normal. The term "amu", as used herein, is intended to mean atomic mass unit. The term ".degree. C.", as used herein, is intended to mean degree Celsius. The term "wt/wt", as used herein, is intended to mean weight/weight. The term "v/v", as used herein, is intended to mean volume/volume. The term "MS", as used herein, is intended to mean mass spectroscopy. The term "HPLC", as used herein, is intended to mean high performance liquid chromatograph. The term "RT", as used herein, is intended to mean room temperature. The term "e.g.", as used herein, is intended to mean example. The term "N/A", as used herein, is intended to mean not tested.

[0091] As used herein, the expression "pharmaceutically acceptable salt" refers to pharmaceutically acceptable organic or inorganic salts of a compound of the invention. Preferred salts include, but are not limited, to sulfate, citrate, acetate, oxalate, chloride, bromide, iodide, nitrate, bisulfate, phosphate, acid phosphate, isonicotinate, lactate, salicylate, acid citrate, tartrate, oleate, tannate, pantothenate, bitartrate, ascorbate, succinate, maleate, gentisinate, fumarate, gluconate, glucaronate, saccharate, formate, benzoate, glutamate, methanesulfonate, ethanesulfonate, benzenesulfonate, p-toluenesulfonate, or pamoate (i.e., 1,1'-methylene-bis-(2-hydroxy-3-naphthoate)) salts. A pharmaceutically acceptable salt may involve the inclusion of another molecule such as an acetate ion, a succinate ion or other counterion. The counterion may be any organic or inorganic moiety that stabilizes the charge on the parent compound. Furthermore, a pharmaceutically acceptable salt may have more than one charged atom in its structure. Instances where multiple charged atoms are part of the pharmaceutically acceptable salt can have multiple counterions. Hence, a pharmaceutically acceptable salt can have one or more charged atoms and/or one or more counterion. As used herein, the expression "pharmaceutically acceptable solvate" refers to an association of one or more solvent molecules and a compound of the invention. Examples of solvents that form pharmaceutically acceptable solvates include, but are not limited to, water, isopropanol, ethanol, methanol, DMSO, ethyl acetate, acetic acid, and ethanolamine. As used herein, the expression "pharmaceutically acceptable hydrate" refers to a compound of the invention, or a salt thereof, that further includes a stoichiometric or non-stoichiometric amount of water bound by non-covalent intermolecular forces.

[0092] Host

[0093] The host genetically engineered to accumulate a Piz compound can be any microorganism. One aspect of the present disclosure is directed to a transgenic microorganism engineered to accumulate L-piperazic acid (L-Piz). As described herein, a microorganism can be used in the biosynthesis of piperazic acid and piperazic acid derivatives. Exemplary microorganisms that can be engineered to accumulate Piz or Piz containing compounds include, but are not limited to, bacteria (e.g., actinobacteria, proteobacteria) or fungi (e.g., yeast).

[0094] As described herein, the microorganism can be a bacterium. In some embodiments, the microorganism can be in the Phylum, Actinobacteria or Proteobacteria. Any actinobacteria or proteiobacteria with native pzBA or pzbB genes can be suitable for use as a heterologous host.

[0095] Exemplary Proteobacteria that can be used in the biosynthesis of piperazic acid or piperazic acid derivatives can be Collimonas (a divergent member of the gram negative Burkholderiales). As an example, the Collimonas can be of the species Collimonas arenas; Collimonas fungivorans +; Collimonas pratensis; Collimonas sp. 16.2.3; Collimonas sp. 16.2.7; Collimonas sp. 16.3.1; Collimonas sp. 5.15; Collimonas sp. 8.2.7; Collimonas sp. A6AGF; Collimonas sp. A6ATD5; Collimonas sp. A9 1b-26a; Collimonas sp. AA5ATF; Collimonas sp. AD101; Collimonas sp. AD102; Collimonas sp. AD103; Collimonas sp. AD137; Collimonas sp. AD19; Collimonas sp. AD23; Collimonas sp. AD33; Collimonas sp. AD58; Collimonas sp. AD59; Collimonas sp. AD60; Collimonas sp. AD61; Collimonas sp. AD62; Collimonas sp. AD63; Collimonas sp. AD64; Collimonas sp. AD65; Collimonas sp. AD66; Collimonas sp. AD67; Collimonas sp. AD68; Collimonas sp. AD69; Collimonas sp. AD70; Collimonas sp. AD71; Collimonas sp. AD76; Collimonas sp. AD77; Collimonas sp. AD88; Collimonas sp. AD89; Collimonas sp. AD95; Collimonas sp. AD97; Collimonas sp. AD98; Collimonas sp. AD99; Collimonas sp. AR5(10); Collimonas sp. AR5(11); Collimonas sp. AR5(6); Collimonas sp. AS3(2); Collimonas sp. AS3(5); Collimonas sp. BJC15-A11; Collimonas sp. BJC15-A32; Collimonas sp. BPN72; Collimonas sp. BPN73; Collimonas sp. C2PN21; Collimonas sp. CB13; Collimonas sp. CB20; Collimonas sp. CT; Collimonas sp. CT_MP11E6; Collimonas sp. CT_MP11E8; Collimonas sp. CTO 113 b214; Collimonas sp. DEC-B5; Collimonas sp. ES3-61; Collimonas sp. F11; Collimonas sp. F14; Collimonas sp. GCM11; Collimonas sp. HPML71; Collimonas sp. HPN72; Collimonas sp. HPN73; Collimonas sp. III-15; Collimonas sp. III-27; Collimonas sp. III-32; Collimonas sp. III-35; Collimonas sp. III-47; Collimonas sp. III-48; Collimonas sp. III-5; Collimonas sp. III-9; Collimonas sp. IS343; Collimonas sp. IS0468_OTU1303; Collimonas sp. IS0613_OTU1303; Collimonas sp. ISO615_OTU1303; Collimonas sp. IS0616_OTU1303; Collimonas sp. ISO644_OTU1303; Collimonas sp. ISO648_OTU1303; Collimonas sp. KN-1; Collimonas sp. KW19; Collimonas sp. M1Ju29; Collimonas sp. M1U16; Collimonas sp. M1U8; Collimonas sp. M1U9; Collimonas sp. MF3_1; Collimonas sp. MH6; Collimonas sp. MPS11E8; Collimonas sp. NAR2(8); Collimonas sp. NAR7(1); Collimonas sp. NAR7(12); Collimonas sp. NAR7(15); Collimonas sp. NAS7(14); Collimonas sp. NAS9(14); Collimonas sp. NBRC 3740; Collimonas sp. NCCB 100027; Collimonas sp. RE1; Collimonas sp. RX265; Collimonas sp. S2U21; Collimonas sp. S2U31; Collimonas sp. S3.TSA.015; Collimonas sp. S5.ACT.019; Collimonas sp. S5.CEL.014; Collimonas sp. S5.TSA.011; Collimonas sp. S5.TSA.20; Collimonas sp. UR 9-06; Collimonas sp. wged101; Collimonas sp. wged148; Collimonas sp. wged41; Collimonas sp. wged45; Collimonas sp. wged84; Collimonas sp. wged96; or Collimonas sp. ZL261.

[0096] Exemplary Actinomycetes that can be used in the biosynthesis of piperazic acid or piperazic acid derivatives can be Actinoalloteichus, Actinomadura, Actinosynnema, Amycolatopsis, Frankia, Kibdelosporangium, Kutzneria, Lentzea, Mycobacterium, Pseudonocardia, Rhodococcus, Salinispora, Streptacidiphilus, or Streptomyces. These exemplary Actinomycetes are known to have strains with native pzbB, which would indicate that they can be heterologous hosts for Piz or Piz derivative production.

[0097] As described herein, an Actinobacteria that can be used in the biosynthesis of piperazic acid or piperazic acid derivatives can be of the genus Actinoalloteichus. As an example, the Actinoalloteichus can be of the species Actinoalloteichus alkalophilus; Actinoalloteichus cyanogriseus +, Actinoalloteichus hymeniacidonis; Actinoalloteichus nanshanensis; Actinoalloteichus sp. 10-82; Actinoalloteichus sp. 2216-6; Actinoalloteichus sp. 3BG8; Actinoalloteichus sp. AH97; Actinoalloteichus sp. CA; Actinoalloteichus sp. CA1, Actinoalloteichus sp. FXJ7.260; Actinoalloteichus sp. JAJ70, Actinoalloteichus sp. JAJ71; Actinoalloteichus sp. L2004; Actinoalloteichus sp. MA-32; Actinoalloteichus sp. MHA15, Actinoalloteichus sp. NPS-702; Actinoalloteichus sp. QAII6; Actinoalloteichus sp. SH18(2011); Actinoalloteichus sp. SHA6; Actinoalloteichus sp. TRM46408; Actinoalloteichus sp. TSI127-17, Actinoalloteichus sp. WH1-2216-6; or Actinoalloteichus spitiensis+.

[0098] As described herein, an Actinobacteria that can be used in the biosynthesis of piperazic acid or piperazic acid derivatives can be of the genus Actinomadura. As an example, the Actinomadura can be of the species Actinomadura alba; Actinomadura apis; Actinomadura atramentaria+; Actinomadura bangladeshensis; Actinomadura catellatispora; Actinomadura chibensis+; Actinomadura chokoriensis; Actinomadura citrea; Actinomadura coerulea; Actinomadura cremea+; Actinomadura echinospora; Actinomadura fibrosa; Actinomadura flavalba+; Actinomadura formosensis+; Actinomadura fulvescens; Actinomadura geliboluensis; Actinomadura glauciflava+; Actinomadura hallensis; Actinomadura hibisca+; Actinomadura keratinilytica; Actinomadura kijaniata+; Actinomadura latina+; Actinomadura livida; Actinomadura luteofluorescens; Actinomadura macra+; Actinomadura madurae+; Actinomadura maheshkhaliensis; Actinomadura melliaura; Actinomadura meridiana; Actinomadura mexicana; Actinomadura meyerae; Actinomadura miaoliensis; Actinomadura namibiensis; Actinomadura napierensis; Actinomadura nitritigenes; Actinomadura ochracea; Actinomadura oligospora+; Actinomadura pelletieri+; Actinomadura rifamycini+; Actinomadura rubrobrunea+; Actinomadura rudentiformis; Actinomadura rugatobispora; Actinomadura rupiterrae; Actinomadura scrupuli; Actinomadura sediminis; Actinomadura sp.; Actinomadura sp. 10-124; Actinomadura sp. 10-44; Actinomadura sp. 13670A; Actinomadura sp. 13679C; Actinomadura sp. 171712; Actinomadura sp. 171810; Actinomadura sp. 171812; Actinomadura sp. 171817; Actinomadura sp. 171824; Actinomadura sp. 171828; Actinomadura sp. 171839; Actinomadura sp. 171848; Actinomadura sp. 171849; Actinomadura sp. 172301; Actinomadura sp. 172301y; Actinomadura sp. 172302a; Actinomadura sp. 172315; Actinomadura sp. 172320; Actinomadura sp. 172512; Actinomadura sp. 1A01698; Actinomadura sp. 1g12710; Actinomadura sp. 21G792; Actinomadura sp. 2602GPT1-42; Actinomadura sp. 28a-59-3; Actinomadura sp. 28a-77-2; Actinomadura sp. 2EPS; Actinomadura sp. 3-196; Actinomadura sp. 306D04; Actinomadura sp. 3196; Actinomadura sp. 322C06; Actinomadura sp. 322G01; Actinomadura sp. 334D05; Actinomadura sp. 334E07; Actinomadura sp. 337H02; Actinomadura sp. 387B11; Actinomadura sp. 387H07; Actinomadura sp. 392-1; Actinomadura sp. 40007; Actinomadura sp. 40008; Actinomadura sp. 413D10; Actinomadura sp. 413F04; Actinomadura sp. 413G02; Actinomadura sp. 415A12; Actinomadura sp. 418H03; Actinomadura sp. 419B09; Actinomadura sp. 428G07; Actinomadura sp. 43-45-3; Actinomadura sp. 431D03; Actinomadura sp. 431D09; Actinomadura sp. 6192; Actinomadura sp. 8-104; Actinomadura sp. A16; Actinomadura sp. A17; Actinomadura sp. AC104; Actinomadura sp. AF-555; Actinomadura sp. AML286; Actinomadura sp. AML34; Actinomadura sp. AML691; Actinomadura sp. AMS667; Actinomadura sp. ANSum10; Actinomadura sp. ART34; Actinomadura sp. ART64; Actinomadura sp. AV1; Actinomadura sp. AW310; Actinomadura sp. BK148; Actinomadura sp. CAP 48; Actinomadura sp. CC 0580; Actinomadura sp. CNQ-052_SD01; Actinomadura sp. CNT-075_SF06; Actinomadura sp. CNU-125 PL04; Actinomadura sp. CNU125 PL04; Actinomadura sp. CPCC201357; Actinomadura sp. CPCC202697; Actinomadura sp. DLS-42; Actinomadura sp. DLS-70; Actinomadura sp. DNK540; Actinomadura sp. E6; Actinomadura sp. EGI 80046; Actinomadura sp. EGI 80170; Actinomadura sp. EHA-2; Actinomadura sp. ERI-11; Actinomadura sp. EXM-24-2; Actinomadura sp. EXM-7-1; Actinomadura sp. EYN-10-1; Actinomadura sp. EYN-4-5; Actinomadura sp. FIM95-F26; Actinomadura sp. FXJ1.340; Actinomadura sp. FXJ6.213; Actinomadura sp. FXJ6.337; Actinomadura sp. FXJ7.135; Actinomadura sp. FXJ7.250; Actinomadura sp. FZ04; Actinomadura sp. G08C011; Actinomadura sp. GD15; Actinomadura sp. GKU 128; Actinomadura sp. GKU 147; Actinomadura sp. GKU 154; Actinomadura sp. GKU 157; Actinomadura sp. GKU 505; Actinomadura sp. GKU 822; Actinomadura sp. GMKU359; Actinomadura sp. H590; Actinomadura sp. I43-1; Actinomadura sp. ID05-A0321; Actinomadura sp. IM-1232; Actinomadura sp. IM-1290; Actinomadura sp. IM-2953; Actinomadura sp. IM-3046; Actinomadura sp. IM-3889; Actinomadura sp. IM-5243; Actinomadura sp. IM-5508; Actinomadura sp. IM-5556; Actinomadura sp. IM-5929; Actinomadura sp. IM-6226; Actinomadura sp. IM-6793; Actinomadura sp. IM-6830; Actinomadura sp. IM-6847; Actinomadura sp. IM-6849; Actinomadura sp. IM-6891; Actinomadura sp. IM-6895; Actinomadura sp. IM-6933; Actinomadura sp. IM-6993; Actinomadura sp. IM-7012; Actinomadura sp. IM-7044; Actinomadura sp. IM-7045; Actinomadura sp. IM-7056; Actinomadura sp. IM-7057; Actinomadura sp. IM-7092; Actinomadura sp. IM-7177; Actinomadura sp. IM-7187; Actinomadura sp. IM-7212; Actinomadura sp. IM-7213; Actinomadura sp. IM-7214; Actinomadura sp. IM-7222; Actinomadura sp. IM-7258; Actinomadura sp. IM-7397; Actinomadura sp. IM-7435; Actinomadura sp. IM-8473; Actinomadura sp. J4S16; Actinomadura sp. J4S4; Actinomadura sp. J5S1; Actinomadura sp. J5S10; Actinomadura sp. J5S17; Actinomadura sp. JCM 4674; Actinomadura sp. JSM 082016; Actinomadura sp. K22T; Actinomadura sp. KC-IT-F8; Actinomadura sp. KC-IT-H5; Actinomadura sp. L1958; Actinomadura sp. L2003; Actinomadura sp. L2097; Actinomadura sp. L2187; Actinomadura sp. LZ95; Actinomadura sp. M23; Actinomadura sp. M9; Actinomadura sp. MD49; Actinomadura sp. MNPostmon14; Actinomadura sp. MSSRFDF8; Actinomadura sp. NEAU-Jh1-3; Actinomadura sp. NEAU-Jh2-5; Actinomadura sp. new-30-5s-4-2; Actinomadura sp. new-30-5s-4-5; Actinomadura sp. NN236; Actinomadura sp. NN242; Actinomadura sp. NTRHn4; Actinomadura sp. OS1-43; Actinomadura sp. OS3-82; Actinomadura sp. OS3-83; Actinomadura sp. OS3-87; Actinomadura sp. OS3-89; Actinomadura sp. P3829; Actinomadura sp. P3842; Actinomadura sp. P3874; Actinomadura sp. PM2091; Actinomadura sp. PMPostmon12; Actinomadura sp. PN409; Actinomadura sp. PN414; Actinomadura sp. PN4221; Actinomadura sp. PN4222; Actinomadura sp. PN4223; Actinomadura sp. PN4226; Actinomadura sp. PN425; Actinomadura sp. Postmon13; Actinomadura sp. QAP 98-328-1842; Actinomadura sp. R-Ac152; Actinomadura sp. R10-32; Actinomadura sp. R16-14; Actinomadura sp. R17-27; Actinomadura sp. R39; Actinomadura sp. RD001933; Actinomadura sp. RK2_75; Actinomadura sp. RK59; Actinomadura sp. RK75; Actinomadura sp. RK79; Actinomadura sp. RS-52; Actinomadura sp. RtII23; Actinomadura sp. RtIII29; Actinomadura sp. RtIV13; Actinomadura sp. RtIV2; Actinomadura sp. RY35-68; Actinomadura sp. S14; Actinomadura sp. S19-10; Actinomadura sp. S19-13; Actinomadura sp. S2; Actinomadura sp. S20-30; Actinomadura sp. SBMs009; Actinomadura sp. SBSK-502; Actinomadura sp. Shinshu-MS-02; Actinomadura sp. Shinshu-MS-03; Actinomadura sp. SK74; Actinomadura sp. SpB081030SC-15; Actinomadura sp. SpC090624GE_01; Actinomadura sp. SR-43; Actinomadura sp. T16-1; Actinomadura sp. T3S5; Actinomadura sp. T5S13; Actinomadura sp. T5S5; Actinomadura sp. TCA62003; Actinomadura sp. TF1; Actinomadura sp. TFS 1144; Actinomadura sp. TFS 1200; Actinomadura sp. TFS 455; Actinomadura sp. TP-A0878; Actinomadura sp. UKMCC_L29; Actinomadura sp. VAN305; Actinomadura sp. WMMB 441; Actinomadura sp. WMMB 499; Actinomadura sp. WMMB 616; Actinomadura sp. XM-11-5; Actinomadura sp. XM-17-1; Actinomadura sp. XM-17-10; Actinomadura sp. XM-17-11; Actinomadura sp. XM-17-12; Actinomadura sp. XM-17-13; Actinomadura sp. XM-17-2; Actinomadura sp. XM-17-3; Actinomadura sp. XM-17-4; Actinomadura sp. XM-17-5; Actinomadura sp. XM-17-6; Actinomadura sp. XM-17-7; Actinomadura sp. XM-17-8; Actinomadura sp. XM-18-9; Actinomadura sp. XM-24-1; Actinomadura sp. XM-24-10; Actinomadura sp. XM-24-11; Actinomadura sp. XM-24-12; Actinomadura sp. XM-24-13; Actinomadura sp. XM-24-14; Actinomadura sp. XM-24-15; Actinomadura sp. XM-24-2; Actinomadura sp. XM-24-3; Actinomadura sp. XM-24-4; Actinomadura sp. XM-24-5; Actinomadura sp. XM-24-7; Actinomadura sp. XM-24-8; Actinomadura sp. XM-24-9; Actinomadura sp. XM-4-3; Actinomadura sp. XM-4-4; Actinomadura sp. XM-7-1; Actinomadura sp. XM-7-2; Actinomadura sp. XMU188; Actinomadura sp. Y218; Actinomadura sp. YIM 48842; Actinomadura sp. YIM 61608; Actinomadura sp. YIM 65605; Actinomadura sp. YIM 65650; Actinomadura sp. YIM 65655; Actinomadura sp. YIM 65659; Actinomadura sp. YIM 65663; Actinomadura sp. YIM 65810; Actinomadura sp. YIM 75700; Actinomadura sp. YIM 77502; Actinomadura sp. YIM 77510; Actinomadura sp. YIM M 10855; Actinomadura sp. YIM M 11143; Actinomadura sp. YIM M 11219; Actinomadura sp. YIM M11072; Actinomadura sp. YIM M11327; Actinomadura sp. YN-10-4; Actinomadura sp. YN-5-3; Actinomadura sp. YN-5-4; Actinomadura sp. YN-6-4; Actinomadura sp. YN-7-1; Actinomadura sp. YN-7-10; Actinomadura sp. YN-7-11; Actinomadura sp. YN-7-12; Actinomadura sp. YN-7-13; Actinomadura sp. YN-7-2; Actinomadura sp. YN-7-3; Actinomadura sp. YN-7-6; Actinomadura sp. YN-7-7; Actinomadura sp. YN-7-8; Actinomadura sp. YN-7-9; Actinomadura sp. YN-8-11; Actinomadura sp. ZZY-2013; Actinomadura sputi+; Actinomadura umbrina; Actinomadura verrucosospora; Actinomadura vinacea; Actinomadura viridilutea; Actinomadura viridis; Actinomadura vulgaris+; Actinomadura xylanilytica; Actinomadura yumaensis+; or Excellospora japonica.

[0099] As described herein, an Actinobacteria that can be used in the biosynthesis of piperazic acid or piperazic acid derivatives can be of the genus Actinosynnema. As an example, the Actinosynnema can be of the species Actinosynnema mirum or Actinosynnema pretiosum.

[0100] As described herein, an Actinobacteria that can be used in the biosynthesis of piperazic acid or piperazic acid derivatives can be of the genus Amycolatopsis. As an example, the Amycolatopsis can be of the species Amycolatopsis alba; Amycolatopsis albidoflavus; Amycolatopsis azurea; Amycolatopsis balhimycina; Amycolatopsis coloradensis; Amycolatopsis decaplanina; Amycolatopsis eurytherma; Amycolatopsis fastidiosa; Amycolatopsis japonica; Amycolatopsis kentuckyensis; Amycolatopsis keratiniphila; Amycolatopsis lexingtonensis; Amycolatopsis lurida; Amycolatopsis mediterranei; Amycolatopsis methanolica; Amycolatopsis orientalis; Amycolatopsis palatopharyngis; Amycolatopsis pretoriensis; Amycolatopsis rubida; Amycolatopsis rugosa; Amycolatopsis sacchari; Amycolatopsis sulphurea; Amycolatopsis thermoflava; Amycolatopsis tolypomycina; or Amycolatopsis vancoresmycina.

[0101] As described herein, an Actinobacteria that can be used in the biosynthesis of piperazic acid or piperazic acid derivatives can be of the genus Frankia. As an example, the Frankia can be of the species Frankia brunchorstii or Frankia subtilis.

[0102] As described herein, an Actinobacteria that can be used in the biosynthesis of piperazic acid or piperazic acid derivatives can be of the genus Kibdelosporangium. As an example, the Kibdelosporangium can be of the species Kibdelosporangium albatum; Kibdelosporangium aridum; or Kibdelosporangium philippinense.

[0103] As described herein, an Actinobacteria that can be used in the biosynthesis of piperazic acid or piperazic acid derivatives can be of the genus Lentzea. As an example, the Lentzea can be of the species Lentzea albida; Lentzea albidocapillata; Lentzea californiensis; Lentzea flaviverrucosa; Lentzea jiangxiensis; Lentzea kentuckyensis; Lentzea sp. 132; Lentzea sp. 173316; Lentzea sp. 173591; Lentzea sp. 173892; Lentzea sp. 18-3; Lentzea sp. 4_C7_44; Lentzea sp. 4_C7_58; Lentzea sp. 7887; Lentzea sp. 84741; Lentzea sp. ACT-0091; Lentzea sp. BJ36; Lentzea sp. DHS C013; Lentzea sp. G-MN-1; Lentzea sp. GP0204; Lentzea sp. 108A-00410; Lentzea sp. IMER-B1-1; Lentzea sp. IR11-RCA120; Lentzea sp. KLBMP 1096; Lentzea sp. LM 058; Lentzea sp. LM 121; Lentzea sp. mCFU23; Lentzea sp. ML457-mF8; Lentzea sp. MS-15; Lentzea sp. MS-20; Lentzea sp. MS-5; Lentzea sp. MS6; Lentzea sp. SAUK6214; Lentzea sp. YIM 48827; Lentzea sp. YIM 48828; Lentzea sp. YIM 65117; Lentzea sp. YIM 75756; Lentzea sp. YIM 75760; Lentzea sp. YIM 75761; Lentzea sp. YIM 75778; Lentzea sp. YIM 75796; Lentzea sp. YM-11; Lentzea sp. YN-8-6; Lentzea violacea; or Lentzea waywayandensis.

[0104] As described herein, an Actinobacteria that can be used in the biosynthesis of piperazic acid or piperazic acid derivatives can be of the genus Mycobacterium. As an example, the Mycobacterium can be of the species Mycobacterium abscessus; Mycobacterium africanum; Mycobacterium agri; Mycobacterium aichiense; Mycobacterium alvei; Mycobacterium arupense; Mycobacterium asiaticum; Mycobacterium aubagnense; Mycobacterium aurum; Mycobacterium austroafricanum; Mycobacterium avium+; Mycobacterium boenickei; Mycobacterium bohemicum; Mycobacterium bolletii; Mycobacterium botniense; Mycobacterium bovis +; Mycobacterium branderi; Mycobacterium brisbanense; Mycobacterium brumae; Mycobacterium canariasense; Mycobacterium caprae; Mycobacterium celatum; Mycobacterium chelonae+; Mycobacterium chimaera; Mycobacterium chitae; Mycobacterium chlorophenolicum; Mycobacterium chubuense; Mycobacterium colombiense; Mycobacterium conceptionense; Mycobacterium confluentis; Mycobacterium conspicuum; Mycobacterium cookie; Mycobacterium cosmeticum; Mycobacterium diernhoferi; Mycobacterium doricum; Mycobacterium duvalii; Mycobacterium elephantis; Mycobacterium; Mycobacterium farcinogenes; Mycobacterium flavescens; Mycobacterium florentinum; Mycobacterium fluoranthenivorans; Mycobacterium fortuitum+; Mycobacterium frederiksbergense; Mycobacterium gadium; Mycobacterium gastri; Mycobacterium genavense; Mycobacterium gilvum; Mycobacterium goodie; Mycobacterium gordonae; Mycobacterium haemophilum; Mycobacterium hassiacum; Mycobacterium heckeshornense; Mycobacterium heidelbergense; Mycobacterium hiberniae; Mycobacterium hodleri; Mycobacterium holsaticum; Mycobacterium houstonense; Mycobacterium immunogenum; Mycobacterium interjectum; Mycobacterium intermedium; Mycobacterium intracellulare; Mycobacterium kansasii; Mycobacterium komossense; Mycobacterium kubicae; Mycobacterium lacus; Mycobacterium lentiflavum; Mycobacterium leprae; Mycobacterium lepraemurium; Mycobacterium madagascariense; Mycobacterium mageritense; Mycobacterium malmoense; Mycobacterium marinum; Mycobacterium massiliense; Mycobacterium microti; Mycobacterium montefiorense; Mycobacterium moriokaense; Mycobacterium mucogenicum; Mycobacterium murale; Mycobacterium nebraskense; Mycobacterium neoaurum; Mycobacterium neworleansense; Mycobacterium nonchromogenicum; Mycobacterium novocastrense; Mycobacterium obuense; Mycobacterium palustre; Mycobacterium parafortuitum; Mycobacterium parascrofulaceum; Mycobacterium parmense; Mycobacterium peregrinum; Mycobacterium phlei; Mycobacterium phocaicum; Mycobacterium pinnipedii; Mycobacterium porcinum; Mycobacterium poriferae; Mycobacterium pseudoshottsii; Mycobacterium psychrotolerans; Mycobacterium pulveris; Mycobacterium pyrenivorans; Mycobacterium rhodesiae; Mycobacterium saskatchewanense; Mycobacterium scrofulaceum; Mycobacterium senegalense; Mycobacterium septicum; Mycobacterium shimoidei; Mycobacterium shottsii; Mycobacterium simiae; Mycobacterium smegmatis; Mycobacterium sphagni; Mycobacterium szulgai; Mycobacterium terrae; Mycobacterium thermoresistibile; Mycobacterium tokaiense; Mycobacterium triplex; Mycobacterium triviale; Mycobacterium tuberculosis+; Mycobacterium tusciae; Mycobacterium ulcerans; Mycobacterium vaccae; Mycobacterium vanbaalenii; Mycobacterium wolinskyi; or Mycobacterium xenopi.

[0105] As described herein, an Actinobacteria that can be used in the biosynthesis of piperazic acid or piperazic acid derivatives can be of the genus Pseudonocardia. As an example, the Pseudonocardia can be of the species Pseudonocardia alaniniphila; Pseudonocardia alni; Pseudonocardia asaccharolytica; Pseudonocardia aurantiaca; Pseudonocardia autotrophica; Pseudonocardia azurea; Pseudonocardia benzenivorans; Pseudonocardia chloroethenivorans; Pseudonocardia compacta; Pseudonocardia halophobica; Pseudonocardia hydrocarbonoxydans; Pseudonocardia kongjuensis; Pseudonocardia nitrificans; Pseudonocardia petroleophila; Pseudonocardia saturnea; Pseudonocardia spinosa; Pseudonocardia spinosispora; Pseudonocardia sulfidoxydans; Pseudonocardia thermophile; Pseudonocardia xinjiangensis; Pseudonocardia yunnanensis; or Pseudonocardia zijingensis.

[0106] As described herein, an Actinobacteria that can be used in the biosynthesis of piperazic acid or piperazic acid derivatives can be of the genus Rhodococcus. As an example, the Rhodococcus can be of the species Rhodococcus luberonensis; Rhodococcus marchali; Rhodococcus perornatus; Rhodococcus rosaeluteae; Rhodococcus sariuoni; Rhodococcus spiraeae; or Rhodococcus turanicus.

[0107] As described herein, an Actinobacteria that can be used in the biosynthesis of piperazic acid or piperazic acid derivatives can be of the genus Salinispora. As an example, the Salinispora can be of the species Actinocatenispora; Actinoplanes; Amorphosporangium; Ampullariella; Asanoa; Catellatospora; Catenuloplanes; Couchioplanes; Dactylosporangium; Krasilnikovia; Longispora; Luedemannella; Micromonospora; Myceliochytrium; Pilimelia; Planopolyspora; Planosporangium; Polymorphospora; Salinispora; Spirilliplanes; Verrucosispora; Virgisporangium corrig.

[0108] As described herein, an Actinobacteria that can be used in the biosynthesis of piperazic acid or piperazic acid derivatives can be of the genus Streptacidiphilus. As an example, the Streptacidiphilus can be of the species Streptacidiphilus albus, Streptacidiphilus carbonis, Streptacidiphilus neutrinimicus, Streptacidiphilus anmyonensis, Streptacidiphilus durhamensis, Streptacidiphilus hamsterleyensis, Streptacidiphilus jiangxiensis, Streptacidiphilus melanogenes, Streptacidiphilus oryzae, or Streptacidiphilus rugosus.

[0109] As described herein, an Actinobacteria that can be used in the biosynthesis of piperazic acid or piperazic acid derivatives can be of the genus Streptomyces. As an example, the Streptomyces can be of the species Streptomyces coelicolor, S. lividans, S. albicans, S. griseus, or S. plicatosporus. As another example, the Streptomyces can be of the species Streptomyces abietis; Streptomyces abikoensis; Streptomyces aburaviensis; Streptomyces achromogenes; Streptomyces acidiscabies; Streptomyces actinomycinicus; Streptomyces acrimycini; Streptomyces actuosus; Streptomyces aculeolatus; Streptomyces abyssalis; Streptomyces afghaniensis; Streptomyces aidingensis; Streptomyces africanus; Streptomyces alanosinicus; Streptomyces albaduncus; Streptomyces albiaxialis; Streptomyces albidochromogenes; Streptomyces albiflavescens; Streptomyces albiflaviniger Streptomyces albidoflavus; Streptomyces albofaciens; Streptomyces alboflavus; Streptomyces albogriseolus; Streptomyces albolongus; Streptomyces alboniger Streptomyces albospinus; Streptomyces albulus; Streptomyces albus; Streptomyces aldersoniae; Streptomyces alfalfae; Streptomyces alkaliphilus; Streptomyces alkalithermotolerans; Streptomyces almquistii; Streptomyces alni; Streptomyces althioticus; Streptomyces amakusaensis; Streptomyces ambofaciens; Streptomyces amritsarensis; Streptomyces anandii; Streptomyces angustmyceticus; Streptomyces anthocyanicus; Streptomyces antibioticus; Streptomyces antimycoticus; Streptomyces anulatus; Streptomyces aomiensis; Streptomyces araujoniae; Streptomyces ardus; Streptomyces arenae; Streptomyces armeniacus; Streptomyces artemisiae; Streptomyces arcticus; Streptomyces ascomycinicus; Streptomyces asiaticus; Streptomyces asterosporus; Streptomyces atacamensis; Streptomyces atratus; Streptomyces atriruber Streptomyces atroolivaceus; Streptomyces atrovirens; Streptomyces aurantiacus; Streptomyces aurantiogriseus; Streptomyces auratus; Streptomyces aureocirculatus; Streptomyces aureofaciens; Streptomyces aureorectus; Streptomyces aureoverticillatus; Streptomyces aureus; Streptomyces avellaneus; Streptomyces avermitilis; Streptomyces avicenniae; Streptomyces avidinii; Streptomyces axinellae; Streptomyces azureus; Streptomyces bacillaris; Streptomyces badius; Streptomyces bambergiensis; Streptomyces bangladeshensis; Streptomyces baliensis; Streptomyces barkulensis; Streptomyces beijiangensis; Streptomyces bellus; Streptomyces bikiniensis; Streptomyces blastmyceticus; Streptomyces bluensis; Streptomyces bobili; Streptomyces bohaiensis; Streptomyces bottropensis; Streptomyces brasiliensis; Streptomyces brevispora; Streptomyces bullii; Streptomyces bungoensis; Streptomyces burgazadensis; Streptomyces cacaoi; Streptomyces caelestis; Streptomyces caeruleatus; Streptomyces calidiresistens; Streptomyces calvus; Streptomyces canarius; Streptomyces canchipurensis; Streptomyces candidus; Streptomyces cangkringensis; Streptomyces caniferus; Streptomyces canus; Streptomyces capillispiralis; Streptomyces capoamus; Streptomyces carpaticus; Streptomyces carpinensis; Streptomyces castelarensis; Streptomyces catbensis; Streptomyces catenulae; Streptomyces cavourensis; Streptomyces cellostaticus; Streptomyces celluloflavus; Streptomyces cellulolyticus; Streptomyces cellulosae; Streptomyces chartreusis; Streptomyces chattanoogensis; Streptomyces cheonanensis; Streptomyces chiangmaiensis; Streptomyces chrestomyceticus; Streptomyces chromofuscus; Streptomyces chryseus; Streptomyces chilikensis; Streptomyces chlorus; Streptomyces chumphonensis; Streptomyces cinereorectus; Streptomyces cinereoruber; Streptomyces cinereospinus; Streptomyces cinereus; Streptomyces cinerochromogenes; Streptomyces cinnabarinus; Streptomyces cinnamonensis; Streptomyces cinnamoneus; Streptomyces cirratus; Streptomyces ciscaucasicus; Streptomyces clavifer Streptomyces clavuligerus; Streptomyces coacervatus; Streptomyces cocklensis; Streptomyces coelescens; Streptomyces coelicoflavus; Streptomyces coelicolor Streptomyces coeruleoflavus; Streptomyces coeruleofuscus; Streptomyces coeruleoprunus; Streptomyces coeruleorubidus; Streptomyces coerulescens; Streptomyces collinus; Streptomyces colombiensis; Streptomyces corchorusii; Streptomyces costaricanus; Streptomyces cremeus; Streptomyces crystallinus; Streptomyces cuspidosporus; Streptomyces cyaneofuscatus; Streptomyces cyaneus; Streptomyces cyanoalbus; Streptomyces cyslabdanicus; Streptomyces daghestanicus; Streptomyces daliensi; Streptomyces deccanensis; Streptomyces decoyicus; Streptomyces demainii; Streptomyces deserti; Streptomyces diastaticus; Streptomyces diastatochromogenes; Streptomyces djakartensis; Streptomyces drozdowiczii; Streptomyces durhamensis; Streptomyces durmitorensis; Streptomyces echinatus; Streptomyces echinoruber Streptomyces ederensis; Streptomyces emeiensis; Streptomyces endophyticus; Streptomyces endus; Streptomyces enissocaesilis; Streptomyces erythrogriseus; Streptomyces erringtonii; Streptomyces eurocidicus; Streptomyces europaeiscabiei; Streptomyces eurythermus; Streptomyces exfoliatus; Streptomyces faba; Streptomyces fenghuangensis; Streptomyces ferralitis; Streptomyces filamentosus; Streptomyces fildesensis; Streptomyces filipinensis; Streptomyces fimbriatus; Streptomyces finlayi; Streptomyces flaveolus; Streptomyces flaveus; Streptomyces flavofungini; Streptomyces flavotricini; Streptomyces flavovariabilis; Streptomyces flavovirens; Streptomyces flavoviridis; Streptomyces fradiae; Streptomyces fragilis; Streptomyces fukangensis; Streptomyces fulvissimus; Streptomyces fulvorobeus; Streptomyces fumanus; Streptomyces fumigatiscleroticus; Streptomyces galbus; Streptomyces galilaeus; Streptomyces gancidicus; Streptomyces gardneri; Streptomyces gelaticus; Streptomyces geldanamycininus; Streptomyces geysiriensis; Streptomyces ghanaensis; Streptomyces gilvifuscus; Streptomyces glaucescens; Streptomyces glauciniger Streptomyces glaucosporus; Streptomyces glaucus; Streptomyces globisporus; Streptomyces globosus; Streptomyces glomeratus; Streptomyces glomeroaurantiacus; Streptomyces glycovorans; Streptomyces gobitricini; Streptomyces goshikiensis; Streptomyces gougerotii; Streptomyces graminearus; Streptomyces gramineus; Streptomyces graminifolii; Streptomyces graminilatus; Streptomyces graminisoli; Streptomyces griseiniger Streptomyces griseoaurantiacus; Streptomyces griseocarneus; Streptomyces griseochromogenes; Streptomyces griseoflavus; Streptomyces griseofuscus; Streptomyces griseoincarnatus; Streptomyces griseoloalbus; Streptomyces griseolus; Streptomyces griseoluteus; Streptomyces griseomycini; Streptomyces griseoplanus; Streptomyces griseorubens; Streptomyces griseoruber Streptomyces griseorubiginosus; Streptomyces griseosporeus; Streptomyces griseostramineus; Streptomyces griseoviridis; Streptomyces griseus; Streptomyces guanduensis; Streptomyces gulbargensis; Streptomyces hainanensis; Streptomyces haliclonae; Streptomyces halophytocola; Streptomyces halstedii; Streptomyces harbinensis; Streptomyces hawaiiensis; Streptomyces hebeiensis; Streptomyces heilongjiangensis; Streptomyces heliomycini; Streptomyces helvaticus; Streptomyces herbaceus; Streptomyces herbaricolor; Streptomyces himastatinicus; Streptomyces hiroshimensis; Streptomyces hirsutus; Streptomyces hokutonensis; Streptomyces hoynatensis; Streptomyces humidus; Streptomyces humiferus; Streptomyces hundungensis; Streptomyces hyderabadensis; Streptomyces hygroscopicus; Streptomyces hypolithicus; Streptomyces iakyrus; Streptomyces iconiensis; Streptomyces incanus; Streptomyces indiaensis; Streptomyces indigoferus; Streptomyces indicus; Streptomyces indonesiensis; Streptomyces intermedius; Streptomyces inusitatus; Streptomyces ipomoeae; Streptomyces iranensis; Streptomyces janthinus; Streptomyces jamaicensis; Streptomyces javensis; Streptomyces jietaisiensis; Streptomyces jiujiangensis; Streptomyces kaempferi; Streptomyces kanamyceticus; Streptomyces karpasiensis; Streptomyces kasugaensis; Streptomyces katrae; Streptomyces kebangsaanensis; Streptomyces klenkii; Streptomyces koyangensis; Streptomyces kunmingensis; Streptomyces kurssanovii; Streptomyces labedae; Streptomyces lacrimifluminis; Streptomyces lacticiproducens; Streptomyces laculatispora; Streptomyces lanatus; Streptomyces lannensis; Streptomyces lateritius; Streptomyces laurentii; Streptomyces lavendofoliae; Streptomyces lavendulae; Streptomyces lavenduligriseus; Streptomyces leeuwenhoekii; Streptomyces lavendulocolor Streptomyces levis; Streptomyces libani; Streptomyces lienomycini; Streptomyces lilacinus; Streptomyces lincolnensis; Streptomyces litmocidini; Streptomyces litoralis; Streptomyces lomondensis; Streptomyces longisporoflavus; Streptomyces longispororuber Streptomyces lopnurensis; Streptomyces longisporus; Streptomyces longwoodensis; Streptomyces lucensis; Streptomyces lunaelactis; Streptomyces lunalinharesii; Streptomyces luridiscabiei; Streptomyces luridus; Streptomyces lusitanus; Streptomyces lushanensis; Streptomyces luteireticuli; Streptomyces luteogriseus; Streptomyces luteosporeus; Streptomyces lydicus; Streptomyces macrosporus; Streptomyces malachitofuscus; Streptomyces malachitospinus; Streptomyces malaysiensis; Streptomyces mangrovi; Streptomyces marinus; Streptomyces marokkonensis; Streptomyces mashuensis; Streptomyces massasporeus; Streptomyces matensis; Streptomyces mayteni; Streptomyces mauvecolor Streptomyces megasporus; Streptomyces melanogenes; Streptomyces melanosporofaciens; Streptomyces mexicanus; Streptomyces michiganensis; Streptomyces microflavus; Streptomyces milbemycinicus; Streptomyces minutiscleroticus; Streptomyces mirabilis; Streptomyces misakiensis; Streptomyces misionensis; Streptomyces mobaraensis; Streptomyces monomycini; Streptomyces mordarskii; Streptomyces morookaense; Streptomyces muensis; Streptomyces murinus; Streptomyces mutabilis; Streptomyces mutomycini; Streptomyces naganishii; Streptomyces nanhaiensis; Streptomyces nanshensis; Streptomyces narbonensis; Streptomyces nashvillensis; Streptomyces netropsis; Streptomyces neyagawaensis; Streptomyces niger Streptomyces nigrescens; Streptomyces nitrosporeus; Streptomyces niveiciscabiei; Streptomyces niveiscabiei; Streptomyces niveoruber Streptomyces niveus; Streptomyces noboritoensis; Streptomyces nodosus; Streptomyces nogalater Streptomyces nojiriensis; Streptomyces noursei; Streptomyces novaecaesareae; Streptomyces ochraceiscleroticus; Streptomyces olivaceiscleroticus; Streptomyces olivaceoviridis; Streptomyces olivaceus; Streptomyces olivicoloratus; Streptomyces olivochromogenes; Streptomyces olivomycini; Streptomyces olivoverticillatus; Streptomyces omiyaensis; Streptomyces osmaniensis; Streptomyces orinoci; Streptomyces pactum; Streptomyces panacagri; Streptomyces panaciradicis; Streptomyces paradoxus; Streptomyces parvulus; Streptomyces parvus; Streptomyces pathocidini; Streptomyces paucisporeus; Streptomyces peucetius; Streptomyces phaeochromogenes; Streptomyces phaeofaciens; Streptomyces phaeogriseichromatogenes; Streptomyces phaeoluteichromatogenes; Streptomyces phaeoluteigriseus; Streptomyces phaeopurpureus; Streptomyces pharetrae; Streptomyces pharmamarensis; Streptomyces phytohabitans; Streptomyces pilosus; Streptomyces platensis; Streptomyces plicatus; Streptomyces plumbiresistens; Streptomyces pluricolorescens; Streptomyces pluripotens; Streptomyces polyantibioticus; Streptomyces polychromogenes; Streptomyces polygonati; Streptomyces polymachus; Streptomyces poonensis; Streptomyces prasinopilosus; Streptomyces prasinosporus; Streptomyces prasinus; Streptomyces pratens; Streptomyces pratensis; Streptomyces prunicolor Streptomyces psammoticus; Streptomyces pseudoechinosporeus; Streptomyces pseudogriseolus; Streptomyces pseudovenezuelae; Streptomyces pulveraceus; Streptomyces puniceus; Streptomyces puniciscabiei; Streptomyces purpeofuscus; Streptomyces purpurascens; Streptomyces purpureus; Streptomyces purpurogeneiscleroticus; Streptomyces qinglanensis; Streptomyces racemochromogenes; Streptomyces radiopugnans; Streptomyces rameus; Streptomyces ramulosus; Streptomyces rapamycinicus; Streptomyces recifensis; Streptomyces rectiviolaceus; Streptomyces regensis; Streptomyces resistomycificus; Streptomyces reticuliscabiei; Streptomyces rhizophilus; Streptomyces rhizosphaericus; Streptomyces rimosus; Streptomyces rishiriensis; Streptomyces rochei; Streptomyces rosealbus; Streptomyces roseiscleroticus; Streptomyces roseofulvus; Streptomyces roseolilacinus; Streptomyces roseolus; Streptomyces roseosporus; Streptomyces roseoviolaceus; Streptomyces roseoviridis; Streptomyces ruber Streptomyces rubidus; Streptomyces rubiginosohelvolus; Streptomyces rubiginosus; Streptomyces rubrisoli; Streptomyces rubrogriseus; Streptomyces rubrus; Streptomyces rutgersensis; Streptomyces samsunensis; Streptomyces sanglieri; Streptomyces sannanensis; Streptomyces sanyensis; Streptomyces sasae; Streptomyces scabiei; Streptomyces scabrisporus; Streptomyces sclerotialus; Streptomyces scopiformis; Streptomyces scopuliridis; Streptomyces sedi; Streptomyces seoulensis; Streptomyces seranimatus; Streptomyces seymenliensis; Streptomyces shaanxiensis; Streptomyces shenzhenensis; Streptomyces showdoensis; Streptomyces silaceus; Streptomyces sindenensis; Streptomyces sioyaensis; Streptomyces smyrnaeus; Streptomyces sodiiphilus; Streptomyces somaliensis; Streptomyces sudanensis; Streptomyces sparsogenes; Streptomyces sparsus; Streptomyces specialis; Streptomyces spectabilis; Streptomyces speibonae; Streptomyces speleomycini; Streptomyces spinoverrucosus; Streptomyces spiralis; Streptomyces spiroverticillatus; Streptomyces spongiae; Streptomyces spongiicola; Streptomyces sporocinereus; Streptomyces sporoclivatus; Streptomyces spororaveus; Streptomyces sporoverrucosus; Streptomyces staurosporininus; Streptomyces stelliscabiei; Streptomyces stramineus; Streptomyces subrutilus; Streptomyces sulfonofaciens; Streptomyces sulphureus; Streptomyces sundarbansensis; Streptomyces synnematoformans; Streptomyces tacrolimicus; Streptomyces tanashiensis; Streptomyces tateyamensis; Streptomyces tauricus; Streptomyces tendae; Streptomyces termitum; Streptomyces thermoalcalitolerans; Streptomyces thermoautotrophicus; Streptomyces thermocarboxydovorans; Streptomyces thermocarboxydus; Streptomyces thermocoprophilus; Streptomyces thermodiastaticus; Streptomyces thermogriseus; Streptomyces thermolineatus; Streptomyces thermospinosisporus; Streptomyces thermoviolaceus; Streptomyces thermovulgaris; Streptomyces thinghirensis; Streptomyces thioluteus; Streptomyces torulosus; Streptomyces toxytricini; Streptomyces tremellae; Streptomyces tritolerans; Streptomyces tricolor, Streptomyces tsukubensis; Streptomyces tubercidicus; Streptomyces tuirus; Streptomyces tunisiensis; Streptomyces turgidiscabies; Streptomyces tyrosinilyticus; Streptomyces umbrinus; Streptomyces variabilis; Streptomyces variegatus; Streptomyces varsoviensis; Streptomyces verticillus; Streptomyces vastus; Streptomyces venezuelae; Streptomyces vietnamensis; Streptomyces vinaceus; Streptomyces vinaceusdrappus; Streptomyces violaceochromogenes; Streptomyces violaceolatus; Streptomyces violaceorectus; Streptomyces violaceoruber Streptomyces violaceorubidus; Streptomyces violaceus; Streptomyces violaceusniger Streptomyces violarus; Streptomyces violascens; Streptomyces violens; Streptomyces virens; Streptomyces virginiae; Streptomyces viridis; Streptomyces viridiviolaceus; Streptomyces viridobrunneus; Streptomyces viridochromogenes; Streptomyces viridodiastaticus; Streptomyces viridosporus; Streptomyces vitaminophilus; Streptomyces wedmorensis; Streptomyces wellingtoniae; Streptomyces werraensis; Streptomyces wuyuanensis; Streptomyces xanthochromogenes; Streptomyces xanthocidicus; Streptomyces xantholiticus; Streptomyces xanthophaeus; Streptomyces xiamenensis; Streptomyces xinghaiensis; Streptomyces xishensis; Streptomyces yaanensis; Streptomyces yanglinensis; Streptomyces yangpuensis; Streptomyces yanii; Streptomyces yatensis; Streptomyces yeochonensis; Streptomyces yerevanensis; Streptomyces yogyakartensis; Streptomyces yokosukanensis; Streptomyces youssoufiensis; Streptomyces yunnanensis; Streptomyces zagrosensis; Streptomyces zaomyceticus; Streptomyces zhaozhouensis; Streptomyces zinciresistens

; or Streptomyces ziwulingensis. As another example, the microorganism can be a streptomyces species with azinothricin as the founding member, Steptomyces flaveolus DSM 9954, Streptomyces MK498-98F14 strain, Steptomyces sp. RJA2928, Streptomyces hygroscopicus strain ATCC 53653, Streptomyces lycidus (strain HKI0343), Streptomyces strain CNQ-593, Streptomyces sp. (A92-308110), or Streptomyces himastatinicus ATCC 53653. As another example, the microorganism can be a Streptomyces strain BB10EC, ES09EC, LM04EC, CS08EC, CM04EC, PF8EC, MRY08EC, LM08EC, JMO5EC, BB04EC, PF1EC, PF5EC, JV594, or JV596.

[0110] As another example, an Actinobacteria that can be used in the biosynthesis of piperazic acid or piperazic acid derivatives can be of the genus, Corynebacterium. As another example, the Corynebacterium can be of the species Corynebacterium glutamicum. As another example, the Corynebacterium can be of the species Corynebacterium efficiens, Corynebacterium diphtheriae group, Corynebacterium xerosis, Corynebacterium striatum, Corynebacterium minutissimum, Corynebacterium amycolatum, Corynebacterium glucuronolyticum, Corynebacterium argentoratense, Corynebacterium matruchotii, Corynebacterium glutamicum, Corynebacterium sp., Nonfermentative corynebacteria, Corynebacterium afermentans subsp. Afermentans, Corynebacterium auris, Corynebacterium pseudodiphtheriticum, Corynebacterium propinquum, Corynebacterium uropygiale, Corynebacterium jeikeium, Corynebacterium urealyticum, Corynebacterium afermentans subsp. lipophilum, Corynebacterium accolens, Corynebacterium macginleyi, CDC coryneform groups F-1 and G, Corynebacterium bovis, or Corynebacterium kroppenstedtii.

[0111] As another example, an Actinobacteria that can be used in the biosynthesis of piperazic acid or piperazic acid derivatives can be of the genus, Kutzneria. As another example, the Kutzneria can be of the species Kutzneria spp. 744, Kutzneria albida, Kutzneria kofuensis, Kutzneria viridogrisea), (see e.g., Neuman et al. 2012 13(7) 972-976). Kutzneria were previously known to be in the family of Streptosporangiaceae (suborder Streptosporangineae) and were known as Streptosporangium albidum, Streptosporangium viridogriseum (subspecies kofuense), or Streptosporangium viridogriseum.

[0112] As described herein, an Actinobacteria that can be used in the biosynthesis of piperazic acid or piperazic acid derivatives can be of the genus Actinomadura. As an example, the Actinomadura can be of the species Actinomadura luzonensis, Actinomadura dassonvillei, Actinomadura madurae, Actinomadura pelletieri, Actinomadura sputi, Actinomadura meyerae, Actinomadura hibisca, Actinomadura pusilla, A. fastidiosa, A. ferruoinea, A. helvata, A. kijaniata, A. libanotica, A. roseola, A. roseoviolacea, A. rubra., A. salmonea, or A. spiralis.

[0113] As described herein, the microorganism can be a fungi. For example, the gene can be refactored and insterted into eukaryal vectors for yeast or fungal expression. In fact, some fungi also encode functionally orthologous PzbA enzymes (SidA). In some embodiments, the microorganism can be in the Phylum, Ascomycota or the genus, Aspergillus. As an example, the species can be Aspergillus caesiellus, Aspergillus candidus, Aspergillus carneus, Aspergillus clavatus, Aspergillus deflectus, Aspergillus flavus, Aspergillus fumigatus, Aspergillus glaucus, Aspergillus israelii, Aspergillus nidulans, Aspergillus niger, Aspergillus ochraceus, Aspergillus oryzae, Aspergillus parasiticus, Aspergillus penicilloides, Aspergillus restrictus, Aspergillus sojae, Aspergillus sydowii, Aspergillus tamari, Aspergillus terreus, Aspergillus ustus, or Aspergillus versicolor.

[0114] In some embodiments, transformed microorganisms, as described herein, can accumulate at least about 1 .mu.M to at least about 1 M L-Piz. For example, in some embodiments, transformed microorganisms can accumulate about 1 .mu.M; about 10 .mu.M; about 20 .mu.M; about 30 .mu.M; about 40 .mu.M; about 50 .mu.M; about 60 .mu.M; about 70 .mu.M; about 80 .mu.M; about 90 .mu.M; about 100 .mu.M; about 110 .mu.M; about 120 .mu.M; about 130 .mu.M; about 140 .mu.M; about 150 .mu.M; about 160 .mu.M; about 170 .mu.M; about 180 .mu.M; about 190 .mu.M; about 200 .mu.M; about 210 .mu.M; about 220 .mu.M; about 230 .mu.M; about 240 .mu.M; about 250 .mu.M; about 260 .mu.M; about 270 .mu.M; about 280 .mu.M; about 290 .mu.M; about 300 .mu.M; about 310 .mu.M; about 320 .mu.M; about 330 .mu.M; about 340 .mu.M; about 350 .mu.M; about 360 .mu.M; about 370 .mu.M; about 380 .mu.M; about 390 .mu.M; about 400 .mu.M; about 410 .mu.M; about 420 .mu.M; about 430 .mu.M; about 440 .mu.M; about 450 .mu.M; about 460 .mu.M; about 470 .mu.M; about 480 .mu.M; about 490 .mu.M; about 500 .mu.M; about 510 .mu.M; about 520 .mu.M; about 530 .mu.M; about 540 .mu.M; about 550 .mu.M; about 560 .mu.M; about 570 .mu.M; about 580 .mu.M; about 590 .mu.M; about 600 .mu.M; about 610 .mu.M; about 620 .mu.M; about 630 .mu.M; about 640 .mu.M; about 650 .mu.M; about 660 .mu.M; about 670 .mu.M; about 680 .mu.M; about 690 .mu.M; about 700 .mu.M; about 710 .mu.M; about 720 .mu.M; about 730 .mu.M; about 740 .mu.M; about 750 .mu.M; about 760 .mu.M; about 770 .mu.M; about 780 .mu.M; about 790 .mu.M; about 800 .mu.M; about 810 .mu.M; about 820 .mu.M; about 830 .mu.M; about 840 .mu.M; about 850 .mu.M; about 860 .mu.M; about 870 .mu.M; about 880 .mu.M; about 890 .mu.M; about 900 .mu.M; about 910 .mu.M; about 920 .mu.M; about 930 .mu.M; about 940 .mu.M; about 950 .mu.M; about 960 .mu.M; about 970 .mu.M; about 980 .mu.M; about 990 .mu.M; or about 1000 .mu.M. Recitation of each of these discrete values is understood to include ranges between each value. Recitation of each of a range is understood to include discrete values within the range.

[0115] In some embodiments, transformed microorganisms, as described herein, can accumulate between at least about 1 mg and at least about 3 mg of Piz or Piz derivatives (e.g., L-Piz, see e.g., Examples 4 or 14) per liter in about 3 days (or at least about 14 .mu.g/L per hour or at least about 0.2 .mu.g/L per minute). In some embodiments, transformed microorganisms can accumulate at least about 0.1 .mu.g up to about 10 .mu.g of a Piz or Piz derivatives (e.g., L-Piz) per minute per L. For example, transformed microorganisms can accumulate at least about 0.1 .mu.g, at least about 0.2 .mu.g, at least about 0.3 .mu.g, at least about 0.4 .mu.g, at least about 0.5 .mu.g, at least about 0.6 .mu.g, at least about 0.7 .mu.g, at least about 0.8 .mu.g, at least about 0.9 .mu.g, or at least about 1 .mu.g of Piz or Piz derivatives (e.g., L-Piz) per minute per L. In other embodiments, various transformed microorganisms accumulate similar amounts of Piz or Piz derivatives (e.g., L-Piz). Recitation of each of these discrete values is understood to include ranges between each value. Recitation of each of a range is understood to include discrete values within the range.

[0116] Hydroxylase, Cyclase, and Dehydratase

[0117] A microorganism (e.g., the bacteria, Streptomyces lividans) can be transformed so as to have hydroxylase, cyclase, or dehydratase activity (e.g., L-Ornithine N.sup.5-hydroxylase, L-Ornithine cyclase, L-Ornithine dehydratase activity).

[0118] Hydroxylase (e.g., L-Ornithine N.sup.5-hydroxylase) activity can be engineered into a microorganism by way of one or more individual genes encoding a polypeptide having hydroxylase (e.g., L-Ornithine N.sup.5-hydroxylase) activity. It is contemplated these activities can likewise be engineered in other microorganisms.

[0119] Cyclase (e.g., L-Ornithine N.sup.5-cyclase) activity or dehydratase (e.g., L-Ornithine N.sup.5-dehydratase) activity can be engineered into a microorganism by way of one or more of the individual genes. For example, cyclase (e.g., L-Ornithine N.sup.5-cyclase) activity or dehydratase (e.g., L-Ornithine N.sup.5-dehydratase) activity can be engineered into a microorganism by way of one or more genes encoding a polypeptide having cyclase (e.g., L-Ornithine N.sup.5-cyclase) activity or encoding a polypeptide having dehydratase (e.g., L-Ornithine N.sup.5-dehydratase) activity; or by one gene encoding both cyclase (e.g., L-Ornithine N.sup.5-cyclase) and dehydratase (e.g., L-Ornithine N.sup.5-dehydratase). For example, L-Ornithine N.sup.5-cyclase activity and L-Ornithine N.sup.5-dehydratase activity can be present in a polypeptide or a fusion polypeptide. It is contemplated these activities can likewise be engineered in other microorganisms.

[0120] The Piz (e.g., L-Piz) can be endogenous or exogenous to the microorganism. Where the Piz is endogenous, the microorganism can be engineered to produce increased levels of Piz. Where Piz is exogenous, the microorganism can be engineered to produce such exogenous Piz.

[0121] The microorganism can be engineered to synthesize and accumulate the desired Piz continuously, after some developmental state, or upon being induced to do so. Induction of Piz synthesis can be according to the actions of an inducible promoter associated with the encoded hydroxylase, cyclase, or dehydratase and an inducing agent, as discussed in further detail herein. Also, the promoters as recited herein are only as examples of useful promoters. It is contemplated to adjust copy number (e.g., plasmid as self replicating high copy, low copy, or chromosomally insertional), in conjunction with promoters driving high, medium, or low expression of pzbA and pzbB combinations.

[0122] Radiolabeled

[0123] One embodiment of the present disclosure provides for a radiolabeled compound. The composition can be Piz, a Piz derivative, or a Piz-containing compound. According to another embodiment, the radiolabeled compound can be for use as a drug discovery agent or an imaging agent.

[0124] References herein to "radiolabeled" include a compound where one or more atoms are replaced or substituted by an atom having an atomic mass or mass number different from the atomic mass or mass number typically found in nature (i.e., naturally occurring). One non-limiting exception is .sup.19F, which allows detection of a molecule which contains this element without enrichment to a higher degree than what is naturally occurring. Compounds carrying the substituent .sup.19F may thus also be referred to as "labelled" or the like. The term radiolabeled may be interchangeably used with "isotopically-labelled", "labelled", "isotopic tracer group", "isotopic marker", "isotopic label", "detectable isotope", or "radioligand".

[0125] In one embodiment, the compound comprises a single radiolabeled group.

[0126] Examples of suitable, non-limiting radiolabel groups can include: .sup.2H (D or deuterium), .sup.3H (T or tritium), .sup.11C, .sup.13C, .sup.14C .sup.13N, .sup.15N, .sup.15O, .sup.17O, .sup.18O, .sup.18F, .sup.35S, .sup.36Cl, .sup.82Br, .sup.75Br, .sup.76Br, .sup.77Br, .sup.123I, .sup.124I, .sup.125I, or .sup.131I. It is to be understood that an isotopically labeled compound needs only to be enriched with a detectable isotope to, or above, the degree which allows detection with a technique suitable for the particular application, e.g., in a detectable compound labeled with .sup.11C, the carbon-atom of the labeled group of the labeled compound may be constituted by .sup.12C or other carbon-isotopes in a fraction of the molecules. The radionuclide that is incorporated in the radiolabeled compounds will depend on the specific application of that radiolabeled compound. For example, "heavy" isotope-labeled compounds (e.g., compounds containing deuterons/heavy hydrogen, heavy nitrogen, heavy oxygen, heavy carbon) can be useful for mass spectrometric and NMR based studies. As another example, for in vitro labelling or in competition assays, compounds that incorporate .sup.3H, .sup.14C, or .sup.125I can be useful. For in vivo imaging applications .sup.11C, .sup.13C, .sup.18F, .sup.19F, .sup.120I, .sup.123I, .sup.131I, .sup.75Br, or .sup.76Br can generally be useful. In one embodiment, the radiolabel is .sup.11C. In an alternative embodiment, the radiolabel is .sup.14C. In a yet further alternative embodiment, the radiolabel is .sup.13C.

[0127] Molecular Engineering

[0128] A gene of particular interest for engineering a microorganism to accumulate Piz or Piz derivative is the active pzbB gene from Streptomyces flaveolus (see e.g., Example 3). Another gene of interest for engineering a microorganism to accumulate Piz is the active pzbA gene. As shown herein, pzbA is natively encoded on the S. lividans chromosome. But pzbA or pzbB can be expressed in another host that does not natively express the pzbA or pzbB gene or the host can be engineered to carry more than one copy of the a non-natively expressed pzbA or pzbB gene.

[0129] In some embodiments, an pzbA- or pzbB-encoding nucleotide sequence is cloned from its native source (e.g., Streptomyces flaveolus, S. lividans) and inserted into a host microorganism (see e.g., Example 3). In some embodiments, a transformed host microorganism comprises a pzbA or pzbB polynucleotide of SEQ ID NO: 177-SEQ ID NO: 178 (pzbA) or SEQ ID NO: 179-SEQ ID NO: 181 (pzbB). In some embodiments, a microorganism is transformed with a nucleotide sequence encoding pzbA or pzbB polypeptide of SEQ ID NO: 1-SEQ ID NO: 81 or SEQ ID NO: 82-SEQ ID NO: 166. In some embodiments, a transformed host microorganism comprises a pzbA and pzbB polynucleotides of SEQ ID NO: 167-SEQ ID NO: 176.

[0130] In some embodiments, a transformed host microorganism comprises a nucleotide sequence having at least about 25% sequence identity to SEQ ID NO: 177-SEQ ID NO: 178 or a nucleotide sequence encoding a polypeptide having L-Ornithine N.sup.5 hydroxylase activity and at least about 80% sequence identity to SEQ ID NO: 1-SEQ ID NO: 81. As an example, a transformed host microorganism, such as a bacterium, can comprise a nucleotide sequence having at least about 85%, at least about 90%, at least about 95%, or at least about 99% sequence identity to SEQ ID NO: 177-SEQ ID NO: 178, wherein the transformed host exhibits L-Ornithine N.sup.5 hydroxylase activity, pzbA activity, and/or accumulation of Piz. As an example, a transformed host microorganism can comprise a nucleotide sequence encoding a polypeptide having at least about 85%, at least about 90%, at least about 95%, or at least about 99% sequence identity to SEQ ID NO: 1-SEQ ID NO: 81, wherein the transformed host exhibits L-Ornithine N.sup.5 hydroxylase activity, pzbA activity and/or accumulation of Piz. As another example, a transformed host microorganism can comprise a nucleotide sequence that hybridizes under stringent conditions to SEQ ID NO: 177-SEQ ID NO: 178 over the entire length of SEQ ID NO: 177-SEQ ID NO: 178, and which encodes an active pzbA polypeptide. As a further example, a transformed host microorganism can comprise the complement to any of the above sequences.

[0131] In some embodiments, a transformed host microorganism comprises a nucleotide sequence having at least about 80% sequence identity to SEQ ID NO: 179-SEQ ID NO: 181 or a nucleotide sequence encoding a polypeptide having L-Ornithine N.sup.5 cyclase activity or L-Ornithine N.sup.5 dehydratase activity and at least about 80% sequence identity to SEQ ID NO: 82-SEQ ID NO: 166. As an example, a transformed host microorganism, such as a bacterium, can comprise a nucleotide sequence having at least about 85%, at least about 90%, at least about 95%, or at least about 99% sequence identity to SEQ ID NO: 179-SEQ ID NO: 181, wherein the transformed host exhibits L-Ornithine N.sup.5 cyclase activity or L-Ornithine N.sup.5 dehydratase activity, or pzbB activity and/or accumulation of Piz. As an example, a transformed host microorganism can comprise a nucleotide sequence encoding a polypeptide having at least about 85%, at least about 90%, at least about 95%, or at least about 99% sequence identity to SEQ ID NO: 82-SEQ ID NO: 166, wherein the transformed host exhibits L-Ornithine N.sup.5 cyclase activity or L-Ornithine N.sup.5 dehydratase activity, or pzbB activity and/or accumulation of Piz. As another example, a transformed host microorganism can comprise a nucleotide sequence that hybridizes under stringent conditions to SEQ ID NO: 179-SEQ ID NO: 181 over the entire length of SEQ ID NO: 179-SEQ ID NO: 181, and which encodes an active pzbB polypeptide. As a further example, a transformed host microorganism can comprise the complement to any of the above sequences.

[0132] In some embodiments, L-Ornithine N.sup.5 hydroxylase (see e.g., SEQ ID NO: 177-SEQ ID NO: 178 encoding pzbA gene and SEQ ID NO: 1-SEQ ID NO: 81 encoding pzbA polypeptide), or homologue thereof, is engineered to be expressed or overexpressed in a transformed microorganism. For example, a microorganism can be transformed with a nucleotide having a sequence of 1SEQ ID NO: 177-SEQ ID NO: 178 so as to express L-Ornithine N.sup.5 hydroxylase. As another example, a microorganism can be transformed with a nucleotide having at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 99% percent identity to SEQ ID NO: 177-SEQ ID NO: 178 encoding a polypeptide having L-Ornithine N.sup.5 hydroxylase activity. As another example, a transformed host microorganism can comprise a nucleotide sequence encoding a polypeptide having at least about 85%, at least about 90%, at least about 95%, or at least about 99% sequence identity to SEQ ID NO: 1-SEQ ID NO: 81, wherein the transformed host exhibits L-Ornithine N.sup.5 hydroxylase activity, pzbA activity, and/or accumulation of Piz.

[0133] In some embodiments, L-Ornithine N.sup.5 cyclase or L-Ornithine N.sup.5 dehydratase (see e.g., SEQ ID NO: 179-SEQ ID NO: 181 encoding pzbB gene and SEQ ID NO: 82-SEQ ID NO: 166 encoding pzbB polypeptide), or homologue thereof, is engineered to be expressed or overexpressed in a transformed microorganism. For example, a microorganism can be transformed with a nucleotide having a sequence of SEQ ID NO: 179-SEQ ID NO: 181 so as to express L-Ornithine N.sup.5 cyclase or L-Ornithine N.sup.5 dehydratase. As another example, a microorganism can be transformed with a nucleotide having at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 99% percent identity to SEQ ID NO: 179-SEQ ID NO: 181 encoding a polypeptide having L-Ornithine N.sup.5 hydroxylase activity. As another example, a transformed host microorganism can comprise a nucleotide sequence encoding a polypeptide having at least about 85%, at least about 90%, at least about 95%, or at least about 99% sequence identity to SEQ ID NO: 82-SEQ ID NO: 166, wherein the transformed host exhibits L-Ornithine N.sup.5 cyclase activity, L-Ornithine N.sup.5 dehydratase activity, pzbB activity, and/or accumulation of Piz.

[0134] In some embodiments, a microorganism (e.g., a bacterium) is engineered to express one or more of pzbA, pzbB, L-Ornithine N.sup.5 hydroxylase, L-Ornithine N.sup.5 cyclase, or L-Ornithine N.sup.5 dehydratase.

[0135] Design, generation, and testing of the variant nucleotides, and their encoded polypeptides, having the above required percent identities to an pzbA or pzbB sequence and retaining a required activity of the expressed protein and/or Piz accumulation phenotype is within the skill of the art.

[0136] The following definitions and methods are provided to better define the present invention and to guide those of ordinary skill in the art in the practice of the present invention. Unless otherwise noted, terms are to be understood according to conventional usage by those of ordinary skill in the relevant art.

[0137] The terms "heterologous DNA sequence", "exogenous DNA segment" or "heterologous nucleic acid," as used herein, each refer to a sequence that originates from a source foreign to the particular host cell or, if from the same source, is modified from its original form. Thus, a heterologous gene in a host cell includes a gene that is endogenous to the particular host cell but has been modified through, for example, the use of DNA shuffling. The terms also include non-naturally occurring multiple copies of a naturally occurring DNA sequence. Thus, the terms refer to a DNA segment that is foreign or heterologous to the cell, or homologous to the cell but in a position within the host cell nucleic acid in which the element is not ordinarily found. Exogenous DNA segments are expressed to yield exogenous polypeptides. A "homologous" DNA sequence is a DNA sequence that is naturally associated with a host cell into which it is introduced.

[0138] Expression vector, expression construct, plasmid, or recombinant DNA construct is generally understood to refer to a nucleic acid that has been generated via human intervention, including by recombinant means or direct chemical synthesis, with a series of specified nucleic acid elements that permit transcription or translation of a particular nucleic acid in, for example, a host cell. The expression vector can be part of a plasmid, virus, or nucleic acid fragment. Typically, the expression vector can include a nucleic acid to be transcribed operably linked to a promoter.

[0139] A "promoter" is generally understood as a nucleic acid control sequence that directs transcription of a nucleic acid. An inducible promoter is generally understood as a promoter that mediates transcription of an operably linked gene in response to a particular stimulus. In some embodiments, the promoter is iducible by an agent selected from the group consisting of temperature, pH, a metabolite, light, an osmotic agent, a heavy metal, and an antibiotic. In some embodiments, the promoter is selected from the group consisting of a constitutive promoter to produce L-Piz.

[0140] A promoter can include necessary nucleic acid sequences near the start site of transcription, such as, in the case of a polymerase II type promoter, a TATA element. A promoter can optionally include distal enhancer or repressor elements, which can be located as much as several thousand base pairs from the start site of transcription.

[0141] A "transcribable nucleic acid molecule" as used herein refers to any nucleic acid molecule capable of being transcribed into a RNA molecule. Methods are known for introducing constructs into a cell in such a manner that the transcribable nucleic acid molecule is transcribed into a functional mRNA molecule that is translated and therefore expressed as a protein product. Constructs may also be constructed to be capable of expressing antisense RNA molecules, in order to inhibit translation of a specific RNA molecule of interest. For the practice of the present disclosure, conventional compositions and methods for preparing and using constructs and host cells are well known to one skilled in the art (see e.g., Sambrook and Russel (2006) Condensed Protocols from Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, ISBN-10: 0879697717; Ausubel et al. (2002) Short Protocols in Molecular Biology, 5th ed., Current Protocols, ISBN-10: 0471250929; Sambrook and Russel (2001) Molecular Cloning: A Laboratory Manual, 3d ed., Cold Spring Harbor Laboratory Press, ISBN-10: 0879695773; Elhai, J. and Wolk, C. P. 1988. Methods in Enzymology 167, 747-754).

[0142] The "transcription start site" or "initiation site" is the position surrounding the first nucleotide that is part of the transcribed sequence, which is also defined as position +1. With respect to this site all other sequences of the gene and its controlling regions can be numbered. Downstream sequences (i.e., further protein encoding sequences in the 3' direction) can be denominated positive, while upstream sequences (mostly of the controlling regions in the 5' direction) are denominated negative.

[0143] "Operably-linked" or "functionally linked" refers preferably to the association of nucleic acid sequences on a single nucleic acid fragment so that the function of one is affected by the other. For example, a regulatory DNA sequence is said to be "operably linked to" or "associated with" a DNA sequence that codes for an RNA or a polypeptide if the two sequences are situated such that the regulatory DNA sequence affects expression of the coding DNA sequence (i.e., that the coding sequence or functional RNA is under the transcriptional control of the promoter). Coding sequences can be operably-linked to regulatory sequences in sense or antisense orientation. The two nucleic acid molecules may be part of a single contiguous nucleic acid molecule and may be adjacent. For example, a promoter is operably linked to a gene of interest if the promoter regulates or mediates transcription of the gene of interest in a cell.

[0144] A "construct" is generally understood as any recombinant nucleic acid molecule such as a plasmid, cosmid, virus, autonomously replicating nucleic acid molecule, phage, or linear or circular single-stranded or double-stranded DNA or RNA nucleic acid molecule, derived from any source, capable of genomic integration or autonomous replication, comprising a nucleic acid molecule where one or more nucleic acid molecule has been operably linked.

[0145] A constructs of the present disclosure can contain a promoter operably linked to a transcribable nucleic acid molecule operably linked to a 3' transcription termination nucleic acid molecule. In addition, constructs can include but are not limited to additional regulatory nucleic acid molecules from, e.g., the 3'-untranslated region (3' UTR). Constructs can include but are not limited to the 5' untranslated regions (5' UTR) of an mRNA nucleic acid molecule which can play an important role in translation initiation and can also be a genetic component in an expression construct. These additional upstream and downstream regulatory nucleic acid molecules may be derived from a source that is native or heterologous with respect to the other elements present on the promoter construct.

[0146] The term "transformation" refers to the transfer of a nucleic acid fragment into the genome of a host cell, resulting in genetically stable inheritance. Host cells containing the transformed nucleic acid fragments are referred to as "transgenic" cells, and organisms comprising transgenic cells are referred to as "transgenic organisms".

[0147] "Transformed," "transgenic," and "recombinant" refer to a host cell or organism such as a bacterium, cyanobacterium, animal or a plant into which a heterologous nucleic acid molecule has been introduced. The nucleic acid molecule can be stably integrated into the genome as generally known in the art and disclosed (Sambrook 1989; Innis 1995; Gelfand 1995; Innis & Gelfand 1999). Known methods of PCR include, but are not limited to, methods using paired primers, nested primers, single specific primers, degenerate primers, gene-specific primers, vector-specific primers, partially mismatched primers, and the like. The term "untransformed" refers to normal cells that have not been through the transformation process.

[0148] "Wild-type" refers to a virus or organism found in nature without any known mutation.

[0149] Design, generation, and testing of the variant nucleotides, and their encoded polypeptides, having the above required percent identities and retaining a required activity of the expressed protein is within the skill of the art. For example, directed evolution and rapid isolation of mutants can be according to methods described in references including, but not limited to, Link et al. (2007) Nature Reviews 5(9), 680-688; Sanger et al. (1991) Gene 97(1), 119-123; Ghadessy et al. (2001) Proc Natl Acad Sci USA 98(8) 4552-4557. Thus, one skilled in the art could generate a large number of nucleotide (e.g. pzbA, pzbB) and/or polypeptide (e.g., pzbA, pzbB) variants having, for example, at least 95%-99% identity to the reference sequence described herein and screen such for desired phenotypes according to methods routine in the art.

[0150] Nucleotide and/or amino acid sequence identity percent (%) is understood as the percentage of nucleotide or amino acid residues that are identical with nucleotide or amino acid residues in a candidate sequence in comparison to a reference sequence when the two sequences are aligned. To determine percent identity, sequences are aligned and if necessary, gaps are introduced to achieve the maximum percent sequence identity. Sequence alignment procedures to determine percent identity are well known to those of skill in the art. Often publicly available computer software such as BLAST, BLAST2, ALIGN2 or Megalign (DNASTAR) software is used to align sequences. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared. When sequences are aligned, the percent sequence identity of a given sequence A to, with, or against a given sequence B (which can alternatively be phrased as a given sequence A that has or comprises a certain percent sequence identity to, with, or against a given sequence B) can be calculated as: percent sequence identity=X/Y100, where X is the number of residues scored as identical matches by the sequence alignment program's or algorithm's alignment of A and B and Y is the total number of residues in B. If the length of sequence A is not equal to the length of sequence B, the percent sequence identity of A to B will not equal the percent sequence identity of B to A.

[0151] Generally, conservative substitutions can be made at any position so long as the required activity is retained. So-called conservative exchanges can be carried out in which the amino acid which is replaced has a similar property as the original amino acid, for example the exchange of Glu by Asp, Gin by Asn, Val by lie, Leu by lie, and Ser by Thr. For example, amino acids with similar properties can be Aliphatic amino acids (e.g., Glycine, Alanine, Valine, Leucine, Isoleucine); Hydroxyl or sulfur/selenium-containing amino acids (e.g., Serine, Cysteine, Selenocysteine, Threonine, Methionine); Cyclic amino acids (e.g., Proline); Aromatic amino acids (e.g., Phenylalanine, Tyrosine, Tryptophan); Basic amino acids (e.g., Histidine, Lysine, Arginine); or Acidic and their Amide (e.g., Aspartate, Glutamate, Asparagine, Glutamine). Deletion is the replacement of an amino acid by a direct bond. Positions for deletions include the termini of a polypeptide and linkages between individual protein domains. Insertions are introductions of amino acids into the polypeptide chain, a direct bond formally being replaced by one or more amino acids. Amino acid sequence can be modulated with the help of art-known computer simulation programs that can produce a polypeptide with, for example, improved activity or altered regulation. On the basis of this artificially generated polypeptide sequences, a corresponding nucleic acid molecule coding for such a modulated polypeptide can be synthesized in-vitro using the specific codon-usage of the desired host cell.

[0152] "Highly stringent hybridization conditions" are defined as hybridization at 65.degree. C. in a 6.times.SSC buffer (i.e., 0.9 M sodium chloride and 0.09 M sodium citrate). Given these conditions, a determination can be made as to whether a given set of sequences will hybridize by calculating the melting temperature (T.sub.m) of a DNA duplex between the two sequences. If a particular duplex has a melting temperature lower than 65.degree. C. in the salt conditions of a 6.times.SSC, then the two sequences will not hybridize. On the other hand, if the melting temperature is above 65.degree. C. in the same salt conditions, then the sequences will hybridize. In general, the melting temperature for any hybridized DNA:DNA sequence can be determined using the following formula: T.sub.m=81.5.degree. C.+16.6(log.sub.10[Na.sup.+])+0.41 (fraction G/C content)-0.63(% formamide)-(600/l). Furthermore, the T.sub.m of a DNA:DNA hybrid is decreased by 1-1.5.degree. C. for every 1% decrease in nucleotide identity (see e.g., Sambrook and Russel, 2006).

[0153] Host cells can be transformed using a variety of standard techniques known to the art (see, e.g., Sambrook and Russel (2006) Condensed Protocols from Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, ISBN-10: 0879697717; Ausubel et al. (2002) Short Protocols in Molecular Biology, 5th ed., Current Protocols, ISBN-10: 0471250929; Sambrook and Russel (2001) Molecular Cloning: A Laboratory Manual, 3d ed., Cold Spring Harbor Laboratory Press, ISBN-10: 0879695773; Elhai, J. and Wolk, C. P. 1988. Methods in Enzymology 167, 747-754). Such techniques include, but are not limited to, viral infection, calcium phosphate transfection, liposome-mediated transfection, microprojectile-mediated delivery, receptor-mediated uptake, cell fusion, electroporation, and the like. The transfected cells can be selected and propagated to provide recombinant host cells that comprise the expression vector stably integrated in the host cell genome.

[0154] Exemplary nucleic acids which may be introduced to a host cell include, for example, DNA sequences or genes from another species, or even genes or sequences which originate with or are present in the same species, but are incorporated into recipient cells by genetic engineering methods. The term "exogenous" is also intended to refer to genes that are not normally present in the cell being transformed, or perhaps simply not present in the form, structure, etc., as found in the transforming DNA segment or gene, or genes which are normally present and that one desires to express in a manner that differs from the natural expression pattern, e.g., to over-express. Thus, the term "exogenous" gene or DNA is intended to refer to any gene or DNA segment that is introduced into a recipient cell, regardless of whether a similar gene may already be present in such a cell. The type of DNA included in the exogenous DNA can include DNA which is already present in the cell, DNA from another individual of the same type of organism, DNA from a different organism, or a DNA generated externally, such as a DNA sequence containing an antisense message of a gene, or a DNA sequence encoding a synthetic or modified version of a gene.

[0155] Host strains developed according to the approaches described herein can be evaluated by a number of means known in the art (see e.g., Studier (2005) Protein Expr Purif. 41(1), 207-234; Gellissen, ed. (2005) Production of Recombinant Proteins: Novel Microbial and Eukaryotic Expression Systems, Wiley-VCH, ISBN-10: 3527310363; Baneyx (2004) Protein Expression Technologies, Taylor & Francis, ISBN-10: 0954523253).

[0156] Methods of down-regulation or silencing genes are known in the art. For example, expressed protein activity can be down-regulated or eliminated using antisense oligonucleotides, protein aptamers, nucleotide aptamers, and RNA interference (RNAi) (e.g., small interfering RNAs (siRNA), short hairpin RNA (shRNA), and micro RNAs (miRNA) (see e.g., Fanning and Symonds (2006) Handb Exp Pharmacol. 173, 289-303G, describing hammerhead ribozymes and small hairpin RNA; Helene, C., et al. (1992) Ann. N.Y. Acad. Sci. 660, 27-36; Maher (1992) Bioassays 14(12): 807-15, describing targeting deoxyribonucleotide sequences; Lee et al. (2006) Curr Opin Chem Biol. 10, 1-8, describing aptamers; Reynolds et al. (2004) Nature Biotechnology 22(3), 326-330, describing RNAi; Pushparaj and Melendez (2006) Clinical and Experimental Pharmacology and Physiology 33(5-6), 504-510, describing RNAi; Dillon et al. (2005) Annual Review of Physiology 67, 147-173, describing RNAi; Dykxhoorn and Lieberman (2005) Annual Review of Medicine 56, 401-423, describing RNAi). RNAi molecules are commercially available from a variety of sources (e.g., Ambion, Tex.; Sigma Aldrich, Mo.; Invitrogen). Several siRNA molecule design programs using a variety of algorithms are known to the art (see e.g., Cenix algorithm, Ambion; BLOCK-iT.TM. RNAi Designer, Invitrogen; siRNA Whitehead Institute Design Tools, Bioinofrmatics & Research Computing). Traits influential in defining optimal siRNA sequences include G/C content at the termini of the siRNAs, Tm of specific internal domains of the siRNA, siRNA length, position of the target sequence within the CDS (coding region), and nucleotide content of the 3' overhangs.

[0157] Definitions and methods described herein are provided to better define the present disclosure and to guide those of ordinary skill in the art in the practice of the present disclosure. Unless otherwise noted, terms are to be understood according to conventional usage by those of ordinary skill in the relevant art.

[0158] In some embodiments, numbers expressing quantities of ingredients, properties such as molecular weight, reaction conditions, and so forth, used to describe and claim certain embodiments of the present disclosure are to be understood as being modified in some instances by the term "about." In some embodiments, the term "about" is used to indicate that a value includes the standard deviation of the mean for the device or method being employed to determine the value. In some embodiments, the numerical parameters set forth in the written description and attached claims are approximations that can vary depending upon the desired properties sought to be obtained by a particular embodiment. In some embodiments, the numerical parameters should be construed in light of the number of reported significant digits and by applying ordinary rounding techniques. Notwithstanding that the numerical ranges and parameters setting forth the broad scope of some embodiments of the present disclosure are approximations, the numerical values set forth in the specific examples are reported as precisely as practicable. The numerical values presented in some embodiments of the present disclosure may contain certain errors necessarily resulting from the standard deviation found in their respective testing measurements. The recitation of ranges of values herein is merely intended to serve as a shorthand method of referring individually to each separate value falling within the range. Unless otherwise indicated herein, each individual value is incorporated into the specification as if it were individually recited herein.

[0159] In some embodiments, the terms "a" and "an" and "the" and similar references used in the context of describing a particular embodiment (especially in the context of certain of the following claims) can be construed to cover both the singular and the plural, unless specifically noted otherwise. In some embodiments, the term "or" as used herein, including the claims, is used to mean "and/or" unless explicitly indicated to refer to alternatives only or the alternatives are mutually exclusive.

[0160] The terms "comprise," "have" and "include" are open-ended linking verbs. Any forms or tenses of one or more of these verbs, such as "comprises," "comprising," "has," "having," "includes" and "including," are also open-ended. For example, any method that "comprises," "has" or "includes" one or more steps is not limited to possessing only those one or more steps and can also cover other unlisted steps. Similarly, any composition or device that "comprises," "has" or "includes" one or more features is not limited to possessing only those one or more features and can cover other unlisted features.

[0161] All methods described herein can be performed in any suitable order unless otherwise indicated herein or otherwise clearly contradicted by context. The use of any and all examples, or exemplary language (e.g. "such as") provided with respect to certain embodiments herein is intended merely to better illuminate the present disclosure and does not pose a limitation on the scope of the present disclosure otherwise claimed. No language in the specification should be construed as indicating any non-claimed element essential to the practice of the present disclosure.

[0162] Groupings of alternative elements or embodiments of the present disclosure disclosed herein are not to be construed as limitations. Each group member can be referred to and claimed individually or in any combination with other members of the group or other elements found herein. One or more members of a group can be included in, or deleted from, a group for reasons of convenience or patentability. When any such inclusion or deletion occurs, the specification is herein deemed to contain the group as modified thus fulfilling the written description of all Markush groups used in the appended claims.

[0163] Citation of a reference herein shall not be construed as an admission that such is prior art to the present disclosure.

[0164] Having described the present disclosure in detail, it will be apparent that modifications, variations, and equivalent embodiments are possible without departing the scope of the present disclosure defined in the appended claims. Furthermore, it should be appreciated that all examples in the present disclosure are provided as non-limiting examples.

EXAMPLES

[0165] The following non-limiting examples are provided to further illustrate the present disclosure. It should be appreciated by those of skill in the art that the techniques disclosed in the examples that follow represent approaches the inventors have found function well in the practice of the present disclosure, and thus can be considered to constitute examples of modes for its practice. However, those of skill in the art should, in light of the present disclosure, appreciate that many changes can be made in the specific embodiments that are disclosed and still obtain a like or similar result without departing from the spirit and scope of the present disclosure.

Example 1: Discovery of the Complete Biosynthetic Pathway to L-Piz from the Central Metabolite L-Orn

[0166] The following example describes the discovery of the complete biosynthetic pathway to L-Piz from the central metabolite, L-Orn.

[0167] Select examples of piperazic acid (Piz) family of natural products are shown in FIG. 2. Piz and modified Piz (e.g., dehydropiperazic, chloropiperazic, hydroxypiperazic acid) molecular components are shown in red in FIG. 2. All of these molecules are bioactive, with sanglifehrin (top left of FIG. 2) under consideration as an immunosuppressant and Hepatitis-C antiviral. The small molecule in the center of FIG. 2 (Sch 382583) is a member of an emerging group of Piz containing metalloprotease inhibitors with clinical relevance as metastatic cancer and antibacterial antibiotic leads. All of these molecules are exclusively produced by actinobacteria.

##STR00021##

##STR00022##

[0168] Orthologs of both PzbA (yellow) and PzbB (red) were found within biosynthetic gene clusters for known Piz-containing antibiotics (see e.g., FIG. 2). As these clusters encode molecules that are structurally dissimilar except for the incorporation of Piz, parsimony suggests both pzbA (previously known) and pzbB (previously unrecognized) are involved in Piz biosynthesis.

[0169] In vitro reconstitution of L-Piz production from L-Orn in a coupled enzymatic reaction containing purified PzbA, PzbB, buffer salts, NADPH cofactor, Fe.sup.+2 salts, and catalytic FAD (Flavin Adenine Dinucleotide) cofactor according to Scheme 2.

[0170] FIG. 2 shows the HPLC-ESI-MS detection of products and substrates with assay time points at time 0 min, 15 min, and 30 min showing the consumption of L-Orn, accumulation of the known intermediate N.sup.5--OH-Orn, and the concomitant formation of Piz. Data (not shown) in the same assay lacking PzbB, the enzyme product is N.sup.5--OH-Orn and no Piz is formed.

Example 2: Green Biocatalysis of L-Piz In Vitro

[0171] L-Piz can be synthesized chemically, but to date a fermentative pathway to the amino acid has eluded researchers. Enantiopure synthetic L-Piz is expensive: ($2800/gram, 95% pure). DL-Piz synthesized as a mix of isomers, which is significantly less chemically desirable, is less expensive ($800/gram, 95% pure), but still of significant cost. Using a coupled enzyme assay containing a suitable L-Ornithine N.sup.5--OHase (PzbA), and a suitable PzbB (L-N.sup.5--OH Orn cyclase/dehydratase), enantiopure (as currently understood) L-Piz can be made from the inexpensive feedstock enantiopure L-Ornithine ($1.40/gram, >99% pure, Sigma-Aldrich), buffer salts, NADPH cofactor, Fe.sup.+2 salts, and catalytic FAD (Flavin Adenine Dinucleotide) cofactor (see e.g., FIG. 3).

Example 3: An Enzymatic Route to Heavy Isotope-Labelled Piz

[0172] Heavy isotope-labeled compounds (e.g., compounds containing deuterons/heavy hydrogen, heavy nitrogen, heavy oxygen, heavy carbon) are valuable tools for mass spectrometric and NMR based studies. Currently, no vendors, custom or otherwise, that offer L-Piz having any combination of these isotopes. Using d.sub.7-L-Orn, the feasible production of d.sub.7 L-Piz using the reaction described in Example 2 above has been demonstrated. In principle, any heavy isotope labeled L-Orn could yield similarly labeled L-Piz. Coupled PzbA/PzbB enzymatic reactions could be scaled to produce and market variously heavy isotopically labeled or radioisotopically labeled versions of L-Piz, for which there are current no known synthetic paths.

Example 4: Green Biocatalysis of L-Piz In Vivo

[0173] This example shows a greener production of L-Piz (no organic solvents and fewer reagents than conventional methods).

[0174] Micro-organisms such as bacteria and fungi are preferred producers of amino acids in the biotechnology industry. This is because the cellular enzyme catalysts of life are typically stereospecific, giving enantiopure products. Enantiopurity can be more difficult to achieve in synthetic chemistry. Also, inexpensive feedstocks are provided for growth, significantly reducing the cost of amino acid production in contrast to fine chemical starting points often required for synthetic chemistry. Here, L-Piz fermentation in a heterologous, genetically engineered host (Streptomyces lividans) grown on standard lab media, and with no investment in yield optimization (see e.g., FIG. 4) has been demonstrated.

[0175] S. lividans (WT parent, no Piz production) is compared against S. lividans harboring a single copy of pzbA (sfaB) alone, pzbB (sfaC) alone, or co-expressing pzbA and pzbB (sfaBC) cloned from the sanglifehrin biosynthetic locus of Streptomyces flaveolus in FIG. 4. LC/MS detection of biosynthetic Piz was compared against an authentic L-Piz standard (top row, FIG. 4). In contrast with the in vitro data in FIG. 4, pzbA is dispensable in the heterologous system because S. lividans encodes a native copy of the gene as part of a siderophore biosynthetic pathway unrelated to Piz production. Thus, pzbA remains required for Piz production, but its role in bacteria is not limited to Piz anabolism. In contrast, to our knowledge, pzbB is only found associated with Piz production.

[0176] Using a mass-spectrometric (MS/MS) method for sensitive quantification, it was estimated that S. lividans is carrying at minimum a single copy of a suitable pzbB gene (one or more native pzbA's are natively encoded on the S. lividans chromosome, and therefore is not absolutely required for heterologous expression) under a constitutive promoter to produce micromolar L-Piz. Measurably higher (.about.1 mM) L-Piz titers can be achieved using a heterologous S. lividans producer carrying one or more copies of a non-native pzbA in conjunction with heterologous pzbB. S. lividans serves as a proof of concept host, not necessarily an industrial endpoint. Much higher L-Piz production can likely be achieved by expressing suitable pzbA and pzbB genes in a heterologous host that overproduces the critical feedstock L-Ornithine. One such candidate host is the actinobacterial industrial producer of L-Orn, Corynebacterium glutamicum (20.8-51.5 grams/liter). Importantly, at least one such industrial L-Orn producing strain is publicly available through the American Type Culture Collection (ATCC), making strain engineering from a high producer feasible.

[0177] L-Piz Fermentation Production Rate.

[0178] The following describes the rate of fermented L-Piz in heterologous hosts (Streptomyces lividans), plated in 1 L. S. lividans makes at least 1 mg/L plates in 3 days. This translates to .about.14 .mu.g/L per hour or 0.2 .mu.g/L per minute.

Example 5: Directed Discovery of Drugs and Drug-Like Compounds Using Heavy Isotope L-Piz

[0179] This example shows how newfound ability to recognize biosynthetic genes encoding Piz-derived small molecules (e.g., isotopically labeled Piz compound) can facilitate genomic discovery of new natural products that can be used as drug leads.

[0180] Current technologies can only enable a rough estimate what the final chemical structures encoded by these biosynthetic genes are. To link biosynthetic genes to the compounds they produce, especially in the case of L-Piz containing compounds, supplying d.sub.7-L-Orn to microorganisms of interest can link the biosynthetic compounds to the produced compounds. Some percentage of this labeled compound is expected to become d.sub.7 L-Piz in cellulo, and consequently become incorporated into the natural products that will be discovered.

[0181] Differential mass spectrometry allows for the detection of the labeled compounds in a much more specific way than absence of such a technology. However, L-Orn can be incorporated into many natural compounds, confusing the analyses. Isotopically labeled L-Piz would be a much more useful molecular probe for the specific and directed discovery of L-Piz-containing drug leads compared to labeled L-Orn for the reasons above.

[0182] Data indicating L-Piz successfully penetrates at least one Piz-compound producing actinomycete was obtained, followed by subsequent incorporation into a Piz drug-like compound sanglifehrin (see e.g., FIG. 5). FIG. 5 shows LC/MS detection of sanglifehrin, a Piz-containing compound produced by Streptomyces flaveolus. Four major isobaric isomers of sanglifehrin A detected in WT S. flaveolus fermentation extracts. As expected from the results in FIG. 5, an unmarked gene deletion of pzbB (sfaC) from S. flaveolus abrogates sanglifehrin production. Genetic complementation of this mutant with an additional copy of pzbB, or exogenously supplied 50 .mu.M authentic L-Piz (top, FIG. 5), restore the production of the four sanglifehrin A isobars. L-Piz is therefore cell penetrant and qualitatively nontoxic. These data (see e.g., FIG. 5) additionally link pzbB function with Piz production in vivo, which agrees with the in vitro assay data.

[0183] Thus, it is expected that isotopically labeled L-Piz will penetrate cells and label Piz compounds without significant complications from poor cell penetrance, transport, or toxicity.

Example 6: Characterization of L-Piperazic Acid Sterochemistry

[0184] The following example describes the characterization of the synthesized piperazic acid compound. It was shown that the product is an L-Piz and is enantiomerically pure.

[0185] FIG. 6 shows the Marfey's derivatization analysis of the product of PzbB in an assay with L-N5 hydroxy Ornithine substrate (the product of PzbA). This conclusively shows the product of PzbB has the same stereochemistry (L) and mass as the same derivative produced using L-Piz authentic standard (see e.g., FIG. 6).

Example 7: PzbB Ortholog Identity with PzbB Activity

[0186] The following example shows that a PzbB ortholog can have as little as around 25% sequence identity to another PzbB ortholog and still produce L-Piz or retain PzbB activity.

[0187] Bioinformatic data showed PzbB orthologs that can be used to produce L-Piz have an estimated protein identity (functional cutoff) to be around 25% (some predicted PzbB orthologs have identity scores in the 30% range and most have 45% or above.

Example 8: SfaBC (Co-Expressing pzbA and pzbB) Combined Ornithine In Vitro Assay Method

[0188] 100 .mu.L of reaction in 50 mM Tris.HCl at pH 8.0 was set up with L-orn (500 .mu.M), FAD (50 .mu.M), His.sub.6-SfaB (10 .mu.M), SfaC-His.sub.6 (135 .mu.M), NADPH (2 mM), and FeSO.sub.4 (10 mM). 30 .mu.L aliquots were removed at 0 min, 15 min, and 30 min, and combined with 30 .mu.L acetonitrile. The cloudy mixture was centrifuged, and 30 .mu.L of the supernatant was acidified with 3 .mu.L 2 M HCl. Sample was analyzed for piperazic acid by HPLC/MS. Analysis was performed using an Imtakt Intrada Amino Acid column (50.times.3 mm, 3 .mu.m pore size) installed on an Agilent 1260 Infinity HPLC connected to an Agilent 6420 Triple-Quad mass spectrometer using the following method: T=0, 0% B; T=2, 0% B; T=8, 100% B; T=14, 100% B; A: water (30%)/methanol (70%)+0.3% formic acid, B: water+100 mM ammonium formate; 0.4 mL/min. A novel peak at T=5.4 min eluted with a [M+H].sup.+ of 131, corresponding to piperazic acid.

Example 9: SfaBC (Co-Expressing pzbA and pzbB) Combined D.sup.7-Ornithine In Vitro Assay Method

[0189] 100 .mu.L of reaction in 50 mM Tris.HCl at pH 8.0 was set up with d.sup.7-L-orn (500 .mu.M), FAD (50 .mu.M), His.sub.6-SfaB (10 .mu.M), SfaC-His.sub.6 (135 .mu.M), NADPH (2 mM), and FeSO.sub.4 (10 mM). 30 .mu.L aliquots were removed at 0 min, 15 min, and 30 min, and combined with 30 .mu.L acetonitrile. The cloudy mixture was centrifuged, and 30 .mu.L of the supernatant was acidified with 3 .mu.L 2 M HCl. Sample was analyzed for piperazic acid by HPLC/MS. Analysis was performed using an Imtakt Intrada Amino Acid column (50.times.3 mm, 3 .mu.m pore size) installed on an Agilent 1260 Infinity HPLC connected to an Agilent 6420 Triple-Quad mass spectrometer using the following method: T=0, 0% B; T=2, 0% B; T=8, 100% B; T=14, 100% B; A: water (30%)/methanol (70%)+0.3% formic acid, B: water+100 mM ammonium formate; 0.4 mL/min. A novel peak at T=5.4 min eluted with a [M+H].sup.+ of 138, corresponding to piperazic acid.

Example 10: PzbAB (Amycolatopsis alba) Ornithine In Vitro Assay

[0190] 100 .mu.L of reaction in 50 mM Tris.HCl at pH 7.0 was set up with L-orn (500 .mu.M), FAD (50 .mu.M), PzbAB (Amycolatopsis alba) (14 .mu.M), NADPH (2 mM), and FeSO.sub.4 (10 mM). 30 .mu.L aliquots were removed at 0 min, 15 min, and 30 min, and combined with 30 .mu.L acetonitrile. The cloudy mixture was centrifuged, and 30 .mu.L of the supernatant was acidified with 3 .mu.L 2 M HCl. Sample was analyzed for piperazic acid by HPLC/MS. Analysis was performed using an Imtakt Intrada Amino Acid column (50.times.3 mm, 3 .mu.m pore size) installed on an Agilent 1260 Infinity HPLC connected to an Agilent 6420 Triple-Quad mass spectrometer using the following method: T=0, 0% B; T=2, 0% B; T=8, 100% B; T=14, 100% B; A: water (30%)/methanol (70%)+0.3% formic acid, B: water+100 mM ammonium formate; 0.4 mL/min. A novel peak at T=5.4 min eluted with a [M+H].sup.+ of 131, corresponding to piperazic acid.

Example 11: SfaC (Expressing pzbB) N.sup.5--OH-L-Ornithine In Vitro Assay

[0191] 100 .mu.L of reaction in 50 mM Tris.HCl at pH 8.0 was set up with N.sup.5--OH-L-orn (1 mM), His.sub.6-SfaC (18 .mu.M). 30 .mu.L aliquots were removed at 0 min, 10 min, and 20 min, and combined with 30 .mu.L 6% 5-sulfosalicylic acid. The cloudy mixture was centrifuged, and the supernatant was used for analysis. Sample was analyzed for piperazic acid by HPLC/MS. Analysis was performed using an Imtakt Intrada Amino Acid column (50.times.3 mm, 3 .mu.m pore size) installed on an Agilent 1260 Infinity HPLC connected to an Agilent 6420 Triple-Quad mass spectrometer using the following method: T=0, 86% B; T=3, 86% B; T=10, 0% B; T=11, 0% B; T=12, 86% B; T=14, 86% B; A: water+100 mM ammonium formate, B: acetonitrile+0.1% formic acid; 0.6 mL/min. A peak at 5.6 min with a [M+H].sup.+ of 131, corresponded to piperazic acid.

Example 12: Marfey's Analysis of SfaC (Expressing pzbB) Product

[0192] The following example confirms that the product of PzbAB from L-Orn is actually L-Piz. Marfey's analysis was performed on the PzbAB reaction product and compared the results with synthetic L-Piz standard. The data so far are consistent with the PzbAB reaction yielding an enantiopure L-Piz.

[0193] 100 .mu.L of reaction in 50 mM Tris.HCl at pH 8.0 was set up with N.sup.5--OH-L-orn (1 mM), His.sub.6-SfaC (20 .mu.M), hemin (20 .mu.M). Reaction was allowed to proceed for a few minutes. A control was also set up in 50 mM Tris.HCl at pH 8.0 with L-Piz (0.25 mg/mL) and hemin (20 .mu.M). To 100 .mu.L of aqueous reaction or control was added 50 .mu.L of 1% FDAA in acetone. The reaction was incubated at 50.degree. C. for 1 hour. 100 .mu.L of 1 M HCl was then added. Finally, 300 .mu.L of water/MeCN (50:50) was added to dissolve the precipitate. The supernatant was filtered (Agilent Captiva Econo Filter, 0.2 .mu.L) into HPLC vials for HPLC/MS analysis.

[0194] Analysis was performed using a Phenomenex Luna C18 column (75.times.3 mm, 3 .mu.m pore size) installed on an Agilent 1260 Infinity HPLC connected to an Agilent 6420 Triple-Quad mass spectrometer using the following method: T=0, 10% B; T=5, 10% B; T=25, 100% B; T=27, 100% B, T=29, 10% B, T=30, 10% B; A: water+0.1% formic acid, B: acetonitrile+0.1% formic acid; 0.6 mL/min. 10 .mu.L of the sample was injected per run, and a total ion count chromatogram was obtained for each sample. An extracted ion count chromatogram at m/z 383.1 (monoisotopic mass of protonated FDAA-derivatized piz) was used to detect derivatization. The UV response at 340 nm was also monitored.

Example 13: Hemin Influence on SfaC (Expressing pzbB)

[0195] This example shows that the PzbB's cofactor is now confirmed to be Fe.sup.+3-protoporphryin IX (aka hemin). As expected for a bona fide cofactor, adding hemin increases the rate of turnover.

[0196] 100 .mu.L of reaction in 50 mM Tris.HCl at pH 8.0 was set up with N.sup.5--OH-L-orn (1 mM), SfaC-His.sub.6 (2 .mu.M), and either hemin in DMSO (10 .mu.M) or just DMSO. The two reactions were incubated at 4.degree. C. for 7 hours. Then, 30 .mu.L aliquots were removed at 30, 60, and 90 sec, and combined with 30 .mu.L 6% 5-sulfosalicylic acid. The cloudy mixture was centrifuged, and the supernatant was used for analysis. Sample was analyzed for piperazic acid by HPLC/MS. Analysis was performed using an Imtakt Intrada Amino Acid column (50.times.3 mm, 3 .mu.m pore size) installed on an Agilent 1260 Infinity HPLC connected to an Agilent 6420 Triple-Quad mass spectrometer using the following method: T=0, 86% B; T=3, 86% B; T=10, 0% B; T=11, 0% B; T=12, 86% B; T=14, 86% B; A: water+100 mM ammonium formate, B: acetonitrile+0.1% formic acid; 0.6 mL/min. An extracted ion count chromatogram at m/z 131.1 (monoisotopic mass of protonated piperazic acid) was used to detect piperazic acid. For quantification, an SRM transition (m/z 131.1=>56.3; source voltage, 86 V; collision energy, 37 V) was monitored, and a standard curve (second order polynomial, R2=0.9996) was generated between 0.1 .mu.M and 100 .mu.M using a chemically synthesized L-piperazic acid dihydrochloride standard. The concentrations in time were plotted, and fitted to a line. The slope of the line was used as the rate of the reaction. Hemin increased the slope by 14.4 times.

Example 14: Fermentative L-Piz Production from Various Streptomyces Strains

[0197] This example describes L-Piz production from various Streptomyces strains (see e.g., FIG. 7) (methods are as described above unless stated otherwise). Randomly selected environmental Streptomyces isolates were transformed with pYH015 via intergeneric conjugation as described for S. lividans. L-Piz production was quantified via SRM LC/MS from triplicate growths essentially as noted for the S. lividans transformants. Resulting strain to strain Piz production is variable, ranging from very low to nearly the same as S. lividans carrying pYH015 (JV594). Note S. lividans JV 596 expressing both sfaB and sfaC produces more L-Piz, with less titer variability, than all sfaC-alone strains in the panel. L-Piz was not detected in any non-transformed parent strains (not shown).

[0198] It is noted that the value reported here for for JV596 (.about.2.5 mg/L) is higher that what we previously reported (.about.1 mg/L).

TABLE-US-00007 SEQUENCE LISTING PzbA 1. >Mycobacterium_marinum_M MQQRLTMWSATGLIFGHALCMNTCRTMVVPRGKPLCIERVPPLPCQPKMGESTMPSGGIA DPELALVDRTLSVVGVGFGVTGLALAAALHEAEMTEDALFLESRPKFGWHDDMLIEGSSM QVSFLKDIVTMRNPTSRFSFISYLHAMGRLTNFINHGVLTPSRREFADYLRWVARQLDHL VRYDVHVTDVRPVYEGATVSALDIVAGENAVVRTRNLVLGTGLRPRMPQGVIPNRRVWHS SELLSRLAECGDYLARQIVVVGAGQSAAEIALYLLDRYPDSQVCPVFARYGYSAVDASPF ANRIFDPSGVDDFYAASPSVKASLLRYHGNTNYSVVSSDVLGALYRRQYEQSVIGDPRLR IFHASRLHLVSFNDDSVVADIEFLPTGEVTRLDTDLVVIYATGYESRDPKHLLTSLAGYL RTDELGALRLDRRYRVKTVEGFRCGIFVQGATESTHGIASTLLSVAAVRAGEISQSLMET SQARPPAGSVTHRH 2. >Lentzea_flaviverrucosa_DSM_44664 VTSEPYDVVGIGFGPSNLSLAIALEETGGLSAAFFEKQDSLRWHSGMLVPGAKMQVSFLK DLATPRNPVSSYSFVSYLHDRGRFARFVNNSDFFPTRREFQDYLRWAEARLSPPVHYRAE VVSVRRAEGVLRVHVRDTESGATRTVDTRNIVISTGLVPRMPVGLEAGESVWHSSQFLHR FHALGDRDVRRVAVVGAGQSAAELVRYLHENLPSAQVFAVLPSYGYAIADSTPFANEVFD ADAVDVFYDASDKAKAAIWRYHRNTNYSVVDDEVIRDLYQRAYDDEVRGEPRLRFLPLTR VVGAKQDRDGITLLTHSTVDDQARDLPLDLVVCATGYDPMDPGELLAGLGCSVAYDELGR HLVGRDHRLVTEPDQDCGIYLQGGTEHTHGLTSSLLSNIAVRGGEITQSILRRRAEQRNG APA 3. >Streptomyces_aureofaciens_ATCC_10762 VGERQRSGVVAGTGIVDVAGIGFGPSNLALAAAIAEIAGEAPVSARFFEA QPRFGWHRGMLIEGATMQVSYLKDLVTMRNPTSPYSFLCYLQARGRLADF INTKSPYPLRVEFHDYLEWVAESFADLVSYGARVVSVEPVSAEQGVEFLD VHFVAPDGTRQVQRARNLVIAAGIEPRLPAGLPASPRIWHTAKFLPEVDR IARQDPRSFVVLGSGQSAAEAIEHLHARFPRAQVHSVHARYGFSVADDSP FANQVFNPEAVDRFHTAPDDVRQRLIDYHASTNYSVVDADLLHSLFQQAY LEKVAGNPRLNFHNVSRVSEVTETPDGLRIDVESLSSGTSTVIEAQALVC ATGYTRTDPAVFLDGLLPHCPLDDQGRLRLDREHRVVTDESVRCGIYVQG FGEHSHGLSETLLSLSAVRAGEIGDMLVKALSG 4. >Streptomyces_diastatochromogenes_NRRL_B-1698 VNVSEPGSDQVVDVVGIGFGPSNLALAVALGEGGRKASEKPVTSVFFERK ERFTWHGGMLIDGATMQISFLKDLVTLRDPRSPYTFLHYLHQVGRLPDFI NHKLLFPSRIEFHDYLCWVAESFDHQVRYGADVVDVRPVHSDGAVNHLDV VVRHEGPEGERISVQRTRNVVVGTGLEAHMPAGAAPGDRVWHTSELLHKV AALKEEPRRIVVVGAGQSAAEATEYLHRRFEAAEICPVFTRYGYSPADDS PFANRIFDPLAVDDYYAATPEVKRMLLGYHRNTNYSVVDAELIDELYRRV YQEKVQGRHRLKVFNASRLAEVKAGAEGVQVTVESVISRCRTVLDADCVV YATGYRPTDVRRLIGGMAGLCKADEMGRLHADRDYRVVTEGDVHCGIYLQ GATEHSHGISSSLLSNTAVRAGEIADSIVAGVVGATASE 5. >Streptomyces_sp._DvalAA-43 MDASARETYDVVGIGFGPSNLSLAIALEEHEANVPARPISAAFFERQPSF GWHRNMLLPAATMQISFLKDLATFRNPVSRYSFIAYLHAADRLVQFVNNQ TFFPTRQEFHQYLEWAESSFSDRVSYNSEVTAIRRATGTGPGEPDCLQIE VRDGIGGGCRLVHARNVAISTGLVPRMPAGVERDDRVWHSSEFLEKYGQV DPNALKSVAVVGAGQSAAEITRFLHDALPHARVFAVVPSYGYSVADDTPF ANRVFDPSAVDDYYFGTEQTREAFWRYHRNTNYSVVDDEIIRDLHQRSYD EDVRNDRRLHFLNLTRVDDVQRIGTEIRVGLRSLIDVEAQTLDVDALVFA TGYGAMQPTGLLGDLDRHCLRDAAGRHRAERDYRLVTTPELSCGIYLQGG TEHTHGLTSSLLSNVAVRSGEIADSIVRRRAEEHEPVASLGTSGRTS 6. >Collimonas_fungivorans_Ter6 MQVCFLKDLAMLRNPTSPFTFLSYLHDKNRLVDFVNHKILFSSRVEFHDY LEWAAAKLKRLVQYDAEVVEVSPVICDGVVKWLDVVVQRDGNPSHHEIYR THNLVIAPGLEPTMPPGISRSERVWHSSEVLDRIAHLTEEPQQFTVVGAG QSAAEITAYLHDHFKYAKVRSIFSRYGYSAADDSPFTNRIFDPLAVDEYY QARDDVKKMLLNFHRNTNYSVVDADLLEDLYRRHYQEMVRGESRLEFMNV SKVFGAVADRDSVDLSVEFLPTGDMRKLRSDIVVFGSGYKIADPIRYFSD FAGKCIRDSFGQLRVARNYRICTSEDVECGIYLQGTTEHTHGLSSTLLSN TAVRAGEILEAMTWERDNKKISSHA 7. >Streptomyces_reticuli_TUE45 MTRLAGQAPTAQHSPESEVRDVTGIGFGAANLALAVALHESGAGDRALFL EKQKEFGWHRGMLIEGSSLQVSFLKDIATMRNPTSDFGFLSYLQEKGRLV DFINQHTLLPSRIEYHDYLQWAADRLGHMVEYGVEATGVRPVTDAGEVVA LDVLAGDRVVTRTRNLVIASGLRPRLPEGAETGERVWHSSQLLHRLPAFD ERPPRRAVVVGAGQSAAEVAAHLMERYPQAEVCAVFSRYGYSVADSSPFA NRVFDPAAVDDFYFAPPEVKQAIMRYHGGTNYAVVDEDVLQGLYRRQYEQ KVTGTPRLRVMNASRLVSVEPRGETAAVRVEFLPTGEHADLDADLVVYAT GYRSADPAELLGGVAGSLRRDAAGQVLIGRDYRLSTTGDFRCGIYVQGAT EATHGIASTLLSMVAVRAGEIAQSIIGGRRDPDRTAGTKAVAGNRG 8. >Streptomyces_scabiei_NCPPB_4086 MEAHTDAYEVVGIGFGPSNLSLAIALEEQRGKDEKPLTAAFFEKQASLGW HRNMLLPDTKMQISFLKDLATFRNPASQWSFIAYLHAAGRLAQFVNNQNF FPTRNEFHDYLDWAESSFSDRVTYNCEVNAVHLPDGYTGGPVDTVRVEVK DNTPRGGTRLVEARNLVISTGLVPTMPTGIERGERVWHSSEFLGRFGTLD RDRVRRFAVVGAGQSAAEITRYVYDIVPNAEVYAIMPSYGYSIADDTPYA NRIFDADAVDDYYGGTDHTRESFWRYHRNTNYGVADDEVIRDLYQRAYDD EVARIKRLHLLNLSRVRTVEQTVDGARLTMHSVRDDSTYGLDVDAIVFAT GYDSMDPTALLGDLAPHCLRDEEGRLRVERDYRLVTSPDLNVGIYLQGGT EHTHGLASALLSNIAIRSGEIADAIAIDLAARQHTTARSTIG 9. >Kutzneria_albida_DSM_43870 MQRDYRVVTVPEMRCGIYLQGGTEHTHGLTSSLLSNIVIRTGEITDSIIT RRAELNVGERRTVNG 10. >Streptomyces_albus_ZpM MTGPEVYDIVGVGFGPANLALAVALTERGSSTPLRALFLDRNESFSWHPG MLIHDATMQVNFLKDLITLRNPASDFSFLSYLKARGRLVDFINHKTFFPT RVEFHDYLEWAAGRVGDVVEYGTEVVDVRPVERDGEVVYFDVVGHQQVGG VSQAVVCRARNVVVAPGLVPRLPGEASQSERVWHSSELLHRVGDLPTDKR MQFVVVGAGQSAAEVVGYLHARYECADVHAVHSRYGYSPADDTPFANRVF DPAAVEHFFHAPPSVKDKFFEYHANTNYSVVDVELIEDLYARVYRESVTE RRRLHIHGMSELTEVADGPEGLRVSVRFLPDGTTTVLEPDHVVYATGYKP ADVNRVIGVVAELCKRDSSGNLRLLHDYRVDMASHVRCGIYLQGGTEHSH GITSSLLSNLADRAAEILDSVLAHGGQLSADAAAWEVAS 11. >Rhodococcus_fascians_02-815 MGAQSGSSVADVVGVGFGPSNLALAIALQESIQPGPVPAKFSMKFYELQP RFGWHRGMLMEDATMQVSFLKDLATMRNPMSRYTFVSYLREKERIAEFIN SKTLYPLRVEFHDYLEWAASQFQSNVSYGSEIKDIRPVVENGVVEYVDVV GPDDVVQRARNIVIGMGLTPRLPDGVNRSERIWHSSQLLGRAAAVTYVPQ NFVVVGSGQSAAEVADYLHRTFPRANVHTVLSRYGYSVADDSPYANGIFD PEGVDRFFSAPTDEKQRLLEYHANTNYSVVDLDISQSLYLKSYQEKVLGK QRLRMINTSRVTSVDEDTDGVRVEVTSSATGLTHTIEADVIVYATGYRPS DPAPLLQGLMRECKHDEQGRLSVGRDYRVTTSDAVRAGIYVHGASTEHSH GLSAGLLSNTAVRSGEIAQSILRR 12. >Streptomyces_neyagawaensis_NRRL_B-3092 MEANTEAYEVVGIGFGPANLSLAIALEEQRGKDEKQLTAAFFEKQPSLGW HRNMLLPDTKMQISFLKDLATFRNPASQWSFIAYLHAAGRLAQFVNNQNF FPTRNEFHDYLEWAESSFSDRVTYNSEVNAVHLPDGHDGGPVDTVRVEVK DNGPRGGTRLVEARNLVISTGLVPKMPDGVDRGERVWHSSEFLGRFHTLD PSRVRRFAVVGAGQSAAEITRYVYDTIPDAEVYAIMPSYGYSIADDTPYA NRIFDADAVDDYYGGTDRTRESFWRYHRNTNYGVADDEVIRDLYQRAYDD EVARIKRLHLLNLSRVQRVDQRADGARLTMHSVRDDSVYDLDVDAIVFAT GYDSMDPTALLGDLAPYCLRDDEGRLRVERDYRLVTKPELNVGIYLQGGT EHTHGLASSLLSNIAIRSGEIADAIAIAIDLASRRHTTV 13. >Kutzneria_buriramensis_DSM_45791 MDTRGSETYDVVGIGFGPANLSLAIALEESPQRLTSAFFERQPSLGWHRG MLVPAAKMQVAFLKDLVTFRNPTSTFSFVSYLHDRGRLARFVNNQDFFPT RREFHDYLEWAESRVSHRVSYQSEVTAMRLPCAQRPGEDDHVEVEVRDRT APSGSRTVAARNVVISTGLVPRMPAGLQTDEFVWHSSEFLHKFSRADHSG LKRVAVVGAGQSAAEIVRFLYDMLPDANVFAIIPSYGYSIADNTPFANQI FDPAAVDDFYAGSDQAKDAIWRYHRNTNYSVVDDEVIKDLYRRQYDDDLG RPGRLAFLNLSRVLDVKRVGEDTRVTVHSTATEQAADLDVDVLVCATGYS PMEPADLLGDLARYCVYDGDGRYQVDRDYRLVTPDLDCGIYLQGGTEHTH GLSSSLLSNIAVRSGEIAASIARRRLSTNGNGVHA 14. >Streptomyces_yanglinensis_CGMCC_4.2023 MSNREQTYDVVGIGFGPSNLSLAIALEEFGAHGMENEISSLFLERQPSFG WHRNMLLPSATMQISFLKDLVTFRNPTSGFSFIAYLHASGRLPQFVNNQD FFPTRQEFHQYLEWAQAQVAGRIEYGAEVTSIRLPSGTAPQEGADRLVLE VAEGAGRTGRAVEARNVVISTGLVPSMPAGAERDERVWHSSEFLDKYRRT DHRELRRVAVVGAGQSAAEIARFLYDELPHAQVSAIIPSYGYAVADDTPF ANRIFDPSAVDDYYFGTEQTRESFWRYHRNTNYSVVDDEVIRDLYRRSYD DEVRGVTRLQLLNLTRVTGVKRAGAETRVSLQVGPDAELRELDFDLLVCA TGYDGMEPTGLLGELDRYCLRDEAGRYRVERDYRIVTTPELRCGIYLQGG TEHTHGLTSSLLSNLAVRSGEIADSIIARRAGYGAEREVLAKIGGDIA 15. >Streptomyces_griseochromogenes_ATCC_14511 MSDREHETYDVVGIGFGPSNLSLAIALEEYRANGPENEISALFLERQSAF GWHRNMLLPSTTMQISFLKDLVTFRNPTSSFSFIAYLHASGRLPQFVNNQ DFFPTRQEFHQYLEWAQARVADRVAYGSEVTSIRLPPGADPERSDRLRLE VADATGRNGRVVEARNVVISTGLVPSMPVGTERDERVWHSSEFLEKYRRM NPAELRRVAVVGAGQSAAEITRFLYDELPHAEVCAVIPSYGYSVADDTPF ANQIFDPGAVDDYYFGTEQTREAFWRYHRNTNYSVVDDEVIRDLYRRSYD DEVRGVRRLQFLNLTRVTSVKRVGAETRVSLQVGPDDEVRELDFDALVCA TGYSTMEPTDLLGDLDRHCLRDEAGRYRVERDYRIVTAPEMRCGIYLQGG TEHTHGLTSSLLSNIAVRSGEIADSIVAGRAGRNAERALLAEVGGDTR 16. >Streptomyces_incarnatus_NRRL_8089 MDIAGRPSQEIYDVVGIGFGPSNMSLAIALEEHEASSPQHPLKCHFFERQ PTFGWHRNMLLPSTTMQISFLKDLATFRNPTSRFSFISYLHAADRLVQFV NNQDFFPTRQEFHQYLEWAAAGLRDRVTYGAEVTSIRPAGEAGSGTSDIL EIEVRGGDGTTSVVSARNVVISTGLVPRLPEGVTSDERVWHSSEFLSRFH AQAPGDLKSVAVVGAGQSAAEITRFLYDSLPHAQVTAVIPSYGYSVADDT PFANQVFDPSAVDEYYFGTERARDSFWRYHRNTNYSVVDADVIRALYQRS YDEQVRGSQRLHFRNLTRVDEVERVGSGARVVVRSVLDDRTEELALDALV FATGYDGLDPARLLGDFDRHFLRDAAGRHRVERDYRLVPASGLTAGVYLQ GGTEHTHGLSSALLSNIAVRSGEIADSIVLRRTERELGSGRPVQAARSAA 17. >Streptomyces_albulus_PD-1 MESHRMTGPEVYDIVGVGFGPANLALAVALTERGSSTPLRALFLDRNESFSWHPGMLIHD ATMQVNFLKDLITLRNPASDFSFLSYLKARGRLVDFINHKTFFPTRVEFHDYLEWAAGRV GDVVEYGTEVVDVRPVERDGEVVYFDVVGHQQVGGVSQAVVCRARNVVVAPGLVPRLPGE ASQSERVWHSSELLHRVGDLPTDKRMQFVVVGAGQSAAEVVGYLHARYECADVHAVHSRY GYSPADDTPFANRVFDPAAVEHFFHAPPSVKDKFFEYHANTNYSVVDVELIEDLYARVYR ESVTERRRLHIHGMSELTEVADGPEGLRVSVRFLPDGTTTVLEPDHVVYATGYKPADVNR VIGVVAELCKRDSSGNLRLLHDYRVDMASHVRCGIYLQGGTEHSHGITSSLLSNLADRAA EILDSVLAHGGQLSADAAAWEVAS 18. >Streptomyces_tsukubaensis_NRRL_18488 MGITGRGKHEVLDLVGIGFGPSNLALAIALDEHGASAPQHPVTSHFFERQPAFGWHRNML LPSTTMQISFLKDLATFRNPMSRFSFVSYLHASNRLVQFVNNQDFYPTRQEFHQYLEWAA AALGDRVTYGAEVASIRPRTGPGSRTADLLEIEVRRGDGTTGTVTARNVAISTGLVPRLP KGVTSGPRVWHSSEFLGRFGAQTPADLRHVAVVGAGQSAAEITRFLHDSLPHAQVSAVIP SYGYSIADDTPFANQVFDPGAVDEYYYGTQRARDAFWRYHGNTNYSVVDADVIRDLYRRS YDEEVRGGRRLHFRNLTRVVEVEGSASGAWVMLRSLLDDRREELAVDALVFATGYDGMDP ARLLGDFDRHFQRDAAGRHRLERDYRLVSASGLTCGVYLQGGTEHSHGLSSSLLSNTAVR SGEIADSIVMRRTRQELGRSRSVAESPSAA 19. >Streptomyces_himastatinicus_ATCC_53653_hmtM MAHETEIYDVVGIGFGPSNLSLAIALEESPDPVTSLFFERQPTLGWHRGMLLPSAKMQVS FLKDLATFRNPASGFGFISYLHDMGRLTRFVNNQDFFPTRREFHDYLEWAASKLTGRVSY DSEVTAVSAVAAAGEGPADRVRVTVRGADGAPRQVEARNVVISTGLVPRMPVNLEAGERV WHSSEFLHRFRQREGELTRVAVVGAGQSAAEIVRFLYDTLPEVRVSAVIPSFGYAIADDT PFANQVFDPDAVDSYYHGTQASKDAVWQYHKNTNYSVVDDEVIRGLYERAYEDELSGHGR LDFRNLARVLDAEPTGDGTRITVYSLVDDASYDLDVDVLICATGYDPMNPARVLGELDKY CVHDTEGRHRVDRDYRLVTTSDLTCGIYLQGGTEHTHGLGSSLLSNIAVRSGDIAQSITA RCAGAPKKGLTA 20. >Streptomyces_flaveolus_DSM_9954_sfaB MTRLAEQSSTAQQSPESEVLDVTGIGFGAANLALAVALHESEAAGKALFLEKQKEFGWHR GMLLGGSSLQVSFLKDIATMRNPTSDFGFLSYLQEKDRLVDFINQHTLLPSRIEYHDYLQ WAADRLNHLVEYGVEATGVRPVTEAGEVVALDVLAGDRVVARTRNLVLASGLRPRLPEGA ETGERVWHSSQLLHRLPAFDERPPRRAVVVGAGQSAAEVAAHLMDRYPQAEVCAVFARYG YSVADSSPFANRVFDPAAVDDFYFAPPEVKQAIMRYHGGTNYAVVDEDVLQGLYRRQYEQ KVSGAPRLRVMNASRLVSVEPRQESAAVRVEFLPTGEHTDLDADLVVYATGYDSTDPAEL LGGVSGALRRDEAGELLIGRDYRLGTTGDFRCGIYVQGATEATHGIASTLLSMVAVRAGE IARSITGGRCDPDRSTGSKAAAGNRG 21. >Streptomyces_aurantiacus_JA_4570 MGTREHEIYDIVGIGFGPSNLSLAIALEEHQANSSQQPVRAAFFERQPSFGWHRNMLLPQ ATMQISFLKDLATFRNPLSRYSFVSYLHASDRLVQFVNNQDFFPTRQEFHQYLEWAESGF RDRVTYNSEVTEIRVSDEGSGGEQLLEIVVRDTVGGGTRVVQARNVTVSTGLVPRMPDGM LRDERVWHSSEFLAKYGRMRPEDLKNVAVVGAGQSAAEITKYLHDKLPHAQVSAILPSYG YSVADDTPFANQVFDPTAVDHYYFGTENTRDAFWRYHKNTNYSVVDDDVIRELFRRSYEE EVAGEKRLHFLNLTRVKEVKRSGNDTRVVLHSLLDGESEQEMDVDALVFATGYSTMDATR LLGDLDRFCERDEEGRHRVERDYRVVTSGELSCGIYLQGGTEHTHGLTSSLLSNIAVRSG EIADSIVERRGAGQRV 22. >Streptomyces_sp._RJA2928_padN MTDSAPEDRTVDVTGIGFGPSNLALATALAEPSATGPGRPLEAVYFERKNRFSWHGGMLL DGATMQISFLKDLVTLRDPRSPYSFLSYLHHAGRLSDFINHKLLFPSRIEFHDYLEWVAG FFEEQVVYGSEVVDVRPVAREDAVEHMDVVVRQRTAAGERTVVQRTRDLVVATGLEPSLP PGTVCSDRVWHSSELLYRVERLPPTPRRIVVVGAGQSAAEAAEFLHSRFPSTDICAVFSR YGYSPSDDSPFANRIFDPAAVDDYCAAAPETRRMLLDYHRNTNYSVVDPELIDELYRRVY QEKVRGRPRLNILGASRLMAAEPAGDGVDVVVESLVTGERTPMRADCVVYATGYRPTDAR GLLGSMAGLCKADELGRLEADRRYRVITEGDVRCAIYLQGATEHSHGISSSLLSNTAVRA GEIADAIRADAVRAGARATTRSQPQPQT 23. >Frankia_alni_str._ACN14A MSAREFDIYDVVGIGFGPSNLSLAVALDEFRVNGMGNVFSNIFFERRSSFAWHPSMLLPS ATMQISFLKDLVTFRNPTSSFSFVAYLHESGRLPRFVNNQDFFPTREEFHQYLEWAQARV AHRVAYGSEARSLRLPAGVGPERADRLCLQVADAASGTSRMVEARNVVISTGLVPTMPTG VERGERVWHSSEFLERFRRTSPARIRRVAVVGAGQSAAEITRFLYDELPHAEVSAIIPSY GYCVADDTPFANEVFDPEAIDDYYYATERTREALWRYHSNTNYSVVDDSVIRDLYRRSYE DDLRDVGRLRFLRLTRVAGVRSVGAQTRVSLRAGIDGDLRDLDVDVLVCATGYAAMEPTG LLGDLDQYCLRDEAGRYRIERDYRIVTAPEMQCGIYLQGGTEHTHGLSSSLLSNIAVRSG EIIDSIVARSAERTAPCAVLAEA 24. >Actinosynnema_mirum_DSM_43827 MTAVVQGADAPRDVVGVGFGPSNLALAVALAERDGPSSAFFERQPRFGWH RGMLLDGATMQVSFLKDLVSMRNPTSPYSFVSYLHARGRMPEFVNAKTLY PLRVEFHDYLEWVAGHFAGSVSYGSEITALEPVAEDGVVGHLDVVARRDG RTTTTRARNVVVATGLEPRLPDGVTGGERVWHSGELLHRVPWLRERRVRK VAVVGAGQSAAEVTEYLHRTLPGAEVIAVFSRFGYSVADDTPFVNEVFDP DSVDLFYGSPPSVRQALLAHHGNTNYSVVDADLSLELYRRRYQERVTGSS RLRVVNVSRVRSVRERPDGVALQVEYLPTGVVGTLAADAVVCATGYRPAD

PTPLLRGLAKLDGAGRPVLDRDHRVVTSGSVRAGIYLQGAVTEPTHGLSA GLLSTTAVRAGEIVRAILDEGR 25. >Kutzneria_sp._744_ktzl MTVAHAGESPTHDVVGVGFGPANLSLAVALEESPAALTSAFFERRASISWHQGMLLPAAK MQVSFLKDLATFRNPASRFSFVSFLHERGRLVRFANNHDFFPTRREFHDYLEWAESKLAH EVSYDSEVTAIRPGPGRPVDSVLVDVSTPEATRTVEARNIVISTGLVPRMPAGVQSDEFV WHSSRFLDHFRDRDPRSLRRVAVAGGGQSAAEIVRFLHDNRPDTVVHAIMPSYGYVVADN TPFANQIFDPAAVDDYFDGSKQAKDAFWRYHRNTNYSVVDDEVIRDLYRRGYDDEVAGAP RLNFVNLAHVVGAKRIADDTRVTVYSMAREESYDLDVDVLVCATGYDPMDPGDLLGELAE HCVQDAEGRWQVDRDYRMVTTPDLRCGIYLQGGTEHTHGLSSSLLSNLATRSGEIVSSIE RRKS 26. >Kibdelosporangium_sp._MJ126-NF4 VTDIHDLVGVGFGPSNLALSIAAAEADVPLRAVFLERSERFGWHRDMLIDDATMQVAFLK DLATPRNPVSRFGFVPYLWARDRLSAFINQKTLFPTRVEFHDYLEWAAAQVDDVVEYAAE VVDIRPVHDNGEVAFLDVVSVRPDGQARVRRTRNVVLALGLQPVVPPGVHPSPRVWHSAD LLGRAATLDRAKPLRFAVVGAGQSAAECVSYLHRAFEQAEVHAVFGRYGYSPADDSPFAN RIFDPAAVDDYFVSPDQVKQRFFDYHANTNYSAVDTELLEELSHRVYRESLSGRQRLFTH HLSAITDLADTDDGVSVSVEFLPTGERTMLRVDHVIHATGYRPTDPIPLLGTTAELCHKD TLGRLRVERDYRVVTKPDVRTGIYLQGGTEHSHGISSSLLSNVAVRAGEILASIQERPQR RDGDQDERTARAGDDPARRAAALPRR 27. >Mycobacterium_xenopi_RIVM700367 MLPGEDDSDLDFIGIGFGPSNLALAVAAEELIPNWRGLFLERSQSFQWHPGMMLEGARMQ ISFLKDLATLRNPASRYTFLQYAKARGRLEQFVNINEFRPTRLEYNDYLKWVAESFADRV RYGAVVTAVVPLRDSPSPAGRFGRLRVYVRDESTGVETCFSSPNVVYGGGGVPRLLGARN TSAVVHSSAFLPNFPNRFNEPDKAYRFAVVGNGQSAAEIAEYLLSHYRRATTHLFISDHT LRATDHSPFINEHFFSVNAAEFYDYPPAKRAALRNELRLTNYGVVDADVLQKLYQIAYLD EVRGCRRLFLHGESRLSRVEEIDGRVVARFEDRFSGESHEFDFDGAVLATGYDRVLDAEI FREVLPHVLRDESGEISLSRSCRVNTGPALTAGLFLQG 28. >Streptomyces_mirabilis_YR139 MGITGRRSQEIYDVVGIGFGPSNLSLAIALEEHGASAPQHPVKSLFFERQSRFGWHRNML LPSTTMQISFLKDLATYRNPTSRFSFISYLHASNRLVQFVNNQDFYPTRQEFHQYLEWAA AGLRDRVTYGAEVTSIRPGTEAGSRTPDLLEVEVRTGDGTTSVVTARNVVISTGLVPRLP QGVTSDERVWHSSEFLSRFNAQAPGDLKSVAVVGAGQSAAEITRFLHDSLPHAQVCAVIP SYGYSVADDTPFANQVFDPGAVDEYYFGTEQAQDAFWRYHRNTNYAVVDADVIRALYQRS YDEQVHGSRRLHFRNLTRVAEVKRTGSGTRVVLRSLLEDRTEELAVDALVFATGYDGLDP AHLLGDFDQHFLRDAAGRHRVERDYSLVTASGLTCGVYLQGGTEHSHGLSSSLLSNIAVR SGEIADSIVLRRTERELGSTCPVKVASSAA 29. >Streptomyces_scabrisporus_DSM_41855 MGMFGHEIHDVVGIGFGPSNLSLAIALEEHQANESARPVTAAFFERQPAFGWHRNMLLPS TTMQISFLKDLATFRNPVSRFGFISYLHASGRLPQFVNAQDFFPTRQEFHQYLEWAESSV TDRVSYGSDVTSIRPPQGIAARDAKHLEIEVEDLVSGATRLVKARNVIVSTGLVPRLPQG IERDERVWHSSEFLEKFGRMDAAGLGSVAVVGAGQSAAEITRFLYDTLPHARVSAILPAY GYSVADDTPFANQVFDPGAVDEYYFGSDRTREAFWRYHKNTNYSVVDDEVIRDLYRRSYE EEVRGVRRLNFLNLTRVDQVKRSGDETRVSLRSLLDDRVRELDVDALVFATGYDSPEPSG LLGDLDRYCLRDEAGRHRVGRDYRLVTSPELSCGIYLQGGTEHTHGLTSSLLSNIAIRSG EIADSVIRRRVEHELELERNAALEVARETR 30. >Streptomyces_sp._TAA040 MHDLVVVGAGPYGLSIAAHAAAAGLQPRVLGTPMASWRDHMPQGMYLKSEPWSSDLSDPA GAHTLAAYCATRGLVAEHGNPLPIEVFTDYGCWFAGRAAPPVEERIVVAVRPHGDGYRVE TAEGERITTRTVALAVGVMPFVHHPSALAALPAELATHSSDHRDLARFRGRDVTVVGAGQ AALETATLLTEHGARARVLARADRINWNTPPQPLERGLWKSLRDPHCGLGTGWSSWLWSE RPSAVRRLPAGLRAAIAGSALGPAGAWWLRERFEQAVPVLLGHRLLAAEQVGGRVRLDVR LADGTARNLHTDHVVAATGFTPELDRLGLLALSLTGTLRRVPGTGAPELGRCFESSRPGL FFGGLLTAPSFGPAMRFVHGAGFTAGRLVEGVRRRLGSGAASRTRAVPQAAGSVGRAAAE RPPG 31. >Actinoalloteichus_cyanogriseus_DSM_43889 MYGSVPVDGNQVSDVVGVGFGPSNLALAVAIAEHNETAPPKTRLRAQFLERQPVFGWHRG MLLPDTTLQVSFLKDLVTLRNPRSSFGFVSYLHDRNRLVDFVNHQSFFPSRREYHDYLEW VAGRFTGSVHYGHEVVDVLPVNEGPDVVAFDVVAAHGGVGATRRVRTRNVVLAPGLEPVL PQGITPSDRVWHSSELLHRLDGVRELLPSRPRFVVVGAGQSAAEVMAHLHDAFPTATVRS VCSRYGFAPADDSPFVNQLFDPAGVDEFFEAALPARENLLRTHAGTNYSAVDGGLINELY RRSYQERVAGEPRLLFERLSRVVATEEGDDEVSVAVRSLADGRVTNRRCDVVVLATGYRP RDALRPLGELAALCKLDANGWPRVERDYRITTTETVRAGIYLQGGTEHSHGLSSTLLSNL AVRSGEITRALVSR 32. >Streptomyces_sp._HNS054 MGITGRRHQEIYDVIGIGFGPSNMSLAIALEEHEASAPQQPLRYHFFERQPTFGWHRNML LPSTTMQISFLKDLATFRNPLSRFSFISFLHSSNRLVQFVNNQDFFPTRQEFHQYLEWAA AGLSDRVTYGTEVVSIRPGTEGGTLTPDLLEIEVRDGDGTTSVVVTRNVVISTGLVPRLP EGVTADERVWHSSQFLSKFHARDPRELKRVAVVGAGQSAAEITRFFYDSLPHAEVLAVIP SYGYSVADDTPFANQVFDPGAVDEYYYGTDRARDAFWRYHRNTNYSVVDTDVIRALYQRS YDEQVRGTQRLHFRNLTRVVEVGSTGEGTRVVLRSLLDDRREDLAVDALVFATGYDGVDP ARLLGDGFDAHFERDAAGRHRVERDYRLVSSSGLTCGVYLQGGTEHSHGLTSSLLSNMAV RSGEIADSIVLGRTGRELDRTHSVEEASSAA 33. >Streptomyces_sp._AW19M42 VCRGAATFLETTLTTPLETARSAAPHDPADGAPLDVLGVGFGPSNLALAIALSEVERPRP RVHFYDRSSRFSWHGGMLLKGATMQVHFLKDLVTLRNPGSPYSFLSYLHDRERLVDFINH KALFPSRVEFHDYLEWAAQACSDRVTYGSEVSRIEPEWVDGEVHRFRVHLTHSEPGERGV RHEVRSARNVVLAPGLRPHLPEGTAESEHVWHSSRLLSRLEDIPKDAPVRFTVVGAGQSG AEVTAYLHGRFPQAQVRAVFSPYGYNPADDSPFANRIFDPAAVDEFFGAPQAVREMLVDR HGNTNYSVVDQDLIAELYRIWYQEKVTDERRLIIDNVSRLVGVREASGLRLTIESLATRE RHEVDSDYLVYATGYRPVAPDDLVDPEIMKLCRRDAAGGLRVNRDYRVQTEDMVRCGLYV QGATEHTHGLSSTLLSNTAVRAGEIASSLLGRM 34. >Salinispora_pacifica_DSM_45549 VFDEPSVYDVLGIGFGPSNLSLAIALHEMGDVEGRPLAARFFEQQPSFGWHRNMLLPSAK MQVSFLKDLVTFRNPHSRFTFVSYLHEMNRLARFINNCDFFPTREEFHGYLEWAAANFAD QVTYGATITSISVPPDSGPGDPIDRVRVNLASGPTGAESSSVEARNVVLGTGLVPRFPAG LTSDDRVWHSSEFLGKFQRCDTTKLKRVLVVGGGQSAAEIAHFVYDNVPGVTVTAVIPSY GYSIADATPFANRVFDPSAIDDYYYGDENSKDAFWRYHRNTNYAVVDSNLISDLNRKAYD EAVTGETRLRFAELSRLSGVRRRDDGVVVSIHSMLSNRTSEVDADIVICATGYEPMEIGD MLGPLDRFCIRDEQGRYRVERDYRLATTEHLRCGIYLQGGMEHTHGLSSSLLSNLAVRNG DISTSVARRAQSQSHDDGRVLQGLVPTGS 35. >Salinispora_pacifica_CNT150 VFDEPSVYDVLGIGFGPSNLSLAIALHEMGDVEGRPLAARFFEQQPSFGW HRNMLLPSAKMQVSFLKDLVTFRNPHSRFTFVSYLHEMNRLARFINNCDF FPTREEFHGYLEWAAANFADQVTYGATITSISVPPDSGPGDPIDRVRVNL ASGPTGAESSSVEARNVVLGTGLVPRFPAGLTSDDRVWHSSEFLGKFQRC DTTKLKRVLVVGGGQSAAEIAHFVYDNVPGVTVTAVIPSYGYSIADATPF ANRVFDPSAIDDYYYGDENSKDAFWRYHRNTNYAVVDSNLISDLNRKAYD EAVTGETRLRFAELSRLSGVRRRDDGVVVSIHSMLSNRTSEVDADIVICA TGYEPMEIGDMLGPLDRFCIRDEQGRYRVERDYRLATTEHLRCGIYLQGG MEHTHGLSSSLLSNLAVRNGDISTSVARRAQSQSHDDGRVLQGLVPTGS 36. >Salinispora_tropica_CNB536 VTGKVHIVFDEPSVYDVLGIGFGPSNLSLAIALHEMGDVEGRPLAARFFEQQPSFGWHRN MLLPSAKMQVSFLKDLVTFRNPHSRFTFVSYLHEMNRLARFVNNCDFFPTREEFHGYLEW AATNFADQVTYGATITSISVPPDSGPGDPIDRVRVHLASGPTGTESSSVEARNVVLGTGL VPRFPAGLTSDDRVWHSSEFLGKFQRCDTTKLKRVLVVGGGQSAAEIAHFVYENVPGATV TAVIPSYGYSIADATPFANRVFDPSAIDDYYYGDENSRDAFWRYHRNTNYAVVDSDLISD LNRKAYDEAVTGEIRLRFAELSRLSGVRRRDDGVVVSIHSMLSNRTSEVDADIVICATGY EPMEIGDMLGPLDRFCIRDEHGRYRVERDYRLATTEHLRCGIYLQGGMEHTHGLSSSLLS NLAVRNGDISTSVARRAQSQPHGDGRVLQGLVPTGS 37. >Salinispora_arenicola_CNH996 VFDEPSVYDVLGIGFGPSNLSLAIALHEMGDVEGRPLAARFFEQQPSFGWHRNMLLPSAK MQVSFLKDLVTFRNPHSRFTFVSYLHEMNRLARFINNCDFFPTREEFHGYLEWAAATFAD QVTYGATITSISVPPDSGPGDPIDRVRVHLASGPTGTESSSVEARNVVLGTGLVPRFPAG LTSDDRVWHSSEFLGKFQRCDTTKLKRVLVVGGGQSAAEIAHFVYENVPGATVTAVIPSY GYSIADATPFANRVFDPSAIDDYYYGDENSKDAFWRYHRNTNYAVVDSDLISDLNRKAYD EAVTGETRLRFAELSRLSGVRRRDDGVVVSIHSMLSNRTSEVDADIVICATGYEPMEIGD MLGPLDRFCIRDEQGRYRVERDYRLATTEHLRCGIYLQGGMEHTHGLSSSLLSNLAVRNG DISTSVARRAQSQPHDDGRVLQGLVPTGS 38. >Salinispora_arenicola_CNH996B VFDEPSVYDVLGIGFGPSNLSLAIALHEMGDVEGRPLAARFFEQQPSFGW HRNMLLPSAKMQVSFLKDLVTFRNPHSRFTFVSYLHEMNRLARFINNCDF FPTREEFHGYLEWAAATFADQVTYGATITSISVPPDSGPGDPIDRVRVHL ASGPTGTESSSVEARNVVLGTGLVPRFPAGLTSDDRVWHSSEFLGKFQRC DTTKLKRVLVVGGGQSAAEIAHFVYENVPGATVTAVIPSYGYSIADATPF ANRVFDPSAIDDYYYGDENSKDAFWRYHRNTNYAVVDSDLISDLNRKAYD EAVTGETRLRFAELSRLSGVRRRDDGVVVSIHSMLSNRTSEVDADIVICA TGYEPMEIGDMLGPLDRFCIRDEQGRYRVERDYRLATTEHLRCGIYLQGG MEHTHGLSSSLLSNLAVRNGDISTSVARRAQSQPHDDGRVLQGLVPTGS 39. >Salinispora_tropica_CNY012 VTGKVHIVFDEPSVYDVLGIGFGPSNLSLAIALHEMGDVEGRPLAARFFEQQPSFGWHRN MLLPSAKMQVSFLKDLVTFRNPHSRFTFVSYLHEMNRLARFVNNCDFFPTREEFHGYLEW AATNFADQVTYGATITSISVPPDSGPGDPIDRVRVHLASGPTGTESSSVEARNVVLGTGL VPRFPAGLTSDDRVWHSSEFLGKFQRCDTTKLKRVLVVGGGQSAAEIAHFVYENVPGATV TAVIPSYGYSIADATPFANRVFDPSAIDDYYYGDENSRDAFWRYHRNTNYAVVDSDLISD LNRKAYDEAVTGEIRLRFAELSRLSGVRRRDDGVVVSIHSMLSNRTSEVDADIVICATGY EPMEIGDMLGPLDRFCIRDEHGRYRVERDYRLATTEHLRCGIYLQGGMEHTHGLSSSLLS NLAVRNGDISTSVARRAQSQPHGDGRVLQGLVPTGS 40. >Salinispora_tropica_CNT261 VTGKVHIVFDEPSVYDVLGIGFGPSNLSLAIALHEMGDVEGRPLAARFFEQQPSFGWHRN MLLPSAKMQVSFLKDLVTFRNPHSRFTFVSYLHEMNRLARFVNNCDFFPTREEFHGYLEW AATNFADQVTYGATITSISVPPDSGPGDPIDRVRVHLASGPTGTESSSVEARNVVLGTGL VPRFPAGLTSDDRVWHSSEFLGKFQRCDTTKLKRVLVVGGGQSAAEIAHFVYENVPGATV TAVIPSYGYSIADATPFANRVFDPSAIDDYYYGDENSRDAFWRYHRNTNYAVVDSDLISD LNRKAYDEAVTGEIRLRFAELSRLSGVRRRDDGVVVSIHSMLSNRTSEVDADIVICATGY EPMEIGDMLGPLDRFCIRDEHGRYRVERDYRLATTEHLRCGIYLQGGMEHTHGLSSSLLS NLAVRNGDISTSVARRAQSQPHGDGRVLQGLVPTGS 41. >Salinispora_tropica_CNH898 VTGKVHIVFDEPSVYDVLGIGFGPSNLSLAIALHEMGDVEGRPLAARFFEQQPSFGWHRN MLLPSAKMQVSFLKDLVTFRNPHSRFTFVSYLHEMNRLARFVNNCDFFPTREEFHGYLEW AATNFADQVTYGATITSISVPPDSGPGDPIDRVRVHLASGPTGTESSSVEARNVVLGTGL VPRFPAGLTSDDRVWHSSEFLGKFQRCDTTKLKRVLVVGGGQSAAEIAHFVYENVPGATV TAVIPSYGYSIADATPFANRVFDPSAIDDYYYGDENSRDAFWRYHRNTNYAVVDSDLISD LNRKAYDEAVTGETRLRFAELSRLSGVRRRDDGVVVSIHSMLSNRTSEVDADIVICATGY EPMEIGDMLGPLDRFCIRDEHGRYRVERDYRLATTEHLRCGIYLQGGMEHTHGLSSSLLS NLAVRNGDISTSVARRAQSQPHGDGRVLQGLVPTGS 42. >Streptomyces_sp._PsTaAH-137 MDTPGSLSQEIYDVVGIGFGPSNLSLAVALEEQGASSAQHPV 43. >Salinispora_arenicola_CNS296 MSNQHETYDLVGIGFGPSNLSLAIALKEYEANGQENGISTLFFERQSSFGWHRNMLLPST TMQISFLKDLVTFRNPTSGFSFISYLHASGRLPQFVNNQDFFPTRQEFHQYLEWAEERMA GRVAYGSEVTSIRLPSGTVPELSDRLRLEVTDAAGRVGRVVEARNVVISTGLVPRMPEGI ERDERVWHSSEFLQKYRRMNPGDLRRVAVVGAGQSAAEITRFLHDELPHAEVWVVIPSYG YSVADDTPFANQIFDPEAVDDYYFGTEQTRDAFWRYHRNTNYSVVDDEVIRDLYRRVYDA EVRGIKRLQILNLTRITGVKRAAAETRVELQVGPDSEVRELDVDALVCATGYDGMEPTHL LGDLDRLCLRDKAGRHQIERDYRIATAPEMRCGIYLQGGTEHTHGLSSSLLSNIAVRSGE IADSIVSRRARHNSEYALAAGAEGDTC 44. >Salinispora_arenicola_CNS299 MSNQHETYDLVGIGFGPSNLSLAIALKEYEANGQENGISTLFFERQSSFGWHRNMLLPST TMQISFLKDLVTFRNPTSGFSFISYLHASGRLPQFVNNQDFFPTRQEFHQYLEWAEERMA GRVAYGSEVTSIRLPSGTVPELSDRLRLEVTDAAGRVGRVVEARNVVISTGLVPRMPEGI ERDERVWHSSEFLQKYRRMNPGDLRRVAVVGAGQSAAEITRFLHDELPHAEVWVVIPSYG YSVADDTPFANQIFDPEAVDDYYFGTEQTRDAFWRYHRNTNYSVVDDEVIRDLYRRVYDA EVRGIKRLQILNLTRITGVKRAAAETRVELQVGPDSEVRELDVDALVCATGYDGMEPTHL LGDLDRLCLRDKAGRHQIERDYRIATAPEMRCGIYLQGGTEHTHGLSSSLLSNIAVRSGE IADSIVSRRARHNSEYALAAGAEGDTC 45. >Salinispora_pacifica_CNY363 MSNQHETYDLVGIGFGPSNLSLAIALKEYEANGQENGISTLFFERQSSFGWHRNMLLPST TMQISFLKDLVTFRNPTSGFSFISYLHASGRLPQFVNNQDFFPTRQEFHQYLEWAEERMA GRVAYCSEVTSIRLPSGIVPELSDRLRLEVTDAAGRVGRVVEARNVVISTGLVPRMPEGI ERDERVWHSSEFLQKYRRMNPGDLRRVAVVGAGQSAAEITRFLHDELPHAEVWVVIPSYG YSVADDTPFANQIFDPEAVDDYYFGTEQTRDAFWRYHRNTNYSVVDDEVIRDLYRRVYDA EVRGIKRLQILNLTRITGVKRAAAETRVELQVGPDSEVRELDVDALVCATGYDGMEPTHL LGDLDRLCLRDKAGRHQIERDYRIATAPEMRCGIYLQGGTEHTHGLSSSLLSNIAVRSGE IADSIVSRRARHNSEYALAAGAEGDTC 46. >Actinomadura_atramentaria_DSM_43919 VTGPATDADDILDIVGVGFGPSNLALAVAVREHNADRPAAEHLTQVYFEKQPAFGWHRGM LIDGATMQVSFIKDLVTMRNPASEYGFLSYLHDNDRLADFINHKSLFPSRVEFHDYLEWV ARRFQDVARYGSEVVAMRPGPGGDHIEVIVRRGGEHRVQRARNVVVAVGQEPALPDDIEL GDRIWHCAQLLERVERLTEEPRRAVVVGAGQSAAETTEFLHRRFENAEVSAIFLRYGYSV ADDTPFANRIFDPESVDVFYGAPENVKRMLFDYHRNTNYSVVDQELADELYRRVYQERVR GVERLRILNASRLHAVRRDVTGDGLRVDVEHLPTGEKRSFGVDLVVYATGYRPIDPANVL GEVAEYCRRDAGKRPAITRDYRLETDDRLRAGIYLQGGTEQTHGISAQLLSNTAVRAGEI VRSIAGARVGAV 47. >Streptomyces_drozdowiczii_SCSI0_10141 MTVNLGSTSVLEVAGIGFGPSNMALAIALEEMHGARANSPGPAMEFFEKQPAFGWHRGML MEDATMQVSFLKDLATMRDPQSRYTFMAYLKAKGRIARFINSKTLFPLRVEFHDYLEWVA DLLAPVVSYGSDVLAIRPVVEDGVMECLDVVVRTSAGDGEPIVRRARNVVIGTGLTPRLP DGTEESARVWHSSRLMDRAASIAAAPRGFVVVGAGQSAAEATEYLHRSFPGTPVSAVFAR YGYSVADDSPFTNGIFDPEAVDEFYAASRDVKQDLLDYHGNTNYAVVDLSLTEELYRRAY QEEVLGRERLRFHNASRVLKVEEHPDRVRVIVEHLPDRTVETLDADAVVYATGYRPSDPT PLLQNLLPECKLDDAGRITLDRDYRIVTSGDVRCGIYLHGASAECTHGLSAGLLSNTAVR SGEIADSIIKR 48. >Streptomyces_sp._RSD-27 MGITGRRDEEIYDVIGIGFGPSNMSLAIALQEHGAGVPLHPVRSHFFERQ PTFGWHRNMLLPSTTMQISFLKDLATFRNPMSRFSFVSYLHASNRLVQFV NNQSFIPTRQEFHQYLEWAAAGLRDQVTYGAEVTSVRPVTAAGSRTPDLL EVEVRTGDEVSVVTARNVVVSTGLVPRMPEGVPAGERVWHSSEFLARFNA QDPAELKSVAVVGAGQSAAEVTRFLYDSLPHAEVSAVIPSYGYSVADDTP FANQVFDPDTVDEYYFGTEGARDAFWRYHRNTNYSVVDADVIRSLYQRWY DEQVRGVQRLRFRNLTRVDGVEGSGSGARMVLRSLLDDSREELAVDAVVF ASGYDGLDPARLLGEDFDRHFQRDAAGRHRVERDYRLVSTSGLTCGVYLQ GGTEHSHGLTSALLSNIAIRSGEIADSIVLRRTERELGRHAEEAPSAA 49. >Actinoalloteichus_spitiensis_RMV-1378 MDGSFPVDGNQVSDVVGVGFGPSNLALAVAVAEHNEAVGPEERLRARFLERQPDFGWHRG MLLPDTTLQVSFLKDLVSLRNPRSSFSFISYLHDRNRLVDFVNHQCFFPSRREYHDYLEW VAGRFVDSVHYDHDVVDVLPVHEGPDVVAFDVVAVQGGAGATRRLRTRNVVLAPGLEPVL PQGITPSDRVWHSSELLHRLDGFRDRLPDRPRFVVVGAGQSAAEVMAHLHGVFPKATVRS VCSRYGFAPADDSPFVNQLFDPAAVDEFFEAALPARENILRVHAGTNYSAVDGDLISELY RRSYQERVSGEPRLHFERLARVVATEERDEEVSVSVLSLTDGRVTDRGCDVVVLATGYRP RDALRPLGQLAALCKLDANGWPRVERNYRITTTETVRAGIYLQGGTEHSHGLSSTLLSNL AVRSGEITRALAAP 50. >Streptomyces_sp._PBH53 MTRLAGQAPTAQHSPESEVRDVTGIGFGAANLALAVALHESGAGGRALFLEKQKEFGWHR GMLIEGSSLQVSFLKDIATMRNPTSDFGFLSYLQEKGRLVDFINQHTLLPSRIEYHDYLQ

WAADRLGHMVEYGVEATGVRPVTDAGEVVALDVLAGDRVVTRTRNLVIASGLRPRLPEGA ETGERVWHSSQLLHRLPAFDERPPRRAVVVGAGQSAAEVAAHLMERYPQAEVCAVFSRYG YSVADSSPFANRVFDPAAVDDFYFAPPEVKQAIMRYHGGTNYAVVDEDVLQGLYRRQYEQ KVTGTPRLRVMNASRLVSVEPRGETAAVRVEFLPTGEHADLDADLVVYATGYRSADPAEL LGGVAGSLRRDAAGQVLIGRDYRLSTTGDFRCGIYVQGATEATHGIASTLLSMVAVRAGE IAQSIIGGRRDPDRTAGTKAVAGNRG 51. >Salinispora_arenicola_CNS-991_DSM_45545 MSNQHETYDLVGIGFGPSNLSLAIALKEYEANGQENGISTLFFERQSSFGWHRNMLLPST TMQISFLKDLVTFRNPTSGFSFISYLHASGRLPQFVNNQDFFPTRQEFHQYLEWAEERMA GRVAYGSEVTSIRLPSGTVPELSDRLRLEVTDAAGRVGRVVEARNVVISTGLVPRMPEGI ERDERVWHSSEFLQKYRRMNPGDLRRVAVVGAGQSAAEITRFLHDELPHAEVWVVIPSYG YSVADDTPFANQIFDPEAVDDYYFGTEQTRDAFWRYHRNTNYSVVDDEVIRDLYRRVYDA EVRGIKRLQILNLTRITGVKRAAAETRVELQVGPDSEVRELDVDALVCATGYDGMEPTHL LGDLDRLCLRDKAGRHQIERDYRIATAPEMRCGIYLQGGTEHTHGLSSSLLSNIAVRSGE IADSIVSRRARHNSEYALAAGAEGDTC 52. >Streptomyces_sp._MNU77 VEASASVTDVVGVGFGPANLALAIALRELGAGPPGGDGLTAAFLEAQPQFGWHSGMLIED STMQVSFLKDLVTPRNPVSPFSFVAYLHAVGRLGRFMDSKMMYPLRIEFHNYLEWVAGHF ANQVAYSRRVTALRPVHGQDGVEALDVVARDADGTERVLRARSVVLACGLRPRLPEGLTG SDRVWHTADLLPRARRLLESGAAPTSFVVLGAGQSSAEAAHYLHRTFTRSSVSVVHSRYG FSVSDDSPFANAVFGAKAVDEFYGAPDEVKRMVLDYHANTNYAVVDEDLIHRLYGDVYRE SLTGDDRLRFHHLSRLSTVTPGEDAVRVEVEALHDGRRTVIDADALVCATGYRPSDPADL MGDLLPLCARDEQDRLVLDRDRRLVTREPLAGGVYVTGYGEHTHGIAESLLSLTAQRAGE LTEALAKTFVT 53. >Micromonospora_pattaloongensis_DSM_45245 MSETDSATVRQVVGVGFGPANLALAIAAGEVAGPDGRTLLDECVFLERQP SFGWHRGMLLDGATMQVSFLKDLATLRSPSSRYTFTSYLHDVGRLTDFIN SKTLYPYRTDFHTYLEWAADRLPADVRYGTEVVSVTPERTDDVVRELLVR TGDGRTFRTRNLVIGTGMTPCFPDGVQRGPRVWHSAELLTRLAAPAPTRP RTFAVVGAGQSAAEVVEHLHATHPEADVHAIFGRFGYSMSDDSPFANQIF DPDSVDEFYHAPGEVRDALMGYHANTNYSVVDLDLIRSLHGTAYREHIAG RRRLHFHHASRITRQTVTGEGVHLDVEFLPTGTIRQIDADAIVYATGYRP SDPRQLLGDLADECKTDDRGRLALARDYRVITSDGVRCGIYVHGAAAERT HGLSAGLLSNVAVRAGEILAAIRSL 54. >Streptacidiphilus_carbonis_NBRC_100919 MGARENATYDVVGIGFGPSNLSLAIALEERCANVLTNSITSAFFERQSSF GWHRNMLLPSATMQISFLKDLVTFRNPVSRFSFVAFLHAKGRLGQFVNRK DFFPTRQEFHQYLEWAAAKMADAVTYDSTVTSVQLPPDHGSGGDGYVQLE VRDTAAGSTRRVNTRNVVVSTGLVPRMPDGIARDDRVWHSSEFLTRYGRT DPEVLRSVAVVGAGQSAAEITQFFHGRLPHAQVHAIMPSYGYSVADDTPF ANQVFDADAVEDYYDGDEPARDAFWRYHRNTNYGVVDSADIQALYQTQYD EGVAGAKRLHFHNLTKVRAVERNGSARRVTLQSLRHHEVRQLDVDAIVFA TGYASMDPTQLLGDLDRYCLRDESGHHRVTRDYRLVTTPELSCGIYLQGG TEHTHGLTSSLLSNIAVRSGEIADSIICRRAESELATIAAEVREAVAERL 55. >Streptomyces_sp._MnatMP-M27 MTDSAPGDRTVDVTGIGFGPSNLALATALAEPSATGPGRPLEAVYFERKN RFSWHGGMLLDGATMQISFLKDLVTLRDPRSPYSFLSYLHHAGRLSDFIN HKLLFPSRIEFHDYLEWVAGFFEEQVVYGSEVVDVRPVAREDAVEHMDVV VRQRTAAGERTVVQRTRDLVVATGLEPSLPPGTVCSDRVWHSSELLYRVE RLPPTPRRIVVVGAGQSAAEAAEFLHSRFPSTDICAVFSRYGYSPSDDSP FANRIFDPAAVDDYCAAAPETRRMLLDYHRNTNYSVVDPELIDELYRRVY QEKVRGRPRLNILGASRLTAAEPAGDGVDVVVESLVTGERTPMRADCVVY ATGYRPTDARGLLGSMAGLCKADELGRLEADRRYRVITEGDVRCAIYLQG ATEHSHGISSSLLSNTAVRAGEIADAIRADAVRAGARATTRSQPQPQT 56. >Pseudonocardia_sp._EC080625-04 MCTCKSDVYDVVGIGFGPSNLSLAIALGEHQGNRAGHPVKAAFFERQQSF GWHRNMLLPETTMQISFMKDLVTFRNPRSRFSFVNYLHESGRLTQFCNNQ DFFPTRQEFHRYLEWVGSSFDDQVSYDSEVLGVTLAPEPCECAQRYLKLE ISNGAIGATEIVNARNISISTGLVPKVPDNVATGDRIWHSSQFLEKLRDV DPADLRNVAVVGGGQSAAEIARYLHATLPEAQIYAIVPSYGYSVADDTPF ANQVFDPEAVDDYYFGSDETRDAFWRYHRNTNYSVVDDDIIRDLHRASYA EQVTGERRLHFLNLTRVRAVTRNGATNRVSLHSLIDRETRELDIDALVLA TGYTEMTPTGLIGDVDHFCHRDPEGRYRIERDYRLMTDPEFPCGIYLQGG TEHTHGLTSSLLSNVAVRGGEIADSVITRTRADAPTMQRSTRRIEQAWER AG 57. >Pseudonocardia_sp._HH130629-09 MCTCKSDVYDVVGIGFGPSNLSLAIALGEHQGNRAGHPVKAAFFERQQSF GWHRNMLLPETTMQISFMKDLVTFRNPRSRFSFVNYLHESGRLTQFCNNQ DFFPTRQEFHRYLEWVGSSFDDQVSYDSEVLGVTLAPEPCECAQLYLKLE ISNGAIGATEIVNARNISISTGLVPKVPDNVPTGDRIWHSSQFLEKLRDV DPADLRNVAVVGGGQSAAEIARYLHATLPEAQIYAIVPSYGYSVADDTPF ANQVFDPEAVDDYYFGSDETRDAFWRYHRNTNYSVVDDDIIRDLHRASYA EQVTGERRLHFLNLTRVRAVTRNGATNRVSLHSLIDRETRELDIDALVLA TGYTEMTPTGLIGDVDHFCHRDPEGRYRIERDYRLMTDPEFPCGIYLQGG TEHTHGLTSSLLSNVAVRGGEIADSVITRTRADAPTMQRSTRRIEQAWER AG 58. >Streptomyces_parvulus_2297 MGITGRRNEEILDVVGIGFGPSNLSLAIALEEHGASAPRHPVTSHFFERQ PTFGWHRNMLLPSTTMQISFLKDLATFRNPMSRFSFISYLHASDRLVQFV NNQDFFPTRQEFHQYLEWAASGLSDRVTYGAEVTAIRPGSDGNGLSPDLL EVEARTADGTTRVVTARNVAISTGLVPRLPEGVTADERVWHSSQFLSRFN AQSPDDLKSVAVVGAGQSAAEITRFLHDALPHAQVCAVVPSYGYSVADDT PFANQVFDPAAVDDYYFGTDRGRDAFWRYHRNTNYSVVDADVIRDLHQRT YDEEVRGTRRLHFRNLTRVAEVERSGSTTRVVLRSLLDDRTEDLSVDALV FATGYDGLDPVRLLGDFDRHFRRDAAGRHRLERDYRLVPATDLTCGVYLQ GGTEHSHGLSSSLLSNIAVRSGEIADSIVLRRTERELERDRPVEVAPPVA 59. >Streptomyces_sp._CFMR_7 MAIRAGSHILDVVGIGFGPSNLALAIALQEMIKADTGRTEYAMAFHERQP RFGWHRGMLMEDATMQVSFLKDLATMRNATSRYTFVAYLQEQGRVAEFIN SKTLYPLRVEFHDYLEWAAQQFDASVSYGSEIVAVRPVIESGSVEYVDVV ARSASGGSSTVVQRARNVVIGMGLTPRLPDGIEESERIWHSSQLLHRADS LPYRPRNFVVVGSGQSAAEVADYLHRTFSDANVHTVLSRYGYSVADDSPF ANGVFDPEAVDRFYTSSADAKQRLLDYHGNTNYSVVDLEVSQDLYRRSYQ EKVLGKQRLRMLNSSRVTSAEEHADGVRVIVEAMDSGSVRTMDADVIVYA TGYRPSDAAPLLSELAGECKRDEEGRLAVERDYRVITSEAVRCGIYVHGA VTEHSHGLSAGLLSNTAVRSGEIARSILRR 60. >Streptomyces_sp._DvalAA-19 MAIRAGSHISDVVGIGFGPSNLALAIALQEMIKADTGRTEYAMAFHERQP RFGWHRGMLMEDATMQVSFLKDLATMRNATSRYTFVAYLQEKGRVAEFIN SKTLYPLRVEFHDYLEWAAQQFDASVSYGSEIVAVRPVIESGSVEYVDVV ARSASGGSSTVVQRARNVVIGMGLTPRLPDGIEESERIWHSSQLLHRADS LPYRPRNFVVVGSGQSAAEVADYLHRTFSDANVHTVLSRYGYSVADDSPF ANGVFDPEAVDRFYTSSADAKQRLLDYHGNTNYSVVDLEVSQDLYRRSYQ EKVLGKQRLRMLNSSRVTSAEEHADGVRVIVEAMDSGSVRTMDADVIVYA TGYRPSDAAPLLSELAGECKRDEEGRLAVERDYRVITSEAVRCGIYVHGA VTEHSHGLSAGLLSNTAVRSGEIARSILRR 61. >Rhodococcus_fascians_A3b MGAQSGSSVADVVGVGFGPSNLALAIALQESIQPGPVPAKFSMKFYELQP RFGWHRGMLMEDATMQVSFLKDLATMRNPMSRYTFVSYLREKERIAEFIN SKTLYPLRVEFHDYLEWAASQFQSNVSYGSEIKDIRPVVENGVVEYVDVV GPDDVVQRARNIVIGMGLTPRLPDGVNRSERIWHSSQLLGRAAAVTYVPQ NFVVVGSGQSAAEVADYLHRTFPRANVHTVLSRYGYSVADDSPYANGIFD PEGVDRFFSAPTDEKQRLLEYHANTNYSVVDLDISQSLYLKSYQEKVLGK QRLRMINTSRVTSVDEDTDGVRVEVTSSATGLTHTIEADVIVYATGYRPS DPAPLLQGLMRECKHDEQGRLSVGRDYRVTTSDAVRAGIYVHGASTEHSH GLSAGLLSNTAVRSGEIAQSILRR 62. >Rhodococcus_fascians_A73a MGAQSGSSVADVVGVGFGPSNLALAIALQESIQPGPVPAKFSMKFYELQP RFGWHRGMLMEDATMQVSFLKDLATMRNPMSRYTFVSYLREKERIAEFIN SKTLYPLRVEFHDYLEWAASQFQSNVSYGSEIKDIRPVVENGVVEYVDVV GPDDVVQRARNIVIGMGLTPRLPDGVNRSERIWHSSQLLGRAAAVTYVPQ NFVVVGSGQSAAEVADYLHRTFPRANVHTVLSRYGYSVADDSPYANGIFD PEGVDRFFSAPTDEKQRLLEYHANTNYSVVDLDISQSLYLKSYQEKVLGK QRLRMINTSRVTSVDEDTDGVRVEVTSSATGLTHTIEADVIVYATGYRPS DPAPLLQGLMRECKHDEQGRLSVGRDYRVTTSDAVRAGIYVHGASTEHSH GLSAGLLSNTAVRSGEIAQSILRR 63. >Rhodococcus_fascians_A76 MGAQSGSSVADVVGVGFGPSNLALAIALQESIQPGPVPAKFSMKFYELQP RFGWHRGMLMEDATMQVSFLKDLATMRNPMSRYTFVSYLREKERIAEFIN SKTLYPLRVEFHDYLEWAASQFQSNVSYGSEIKDIRPVVENGVVEYVDVV GPDDVVQRARNIVIGMGLTPRLPDGVNRSERIWHSSQLLGRAAAVTYVPQ NFVVVGSGQSAAEVADYLHRTFPRANVHTVLSRYGYSVADDSPYANGIFD PEGVDRFFSAPTDEKQRLLEYHANTNYSVVDLDISQSLYLKSYQEKVLGK QRLRMINTSRVTSVDEDTDGVRVEVTSSATGLTHTIEADVIVYATGYRPS DPAPLLQGLMRECKHDEQGRLSVGRDYRVTTSDAVRAGIYVHGASTEHSH GLSAGLLSNTAVRSGEIAQSILRR 64. >Rhodococcus_fascians_A78 MGAQSGSSVADVVGVGFGPSNLALAIALQESIQPGPVPAKFSMKFYELQP RFGWHRGMLMEDATMQVSFLKDLATMRNPMSRYTFVSYLREKERIAEFIN SKTLYPLRVEFHDYLEWAASQFQSNVSYGSEIKDIRPVVENGVVEYVDVV GPDDVVQRARNIVIGMGLTPRLPDGVNRSERIWHSSQLLGRAAAVTYVPQ NFVVVGSGQSAAEVADYLHRTFPRANVHTVLSRYGYSVADDSPYANGIFD PEGVDRFFSAPTDEKQRLLEYHANTNYSVVDLDISQSLYLKSYQEKVLGK QRLRMINTSRVTSVDEDTDGVRVEVTSSATGLTHTIEADVIVYATGYRPS DPAPLLQGLMRECKHDEQGRLSVGRDYRVTTSDAVRAGIYVHGASTEHSH GLSAGLLSNTAVRSGEIAQSILRR 65. >Rhodococcus_fascians_D188 MGAQSGSSVADVVGVGFGPSNLALAIALQESIQPGPVPAKFSMKFYELQP RFGWHRGMLMEDATMQVSFLKDLATMRNPMSRYTFVSYLREKERIAEFIN SKTLYPLRVEFHDYLEWAASQFQSNVSYGSEIKDIRPVVENGVVEYVDVV GPDDVVQRARNIVIGMGLTPRLPDGVNRSERIWHSSQLLGRAAAVTYVPQ NFVVVGSGQSAAEVADYLHRTFPRANVHTVLSRYGYSVADDSPYANGIFD PEGVDRFFSAPTDEKQRLLEYHANTNYSVVDLDISQSLYLKSYQEKVLGK QRLRMINTSRVTSVDEDTDGVRVEVTSSATGLTHTIEADVIVYATGYRPS DPAPLLQGLMRECKHDEQGRLSVGRDYRVTTSDAVRAGIYVHGASTEHSH GLSAGLLSNTAVRSGEIAQSILRR 66. >Rhodococcus_fascians_02-816c MGAQSGSSVADVVGVGFGPSNLALAIALQESIQPGPVPAKFSMKFYELQP RFGWHRGMLMEDATMQVSFLKDLATMRNPMSRYTFVSYLREKERIAEFIN SKTLYPLRVEFHDYLEWAASQFQSNVSYGSEIKDIRPVVENGVVEYVDVV GPDDVVQRARNIVIGMGLTPRLPDGVNRSERIWHSSQLLGRAAAVTYVPQ NFVVVGSGQSAAEVADYLHRTFPRANVHTVLSRYGYSVADDSPYANGIFD PEGVDRFFSAPTDEKQRLLEYHANTNYSVVDLDISQSLYLKSYQEKVLGK QRLRMINTSRVTSVDEDTDGVRVEVTSSATGLTHTIEADVIVYATGYRPS DPAPLLQGLMRECKHDEQGRLSVGRDYRVTTSDAVRAGIYVHGASTEHSH GLSAGLLSNTAVRSGEIAQSILRR 67. >Rhodococcus_fascians_05-339-1 MGAQSGSSVADVVGVGFGPSNLALAIALQESIQPGPVPAKFSMKFYELQP RFGWHRGMLMEDATMQVSFLKDLATMRNPMSRYTFVSYLREKERIAEFIN SKTLYPLRVEFHDYLEWAASQFQSNVSYGSEIKDIRPVVENGVVEYVDVV GPDDVVQRARNIVIGMGLTPRLPDGVNRSERIWHSSQLLGRAAAVTYVPQ NFVVVGSGQSAAEVADYLHRTFPRANVHTVLSRYGYSVADDSPYANGIFD PEGVDRFFSAPTDEKQRLLEYHANTNYSVVDLDISQSLYLKSYQEKVLGK QRLRMINTSRVTSVDEDTDGVRVEVTSSATGLTHTIEADVIVYATGYRPS DPAPLLQGLMRECKHDEQGRLSVGRDYRVTTSDAVRAGIYVHGASTEHSH GLSAGLLSNTAVRSGEIAQSILRR 68. >Rhodococcus_fascians_LMG_3605 MGAQSGSSVADVVGVGFGPSNLALAIALQESIQPGPVPAKFSMKFYELQP RFGWHRGMLMEDATMQVSFLKDLATMRNPMSRYTFVSYLREKERIAEFIN SKTLYPLRVEFHDYLEWAASQFQSNVSYGSEIKDIRPVVENGVVEYVDVV GPDDVVQRARNIVIGMGLTPRLPDGVNRSERIWHSSQLLGRAAAVTYVPQ NFVVVGSGQSAAEVADYLHRTFPRANVHTVLSRYGYSVADDSPYANGIFD PEGVDRFFSAPTDEKQRLLEYHANTNYSVVDLDISQSLYLKSYQEKVLGK QRLRMINTSRVTSVDEDTDGVRVEVTSSATGLTHTIEADVIVYATGYRPS DPAPLLQGLMRECKHDEQGRLSVGRDYRVTTSDAVRAGIYVHGASTEHSH GLSAGLLSNTAVRSGEIAQSILRR 69. >Rhodococcus_fascians_LMG_3616 MGAQSGSSVADVVGVGFGPSNLALAIALQESIQPGPVPAKFSMKFYELQP RFGWHRGMLMEDATMQVSFLKDLATMRNPMSRYTFVSYLREKERIAEFIN SKTLYPLRVEFHDYLEWAASQFQSNVSYGSEIKDIRPVVENGVVEYVDVV GPDDVVQRARNIVIGMGLTPRLPDGVNRSERIWHSSQLLGRAAAVTYVPQ NFVVVGSGQSAAEVADYLHRTFPRANVHTVLSRYGYSVADDSPYANGIFD PEGVDRFFSAPTDEKQRLLEYHANTNYSVVDLDISQSLYLKSYQEKVLGK QRLRMINTSRVTSVDEDTDGVRVEVTSSATGLTHTIEADVIVYATGYRPS DPAPLLQGLMRECKHDEQGRLSVGRDYRVTTSDAVRAGIYVHGASTEHSH GLSAGLLSNTAVRSGEIAQSILRR 70. >Rhodococcus_fascians_LMG_3623 MGAQSGSSVADVVGVGFGPSNLALAIALQESIQPGPVPAKFSMKFYELQP RFGWHRGMLMEDATMQVSFLKDLATMRNPMSRYTFVSYLREKERIAEFIN SKTLYPLRVEFHDYLEWAASQFQSNVSYGSEIKDIRPVVENGVVEYVDVV GPDDVVQRARNIVIGMGLTPRLPDGVNRSERIWHSSQLLGRAAAVTYVPQ NFVVVGSGQSAAEVADYLHRTFPRANVHTVLSRYGYSVADDSPYANGIFD PEGVDRFFSAPTDEKQRLLEYHANTNYSVVDLDISQSLYLKSYQEKVLGK QRLRMINTSRVTSVDEDTDGVRVEVTSSATGLTHTIEADVIVYATGYRPS DPAPLLQGLMRECKHDEQGRLSVGRDYRVTTSDAVRAGIYVHGASTEHSH GLSAGLLSNTAVRSGEIAQSILRR 71. >Rhodococcus_fascians_A22b MGAQSGSSVADVVGVGFGPSNLALAIALQESIQPGPVPAKFSMKFYELQP RFGWHRGMLMEDATMQVSFLKDLATMRNPMSRYTFVSYLREKERIAEFIN SKTLYPLRVEFHDYLEWAASQFQSNVSYGSEIKDIRPVVENGVVEYVDVV GPDDVVQRARNIVIGMGLTPRLPDGVNRSERIWHSSQLLGRAAAVTYVPQ NFVVVGSGQSAAEVADYLHRTFPRANVHTVLSRYGYSVADDSPYANGIFD PEGVDRFFSAPTDEKQRLLEYHANTNYSVVDLDISQSLYLKSYQEKVLGK QRLRMINTSRVTSVDEDTDGVRVEVTSSATGLTHTIEADVIVYATGYRPS DPAPLLQGLMRECKHDEQGRLSVGRDYRVTTSDAVRAGIYVHGASTEHSH GLSAGLLSNTAVRSGEIAQSILRR 72. >Salinispora_arenicola_CNS848 MSNQHETYDLVGIGFGPSNLSLAIALKEYEANGQENGISTLFFERQSSFG WHRNMLLPSTTMQISFLKDLVTFRNPTSGFSFISYLHASGRLPQFVNNQD FFPTRQEFHQYLEWAEERMAGRVAYGSEVTSIRLPSGTVPELSDRLRLEV TDAAGRVGRVVEARNVVISTGLVPRMPEGIERDERVWHSSEFLQKYRRMN PGDLRRVAVVGAGQSAAEITRFLHDELPHAEVWVVIPSYGYSVADDTPFA NQIFDPEAVDDYYFGTEQTRDAFWRYHRNTNYSVVDDEVIRDLYRRVYDA EVRGIKRLQILNLTRITGVKRAAAETRVELQVGPDSEVRELDVDALVCAT GYDGMEPTHLLGDLDRLCLRDKAGRHQIERDYRIATAPEMRCGIYLQGGT EHTHGLSSSLLSNIAVRSGEIADSIVSRRARHNSEYALAAGAEGDTC 73. >Salinispora_arenicola_CNY231 MSNQHETYDLVGIGFGPSNLSLAIALKEYEANGQENGISTLFFERQSSFG

WHRNMLLPSTTMQISFLKDLVTFRNPTSGFSFISYLHASGRLPQFVNNQD FFPTRQEFHQYLEWAEERMAGRVAYGSEVTSIRLPSGTVPELSDRLRLEV TDAAGRVGRVVEARNVVISTGLVPRMPEGIERDERVWHSSEFLQKYRRMN PGDLRRVAVVGAGQSAAEITRFLHDELPHAEVWVVIPSYGYSVADDTPFA NQIFDPEAVDDYYFGTEQTRDAFWRYHRNTNYSVVDDEVIRDLYRRVYDA EVRGIKRLQILNLTRITGVKRAAAETRVELQVGPDSEVRELDVDALVCAT GYDGMEPTHLLGDLDRLCLRDKAGRHQIERDYRIATAPEMRCGIYLQGGT EHTHGLSSSLLSNIAVRSGEIADSIVSRRARHNSEYALAAGAEGDTC 74. >Salinispora_arenicola_CNY280 MSNQHETYDLVGIGFGPSNLSLAIALKEYEANGQENGISTLFFERQSSFG WHRNMLLPSTTMQISFLKDLVTFRNPTSGFSFISYLHASGRLPQFVNNQD FFPTRQEFHQYLEWAEERMAGRVAYGSEVTSIRLPSGTVPELSDRLRLEV TDAAGRVGRVVEARNVVISTGLVPRMPEGIERDERVWHSSEFLQKYRRMN PGDLRRVAVVGAGQSAAEITRFLHDELPHAEVWVVIPSYGYSVADDTPFA NQIFDPEAVDDYYFGTEQTRDAFWRYHRNTNYSVVDDEVIRDLYRRVYDA EVRGIKRLQILNLTRITGVKRAAAETRVELQVGPDSEVRELDVDALVCAT GYDGMEPTHLLGDLDRLCLRDKAGRHQIERDYRIATAPEMRCGIYLQGGT EHTHGLSSSLLSNIAVRSGEIADSIVSRRARHNSEYALAAGAEGDTC 75. >Salinispora_arenicola_CNT005 MSNQHETYDLVGIGFGPSNLSLAIALKEYEANGQENGISTLFFERQSSFG WHRNMLLPSTTMQISFLKDLVTFRNPTSGFSFISYLHASGRLPQFVNNQD FFPTRQEFHQYLEWAEERMAGRVAYGSEVTSIRLPSGTVPELSDRLRLEV TDAAGRVGRVVEARNVVISTGLVPRMPEGIERDERVWHSSEFLQKYRRMN PGDLRRVAVVGAGQSAAEITRFLHDELPHAEVWVVIPSYGYSVADDTPFA NQIFDPEAVDDYYFGTEQTRDAFWRYHRNTNYSVVDDEVIRDLYRRVYDA EVRGIKRLQILNLTRITGVKRAAAETRVELQVGPDSEVRELDVDALVCAT GYDGMEPTHLLGDLDRLCLRDKAGRHQIERDYRIATAPEMRCGIYLQGGT EHTHGLSSSLLSNIAVRSGEIADSIVSRRARHNSEYALAAGAEGDTC 76. >Salinispora_arenicola_CNY230 MSNQHETYDLVGIGFGPSNLSLAIALKEYEANGQENGISTLFFERQSSFG WHRNMLLPSTTMQISFLKDLVTFRNPTSGFSFISYLHASGRLPQFVNNQD FFPTRQEFHQYLEWAEERMAGRVAYCSEVTSIRLPSGTVPELSDRLRLEV TDAAGRVGRVVEARNVVISTGLVPRMPEGIERDERVWHSSEFLQKYRRMN PGDLRRVAVVGAGQSAAEITRFLHDELPHAEVWVVIPSYGYSVADDTPFA NQIFDPEAVDDYYFGTEQTRDAFWRYHRNTNYSVVDDEVIRDLYRRVYDA EVRGIKRLQILNLTRITGVKRAAAETRVELQVGPDSEVRELDVDALVCAT GYDGMEPTHLLGDLDRLCLRDKAGRHQIERDYRIATAPEMRCGIYLQGGT EHTHGLSSSLLSNIAVRSGEIADSIVSRRARHNSEYALAAGAEGDTC 77. >Salinispora_arenicola_CNY486 MSNQHETYDLVGIGFGPSNLSLAIALKEYEANGQENGISTLFFERQSSFG WHRNMLLPSTTMQISFLKDLVTFRNPTSGFSFISYLHASGRLPQFVNNQD FFPTRQEFHQYLEWAEERMAGRVAYCSEVTSIRLPSGTVPELSDRLRLEV TDAAGRVGRVVEARNVVISTGLVPRMPEGIERDERVWHSSEFLQKYRRMN PGDLRRVAVVGAGQSAAEITRFLHDELPHAEVWVVIPSYGYSVADDTPFA NQIFDPEAVDDYYFGTEQTRDAFWRYHRNTNYSVVDDEVIRDLYRRVYDA EVRGIKRLQILNLTRITGVKRAAAETRVELQVGPDSEVRELDVDALVCAT GYDGMEPTHLLGDLDRLCLRDKAGRHQIERDYRIATAPEMRCGIYLQGGT EHTHGLSSSLLSNIAVRSGEIADSIVSRRARHNSEYALAAGAEGDTC 78. >Salinispora_pacifica_CNY331 MSNQHETYDLVGIGFGPSNLSLAIALKEYEANGQENGISTLFFERQSSFG WHRNMLLPSTTMQISFLKDLVTFRNPTSGFSFISYLHASGRLPQFVNNQD FFPTRQEFHQYLEWAEERMAGRVAYCSEVTSIRLPSGTVPELSDRLRLEV TDAAGRVGRVVEARNVVISTGLVPRMPEGIERDERVWHSSEFLQKYRRMN PGDLRRVAVVGAGQSAAEITRFLHDELPHAEVWVVIPSYGYSVADDTPFA NQIFDPEAVDDYYFGTEQTRDAFWRYHRNTNYSVVDDEVIRDLYRRVYDA EVRGIKRLQILNLTRITGVKRAAAETRVELQVGPDSEVRELDVDALVCAT GYDGMEPTHLLGDLDRLCLRDKAGRHQIERDYRIATAPEMRCGIYLQGGT EHTHGLSSSLLSNIAVRSGEIADSIVSRRARHNSEYALAAGAEGDTC 79. >Streptomyces_aureofaciens_NRRL_2209 VGERQRSGVVAGTGIVDVAGIGFGPSNLALAAAIAEIAGEAPVSARFFEA QPRFGWHRGMLIEGATMQVSYLKDLVTMRNPTSPYSFLCYLQARGRLADF INTKSPYPLRVEFHDYLEWVAESFADLVSYGARVVSVEPVSAEQGVEFLD VHFVAPDGTRQVQRARNLVIAAGIEPRLPAGLPASPRIWHTAKFLPEVDR IARQDPRSFVVLGSGQSAAEAIEHLHARFPRAQVHSVHARYGFSVADDSP FANQVFNPEAVDRFHTAPDDVRQRLIDYHASTNYSVVDADLLHSLFQQAY LEKVAGNPRLNFHNVSRVSEVTETPDGLRIDVESLSSGTSTVIEAQALVC ATGYTRTDPAVFLDGLLPHCPLDDQGRLRLDREHRVVTDESVRCGIYVQG FGEHSHGLSETLLSLSAVRAGEIGDMLVKALSG 80. >Streptomyces_sp._OK885 MGARETEVYDVVGVGFGPSNLSLAVAIQEHNSSTSDRPLTAAFFERQEAF GWHRNMLLPAATMQIPFLKDIATFRNPASRYSFVAYLHASGRLAGFVNNQ TFFPTRREFHRYLEWVAANFTDQVSYGCEVVGLRLSGQGTGAGAPAHLEI EVAGGAGRQRSSVRARNVVVSTGLVPRMPEGVLGDDRVWHSSEFLTRFRG LKPVDLRAVAVVGAGQSAAEITRFVHDAAPHAQVYSVIPSYGYALADDTP FANQVFDPAAVDDYFFGTDRARQAFWDYHKNTNYSVVDDDVIRDLYRRSY DEEVNGARRLHFLNLTRVGEVKRAGDETRVLLMNGERRELEVDLCVFATG YHGMEPAGVLGDLAPYCLRDEAGRLRVERDYRLVTGPELPGGIYLQGGTE HTHGLSSSLLSNIAVRSGEIAESIVSRHRIERELGQVHPAEPAGKIR 81. >Pseudonocardia_sp._AL041005-10 MDTDDMGTYDFVGIGFGPSNLSLAAALRDASSSDASPVRGHFFEAQPSFG WHRNMLLPSAKMQVSFLKDLVTFRNPHSRFSFVSYLHEMNRLPQFANNND FFPTRREFHQYLEWVAGHFADSVTYGARVTGIEPICGGATAGPHDRFRIT IASGKDALATTRVEAYNVVLATGLTPRMPEGSVRDDRVWHSSEFLERFGS CSSASLRRVAVVGAGQSAAEIARFCYDHAPNATISAILPSYGYSIADNTP FANRVFDPGAVDDYYFSDPLGKDRLWESHRNTNYSVVDDEVIRSLFQRQY DDEVRGVERLQIINLARVANIKRSGDETRVTIHSLARDEHFDLDVDVVVC ATGYEAMGADGVLAGLDAFCPRDDRGRHRVERDYRLITTDDLTAGIYLQG GTEHTHGLTSSLLSNLATRSGEIASSLRSSRRVGSAGGDRW PzbB 82. >Mycobacterium_marinum_M MYERPGYSAIEPAAVLDLLTANPLGLVVTIDGARPLATHAPVLFSQGPNGVAQAEVASGD APLVGSLLVGHMNADNPQWRGMQKGGRVLVAFQGPHGYVSPSVYGVTPASPTWNFTAVHI AGTLEPIADPESTFELVCDTARRLEARFGHGWRQEPSLDYFRRIVSGVGAFEIQVESVQT MFKLSQEQPPVLRRRVAEHFESSDSVLHQELADLMRKHVFPKPI 83. >Lentzea_flaviverrucosa_DSM_44664 MFVPAQYREPHGHWITDLVRGHPLAQLVSNGPAGSSPYVTHAPIILDPGHPDPHPDDLHG AVLWGHLNRANPHWAALGDGTEVTAVFTGPGSYVSPTVYERTPAAPTWDFTAVHVRGTLR RVLDAEQTLATVTATVRAFEADHGTGWSMESSLDYFDQLLPGVGAFRLAVTGVDAMFKLS QEQPPEVRLRVRDHFAGSERTHHCLIAEMMDRLPVAEH 84. >Streptomyces_aureofaciens_ATCC_10762 VFTPKLYQVDGDDWPLRIIERHPLAVLVSNGDPVPNATHVPVIAPPDAAPEDALSGMRLW AHLTRANPHWQQLAAAGGGPAKLVFHGPNGYVTPSLYSADMVAPTWNYVAVHLEGTVELA GDDETLAIVHTTAQTLEDRFGDGMALAPSLEYHRQIVGAVGGLFFTVTKVDVMFKLSQEK DPEVQQRVLDRFAASGSGLHREVADTMRALRLGGSAG 85. >Streptomyces_diastatochromogenes_NRRL_B-1698 VYIPDLYRTDDKEWPVRILEENPLGLLTTHASSSAPPFATHLPVIIPSGSRDALLQDEKW RGATLLGHMNRANPHWQSLADGTPARIVFQGPGAYVSPSVYHTDPAAPTWDFTAVHVQGT LWPVRDEAETLAIVTATATELERKFGTGWCPHSSTEYFRQLLAGVGAFELRVDTMDAMFK LSQEKSHEIRNGVVDWFVQGQHGRSRELASLMAEFYKDDRGTGA 86. >Streptomyces_sp._DvalAA-43 MFVPSHYREPDGSWMIDLIRANPMAIMAINGSSADGPFATHLPVIPDPAATGRRSADLSG ATLLGHMNRANPQWAALESGGVALLIFTGPHGYVSPTVYEMAPAAPTWNFTSVHVHGMVE KIDSTEETLGVVKSTVTALETDFGTDWDMSGSVDYFRKIVPAVGAFRFTVSGAEGMFKLS QEQPAEVRDRVQTSFSCREQGRYRETAELMGRLPG 87. >Collimonas_fungivorans_Ter6 MYVPEYYRVDENTARELVYRHPLALLVCNGNNGLPWATHLPAIFPPETRKLLDQGESIIG KTMYGHMNRINPHWNALQAGSALLIFQGPNSYVSPTVYEVTPAAPTWNFTSTHLRGTLRP IDERDQILEIVRWTVATFEKEFCTNWDLTESIPYFERIVHGVGAFAFEVESFDSMFKLSQ EQPAAIQERVVNSFASSSHCPHKEIADLMQRTNSKNKK 88. >Streptomyces_reticuli_TUE45 VYERPLYREDRDGVVLAFLHHHPLALVVTAHEGVPVATHAPVLFRHGPDGADAEAVAAGT VPLAGSTLIGHMNVENPQWRRMRSGDQALIVFQGPHGYVSPTVYDVTPAAPTWNFTAVHV TGTVEPTAEPADVLDIVSDTARRLEGRFGRGWDQESSLDYFRQIAPGVGAFTLRVESVQT MFKLSQEKPTPMRRRVAEQFEASESGTHRALAGMMRAHGLTDADEERETAG 89. >Streptomyces_scabiei_NCPPB_4086 MFVPDPYREPDGSWMTELIRLNPFALLVSNGPADADPYATHLPVLRDPEWTGEWTEDLAG GRLVGHMNRENPHWTALETGTPVLITFTGPHAYVSPIVYDITPAAPTWDFTSVHVHGVFH KIEAAAPGEDTLEVCKDTVKAYERDFGAAKAWDMSRSIDYFATILPAVGAFRVEITGAEG MFKLSQEQDQEIRERVQKDFALRDSTQYRETADLMDRMEKTGTVQGCPVHH 90. >Kutzneria_albida_DSM_43870 MFVPSHYREPDVSWMVDLMRQNPLALLASNGNPADGPFATHLPVITDPAWDGPPAEKLAG WPLLGHMNRANPQWTALENGATVLLTFTGPHAYVSPTVYEISPAAPTWNFTSVHAHGVVE KIESIEETLEVVQATVKVFEKFFGDSWDMTESLGYFRKIVPAVGAFRIRVTRADGMFKLS QEQKPEVRKRVVTSFSERGCGRHAQTAALMTQLP 91. >Streptomyces_albus_ZpM MFVPPEYRPDDPEWLIEVIRSHPLACLVTNGPDGPRASHVPVIPDPEQFPSGMPAREGEV AGRRLFGHMNRLNPHWAALQGGAQALLVFQGPNGYVSPTVYEYTPAAPTWDFTAVHVRGW LEPVGDRESSLQIITETVAAYERDLGTGWDMTESLGYFRQLLPGVGAFRLAIDTVDGMFK LSQEQSPEVRERVACEFAARAEARGTALAEHIQRTK 92. >Rhodococcus_fascians_02-815 MYVPRIYKASDRTWLRRVVAQYPFAALISNGPKAPYATHLPVICAPCAPSESEDLEGSTL FGHMNRANPHWDSLVDGADAQLIFTGPHGYVTPSVYQRDSVAPTWNYVSVHLRGKLQPVA DFEETLKVVQLTVSTYEQKFGSGWEMDSSLDHYRRIGPAVGAFSFEVESADGMFKLSQEQ NLETRRRVADHFSANHAGRGKELASFMREYSHGDYNNF 93. >Streptomyces_neyagawaensis_NRRL_B-3092 MFVPDPYREPDGSWMTELIRLNPFALLVSNGPADADPYATHLPVIRDPEWTGAWTENLAG GRLIGHMNRENPHWTALENGTPVLITFTGPHAYVSPTVYDITPAAPTWDFTSVHVHGVFE KIEAAAPGEDSLEVCKDTVKAYERDFGAAKAWDMSRSIDYFATILPAVGAFRVEITGAEG MFKLSQEQDEEIRERVREDFALRDSSQYRETAELMDRMEKTGTIKGCPVHH 94. >Kutzneria_buriramensis_DSM_45791 MFVPHHYHEPNESWMTDLIRENPLAELVSNGNGPAGPFATHVPVIPDPHDPDRPPGEIVG ATLWGHMNRSNPHWAALESETPVVIVFTGPHAYVSPTLYQRTPAAPTWNFTAVHARGLLR RVDAEAAGDETLETVMATVRAFEARFGAGWAMSESVEYFRRIVPAVGAFRVTVSHVDGMF KLSQEQDADVRARVRESFAERESSNHKAIAAMMGRLADAE 95. >Streptomyces_yanglinensis_CGMCC_4.2023 MFVPSQYREPDVSWMVDLMRDNPLALMASNGTAADGPYATHLPVITDPGWEGPPAADLAG MLLLGHMNRANPHWSALEDGQTILLTFTGPHAYVSPTVYDITPAAPTWNFTSVHVRGTVE KIATTEETLEVVKSTVRAYEKEFGDSWDMNASLDYFRKIVPGVGAFHVRVTRAEAMFKLS QEQSPEVRDRVVRSFAGRGCTRHAQAADLMTRLP 96. >Streptomyces_griseochromogenes_ATCC_14511 MFVPSHYREPDVSWMVDLMRGNPLALMASNGTPADGPFATHLPVITDPQWEGSPTADLAG MPLLGHMNRANPHWAALETGSAILLTFTGPHAYVSPTVYDVTPAAPTWNFTSVHVHGVVE KIESTEETLDVVQATVQAFEGEFGDSWDMSESVDYFRKIVTGVGAFRVRVTKAEGMFKLS QEQRPEIRERVVQSFAGRECTRHVQTADLMNRLP 97. >Frankia_sp._Avcl.1 MFVPCHYRAPNVSMMVDLMRENPLALMVSNGAPGAVPFATHLPVITDPCWDGQAGPDLGG MVLLGHLNRANPHWXALETGSMILLTFTGPHAYVSPTVYGLTPAAPTWDFTSVHVHGVVE KLTTTEETLEVVRATVLAFEQEFGDGWDMTDSLGYFRRIVPRVGAFRLRVTGAQGMFKLS QEQTPEIRERVARSFAAHGSTRHAQTAELISRLPH 98. >Streptomyces_incarnatus_NRRL_8089 MFVPSFYREPDSAWMVDLIRGNPLALAVTNGSPEDGPFATHLPVIFDPETSGDWSGELPG ATLLGHMNRANPHWAALETGSVLLLTFTGPHSYVSPTVYETTPAAPTWNFTAVHVRGVVE KISSTEETLGVVQSTVRAYEGAFGDGWDMSESLDYFRKIVPAVGAFRFTVTGAEGMFKLS QEQPGEVRERVRDAFGQSGCAYRREVAGLMSRLP 99. >Streptomyces_sp._MUSC136T MFVPPQYREPDGSWMVDLMRRNPLALCVTNGDAADGPYATHLPVIRDPGMTGEWAEDLSG GTLLGHMNLQNPHWAALRDGQSVLLVFTGPHAYVSPTVYEKSPAAPTWDFTAVHVHGTVE KLTSAQDTLDVVKSTVRAFESDLGTGWDMTESEAYFDQLLPGVGAFRVEVTGAEGMFKLS QEQQPHVRDRVHDAFAERPCGRHRETAELMARLP 100. >Streptomyces_albulus_PD-1 MFVPPEYRPDDPEWLIEVIRSHPLACLVTNGPDGPRASHVPVIPDPEQFPSGMPAREGEV AGRRLFGHMNRLNPHWAALQGGAQALLVFQGPNGYVSPTVYEYTPAAPTWDFTAVHVRGW LEPVGDRESSLQIITETVAAYERDLGTGWDMTESLGYFRQLLPGVGAFRLAIDTVDGMFK LSQEQSPEVRERVACEFAARAEARGTALAEHIQRTK 101. >Streptomyces_tsukubaensis_NRRL_18488 MFVPSMYRAPDSSWMVNLIRENPLALAVANGSPENGPFATHLPVVFDPETSADPAGELPG TTLLGHMNRANPHWAALETGSVLLLTFTGPNSYVSPSVYGVTPAAPTWNFTAVHVRGVVE KISSLEESLDVVQSTVRAFEGAFGNGWDMTESLGYFRRIAPAVGAFRLTVTGAEGMFKLS QEQPGDVRRRVRESFGQSACRYRRETAGLMSRLP 102. >Streptomyces_himastatinicus_ATCC_53653_hmtC MFVPSHYREPDSSWMVDIIRGNPLALMMSNGAAGEPPFATHLPVIPDPAMTGDWSERLSE ATLLGHMNRDNPQWQALEDGAVVRIAFSGPHAYVSPTLYGVTPAAPTWNFTSVHVRGVVE RIPSTEETLEVVKSTVRAFEADFGEGWDMAASIDYFRKIVPGVGAFRIMVRNVDGMFKLS QEQQPEVRDRVRKSFAGRECGRHQETAAYMSRLP 103. >Streptomyces_flaveolus_DSM_9954_sfaC MYERPLYREDCDGVVLAFLRHNPLAMVVTSHDDVPVATHAPVLFRHGPDGADAEAVAAGT VPLAGSTLIGHMNVENPQWRRMRSGDRALIVFQGPHGYVSPTVYGVTPAAPTWDFIAVHV NGTVEPTADPAAVLDIVSDTARRLESGFGRGWDQESSLDYFRQIAPGVGAFTLRVDSVQT MFKLSQEKPAPMRRRVVEQFEASESGTHRALASVMRDRGLTEADEERETAG 104. >Streptomyces_auranticaus_JA_4570 MFVPSQYRQPDSSWMLDLIHGNPLALFVSNGSPEAGPFATHLPVIQDPEWTGEWSDDLSG GRLLGHMNRANPHWKALESGTVNLLTFTGPHGYVSPTVYRTTPAAPTWNFTSVHVHGVVE KIDGIENTLEVVKATVRAYEGAFGAGWDMTESLDYFRKIVPAVGAFQFRVTGAEGMFKLS QEQPDDVQERVRESFGGRECTRHQAAAQLMDKLR 105. >Streptomyces_sp._RJA2928_padO MFVPQHYRTDDRRWPVRIVQDNPLALLMSTRDGRAPFASHVPVIVLPRQREELERTGRWQ GAVLHGHMNRANPHWKSLADGQPAGLVFQGPAGYVSPAVYNTSPAVPTWNFTAVHVQGRL KLVADEEATLGVVSATARQLEERFGARWTVEPSVDHFRQILPGVGAFELRVEECDSMFKL SQEKEHEVRHAVMDWCARSPRGRSNDLAAVMRDYYPPTTTWPS 106. >Frankia_alni_str._ACN14A MFVPCHYRAPNVSMMVDLMRENPLALMVSNGAPGAVPFATHLPVITDPCWDGQAGPDLGG MVLLGHLNRANPHWAALETGSMILLTFTGPHAYVSPTVYGLTPAAPTWDFTSVHVHGVVE KLTTTEETLEVVRATVLAFEQEFGDGWDMTDSLGYFRRIVPRVGAFRLRVTGAQGMFKLS QEQTPEIRERVARSFAAHGSTRHAQTAELISRLPH 107. >Actinosynnema_mirum_DSM_43827 MHVPPMYRADDEDRARQVVHDYPLATLVSNGPRVPHATHLPVVAAPGAPQVGGLAGSTLW GHLNRANAHWRALAGGVPAVLVFTGPHAYITPAIYRTTPAVPTWDFVSVHLHGRVEPIDG

EAGTLEVVKRTAELFESAFGAGWAAEPSHGHFARIVSGVGAFRFHVESVDSMFKLSQEKD RDVRVRIIASLREASGPAAELGRIMHEHGLGGRGAEGA 108. >Kutzneria_sp._744_orf4 MFVPGPYHAPEDRWLVDLVRGHPLAQLASNGAGGAAPHITHVPIIVDPELDGPVDRLVGI TLWGHMNRANPHWAALGGAANVVATFAGPNAYVSPAVYRTAPAAPTWNFTSVQVRGELRK VESADDTLATVRATVAALESRFGAGWDMTGSLDYFRRILPGVGAFRLRVAEADGMFKLSQ EQQPAIRRRVRHSFGGCEATRAVAGLMDRLPTE 109. >Kibdelosporangium_sp._MJ126-NF4 MHVPPMYEAPDPAWIPALIRAHPLATLVTAPDGIPAASHVPMIIRRTPDDERLTLVGHMN RMNPQFKAIGDGCPALLVFTGPHGYVSPTVYGFTPAAPTWNFAVVHASGTLSPLPAGPDT LEVIIDTVTALEGQLGNGWQMRDSLEYFDQLLPGVGAFSVQVDRVEAMYKLSQEQEPTTR ETVAAAFEARSSDLAAMMRVCLDVERSTLGNRVG 110. >Mycobacterium_xenopi_RIVM700367 MLSLLPFRAQAIAQEIAASRHRDAVTVRQRPVGDYPPKRYLETDPDRLRAVIERYRFATL ISARATDEPVVTQLPLTLDTSRGSHGVLFGHMDLANPHAELLDGRPVLALFHGPNGYIPP HQSNQLPTWNSITVEVRGRARILRDKDAVVDGLRGIAAAADPSPGGFRLTREAASDERLF PFLVGFEIDIDEMVGRFKLSQDRDDRDRWLAARTLAHGLEQDDRDLIASIVELPLDRDDD PIPLRRARTSGT 111. >Streptomyces_mirabilis_YR139 MFVPSFYREPDSSWMVDLIRGNPLALAAANGSPEEGPFATHLPVIFDPETSGDWSGELPG ATLLGHMNRANPHWAALATGSVLLLTFTGPHSYVSPTVYEVTPAAPTWNFTAVHVRGVVE KIDSIEETLGVVQSIVRAFEGAFGDGWDMTESLGYFRKIVPDVGAFRFTVTGAEGMFKLS QEQPGEVRERVRESFGHSACAYKRETAGLMSRLP 112. >Streptomyces_scabrisporus_DSM_41855 MFVPRHYREPDSSWMVDLIRANPLALAVMNGDPSAGPFATHLPVIPDPQMTPSWSDDLSG ATLLGHMNRANPHWKALETGTVLLLTFTGPHGYVSPTVYEVTPAAPTWNFTSVHVRGVVE RIDSLEETLGVVRATALAFESEFGAGWDQTESVDYFRKIVPGVGAFRVTVTGAEGMFKLS QEQPAEVRERVRQSFSTRACSLQRETAELMTRLP 113. >Streptomyces_sp._TAA040 VFVPTHYREPDGSWMADLMRENPLALAVTDGGAGDGPFATHLPVVPDPGTTGDWPNGLKG ATLLGHMNRANPHWRALETGGVVLLAFTGPHAYVSPTVYEVTPAAPTWNFTSVHVRGVVD RIDSPEETLDVVRTTALVYEARFGAGWDQAASLDYFRRIVPAVGAFRIAVTSAEGMFKLS QEQPAEVRERVHRSFSGRECGRHRDTAALMERLPRTGAEPPVGR 114. >Actinoalloteichus_cyanogriseus_DSM_43889 MFVPHQYRAADTRPLVELIRSFPLATLVSHADGALFATHVPVLLAADADAGRDVPDPADL TILGHLNRLNPHRDALAGGGACLLTFTGPHSYVSPAHYGRDTAAPTWNFTSVHVHGHLTP LDSTEDTRHVVRSTALLYERRFGAGWDMTGSLDYFEQLLPGVSAFRVDVGTVEGMFKLGQ EQPGHARQGVLAAFTSPGAPPHQRAVAELMRRFPPDAAGGVPGCPAQSAARMSPPADAIR GEH 115. >Streptomyces_sp._HNS054 MFVPNFYREPDASWMVDLVRGNPLALAVSNGCPEDGPFATHLPVIFDPARYGDLPGELAG ATLLGHMNRANPHWPALQTGGILLLTFTGPHSYVSPTAYGTTPAAPTWNFTAVHARGVVE KIDSTEETLDVVKATVRAYEGEFGDGWDMTESLGYFRKIVPAVGAFRLTVTRAEGMFKLS QEQPAEVRERVRESFEQSACRYKRETAGLMSRLP 116. >Streptomyces_sp._AW19M42 MYVPDHYQGSPEAALTVVRAGPLATLVTGADPWPLATHLPVVVPADVEAALEHGPVDLRG HRLIGHLNRANPHWRQLSAGEQPSLLIFRGPHGYISPVVYESTPAAPTWNFTAVHVHGTI RPLPAGKETLDVIHRTVEVLEGGFGHGWDMRGSLEYFEKIVPHVGAFEFQVAEVDGMFKL SQELDEETRERTTHHFATSAHGTHRELACEMARLSTAAETKDGASEGASGSSSKRGTA 117. >Salinispora_pacifica_DSM_45549 MFVPSPYREPDGSWTVDLMRRNPLALLVTSSDKTDVPYATHLPVIFDPCMPEEDYSDPAR FVLLGHMNRANPHWKALATGMPTLVVFSGSHAYVSPTVYDKSPAAPTWNFTAAHARGVLE KIESAEETLGVIGSTVRAFEADFGTDWDMTQSVGYFRKILPGVGAFRIAVSSIDSMFKLS QEQPPEVRDRVGCAFAESASTRHREVAGLMNRLAVPKQVTV 118. >Salinispora_pacifica_CNT150 MFVPSPYREPDGSWTVDLMRRNPLALLVTSSDKTDVPYATHLPVIFDPCM PEEDYSDPARFVLLGHMNRANPHWKALATGMPTLVVFSGSHAYVSPTVYD KSPAAPTWNFTAAHARGVLEKIESAEETLGVIGSTVRAFEADFGTDWDMT QSVGYFRKILPGVGAFRIAVSSIDSMFKLSQEQPPEVRDRVGCAFAESAS TRHREVAGLMNRLAVPKQVTV 119. >Salinispora_tropica_CNB536 MFVPSPYREPDGSWTVDLMRRNPLALLVTSSDKTDIPYATHLPVIFDPRMPEEDYSDPAR FVLLGHMNRANPHWKALATGMPTLVVFSGSHAYVSPTVYDKSPAAPTWNFTAAHARGVLE KIESAEETLGVIGSTVRAFEADFGADWDMAQSVGYFRKILPGVGAFRIAVSSIDSMFKLS QEQSPEVRDRVGCAFAESASTRHREVADLMNRLAVPKQVTV 120. >Salinispora_arenicola_CNH996B MFVPSPYREPDGSWTVDLMRRNPLALLVTSSDKTDVPYATHLPVIFDPCM PEEDYSDPARFVLLGHMNRANPHWKALATGMPTLVVFSGSHAYVSPTVYD KSPAAPTWNFTAAHARGVLEKIESAEEALGVIGSTVRAFEADFGTDWDMT QSVGYFRKILPGVGAFRIAVSSIDSMFKLSQEQPPEVRDRVGCAFAESAS TRHREVAGLMNRLAVPKRVIV 121. >Salinispora_arenicola_CNH996 MFVPSPYREPDGSWTVDLMRRNPLALLVTSSDKTDVPYATHLPVIFDPCMPEEDYSDPAR FVLLGHMNRANPHWKALATGMPTLVVFSGSHAYVSPTVYDKSPAAPTWNFTAAHARGVLE KIESAEEALGVIGSTVRAFEADFGTDWDMTQSVGYFRKILPGVGAFRIAVSSIDSMFKLS QEQPPEVRDRVGCAFAESASTRHREVAGLMNRLAVPKRVTV 122. >Salinispora_tropica_CNY012 MFVPSPYREPDGSWTVDLMRRNPLALLVTSSDKTDIPYATHLPVIFDPRMPEEDYSDPAR FVLLGHMNRANPHWKALATGMPTLVVFSGSHAYVSPTVYDKSPAAPTWNFTAAHARGVLE KIESAEETLGVIGSTVRAFEADFGTDWDMAQSVGYFRKILPGVGAFRIAVSSIDSMFKLS QEQSPEVRDRVGCAFAESASTRHREVADLMNRLAVPKQVTV 123. >Salinispora_tropica_CNT261 MFVPSPYREPDGSWTVDLMRRNPLALLVTSSDKTDIPYATHLPVIFDPRMPEEDYSDPAR FVLLGHMNRANPHWKALATGMPTLVVFSGSHAYVSPTVYDKSPAAPTWNFTAAHARGVLE KIESAEETLGVIGSTVRAFEADFGTDWDMAQSVGYFRKILPGVGAFRIAVSSIDSMFKLS QEQSPEVRDRVGCAFAESASTRHREVADLMNRLAVPKQVTV 124. >Salinispora_tropica_CNH898 MFVPSPYREPDGSWTVDLMRRNPLALLVTSSDKTDIPYATHLPVIFDPRMPEEDYSDPAR FVLLGHMNRANPHWKALVTGMPTLVVFSGSHAYVSPTVYDKSPAAPTWNFTAAHARGVLE KIESAEETLGVIGSTVRAFEADFGTDWDMAQSVGYFRKILPGVGAFRIAVSSIDSMFKLS QEQSPEVRDRVGCAFAESASTRHREVADLMNRLAVPKQVTV 125. >Streptomyces_sp._PsTaAH-137 MFVPSFYREPDSSWMVDLIRGNPLALAVANGPAEDGPFATHLPVIFDPETSADVSGELPG VTLLGHMNRANPHWSALQDGGVLLLTFTGPHSYVSPTVYEKSPAAPTWNFTSVHVRGVVE KISSIEETLEVVQATVRAFEGAFGDGWDMTGSLDYFRKIVPAVGAFRFTVTGAEGMFKLS QEQPGEVRERVRESFGQSACTYKRETAGLMNRLAQTEDVTVSSGA 126. >Salinispora_arenicola_CNS296 MLVPHMYEAPSAAQVDAVITGHPMAVLVTNGPDVPHATHLPVIRTVDTEQTGPGSVLLGH MNRTNPHWSALTSGTPGKLIFTGPNTYVCPVLYQTEPAAPTWDFVVVHVSGRVMPLDAGE PTLAVVQRTAATLEGAFGAGWDHTGSIDYFRSIVGGVGAFEFVVEQVESMFKLSQEKDHT VRQRLIDDFTSAPRNGSAQVGQLMSDLNLGVAP 127. >Salinispora_arenicola_CNS299 MLVPHMYEAPSAAQVDAVITGHPMAVLVTNGPDVPHATHLPVIRTVDTEQTGPGSVLLGH MNRTNPHWSALTSGTPGKLIFTGPNTYVCPVLYQTEPAAPTWDFVVVHVSGRVMPLDAGE PTLAVVQRTAATLEGAFGAGWDHTGSIDYFRSIVGGVGAFEFVVEQVESMFKLSQEKDHT VRQRLIDDFTSAPRNGSAQVGQLMSDLNLGVAP 128. >Salinispora_pacifica_CNY363 MLVPHMYEAPSAAQVDAVITGHPMAVLVTNGPDVPHATHLPVIRTVDTEQTGPGSVLLGH MNRTNPHWSALTSGTPGKLIFTGPNTYVCPVLYQTEPAAPTWDFVVVHVSGRVMPLDAGE PTLAVVQRTAATLEGAFGAGWDHTGSIDYFRSIVGGVGAFEFVVEQVESMFKLSQEKDHT VRQRLIDDFTSAPRNGSTQVGQLMSDLNLGVAP 129. >Actinomadura_atramentaria_DSM_43919 VFVPPQYRPRGRSWTLETVRSNPLAMLVTRGERALPWITHLPVITHPERPPAELPGATLL GHMNAANPHWAAVASGGPGTLVFTGPHGYVSPTVYELPVAAPTWDFVAVHVHGTLRPLDT PEDARRVVRWTVEAYEGTHGTGWDPEGSLDYFDKILPGVRAFEFHVESVDGMYKLSQEQE PETRRRVVRSFAASGRGAHAELSALIDRFGDPGPGAPATGCPAAREAGDGAR 130. >Streptomyces_drozdowiczii_SCSIO_10141 MFVPPMYRTENEGRLRQVMERYPLAMLVTNGEPTPYATHLPVIFDQNGAPGTDGPVGATL LGHLNRNNPHWRTLTDGLAAKLVFTGPHSYITPTLYETTPAAPTWNFVTVHLEGTLHPVT DLEETLGVLQATVETFESAFGNKWEMDSSLDYFRHIGPAVGAFRFVVTSADGMFKLSQEK TPEIQHRIADRLIGTETGTRHELGALMAELTLGDRDGV 131. >Streptomyces_sp._RSD-27 MVDLVRGHPMALAVANGSPEDGPFATHLPVIFDPVTSGQWTGELPGATLLGHMNRANPHW AALETGGVLLLTFTGPHSYVSPTVYAKSPAAPTWNFTSVHVRGVVEKIDSIEETLEVVQS TVRAFEGAFGDGWDMTGSLDYFRKIVPDVGAFRLTVTGAEGMFKLSQEQPGEVRERVRES FGQSACTYRRETAGLMG RLP 132. >Streptomyces_sp._YR375 MVDLLRNNPLALMVSNGDAAAAPFATHLPVIPDPAMTDEWSADLSGATLLGHMNRGNPHW KALETGDVVLLTFTGPHAYVSPTVYEVTPAAPTWNFTSVHVRGVVEKIDSAEETLEVVQS TVRAFEADFGDDWDMTESLGYFRRIVPAVGAFRLTVSGAEGMFKLSQEQKPEVRERVQKA FSGRECGRHRETASFMSRLP 133. >Actinoalloteichus_spitiensis_RMV-1378 MFVPDQYRAADNRPLVELIRSFPLATLVSHAEGTLFATHVPVLLAADADAGRDVPEPADL TILGHLDRRNPHRAALAAGGPCLLTFTGPHSYVSPAHYGRETAAPTWNFTAVHVHGRLTP LDGAEDTRHVVRSTALLYERRFGAGWDTTGSLDYFEQLLPGVSAFRVDVSTVEGMFKLGQ EQPGYARQGVVAAFTSPGAPPHQRAVAELMRRFAPDSPDDGGPGCPVRAPAKPEPATRGE R 134. >Streptomyces_sp._Ncost-T6T-1 MVDLMRSNPLALMVSNGSPEASPFATHLPVIFDPGDAADLAEDLARLPLLGHMNRANPHW SALQDDAVVLLSFTGPHAYVSPTVYDVTPAAPTWNFTSVHVHGVVEKFDSTEETLEVVQA TVRAFEEKFGNNWDMTDSIDYFRKIVHDVGAFRIRVTKAEGMFKLSQEQEPEIRDRVVQS FTGRGCTRHAQTATLMSRLP 135. >Streptomyces_sp._PBH53 VYERPLYREDRDGVVLAFLHHHPLALVVTAHEGVPVATHAPVLFRHGPDGADAEAVAAGT VPLAGSTLIGHMNVENPQWRRMRSGDRALIVFQGPHGYVSPTVYDVTPAAPTWNFTAVHV TGTVEPTAEPADVLDIVSDTARRLEGRFGRGWDQESSLDYFRQIAPGVGAFTLRVESVQT MFKLSQEKPTPMRRRVAEQFEASESGTHRALAGMMRAHGLTDADEERETAG 136. >Salinispora_arenicola_CNS-991_DSM_45545 MLVPHMYEAPSAAQVDAVITGHPMAVLVTNGPDVPHATHLPVIRTVDTEQTGPGSVLLGH MNRTNPHWSALTSGTPGKLIFTGPNTYVCPVLYQTEPAAPTWDFVVVHVSGRVMPLDAGE PTLAVVQRTAATLEGAFGAGWDHTGSIDYFRSIVGGVGAFEFVVEQVESMFKLSQEKDHT VRQRLIDDFTSAPRNGSAQVGQLMSDLNLGVAP 137. >Streptomyces_sp._MNU77 MFVPRIYQVDGEHWPSEIIDRHPLALLTTNGDDVPHATHVPVIRPPHDEQLVGSELLVHM NRANPHWAALSDHDAAKLVFQGPDGYVTPSVYHVEPAVPTWDFVTVHLTGTLRISEDVDE VLSIVTATARTLERRFGAGFDVDRAADHHARIASGVGAIRFRVTKAEAMFKFSQEKDAEI RDRVMQWFEDSDIGEYADLGRLMRQFLDRPDITAPAAAG 138. >Micromonospora_halophytica_DSM_43171 MFVPRSFAVEDAGPVVELMRSNPLACFVLGGESPSVSHLPVVFADDDERDDLAGITLLTH MNRQNPLWGSLSDGARVLVVFQGPHGYVSPTVYGVSPAAPTWNFTVVHAHGVVRLLGAGE PALRVVKRTVQVLEGRFGAGWDMTGSLGYFERIVHAVGALEIHVDAVQSMFKLSQDQPVE LQSKVAAAFAGSGRGTHRELAEQMYTHLRLKADVDGF 139. >Streptacidiphilus_carbonis_NBRC_100919 MFVPPPYRPPDGSWTAELIRSNPLAILASNGSTADGPFATHLPVIPDPGT PDLLSAELTGAVLLGHMNRANPHWAALAEGGTSLLTFTGPHAYVSPTVYG VTPAAPTWNFTSVHARGTIERIESSEETLEVVKATVRAFEERFGAEWDMS ESISYFRQILPGVGGFRFTVTGTDGMFKLSQEQAPEIRCRVQRSFTGREC SRH RETAALMGSLP 140. >Streptomyces_sp._MnatMP-M27 MFVPQHYRTDDRRWPVRIVQDNPLALLMSTRDGRAPFASHVPVIVLPRQR EELERTGRWQGAVLHGHMNRANPHWKSLADGQPAGLVFQGPAGYVSPAVY NTSPAVPTWNFTAVHVQGRLKLVADEEATLGVVSATARQLEERFGARWTV EPSVDHFRQILPGVGAFELRVEECDSMFKLSQEKEHEVRHAVMDWCARSP RGRSNDLAAVMRDYYPPTTAWPS 141. >Pseudonocardia_sp._EC080625-04 MFVPEQYREQDSNWMLDIVRSNPLALMASDGTPEGCGPAATHLPCIPDPS APHDWSDGPRGAVLLGHMNRANPQWRHLHDGQIVLLVFTGPHAYVSPAVY DTTPAAPTWDFTAVHVHGVVTKLEPHKAERTTLDVVTDTVTALEGRFGAG WDMTDSIEYFHRLLPGVGAFRVRVGSAEGMFKLSQEQPSDIRDRVRCHFA AAQHGRSSEIAHLMTTLDGH 142. >Pseudonocardia_sp._HH130629-09 MFVPEQYREQDSNWMLDIVRSNPLALMASDGTPEGCGPAATHLPCIPDPS APHDWSDGPRGAVLLGHMNRANPQWRHLHDGQIVLLVFTGPHAYVSPAVY DTTPAAPTWDFTAVHVHGVVTKLEPHKAERTTLDVVTDTVTALEGRFGAG WDMTDSIEYFHRLLPGVGAFRVRVGSAEGMFKLSQEQPSDIRDRVRCHFA AAQHGRSSEIAHLMTTLDGH 143. >Streptomyces_paryulus_2297 MFVPSFYREPSNSWMVDLIRGNPLALAVANGQPDEGPFATHLPVIFDPDH PLDRDDDLTGATLLGHMNRANPHWGSLETGGVLLLTFTGPHSYVSPTVYE VTPAAPTWNFTAVHVRGVVEKLDSTDETLAVVQSTVRAFEGEFGNGWDMT DSLGYFRKIAPGVGAFRFTVTGAEGMFKLSQEQPGEVRDRVRESFGQSGC VHKRGTAGLMSRLP 144. >Streptomyces_sp._OK885 MFVPDPYREPNTTWMVDLIRRNPLALLTTNGPAECGPFATHLPVIQDPGM TAEWSADLSGSLLLGHMNAQNPHWSALRDGDSVLLAFTGPHAYVSPTVYQ KIPAAPTWNFTSVHVHGVIEKIESEEETLTVVRSTVRAFEEEFGTDWNME GSVDYFRKILPGVGAFRITVSRADGMFKLSQEQEPQIRDRVRQSFAQRKC SLHRETADLMGRLP 145. >Streptomyces_sp._CFMR7 MYVPSIYQAEDRAWLRHVVERYPLATVITNGPQAPYATHVPVIPAPDTTS WNDGPEGATLLGHMNRANSHWGSLTDGTHAQLVFTGPNGYVSPTVYETSP AAPTWNFVSVHLRGRLRPISDFEETLEVVRLTVEAYEKNFGDGWEMDSSL EYFRNIGPAVGGFRFDVESADGMFKLSQEKHPETRRRIADRFGGRRSGRA TELAFFMRQFTSADHHAS 146. >Streptomyces_sp._DvalAA-19 MYVPSIYQAEDRAWLRHVVERYPLATVITNGPQAPYATHVPVIPAPDTTS WNDGPEGATLLGHMNRANSHWGSLTDGTHAQLVFTGPNGYVSPTIYETSP AAPTWNFVSVHLRGRLRPISDFEETLEVVRLTVEAYEKNFGDGWEMDSSL EYFRNIGPAVGGFRFDVESADGMFKLSQEKHPETRRRIADRFGGRRSGRA TELAFFMRQFTSADRHAS 147. >Rhodococcus_fascians_A3b

MYVPRIYKASDRTWLRRVVAQYPFAALISNGPKAPYATHLPVICAPCAPS ESEDLEGSTLFGHMNRANPHWDSLVDGADAQLIFTGPHGYVTPSVYQRDS VAPTWNYVSVHLRGKLQPVADFEETLKVVQLTVSTYEQKFGSGWEMDSSL DHYRRIGPAVGAFSFEVESADGMFKLSQEQNLETRRRVADHFSANHAGRG KELASFMREYSHGDYNNF 148. >Rhodococcus_fascians_A73a MYVPRIYKASDRTWLRRVVAQYPFAALISNGPKAPYATHLPVICAPCAPS ESEDLEGSTLFGHMNRANPHWDSLVDGADAQLIFTGPHGYVTPSVYQRDS VAPTWNYVSVHLRGKLQPVADFEETLKVVQLTVSTYEQKFGSGWEMDSSL DHYRRIGPAVGAFSFEVESADGMFKLSQEQNLETRRRVADHFSANHAGRG KELASFMREYSHGDYNNF 149. >Rhodococcus_fascians_A76 MYVPRIYKASDRTWLRRVVAQYPFAALISNGPKAPYATHLPVICAPCAPS ESEDLEGSTLFGHMNRANPHWDSLVDGADAQLIFTGPHGYVTPSVYQRDS VAPTWNYVSVHLRGKLQPVADFEETLKVVQLTVSTYEQKFGSGWEMDSSL DHYRRIGPAVGAFSFEVESADGMFKLSQEQNLETRRRVADHFSANHAGRG KELASFMREYSHGDYNNF 150. >Rhodococcus_fascians_A78 MYVPRIYKASDRTWLRRVVAQYPFAALISNGPKAPYATHLPVICAPCAPS ESEDLEGSTLFGHMNRANPHWDSLVDGADAQLIFTGPHGYVTPSVYQRDS VAPTWNYVSVHLRGKLQPVADFEETLKVVQLTVSTYEQKFGSGWEMDSSL DHYRRIGPAVGAFSFEVESADGMFKLSQEQNLETRRRVADHFSANHAGRG KELASFMREYSHGDYNNF 151. >Rhodococcus_fascians_D188 MYVPRIYKASDRTWLRRVVAQYPFAALISNGPKAPYATHLPVICAPCAPS ESEDLEGSTLFGHMNRANPHWDSLVDGADAQLIFTGPHGYVTPSVYQRDS VAPTWNYVSVHLRGKLQPVADFEETLKVVQLTVSTYEQKFGSGWEMDSSL DHYRRIGPAVGAFSFEVESADGMFKLSQEQNLETRRRVADHFSANHAGRG KELASFMREYSHGDYNNF 152. >Rhodococcus_fascians_02-816c MYVPRIYKASDRTWLRRVVAQYPFAALISNGPKAPYATHLPVICAPCAPS ESEDLEGSTLFGHMNRANPHWDSLVDGADAQLIFTGPHGYVTPSVYQRDS VAPTWNYVSVHLRGKLQPVADFEETLKVVQLTVSTYEQKFGSGWEMDSSL DHYRRIGPAVGAFSFEVESADGMFKLSQEQNLETRRRVADHFSANHAGRG KELASFMREYSHGDYNNF 153. >Rhodococcus_fascians_05-339-1 MYVPRIYKASDRTWLRRVVAQYPFAALISNGPKAPYATHLPVICAPCAPS ESEDLEGSTLFGHMNRANPHWDSLVDGADAQLIFTGPHGYVTPSVYQRDS VAPTWNYVSVHLRGKLQPVADFEETLKVVQLIVSTYEQKFGSGWEMDSSL DHYRRIGPAVGAFSFEVESADGMFKLSQEQNLETRRRVADHFSANHAGRG KELASFMREYSHGDYNNF 154. >Rhodococcus_fascians_LMG_3605 MYVPRIYKASDRTWLRRVVAQYPFAALISNGPKAPYATHLPVICAPCAPS ESEDLEGSTLFGHMNRANPHWDSLVDGADAQLIFTGPHGYVTPSVYQRDS VAPTWNYVSVHLRGKLQPVADFEETLKVVQLTVSTYEQKFGSGWEMDSSL DHYRRIGPAVGAFSFEVESADGMFKLSQEQNLETRRRVADHFSANHAGRG KELASFMREYSHGDYNNF 155. >Rhodococcus_fascians_LMG_3616 MYVPRIYKASDRTWLRRVVAQYPFAALISNGPKAPYATHLPVICAPCAPS ESEDLEGSTLFGHMNRANPHWDSLVDGADAQLIFTGPHGYVTPSVYQRDS VAPTWNYVSVHLRGKLQPVADFEETLKVVQLTVSTYEQKFGSGWEMDSSL DHYRRIGPAVGAFSFEVESADGMFKLSQEQNLETRRRVADHFSANHAGRG KELASFMREYSHGDYNNF 156. >Rhodococcus_fascians_LMG_3623 MYVPRIYKASDRTWLRRVVAQYPFAALISNGPKAPYATHLPVICAPCAPS ESEDLEGSTLFGHMNRANPHWDSLVDGADAQLIFTGPHGYVTPSVYQRDS VAPTWNYVSVHLRGKLQPVADFEETLKVVQLTVSTYEQKFGSGWEMDSSL DHYRRIGPAVGAFSFEVESADGMFKLSQEQNLETRRRVADHFSANHAGRG KELASFMREYSHGDYNNF 157. >Rhodococcus_fascians_A22b MYVPRIYKASDRTWLRRVVAQYPFAALISNGPKAPYATHLPVICAPCAPS ESEDLEGSTLFGHMNRANPHWDSLVDGADAQLIFTGPHGYVTPSVYQRDS VAPTWNYVSVHLRGKLQPVADFEETLKVVQLTVSTYEQKFGSGWEMDSSL DHYRRIGPAVGAFSFEVESADGMFKLSQEQNLETRRRVADHFSANHAGRG KELASFMREYSHGDYNNF 158. >Streptomyces_sp._CNT360 MYVPQHFAVDETEPVVELIRANPLAVFVTTQGGVPVASHIPVVFASEDEA EQADDLVGVTLFGHLNVQNPQYGVLADGDRVLVVFQGSHGYISPTVYDTV PAAPTWNFSAVHVTGTVRLLGPGEPALKVVRRIVTALERRFGAGWDMTES LPYFERIVPGVGAFEIAVEAVDSIFKLSQDQPAELRDKAECAFRNSDAGV HRELAAQMRRHNGAACSHQERTARDGD 159. >Salinispora_arenicola_CN5848 MLVPHMYEAPSAAQVDAVITGHPMAVLVTNGPDVPHATHLPVIRTVDTEQ TGPGSVLLGHMNRTNPHWSALTSGTPGKLIFTGPNTYVCPVLYQTEPAAP TWDFVVVHVSGRVMPLDAGEPTLAVVQRTAATLEGAFGAGWDHTGSIDYF RSIVGGVGAFEFVVEQVESMFKLSQEKDHTVRQRLIDDFTSAPRNGSAQV GQLMSDLNLGVAP 160. >Salinispora_arenicola_CNY231 MLVPHMYEAPSAAQVDAVITGHPMAVLVTNGPDVPHATHLPVIRTVDTEQ TGPGSVLLGHMNRTNPHWSALTSGTPGKLIFTGPNTYVCPVLYQTEPAAP TWDFVVVHVSGRVMPLDAGEPTLAVVQRTAATLEGAFGAGWDHTGSIDYF RSIVGGVGAFEFVVEQVESMFKLSQEKDHTVRQRLIDDFTSAPRNGSAQV GQLMSDLNLGVAP 161. >Salinispora_arenicola_CNY280 MLVPHMYEAPSAAQVDAVITGHPMAVLVTNGPDVPHATHLPVIRTVDTEQ TGPGSVLLGHMNRTNPHWSALTSGTPGKLIFTGPNTYVCPVLYQTEPAAP TWDFVVVHVSGRVMPLDAGEPTLAVVQRTAATLEGAFGAGWDHTGSIDYF RSIVGGVGAFEFVVEQVESMFKLSQEKDHTVRQRLIDDFTSAPRNGSAQV GQLMSDLNLGVAP 162. >Salinispora_arenicola_CNT005 MLVPHMYEAPSAAQVDAVITGHPMAVLVTNGPDVPHATHLPVIRTVDTEQ TGPGSVLLGHMNRTNPHWSALTSGTPGKLIFTGPNTYVCPVLYQTEPAAP TWDFVVVHVSGRVMPLDAGEPTLAVVQRTAATLEGAFGAGWDHTGSIDYF RSIVGGVGAFEFVVEQVESMFKLSQEKDHTVRQRLIDDFTSAPRNGSAQV GQLMSDLNLGVAP 163. >Salinispora_arenicola_CNY230 MLVPHMYEAPSAAQVDAVITGHPMAVLVTNGPDVPHATHLPVIRTVDTEQ TGPGSVLLGHMNRTNPHWSALTSGTPGKLIFTGPNTYVCPVLYQTEPAAP TWDFVVVHVSGRVMPLDAGEPTLAVVQRTAATLEGAFGAGWDHTGSIDYF RSIVGGVGAFEFVVEQVESMFKLSQEKDHTVRQRLIDDFTSAPRNGSTQV GQLMSDLNLGVAP 164. >Salinispora_arenicola_CNY486 MLVPHMYEAPSAAQVDAVITGHPMAVLVTNGPDVPHATHLPVIRTVDTEQ TGPGSVLLGHMNRTNPHWSALTSGTPGKLIFTGPNTYVCPVLYQTEPAAP TWDFVVVHVSGRVMPLDAGEPTLAVVQRTAATLEGAFGAGWDHTGSIDYF RSIVGGVGAFEFVVEQVESMFKLSQEKDHTVRQRLIDDFTSAPRNGSTQV GQLMSDLNLGVAP 165. >Salinispora_pacifica_CNY331 MLVPHMYEAPSAAQVDAVITGHPMAVLVTNGPDVPHATHLPVIRTVDTEQ TGPGSVLLGHMNRTNPHWSALTSGTPGKLIFTGPNTYVCPVLYQTEPAAP TWDFVVVHVSGRVMPLDAGEPTLAVVQRTAATLEGAFGAGWDHTGSIDYF RSIVGGVGAFEFVVEQVESMFKLSQEKDHTVRQRLIDDFTSAPRNGSTQV GQLMSDLNLGVAP 166. >Streptomyces_aureofaciens_NRRL_2209 VFTPKLYQVDGDDWPLRIIERHPLAVLVSNGDPVPNATHVPVIAPPDAAP EDALSGMRLWAHLTRANPHWQQLAAAGGGPAKLVFHGPNGYVTPSLYSAD MVAPTWNYVAVHLEGTVELAGDDETLAIVHTTAQTLEDRFGDGMALAPSL EYHRQIVGAVGGLFFTVTKVDVMFKLSQEKDPEVQQRVLDRFAASGSGLH REVADTMRALRLGGSAG PzbAB 167. >Streptomyces_sp._CFMR_7 VRNAHATHPDDDPVGTTTERPYDLLGIGFGPSNLALAVCAREQKLPLSCL FVERQDTVAWHPGMLIDGARMQISFLKDLVSLRNPSSPYSFLQYTKAKGR LERFVNLNESRPTRIEYDDYLKWVAQDFADQVRFGSQVDRVTPVQGPDGG DLSLFRVETQDVATGRHSVHYARNVVHAGGGRPPARTAGVAEVSSVVHSS EFLTRFPDQFKDHDGAYRFVVVGGGQSAGEISEYLLDHYDRAEVHVVVSG YTLLPTDNSPFVNEQFYSGNADAFYRMRPEQRAAVSGRLRAANYGVVRED LLERLFNTDYLDQVKGRKRLHIHPFSRLSEVRENGDALAVTLRQHLDEGP EEPLRCDGVVLATGYDRSLDPAVFGDVLPHLTAGEGEGVGGVALSRHYRA RTSPELRAGLYLQGFGEAQFGLGDTLLSLLPFRSQEIVEDIADRVPVAGV GGCPVMSPYGSGVVSTSPHGPARSAVYPPKWYLEHDREKLYGLMERFRFA TLISARSGDQPFATHLPLILDRSRGANGVLFGHLDRGNEHADLIDGRHML AVFHGPNAYMPPGVFESDPLPTWNSMSVHVRGRVRVVRDRDALVHGLIGI AERSQPDNRLAADDPRIDRIIGSIVGFEFEVEELVGRFKLSQDRDETDRR HAAVALARATERGERDFIEYVVGLSLITEDDPRDLAGRPLSPLAIGGVHE 168. >Micromonospora_tulbaghiae_DSM_45142 MRNDPAPDARSSEPGSEQNPYDLIGVGFGPSNLALAIAAEELDGERTCLF FERSPSLQWHPGMLLEGSRMQISFLKDLVSLRNPASPYTFLQYAKAKDRL ERFVNLSEFRPTRLEYQDYLRWVAEFFAGQVRYHTEVTRVSPVRRPGEDV HRLFRVEARDIRTGETTVHHAANVVHAAGGRPRLPPGGVCASPAVIHSSD FLPHFPERFADRSRPYEFAVAGDGQSAGEVALYLMRTYPESRVHLFLSGQ ALRATDNSPFVNEQFFESSANAFSARPRDERTALRAELRNTNYGVVEAGT LDDLYRTVYDDEVRGRHRLIVHPATRVVAVREGDEGPLVAILDRRSGAEG EIRCDGVVLATGYVRALDESIFSELTPFLRTESDKLLLSGYRVRTTAEVA GGFYVQGYGEQHFGLGDTLLSLLPFRSRQIFTDICRRTPPPRQAVAVSDA SAYPPPHYLEHDPEKLYAVMERFNFATVISARAAEDPVVTHVPLTLDRSR GAHGVLFGHLDRANPHAQLIDGKQVTVVFHGPNTYLSPYALETDALPTWN SMNVHVGGRGRLLADRAALVTGLSGICEKSDPGVDSYRLDPDDPRIDRLV DYVVGFEIEIQALVGRFKLSQELDDRNRRLAASALMATARRDESEVIGKV FGMSPVNGRQNGSSALWSAHSR 169. >Amycolatopsis_alba_DSM_44262 MRNDAPPNPLTAELGAEGNPYDLIGVGFGPSNLALAIAAEELDSERNCLF FERSSRLRWHPGMLIDGSRMQISFLKDLVSLRNLASPYTFLQYTKAKGRL EQFVNLNDFRPTRLEYQDYLEWVAESFSGQVRYNSEVTRVTPVRRTGEDA HRLFRVEARDVVTGQTTVRYAANVVHAAGGRPRLPDGGVCDSPAVVHSSD FLPRFPGHFADRSRPYEFGVAGDGQSAGEIAAYLLSRYPASRVHLLLSGS ALRAADSNPFVNEQFFEGRANHFHARTKPDRTGLLAELRNTNYAVVEPGF LDDLYRLVYDDEVRGTRRLIVHPGTKVTAVGADGASLRVAVTDRRGGDEE MRCDGVVLATGYVRALDESMFADLLPFLREESGDLVLSPDYRVGTTAELE GGFYVQGYGESSFGLGDTLLSLLPFRAKQIFTDICKQTPPPVRTRRPVEV SKASAYPPPHYVETDPKKIYAVMERFSFATLISARGAEDPVVTHLPLTLD RARGAHGVLFGHLDRANPHVQLIDGHQLTVLFHGPNAYLSPQVFETSVLP TWNSMNVHVRGRGRLLPDRAALLAGLSGICVKSDPGDDSYRLDLDDPRID RMIEHIVGFEIEIHELVGRFKLSQELDDQNRMLAASALSATARRGELELI EEVVGLNVVQG 170. >Mycobacterium_sp._IS-1556 MTSMPPGEGHDSDLDFIGIGFGPSNLALAVAADEIVPDRKGLFFERSGTF QWHPGMLLDGTKMQISFLKDLATLRNPASRYTFLQYAKARGRLEQFVNLH EFHPSRLEYNDYLRWVAEFFTDRVCYNTIVTAVVPVGHSPSSNGHLTRFR VHVRDMATGAESCFFTANVIFGGGGVPRLLGARADASAVLHSSAFLPNFT NRFNESQKPYRFAVIGNGQSAAEIVDYLLNHYPGATIHLFISDCTLRATD HSPFINEHFFSTSAADFYNHPPAQRVALRSALRSTNYGVVDADLLQKLYQ ITYLDEVKGCRRLLLHRESRLSQIEEIDDQVVASFEDRFSGDSSEFHFDG AVLATGYERVLDAEVFRHVLPHVLWDESGAISLTRSCRVNIVPAVTARLF LQGYGEAWFGIGDTLLSLLPFRAQAIAQEIGNAPSGAPIRRKQRVHGEYP PKRYLETDPDRLHDVINRYRFATLVSASGVDEPVVTQLPLTLDTSRGSLG VLFGHMDFANPHTELLDGRRVLVLFHGPNGYISPHVYESAQLPTWNSITV EVRGRARILRDKDAVVNGLRGIAAAADPTPGGFRLTREAASDQRLFPLLV GFEIDIDDMRGRFKLSQERDDRDRWHAAHALANGVEQDDRDLISSIVGLP LDVDEEPKPQQQAQIHQYGNAPADTAYRRVDG 171. >Streptomyces_sp._Root55 MSSEAGAVFPCANGRPAAEVAPGPSRGSHPADPYDLIGVGFGPSNMALAI AVEELDPGRSCLFLERNTGVRWHPGMLIEGARMQISYLKDLVSLRNLASP YTFLSYLKAKGRLEKFINVGASRPTRLEYQDYLSWVAEDFGHVVRYESEV VAVVPVAGPGSETLDLLRVRVRDAGSAEFHDLYARNVVHAGGGTPRRGAP GQICDASSVIHSSTFLDAFPARFPDHDAALDLGVVGDGQSAAEITSHVLK GYPNARVHLFVPGYALRATDNNPFANEQFYQRNAGEFYASGARRRTILRT ELRNTNYGAVEAGHLDELYDITYADEVRGAPRLVVHRASHVSRVVEDGER LSVEVRDRTDGPDRTMVCDGLVLATGYTRELHPAVFGELTPLLSRDDSGE LLVTADCRVRTDERVTAGFYVQGYAESAYGIGDTLLSLLPFRSQQIVDDI RGRLPAGRPVAVEESAPYPPSHYVETDLDRIRSLMERFNFATVISVARDA RVLVTHVPLVVERDRGGEHGMLIGHLDRSNPQVELLRDRPVTVVFHGPDA YLSPDVLKTDRLPTWNSMSVHVRGHARLFSGRDELMRVFNGLCEQAEGES GSYWLRPDDTRIEQLRGQVVGFEVDIHELTGRFKLSQELDEANRELAAAD MARGTSAERQAFIERAFDLQPRPDVLGPPGGPGVGGCPVGGARAAGGTTA VADNERETAR 172. >Streptomyces_sp._2AW MLDLLGIGFGPSNVALAAAMAEGGKPPRALFLEAKERFGWHPGMLLDGAR MQISFLKDLVTLRNPESPYSFLAYLKAKGRLEEFANLREFYPSRIEFQDY LRWVAGHFEHQAVFGARVASVSPDFGIDGMARSFTVRAELADSGEYVTYQ ARNVVYAPGGTPNRVAGVAPRDERVIHTAEFLERFPKSFPDHSADLSFAV VGGGQSAAEIIEYILAKYPLSRVHAILPGYSFRPADDSPYSNEVFFSAEV DDHFTAHDQAARLAEARSTNYGVVDLDLIEDLYRMGYEDQVRGNVPRLTF CRSSRLLSADAGPSGIEVTVGGPEGSRSLNLDGLVLATGYHRELDPEMFR DVIPHLQRNESGNFLVSRAYRADSVPELTAGIYFQGLTELSHGIGDTLLS LLSFRSAEIAEDVRKRSEVPSADEVEYPPARHIEPYRAAILETLQRFPLA TLISSDDESEVFATHLPLILDRERGEQGVLFGHLDVGNPQVPNLNGRRVL AVFHGPNSYISPRTYTTDQLPTWNYVAVHVRGHVRVLENQDQVVSGLASI SEKADRSDGAYRLDENDSRIEKLIGGIVGFELDIESLTGRFKLSQDRSDE DRKRAMAVLREGAGDEHHDFVARIHQQ 173. >Streptomyces_sp._SolWspMP-5a-2 MPKKGGAVTPRAQGLPSGEAGPAPRRGTDPADPLDLIGIGFGPSNLALAI AAEELDPAADRLFLERNAGVHWHPGMLLEGARMQISYLKDLVSLRNLASP YTFLSYLKAKGRLEKFINIGVTRPTRLEYQDYLTWVAGHFADVVRYRSEV VSVTPVSGPGSTALDLLHVRVRDTATGTPYSLYARNVVHAGGGTPRRGTP DRICDTPSVIHSSRFLPAFPRRFPDHDAALDLGVVGDGQSAAEIAAHMLT HYPDATVHLFVPGYALRATDNNPFVNEQFYRHNADAFYADEPHRRALLRT ELRNTNYGAVEAGYLDTLYDITYADEVRGAPRLLVHRGCDVTRITEDGPR LDVLVRDRTGGPDRTVRCDGVVLATGYTRALDPAVFAGLDPLLRRDESGA LLVSADCRVDAEAPLTAGFYVQGYAEGAYGIGDTLLSLLPFRSQRIIDDL RARRPEDLPSGGPYPPDHYVEKDLERVRAVMERFNFATVISADRDARVLV THVPLVVERDRGGEHGTLIGHLDRSNPQVELLRDRPVTVVFHGPNSYLSP DVLTTDKLPTWNSMSVHVRGHARLFSGRDELMRVFNGLCEQAEPGPGSYR LRPDDERIDQLLGHVVGFEVDIQEVTGRFKLSQDLDEDNRALAAADMQRD LGEERRTFVADVFDLAPRPDGPEAGPRACGCPLGGPPAGTGAALAEEAGQ

TVR 174. >Streptomyces_sp._ScaeMP-e83 VRNAHATHPDDDPVGTTTERPYDLLGIGFGPSNLALAVCAREQKLPLSCL FVERQDTVAWHPGMLIDGARMQISFLKDLVSLRDPSSPYSFLRYTKAKGR LERFVNLNESRPTRIEYDDYLKWVAQDFADQVRFGSQVDRVTPVQGPDGG DLSLFRVETEDVATGRRSVHYARNVVHAGGGRPPTRTAGVAEVPSVVHSS EFLTRFPGQFKDHDGAYRFVVVGGGQSAGEISEYLLDHYDRAEVHVVVPG YTLLPTDNSPFVNEQFYSGNADAFYRMRPEQRAAVSGRLRAANYGVVRED LLERLFNTDYLDQVKGRKRLHIHSFSRLSEVREDGEALAVTLQPRLDEGP EESLRCDGVVLATGYDRSLDPAVFGDVLPHLTPGEGEGAAGVVLSRHYRA RTSPELRAGLYLQGFGEAQFGLGDTLLSLLPFRSQEIVEDIADRVPAAGV GGCPVMSPYGSGVVSTSPHGPVPSAVYPPKWYLEHDREKLYGLMERFRFA TLISARSGDEPFATHLPLILDRSRGANGVLFGHLDRGNEHAELIDGRHML AVFHGPNAYMPPGVFESDPLPTWNSMSVHVRGRVRAVRDQDALVRGLIGI AERSQPDNRLAADDPRIDRIIGSIVGFEFEVEELVGRFKLSQDRDETDRR HAAVALARATERGERDFIEYVVGLSLITEDDPRDLAGRPLSPSP 175. >Mycobacterium_sp._GA-0227b MTSMPPGEGHDSDLDFIGIGFGPSNLALAVAADEIVPDRKGLFFERSGTF QWHPGMLLDGTKMQISFLKDLATLRNPASRYTFLQYAKARGRLEQFVNLH EFHPSRLEYNDYLRWVAEFFTDRVCYNTIVTAVVPVGHSPSSNGHLTRFR VHVRDMATGAESCFFTANVIFGGGGVPRLLGARADASAVLHSSAFLPNFT NRFNESQKPYRFAVIGNGQSAAEIVDYLLNHYPGATIHLFISDCTLRATD HSPFINEHFFSTSAADFYNHPPAQRVALRSALRSTNYGVVDADLLQKLYQ ITYLDEVKGCRRLLLHRESRLSQIEEIDDQVVASFEDRFSGDSSEFHFDG AVLATGYERVLDAEVFRHVLPHVLWDESGAISLTRSCRVNIVPAVTARLF LQGYGEAWFGIGDTLLSLLPFRAQAIAQEIGNAPSGAPIRRKQRVHGEYP PKRYLETDPDRLHDVINRYRFATLVSASGVDEPVVTQLPLTLDTSRGSLG VLFGHMDFANPHTELLDGRRVLVLFHGPNGYISPHVYESAQLPTWNSITV EVRGRARILRDKDAVVNGLRGIAAAADPTPGGFRLTREAASDQRLFPLLV GFEIDIDDMRGRFKLSQERDDRDRWHAAHALANGVEQDDRDLISSIVGLP LDVDEEPKPQQQAQIHQYGNAPADTAYRRVDG 176. >Mycobacterium_sp._GA-1999 MTSMPPGEGHDSDLDFIGIGFGPSNLALAVAADEIVPDRKGLFFERSGTF QWHPGMLLDGTKMQISFLKDLATLRNPASRYTFLQYAKARGRLEQFVNLH EFHPSRLEYNDYLRWVAEFFTDRVCYNTIVTAVVPVGHSPSSNGHLTRFR VHVRDMATGAESCFFTANVIFGGGGVPRLLGARADASAVLHSSAFLPNFT NRFNESQKPYRFAVIGNGQSAAEIVDYLLNHYPGATIHLFISDCTLRATD HSPFINEHFFSTSAADFYNHPPAQRVALRSALRSTNYGVVDADLLQKLYQ ITYLDEVKGCRRLLLHRESRLSQIEEIDDQVVASFEDRFSGDSSEFHFDG AVLATGYERVLDAEVFRHVLPHVLWDESGAISLTRSCRVNIVPAVTARLF LQGYGEAWFGIGDTLLSLLPFRAQAIAQEIGNAPSGAPIRRKQRVHGEYP PKRYLETDPDRLHDVINRYRFATLVSASGVDEPVVTQLPLTLDTSRGSLG VLFGHMDFANPHTELLDGRRVLVLFHGPNGYISPHVYESAQLPTWNSITV EVRGRARILRDKDAVVNGLRGIAAAADPTPGGFRLTREAASDQRLFPLLV GFEIDIDDMRGRFKLSQERDDRDRWHAAHALANGVEQDDRDLISSIVGLP LDVDEEPKPQQQAQIHQYGNAPADTAYRRVDG Plasmids: 177. SfaB (PzbA) expression 1 tatggctgcc gcgcggcacc aggccgctgc tgtgatgatg atgatgatgg ctgctgccca 61 tggtatatct ccttcttaaa gttaaacaaa attatttcta gaggggaatt gttatccgct 121 cacaattccc ctatagtgag tcgtattaat ttcgcgggat cgagatctcg atcctctacg 181 ccggacgcat cgtggccggc atcaccggcg ccacaggtgc ggttgctggc gcctatatcg 241 ccgacatcac cgatggggaa gatcgggctc gccacttcgg gctcatgagc gcttgtttcg 301 gcgtgggtat ggtggcaggc cccgtggccg ggggactgtt gggcgccatc tccttgcatg 361 caccattcct tgcggcggcg gtgctcaacg gcctcaacct actactgggc tgcttcctaa 421 tgcaggagtc gcataaggga gagcgtcgag atcccggaca ccatcgaatg gcgcaaaacc 481 tttcgcggta tggcatgata gcgcccggaa gagagtcaat tcagggtggt gaatgtgaaa 541 ccagtaacgt tatacgatgt cgcagagtat gccggtgtct cttatcagac cgtttcccgc 601 gtggtgaacc aggccagcca cgtttctgcg aaaacgcggg aaaaagtgga agcggcgatg 661 gcggagctga attacattcc caaccgcgtg gcacaacaac tggcgggcaa acagtcgttg 721 ctgattggcg ttgccacctc cagtctggcc ctgcacgcgc cgtcgcaaat tgtcgcggcg 781 attaaatctc gcgccgatca actgggtgcc agcgtggtgg tgtcgatggt agaacgaagc 841 ggcgtcgaag cctgtaaagc ggcggtgcac aatcttctcg cgcaacgcgt cagtgggctg 901 atcattaact atccgctgga tgaccaggat gccattgctg tggaagctgc ctgcactaat 961 gttccggcgt tatttcttga tgtctctgac cagacaccca tcaacagtat tattttctcc 1021 catgaagacg gtacgcgact gggcgtggag catctggtcg cattgggtca ccagcaaatc 1081 gcgctgttag cgggcccatt aagttctgtc tcggcgcgtc tgcgtctggc tggctggcat 1141 aaatatctca ctcgcaatca aattcagccg atagcggaac gggaaggcga ctggagtgcc 1201 atgtccggtt ttcaacaaac catgcaaatg ctgaatgagg gcatcgttcc cactgcgatg 1261 ctggttgcca acgatcagat ggcgctgggc gcaatgcgcg ccattaccga gtccgggctg 1321 cgcgttggtg cggatatctc ggtagtggga tacgacgata ccgaagacag ctcatgttat 1381 atcccgccgt taaccaccat caaacaggat tttcgcctgc tggggcaaac cagcgtggac 1441 cgcttgctgc aactctctca gggccaggcg gtgaagggca atcagctgtt gcccgtctca 1501 ctggtgaaaa gaaaaaccac cctggcgccc aatacgcaaa ccgcctctcc ccgcgcgttg 1561 gccgattcat taatgcagct ggcacgacag gtttcccgac tggaaagcgg gcagtgagcg 1621 caacgcaatt aatgtaagtt agctcactca ttaggcaccg ggatctcgac cgatgccctt 1681 gagagccttc aacccagtca gctccttccg gtgggcgcgg ggcatgacta tcgtcgccgc 1741 acttatgact gtcttcttta tcatgcaact cgtaggacag gtgccggcag cgctctgggt 1801 cattttcggc gaggaccgct ttcgctggag cgcgacgatg atcggcctgt cgcttgcggt 1861 attcggaatc ttgcacgccc tcgctcaagc cttcgtcact ggtcccgcca ccaaacgttt 1921 cggcgagaag caggccatta tcgccggcat ggcggccgac gcgctgggct acgtcttgct 1981 ggcgttcgcg acgcgaggct ggatggcctt ccccattatg attcttctcg cttccggcgg 2041 catcgggatg cccgcgttgc aggccatgct gtccaggcag gtagatgacg accatcaggg 2101 acagcttcaa ggatcgctcg cggctcttac cagcctaact tcgatcactg gaccgctgat 2161 cgtcacggcg atttatgccg cctcggcgag cacatggaac gggttggcat ggattgtagg 2221 cgccgcccta taccttgtct gcctccccgc gttgcgtcgc ggtgcatgga gccgggccac 2281 ctcgacctga atggaagccg gcggcacctc gctaacggat tcaccactcc aagaattgga 2341 gccaatcaat tcttgcggag aactgtgaat gcgcaaacca acccttggca gaacatatcc 2401 atcgcgtccg ccatctccag cagccgcacg cggcgcatct cgggcagcgt tgggtcctgg 2461 ccacgggtgc gcatgatcgt gctcctgtcg ttgaggaccc ggctaggctg gcggggttgc 2521 cttactggtt agcagaatga atcaccgata cgcgagcgaa cgtgaagcga ctgctgctgc 2581 aaaacgtctg cgacctgagc aacaacatga atggtcttcg gtttccgtgt ttcgtaaagt 2641 ctggaaacgc ggaagtcagc gccctgcacc attatgttcc ggatctgcat cgcaggatgc 2701 tgctggctac cctgtggaac acctacatct gtattaacga agcgctggca ttgaccctga 2761 gtgatttttc tctggtcccg ccgcatccat accgccagtt gtttaccctc acaacgttcc 2821 agtaaccggg catgttcatc atcagtaacc cgtatcgtga gcatcctctc tcgtttcatc 2881 ggtatcatta cccccatgaa cagaaatccc ccttacacgg aggcatcagt gaccaaacag 2941 gaaaaaaccg cccttaacat ggcccgcttt atcagaagcc agacattaac gcttctggag 3001 aaactcaacg agctggacgc ggatgaacag gcagacatct gtgaatcgct tcacgaccac 3061 gctgatgagc tttaccgcag ctgcctcgcg cgtttcggtg atgacggtga aaacctctga 3121 cacatgcagc tcccggagac ggtcacagct tgtctgtaag cggatgccgg gagcagacaa 3181 gcccgtcagg gcgcgtcagc gggtgttggc gggtgtcggg gcgcagccat gacccagtca 3241 cgtagcgata gcggagtgta tactggctta actatgcggc atcagagcag attgtactga 3301 gagtgcacca tatatgcggt gtgaaatacc gcacagatgc gtaaggagaa aataccgcat 3361 caggcgctct tccgcttcct cgctcactga ctcgctgcgc tcggtcgttc ggctgcggcg 3421 agcggtatca gctcactcaa aggcggtaat acggttatcc acagaatcag gggataacgc 3481 aggaaagaac atgtgagcaa aaggccagca aaaggccagg aaccgtaaaa aggccgcgtt 3541 gctggcgttt ttccataggc tccgcccccc tgacgagcat cacaaaaatc gacgctcaag 3601 tcagaggtgg cgaaacccga caggactata aagataccag gcgtttcccc ctggaagctc 3661 cctcgtgcgc tctcctgttc cgaccctgcc gcttaccgga tacctgtccg cctttctccc 3721 ttcgggaagc gtggcgcttt ctcatagctc acgctgtagg tatctcagtt cggtgtaggt 3781 cgttcgctcc aagctgggct gtgtgcacga accccccgtt cagcccgacc gctgcgcctt 3841 atccggtaac tatcgtcttg agtccaaccc ggtaagacac gacttatcgc cactggcagc 3901 agccactggt aacaggatta gcagagcgag gtatgtaggc ggtgctacag agttcttgaa 3961 gtggtggcct aactacggct acactagaag gacagtattt ggtatctgcg ctctgctgaa 4021 gccagttacc ttcggaaaaa gagttggtag ctcttgatcc ggcaaacaaa ccaccgctgg 4081 tagcggtggt ttttttgttt gcaagcagca gattacgcgc agaaaaaaag gatctcaaga 4141 agatcctttg atcttttcta cggggtctga cgctcagtgg aacgaaaact cacgttaagg 4201 gattttggtc atgagattat caaaaaggat cttcacctag atccttttaa attaaaaatg 4261 aagttttaaa tcaatctaaa gtatatatga gtaaacttgg tctgacagtt accaatgctt 4321 aatcagtgag gcacctatct cagcgatctg tctatttcgt tcatccatag ttgcctgact 4381 ccccgtcgtg tagataacta cgatacggga gggcttacca tctggcccca gtgctgcaat 4441 gataccgcga gacccacgct caccggctcc agatttatca gcaataaacc agccagccgg 4501 aagggccgag cgcagaagtg gtcctgcaac tttatccgcc tccatccagt ctattaattg 4561 ttgccgggaa gctagagtaa gtagttcgcc agttaatagt ttgcgcaacg ttgttgccat 4621 tgctgcaggc atcgtggtgt cacgctcgtc gtttggtatg gcttcattca gctccggttc 4681 ccaacgatca aggcgagtta catgatcccc catgttgtgc aaaaaagcgg ttagctcctt 4741 cggtcctccg atcgttgtca gaagtaagtt ggccgcagtg ttatcactca tggttatggc 4801 agcactgcat aattctctta ctgtcatgcc atccgtaaga tgcttttctg tgactggtga 4861 gtactcaacc aagtcattct gagaatagtg tatgcggcga ccgagttgct cttgcccggc 4921 gtcaacacgg gataataccg cgccacatag cagaacttta aaagtgctca tcattggaaa 4981 acgttcttcg gggcgaaaac tctcaaggat cttaccgctg ttgagatcca gttcgatgta 5041 acccactcgt gcacccaact gatcttcagc atcttttact ttcaccagcg tttctgggtg 5101 agcaaaaaca ggaaggcaaa atgccgcaaa aaagggaata agggcgacac ggaaatgttg 5161 aatactcata ctcttccttt ttcaatatta ttgaagcatt tatcagggtt attgtctcat 5221 gagcggatac atatttgaat gtatttagaa aaataaacaa ataggggttc cgcgcacatt 5281 tccccgaaaa gtgccacctg acgtctaaga aaccattatt atcatgacat taacctataa 5341 aaataggcgt atcacgaggc cctttcgtct tcaagaattc tcatgtttga cagcttatca 5401 tcgataagct ttaatgcggt agtttatcac agttaaattg ctaacgcagt caggcaccgt 5461 gtatgaaatc taacaatgcg ctcatcgtca tcctcggcac cgtcaccctg gatgctgtag 5521 gcataggctt ggttatgccg gtactgccgg gcctcttgcg ggatatccgg atatagttcc 5581 tcctttcagc aaaaaacccc tcaagacccg tttagaggcc ccaaggggtt atgctagtta 5641 ttgctcagcg gtggcagcag ccaactcagc ttcctttcgg gctttgttag cagccggatc 5701 ctcagcccct gttccccgct gctgccttgc ttccggtgga gcggtccggg tcgcaccggc 5761 cgccggtgat cgaccgggcg atctcgcccg cgcggaccgc caccatggac agcagggtgg 5821 aggcgatgcc gtgggtcgcc tcggtggcgc cctggacgta gatgccgcac cggaaatccc 5881 cggtggtgcc gagccggtag tcgcggccga tcagcaactc ccccgcctcg tcccggcgga 5941 gggcgccgga gacgccgccg agcagttcgg ccgggtcggt ggagtcgtac ccggtggcgt

6001 acacgaccag gtcggcgtcc aggtcggtgt gttcgcccgt gggcaggaac tccacgcgta 6061 cggcggcgga ttcctggcgc ggttcgacgg acaccaggcg ggaggcgttc atcacccgca 6121 gccgcggggc gccggacacc ttctgctcgt actggcggcg gtagaggccc tggaggacgt 6181 cctcgtcgac gacggcgtag ttggtgccgc cgtggtagcg catgatggcc tgcttgacct 6241 cgggcggggc gaagtagaag tcgtccacgg cggccgggtc gaagacgcgg ttggcgaacg 6301 ggctggagtc ggcgacgctg tagccgtagc gggcgaacac cgcgcacacc tcggcctgcg 6361 ggtagcggtc catgaggtgc gcggcgacct cggccgcgct ctggccggcg ccgaccacga 6421 cggcccggcg gggcgggcgt tcgtcgaacg cgggcagccg gtgcagcaac tgggagctgt 6481 gccagacgcg ttcgccggtc tccgcgccct cgggcagccg ggggcgcagg ccggaggcga 6541 ggacgaggtt tctggtccgg gcgaccaccc ggtccccggc gagcacgtcg agcgcgacga 6601 cctcaccggc ttcggtcacc ggccgcacac cggtggcctc cacgccgtac tcgaccaggt 6661 ggttcagccg gtcggcggcc cactggaggt agtcgtggta ctcgatccgg gagggcagca 6721 gggtgtgctg gttgatgaag tcgaccagcc ggtccttctc ctggagatag gacaggaatc 6781 cgaaatcact ggtgggattg cgcatcgtgg cgatgtcctt gagaaaggac acctggagcg 6841 aggagccccc caggagcatc ccccgatgcc agccgaattc cttctgcttc tccaggaaaa 6901 gggccttccc ggcggcttcg gattcatgga gcgccaccgc cagggcgaga ttcgcggcac 6961 cgaatccgat tccggtgacg tccagtactt ctgattccgg gctctgctgc gcagtggatg 7021 attgctctgc gagccgggtc a 178. SfaB (PzbA) in vivo expression 1 gtaggagggc gtggatatgt cctgcgggta aactatagtc gttgagagga ggagtctgac 61 tcctgttgat agatccagta atgacctcag aactccatct ggatttgttc agaacgctcg 121 gttgccgccg ggcgtttttt attggtgaga ataggtcttg acggctggcg agaggtgcgg 181 ggaggatctg accgacgcgg tccacacgtg gcaccgcgat gctgttgtgg gcacaatcgt 241 gccggttggt aggatccggt taattaagca gtaccagatc tgactgagtg accaaaggag 301 gcggacatat gacccggctc gcagagcaat catccactgc gcagcagagc ccggaatcag 361 aagtactgga cgtcaccgga atcggattcg gtgccgcgaa tctcgccctg gcggtggcgc 421 tccatgaatc cgaagccgcc gggaaggccc ttttcctgga gaagcagaag gaattcggct 481 ggcatcgggg gatgctcctg gggggctcct cgctccaggt gtcctttctc aaggacatcg 541 ccacgatgcg caatcccacc agtgatttcg gattcctgtc ctatctccag gagaaggacc 601 ggctggtcga cttcatcaac cagcacaccc tgctgccctc ccggatcgag taccacgact 661 acctccagtg ggccgccgac cggctgaacc acctggtcga gtacggcgtg gaggccaccg 721 gtgtgcggcc ggtgaccgaa gccggtgagg tcgtcgcgct cgacgtgctc gccggggacc 781 gggtggtcgc ccggaccaga aacctcgtcc tcgcctccgg cctgcgcccc cggctgcccg 841 agggcgcgga gaccggcgaa cgcgtctggc acagctccca gttgctgcac cggctgcccg 901 cgttcgacga acgcccgccc cgccgggccg tcgtggtcgg cgccggccag agcgcggccg 961 aggtcgccgc gcacctcatg gaccgctacc cgcaggccga ggtgtgcgcg gtgttcgccc 1021 gctacggcta cagcgtcgcc gactccagcc cgttcgccaa ccgcgtcttc gacccggccg 1081 ccgtggacga cttctacttc gccccgcccg aggtcaagca ggccatcatg cgctaccacg 1141 gcggcaccaa ctacgccgtc gtcgacgagg acgtcctcca gggcctctac cgccgccagt 1201 acgagcagaa ggtgtccggc gccccgcggc tgcgggtgat gaacgcctcc cgcctggtgt 1261 ccgtcgaacc gcgccaggaa tccgccgccg tacgcgtgga gttcctgccc acgggcgaac 1321 acaccgacct ggacgccgac ctggtcgtgt acgccaccgg gtacgactcc accgacccgg 1381 ccgaactgct cggcggcgtc tccggcgccc tccgccggga cgaggcgggg gagttgctga 1441 tcggccgcga ctaccggctc ggcaccaccg gggatttccg gtgcggcatc tacgtccagg 1501 gcgccaccga ggcgacccac ggcatcgcct ccaccctgct gtccatggtg gcggtccgcg 1561 cgggcgagat cgcccggtcg atcaccggcg gccggtgcga cccggaccgc tccaccggaa 1621 gcaaggcagc agcggggaac aggggctgag gatccccggg taccttcgaa aaaaaaaggc 1681 tccaaaagga gcctttaatt gttcctccag accttacttg accggcgctc actgcccgct 1741 ttccagtcgg gaaacctgtc gtgccagctg cattaatgaa tcggccaacg cgcggggaga 1801 ggcggtttgc gtattgggcg ctcttccgct tcctcgctca ctgactcgct gcgctcggtc 1861 gttcggctgc ggcgagcggt atcagctcac tcaaaggcgg taatacggtt atccacagaa 1921 tcaggggata acgcaggaaa gaacatgtga gcaaaaggcc agcaaaaggc caggaaccgt 1981 aaaaaggccg cgttgctggc gtttttccat aggctccgcc cccctgacga gcatcacaaa 2041 aatcgacgct caagtcagag gtggcgaaac ccgacaggac tataaagata ccaggcgttt 2101 ccccctggaa gctccctcgt gcgctctcct gttccgaccc tgccgcttac cggatacctg 2161 tccgcctttc tcccttcggg aagcgtggcg ctttctcata gctcacgctg taggtatctc 2221 agttcggtgt aggtcgttcg ctccaagctg ggctgtgtgc acgaaccccc cgttcagccc 2281 gaccgctgcg ccttatccgg taactatcgt cttgagtcca acccggtaag acacgactta 2341 tcgccactgg cagcagccac tggtaacagg attagcagag cgaggtatgt aggcggtgct 2401 acagagttct tgaagtggtg gcctaactac ggctacacta gaagaacagt atttggtatc 2461 tgcgctctgc tgaagccagt taccttcgga aaaagagttg gtagctcttg atccggcaaa 2521 caaaccaccg ctggtagcgg tggttttttt gtttgcaagc agcagattac gcgcagaaaa 2581 aaaggatctc aagaagatcc tttgatcttt tctacggggt ctgacgctca gtggaacgaa 2641 aactcacgtt aagggatttt ggtcatgaga ttatcaaaaa ggatcttcac ctagatcctt 2701 ttggttcatg tgcagctcca ctgctttaga ctctacatct gtatgaagtc ttcagatcct 2761 ctacgccgga cgcatcgtgg ccggatctaa aaaaaagccc gctcattagg cgggctgaca 2821 gttaccaatg cttaatcagt gaggcaccta tctcagcgat ctgtctattt cgttcatcca 2881 tagttgcctg actccccgtc gtgtagataa ctacgatacg ggagggctta ccatctggcc 2941 ccagtgctgc aatgataccg cgagacccac gctcaccggc tccagattta tcagcaataa 3001 accagccagc cggaagggcc gagcgcagaa gtggtcctgc aactttatcc gcctccatcc 3061 agtctattaa ttgttgccgg gaagctagag taagtagttc gccagttaat agtttgcgca 3121 acgttgttgc cattgctaca ggcatcgtgg tgtcacgctc gtcgtttggt atggcttcat 3181 tcagctccgg ttcccaacga tcaaggcgag ttacatgatc ccccatgttg tgcaaaaaag 3241 cggttagctc cttcggtcct ccgatcgttg tcagaagtaa gttggccgca gtgttatcac 3301 tcatggttat ggcagcactg cataattctc ttactgtcat gccatccgta agatgctttt 3361 ctgtgactgg tgagtactca accaagtcat tctgagaata gtgtatgcgg cgaccgagtt 3421 gctcttgccc ggcgtcaata cgggataata ccgcgccaca tagcagaact ttaaaagtgc 3481 tcatcattgg aaaacgttct tcggggcgaa aactctcaag gatcttaccg ctgttgagat 3541 ccagttcgat gtaacccact cgtgcaccca actgatcttc agcatctttt actttcacca 3601 gcgtttctgg gtgagcaaaa acaggaaggc aaagtgccgc aaaaaaggga ataagggcga 3661 cacggaaatg ttgaatactc atactcttcc tttttcaata ttattgaagc atttatcagg 3721 gttattgtct catgagcgga tacatatttg aatgtattta gaaaaataaa caaatagggg 3781 ttccgcgcac atttccccga aaagtgccac ctggcgcgcc acaaaacagc agggaagcag 3841 cgcttttccg ctgcataacc ctgcttcggg gtcattatag cgattttttc ggtatatcca 3901 tcctttttcg cacgatatac aggattttgc caaagggttc gtgtagactt tccttggtgt 3961 atccaacggc gtcagccggg caggataggt gaagtaggcc cacccgcgag cgggtgttcc 4021 ttcttcactg tcccttattc gcacctggcg gtgctcaacg ggaatcctgc tctgcgaggc 4081 tggccggcta ccgccggcgt aacagatgag ggcaagcgga tggctgatga aaccaagcca 4141 accaggaagg gcagcccacc tatcaaggtg tactgccttc cagacgaacg aagagcgatt 4201 gaggaaaagg cggcggcggc cggcatgagc ctgtcggcct acctgctggc cgtcggccag 4261 ggctacaaaa tcacgggcgt cgtggactat gagcacgtcg gcgcgcctct agtatgcagg 4321 agtggggagg cacgatggcc gctttggtcg acctcaacga gacgatgaag ccgtggaacg 4381 acaccacccc ggcggccctg ctggaccaca cccggcacta caccttcgac gtctgatcat 4441 cactgacgaa tcgaggtcga ggaaccgagc gtccgaggaa cagaggcgct tatcggttgg 4501 ccgcgagatt cctgtcgatc ctctcgtgca gcgcgattcc gagggaaacg gaaacgttga 4561 gagactcggt ctggctcatc atggggatgg aaaccgaggc ggaagacgcc tcctcgaaca 4621 ggtcggaagg cccacccttt tcgctgccga acagcaaggc cagccgatcc ggattgtccc 4681 cgagttcctt cacggaaatg tcgccatccg ccttgagcgt catcagctgc ataccgctgt 4741 cccgaatgaa ggcgatggcc tcctcgcgac cggagagaac gacgggaagg gagaagacgt 4801 aacctcggct ggccctttgg agacgccggt ccgcgatgct ggtgatgtca ctgtcgacca 4861 ggatgatccc cgacgctccg agcgcgagcg acgtgcgtac tatcgcgccg atgttcccga 4921 cgatcttcac cccgtcgaga acgacgacgt ccccacgccg gctcgcgata tcgccgaacc 4981 tggccgggcg agggacgcgg gcgatgccga atgtcttggc cttccgctcc cccttgaaca 5041 actggttgac gatcgaggag tcgatgaggc ggaccggtat gttctgccgc ccgcacagat 5101 ccagcaactc agatggaaaa ggactgctgt cgctgccgta gacctcgatg aactccaccc 5161 cggccgcgat gctgtgcatg aggggctcga cgtcctcgat caacgttgtc tttatgttgg 5221 atcgcgacgg cttggtgaca tcgatgatcc gctgcaccgc gggatcggac ggatttgcga 5281 tggtgtccaa ctcagtcatg gtcgtcctac cggctgctgt gttcagtgac gcgattcctg 5341 gggtgtgaca ccctacgcga cgatggcgga tggctgccct gaccggcaat caccaacgca 5401 aggggaagac tacgccttcc actagaccgg tcgacctgca ggcctgctgg cgccggacgg 5461 ggcttcagac gtttcgggtg ctgggttgtt gtctctggac agtgatccat gggaaactac 5521 tcagcaccac caatgttccc aaaagaaagc gcaggtcagc gcccatgagc caatatctag 5581 gcatgtcgcc cttcatcgct cccgaggtcc ctgagcacct tctcgacact gttcgcgtct 5641 tcctgtacgc gcgtcagtct aagggccggt ccgacggctc agacgtgtcg accgaagcac 5701 agctcgcggc cggtcgtgcg ttggtcgcgt ctcgcaacgc ccaggggggt gcgcgctggg 5761 tcgtggcagg tgagttcgtg gacgtcgggc gctccggctg ggacccgaac gtgacccgtg 5821 ccgacttcga gcgcatgatg ggcgaagtcc gcgccggcga aggtgacgtt gtcgttgtga 5881 atgagctttc ccggctcact cgcaagggcg cccatgacgc gctcgaaatc gacaacgaat 5941 tgaagaagca cggcgtgcgc ttcatgtcgg ttcttgagcc gttccttgac acgtctaccc 6001 ctatcggcgt cgccattttc gcgctgatcg ctgcccttgc gaaacaggac agtgacctga 6061 aggcggagcg cctgaagggt gcgaaagacg agattgccgc gctgggtggc gttcactcgt 6121 cttccgcccc gttcggaatg cgcgccgtgc gcaagaaggt cgataatctc gtgatctccg 6181 ttcttgagcc ggacgaagac aacccggatc acgtcgagct agttgagcgc atggcgaaaa 6241 tgtcgttcga gggcgtgtcc gacaacgcca ttgcaacgac cttcgagaag gaaaagatcc 6301 cgtcgcccgg aatggctgag agacgcgcca cggaaaagcg tcttgcgtcc atcaaggcac 6361 gtcgcctgaa cggcgctgaa aagccgatca tgtggcgcgc tcaaacggtc cgatggattc

6421 tcaaccatcc cgcaatcggc ggtttcgcat tcgagcgtgt gaagcacggt aaggcgcaca 6481 tcaacgtcat acggcgcgac cccggcggca agccgctaac gccccacacg ggcattctca 6541 gcggctcgaa gtggcttgag cttcaagaga agcgttccgg gaagaatctc agcgaccgga 6601 agcctggggc cgaagtcgaa ccgacgcttc tgagcgggtg gcgtttcctg gggtgccgaa 6661 tctgcggcgg ctcaatgggt cagtcccagg gtggccgtaa gcgcaacggc gaccttgccg 6721 aaggcaatta catgtgcgcc aacccgaagg ggcacggcgg cttgtcggtc aagcgcagcg 6781 aactggacga gttcgttgct tcgagggtgt gggcacggct ccgcacagcc gacatggaag 6841 atgaacacga tcaggcatgg attgccgccg ctgcggagcg cttcgccctt cagcacgacc 6901 tagcgggggt ggccgatgag cggcgcgaac aacaggcgca cctagacaac gtgcggcgct 6961 ccatcaagga ccttcaggcg gaccgtaagg ccggtctgta cgtcgggcgt gaagagctgg 7021 aaacgtggcg ctcaacggtg ctgcaatacc ggtcctacga agcggagtgc acgacccgac 7081 tcgctgagct tgacgagaag atgaacggca gcacccgcgt tccgtctgag tggttcagcg 7141 gcgaagaccc gacggccgaa gggggcatct gggcaagctg ggacgtgtac gagcgtcggg 7201 agttcctgag cttcttcctt gactccgtca tggtcgaccg ggggcgccac cctgagacga 7261 agaaatacat ccccctgaag gaccgtgtga cgctcaagtg ggcggagctg ctgaaggagg 7321 aagacgaagc gagcgaagcc actgagcggg agcttgcggc gctgtaggta caatcataat 7381 gaggctagac tacagacgcg aagaatctcg tgctttcagc ttcgat 179. SfaC (PzbB) expression 1 tatgtacgaa cgtccgctgt accgggagga ttgcgacggc gtcgtcctgg cgtttctgcg 61 acacaaccca ctggcaatgg tcgtcacctc gcacgacgac gtcccggtgg ccacccacgc 121 gccggtgctg ttccggcacg gacccgacgg cgccgacgcc gaggccgtcg ccgcgggcac 181 cgtcccgctc gccggctcca ccctgatcgg ccacatgaac gtcgagaacc cgcagtggcg 241 ccggatgcgc tccggcgacc gggcgctcat cgtcttccag ggcccgcacg gctatgtctc 301 gccgacggtc tacggggtca cgcccgcggc ccccacctgg gacttcatcg ccgtccacgt 361 gaacggcaca gtggagccca ccgccgaccc cgccgccgtg ctggacatcg tctccgacac 421 cgcccggcgg ctggagtccg gcttcgggcg cggctgggac caggagtcct ccctcgacta 481 cttccgccag atcgcgcccg gcgtgggcgc cttcaccctg cgggtcgatt ccgtgcagac 541 gatgttcaag ctcagccagg agaagcccgc cccgatgcgg cggcgcgtgg tcgagcagtt 601 cgaagcaagc gagtccggca cccaccgcgc cctggccagc gtgatgcgcg accgcggact 661 caccgaagcc gacgaggagc gggagacagc cggatgagga tccggctgct aacaaagccc 721 gaaaggaagc tgagttggct gctgccaccg ctgagcaata actagcataa ccccttgggg 781 cctctaaacg ggtcttgagg ggttttttgc tgaaaggagg aactatatcc ggatatcccg 841 caagaggccc ggcagtaccg gcataaccaa gcctatgcct acagcatcca gggtgacggt 901 gccgaggatg acgatgagcg cattgttaga tttcatacac ggtgcctgac tgcgttagca 961 atttaactgt gataaactac cgcattaaag cttatcgatg ataagctgtc aaacatgaga 1021 attcttgaag acgaaagggc ctcgtgatac gcctattttt ataggttaat gtcatgataa 1081 taatggtttc ttagacgtca ggtggcactt ttcggggaaa tgtgcgcgga acccctattt 1141 gtttattttt ctaaatacat tcaaatatgt atccgctcat gagacaataa ccctgataaa 1201 tgcttcaata atattgaaaa aggaagagta tgagtattca acatttccgt gtcgccctta 1261 ttcccttttt tgcggcattt tgccttcctg tttttgctca cccagaaacg ctggtgaaag 1321 taaaagatgc tgaagatcag ttgggtgcac gagtgggtta catcgaactg gatctcaaca 1381 gcggtaagat ccttgagagt tttcgccccg aagaacgttt tccaatgatg agcactttta 1441 aagttctgct atgtggcgcg gtattatccc gtgttgacgc cgggcaagag caactcggtc 1501 gccgcataca ctattctcag aatgacttgg ttgagtactc accagtcaca gaaaagcatc 1561 ttacggatgg catgacagta agagaattat gcagtgctgc cataaccatg agtgataaca 1621 ctgcggccaa cttacttctg acaacgatcg gaggaccgaa ggagctaacc gcttttttgc 1681 acaacatggg ggatcatgta actcgccttg atcgttggga accggagctg aatgaagcca 1741 taccaaacga cgagcgtgac accacgatgc ctgcagcaat ggcaacaacg ttgcgcaaac 1801 tattaactgg cgaactactt actctagctt cccggcaaca attaatagac tggatggagg 1861 cggataaagt tgcaggacca cttctgcgct cggcccttcc ggctggctgg tttattgctg 1921 ataaatctgg agccggtgag cgtgggtctc gcggtatcat tgcagcactg gggccagatg 1981 gtaagccctc ccgtatcgta gttatctaca cgacggggag tcaggcaact atggatgaac 2041 gaaatagaca gatcgctgag ataggtgcct cactgattaa gcattggtaa ctgtcagacc 2101 aagtttactc atatatactt tagattgatt taaaacttca tttttaattt aaaaggatct 2161 aggtgaagat cctttttgat aatctcatga ccaaaatccc ttaacgtgag ttttcgttcc 2221 actgagcgtc agaccccgta gaaaagatca aaggatcttc ttgagatcct ttttttctgc 2281 gcgtaatctg ctgcttgcaa acaaaaaaac caccgctacc agcggtggtt tgtttgccgg 2341 atcaagagct accaactctt tttccgaagg taactggctt cagcagagcg cagataccaa 2401 atactgtcct tctagtgtag ccgtagttag gccaccactt caagaactct gtagcaccgc 2461 ctacatacct cgctctgcta atcctgttac cagtggctgc tgccagtggc gataagtcgt 2521 gtcttaccgg gttggactca agacgatagt taccggataa ggcgcagcgg tcgggctgaa 2581 cggggggttc gtgcacacag cccagcttgg agcgaacgac ctacaccgaa ctgagatacc 2641 tacagcgtga gctatgagaa agcgccacgc ttcccgaagg gagaaaggcg gacaggtatc 2701 cggtaagcgg cagggtcgga acaggagagc gcacgaggga gcttccaggg ggaaacgcct 2761 ggtatcttta tagtcctgtc gggtttcgcc acctctgact tgagcgtcga tttttgtgat 2821 gctcgtcagg ggggcggagc ctatggaaaa acgccagcaa cgcggccttt ttacggttcc 2881 tggccttttg ctggcctttt gctcacatgt tctttcctgc gttatcccct gattctgtgg 2941 ataaccgtat taccgccttt gagtgagctg ataccgctcg ccgcagccga acgaccgagc 3001 gcagcgagtc agtgagcgag gaagcggaag agcgcctgat gcggtatttt ctccttacgc 3061 atctgtgcgg tatttcacac cgcatatatg gtgcactctc agtacaatct gctctgatgc 3121 cgcatagtta agccagtata cactccgcta tcgctacgtg actgggtcat ggctgcgccc 3181 cgacacccgc caacacccgc tgacgcgccc tgacgggctt gtctgctccc ggcatccgct 3241 tacagacaag ctgtgaccgt ctccgggagc tgcatgtgtc agaggttttc accgtcatca 3301 ccgaaacgcg cgaggcagct gcggtaaagc tcatcagcgt ggtcgtgaag cgattcacag 3361 atgtctgcct gttcatccgc gtccagctcg ttgagtttct ccagaagcgt taatgtctgg 3421 cttctgataa agcgggccat gttaagggcg gttttttcct gtttggtcac tgatgcctcc 3481 gtgtaagggg gatttctgtt catgggggta atgataccga tgaaacgaga gaggatgctc 3541 acgatacggg ttactgatga tgaacatgcc cggttactgg aacgttgtga gggtaaacaa 3601 ctggcggtat ggatgcggcg ggaccagaga aaaatcactc agggtcaatg ccagcgcttc 3661 gttaatacag atgtaggtgt tccacagggt agccagcagc atcctgcgat gcagatccgg 3721 aacataatgg tgcagggcgc tgacttccgc gtttccagac tttacgaaac acggaaaccg 3781 aagaccattc atgttgttgc tcaggtcgca gacgttttgc agcagcagtc gcttcacgtt 3841 cgctcgcgta tcggtgattc attctgctaa ccagtaaggc aaccccgcca gcctagccgg 3901 gtcctcaacg acaggagcac gatcatgcgc acccgtggcc aggacccaac gctgcccgag 3961 atgcgccgcg tgcggctgct ggagatggcg gacgcgatgg atatgttctg ccaagggttg 4021 gtttgcgcat tcacagttct ccgcaagaat tgattggctc caattcttgg agtggtgaat 4081 ccgttagcga ggtgccgccg gcttccattc aggtcgaggt ggcccggctc catgcaccgc 4141 gacgcaacgc ggggaggcag acaaggtata gggcggcgcc tacaatccat gccaacccgt 4201 tccatgtgct cgccgaggcg gcataaatcg ccgtgacgat cagcggtcca gtgatcgaag 4261 ttaggctggt aagagccgcg agcgatcctt gaagctgtcc ctgatggtcg tcatctacct 4321 gcctggacag catggcctgc aacgcgggca tcccgatgcc gccggaagcg agaagaatca 4381 taatggggaa ggccatccag cctcgcgtcg cgaacgccag caagacgtag cccagcgcgt 4441 cggccgccat gccggcgata atggcctgct tctcgccgaa acgtttggtg gcgggaccag 4501 tgacgaaggc ttgagcgagg gcgtgcaaga ttccgaatac cgcaagcgac aggccgatca 4561 tcgtcgcgct ccagcgaaag cggtcctcgc cgaaaatgac ccagagcgct gccggcacct 4621 gtcctacgag ttgcatgata aagaagacag tcataagtgc ggcgacgata gtcatgcccc 4681 gcgcccaccg gaaggagctg actgggttga aggctctcaa gggcatcggt cgagatcccg 4741 gtgcctaatg agtgagctaa cttacattaa ttgcgttgcg ctcactgccc gctttccagt 4801 cgggaaacct gtcgtgccag ctgcattaat gaatcggcca acgcgcgggg agaggcggtt 4861 tgcgtattgg gcgccagggt ggtttttctt ttcaccagtg agacgggcaa cagctgattg 4921 cccttcaccg cctggccctg agagagttgc agcaagcggt ccacgctggt ttgccccagc 4981 aggcgaaaat cctgtttgat ggtggttaac ggcgggatat aacatgagct gtcttcggta 5041 tcgtcgtatc ccactaccga gatatccgca ccaacgcgca gcccggactc ggtaatggcg 5101 cgcattgcgc ccagcgccat ctgatcgttg gcaaccagca tcgcagtggg aacgatgccc 5161 tcattcagca tttgcatggt ttgttgaaaa ccggacatgg cactccagtc gccttcccgt 5221 tccgctatcg gctgaatttg attgcgagtg agatatttat gccagccagc cagacgcaga 5281 cgcgccgaga cagaacttaa tgggcccgct aacagcgcga tttgctggtg acccaatgcg 5341 accagatgct ccacgcccag tcgcgtaccg tcttcatggg agaaaataat actgttgatg 5401 ggtgtctggt cagagacatc aagaaataac gccggaacat tagtgcaggc agcttccaca 5461 gcaatggcat cctggtcatc cagcggatag ttaatgatca gcccactgac gcgttgcgcg 5521 agaagattgt gcaccgccgc tttacaggct tcgacgccgc ttcgttctac catcgacacc 5581 accacgctgg cacccagttg atcggcgcga gatttaatcg ccgcgacaat ttgcgacggc 5641 gcgtgcaggg ccagactgga ggtggcaacg ccaatcagca acgactgttt gcccgccagt 5701 tgttgtgcca cgcggttggg aatgtaattc agctccgcca tcgccgcttc cactttttcc 5761 cgcgttttcg cagaaacgtg gctggcctgg ttcaccacgc gggaaacggt ctgataagag 5821 acaccggcat actctgcgac atcgtataac gttactggtt tcacattcac caccctgaat 5881 tgactctctt ccgggcgcta tcatgccata ccgcgaaagg ttttgcgcca ttcgatggtg 5941 tccgggatct cgacgctctc ccttatgcga ctcctgcatt aggaagcagc ccagtagtag 6001 gttgaggccg ttgagcaccg ccgccgcaag gaatggtgca tgcaaggaga tggcgcccaa 6061 cagtcccccg gccacggggc ctgccaccat acccacgccg aaacaagcgc tcatgagccc 6121 gaagtggcga gcccgatctt ccccatcggt gatgtcggcg atataggcgc cagcaaccgc 6181 acctgtggcg ccggtgatgc cggccacgat gcgtccggcg tagaggatcg agatctcgat 6241 cccgcgaaat taatacgact cactataggg gaattgtgag cggataacaa ttcccctcta 6301 gaaataattt tgtttaactt taagaaggag atataccatg ggcagcagcc atcatcatca 6361 tcatcacagc agcggcctgg tgccgcgcgg cagcca 180. SfaC (PzbB) complementation of flaveolus

1 gtaggagggc gtggatatgt cctgcgggta aactatagtc gttgagagga ggagtctgac 61 tcctgttgat agatccagta atgacctcag aactccatct ggatttgttc agaacgctcg 121 gttgccgccg ggcgtttttt attggtgaga ataggtcttg acggctggcg agaggtgcgg 181 ggaggatctg accgacgcgg tccacacgtg gcaccgcgat gctgttgtgg gcacaatcgt 241 gccggttggt aggatccggt taattaagca gtaccagatc tgactgagtg accaaaggag 301 gcggacatat gtacgaacgt ccgctgtacc gggaggattg cgacggcgtc gtcctggcgt 361 ttctgcgaca caacccactg gcaatggtcg tcacctcgca cgacgacgtc ccggtggcca 421 cccacgcgcc ggtgctgttc cggcacggac ccgacggcgc cgacgccgag gccgtcgccg 481 cgggcaccgt cccgctcgcc ggctccaccc tgatcggcca catgaacgtc gagaacccgc 541 agtggcgccg gatgcgctcc ggcgaccggg cgctcatcgt cttccagggc ccgcacggct 601 atgtctcgcc gacggtctac ggggtcacgc ccgcggcccc cacctgggac ttcatcgccg 661 tccacgtgaa cggcacagtg gagcccaccg ccgaccccgc cgccgtgctg gacatcgtct 721 ccgacaccgc ccggcggctg gagtccggct tcgggcgcgg ctgggaccag gagtcctccc 781 tcgactactt ccgccagatc gcgcccggcg tgggcgcctt caccctgcgg gtcgattccg 841 tgcagacgat gttcaagctc agccaggaga agcccgcccc gatgcggcgg cgcgtggtcg 901 agcagttcga agcaagcgag tccggcaccc accgcgccct ggccagcgtg atgcgcgacc 961 gcggactcac cgaagccgac gaggagcggg agacagccgg atgaggatcc ccgggtacct 1021 tcgaaaaaaa aaggctccaa aaggagcctt taattgttcc tccagacctt acttgaccgg 1081 cgctcactgc ccgctttcca gtcgggaaac ctgtcgtgcc agctgcatta atgaatcggc 1141 caacgcgcgg ggagaggcgg tttgcgtatt gggcgctctt ccgcttcctc gctcactgac 1201 tcgctgcgct cggtcgttcg gctgcggcga gcggtatcag ctcactcaaa ggcggtaata 1261 cggttatcca cagaatcagg ggataacgca ggaaagaaca tgtgagcaaa aggccagcaa 1321 aaggccagga accgtaaaaa ggccgcgttg ctggcgtttt tccataggct ccgcccccct 1381 gacgagcatc acaaaaatcg acgctcaagt cagaggtggc gaaacccgac aggactataa 1441 agataccagg cgtttccccc tggaagctcc ctcgtgcgct ctcctgttcc gaccctgccg 1501 cttaccggat acctgtccgc ctttctccct tcgggaagcg tggcgctttc tcatagctca 1561 cgctgtaggt atctcagttc ggtgtaggtc gttcgctcca agctgggctg tgtgcacgaa 1621 ccccccgttc agcccgaccg ctgcgcctta tccggtaact atcgtcttga gtccaacccg 1681 gtaagacacg acttatcgcc actggcagca gccactggta acaggattag cagagcgagg 1741 tatgtaggcg gtgctacaga gttcttgaag tggtggccta actacggcta cactagaaga 1801 acagtatttg gtatctgcgc tctgctgaag ccagttacct tcggaaaaag agttggtagc 1861 tcttgatccg gcaaacaaac caccgctggt agcggtggtt tttttgtttg caagcagcag 1921 attacgcgca gaaaaaaagg atctcaagaa gatcctttga tcttttctac ggggtctgac 1981 gctcagtgga acgaaaactc acgttaaggg attttggtca tgagattatc aaaaaggatc 2041 ttcacctaga tccttttggt tcatgtgcag ctccactgct ttagactcta catctgtatg 2101 aagtcttcag atcctctacg ccggacgcat cgtggccgga tctaaaaaaa agcccgctca 2161 ttaggcgggc tgacagttac caatgcttaa tcagtgaggc acctatctca gcgatctgtc 2221 tatttcgttc atccatagtt gcctgactcc ccgtcgtgta gataactacg atacgggagg 2281 gcttaccatc tggccccagt gctgcaatga taccgcgaga cccacgctca ccggctccag 2341 atttatcagc aataaaccag ccagccggaa gggccgagcg cagaagtggt cctgcaactt 2401 tatccgcctc catccagtct attaattgtt gccgggaagc tagagtaagt agttcgccag 2461 ttaatagttt gcgcaacgtt gttgccattg ctacaggcat cgtggtgtca cgctcgtcgt 2521 ttggtatggc ttcattcagc tccggttccc aacgatcaag gcgagttaca tgatccccca 2581 tgttgtgcaa aaaagcggtt agctccttcg gtcctccgat cgttgtcaga agtaagttgg 2641 ccgcagtgtt atcactcatg gttatggcag cactgcataa ttctcttact gtcatgccat 2701 ccgtaagatg cttttctgtg actggtgagt actcaaccaa gtcattctga gaatagtgta 2761 tgcggcgacc gagttgctct tgcccggcgt caatacggga taataccgcg ccacatagca 2821 gaactttaaa agtgctcatc attggaaaac gttcttcggg gcgaaaactc tcaaggatct 2881 taccgctgtt gagatccagt tcgatgtaac ccactcgtgc acccaactga tcttcagcat 2941 cttttacttt caccagcgtt tctgggtgag caaaaacagg aaggcaaagt gccgcaaaaa 3001 agggaataag ggcgacacgg aaatgttgaa tactcatact cttccttttt caatattatt 3061 gaagcattta tcagggttat tgtctcatga gcggatacat atttgaatgt atttagaaaa 3121 ataaacaaat aggggttccg cgcacatttc cccgaaaagt gccacctggc gcgccacaaa 3181 acagcaggga agcagcgctt ttccgctgca taaccctgct tcggggtcat tatagcgatt 3241 ttttcggtat atccatcctt tttcgcacga tatacaggat tttgccaaag ggttcgtgta 3301 gactttcctt ggtgtatcca acggcgtcag ccgggcagga taggtgaagt aggcccaccc 3361 gcgagcgggt gttccttctt cactgtccct tattcgcacc tggcggtgct caacgggaat 3421 cctgctctgc gaggctggcc ggctaccgcc ggcgtaacag atgagggcaa gcggatggct 3481 gatgaaacca agccaaccag gaagggcagc ccacctatca aggtgtactg ccttccagac 3541 gaacgaagag cgattgagga aaaggcggcg gcggccggca tgagcctgtc ggcctacctg 3601 ctggccgtcg gccagggcta caaaatcacg ggcgtcgtgg actatgagca cgtcggcgcg 3661 cctctagtat gcaggagtgg ggaggcacga tggccgcttt ggtcgacctc aacgagacga 3721 tgaagccgtg gaacgacacc accccggcgg ccctgctgga ccacacccgg cactacacct 3781 tcgacgtctg atcatcactg acgaatcgag gtcgaggaac cgagcgtccg aggaacagag 3841 gcgcttatcg gttggccgcg agattcctgt cgatcctctc gtgcagcgcg attccgaggg 3901 aaacggaaac gttgagagac tcggtctggc tcatcatggg gatggaaacc gaggcggaag 3961 acgcctcctc gaacaggtcg gaaggcccac ccttttcgct gccgaacagc aaggccagcc 4021 gatccggatt gtccccgagt tccttcacgg aaatgtcgcc atccgccttg agcgtcatca 4081 gctgcatacc gctgtcccga atgaaggcga tggcctcctc gcgaccggag agaacgacgg 4141 gaagggagaa gacgtaacct cggctggccc tttggagacg ccggtccgcg atgctggtga 4201 tgtcactgtc gaccaggatg atccccgacg ctccgagcgc gagcgacgtg cgtactatcg 4261 cgccgatgtt cccgacgatc ttcaccccgt cgagaacgac gacgtcccca cgccggctcg 4321 cgatatcgcc gaacctggcc gggcgaggga cgcgggcgat gccgaatgtc ttggccttcc 4381 gctccccctt gaacaactgg ttgacgatcg aggagtcgat gaggcggacc ggtatgttct 4441 gccgcccgca cagatccagc aactcagatg gaaaaggact gctgtcgctg ccgtagacct 4501 cgatgaactc caccccggcc gcgatgctgt gcatgagggg ctcgacgtcc tcgatcaacg 4561 ttgtctttat gttggatcgc gacggcttgg tgacatcgat gatccgctgc accgcgggat 4621 cggacggatt tgcgatggtg tccaactcag tcatggtcgt cctaccggct gctgtgttca 4681 gtgacgcgat tcctggggtg tgacacccta cgcgacgatg gcggatggct gccctgaccg 4741 gcaatcacca acgcaagggg aagactacgc cttccactag accggtcgac ctgcaggcct 4801 gctggcgccg gacggggctt cagacgtttc gggtgctggg ttgttgtctc tggacagtga 4861 tccatgggaa actactcagc accaccaatg ttcccaaaag aaagcgcagg tcagcgccca 4921 tgagccaata tctaggcatg tcgcccttca tcgctcccga ggtccctgag caccttctcg 4981 acactgttcg cgtcttcctg tacgcgcgtc agtctaaggg ccggtccgac ggctcagacg 5041 tgtcgaccga agcacagctc gcggccggtc gtgcgttggt cgcgtctcgc aacgcccagg 5101 ggggtgcgcg ctgggtcgtg gcaggtgagt tcgtggacgt cgggcgctcc ggctgggacc 5161 cgaacgtgac ccgtgccgac ttcgagcgca tgatgggcga agtccgcgcc ggcgaaggtg 5221 acgttgtcgt tgtgaatgag ctttcccggc tcactcgcaa gggcgcccat gacgcgctcg 5281 aaatcgacaa cgaattgaag aagcacggcg tgcgcttcat gtcggttctt gagccgttcc 5341 ttgacacgtc tacccctatc ggcgtcgcca ttttcgcgct gatcgctgcc cttgcgaaac 5401 aggacagtga cctgaaggcg gagcgcctga agggtgcgaa agacgagatt gccgcgctgg 5461 gtggcgttca ctcgtcttcc gccccgttcg gaatgcgcgc cgtgcgcaag aaggtcgata 5521 atctcgtgat ctccgttctt gagccggacg aagacaaccc ggatcacgtc gagctagttg 5581 agcgcatggc gaaaatgtcg ttcgagggcg tgtccgacaa cgccattgca acgaccttcg 5641 agaaggaaaa gatcccgtcg cccggaatgg ctgagagacg cgccacggaa aagcgtcttg 5701 cgtccatcaa ggcacgtcgc ctgaacggcg ctgaaaagcc gatcatgtgg cgcgctcaaa 5761 cggtccgatg gattctcaac catcccgcaa tcggcggttt cgcattcgag cgtgtgaagc 5821 acggtaaggc gcacatcaac gtcatacggc gcgaccccgg cggcaagccg ctaacgcccc 5881 acacgggcat tctcagcggc tcgaagtggc ttgagcttca agagaagcgt tccgggaaga 5941 atctcagcga ccggaagcct ggggccgaag tcgaaccgac gcttctgagc gggtggcgtt 6001 tcctggggtg ccgaatctgc ggcggctcaa tgggtcagtc ccagggtggc cgtaagcgca 6061 acggcgacct tgccgaaggc aattacatgt gcgccaaccc gaaggggcac ggcggcttgt 6121 cggtcaagcg cagcgaactg gacgagttcg ttgcttcgag ggtgtgggca cggctccgca 6181 cagccgacat ggaagatgaa cacgatcagg catggattgc cgccgctgcg gagcgcttcg 6241 cccttcagca cgacctagcg ggggtggccg atgagcggcg cgaacaacag gcgcacctag 6301 acaacgtgcg gcgctccatc aaggaccttc aggcggaccg taaggccggt ctgtacgtcg 6361 ggcgtgaaga gctggaaacg tggcgctcaa cggtgctgca ataccggtcc tacgaagcgg 6421 agtgcacgac ccgactcgct gagcttgacg agaagatgaa cggcagcacc cgcgttccgt 6481 ctgagtggtt cagcggcgaa gacccgacgg ccgaaggggg catctgggca agctgggacg 6541 tgtacgagcg tcgggagttc ctgagcttct tccttgactc cgtcatggtc gaccgggggc 6601 gccaccctga gacgaagaaa tacatccccc tgaaggaccg tgtgacgctc aagtgggcgg 6661 agctgctgaa ggaggaagac gaagcgagcg aagccactga gcgggagctt gcggcgctgt 6721 aggtacaatc ataatgaggc tagactacag acgcgaagaa tctcgtgctt tcagcttcga 6781 t 181. SfaC (PzbB) in vivo expression 1 atctacgtct gtcgagaagt ttctgatcga aaagttcgac agcgtctccg acctgatgca 61 gctctcgcag ggcgaagaat ctcgtgcttt cagcttcgat gtaggagggc gtggatatgt 121 cctgcgggta aactatagtc gttgagagga ggagtctgac tcctgttgat agatccagta 181 atgacctcag aactccatct ggatttgttc agaacgctcg gttgccgccg ggcgtttttt 241 attggtgaga ataggtcttg acggctggcg agaggtgcgg ggaggatctg accgacgcgg 301 tccacacgtg gcaccgcgat gctgttgtgg gcacaatcgt gccggttggt aggatccggt 361 taattaagca gtaccagatc tgactgagtg accaaaggag gcggacatat gtacgaacgt 421 ccgctgtacc gggaggattg cgacggcgtc gtcctggcgt ttctgcgaca caacccactg 481 gcaatggtcg tcacctcgca cgacgacgtc ccggtggcca cccacgcgcc ggtgctgttc 541 cggcacggac ccgacggcgc cgacgccgag gccgtcgccg cgggcaccgt cccgctcgcc 601 ggctccaccc tgatcggcca catgaacgtc gagaacccgc agtggcgccg gatgcgctcc

661 ggcgaccggg cgctcatcgt cttccagggc ccgcacggct atgtctcgcc gacggtctac 721 ggggtcacgc ccgcggcccc cacctgggac ttcatcgccg tccacgtgaa cggcacagtg 781 gagcccaccg ccgaccccgc cgccgtgctg gacatcgtct ccgacaccgc ccggcggctg 841 gagtccggct tcgggcgcgg ctgggaccag gagtcctccc tcgactactt ccgccagatc 901 gcgcccggcg tgggcgcctt caccctgcgg gtcgattccg tgcagacgat gttcaagctc 961 agccaggaga agcccgcccc gatgcggcgg cgcgtggtcg agcagttcga agcaagcgag 1021 tccggcaccc accgcgccct ggccagcgtg atgcgcgacc gcggactcac cgaagccgac 1081 gaggagcggg agacagccgg atgaggatcc ccgggtacct tcgaaaaaaa aaggctccaa 1141 aaggagcctt taattgttcc tccagacctt acttgaccgg cgctcactgc ccgctttcca 1201 gtcgggaaac ctgtcgtgcc agctgcatta atgaatcggc caacgcgcgg ggagaggcgg 1261 tttgcgtatt gggcgctctt ccgcttcctc gctcactgac tcgctgcgct cggtcgttcg 1321 gctgcggcga gcggtatcag ctcactcaaa ggcggtaata cggttatcca cagaatcagg 1381 ggataacgca ggaaagaaca tgtgagcaaa aggccagcaa aaggccagga accgtaaaaa 1441 ggccgcgttg ctggcgtttt tccataggct ccgcccccct gacgagcatc acaaaaatcg 1501 acgctcaagt cagaggtggc gaaacccgac aggactataa agataccagg cgtttccccc 1561 tggaagctcc ctcgtgcgct ctcctgttcc gaccctgccg cttaccggat acctgtccgc 1621 ctttctccct tcgggaagcg tggcgctttc tcatagctca cgctgtaggt atctcagttc 1681 ggtgtaggtc gttcgctcca agctgggctg tgtgcacgaa ccccccgttc agcccgaccg 1741 ctgcgcctta tccggtaact atcgtcttga gtccaacccg gtaagacacg acttatcgcc 1801 actggcagca gccactggta acaggattag cagagcgagg tatgtaggcg gtgctacaga 1861 gttcttgaag tggtggccta actacggcta cactagaaga acagtatttg gtatctgcgc 1921 tctgctgaag ccagttacct tcggaaaaag agttggtagc tcttgatccg gcaaacaaac 1981 caccgctggt agcggtggtt tttttgtttg caagcagcag attacgcgca gaaaaaaagg 2041 atctcaagaa gatcctttga tcttttctac ggggtctgac gctcagtgga acgaaaactc 2101 acgttaaggg attttggtca tgagattatc aaaaaggatc ttcacctaga tccttttggt 2161 tcatgtgcag ctccatcagc aaaaggggat gataagttta tcaccaccga ctatttgcaa 2221 cagtgccgtt gatcgtgcta tgatcgactg atgtcatcag cggtggagtg caatgtcgtg 2281 caatacgaat ggcgaaaagc cgagctcatc ggtcagcttc tcaaccttgg ggttaccccc 2341 ggcggtgtgc tgctggtcca cagctccttc cgtagcgtcc ggcccctcga agatgggcca 2401 cttggactga tcgaggccct gcgtgctgcg ctgggtccgg gagggacgct cgtcatgccc 2461 tcgtggtcag gtctggacga cgagccgttc gatcctgcca cgtcgcccgt tacaccggac 2521 cttggagttg tctctgacac attctggcgc ctgccaaatg taaagcgcag cgcccatcca 2581 tttgcctttg cggcagcggg gccacaggca gagcagatca tctctgatcc attgcccctg 2641 ccacctcact cgcctgcaag cccggtcgcc cgtgtccatg aactcgatgg gcaggtactt 2701 ctcctcggcg tgggacacga tgccaacacg acgctgcatc ttgccgagtt gatggcaaag 2761 gttccctatg gggtgccgag acactgcacc attcttcagg atggcaagtt ggtacgcgtc 2821 gattatctcg agaatgacca ctgctgtgag cgctttgcct tggcggacag gtggctcaag 2881 gagaagagcc ttcagaagga aggtccagtc ggtcatgcct ttgctcggtt gatccgctcc 2941 cgcgacattg tggcgacagc cctgggtcaa ctgggccgag atccgttgat cttcctgcat 3001 ccgccagagg cgggatgcga agaatgcgat gccgctcgcc agtcgattgg ctgagctcat 3061 gagcggagaa cgagatgacg ttggaggggc aaggtcgcgc tgattgctgg ggcaacacgt 3121 ggagcggatc ggggattgtc tttcttcagc tcgctgatga tatgctgacg ctcaatgccg 3181 tttggcctcc gactaacgaa aatcccgcat ttggacggct gatccgattg gcacggcgga 3241 cggcgaatgg cggagcagac gctcgtccgg gggcaatgag atatgaaaaa gcctgaactc 3301 accgcgacgt atcgggccct ggccagctag ctagagtcga cctgcaggtc cccggggatc 3361 ggtcttgcct tgctcgtcgg tgatgtactt caccagctcc gcgaagtcgc tcttcttgat 3421 ggagcgcatg gggacgtgct tggcaatcac gcgcaccccc cggccgtttt agcggctaaa 3481 aaagtcatgg ctctgccctc gggcggacca cgcccatcat gaccttgcca agctcgtcct 3541 gcttctcttc gatcttcgcc agcagggcga ggatcgtggc atcaccgaac cgcgccgtgc 3601 gcgggtcgtc ggtgagccag agtttcagca ggccgcccag gcggcccagg tcgccattga 3661 tgcgggccag ctcgcggacg tgctcatagt ccacgacgcc cgtgattttg tagccctggc 3721 cgacggccag caggtaggcc gacaggctca tgccggccgc cgccgccttt tcctcaatcg 3781 ctcttcgttc gtctggaagg cagtacacct tgataggtgg gctgcccttc ctggttggct 3841 tggtttcatc agccatccgc ttgccctcat ctgttacgcc ggcggtagcc ggccagcctc 3901 gcagagcagg attcccgttg agcaccgcca ggtgcgaata agggacagtg aagaaggaac 3961 acccgctcgc gggtgggcct acttcaccta tcctgcccgg ctgacgccgt tggatacacc 4021 aaggaaagtc tacacgaacc ctttggcaaa atcctgtata tcgtgcgaaa aaggatggat 4081 ataccgaaaa aatcgctata atgaccccga agcagggtta tgcagcggaa aagatccgtc 4141 gacctgcagg catgcaagct ctagcgattc cagacgtccc gaaggcgtgg cgcggcttcc 4201 ccgtgccgga gcaatcgccc tgggtgggtt acacgacgcc cctctatggc ccgtactgac 4261 ggacacaccg aagccccggc ggcaaccctc agcggatgcc ccggggcttc acgttttccc 4321 aggtcagaag cggttttcgg gagtagtgcc ccaactgggg taacctttga gttctctcag 4381 ttgggggcgt agggtcgccg acatgacaca aggggttgtg accggggtgg acacgtacgc 4441 gggtgcttac gaccgtcagt cgcgcgagcg cgaaaattcg agcgcagcaa gcccagcgac 4501 acagcgtagc gccaacgaag acaaggcggc cgaccttcag cgcgaagtcg agcgcgacgg 4561 gggccggttc aggttcgtcg ggcatttcag cgaagcgccg ggcacgtcgg cgttcgggac 4621 ggcggagcgc ccggagttcg aacgcatcct gaacgaatgc cgcgccgggc ggctcaacat 4681 gatcattgtc tatgacgtgt cgcgcttctc gcgcctgaag gtcatggacg cgattccgat 4741 tgtctcggaa ttgctcgccc tgggcgtgac gattgtttcc actcaggaag gcgtcttccg 4801 gcagggaaac gtcatggacc tgattcacct gattatgcgg ctcgacgcgt cgcacaaaga 4861 atcttcgctg aagtcggcga agattctcga cacgaagaac cttcagcgcg aattgggcgg 4921 gtacgtcggc gggaaggcgc cttacggctt cgagcttgtt tcggagacga aggagatcac 4981 gcgcaacggc cgaatggtca atgtcgtcat caacaagctt gcgcactcga ccactcccct 5041 taccggaccc ttcgagttcg agcccgacgt aatccggtgg tggtggcgtg agatcaagac 5101 gcacaaacac cttcccttca agccgggcag tcaagccgcc attcacccgg gcagcatcac 5161 ggggctttgt aagcgcatgg acgctgacgc cgtgccgacc cggggcgaga cgattgggaa 5221 gaagaccgct tcaagcgcct gggacccggc aaccgttatg cgaatccttc gggacccgcg 5281 tattgcgggc ttcgccgctg aggtgatcta caagaagaag ccggacggca cgccgaccac 5341 gaagattgag ggttaccgca ttcagcgcga cccgatcacg ctccggccgg tcgagcttga 5401 ttgcggaccg atcatcgagc ccgctgagtg gtatgagctt caggcgtggt tggacggcag 5461 ggggcgcggc aaggggcttt cccgggggca agccattctg tccgccatgg acaagctgta 5521 ctgcgagtgt ggcgccgtca tgacttcgaa gcgcggggaa gaatcgatca aggactctta 5581 ccgctgccgt cgccggaagg tggtcgaccc gtccgcacct gggcagcacg aaggcacgtg 5641 caacgtcagc atggcggcac tcgacaagtt cgttgcggaa cgcatcttca acaagatcag 5701 gcacgccgaa ggcgacgaag agacgttggc gcttctgtgg gaagccgccc gacgcttcgg 5761 caagctcact gaggcgcctg agaagagcgg cgaacgggcg aaccttgttg cggagcgcgc 5821 cgacgccctg aacgcccttg aagagctgta cgaagaccgc gcggcaggcg cgtacgacgg 5881 acccgttggc aggaagcact tccggaagca acaggcagcg ctgacgctcc ggcagcaagg 5941 ggcggaagag cggcttgccg aacttgaagc cgccgaagcc ccgaagcttc cccttgacca 6001 atggttcccc gaagacgccg acgctgaccc gaccggccct aagtcgtggt gggggcgcgc 6061 gtcagtagac gacaagcgcg tgttcgtcgg gctcttcgta gacaagatcg ttgtcacgaa 6121 gtcgactacg ggcagggggc agggaacgcc catcgagaag cgcgcttcga tcacgtgggc 6181 gaagccgccg accgacgacg acgaagacga cgcccaggac ggcacggaag acgtagcggc 6241 gtagcgagac acccgggaag cctg

Sequence CWU 1

1

1811494PRTMycobacterium marinum 1Met Gln Gln Arg Leu Thr Met Trp Ser Ala Thr Gly Leu Ile Phe Gly 1 5 10 15 His Ala Leu Cys Met Asn Thr Cys Arg Thr Met Val Val Pro Arg Gly 20 25 30 Lys Pro Leu Cys Ile Glu Arg Val Pro Pro Leu Pro Cys Gln Pro Lys 35 40 45 Met Gly Glu Ser Thr Met Pro Ser Gly Gly Ile Ala Asp Pro Glu Leu 50 55 60 Ala Leu Val Asp Arg Thr Leu Ser Val Val Gly Val Gly Phe Gly Val 65 70 75 80 Thr Gly Leu Ala Leu Ala Ala Ala Leu His Glu Ala Glu Met Thr Glu 85 90 95 Asp Ala Leu Phe Leu Glu Ser Arg Pro Lys Phe Gly Trp His Asp Asp 100 105 110 Met Leu Ile Glu Gly Ser Ser Met Gln Val Ser Phe Leu Lys Asp Ile 115 120 125 Val Thr Met Arg Asn Pro Thr Ser Arg Phe Ser Phe Ile Ser Tyr Leu 130 135 140 His Ala Met Gly Arg Leu Thr Asn Phe Ile Asn His Gly Val Leu Thr 145 150 155 160 Pro Ser Arg Arg Glu Phe Ala Asp Tyr Leu Arg Trp Val Ala Arg Gln 165 170 175 Leu Asp His Leu Val Arg Tyr Asp Val His Val Thr Asp Val Arg Pro 180 185 190 Val Tyr Glu Gly Ala Thr Val Ser Ala Leu Asp Ile Val Ala Gly Glu 195 200 205 Asn Ala Val Val Arg Thr Arg Asn Leu Val Leu Gly Thr Gly Leu Arg 210 215 220 Pro Arg Met Pro Gln Gly Val Ile Pro Asn Arg Arg Val Trp His Ser 225 230 235 240 Ser Glu Leu Leu Ser Arg Leu Ala Glu Cys Gly Asp Tyr Leu Ala Arg 245 250 255 Gln Ile Val Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ile Ala Leu 260 265 270 Tyr Leu Leu Asp Arg Tyr Pro Asp Ser Gln Val Cys Pro Val Phe Ala 275 280 285 Arg Tyr Gly Tyr Ser Ala Val Asp Ala Ser Pro Phe Ala Asn Arg Ile 290 295 300 Phe Asp Pro Ser Gly Val Asp Asp Phe Tyr Ala Ala Ser Pro Ser Val 305 310 315 320 Lys Ala Ser Leu Leu Arg Tyr His Gly Asn Thr Asn Tyr Ser Val Val 325 330 335 Ser Ser Asp Val Leu Gly Ala Leu Tyr Arg Arg Gln Tyr Glu Gln Ser 340 345 350 Val Ile Gly Asp Pro Arg Leu Arg Ile Phe His Ala Ser Arg Leu His 355 360 365 Leu Val Ser Phe Asn Asp Asp Ser Val Val Ala Asp Ile Glu Phe Leu 370 375 380 Pro Thr Gly Glu Val Thr Arg Leu Asp Thr Asp Leu Val Val Ile Tyr 385 390 395 400 Ala Thr Gly Tyr Glu Ser Arg Asp Pro Lys His Leu Leu Thr Ser Leu 405 410 415 Ala Gly Tyr Leu Arg Thr Asp Glu Leu Gly Ala Leu Arg Leu Asp Arg 420 425 430 Arg Tyr Arg Val Lys Thr Val Glu Gly Phe Arg Cys Gly Ile Phe Val 435 440 445 Gln Gly Ala Thr Glu Ser Thr His Gly Ile Ala Ser Thr Leu Leu Ser 450 455 460 Val Ala Ala Val Arg Ala Gly Glu Ile Ser Gln Ser Leu Met Glu Thr 465 470 475 480 Ser Gln Ala Arg Pro Pro Ala Gly Ser Val Thr His Arg His 485 490 2423PRTLentzea flaviverrucosa 2Val Thr Ser Glu Pro Tyr Asp Val Val Gly Ile Gly Phe Gly Pro Ser 1 5 10 15 Asn Leu Ser Leu Ala Ile Ala Leu Glu Glu Thr Gly Gly Leu Ser Ala 20 25 30 Ala Phe Phe Glu Lys Gln Asp Ser Leu Arg Trp His Ser Gly Met Leu 35 40 45 Val Pro Gly Ala Lys Met Gln Val Ser Phe Leu Lys Asp Leu Ala Thr 50 55 60 Pro Arg Asn Pro Val Ser Ser Tyr Ser Phe Val Ser Tyr Leu His Asp 65 70 75 80 Arg Gly Arg Phe Ala Arg Phe Val Asn Asn Ser Asp Phe Phe Pro Thr 85 90 95 Arg Arg Glu Phe Gln Asp Tyr Leu Arg Trp Ala Glu Ala Arg Leu Ser 100 105 110 Pro Pro Val His Tyr Arg Ala Glu Val Val Ser Val Arg Arg Ala Glu 115 120 125 Gly Val Leu Arg Val His Val Arg Asp Thr Glu Ser Gly Ala Thr Arg 130 135 140 Thr Val Asp Thr Arg Asn Ile Val Ile Ser Thr Gly Leu Val Pro Arg 145 150 155 160 Met Pro Val Gly Leu Glu Ala Gly Glu Ser Val Trp His Ser Ser Gln 165 170 175 Phe Leu His Arg Phe His Ala Leu Gly Asp Arg Asp Val Arg Arg Val 180 185 190 Ala Val Val Gly Ala Gly Gln Ser Ala Ala Glu Leu Val Arg Tyr Leu 195 200 205 His Glu Asn Leu Pro Ser Ala Gln Val Phe Ala Val Leu Pro Ser Tyr 210 215 220 Gly Tyr Ala Ile Ala Asp Ser Thr Pro Phe Ala Asn Glu Val Phe Asp 225 230 235 240 Ala Asp Ala Val Asp Val Phe Tyr Asp Ala Ser Asp Lys Ala Lys Ala 245 250 255 Ala Ile Trp Arg Tyr His Arg Asn Thr Asn Tyr Ser Val Val Asp Asp 260 265 270 Glu Val Ile Arg Asp Leu Tyr Gln Arg Ala Tyr Asp Asp Glu Val Arg 275 280 285 Gly Glu Pro Arg Leu Arg Phe Leu Pro Leu Thr Arg Val Val Gly Ala 290 295 300 Lys Gln Asp Arg Asp Gly Ile Thr Leu Leu Thr His Ser Thr Val Asp 305 310 315 320 Asp Gln Ala Arg Asp Leu Pro Leu Asp Leu Val Val Cys Ala Thr Gly 325 330 335 Tyr Asp Pro Met Asp Pro Gly Glu Leu Leu Ala Gly Leu Gly Cys Ser 340 345 350 Val Ala Tyr Asp Glu Leu Gly Arg His Leu Val Gly Arg Asp His Arg 355 360 365 Leu Val Thr Glu Pro Asp Gln Asp Cys Gly Ile Tyr Leu Gln Gly Gly 370 375 380 Thr Glu His Thr His Gly Leu Thr Ser Ser Leu Leu Ser Asn Ile Ala 385 390 395 400 Val Arg Gly Gly Glu Ile Thr Gln Ser Ile Leu Arg Arg Arg Ala Glu 405 410 415 Gln Arg Asn Gly Ala Pro Ala 420 3 433PRTStreptomyces aureofaciens 3Val Gly Glu Arg Gln Arg Ser Gly Val Val Ala Gly Thr Gly Ile Val 1 5 10 15 Asp Val Ala Gly Ile Gly Phe Gly Pro Ser Asn Leu Ala Leu Ala Ala 20 25 30 Ala Ile Ala Glu Ile Ala Gly Glu Ala Pro Val Ser Ala Arg Phe Phe 35 40 45 Glu Ala Gln Pro Arg Phe Gly Trp His Arg Gly Met Leu Ile Glu Gly 50 55 60 Ala Thr Met Gln Val Ser Tyr Leu Lys Asp Leu Val Thr Met Arg Asn 65 70 75 80 Pro Thr Ser Pro Tyr Ser Phe Leu Cys Tyr Leu Gln Ala Arg Gly Arg 85 90 95 Leu Ala Asp Phe Ile Asn Thr Lys Ser Pro Tyr Pro Leu Arg Val Glu 100 105 110 Phe His Asp Tyr Leu Glu Trp Val Ala Glu Ser Phe Ala Asp Leu Val 115 120 125 Ser Tyr Gly Ala Arg Val Val Ser Val Glu Pro Val Ser Ala Glu Gln 130 135 140 Gly Val Glu Phe Leu Asp Val His Phe Val Ala Pro Asp Gly Thr Arg 145 150 155 160 Gln Val Gln Arg Ala Arg Asn Leu Val Ile Ala Ala Gly Ile Glu Pro 165 170 175 Arg Leu Pro Ala Gly Leu Pro Ala Ser Pro Arg Ile Trp His Thr Ala 180 185 190 Lys Phe Leu Pro Glu Val Asp Arg Ile Ala Arg Gln Asp Pro Arg Ser 195 200 205 Phe Val Val Leu Gly Ser Gly Gln Ser Ala Ala Glu Ala Ile Glu His 210 215 220 Leu His Ala Arg Phe Pro Arg Ala Gln Val His Ser Val His Ala Arg 225 230 235 240 Tyr Gly Phe Ser Val Ala Asp Asp Ser Pro Phe Ala Asn Gln Val Phe 245 250 255 Asn Pro Glu Ala Val Asp Arg Phe His Thr Ala Pro Asp Asp Val Arg 260 265 270 Gln Arg Leu Ile Asp Tyr His Ala Ser Thr Asn Tyr Ser Val Val Asp 275 280 285 Ala Asp Leu Leu His Ser Leu Phe Gln Gln Ala Tyr Leu Glu Lys Val 290 295 300 Ala Gly Asn Pro Arg Leu Asn Phe His Asn Val Ser Arg Val Ser Glu 305 310 315 320 Val Thr Glu Thr Pro Asp Gly Leu Arg Ile Asp Val Glu Ser Leu Ser 325 330 335 Ser Gly Thr Ser Thr Val Ile Glu Ala Gln Ala Leu Val Cys Ala Thr 340 345 350 Gly Tyr Thr Arg Thr Asp Pro Ala Val Phe Leu Asp Gly Leu Leu Pro 355 360 365 His Cys Pro Leu Asp Asp Gln Gly Arg Leu Arg Leu Asp Arg Glu His 370 375 380 Arg Val Val Thr Asp Glu Ser Val Arg Cys Gly Ile Tyr Val Gln Gly 385 390 395 400 Phe Gly Glu His Ser His Gly Leu Ser Glu Thr Leu Leu Ser Leu Ser 405 410 415 Ala Val Arg Ala Gly Glu Ile Gly Asp Met Leu Val Lys Ala Leu Ser 420 425 430 Gly 4439PRT Streptomyces diastatochromogenes 4Val Asn Val Ser Glu Pro Gly Ser Asp Gln Val Val Asp Val Val Gly 1 5 10 15 Ile Gly Phe Gly Pro Ser Asn Leu Ala Leu Ala Val Ala Leu Gly Glu 20 25 30 Gly Gly Arg Lys Ala Ser Glu Lys Pro Val Thr Ser Val Phe Phe Glu 35 40 45 Arg Lys Glu Arg Phe Thr Trp His Gly Gly Met Leu Ile Asp Gly Ala 50 55 60 Thr Met Gln Ile Ser Phe Leu Lys Asp Leu Val Thr Leu Arg Asp Pro 65 70 75 80 Arg Ser Pro Tyr Thr Phe Leu His Tyr Leu His Gln Val Gly Arg Leu 85 90 95 Pro Asp Phe Ile Asn His Lys Leu Leu Phe Pro Ser Arg Ile Glu Phe 100 105 110 His Asp Tyr Leu Cys Trp Val Ala Glu Ser Phe Asp His Gln Val Arg 115 120 125 Tyr Gly Ala Asp Val Val Asp Val Arg Pro Val His Ser Asp Gly Ala 130 135 140 Val Asn His Leu Asp Val Val Val Arg His Glu Gly Pro Glu Gly Glu 145 150 155 160 Arg Ile Ser Val Gln Arg Thr Arg Asn Val Val Val Gly Thr Gly Leu 165 170 175 Glu Ala His Met Pro Ala Gly Ala Ala Pro Gly Asp Arg Val Trp His 180 185 190 Thr Ser Glu Leu Leu His Lys Val Ala Ala Leu Lys Glu Glu Pro Arg 195 200 205 Arg Ile Val Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ala Thr Glu 210 215 220 Tyr Leu His Arg Arg Phe Glu Ala Ala Glu Ile Cys Pro Val Phe Thr 225 230 235 240 Arg Tyr Gly Tyr Ser Pro Ala Asp Asp Ser Pro Phe Ala Asn Arg Ile 245 250 255 Phe Asp Pro Leu Ala Val Asp Asp Tyr Tyr Ala Ala Thr Pro Glu Val 260 265 270 Lys Arg Met Leu Leu Gly Tyr His Arg Asn Thr Asn Tyr Ser Val Val 275 280 285 Asp Ala Glu Leu Ile Asp Glu Leu Tyr Arg Arg Val Tyr Gln Glu Lys 290 295 300 Val Gln Gly Arg His Arg Leu Lys Val Phe Asn Ala Ser Arg Leu Ala 305 310 315 320 Glu Val Lys Ala Gly Ala Glu Gly Val Gln Val Thr Val Glu Ser Val 325 330 335 Ile Ser Arg Cys Arg Thr Val Leu Asp Ala Asp Cys Val Val Tyr Ala 340 345 350 Thr Gly Tyr Arg Pro Thr Asp Val Arg Arg Leu Ile Gly Gly Met Ala 355 360 365 Gly Leu Cys Lys Ala Asp Glu Met Gly Arg Leu His Ala Asp Arg Asp 370 375 380 Tyr Arg Val Val Thr Glu Gly Asp Val His Cys Gly Ile Tyr Leu Gln 385 390 395 400 Gly Ala Thr Glu His Ser His Gly Ile Ser Ser Ser Leu Leu Ser Asn 405 410 415 Thr Ala Val Arg Ala Gly Glu Ile Ala Asp Ser Ile Val Ala Gly Val 420 425 430 Val Gly Ala Thr Ala Ser Glu 435 5447 PRTStreptomyces sp. DvalAA-43 5Met Asp Ala Ser Ala Arg Glu Thr Tyr Asp Val Val Gly Ile Gly Phe 1 5 10 15 Gly Pro Ser Asn Leu Ser Leu Ala Ile Ala Leu Glu Glu His Glu Ala 20 25 30 Asn Val Pro Ala Arg Pro Ile Ser Ala Ala Phe Phe Glu Arg Gln Pro 35 40 45 Ser Phe Gly Trp His Arg Asn Met Leu Leu Pro Ala Ala Thr Met Gln 50 55 60 Ile Ser Phe Leu Lys Asp Leu Ala Thr Phe Arg Asn Pro Val Ser Arg 65 70 75 80 Tyr Ser Phe Ile Ala Tyr Leu His Ala Ala Asp Arg Leu Val Gln Phe 85 90 95 Val Asn Asn Gln Thr Phe Phe Pro Thr Arg Gln Glu Phe His Gln Tyr 100 105 110 Leu Glu Trp Ala Glu Ser Ser Phe Ser Asp Arg Val Ser Tyr Asn Ser 115 120 125 Glu Val Thr Ala Ile Arg Arg Ala Thr Gly Thr Gly Pro Gly Glu Pro 130 135 140 Asp Cys Leu Gln Ile Glu Val Arg Asp Gly Ile Gly Gly Gly Cys Arg 145 150 155 160 Leu Val His Ala Arg Asn Val Ala Ile Ser Thr Gly Leu Val Pro Arg 165 170 175 Met Pro Ala Gly Val Glu Arg Asp Asp Arg Val Trp His Ser Ser Glu 180 185 190 Phe Leu Glu Lys Tyr Gly Gln Val Asp Pro Asn Ala Leu Lys Ser Val 195 200 205 Ala Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ile Thr Arg Phe Leu 210 215 220 His Asp Ala Leu Pro His Ala Arg Val Phe Ala Val Val Pro Ser Tyr 225 230 235 240 Gly Tyr Ser Val Ala Asp Asp Thr Pro Phe Ala Asn Arg Val Phe Asp 245 250 255 Pro Ser Ala Val Asp Asp Tyr Tyr Phe Gly Thr Glu Gln Thr Arg Glu 260 265 270 Ala Phe Trp Arg Tyr His Arg Asn Thr Asn Tyr Ser Val Val Asp Asp 275 280 285 Glu Ile Ile Arg Asp Leu His Gln Arg Ser Tyr Asp Glu Asp Val Arg 290 295 300 Asn Asp Arg Arg Leu His Phe Leu Asn Leu Thr Arg Val Asp Asp Val 305 310 315 320 Gln Arg Ile Gly Thr Glu Ile Arg Val Gly Leu Arg Ser Leu Ile Asp 325 330 335 Val Glu Ala Gln Thr Leu Asp Val Asp Ala Leu Val Phe Ala Thr Gly 340 345 350 Tyr Gly Ala Met Gln Pro Thr Gly Leu Leu Gly Asp Leu Asp Arg His 355 360 365 Cys Leu Arg Asp Ala Ala Gly Arg His Arg Ala Glu Arg Asp Tyr Arg 370 375 380 Leu Val Thr Thr Pro Glu Leu Ser Cys Gly Ile Tyr Leu Gln Gly Gly 385 390 395 400 Thr Glu His Thr His Gly Leu Thr Ser Ser Leu Leu Ser Asn Val Ala 405 410 415 Val Arg Ser Gly Glu Ile Ala Asp Ser Ile Val Arg Arg Arg Ala Glu 420 425 430 Glu His Glu Pro Val Ala Ser Leu Gly Thr Ser Gly Arg Thr Ser 435 440 445 6375 PRTCollimonas fungivorans 6Met Gln Val Cys Phe Leu Lys Asp Leu Ala Met Leu Arg Asn Pro Thr 1 5 10 15 Ser Pro Phe Thr Phe Leu Ser Tyr Leu His Asp Lys Asn Arg Leu Val 20 25

30 Asp Phe Val Asn His Lys Ile Leu Phe Ser Ser Arg Val Glu Phe His 35 40 45 Asp Tyr Leu Glu Trp Ala Ala Ala Lys Leu Lys Arg Leu Val Gln Tyr 50 55 60 Asp Ala Glu Val Val Glu Val Ser Pro Val Ile Cys Asp Gly Val Val 65 70 75 80 Lys Trp Leu Asp Val Val Val Gln Arg Asp Gly Asn Pro Ser His His 85 90 95 Glu Ile Tyr Arg Thr His Asn Leu Val Ile Ala Pro Gly Leu Glu Pro 100 105 110 Thr Met Pro Pro Gly Ile Ser Arg Ser Glu Arg Val Trp His Ser Ser 115 120 125 Glu Val Leu Asp Arg Ile Ala His Leu Thr Glu Glu Pro Gln Gln Phe 130 135 140 Thr Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ile Thr Ala Tyr Leu 145 150 155 160 His Asp His Phe Lys Tyr Ala Lys Val Arg Ser Ile Phe Ser Arg Tyr 165 170 175 Gly Tyr Ser Ala Ala Asp Asp Ser Pro Phe Thr Asn Arg Ile Phe Asp 180 185 190 Pro Leu Ala Val Asp Glu Tyr Tyr Gln Ala Arg Asp Asp Val Lys Lys 195 200 205 Met Leu Leu Asn Phe His Arg Asn Thr Asn Tyr Ser Val Val Asp Ala 210 215 220 Asp Leu Leu Glu Asp Leu Tyr Arg Arg His Tyr Gln Glu Met Val Arg 225 230 235 240 Gly Glu Ser Arg Leu Glu Phe Met Asn Val Ser Lys Val Phe Gly Ala 245 250 255 Val Ala Asp Arg Asp Ser Val Asp Leu Ser Val Glu Phe Leu Pro Thr 260 265 270 Gly Asp Met Arg Lys Leu Arg Ser Asp Ile Val Val Phe Gly Ser Gly 275 280 285 Tyr Lys Ile Ala Asp Pro Ile Arg Tyr Phe Ser Asp Phe Ala Gly Lys 290 295 300 Cys Ile Arg Asp Ser Phe Gly Gln Leu Arg Val Ala Arg Asn Tyr Arg 305 310 315 320 Ile Cys Thr Ser Glu Asp Val Glu Cys Gly Ile Tyr Leu Gln Gly Thr 325 330 335 Thr Glu His Thr His Gly Leu Ser Ser Thr Leu Leu Ser Asn Thr Ala 340 345 350 Val Arg Ala Gly Glu Ile Leu Glu Ala Met Thr Trp Glu Arg Asp Asn 355 360 365 Lys Lys Ile Ser Ser His Ala 370 375 7446PRTStreptomyces reticuli 7Met Thr Arg Leu Ala Gly Gln Ala Pro Thr Ala Gln His Ser Pro Glu 1 5 10 15 Ser Glu Val Arg Asp Val Thr Gly Ile Gly Phe Gly Ala Ala Asn Leu 20 25 30 Ala Leu Ala Val Ala Leu His Glu Ser Gly Ala Gly Asp Arg Ala Leu 35 40 45 Phe Leu Glu Lys Gln Lys Glu Phe Gly Trp His Arg Gly Met Leu Ile 50 55 60 Glu Gly Ser Ser Leu Gln Val Ser Phe Leu Lys Asp Ile Ala Thr Met 65 70 75 80 Arg Asn Pro Thr Ser Asp Phe Gly Phe Leu Ser Tyr Leu Gln Glu Lys 85 90 95 Gly Arg Leu Val Asp Phe Ile Asn Gln His Thr Leu Leu Pro Ser Arg 100 105 110 Ile Glu Tyr His Asp Tyr Leu Gln Trp Ala Ala Asp Arg Leu Gly His 115 120 125 Met Val Glu Tyr Gly Val Glu Ala Thr Gly Val Arg Pro Val Thr Asp 130 135 140 Ala Gly Glu Val Val Ala Leu Asp Val Leu Ala Gly Asp Arg Val Val 145 150 155 160 Thr Arg Thr Arg Asn Leu Val Ile Ala Ser Gly Leu Arg Pro Arg Leu 165 170 175 Pro Glu Gly Ala Glu Thr Gly Glu Arg Val Trp His Ser Ser Gln Leu 180 185 190 Leu His Arg Leu Pro Ala Phe Asp Glu Arg Pro Pro Arg Arg Ala Val 195 200 205 Val Val Gly Ala Gly Gln Ser Ala Ala Glu Val Ala Ala His Leu Met 210 215 220 Glu Arg Tyr Pro Gln Ala Glu Val Cys Ala Val Phe Ser Arg Tyr Gly 225 230 235 240 Tyr Ser Val Ala Asp Ser Ser Pro Phe Ala Asn Arg Val Phe Asp Pro 245 250 255 Ala Ala Val Asp Asp Phe Tyr Phe Ala Pro Pro Glu Val Lys Gln Ala 260 265 270 Ile Met Arg Tyr His Gly Gly Thr Asn Tyr Ala Val Val Asp Glu Asp 275 280 285 Val Leu Gln Gly Leu Tyr Arg Arg Gln Tyr Glu Gln Lys Val Thr Gly 290 295 300 Thr Pro Arg Leu Arg Val Met Asn Ala Ser Arg Leu Val Ser Val Glu 305 310 315 320 Pro Arg Gly Glu Thr Ala Ala Val Arg Val Glu Phe Leu Pro Thr Gly 325 330 335 Glu His Ala Asp Leu Asp Ala Asp Leu Val Val Tyr Ala Thr Gly Tyr 340 345 350 Arg Ser Ala Asp Pro Ala Glu Leu Leu Gly Gly Val Ala Gly Ser Leu 355 360 365 Arg Arg Asp Ala Ala Gly Gln Val Leu Ile Gly Arg Asp Tyr Arg Leu 370 375 380 Ser Thr Thr Gly Asp Phe Arg Cys Gly Ile Tyr Val Gln Gly Ala Thr 385 390 395 400 Glu Ala Thr His Gly Ile Ala Ser Thr Leu Leu Ser Met Val Ala Val 405 410 415 Arg Ala Gly Glu Ile Ala Gln Ser Ile Ile Gly Gly Arg Arg Asp Pro 420 425 430 Asp Arg Thr Ala Gly Thr Lys Ala Val Ala Gly Asn Arg Gly 435 440 445 8442 PRTStreptomyces scabies 8Met Glu Ala His Thr Asp Ala Tyr Glu Val Val Gly Ile Gly Phe Gly 1 5 10 15 Pro Ser Asn Leu Ser Leu Ala Ile Ala Leu Glu Glu Gln Arg Gly Lys 20 25 30 Asp Glu Lys Pro Leu Thr Ala Ala Phe Phe Glu Lys Gln Ala Ser Leu 35 40 45 Gly Trp His Arg Asn Met Leu Leu Pro Asp Thr Lys Met Gln Ile Ser 50 55 60 Phe Leu Lys Asp Leu Ala Thr Phe Arg Asn Pro Ala Ser Gln Trp Ser 65 70 75 80 Phe Ile Ala Tyr Leu His Ala Ala Gly Arg Leu Ala Gln Phe Val Asn 85 90 95 Asn Gln Asn Phe Phe Pro Thr Arg Asn Glu Phe His Asp Tyr Leu Asp 100 105 110 Trp Ala Glu Ser Ser Phe Ser Asp Arg Val Thr Tyr Asn Cys Glu Val 115 120 125 Asn Ala Val His Leu Pro Asp Gly Tyr Thr Gly Gly Pro Val Asp Thr 130 135 140 Val Arg Val Glu Val Lys Asp Asn Thr Pro Arg Gly Gly Thr Arg Leu 145 150 155 160 Val Glu Ala Arg Asn Leu Val Ile Ser Thr Gly Leu Val Pro Thr Met 165 170 175 Pro Thr Gly Ile Glu Arg Gly Glu Arg Val Trp His Ser Ser Glu Phe 180 185 190 Leu Gly Arg Phe Gly Thr Leu Asp Arg Asp Arg Val Arg Arg Phe Ala 195 200 205 Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ile Thr Arg Tyr Val Tyr 210 215 220 Asp Thr Val Pro Asn Ala Glu Val Tyr Ala Ile Met Pro Ser Tyr Gly 225 230 235 240 Tyr Ser Ile Ala Asp Asp Thr Pro Tyr Ala Asn Arg Ile Phe Asp Ala 245 250 255 Asp Ala Val Asp Asp Tyr Tyr Gly Gly Thr Asp His Thr Arg Glu Ser 260 265 270 Phe Trp Arg Tyr His Arg Asn Thr Asn Tyr Gly Val Ala Asp Asp Glu 275 280 285 Val Ile Arg Asp Leu Tyr Gln Arg Ala Tyr Asp Asp Glu Val Ala Arg 290 295 300 Ile Lys Arg Leu His Leu Leu Asn Leu Ser Arg Val Arg Thr Val Glu 305 310 315 320 Gln Thr Val Asp Gly Ala Arg Leu Thr Met His Ser Val Arg Asp Asp 325 330 335 Ser Thr Tyr Gly Leu Asp Val Asp Ala Ile Val Phe Ala Thr Gly Tyr 340 345 350 Asp Ser Met Asp Pro Thr Ala Leu Leu Gly Asp Leu Ala Pro His Cys 355 360 365 Leu Arg Asp Glu Glu Gly Arg Leu Arg Val Glu Arg Asp Tyr Arg Leu 370 375 380 Val Thr Ser Pro Asp Leu Asn Val Gly Ile Tyr Leu Gln Gly Gly Thr 385 390 395 400 Glu His Thr His Gly Leu Ala Ser Ala Leu Leu Ser Asn Ile Ala Ile 405 410 415 Arg Ser Gly Glu Ile Ala Asp Ala Ile Ala Ile Asp Leu Ala Ala Arg 420 425 430 Gln His Thr Thr Ala Arg Ser Thr Ile Gly 435 440 965 PRTKutzneria albida 9Met Gln Arg Asp Tyr Arg Val Val Thr Val Pro Glu Met Arg Cys Gly 1 5 10 15 Ile Tyr Leu Gln Gly Gly Thr Glu His Thr His Gly Leu Thr Ser Ser 20 25 30 Leu Leu Ser Asn Ile Val Ile Arg Thr Gly Glu Ile Thr Asp Ser Ile 35 40 45 Ile Thr Arg Arg Ala Glu Leu Asn Val Gly Glu Arg Arg Thr Val Asn 50 55 60 Gly 65 10439PRTStreptomyces albus 10Met Thr Gly Pro Glu Val Tyr Asp Ile Val Gly Val Gly Phe Gly Pro 1 5 10 15 Ala Asn Leu Ala Leu Ala Val Ala Leu Thr Glu Arg Gly Ser Ser Thr 20 25 30 Pro Leu Arg Ala Leu Phe Leu Asp Arg Asn Glu Ser Phe Ser Trp His 35 40 45 Pro Gly Met Leu Ile His Asp Ala Thr Met Gln Val Asn Phe Leu Lys 50 55 60 Asp Leu Ile Thr Leu Arg Asn Pro Ala Ser Asp Phe Ser Phe Leu Ser 65 70 75 80 Tyr Leu Lys Ala Arg Gly Arg Leu Val Asp Phe Ile Asn His Lys Thr 85 90 95 Phe Phe Pro Thr Arg Val Glu Phe His Asp Tyr Leu Glu Trp Ala Ala 100 105 110 Gly Arg Val Gly Asp Val Val Glu Tyr Gly Thr Glu Val Val Asp Val 115 120 125 Arg Pro Val Glu Arg Asp Gly Glu Val Val Tyr Phe Asp Val Val Gly 130 135 140 His Gln Gln Val Gly Gly Val Ser Gln Ala Val Val Cys Arg Ala Arg 145 150 155 160 Asn Val Val Val Ala Pro Gly Leu Val Pro Arg Leu Pro Gly Glu Ala 165 170 175 Ser Gln Ser Glu Arg Val Trp His Ser Ser Glu Leu Leu His Arg Val 180 185 190 Gly Asp Leu Pro Thr Asp Lys Arg Met Gln Phe Val Val Val Gly Ala 195 200 205 Gly Gln Ser Ala Ala Glu Val Val Gly Tyr Leu His Ala Arg Tyr Glu 210 215 220 Cys Ala Asp Val His Ala Val His Ser Arg Tyr Gly Tyr Ser Pro Ala 225 230 235 240 Asp Asp Thr Pro Phe Ala Asn Arg Val Phe Asp Pro Ala Ala Val Glu 245 250 255 His Phe Phe His Ala Pro Pro Ser Val Lys Asp Lys Phe Phe Glu Tyr 260 265 270 His Ala Asn Thr Asn Tyr Ser Val Val Asp Val Glu Leu Ile Glu Asp 275 280 285 Leu Tyr Ala Arg Val Tyr Arg Glu Ser Val Thr Glu Arg Arg Arg Leu 290 295 300 His Ile His Gly Met Ser Glu Leu Thr Glu Val Ala Asp Gly Pro Glu 305 310 315 320 Gly Leu Arg Val Ser Val Arg Phe Leu Pro Asp Gly Thr Thr Thr Val 325 330 335 Leu Glu Pro Asp His Val Val Tyr Ala Thr Gly Tyr Lys Pro Ala Asp 340 345 350 Val Asn Arg Val Ile Gly Val Val Ala Glu Leu Cys Lys Arg Asp Ser 355 360 365 Ser Gly Asn Leu Arg Leu Leu His Asp Tyr Arg Val Asp Met Ala Ser 370 375 380 His Val Arg Cys Gly Ile Tyr Leu Gln Gly Gly Thr Glu His Ser His 385 390 395 400 Gly Ile Thr Ser Ser Leu Leu Ser Asn Leu Ala Asp Arg Ala Ala Glu 405 410 415 Ile Leu Asp Ser Val Leu Ala His Gly Gly Gln Leu Ser Ala Asp Ala 420 425 430 Ala Ala Trp Glu Val Ala Ser 435 11424 PRTRhodococcus fascians 11Met Gly Ala Gln Ser Gly Ser Ser Val Ala Asp Val Val Gly Val Gly 1 5 10 15 Phe Gly Pro Ser Asn Leu Ala Leu Ala Ile Ala Leu Gln Glu Ser Ile 20 25 30 Gln Pro Gly Pro Val Pro Ala Lys Phe Ser Met Lys Phe Tyr Glu Leu 35 40 45 Gln Pro Arg Phe Gly Trp His Arg Gly Met Leu Met Glu Asp Ala Thr 50 55 60 Met Gln Val Ser Phe Leu Lys Asp Leu Ala Thr Met Arg Asn Pro Met 65 70 75 80 Ser Arg Tyr Thr Phe Val Ser Tyr Leu Arg Glu Lys Glu Arg Ile Ala 85 90 95 Glu Phe Ile Asn Ser Lys Thr Leu Tyr Pro Leu Arg Val Glu Phe His 100 105 110 Asp Tyr Leu Glu Trp Ala Ala Ser Gln Phe Gln Ser Asn Val Ser Tyr 115 120 125 Gly Ser Glu Ile Lys Asp Ile Arg Pro Val Val Glu Asn Gly Val Val 130 135 140 Glu Tyr Val Asp Val Val Gly Pro Asp Asp Val Val Gln Arg Ala Arg 145 150 155 160 Asn Ile Val Ile Gly Met Gly Leu Thr Pro Arg Leu Pro Asp Gly Val 165 170 175 Asn Arg Ser Glu Arg Ile Trp His Ser Ser Gln Leu Leu Gly Arg Ala 180 185 190 Ala Ala Val Thr Tyr Val Pro Gln Asn Phe Val Val Val Gly Ser Gly 195 200 205 Gln Ser Ala Ala Glu Val Ala Asp Tyr Leu His Arg Thr Phe Pro Arg 210 215 220 Ala Asn Val His Thr Val Leu Ser Arg Tyr Gly Tyr Ser Val Ala Asp 225 230 235 240 Asp Ser Pro Tyr Ala Asn Gly Ile Phe Asp Pro Glu Gly Val Asp Arg 245 250 255 Phe Phe Ser Ala Pro Thr Asp Glu Lys Gln Arg Leu Leu Glu Tyr His 260 265 270 Ala Asn Thr Asn Tyr Ser Val Val Asp Leu Asp Ile Ser Gln Ser Leu 275 280 285 Tyr Leu Lys Ser Tyr Gln Glu Lys Val Leu Gly Lys Gln Arg Leu Arg 290 295 300 Met Ile Asn Thr Ser Arg Val Thr Ser Val Asp Glu Asp Thr Asp Gly 305 310 315 320 Val Arg Val Glu Val Thr Ser Ser Ala Thr Gly Leu Thr His Thr Ile 325 330 335 Glu Ala Asp Val Ile Val Tyr Ala Thr Gly Tyr Arg Pro Ser Asp Pro 340 345 350 Ala Pro Leu Leu Gln Gly Leu Met Arg Glu Cys Lys His Asp Glu Gln 355 360 365 Gly Arg Leu Ser Val Gly Arg Asp Tyr Arg Val Thr Thr Ser Asp Ala 370 375 380 Val Arg Ala Gly Ile Tyr Val His Gly Ala Ser Thr Glu His Ser His 385 390 395 400 Gly Leu Ser Ala Gly Leu Leu Ser Asn Thr Ala Val Arg Ser Gly Glu 405 410 415 Ile Ala Gln Ser Ile Leu Arg Arg 420 12439PRTStreptomyces neyagawaensis 12Met Glu Ala Asn Thr Glu Ala Tyr Glu Val Val Gly Ile Gly Phe Gly 1 5 10 15 Pro Ala Asn Leu Ser Leu Ala Ile Ala Leu Glu Glu Gln Arg Gly Lys 20 25 30 Asp Glu Lys Gln Leu Thr Ala Ala Phe Phe Glu Lys Gln Pro Ser Leu 35 40 45 Gly Trp His Arg Asn Met Leu Leu Pro Asp Thr Lys Met Gln Ile Ser 50 55 60 Phe Leu Lys Asp Leu Ala Thr Phe Arg Asn Pro Ala Ser Gln Trp Ser 65 70 75 80 Phe Ile Ala Tyr Leu His Ala Ala Gly Arg Leu Ala Gln Phe Val Asn 85 90 95 Asn Gln Asn Phe Phe Pro Thr Arg Asn Glu Phe His Asp Tyr Leu Glu 100

105 110 Trp Ala Glu Ser Ser Phe Ser Asp Arg Val Thr Tyr Asn Ser Glu Val 115 120 125 Asn Ala Val His Leu Pro Asp Gly His Asp Gly Gly Pro Val Asp Thr 130 135 140 Val Arg Val Glu Val Lys Asp Asn Gly Pro Arg Gly Gly Thr Arg Leu 145 150 155 160 Val Glu Ala Arg Asn Leu Val Ile Ser Thr Gly Leu Val Pro Lys Met 165 170 175 Pro Asp Gly Val Asp Arg Gly Glu Arg Val Trp His Ser Ser Glu Phe 180 185 190 Leu Gly Arg Phe His Thr Leu Asp Pro Ser Arg Val Arg Arg Phe Ala 195 200 205 Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ile Thr Arg Tyr Val Tyr 210 215 220 Asp Thr Ile Pro Asp Ala Glu Val Tyr Ala Ile Met Pro Ser Tyr Gly 225 230 235 240 Tyr Ser Ile Ala Asp Asp Thr Pro Tyr Ala Asn Arg Ile Phe Asp Ala 245 250 255 Asp Ala Val Asp Asp Tyr Tyr Gly Gly Thr Asp Arg Thr Arg Glu Ser 260 265 270 Phe Trp Arg Tyr His Arg Asn Thr Asn Tyr Gly Val Ala Asp Asp Glu 275 280 285 Val Ile Arg Asp Leu Tyr Gln Arg Ala Tyr Asp Asp Glu Val Ala Arg 290 295 300 Ile Lys Arg Leu His Leu Leu Asn Leu Ser Arg Val Gln Arg Val Asp 305 310 315 320 Gln Arg Ala Asp Gly Ala Arg Leu Thr Met His Ser Val Arg Asp Asp 325 330 335 Ser Val Tyr Asp Leu Asp Val Asp Ala Ile Val Phe Ala Thr Gly Tyr 340 345 350 Asp Ser Met Asp Pro Thr Ala Leu Leu Gly Asp Leu Ala Pro Tyr Cys 355 360 365 Leu Arg Asp Asp Glu Gly Arg Leu Arg Val Glu Arg Asp Tyr Arg Leu 370 375 380 Val Thr Lys Pro Glu Leu Asn Val Gly Ile Tyr Leu Gln Gly Gly Thr 385 390 395 400 Glu His Thr His Gly Leu Ala Ser Ser Leu Leu Ser Asn Ile Ala Ile 405 410 415 Arg Ser Gly Glu Ile Ala Asp Ala Ile Ala Ile Ala Ile Asp Leu Ala 420 425 430 Ser Arg Arg His Thr Thr Val 435 13435 PRTKutzneria buriramensis 13Met Asp Thr Arg Gly Ser Glu Thr Tyr Asp Val Val Gly Ile Gly Phe 1 5 10 15 Gly Pro Ala Asn Leu Ser Leu Ala Ile Ala Leu Glu Glu Ser Pro Gln 20 25 30 Arg Leu Thr Ser Ala Phe Phe Glu Arg Gln Pro Ser Leu Gly Trp His 35 40 45 Arg Gly Met Leu Val Pro Ala Ala Lys Met Gln Val Ala Phe Leu Lys 50 55 60 Asp Leu Val Thr Phe Arg Asn Pro Thr Ser Thr Phe Ser Phe Val Ser 65 70 75 80 Tyr Leu His Asp Arg Gly Arg Leu Ala Arg Phe Val Asn Asn Gln Asp 85 90 95 Phe Phe Pro Thr Arg Arg Glu Phe His Asp Tyr Leu Glu Trp Ala Glu 100 105 110 Ser Arg Val Ser His Arg Val Ser Tyr Gln Ser Glu Val Thr Ala Met 115 120 125 Arg Leu Pro Cys Ala Gln Arg Pro Gly Glu Asp Asp His Val Glu Val 130 135 140 Glu Val Arg Asp Arg Thr Ala Pro Ser Gly Ser Arg Thr Val Ala Ala 145 150 155 160 Arg Asn Val Val Ile Ser Thr Gly Leu Val Pro Arg Met Pro Ala Gly 165 170 175 Leu Gln Thr Asp Glu Phe Val Trp His Ser Ser Glu Phe Leu His Lys 180 185 190 Phe Ser Arg Ala Asp His Ser Gly Leu Lys Arg Val Ala Val Val Gly 195 200 205 Ala Gly Gln Ser Ala Ala Glu Ile Val Arg Phe Leu Tyr Asp Met Leu 210 215 220 Pro Asp Ala Asn Val Phe Ala Ile Ile Pro Ser Tyr Gly Tyr Ser Ile 225 230 235 240 Ala Asp Asn Thr Pro Phe Ala Asn Gln Ile Phe Asp Pro Ala Ala Val 245 250 255 Asp Asp Phe Tyr Ala Gly Ser Asp Gln Ala Lys Asp Ala Ile Trp Arg 260 265 270 Tyr His Arg Asn Thr Asn Tyr Ser Val Val Asp Asp Glu Val Ile Lys 275 280 285 Asp Leu Tyr Arg Arg Gln Tyr Asp Asp Asp Leu Gly Arg Pro Gly Arg 290 295 300 Leu Ala Phe Leu Asn Leu Ser Arg Val Leu Asp Val Lys Arg Val Gly 305 310 315 320 Glu Asp Thr Arg Val Thr Val His Ser Thr Ala Thr Glu Gln Ala Ala 325 330 335 Asp Leu Asp Val Asp Val Leu Val Cys Ala Thr Gly Tyr Ser Pro Met 340 345 350 Glu Pro Ala Asp Leu Leu Gly Asp Leu Ala Arg Tyr Cys Val Tyr Asp 355 360 365 Gly Asp Gly Arg Tyr Gln Val Asp Arg Asp Tyr Arg Leu Val Thr Pro 370 375 380 Asp Leu Asp Cys Gly Ile Tyr Leu Gln Gly Gly Thr Glu His Thr His 385 390 395 400 Gly Leu Ser Ser Ser Leu Leu Ser Asn Ile Ala Val Arg Ser Gly Glu 405 410 415 Ile Ala Ala Ser Ile Ala Arg Arg Arg Leu Ser Thr Asn Gly Asn Gly 420 425 430 Val His Ala 435 14448PRTStreptomyces yanglinensis 14Met Ser Asn Arg Glu Gln Thr Tyr Asp Val Val Gly Ile Gly Phe Gly 1 5 10 15 Pro Ser Asn Leu Ser Leu Ala Ile Ala Leu Glu Glu Phe Gly Ala His 20 25 30 Gly Met Glu Asn Glu Ile Ser Ser Leu Phe Leu Glu Arg Gln Pro Ser 35 40 45 Phe Gly Trp His Arg Asn Met Leu Leu Pro Ser Ala Thr Met Gln Ile 50 55 60 Ser Phe Leu Lys Asp Leu Val Thr Phe Arg Asn Pro Thr Ser Gly Phe 65 70 75 80 Ser Phe Ile Ala Tyr Leu His Ala Ser Gly Arg Leu Pro Gln Phe Val 85 90 95 Asn Asn Gln Asp Phe Phe Pro Thr Arg Gln Glu Phe His Gln Tyr Leu 100 105 110 Glu Trp Ala Gln Ala Gln Val Ala Gly Arg Ile Glu Tyr Gly Ala Glu 115 120 125 Val Thr Ser Ile Arg Leu Pro Ser Gly Thr Ala Pro Gln Glu Gly Ala 130 135 140 Asp Arg Leu Val Leu Glu Val Ala Glu Gly Ala Gly Arg Thr Gly Arg 145 150 155 160 Ala Val Glu Ala Arg Asn Val Val Ile Ser Thr Gly Leu Val Pro Ser 165 170 175 Met Pro Ala Gly Ala Glu Arg Asp Glu Arg Val Trp His Ser Ser Glu 180 185 190 Phe Leu Asp Lys Tyr Arg Arg Thr Asp His Arg Glu Leu Arg Arg Val 195 200 205 Ala Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ile Ala Arg Phe Leu 210 215 220 Tyr Asp Glu Leu Pro His Ala Gln Val Ser Ala Ile Ile Pro Ser Tyr 225 230 235 240 Gly Tyr Ala Val Ala Asp Asp Thr Pro Phe Ala Asn Arg Ile Phe Asp 245 250 255 Pro Ser Ala Val Asp Asp Tyr Tyr Phe Gly Thr Glu Gln Thr Arg Glu 260 265 270 Ser Phe Trp Arg Tyr His Arg Asn Thr Asn Tyr Ser Val Val Asp Asp 275 280 285 Glu Val Ile Arg Asp Leu Tyr Arg Arg Ser Tyr Asp Asp Glu Val Arg 290 295 300 Gly Val Thr Arg Leu Gln Leu Leu Asn Leu Thr Arg Val Thr Gly Val 305 310 315 320 Lys Arg Ala Gly Ala Glu Thr Arg Val Ser Leu Gln Val Gly Pro Asp 325 330 335 Ala Glu Leu Arg Glu Leu Asp Phe Asp Leu Leu Val Cys Ala Thr Gly 340 345 350 Tyr Asp Gly Met Glu Pro Thr Gly Leu Leu Gly Glu Leu Asp Arg Tyr 355 360 365 Cys Leu Arg Asp Glu Ala Gly Arg Tyr Arg Val Glu Arg Asp Tyr Arg 370 375 380 Ile Val Thr Thr Pro Glu Leu Arg Cys Gly Ile Tyr Leu Gln Gly Gly 385 390 395 400 Thr Glu His Thr His Gly Leu Thr Ser Ser Leu Leu Ser Asn Leu Ala 405 410 415 Val Arg Ser Gly Glu Ile Ala Asp Ser Ile Ile Ala Arg Arg Ala Gly 420 425 430 Tyr Gly Ala Glu Arg Glu Val Leu Ala Lys Ile Gly Gly Asp Ile Ala 435 440 445 15448 PRTStreptomyces griseochromogenes 15Met Ser Asp Arg Glu His Glu Thr Tyr Asp Val Val Gly Ile Gly Phe 1 5 10 15 Gly Pro Ser Asn Leu Ser Leu Ala Ile Ala Leu Glu Glu Tyr Arg Ala 20 25 30 Asn Gly Pro Glu Asn Glu Ile Ser Ala Leu Phe Leu Glu Arg Gln Ser 35 40 45 Ala Phe Gly Trp His Arg Asn Met Leu Leu Pro Ser Thr Thr Met Gln 50 55 60 Ile Ser Phe Leu Lys Asp Leu Val Thr Phe Arg Asn Pro Thr Ser Ser 65 70 75 80 Phe Ser Phe Ile Ala Tyr Leu His Ala Ser Gly Arg Leu Pro Gln Phe 85 90 95 Val Asn Asn Gln Asp Phe Phe Pro Thr Arg Gln Glu Phe His Gln Tyr 100 105 110 Leu Glu Trp Ala Gln Ala Arg Val Ala Asp Arg Val Ala Tyr Gly Ser 115 120 125 Glu Val Thr Ser Ile Arg Leu Pro Pro Gly Ala Asp Pro Glu Arg Ser 130 135 140 Asp Arg Leu Arg Leu Glu Val Ala Asp Ala Thr Gly Arg Asn Gly Arg 145 150 155 160 Val Val Glu Ala Arg Asn Val Val Ile Ser Thr Gly Leu Val Pro Ser 165 170 175 Met Pro Val Gly Thr Glu Arg Asp Glu Arg Val Trp His Ser Ser Glu 180 185 190 Phe Leu Glu Lys Tyr Arg Arg Met Asn Pro Ala Glu Leu Arg Arg Val 195 200 205 Ala Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ile Thr Arg Phe Leu 210 215 220 Tyr Asp Glu Leu Pro His Ala Glu Val Cys Ala Val Ile Pro Ser Tyr 225 230 235 240 Gly Tyr Ser Val Ala Asp Asp Thr Pro Phe Ala Asn Gln Ile Phe Asp 245 250 255 Pro Gly Ala Val Asp Asp Tyr Tyr Phe Gly Thr Glu Gln Thr Arg Glu 260 265 270 Ala Phe Trp Arg Tyr His Arg Asn Thr Asn Tyr Ser Val Val Asp Asp 275 280 285 Glu Val Ile Arg Asp Leu Tyr Arg Arg Ser Tyr Asp Asp Glu Val Arg 290 295 300 Gly Val Arg Arg Leu Gln Phe Leu Asn Leu Thr Arg Val Thr Ser Val 305 310 315 320 Lys Arg Val Gly Ala Glu Thr Arg Val Ser Leu Gln Val Gly Pro Asp 325 330 335 Asp Glu Val Arg Glu Leu Asp Phe Asp Ala Leu Val Cys Ala Thr Gly 340 345 350 Tyr Ser Thr Met Glu Pro Thr Asp Leu Leu Gly Asp Leu Asp Arg His 355 360 365 Cys Leu Arg Asp Glu Ala Gly Arg Tyr Arg Val Glu Arg Asp Tyr Arg 370 375 380 Ile Val Thr Ala Pro Glu Met Arg Cys Gly Ile Tyr Leu Gln Gly Gly 385 390 395 400 Thr Glu His Thr His Gly Leu Thr Ser Ser Leu Leu Ser Asn Ile Ala 405 410 415 Val Arg Ser Gly Glu Ile Ala Asp Ser Ile Val Ala Gly Arg Ala Gly 420 425 430 Arg Asn Ala Glu Arg Ala Leu Leu Ala Glu Val Gly Gly Asp Thr Arg 435 440 445 16450 PRTStreptomyces incarnatus 16Met Asp Ile Ala Gly Arg Pro Ser Gln Glu Ile Tyr Asp Val Val Gly 1 5 10 15 Ile Gly Phe Gly Pro Ser Asn Met Ser Leu Ala Ile Ala Leu Glu Glu 20 25 30 His Glu Ala Ser Ser Pro Gln His Pro Leu Lys Cys His Phe Phe Glu 35 40 45 Arg Gln Pro Thr Phe Gly Trp His Arg Asn Met Leu Leu Pro Ser Thr 50 55 60 Thr Met Gln Ile Ser Phe Leu Lys Asp Leu Ala Thr Phe Arg Asn Pro 65 70 75 80 Thr Ser Arg Phe Ser Phe Ile Ser Tyr Leu His Ala Ala Asp Arg Leu 85 90 95 Val Gln Phe Val Asn Asn Gln Asp Phe Phe Pro Thr Arg Gln Glu Phe 100 105 110 His Gln Tyr Leu Glu Trp Ala Ala Ala Gly Leu Arg Asp Arg Val Thr 115 120 125 Tyr Gly Ala Glu Val Thr Ser Ile Arg Pro Ala Gly Glu Ala Gly Ser 130 135 140 Gly Thr Ser Asp Ile Leu Glu Ile Glu Val Arg Gly Gly Asp Gly Thr 145 150 155 160 Thr Ser Val Val Ser Ala Arg Asn Val Val Ile Ser Thr Gly Leu Val 165 170 175 Pro Arg Leu Pro Glu Gly Val Thr Ser Asp Glu Arg Val Trp His Ser 180 185 190 Ser Glu Phe Leu Ser Arg Phe His Ala Gln Ala Pro Gly Asp Leu Lys 195 200 205 Ser Val Ala Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ile Thr Arg 210 215 220 Phe Leu Tyr Asp Ser Leu Pro His Ala Gln Val Thr Ala Val Ile Pro 225 230 235 240 Ser Tyr Gly Tyr Ser Val Ala Asp Asp Thr Pro Phe Ala Asn Gln Val 245 250 255 Phe Asp Pro Ser Ala Val Asp Glu Tyr Tyr Phe Gly Thr Glu Arg Ala 260 265 270 Arg Asp Ser Phe Trp Arg Tyr His Arg Asn Thr Asn Tyr Ser Val Val 275 280 285 Asp Ala Asp Val Ile Arg Ala Leu Tyr Gln Arg Ser Tyr Asp Glu Gln 290 295 300 Val Arg Gly Ser Gln Arg Leu His Phe Arg Asn Leu Thr Arg Val Asp 305 310 315 320 Glu Val Glu Arg Val Gly Ser Gly Ala Arg Val Val Val Arg Ser Val 325 330 335 Leu Asp Asp Arg Thr Glu Glu Leu Ala Leu Asp Ala Leu Val Phe Ala 340 345 350 Thr Gly Tyr Asp Gly Leu Asp Pro Ala Arg Leu Leu Gly Asp Phe Asp 355 360 365 Arg His Phe Leu Arg Asp Ala Ala Gly Arg His Arg Val Glu Arg Asp 370 375 380 Tyr Arg Leu Val Pro Ala Ser Gly Leu Thr Ala Gly Val Tyr Leu Gln 385 390 395 400 Gly Gly Thr Glu His Thr His Gly Leu Ser Ser Ala Leu Leu Ser Asn 405 410 415 Ile Ala Val Arg Ser Gly Glu Ile Ala Asp Ser Ile Val Leu Arg Arg 420 425 430 Thr Glu Arg Glu Leu Gly Ser Gly Arg Pro Val Gln Ala Ala Arg Ser 435 440 445 Ala Ala 450 17444PRTStreptomyces albulus 17Met Glu Ser His Arg Met Thr Gly Pro Glu Val Tyr Asp Ile Val Gly 1 5 10 15 Val Gly Phe Gly Pro Ala Asn Leu Ala Leu Ala Val Ala Leu Thr Glu 20 25 30 Arg Gly Ser Ser Thr Pro Leu Arg Ala Leu Phe Leu Asp Arg Asn Glu 35 40 45 Ser Phe Ser Trp His Pro Gly Met Leu Ile His Asp Ala Thr Met Gln 50 55 60 Val Asn Phe Leu Lys Asp Leu Ile Thr Leu Arg Asn Pro Ala Ser Asp 65 70 75 80 Phe Ser Phe Leu Ser Tyr Leu Lys Ala Arg Gly Arg Leu Val Asp Phe 85 90 95 Ile Asn His Lys Thr Phe Phe Pro Thr Arg Val Glu Phe His Asp Tyr 100 105 110 Leu Glu Trp Ala Ala Gly Arg Val Gly Asp Val Val Glu Tyr Gly Thr 115 120 125 Glu Val Val Asp Val Arg Pro Val Glu Arg Asp Gly Glu Val Val Tyr 130 135 140 Phe Asp Val Val Gly His Gln Gln Val Gly Gly Val Ser Gln Ala Val 145 150

155 160 Val Cys Arg Ala Arg Asn Val Val Val Ala Pro Gly Leu Val Pro Arg 165 170 175 Leu Pro Gly Glu Ala Ser Gln Ser Glu Arg Val Trp His Ser Ser Glu 180 185 190 Leu Leu His Arg Val Gly Asp Leu Pro Thr Asp Lys Arg Met Gln Phe 195 200 205 Val Val Val Gly Ala Gly Gln Ser Ala Ala Glu Val Val Gly Tyr Leu 210 215 220 His Ala Arg Tyr Glu Cys Ala Asp Val His Ala Val His Ser Arg Tyr 225 230 235 240 Gly Tyr Ser Pro Ala Asp Asp Thr Pro Phe Ala Asn Arg Val Phe Asp 245 250 255 Pro Ala Ala Val Glu His Phe Phe His Ala Pro Pro Ser Val Lys Asp 260 265 270 Lys Phe Phe Glu Tyr His Ala Asn Thr Asn Tyr Ser Val Val Asp Val 275 280 285 Glu Leu Ile Glu Asp Leu Tyr Ala Arg Val Tyr Arg Glu Ser Val Thr 290 295 300 Glu Arg Arg Arg Leu His Ile His Gly Met Ser Glu Leu Thr Glu Val 305 310 315 320 Ala Asp Gly Pro Glu Gly Leu Arg Val Ser Val Arg Phe Leu Pro Asp 325 330 335 Gly Thr Thr Thr Val Leu Glu Pro Asp His Val Val Tyr Ala Thr Gly 340 345 350 Tyr Lys Pro Ala Asp Val Asn Arg Val Ile Gly Val Val Ala Glu Leu 355 360 365 Cys Lys Arg Asp Ser Ser Gly Asn Leu Arg Leu Leu His Asp Tyr Arg 370 375 380 Val Asp Met Ala Ser His Val Arg Cys Gly Ile Tyr Leu Gln Gly Gly 385 390 395 400 Thr Glu His Ser His Gly Ile Thr Ser Ser Leu Leu Ser Asn Leu Ala 405 410 415 Asp Arg Ala Ala Glu Ile Leu Asp Ser Val Leu Ala His Gly Gly Gln 420 425 430 Leu Ser Ala Asp Ala Ala Ala Trp Glu Val Ala Ser 435 440 18450 PRTStreptomyces tsukubaensis 18Met Gly Ile Thr Gly Arg Gly Lys His Glu Val Leu Asp Leu Val Gly 1 5 10 15 Ile Gly Phe Gly Pro Ser Asn Leu Ala Leu Ala Ile Ala Leu Asp Glu 20 25 30 His Gly Ala Ser Ala Pro Gln His Pro Val Thr Ser His Phe Phe Glu 35 40 45 Arg Gln Pro Ala Phe Gly Trp His Arg Asn Met Leu Leu Pro Ser Thr 50 55 60 Thr Met Gln Ile Ser Phe Leu Lys Asp Leu Ala Thr Phe Arg Asn Pro 65 70 75 80 Met Ser Arg Phe Ser Phe Val Ser Tyr Leu His Ala Ser Asn Arg Leu 85 90 95 Val Gln Phe Val Asn Asn Gln Asp Phe Tyr Pro Thr Arg Gln Glu Phe 100 105 110 His Gln Tyr Leu Glu Trp Ala Ala Ala Ala Leu Gly Asp Arg Val Thr 115 120 125 Tyr Gly Ala Glu Val Ala Ser Ile Arg Pro Arg Thr Gly Pro Gly Ser 130 135 140 Arg Thr Ala Asp Leu Leu Glu Ile Glu Val Arg Arg Gly Asp Gly Thr 145 150 155 160 Thr Gly Thr Val Thr Ala Arg Asn Val Ala Ile Ser Thr Gly Leu Val 165 170 175 Pro Arg Leu Pro Lys Gly Val Thr Ser Gly Pro Arg Val Trp His Ser 180 185 190 Ser Glu Phe Leu Gly Arg Phe Gly Ala Gln Thr Pro Ala Asp Leu Arg 195 200 205 His Val Ala Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ile Thr Arg 210 215 220 Phe Leu His Asp Ser Leu Pro His Ala Gln Val Ser Ala Val Ile Pro 225 230 235 240 Ser Tyr Gly Tyr Ser Ile Ala Asp Asp Thr Pro Phe Ala Asn Gln Val 245 250 255 Phe Asp Pro Gly Ala Val Asp Glu Tyr Tyr Tyr Gly Thr Gln Arg Ala 260 265 270 Arg Asp Ala Phe Trp Arg Tyr His Gly Asn Thr Asn Tyr Ser Val Val 275 280 285 Asp Ala Asp Val Ile Arg Asp Leu Tyr Arg Arg Ser Tyr Asp Glu Glu 290 295 300 Val Arg Gly Gly Arg Arg Leu His Phe Arg Asn Leu Thr Arg Val Val 305 310 315 320 Glu Val Glu Gly Ser Ala Ser Gly Ala Trp Val Met Leu Arg Ser Leu 325 330 335 Leu Asp Asp Arg Arg Glu Glu Leu Ala Val Asp Ala Leu Val Phe Ala 340 345 350 Thr Gly Tyr Asp Gly Met Asp Pro Ala Arg Leu Leu Gly Asp Phe Asp 355 360 365 Arg His Phe Gln Arg Asp Ala Ala Gly Arg His Arg Leu Glu Arg Asp 370 375 380 Tyr Arg Leu Val Ser Ala Ser Gly Leu Thr Cys Gly Val Tyr Leu Gln 385 390 395 400 Gly Gly Thr Glu His Ser His Gly Leu Ser Ser Ser Leu Leu Ser Asn 405 410 415 Thr Ala Val Arg Ser Gly Glu Ile Ala Asp Ser Ile Val Met Arg Arg 420 425 430 Thr Arg Gln Glu Leu Gly Arg Ser Arg Ser Val Ala Glu Ser Pro Ser 435 440 445 Ala Ala 450 19432PRTStreptomyces himastatinicus 19Met Ala His Glu Thr Glu Ile Tyr Asp Val Val Gly Ile Gly Phe Gly 1 5 10 15 Pro Ser Asn Leu Ser Leu Ala Ile Ala Leu Glu Glu Ser Pro Asp Pro 20 25 30 Val Thr Ser Leu Phe Phe Glu Arg Gln Pro Thr Leu Gly Trp His Arg 35 40 45 Gly Met Leu Leu Pro Ser Ala Lys Met Gln Val Ser Phe Leu Lys Asp 50 55 60 Leu Ala Thr Phe Arg Asn Pro Ala Ser Gly Phe Gly Phe Ile Ser Tyr 65 70 75 80 Leu His Asp Met Gly Arg Leu Thr Arg Phe Val Asn Asn Gln Asp Phe 85 90 95 Phe Pro Thr Arg Arg Glu Phe His Asp Tyr Leu Glu Trp Ala Ala Ser 100 105 110 Lys Leu Thr Gly Arg Val Ser Tyr Asp Ser Glu Val Thr Ala Val Ser 115 120 125 Ala Val Ala Ala Ala Gly Glu Gly Pro Ala Asp Arg Val Arg Val Thr 130 135 140 Val Arg Gly Ala Asp Gly Ala Pro Arg Gln Val Glu Ala Arg Asn Val 145 150 155 160 Val Ile Ser Thr Gly Leu Val Pro Arg Met Pro Val Asn Leu Glu Ala 165 170 175 Gly Glu Arg Val Trp His Ser Ser Glu Phe Leu His Arg Phe Arg Gln 180 185 190 Arg Glu Gly Glu Leu Thr Arg Val Ala Val Val Gly Ala Gly Gln Ser 195 200 205 Ala Ala Glu Ile Val Arg Phe Leu Tyr Asp Thr Leu Pro Glu Val Arg 210 215 220 Val Ser Ala Val Ile Pro Ser Phe Gly Tyr Ala Ile Ala Asp Asp Thr 225 230 235 240 Pro Phe Ala Asn Gln Val Phe Asp Pro Asp Ala Val Asp Ser Tyr Tyr 245 250 255 His Gly Thr Gln Ala Ser Lys Asp Ala Val Trp Gln Tyr His Lys Asn 260 265 270 Thr Asn Tyr Ser Val Val Asp Asp Glu Val Ile Arg Gly Leu Tyr Glu 275 280 285 Arg Ala Tyr Glu Asp Glu Leu Ser Gly His Gly Arg Leu Asp Phe Arg 290 295 300 Asn Leu Ala Arg Val Leu Asp Ala Glu Pro Thr Gly Asp Gly Thr Arg 305 310 315 320 Ile Thr Val Tyr Ser Leu Val Asp Asp Ala Ser Tyr Asp Leu Asp Val 325 330 335 Asp Val Leu Ile Cys Ala Thr Gly Tyr Asp Pro Met Asn Pro Ala Arg 340 345 350 Val Leu Gly Glu Leu Asp Lys Tyr Cys Val His Asp Thr Glu Gly Arg 355 360 365 His Arg Val Asp Arg Asp Tyr Arg Leu Val Thr Thr Ser Asp Leu Thr 370 375 380 Cys Gly Ile Tyr Leu Gln Gly Gly Thr Glu His Thr His Gly Leu Gly 385 390 395 400 Ser Ser Leu Leu Ser Asn Ile Ala Val Arg Ser Gly Asp Ile Ala Gln 405 410 415 Ser Ile Thr Ala Arg Cys Ala Gly Ala Pro Lys Lys Gly Leu Thr Ala 420 425 430 20446PRTStreptomyces flaveolus 20Met Thr Arg Leu Ala Glu Gln Ser Ser Thr Ala Gln Gln Ser Pro Glu 1 5 10 15 Ser Glu Val Leu Asp Val Thr Gly Ile Gly Phe Gly Ala Ala Asn Leu 20 25 30 Ala Leu Ala Val Ala Leu His Glu Ser Glu Ala Ala Gly Lys Ala Leu 35 40 45 Phe Leu Glu Lys Gln Lys Glu Phe Gly Trp His Arg Gly Met Leu Leu 50 55 60 Gly Gly Ser Ser Leu Gln Val Ser Phe Leu Lys Asp Ile Ala Thr Met 65 70 75 80 Arg Asn Pro Thr Ser Asp Phe Gly Phe Leu Ser Tyr Leu Gln Glu Lys 85 90 95 Asp Arg Leu Val Asp Phe Ile Asn Gln His Thr Leu Leu Pro Ser Arg 100 105 110 Ile Glu Tyr His Asp Tyr Leu Gln Trp Ala Ala Asp Arg Leu Asn His 115 120 125 Leu Val Glu Tyr Gly Val Glu Ala Thr Gly Val Arg Pro Val Thr Glu 130 135 140 Ala Gly Glu Val Val Ala Leu Asp Val Leu Ala Gly Asp Arg Val Val 145 150 155 160 Ala Arg Thr Arg Asn Leu Val Leu Ala Ser Gly Leu Arg Pro Arg Leu 165 170 175 Pro Glu Gly Ala Glu Thr Gly Glu Arg Val Trp His Ser Ser Gln Leu 180 185 190 Leu His Arg Leu Pro Ala Phe Asp Glu Arg Pro Pro Arg Arg Ala Val 195 200 205 Val Val Gly Ala Gly Gln Ser Ala Ala Glu Val Ala Ala His Leu Met 210 215 220 Asp Arg Tyr Pro Gln Ala Glu Val Cys Ala Val Phe Ala Arg Tyr Gly 225 230 235 240 Tyr Ser Val Ala Asp Ser Ser Pro Phe Ala Asn Arg Val Phe Asp Pro 245 250 255 Ala Ala Val Asp Asp Phe Tyr Phe Ala Pro Pro Glu Val Lys Gln Ala 260 265 270 Ile Met Arg Tyr His Gly Gly Thr Asn Tyr Ala Val Val Asp Glu Asp 275 280 285 Val Leu Gln Gly Leu Tyr Arg Arg Gln Tyr Glu Gln Lys Val Ser Gly 290 295 300 Ala Pro Arg Leu Arg Val Met Asn Ala Ser Arg Leu Val Ser Val Glu 305 310 315 320 Pro Arg Gln Glu Ser Ala Ala Val Arg Val Glu Phe Leu Pro Thr Gly 325 330 335 Glu His Thr Asp Leu Asp Ala Asp Leu Val Val Tyr Ala Thr Gly Tyr 340 345 350 Asp Ser Thr Asp Pro Ala Glu Leu Leu Gly Gly Val Ser Gly Ala Leu 355 360 365 Arg Arg Asp Glu Ala Gly Glu Leu Leu Ile Gly Arg Asp Tyr Arg Leu 370 375 380 Gly Thr Thr Gly Asp Phe Arg Cys Gly Ile Tyr Val Gln Gly Ala Thr 385 390 395 400 Glu Ala Thr His Gly Ile Ala Ser Thr Leu Leu Ser Met Val Ala Val 405 410 415 Arg Ala Gly Glu Ile Ala Arg Ser Ile Thr Gly Gly Arg Cys Asp Pro 420 425 430 Asp Arg Ser Thr Gly Ser Lys Ala Ala Ala Gly Asn Arg Gly 435 440 445 21436 PRTStreptomyces aurantiacus 21Met Gly Thr Arg Glu His Glu Ile Tyr Asp Ile Val Gly Ile Gly Phe 1 5 10 15 Gly Pro Ser Asn Leu Ser Leu Ala Ile Ala Leu Glu Glu His Gln Ala 20 25 30 Asn Ser Ser Gln Gln Pro Val Arg Ala Ala Phe Phe Glu Arg Gln Pro 35 40 45 Ser Phe Gly Trp His Arg Asn Met Leu Leu Pro Gln Ala Thr Met Gln 50 55 60 Ile Ser Phe Leu Lys Asp Leu Ala Thr Phe Arg Asn Pro Leu Ser Arg 65 70 75 80 Tyr Ser Phe Val Ser Tyr Leu His Ala Ser Asp Arg Leu Val Gln Phe 85 90 95 Val Asn Asn Gln Asp Phe Phe Pro Thr Arg Gln Glu Phe His Gln Tyr 100 105 110 Leu Glu Trp Ala Glu Ser Gly Phe Arg Asp Arg Val Thr Tyr Asn Ser 115 120 125 Glu Val Thr Glu Ile Arg Val Ser Asp Glu Gly Ser Gly Gly Glu Gln 130 135 140 Leu Leu Glu Ile Val Val Arg Asp Thr Val Gly Gly Gly Thr Arg Val 145 150 155 160 Val Gln Ala Arg Asn Val Thr Val Ser Thr Gly Leu Val Pro Arg Met 165 170 175 Pro Asp Gly Met Leu Arg Asp Glu Arg Val Trp His Ser Ser Glu Phe 180 185 190 Leu Ala Lys Tyr Gly Arg Met Arg Pro Glu Asp Leu Lys Asn Val Ala 195 200 205 Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ile Thr Lys Tyr Leu His 210 215 220 Asp Lys Leu Pro His Ala Gln Val Ser Ala Ile Leu Pro Ser Tyr Gly 225 230 235 240 Tyr Ser Val Ala Asp Asp Thr Pro Phe Ala Asn Gln Val Phe Asp Pro 245 250 255 Thr Ala Val Asp His Tyr Tyr Phe Gly Thr Glu Asn Thr Arg Asp Ala 260 265 270 Phe Trp Arg Tyr His Lys Asn Thr Asn Tyr Ser Val Val Asp Asp Asp 275 280 285 Val Ile Arg Glu Leu Phe Arg Arg Ser Tyr Glu Glu Glu Val Ala Gly 290 295 300 Glu Lys Arg Leu His Phe Leu Asn Leu Thr Arg Val Lys Glu Val Lys 305 310 315 320 Arg Ser Gly Asn Asp Thr Arg Val Val Leu His Ser Leu Leu Asp Gly 325 330 335 Glu Ser Glu Gln Glu Met Asp Val Asp Ala Leu Val Phe Ala Thr Gly 340 345 350 Tyr Ser Thr Met Asp Ala Thr Arg Leu Leu Gly Asp Leu Asp Arg Phe 355 360 365 Cys Glu Arg Asp Glu Glu Gly Arg His Arg Val Glu Arg Asp Tyr Arg 370 375 380 Val Val Thr Ser Gly Glu Leu Ser Cys Gly Ile Tyr Leu Gln Gly Gly 385 390 395 400 Thr Glu His Thr His Gly Leu Thr Ser Ser Leu Leu Ser Asn Ile Ala 405 410 415 Val Arg Ser Gly Glu Ile Ala Asp Ser Ile Val Glu Arg Arg Gly Ala 420 425 430 Gly Gln Arg Val 435 22448 PRTStreptomyces sp. RJA2928 22Met Thr Asp Ser Ala Pro Glu Asp Arg Thr Val Asp Val Thr Gly Ile 1 5 10 15 Gly Phe Gly Pro Ser Asn Leu Ala Leu Ala Thr Ala Leu Ala Glu Pro 20 25 30 Ser Ala Thr Gly Pro Gly Arg Pro Leu Glu Ala Val Tyr Phe Glu Arg 35 40 45 Lys Asn Arg Phe Ser Trp His Gly Gly Met Leu Leu Asp Gly Ala Thr 50 55 60 Met Gln Ile Ser Phe Leu Lys Asp Leu Val Thr Leu Arg Asp Pro Arg 65 70 75 80 Ser Pro Tyr Ser Phe Leu Ser Tyr Leu His His Ala Gly Arg Leu Ser 85 90 95 Asp Phe Ile Asn His Lys Leu Leu Phe Pro Ser Arg Ile Glu Phe His 100 105 110 Asp Tyr Leu Glu Trp Val Ala Gly Phe Phe Glu Glu Gln Val Val Tyr 115 120 125 Gly Ser Glu Val Val Asp Val Arg Pro Val Ala Arg Glu Asp Ala Val 130 135 140 Glu His Met Asp Val Val Val Arg Gln Arg Thr Ala Ala Gly Glu Arg 145 150 155 160 Thr Val Val Gln Arg Thr Arg Asp Leu Val Val Ala Thr Gly Leu Glu 165 170 175 Pro Ser Leu Pro Pro Gly Thr Val Cys Ser Asp Arg Val Trp His Ser 180 185 190 Ser Glu Leu Leu Tyr Arg Val Glu Arg Leu Pro Pro Thr Pro Arg Arg 195 200 205 Ile Val Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ala Ala Glu Phe 210 215

220 Leu His Ser Arg Phe Pro Ser Thr Asp Ile Cys Ala Val Phe Ser Arg 225 230 235 240 Tyr Gly Tyr Ser Pro Ser Asp Asp Ser Pro Phe Ala Asn Arg Ile Phe 245 250 255 Asp Pro Ala Ala Val Asp Asp Tyr Cys Ala Ala Ala Pro Glu Thr Arg 260 265 270 Arg Met Leu Leu Asp Tyr His Arg Asn Thr Asn Tyr Ser Val Val Asp 275 280 285 Pro Glu Leu Ile Asp Glu Leu Tyr Arg Arg Val Tyr Gln Glu Lys Val 290 295 300 Arg Gly Arg Pro Arg Leu Asn Ile Leu Gly Ala Ser Arg Leu Met Ala 305 310 315 320 Ala Glu Pro Ala Gly Asp Gly Val Asp Val Val Val Glu Ser Leu Val 325 330 335 Thr Gly Glu Arg Thr Pro Met Arg Ala Asp Cys Val Val Tyr Ala Thr 340 345 350 Gly Tyr Arg Pro Thr Asp Ala Arg Gly Leu Leu Gly Ser Met Ala Gly 355 360 365 Leu Cys Lys Ala Asp Glu Leu Gly Arg Leu Glu Ala Asp Arg Arg Tyr 370 375 380 Arg Val Ile Thr Glu Gly Asp Val Arg Cys Ala Ile Tyr Leu Gln Gly 385 390 395 400 Ala Thr Glu His Ser His Gly Ile Ser Ser Ser Leu Leu Ser Asn Thr 405 410 415 Ala Val Arg Ala Gly Glu Ile Ala Asp Ala Ile Arg Ala Asp Ala Val 420 425 430 Arg Ala Gly Ala Arg Ala Thr Thr Arg Ser Gln Pro Gln Pro Gln Thr 435 440 445 23443 PRTFrankia alni 23Met Ser Ala Arg Glu Phe Asp Ile Tyr Asp Val Val Gly Ile Gly Phe 1 5 10 15 Gly Pro Ser Asn Leu Ser Leu Ala Val Ala Leu Asp Glu Phe Arg Val 20 25 30 Asn Gly Met Gly Asn Val Phe Ser Asn Ile Phe Phe Glu Arg Arg Ser 35 40 45 Ser Phe Ala Trp His Pro Ser Met Leu Leu Pro Ser Ala Thr Met Gln 50 55 60 Ile Ser Phe Leu Lys Asp Leu Val Thr Phe Arg Asn Pro Thr Ser Ser 65 70 75 80 Phe Ser Phe Val Ala Tyr Leu His Glu Ser Gly Arg Leu Pro Arg Phe 85 90 95 Val Asn Asn Gln Asp Phe Phe Pro Thr Arg Glu Glu Phe His Gln Tyr 100 105 110 Leu Glu Trp Ala Gln Ala Arg Val Ala His Arg Val Ala Tyr Gly Ser 115 120 125 Glu Ala Arg Ser Leu Arg Leu Pro Ala Gly Val Gly Pro Glu Arg Ala 130 135 140 Asp Arg Leu Cys Leu Gln Val Ala Asp Ala Ala Ser Gly Thr Ser Arg 145 150 155 160 Met Val Glu Ala Arg Asn Val Val Ile Ser Thr Gly Leu Val Pro Thr 165 170 175 Met Pro Thr Gly Val Glu Arg Gly Glu Arg Val Trp His Ser Ser Glu 180 185 190 Phe Leu Glu Arg Phe Arg Arg Thr Ser Pro Ala Arg Ile Arg Arg Val 195 200 205 Ala Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ile Thr Arg Phe Leu 210 215 220 Tyr Asp Glu Leu Pro His Ala Glu Val Ser Ala Ile Ile Pro Ser Tyr 225 230 235 240 Gly Tyr Cys Val Ala Asp Asp Thr Pro Phe Ala Asn Glu Val Phe Asp 245 250 255 Pro Glu Ala Ile Asp Asp Tyr Tyr Tyr Ala Thr Glu Arg Thr Arg Glu 260 265 270 Ala Leu Trp Arg Tyr His Ser Asn Thr Asn Tyr Ser Val Val Asp Asp 275 280 285 Ser Val Ile Arg Asp Leu Tyr Arg Arg Ser Tyr Glu Asp Asp Leu Arg 290 295 300 Asp Val Gly Arg Leu Arg Phe Leu Arg Leu Thr Arg Val Ala Gly Val 305 310 315 320 Arg Ser Val Gly Ala Gln Thr Arg Val Ser Leu Arg Ala Gly Ile Asp 325 330 335 Gly Asp Leu Arg Asp Leu Asp Val Asp Val Leu Val Cys Ala Thr Gly 340 345 350 Tyr Ala Ala Met Glu Pro Thr Gly Leu Leu Gly Asp Leu Asp Gln Tyr 355 360 365 Cys Leu Arg Asp Glu Ala Gly Arg Tyr Arg Ile Glu Arg Asp Tyr Arg 370 375 380 Ile Val Thr Ala Pro Glu Met Gln Cys Gly Ile Tyr Leu Gln Gly Gly 385 390 395 400 Thr Glu His Thr His Gly Leu Ser Ser Ser Leu Leu Ser Asn Ile Ala 405 410 415 Val Arg Ser Gly Glu Ile Ile Asp Ser Ile Val Ala Arg Ser Ala Glu 420 425 430 Arg Thr Ala Pro Cys Ala Val Leu Ala Glu Ala 435 440 24422PRTActinosynnema mirum 24Met Thr Ala Val Val Gln Gly Ala Asp Ala Pro Arg Asp Val Val Gly 1 5 10 15 Val Gly Phe Gly Pro Ser Asn Leu Ala Leu Ala Val Ala Leu Ala Glu 20 25 30 Arg Asp Gly Pro Ser Ser Ala Phe Phe Glu Arg Gln Pro Arg Phe Gly 35 40 45 Trp His Arg Gly Met Leu Leu Asp Gly Ala Thr Met Gln Val Ser Phe 50 55 60 Leu Lys Asp Leu Val Ser Met Arg Asn Pro Thr Ser Pro Tyr Ser Phe 65 70 75 80 Val Ser Tyr Leu His Ala Arg Gly Arg Met Pro Glu Phe Val Asn Ala 85 90 95 Lys Thr Leu Tyr Pro Leu Arg Val Glu Phe His Asp Tyr Leu Glu Trp 100 105 110 Val Ala Gly His Phe Ala Gly Ser Val Ser Tyr Gly Ser Glu Ile Thr 115 120 125 Ala Leu Glu Pro Val Ala Glu Asp Gly Val Val Gly His Leu Asp Val 130 135 140 Val Ala Arg Arg Asp Gly Arg Thr Thr Thr Thr Arg Ala Arg Asn Val 145 150 155 160 Val Val Ala Thr Gly Leu Glu Pro Arg Leu Pro Asp Gly Val Thr Gly 165 170 175 Gly Glu Arg Val Trp His Ser Gly Glu Leu Leu His Arg Val Pro Trp 180 185 190 Leu Arg Glu Arg Arg Val Arg Lys Val Ala Val Val Gly Ala Gly Gln 195 200 205 Ser Ala Ala Glu Val Thr Glu Tyr Leu His Arg Thr Leu Pro Gly Ala 210 215 220 Glu Val Ile Ala Val Phe Ser Arg Phe Gly Tyr Ser Val Ala Asp Asp 225 230 235 240 Thr Pro Phe Val Asn Glu Val Phe Asp Pro Asp Ser Val Asp Leu Phe 245 250 255 Tyr Gly Ser Pro Pro Ser Val Arg Gln Ala Leu Leu Ala His His Gly 260 265 270 Asn Thr Asn Tyr Ser Val Val Asp Ala Asp Leu Ser Leu Glu Leu Tyr 275 280 285 Arg Arg Arg Tyr Gln Glu Arg Val Thr Gly Ser Ser Arg Leu Arg Val 290 295 300 Val Asn Val Ser Arg Val Arg Ser Val Arg Glu Arg Pro Asp Gly Val 305 310 315 320 Ala Leu Gln Val Glu Tyr Leu Pro Thr Gly Val Val Gly Thr Leu Ala 325 330 335 Ala Asp Ala Val Val Cys Ala Thr Gly Tyr Arg Pro Ala Asp Pro Thr 340 345 350 Pro Leu Leu Arg Gly Leu Ala Lys Leu Asp Gly Ala Gly Arg Pro Val 355 360 365 Leu Asp Arg Asp His Arg Val Val Thr Ser Gly Ser Val Arg Ala Gly 370 375 380 Ile Tyr Leu Gln Gly Ala Val Thr Glu Pro Thr His Gly Leu Ser Ala 385 390 395 400 Gly Leu Leu Ser Thr Thr Ala Val Arg Ala Gly Glu Ile Val Arg Ala 405 410 415 Ile Leu Asp Glu Gly Arg 420 25424PRTKutzneria sp. 744 25Met Thr Val Ala His Ala Gly Glu Ser Pro Thr His Asp Val Val Gly 1 5 10 15 Val Gly Phe Gly Pro Ala Asn Leu Ser Leu Ala Val Ala Leu Glu Glu 20 25 30 Ser Pro Ala Ala Leu Thr Ser Ala Phe Phe Glu Arg Arg Ala Ser Ile 35 40 45 Ser Trp His Gln Gly Met Leu Leu Pro Ala Ala Lys Met Gln Val Ser 50 55 60 Phe Leu Lys Asp Leu Ala Thr Phe Arg Asn Pro Ala Ser Arg Phe Ser 65 70 75 80 Phe Val Ser Phe Leu His Glu Arg Gly Arg Leu Val Arg Phe Ala Asn 85 90 95 Asn His Asp Phe Phe Pro Thr Arg Arg Glu Phe His Asp Tyr Leu Glu 100 105 110 Trp Ala Glu Ser Lys Leu Ala His Glu Val Ser Tyr Asp Ser Glu Val 115 120 125 Thr Ala Ile Arg Pro Gly Pro Gly Arg Pro Val Asp Ser Val Leu Val 130 135 140 Asp Val Ser Thr Pro Glu Ala Thr Arg Thr Val Glu Ala Arg Asn Ile 145 150 155 160 Val Ile Ser Thr Gly Leu Val Pro Arg Met Pro Ala Gly Val Gln Ser 165 170 175 Asp Glu Phe Val Trp His Ser Ser Arg Phe Leu Asp His Phe Arg Asp 180 185 190 Arg Asp Pro Arg Ser Leu Arg Arg Val Ala Val Ala Gly Gly Gly Gln 195 200 205 Ser Ala Ala Glu Ile Val Arg Phe Leu His Asp Asn Arg Pro Asp Thr 210 215 220 Val Val His Ala Ile Met Pro Ser Tyr Gly Tyr Val Val Ala Asp Asn 225 230 235 240 Thr Pro Phe Ala Asn Gln Ile Phe Asp Pro Ala Ala Val Asp Asp Tyr 245 250 255 Phe Asp Gly Ser Lys Gln Ala Lys Asp Ala Phe Trp Arg Tyr His Arg 260 265 270 Asn Thr Asn Tyr Ser Val Val Asp Asp Glu Val Ile Arg Asp Leu Tyr 275 280 285 Arg Arg Gly Tyr Asp Asp Glu Val Ala Gly Ala Pro Arg Leu Asn Phe 290 295 300 Val Asn Leu Ala His Val Val Gly Ala Lys Arg Ile Ala Asp Asp Thr 305 310 315 320 Arg Val Thr Val Tyr Ser Met Ala Arg Glu Glu Ser Tyr Asp Leu Asp 325 330 335 Val Asp Val Leu Val Cys Ala Thr Gly Tyr Asp Pro Met Asp Pro Gly 340 345 350 Asp Leu Leu Gly Glu Leu Ala Glu His Cys Val Gln Asp Ala Glu Gly 355 360 365 Arg Trp Gln Val Asp Arg Asp Tyr Arg Met Val Thr Thr Pro Asp Leu 370 375 380 Arg Cys Gly Ile Tyr Leu Gln Gly Gly Thr Glu His Thr His Gly Leu 385 390 395 400 Ser Ser Ser Leu Leu Ser Asn Leu Ala Thr Arg Ser Gly Glu Ile Val 405 410 415 Ser Ser Ile Glu Arg Arg Lys Ser 420 26446PRTKibdelosporangium sp. MJ126-NF4 26Val Thr Asp Ile His Asp Leu Val Gly Val Gly Phe Gly Pro Ser Asn 1 5 10 15 Leu Ala Leu Ser Ile Ala Ala Ala Glu Ala Asp Val Pro Leu Arg Ala 20 25 30 Val Phe Leu Glu Arg Ser Glu Arg Phe Gly Trp His Arg Asp Met Leu 35 40 45 Ile Asp Asp Ala Thr Met Gln Val Ala Phe Leu Lys Asp Leu Ala Thr 50 55 60 Pro Arg Asn Pro Val Ser Arg Phe Gly Phe Val Pro Tyr Leu Trp Ala 65 70 75 80 Arg Asp Arg Leu Ser Ala Phe Ile Asn Gln Lys Thr Leu Phe Pro Thr 85 90 95 Arg Val Glu Phe His Asp Tyr Leu Glu Trp Ala Ala Ala Gln Val Asp 100 105 110 Asp Val Val Glu Tyr Ala Ala Glu Val Val Asp Ile Arg Pro Val His 115 120 125 Asp Asn Gly Glu Val Ala Phe Leu Asp Val Val Ser Val Arg Pro Asp 130 135 140 Gly Gln Ala Arg Val Arg Arg Thr Arg Asn Val Val Leu Ala Leu Gly 145 150 155 160 Leu Gln Pro Val Val Pro Pro Gly Val His Pro Ser Pro Arg Val Trp 165 170 175 His Ser Ala Asp Leu Leu Gly Arg Ala Ala Thr Leu Asp Arg Ala Lys 180 185 190 Pro Leu Arg Phe Ala Val Val Gly Ala Gly Gln Ser Ala Ala Glu Cys 195 200 205 Val Ser Tyr Leu His Arg Ala Phe Glu Gln Ala Glu Val His Ala Val 210 215 220 Phe Gly Arg Tyr Gly Tyr Ser Pro Ala Asp Asp Ser Pro Phe Ala Asn 225 230 235 240 Arg Ile Phe Asp Pro Ala Ala Val Asp Asp Tyr Phe Val Ser Pro Asp 245 250 255 Gln Val Lys Gln Arg Phe Phe Asp Tyr His Ala Asn Thr Asn Tyr Ser 260 265 270 Ala Val Asp Thr Glu Leu Leu Glu Glu Leu Ser His Arg Val Tyr Arg 275 280 285 Glu Ser Leu Ser Gly Arg Gln Arg Leu Phe Thr His His Leu Ser Ala 290 295 300 Ile Thr Asp Leu Ala Asp Thr Asp Asp Gly Val Ser Val Ser Val Glu 305 310 315 320 Phe Leu Pro Thr Gly Glu Arg Thr Met Leu Arg Val Asp His Val Ile 325 330 335 His Ala Thr Gly Tyr Arg Pro Thr Asp Pro Ile Pro Leu Leu Gly Thr 340 345 350 Thr Ala Glu Leu Cys His Lys Asp Thr Leu Gly Arg Leu Arg Val Glu 355 360 365 Arg Asp Tyr Arg Val Val Thr Lys Pro Asp Val Arg Thr Gly Ile Tyr 370 375 380 Leu Gln Gly Gly Thr Glu His Ser His Gly Ile Ser Ser Ser Leu Leu 385 390 395 400 Ser Asn Val Ala Val Arg Ala Gly Glu Ile Leu Ala Ser Ile Gln Glu 405 410 415 Arg Pro Gln Arg Arg Asp Gly Asp Gln Asp Glu Arg Thr Ala Arg Ala 420 425 430 Gly Asp Asp Pro Ala Arg Arg Ala Ala Ala Leu Pro Arg Arg 435 440 445 27398 PRTMycobacterium xenopi 27Met Leu Pro Gly Glu Asp Asp Ser Asp Leu Asp Phe Ile Gly Ile Gly 1 5 10 15 Phe Gly Pro Ser Asn Leu Ala Leu Ala Val Ala Ala Glu Glu Leu Ile 20 25 30 Pro Asn Trp Arg Gly Leu Phe Leu Glu Arg Ser Gln Ser Phe Gln Trp 35 40 45 His Pro Gly Met Met Leu Glu Gly Ala Arg Met Gln Ile Ser Phe Leu 50 55 60 Lys Asp Leu Ala Thr Leu Arg Asn Pro Ala Ser Arg Tyr Thr Phe Leu 65 70 75 80 Gln Tyr Ala Lys Ala Arg Gly Arg Leu Glu Gln Phe Val Asn Ile Asn 85 90 95 Glu Phe Arg Pro Thr Arg Leu Glu Tyr Asn Asp Tyr Leu Lys Trp Val 100 105 110 Ala Glu Ser Phe Ala Asp Arg Val Arg Tyr Gly Ala Val Val Thr Ala 115 120 125 Val Val Pro Leu Arg Asp Ser Pro Ser Pro Ala Gly Arg Phe Gly Arg 130 135 140 Leu Arg Val Tyr Val Arg Asp Glu Ser Thr Gly Val Glu Thr Cys Phe 145 150 155 160 Ser Ser Pro Asn Val Val Tyr Gly Gly Gly Gly Val Pro Arg Leu Leu 165 170 175 Gly Ala Arg Asn Thr Ser Ala Val Val His Ser Ser Ala Phe Leu Pro 180 185 190 Asn Phe Pro Asn Arg Phe Asn Glu Pro Asp Lys Ala Tyr Arg Phe Ala 195 200 205 Val Val Gly Asn Gly Gln Ser Ala Ala Glu Ile Ala Glu Tyr Leu Leu 210 215 220 Ser His Tyr Arg Arg Ala Thr Thr His Leu Phe Ile Ser Asp His Thr 225 230 235 240 Leu Arg Ala Thr Asp His Ser Pro Phe Ile Asn Glu His Phe Phe Ser 245 250 255 Val Asn Ala Ala Glu Phe Tyr Asp Tyr Pro Pro Ala Lys Arg Ala Ala 260 265 270 Leu Arg Asn Glu Leu Arg Leu Thr Asn Tyr Gly Val Val Asp Ala Asp 275 280 285 Val Leu Gln Lys Leu Tyr Gln Ile Ala Tyr Leu Asp Glu Val Arg Gly 290 295 300 Cys Arg Arg Leu Phe Leu His Gly Glu Ser Arg Leu Ser

Arg Val Glu 305 310 315 320 Glu Ile Asp Gly Arg Val Val Ala Arg Phe Glu Asp Arg Phe Ser Gly 325 330 335 Glu Ser His Glu Phe Asp Phe Asp Gly Ala Val Leu Ala Thr Gly Tyr 340 345 350 Asp Arg Val Leu Asp Ala Glu Ile Phe Arg Glu Val Leu Pro His Val 355 360 365 Leu Arg Asp Glu Ser Gly Glu Ile Ser Leu Ser Arg Ser Cys Arg Val 370 375 380 Asn Thr Gly Pro Ala Leu Thr Ala Gly Leu Phe Leu Gln Gly 385 390 395 28450PRTStreptomyces mirabilis 28Met Gly Ile Thr Gly Arg Arg Ser Gln Glu Ile Tyr Asp Val Val Gly 1 5 10 15 Ile Gly Phe Gly Pro Ser Asn Leu Ser Leu Ala Ile Ala Leu Glu Glu 20 25 30 His Gly Ala Ser Ala Pro Gln His Pro Val Lys Ser Leu Phe Phe Glu 35 40 45 Arg Gln Ser Arg Phe Gly Trp His Arg Asn Met Leu Leu Pro Ser Thr 50 55 60 Thr Met Gln Ile Ser Phe Leu Lys Asp Leu Ala Thr Tyr Arg Asn Pro 65 70 75 80 Thr Ser Arg Phe Ser Phe Ile Ser Tyr Leu His Ala Ser Asn Arg Leu 85 90 95 Val Gln Phe Val Asn Asn Gln Asp Phe Tyr Pro Thr Arg Gln Glu Phe 100 105 110 His Gln Tyr Leu Glu Trp Ala Ala Ala Gly Leu Arg Asp Arg Val Thr 115 120 125 Tyr Gly Ala Glu Val Thr Ser Ile Arg Pro Gly Thr Glu Ala Gly Ser 130 135 140 Arg Thr Pro Asp Leu Leu Glu Val Glu Val Arg Thr Gly Asp Gly Thr 145 150 155 160 Thr Ser Val Val Thr Ala Arg Asn Val Val Ile Ser Thr Gly Leu Val 165 170 175 Pro Arg Leu Pro Gln Gly Val Thr Ser Asp Glu Arg Val Trp His Ser 180 185 190 Ser Glu Phe Leu Ser Arg Phe Asn Ala Gln Ala Pro Gly Asp Leu Lys 195 200 205 Ser Val Ala Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ile Thr Arg 210 215 220 Phe Leu His Asp Ser Leu Pro His Ala Gln Val Cys Ala Val Ile Pro 225 230 235 240 Ser Tyr Gly Tyr Ser Val Ala Asp Asp Thr Pro Phe Ala Asn Gln Val 245 250 255 Phe Asp Pro Gly Ala Val Asp Glu Tyr Tyr Phe Gly Thr Glu Gln Ala 260 265 270 Gln Asp Ala Phe Trp Arg Tyr His Arg Asn Thr Asn Tyr Ala Val Val 275 280 285 Asp Ala Asp Val Ile Arg Ala Leu Tyr Gln Arg Ser Tyr Asp Glu Gln 290 295 300 Val His Gly Ser Arg Arg Leu His Phe Arg Asn Leu Thr Arg Val Ala 305 310 315 320 Glu Val Lys Arg Thr Gly Ser Gly Thr Arg Val Val Leu Arg Ser Leu 325 330 335 Leu Glu Asp Arg Thr Glu Glu Leu Ala Val Asp Ala Leu Val Phe Ala 340 345 350 Thr Gly Tyr Asp Gly Leu Asp Pro Ala His Leu Leu Gly Asp Phe Asp 355 360 365 Gln His Phe Leu Arg Asp Ala Ala Gly Arg His Arg Val Glu Arg Asp 370 375 380 Tyr Ser Leu Val Thr Ala Ser Gly Leu Thr Cys Gly Val Tyr Leu Gln 385 390 395 400 Gly Gly Thr Glu His Ser His Gly Leu Ser Ser Ser Leu Leu Ser Asn 405 410 415 Ile Ala Val Arg Ser Gly Glu Ile Ala Asp Ser Ile Val Leu Arg Arg 420 425 430 Thr Glu Arg Glu Leu Gly Ser Thr Cys Pro Val Lys Val Ala Ser Ser 435 440 445 Ala Ala 450 29450PRTStreptomyces scabrisporus 29Met Gly Met Phe Gly His Glu Ile His Asp Val Val Gly Ile Gly Phe 1 5 10 15 Gly Pro Ser Asn Leu Ser Leu Ala Ile Ala Leu Glu Glu His Gln Ala 20 25 30 Asn Glu Ser Ala Arg Pro Val Thr Ala Ala Phe Phe Glu Arg Gln Pro 35 40 45 Ala Phe Gly Trp His Arg Asn Met Leu Leu Pro Ser Thr Thr Met Gln 50 55 60 Ile Ser Phe Leu Lys Asp Leu Ala Thr Phe Arg Asn Pro Val Ser Arg 65 70 75 80 Phe Gly Phe Ile Ser Tyr Leu His Ala Ser Gly Arg Leu Pro Gln Phe 85 90 95 Val Asn Ala Gln Asp Phe Phe Pro Thr Arg Gln Glu Phe His Gln Tyr 100 105 110 Leu Glu Trp Ala Glu Ser Ser Val Thr Asp Arg Val Ser Tyr Gly Ser 115 120 125 Asp Val Thr Ser Ile Arg Pro Pro Gln Gly Ile Ala Ala Arg Asp Ala 130 135 140 Lys His Leu Glu Ile Glu Val Glu Asp Leu Val Ser Gly Ala Thr Arg 145 150 155 160 Leu Val Lys Ala Arg Asn Val Thr Val Ser Thr Gly Leu Val Pro Arg 165 170 175 Leu Pro Gln Gly Ile Glu Arg Asp Glu Arg Val Trp His Ser Ser Glu 180 185 190 Phe Leu Glu Lys Phe Gly Arg Met Asp Ala Ala Gly Leu Gly Ser Val 195 200 205 Ala Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ile Thr Arg Phe Leu 210 215 220 Tyr Asp Thr Leu Pro His Ala Arg Val Ser Ala Ile Leu Pro Ala Tyr 225 230 235 240 Gly Tyr Ser Val Ala Asp Asp Thr Pro Phe Ala Asn Gln Val Phe Asp 245 250 255 Pro Gly Ala Val Asp Glu Tyr Tyr Phe Gly Ser Asp Arg Thr Arg Glu 260 265 270 Ala Phe Trp Arg Tyr His Lys Asn Thr Asn Tyr Ser Val Val Asp Asp 275 280 285 Glu Val Ile Arg Asp Leu Tyr Arg Arg Ser Tyr Glu Glu Glu Val Arg 290 295 300 Gly Val Arg Arg Leu Asn Phe Leu Asn Leu Thr Arg Val Asp Gln Val 305 310 315 320 Lys Arg Ser Gly Asp Glu Thr Arg Val Ser Leu Arg Ser Leu Leu Asp 325 330 335 Asp Arg Val Arg Glu Leu Asp Val Asp Ala Leu Val Phe Ala Thr Gly 340 345 350 Tyr Asp Ser Pro Glu Pro Ser Gly Leu Leu Gly Asp Leu Asp Arg Tyr 355 360 365 Cys Leu Arg Asp Glu Ala Gly Arg His Arg Val Gly Arg Asp Tyr Arg 370 375 380 Leu Val Thr Ser Pro Glu Leu Ser Cys Gly Ile Tyr Leu Gln Gly Gly 385 390 395 400 Thr Glu His Thr His Gly Leu Thr Ser Ser Leu Leu Ser Asn Ile Ala 405 410 415 Ile Arg Ser Gly Glu Ile Ala Asp Ser Val Ile Arg Arg Arg Val Glu 420 425 430 His Glu Leu Glu Leu Glu Arg Asn Ala Ala Leu Glu Val Ala Arg Glu 435 440 445 Thr Arg 450 30424PRTStreptomyces sp. TAA040 30Met His Asp Leu Val Val Val Gly Ala Gly Pro Tyr Gly Leu Ser Ile 1 5 10 15 Ala Ala His Ala Ala Ala Ala Gly Leu Gln Pro Arg Val Leu Gly Thr 20 25 30 Pro Met Ala Ser Trp Arg Asp His Met Pro Gln Gly Met Tyr Leu Lys 35 40 45 Ser Glu Pro Trp Ser Ser Asp Leu Ser Asp Pro Ala Gly Ala His Thr 50 55 60 Leu Ala Ala Tyr Cys Ala Thr Arg Gly Leu Val Ala Glu His Gly Asn 65 70 75 80 Pro Leu Pro Ile Glu Val Phe Thr Asp Tyr Gly Cys Trp Phe Ala Gly 85 90 95 Arg Ala Ala Pro Pro Val Glu Glu Arg Thr Val Val Ala Val Arg Pro 100 105 110 His Gly Asp Gly Tyr Arg Val Glu Thr Ala Glu Gly Glu Arg Ile Thr 115 120 125 Thr Arg Thr Val Ala Leu Ala Val Gly Val Met Pro Phe Val His His 130 135 140 Pro Ser Ala Leu Ala Ala Leu Pro Ala Glu Leu Ala Thr His Ser Ser 145 150 155 160 Asp His Arg Asp Leu Ala Arg Phe Arg Gly Arg Asp Val Thr Val Val 165 170 175 Gly Ala Gly Gln Ala Ala Leu Glu Thr Ala Thr Leu Leu Thr Glu His 180 185 190 Gly Ala Arg Ala Arg Val Leu Ala Arg Ala Asp Arg Ile Asn Trp Asn 195 200 205 Thr Pro Pro Gln Pro Leu Glu Arg Gly Leu Trp Lys Ser Leu Arg Asp 210 215 220 Pro His Cys Gly Leu Gly Thr Gly Trp Ser Ser Trp Leu Trp Ser Glu 225 230 235 240 Arg Pro Ser Ala Val Arg Arg Leu Pro Ala Gly Leu Arg Ala Ala Ile 245 250 255 Ala Gly Ser Ala Leu Gly Pro Ala Gly Ala Trp Trp Leu Arg Glu Arg 260 265 270 Phe Glu Gln Ala Val Pro Val Leu Leu Gly His Arg Leu Leu Ala Ala 275 280 285 Glu Gln Val Gly Gly Arg Val Arg Leu Asp Val Arg Leu Ala Asp Gly 290 295 300 Thr Ala Arg Asn Leu His Thr Asp His Val Val Ala Ala Thr Gly Phe 305 310 315 320 Thr Pro Glu Leu Asp Arg Leu Gly Leu Leu Ala Leu Ser Leu Thr Gly 325 330 335 Thr Leu Arg Arg Val Pro Gly Thr Gly Ala Pro Glu Leu Gly Arg Cys 340 345 350 Phe Glu Ser Ser Arg Pro Gly Leu Phe Phe Gly Gly Leu Leu Thr Ala 355 360 365 Pro Ser Phe Gly Pro Ala Met Arg Phe Val His Gly Ala Gly Phe Thr 370 375 380 Ala Gly Arg Leu Val Glu Gly Val Arg Arg Arg Leu Gly Ser Gly Ala 385 390 395 400 Ala Ser Arg Thr Arg Ala Val Pro Gln Ala Ala Gly Ser Val Gly Arg 405 410 415 Ala Ala Ala Glu Arg Pro Pro Gly 420 31434PRTActinoalloteichus cyanogriseus 31Met Tyr Gly Ser Val Pro Val Asp Gly Asn Gln Val Ser Asp Val Val 1 5 10 15 Gly Val Gly Phe Gly Pro Ser Asn Leu Ala Leu Ala Val Ala Ile Ala 20 25 30 Glu His Asn Glu Thr Ala Pro Pro Lys Thr Arg Leu Arg Ala Gln Phe 35 40 45 Leu Glu Arg Gln Pro Val Phe Gly Trp His Arg Gly Met Leu Leu Pro 50 55 60 Asp Thr Thr Leu Gln Val Ser Phe Leu Lys Asp Leu Val Thr Leu Arg 65 70 75 80 Asn Pro Arg Ser Ser Phe Gly Phe Val Ser Tyr Leu His Asp Arg Asn 85 90 95 Arg Leu Val Asp Phe Val Asn His Gln Ser Phe Phe Pro Ser Arg Arg 100 105 110 Glu Tyr His Asp Tyr Leu Glu Trp Val Ala Gly Arg Phe Thr Gly Ser 115 120 125 Val His Tyr Gly His Glu Val Val Asp Val Leu Pro Val Asn Glu Gly 130 135 140 Pro Asp Val Val Ala Phe Asp Val Val Ala Ala His Gly Gly Val Gly 145 150 155 160 Ala Thr Arg Arg Val Arg Thr Arg Asn Val Val Leu Ala Pro Gly Leu 165 170 175 Glu Pro Val Leu Pro Gln Gly Ile Thr Pro Ser Asp Arg Val Trp His 180 185 190 Ser Ser Glu Leu Leu His Arg Leu Asp Gly Val Arg Glu Leu Leu Pro 195 200 205 Ser Arg Pro Arg Phe Val Val Val Gly Ala Gly Gln Ser Ala Ala Glu 210 215 220 Val Met Ala His Leu His Asp Ala Phe Pro Thr Ala Thr Val Arg Ser 225 230 235 240 Val Cys Ser Arg Tyr Gly Phe Ala Pro Ala Asp Asp Ser Pro Phe Val 245 250 255 Asn Gln Leu Phe Asp Pro Ala Gly Val Asp Glu Phe Phe Glu Ala Ala 260 265 270 Leu Pro Ala Arg Glu Asn Leu Leu Arg Thr His Ala Gly Thr Asn Tyr 275 280 285 Ser Ala Val Asp Gly Gly Leu Ile Asn Glu Leu Tyr Arg Arg Ser Tyr 290 295 300 Gln Glu Arg Val Ala Gly Glu Pro Arg Leu Leu Phe Glu Arg Leu Ser 305 310 315 320 Arg Val Val Ala Thr Glu Glu Gly Asp Asp Glu Val Ser Val Ala Val 325 330 335 Arg Ser Leu Ala Asp Gly Arg Val Thr Asn Arg Arg Cys Asp Val Val 340 345 350 Val Leu Ala Thr Gly Tyr Arg Pro Arg Asp Ala Leu Arg Pro Leu Gly 355 360 365 Glu Leu Ala Ala Leu Cys Lys Leu Asp Ala Asn Gly Trp Pro Arg Val 370 375 380 Glu Arg Asp Tyr Arg Ile Thr Thr Thr Glu Thr Val Arg Ala Gly Ile 385 390 395 400 Tyr Leu Gln Gly Gly Thr Glu His Ser His Gly Leu Ser Ser Thr Leu 405 410 415 Leu Ser Asn Leu Ala Val Arg Ser Gly Glu Ile Thr Arg Ala Leu Val 420 425 430 Ser Arg 32451PRTStreptomyces sp. HNS054 32Met Gly Ile Thr Gly Arg Arg His Gln Glu Ile Tyr Asp Val Ile Gly 1 5 10 15 Ile Gly Phe Gly Pro Ser Asn Met Ser Leu Ala Ile Ala Leu Glu Glu 20 25 30 His Glu Ala Ser Ala Pro Gln Gln Pro Leu Arg Tyr His Phe Phe Glu 35 40 45 Arg Gln Pro Thr Phe Gly Trp His Arg Asn Met Leu Leu Pro Ser Thr 50 55 60 Thr Met Gln Ile Ser Phe Leu Lys Asp Leu Ala Thr Phe Arg Asn Pro 65 70 75 80 Leu Ser Arg Phe Ser Phe Ile Ser Phe Leu His Ser Ser Asn Arg Leu 85 90 95 Val Gln Phe Val Asn Asn Gln Asp Phe Phe Pro Thr Arg Gln Glu Phe 100 105 110 His Gln Tyr Leu Glu Trp Ala Ala Ala Gly Leu Ser Asp Arg Val Thr 115 120 125 Tyr Gly Thr Glu Val Val Ser Ile Arg Pro Gly Thr Glu Gly Gly Thr 130 135 140 Leu Thr Pro Asp Leu Leu Glu Ile Glu Val Arg Asp Gly Asp Gly Thr 145 150 155 160 Thr Ser Val Val Val Thr Arg Asn Val Val Ile Ser Thr Gly Leu Val 165 170 175 Pro Arg Leu Pro Glu Gly Val Thr Ala Asp Glu Arg Val Trp His Ser 180 185 190 Ser Gln Phe Leu Ser Lys Phe His Ala Arg Asp Pro Arg Glu Leu Lys 195 200 205 Arg Val Ala Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ile Thr Arg 210 215 220 Phe Phe Tyr Asp Ser Leu Pro His Ala Glu Val Leu Ala Val Ile Pro 225 230 235 240 Ser Tyr Gly Tyr Ser Val Ala Asp Asp Thr Pro Phe Ala Asn Gln Val 245 250 255 Phe Asp Pro Gly Ala Val Asp Glu Tyr Tyr Tyr Gly Thr Asp Arg Ala 260 265 270 Arg Asp Ala Phe Trp Arg Tyr His Arg Asn Thr Asn Tyr Ser Val Val 275 280 285 Asp Thr Asp Val Ile Arg Ala Leu Tyr Gln Arg Ser Tyr Asp Glu Gln 290 295 300 Val Arg Gly Thr Gln Arg Leu His Phe Arg Asn Leu Thr Arg Val Val 305 310 315 320 Glu Val Gly Ser Thr Gly Glu Gly Thr Arg Val Val Leu Arg Ser Leu 325 330 335 Leu Asp Asp Arg Arg Glu Asp Leu Ala Val Asp Ala Leu Val Phe Ala 340 345 350 Thr Gly Tyr Asp Gly Val Asp Pro Ala Arg Leu Leu Gly Asp Gly Phe 355 360 365 Asp Ala His Phe Glu Arg Asp Ala Ala Gly Arg His Arg Val Glu Arg 370 375 380 Asp Tyr Arg Leu Val Ser Ser Ser Gly Leu Thr Cys Gly Val Tyr Leu 385 390 395 400 Gln Gly Gly Thr Glu His Ser His Gly Leu Thr Ser Ser Leu Leu Ser 405 410 415 Asn Met Ala Val Arg Ser Gly Glu Ile Ala Asp Ser Ile Val Leu Gly

420 425 430 Arg Thr Gly Arg Glu Leu Asp Arg Thr His Ser Val Glu Glu Ala Ser 435 440 445 Ser Ala Ala 450 33453PRTStreptomyces sp. AW19M42 33Val Cys Arg Gly Ala Ala Thr Phe Leu Glu Thr Thr Leu Thr Thr Pro 1 5 10 15 Leu Glu Thr Ala Arg Ser Ala Ala Pro His Asp Pro Ala Asp Gly Ala 20 25 30 Pro Leu Asp Val Leu Gly Val Gly Phe Gly Pro Ser Asn Leu Ala Leu 35 40 45 Ala Ile Ala Leu Ser Glu Val Glu Arg Pro Arg Pro Arg Val His Phe 50 55 60 Tyr Asp Arg Ser Ser Arg Phe Ser Trp His Gly Gly Met Leu Leu Lys 65 70 75 80 Gly Ala Thr Met Gln Val His Phe Leu Lys Asp Leu Val Thr Leu Arg 85 90 95 Asn Pro Gly Ser Pro Tyr Ser Phe Leu Ser Tyr Leu His Asp Arg Glu 100 105 110 Arg Leu Val Asp Phe Ile Asn His Lys Ala Leu Phe Pro Ser Arg Val 115 120 125 Glu Phe His Asp Tyr Leu Glu Trp Ala Ala Gln Ala Cys Ser Asp Arg 130 135 140 Val Thr Tyr Gly Ser Glu Val Ser Arg Ile Glu Pro Glu Trp Val Asp 145 150 155 160 Gly Glu Val His Arg Phe Arg Val His Leu Thr His Ser Glu Pro Gly 165 170 175 Glu Arg Gly Val Arg His Glu Val Arg Ser Ala Arg Asn Val Val Leu 180 185 190 Ala Pro Gly Leu Arg Pro His Leu Pro Glu Gly Thr Ala Glu Ser Glu 195 200 205 His Val Trp His Ser Ser Arg Leu Leu Ser Arg Leu Glu Asp Ile Pro 210 215 220 Lys Asp Ala Pro Val Arg Phe Thr Val Val Gly Ala Gly Gln Ser Gly 225 230 235 240 Ala Glu Val Thr Ala Tyr Leu His Gly Arg Phe Pro Gln Ala Gln Val 245 250 255 Arg Ala Val Phe Ser Pro Tyr Gly Tyr Asn Pro Ala Asp Asp Ser Pro 260 265 270 Phe Ala Asn Arg Ile Phe Asp Pro Ala Ala Val Asp Glu Phe Phe Gly 275 280 285 Ala Pro Gln Ala Val Arg Glu Met Leu Val Asp Arg His Gly Asn Thr 290 295 300 Asn Tyr Ser Val Val Asp Gln Asp Leu Ile Ala Glu Leu Tyr Arg Ile 305 310 315 320 Trp Tyr Gln Glu Lys Val Thr Asp Glu Arg Arg Leu Ile Ile Asp Asn 325 330 335 Val Ser Arg Leu Val Gly Val Arg Glu Ala Ser Gly Leu Arg Leu Thr 340 345 350 Ile Glu Ser Leu Ala Thr Arg Glu Arg His Glu Val Asp Ser Asp Tyr 355 360 365 Leu Val Tyr Ala Thr Gly Tyr Arg Pro Val Ala Pro Asp Asp Leu Val 370 375 380 Asp Pro Glu Ile Met Lys Leu Cys Arg Arg Asp Ala Ala Gly Gly Leu 385 390 395 400 Arg Val Asn Arg Asp Tyr Arg Val Gln Thr Glu Asp Met Val Arg Cys 405 410 415 Gly Leu Tyr Val Gln Gly Ala Thr Glu His Thr His Gly Leu Ser Ser 420 425 430 Thr Leu Leu Ser Asn Thr Ala Val Arg Ala Gly Glu Ile Ala Ser Ser 435 440 445 Leu Leu Gly Arg Met 450 34449PRTSalinispora pacifica 34Val Phe Asp Glu Pro Ser Val Tyr Asp Val Leu Gly Ile Gly Phe Gly 1 5 10 15 Pro Ser Asn Leu Ser Leu Ala Ile Ala Leu His Glu Met Gly Asp Val 20 25 30 Glu Gly Arg Pro Leu Ala Ala Arg Phe Phe Glu Gln Gln Pro Ser Phe 35 40 45 Gly Trp His Arg Asn Met Leu Leu Pro Ser Ala Lys Met Gln Val Ser 50 55 60 Phe Leu Lys Asp Leu Val Thr Phe Arg Asn Pro His Ser Arg Phe Thr 65 70 75 80 Phe Val Ser Tyr Leu His Glu Met Asn Arg Leu Ala Arg Phe Ile Asn 85 90 95 Asn Cys Asp Phe Phe Pro Thr Arg Glu Glu Phe His Gly Tyr Leu Glu 100 105 110 Trp Ala Ala Ala Asn Phe Ala Asp Gln Val Thr Tyr Gly Ala Thr Ile 115 120 125 Thr Ser Ile Ser Val Pro Pro Asp Ser Gly Pro Gly Asp Pro Ile Asp 130 135 140 Arg Val Arg Val Asn Leu Ala Ser Gly Pro Thr Gly Ala Glu Ser Ser 145 150 155 160 Ser Val Glu Ala Arg Asn Val Val Leu Gly Thr Gly Leu Val Pro Arg 165 170 175 Phe Pro Ala Gly Leu Thr Ser Asp Asp Arg Val Trp His Ser Ser Glu 180 185 190 Phe Leu Gly Lys Phe Gln Arg Cys Asp Thr Thr Lys Leu Lys Arg Val 195 200 205 Leu Val Val Gly Gly Gly Gln Ser Ala Ala Glu Ile Ala His Phe Val 210 215 220 Tyr Asp Asn Val Pro Gly Val Thr Val Thr Ala Val Ile Pro Ser Tyr 225 230 235 240 Gly Tyr Ser Ile Ala Asp Ala Thr Pro Phe Ala Asn Arg Val Phe Asp 245 250 255 Pro Ser Ala Ile Asp Asp Tyr Tyr Tyr Gly Asp Glu Asn Ser Lys Asp 260 265 270 Ala Phe Trp Arg Tyr His Arg Asn Thr Asn Tyr Ala Val Val Asp Ser 275 280 285 Asn Leu Ile Ser Asp Leu Asn Arg Lys Ala Tyr Asp Glu Ala Val Thr 290 295 300 Gly Glu Thr Arg Leu Arg Phe Ala Glu Leu Ser Arg Leu Ser Gly Val 305 310 315 320 Arg Arg Arg Asp Asp Gly Val Val Val Ser Ile His Ser Met Leu Ser 325 330 335 Asn Arg Thr Ser Glu Val Asp Ala Asp Ile Val Ile Cys Ala Thr Gly 340 345 350 Tyr Glu Pro Met Glu Ile Gly Asp Met Leu Gly Pro Leu Asp Arg Phe 355 360 365 Cys Ile Arg Asp Glu Gln Gly Arg Tyr Arg Val Glu Arg Asp Tyr Arg 370 375 380 Leu Ala Thr Thr Glu His Leu Arg Cys Gly Ile Tyr Leu Gln Gly Gly 385 390 395 400 Met Glu His Thr His Gly Leu Ser Ser Ser Leu Leu Ser Asn Leu Ala 405 410 415 Val Arg Asn Gly Asp Ile Ser Thr Ser Val Ala Arg Arg Ala Gln Ser 420 425 430 Gln Ser His Asp Asp Gly Arg Val Leu Gln Gly Leu Val Pro Thr Gly 435 440 445 Ser 35449PRTSalinispora pacifica 35Val Phe Asp Glu Pro Ser Val Tyr Asp Val Leu Gly Ile Gly Phe Gly 1 5 10 15 Pro Ser Asn Leu Ser Leu Ala Ile Ala Leu His Glu Met Gly Asp Val 20 25 30 Glu Gly Arg Pro Leu Ala Ala Arg Phe Phe Glu Gln Gln Pro Ser Phe 35 40 45 Gly Trp His Arg Asn Met Leu Leu Pro Ser Ala Lys Met Gln Val Ser 50 55 60 Phe Leu Lys Asp Leu Val Thr Phe Arg Asn Pro His Ser Arg Phe Thr 65 70 75 80 Phe Val Ser Tyr Leu His Glu Met Asn Arg Leu Ala Arg Phe Ile Asn 85 90 95 Asn Cys Asp Phe Phe Pro Thr Arg Glu Glu Phe His Gly Tyr Leu Glu 100 105 110 Trp Ala Ala Ala Asn Phe Ala Asp Gln Val Thr Tyr Gly Ala Thr Ile 115 120 125 Thr Ser Ile Ser Val Pro Pro Asp Ser Gly Pro Gly Asp Pro Ile Asp 130 135 140 Arg Val Arg Val Asn Leu Ala Ser Gly Pro Thr Gly Ala Glu Ser Ser 145 150 155 160 Ser Val Glu Ala Arg Asn Val Val Leu Gly Thr Gly Leu Val Pro Arg 165 170 175 Phe Pro Ala Gly Leu Thr Ser Asp Asp Arg Val Trp His Ser Ser Glu 180 185 190 Phe Leu Gly Lys Phe Gln Arg Cys Asp Thr Thr Lys Leu Lys Arg Val 195 200 205 Leu Val Val Gly Gly Gly Gln Ser Ala Ala Glu Ile Ala His Phe Val 210 215 220 Tyr Asp Asn Val Pro Gly Val Thr Val Thr Ala Val Ile Pro Ser Tyr 225 230 235 240 Gly Tyr Ser Ile Ala Asp Ala Thr Pro Phe Ala Asn Arg Val Phe Asp 245 250 255 Pro Ser Ala Ile Asp Asp Tyr Tyr Tyr Gly Asp Glu Asn Ser Lys Asp 260 265 270 Ala Phe Trp Arg Tyr His Arg Asn Thr Asn Tyr Ala Val Val Asp Ser 275 280 285 Asn Leu Ile Ser Asp Leu Asn Arg Lys Ala Tyr Asp Glu Ala Val Thr 290 295 300 Gly Glu Thr Arg Leu Arg Phe Ala Glu Leu Ser Arg Leu Ser Gly Val 305 310 315 320 Arg Arg Arg Asp Asp Gly Val Val Val Ser Ile His Ser Met Leu Ser 325 330 335 Asn Arg Thr Ser Glu Val Asp Ala Asp Ile Val Ile Cys Ala Thr Gly 340 345 350 Tyr Glu Pro Met Glu Ile Gly Asp Met Leu Gly Pro Leu Asp Arg Phe 355 360 365 Cys Ile Arg Asp Glu Gln Gly Arg Tyr Arg Val Glu Arg Asp Tyr Arg 370 375 380 Leu Ala Thr Thr Glu His Leu Arg Cys Gly Ile Tyr Leu Gln Gly Gly 385 390 395 400 Met Glu His Thr His Gly Leu Ser Ser Ser Leu Leu Ser Asn Leu Ala 405 410 415 Val Arg Asn Gly Asp Ile Ser Thr Ser Val Ala Arg Arg Ala Gln Ser 420 425 430 Gln Ser His Asp Asp Gly Arg Val Leu Gln Gly Leu Val Pro Thr Gly 435 440 445 Ser 36456PRTSalinispora tropica 36Val Thr Gly Lys Val His Ile Val Phe Asp Glu Pro Ser Val Tyr Asp 1 5 10 15 Val Leu Gly Ile Gly Phe Gly Pro Ser Asn Leu Ser Leu Ala Ile Ala 20 25 30 Leu His Glu Met Gly Asp Val Glu Gly Arg Pro Leu Ala Ala Arg Phe 35 40 45 Phe Glu Gln Gln Pro Ser Phe Gly Trp His Arg Asn Met Leu Leu Pro 50 55 60 Ser Ala Lys Met Gln Val Ser Phe Leu Lys Asp Leu Val Thr Phe Arg 65 70 75 80 Asn Pro His Ser Arg Phe Thr Phe Val Ser Tyr Leu His Glu Met Asn 85 90 95 Arg Leu Ala Arg Phe Val Asn Asn Cys Asp Phe Phe Pro Thr Arg Glu 100 105 110 Glu Phe His Gly Tyr Leu Glu Trp Ala Ala Thr Asn Phe Ala Asp Gln 115 120 125 Val Thr Tyr Gly Ala Thr Ile Thr Ser Ile Ser Val Pro Pro Asp Ser 130 135 140 Gly Pro Gly Asp Pro Ile Asp Arg Val Arg Val His Leu Ala Ser Gly 145 150 155 160 Pro Thr Gly Thr Glu Ser Ser Ser Val Glu Ala Arg Asn Val Val Leu 165 170 175 Gly Thr Gly Leu Val Pro Arg Phe Pro Ala Gly Leu Thr Ser Asp Asp 180 185 190 Arg Val Trp His Ser Ser Glu Phe Leu Gly Lys Phe Gln Arg Cys Asp 195 200 205 Thr Thr Lys Leu Lys Arg Val Leu Val Val Gly Gly Gly Gln Ser Ala 210 215 220 Ala Glu Ile Ala His Phe Val Tyr Glu Asn Val Pro Gly Ala Thr Val 225 230 235 240 Thr Ala Val Ile Pro Ser Tyr Gly Tyr Ser Ile Ala Asp Ala Thr Pro 245 250 255 Phe Ala Asn Arg Val Phe Asp Pro Ser Ala Ile Asp Asp Tyr Tyr Tyr 260 265 270 Gly Asp Glu Asn Ser Arg Asp Ala Phe Trp Arg Tyr His Arg Asn Thr 275 280 285 Asn Tyr Ala Val Val Asp Ser Asp Leu Ile Ser Asp Leu Asn Arg Lys 290 295 300 Ala Tyr Asp Glu Ala Val Thr Gly Glu Ile Arg Leu Arg Phe Ala Glu 305 310 315 320 Leu Ser Arg Leu Ser Gly Val Arg Arg Arg Asp Asp Gly Val Val Val 325 330 335 Ser Ile His Ser Met Leu Ser Asn Arg Thr Ser Glu Val Asp Ala Asp 340 345 350 Ile Val Ile Cys Ala Thr Gly Tyr Glu Pro Met Glu Ile Gly Asp Met 355 360 365 Leu Gly Pro Leu Asp Arg Phe Cys Ile Arg Asp Glu His Gly Arg Tyr 370 375 380 Arg Val Glu Arg Asp Tyr Arg Leu Ala Thr Thr Glu His Leu Arg Cys 385 390 395 400 Gly Ile Tyr Leu Gln Gly Gly Met Glu His Thr His Gly Leu Ser Ser 405 410 415 Ser Leu Leu Ser Asn Leu Ala Val Arg Asn Gly Asp Ile Ser Thr Ser 420 425 430 Val Ala Arg Arg Ala Gln Ser Gln Pro His Gly Asp Gly Arg Val Leu 435 440 445 Gln Gly Leu Val Pro Thr Gly Ser 450 455 37449PRTSalinispora arenicola 37Val Phe Asp Glu Pro Ser Val Tyr Asp Val Leu Gly Ile Gly Phe Gly 1 5 10 15 Pro Ser Asn Leu Ser Leu Ala Ile Ala Leu His Glu Met Gly Asp Val 20 25 30 Glu Gly Arg Pro Leu Ala Ala Arg Phe Phe Glu Gln Gln Pro Ser Phe 35 40 45 Gly Trp His Arg Asn Met Leu Leu Pro Ser Ala Lys Met Gln Val Ser 50 55 60 Phe Leu Lys Asp Leu Val Thr Phe Arg Asn Pro His Ser Arg Phe Thr 65 70 75 80 Phe Val Ser Tyr Leu His Glu Met Asn Arg Leu Ala Arg Phe Ile Asn 85 90 95 Asn Cys Asp Phe Phe Pro Thr Arg Glu Glu Phe His Gly Tyr Leu Glu 100 105 110 Trp Ala Ala Ala Thr Phe Ala Asp Gln Val Thr Tyr Gly Ala Thr Ile 115 120 125 Thr Ser Ile Ser Val Pro Pro Asp Ser Gly Pro Gly Asp Pro Ile Asp 130 135 140 Arg Val Arg Val His Leu Ala Ser Gly Pro Thr Gly Thr Glu Ser Ser 145 150 155 160 Ser Val Glu Ala Arg Asn Val Val Leu Gly Thr Gly Leu Val Pro Arg 165 170 175 Phe Pro Ala Gly Leu Thr Ser Asp Asp Arg Val Trp His Ser Ser Glu 180 185 190 Phe Leu Gly Lys Phe Gln Arg Cys Asp Thr Thr Lys Leu Lys Arg Val 195 200 205 Leu Val Val Gly Gly Gly Gln Ser Ala Ala Glu Ile Ala His Phe Val 210 215 220 Tyr Glu Asn Val Pro Gly Ala Thr Val Thr Ala Val Ile Pro Ser Tyr 225 230 235 240 Gly Tyr Ser Ile Ala Asp Ala Thr Pro Phe Ala Asn Arg Val Phe Asp 245 250 255 Pro Ser Ala Ile Asp Asp Tyr Tyr Tyr Gly Asp Glu Asn Ser Lys Asp 260 265 270 Ala Phe Trp Arg Tyr His Arg Asn Thr Asn Tyr Ala Val Val Asp Ser 275 280 285 Asp Leu Ile Ser Asp Leu Asn Arg Lys Ala Tyr Asp Glu Ala Val Thr 290 295 300 Gly Glu Thr Arg Leu Arg Phe Ala Glu Leu Ser Arg Leu Ser Gly Val 305 310 315 320 Arg Arg Arg Asp Asp Gly Val Val Val Ser Ile His Ser Met Leu Ser 325 330 335 Asn Arg Thr Ser Glu Val Asp Ala Asp Ile Val Ile Cys Ala Thr Gly 340 345 350 Tyr Glu Pro Met Glu Ile Gly Asp Met Leu Gly Pro Leu Asp Arg Phe 355 360 365 Cys Ile Arg Asp Glu Gln Gly Arg Tyr Arg Val Glu Arg Asp Tyr Arg 370 375 380 Leu Ala Thr Thr Glu His Leu Arg Cys Gly Ile Tyr Leu Gln Gly Gly 385 390 395 400 Met Glu His Thr His Gly Leu Ser Ser Ser Leu Leu Ser Asn Leu Ala 405 410 415 Val Arg Asn Gly Asp Ile Ser Thr Ser Val Ala Arg Arg Ala Gln Ser 420 425 430 Gln Pro His Asp Asp Gly Arg Val Leu Gln Gly Leu Val Pro Thr

Gly 435 440 445 Ser 38449PRTSalinispora arenicola 38Val Phe Asp Glu Pro Ser Val Tyr Asp Val Leu Gly Ile Gly Phe Gly 1 5 10 15 Pro Ser Asn Leu Ser Leu Ala Ile Ala Leu His Glu Met Gly Asp Val 20 25 30 Glu Gly Arg Pro Leu Ala Ala Arg Phe Phe Glu Gln Gln Pro Ser Phe 35 40 45 Gly Trp His Arg Asn Met Leu Leu Pro Ser Ala Lys Met Gln Val Ser 50 55 60 Phe Leu Lys Asp Leu Val Thr Phe Arg Asn Pro His Ser Arg Phe Thr 65 70 75 80 Phe Val Ser Tyr Leu His Glu Met Asn Arg Leu Ala Arg Phe Ile Asn 85 90 95 Asn Cys Asp Phe Phe Pro Thr Arg Glu Glu Phe His Gly Tyr Leu Glu 100 105 110 Trp Ala Ala Ala Thr Phe Ala Asp Gln Val Thr Tyr Gly Ala Thr Ile 115 120 125 Thr Ser Ile Ser Val Pro Pro Asp Ser Gly Pro Gly Asp Pro Ile Asp 130 135 140 Arg Val Arg Val His Leu Ala Ser Gly Pro Thr Gly Thr Glu Ser Ser 145 150 155 160 Ser Val Glu Ala Arg Asn Val Val Leu Gly Thr Gly Leu Val Pro Arg 165 170 175 Phe Pro Ala Gly Leu Thr Ser Asp Asp Arg Val Trp His Ser Ser Glu 180 185 190 Phe Leu Gly Lys Phe Gln Arg Cys Asp Thr Thr Lys Leu Lys Arg Val 195 200 205 Leu Val Val Gly Gly Gly Gln Ser Ala Ala Glu Ile Ala His Phe Val 210 215 220 Tyr Glu Asn Val Pro Gly Ala Thr Val Thr Ala Val Ile Pro Ser Tyr 225 230 235 240 Gly Tyr Ser Ile Ala Asp Ala Thr Pro Phe Ala Asn Arg Val Phe Asp 245 250 255 Pro Ser Ala Ile Asp Asp Tyr Tyr Tyr Gly Asp Glu Asn Ser Lys Asp 260 265 270 Ala Phe Trp Arg Tyr His Arg Asn Thr Asn Tyr Ala Val Val Asp Ser 275 280 285 Asp Leu Ile Ser Asp Leu Asn Arg Lys Ala Tyr Asp Glu Ala Val Thr 290 295 300 Gly Glu Thr Arg Leu Arg Phe Ala Glu Leu Ser Arg Leu Ser Gly Val 305 310 315 320 Arg Arg Arg Asp Asp Gly Val Val Val Ser Ile His Ser Met Leu Ser 325 330 335 Asn Arg Thr Ser Glu Val Asp Ala Asp Ile Val Ile Cys Ala Thr Gly 340 345 350 Tyr Glu Pro Met Glu Ile Gly Asp Met Leu Gly Pro Leu Asp Arg Phe 355 360 365 Cys Ile Arg Asp Glu Gln Gly Arg Tyr Arg Val Glu Arg Asp Tyr Arg 370 375 380 Leu Ala Thr Thr Glu His Leu Arg Cys Gly Ile Tyr Leu Gln Gly Gly 385 390 395 400 Met Glu His Thr His Gly Leu Ser Ser Ser Leu Leu Ser Asn Leu Ala 405 410 415 Val Arg Asn Gly Asp Ile Ser Thr Ser Val Ala Arg Arg Ala Gln Ser 420 425 430 Gln Pro His Asp Asp Gly Arg Val Leu Gln Gly Leu Val Pro Thr Gly 435 440 445 Ser 39456PRTSalinispora tropica 39Val Thr Gly Lys Val His Ile Val Phe Asp Glu Pro Ser Val Tyr Asp 1 5 10 15 Val Leu Gly Ile Gly Phe Gly Pro Ser Asn Leu Ser Leu Ala Ile Ala 20 25 30 Leu His Glu Met Gly Asp Val Glu Gly Arg Pro Leu Ala Ala Arg Phe 35 40 45 Phe Glu Gln Gln Pro Ser Phe Gly Trp His Arg Asn Met Leu Leu Pro 50 55 60 Ser Ala Lys Met Gln Val Ser Phe Leu Lys Asp Leu Val Thr Phe Arg 65 70 75 80 Asn Pro His Ser Arg Phe Thr Phe Val Ser Tyr Leu His Glu Met Asn 85 90 95 Arg Leu Ala Arg Phe Val Asn Asn Cys Asp Phe Phe Pro Thr Arg Glu 100 105 110 Glu Phe His Gly Tyr Leu Glu Trp Ala Ala Thr Asn Phe Ala Asp Gln 115 120 125 Val Thr Tyr Gly Ala Thr Ile Thr Ser Ile Ser Val Pro Pro Asp Ser 130 135 140 Gly Pro Gly Asp Pro Ile Asp Arg Val Arg Val His Leu Ala Ser Gly 145 150 155 160 Pro Thr Gly Thr Glu Ser Ser Ser Val Glu Ala Arg Asn Val Val Leu 165 170 175 Gly Thr Gly Leu Val Pro Arg Phe Pro Ala Gly Leu Thr Ser Asp Asp 180 185 190 Arg Val Trp His Ser Ser Glu Phe Leu Gly Lys Phe Gln Arg Cys Asp 195 200 205 Thr Thr Lys Leu Lys Arg Val Leu Val Val Gly Gly Gly Gln Ser Ala 210 215 220 Ala Glu Ile Ala His Phe Val Tyr Glu Asn Val Pro Gly Ala Thr Val 225 230 235 240 Thr Ala Val Ile Pro Ser Tyr Gly Tyr Ser Ile Ala Asp Ala Thr Pro 245 250 255 Phe Ala Asn Arg Val Phe Asp Pro Ser Ala Ile Asp Asp Tyr Tyr Tyr 260 265 270 Gly Asp Glu Asn Ser Arg Asp Ala Phe Trp Arg Tyr His Arg Asn Thr 275 280 285 Asn Tyr Ala Val Val Asp Ser Asp Leu Ile Ser Asp Leu Asn Arg Lys 290 295 300 Ala Tyr Asp Glu Ala Val Thr Gly Glu Ile Arg Leu Arg Phe Ala Glu 305 310 315 320 Leu Ser Arg Leu Ser Gly Val Arg Arg Arg Asp Asp Gly Val Val Val 325 330 335 Ser Ile His Ser Met Leu Ser Asn Arg Thr Ser Glu Val Asp Ala Asp 340 345 350 Ile Val Ile Cys Ala Thr Gly Tyr Glu Pro Met Glu Ile Gly Asp Met 355 360 365 Leu Gly Pro Leu Asp Arg Phe Cys Ile Arg Asp Glu His Gly Arg Tyr 370 375 380 Arg Val Glu Arg Asp Tyr Arg Leu Ala Thr Thr Glu His Leu Arg Cys 385 390 395 400 Gly Ile Tyr Leu Gln Gly Gly Met Glu His Thr His Gly Leu Ser Ser 405 410 415 Ser Leu Leu Ser Asn Leu Ala Val Arg Asn Gly Asp Ile Ser Thr Ser 420 425 430 Val Ala Arg Arg Ala Gln Ser Gln Pro His Gly Asp Gly Arg Val Leu 435 440 445 Gln Gly Leu Val Pro Thr Gly Ser 450 455 40456PRTSalinispora tropica 40Val Thr Gly Lys Val His Ile Val Phe Asp Glu Pro Ser Val Tyr Asp 1 5 10 15 Val Leu Gly Ile Gly Phe Gly Pro Ser Asn Leu Ser Leu Ala Ile Ala 20 25 30 Leu His Glu Met Gly Asp Val Glu Gly Arg Pro Leu Ala Ala Arg Phe 35 40 45 Phe Glu Gln Gln Pro Ser Phe Gly Trp His Arg Asn Met Leu Leu Pro 50 55 60 Ser Ala Lys Met Gln Val Ser Phe Leu Lys Asp Leu Val Thr Phe Arg 65 70 75 80 Asn Pro His Ser Arg Phe Thr Phe Val Ser Tyr Leu His Glu Met Asn 85 90 95 Arg Leu Ala Arg Phe Val Asn Asn Cys Asp Phe Phe Pro Thr Arg Glu 100 105 110 Glu Phe His Gly Tyr Leu Glu Trp Ala Ala Thr Asn Phe Ala Asp Gln 115 120 125 Val Thr Tyr Gly Ala Thr Ile Thr Ser Ile Ser Val Pro Pro Asp Ser 130 135 140 Gly Pro Gly Asp Pro Ile Asp Arg Val Arg Val His Leu Ala Ser Gly 145 150 155 160 Pro Thr Gly Thr Glu Ser Ser Ser Val Glu Ala Arg Asn Val Val Leu 165 170 175 Gly Thr Gly Leu Val Pro Arg Phe Pro Ala Gly Leu Thr Ser Asp Asp 180 185 190 Arg Val Trp His Ser Ser Glu Phe Leu Gly Lys Phe Gln Arg Cys Asp 195 200 205 Thr Thr Lys Leu Lys Arg Val Leu Val Val Gly Gly Gly Gln Ser Ala 210 215 220 Ala Glu Ile Ala His Phe Val Tyr Glu Asn Val Pro Gly Ala Thr Val 225 230 235 240 Thr Ala Val Ile Pro Ser Tyr Gly Tyr Ser Ile Ala Asp Ala Thr Pro 245 250 255 Phe Ala Asn Arg Val Phe Asp Pro Ser Ala Ile Asp Asp Tyr Tyr Tyr 260 265 270 Gly Asp Glu Asn Ser Arg Asp Ala Phe Trp Arg Tyr His Arg Asn Thr 275 280 285 Asn Tyr Ala Val Val Asp Ser Asp Leu Ile Ser Asp Leu Asn Arg Lys 290 295 300 Ala Tyr Asp Glu Ala Val Thr Gly Glu Ile Arg Leu Arg Phe Ala Glu 305 310 315 320 Leu Ser Arg Leu Ser Gly Val Arg Arg Arg Asp Asp Gly Val Val Val 325 330 335 Ser Ile His Ser Met Leu Ser Asn Arg Thr Ser Glu Val Asp Ala Asp 340 345 350 Ile Val Ile Cys Ala Thr Gly Tyr Glu Pro Met Glu Ile Gly Asp Met 355 360 365 Leu Gly Pro Leu Asp Arg Phe Cys Ile Arg Asp Glu His Gly Arg Tyr 370 375 380 Arg Val Glu Arg Asp Tyr Arg Leu Ala Thr Thr Glu His Leu Arg Cys 385 390 395 400 Gly Ile Tyr Leu Gln Gly Gly Met Glu His Thr His Gly Leu Ser Ser 405 410 415 Ser Leu Leu Ser Asn Leu Ala Val Arg Asn Gly Asp Ile Ser Thr Ser 420 425 430 Val Ala Arg Arg Ala Gln Ser Gln Pro His Gly Asp Gly Arg Val Leu 435 440 445 Gln Gly Leu Val Pro Thr Gly Ser 450 455 41456PRTSalinispora tropica 41Val Thr Gly Lys Val His Ile Val Phe Asp Glu Pro Ser Val Tyr Asp 1 5 10 15 Val Leu Gly Ile Gly Phe Gly Pro Ser Asn Leu Ser Leu Ala Ile Ala 20 25 30 Leu His Glu Met Gly Asp Val Glu Gly Arg Pro Leu Ala Ala Arg Phe 35 40 45 Phe Glu Gln Gln Pro Ser Phe Gly Trp His Arg Asn Met Leu Leu Pro 50 55 60 Ser Ala Lys Met Gln Val Ser Phe Leu Lys Asp Leu Val Thr Phe Arg 65 70 75 80 Asn Pro His Ser Arg Phe Thr Phe Val Ser Tyr Leu His Glu Met Asn 85 90 95 Arg Leu Ala Arg Phe Val Asn Asn Cys Asp Phe Phe Pro Thr Arg Glu 100 105 110 Glu Phe His Gly Tyr Leu Glu Trp Ala Ala Thr Asn Phe Ala Asp Gln 115 120 125 Val Thr Tyr Gly Ala Thr Ile Thr Ser Ile Ser Val Pro Pro Asp Ser 130 135 140 Gly Pro Gly Asp Pro Ile Asp Arg Val Arg Val His Leu Ala Ser Gly 145 150 155 160 Pro Thr Gly Thr Glu Ser Ser Ser Val Glu Ala Arg Asn Val Val Leu 165 170 175 Gly Thr Gly Leu Val Pro Arg Phe Pro Ala Gly Leu Thr Ser Asp Asp 180 185 190 Arg Val Trp His Ser Ser Glu Phe Leu Gly Lys Phe Gln Arg Cys Asp 195 200 205 Thr Thr Lys Leu Lys Arg Val Leu Val Val Gly Gly Gly Gln Ser Ala 210 215 220 Ala Glu Ile Ala His Phe Val Tyr Glu Asn Val Pro Gly Ala Thr Val 225 230 235 240 Thr Ala Val Ile Pro Ser Tyr Gly Tyr Ser Ile Ala Asp Ala Thr Pro 245 250 255 Phe Ala Asn Arg Val Phe Asp Pro Ser Ala Ile Asp Asp Tyr Tyr Tyr 260 265 270 Gly Asp Glu Asn Ser Arg Asp Ala Phe Trp Arg Tyr His Arg Asn Thr 275 280 285 Asn Tyr Ala Val Val Asp Ser Asp Leu Ile Ser Asp Leu Asn Arg Lys 290 295 300 Ala Tyr Asp Glu Ala Val Thr Gly Glu Thr Arg Leu Arg Phe Ala Glu 305 310 315 320 Leu Ser Arg Leu Ser Gly Val Arg Arg Arg Asp Asp Gly Val Val Val 325 330 335 Ser Ile His Ser Met Leu Ser Asn Arg Thr Ser Glu Val Asp Ala Asp 340 345 350 Ile Val Ile Cys Ala Thr Gly Tyr Glu Pro Met Glu Ile Gly Asp Met 355 360 365 Leu Gly Pro Leu Asp Arg Phe Cys Ile Arg Asp Glu His Gly Arg Tyr 370 375 380 Arg Val Glu Arg Asp Tyr Arg Leu Ala Thr Thr Glu His Leu Arg Cys 385 390 395 400 Gly Ile Tyr Leu Gln Gly Gly Met Glu His Thr His Gly Leu Ser Ser 405 410 415 Ser Leu Leu Ser Asn Leu Ala Val Arg Asn Gly Asp Ile Ser Thr Ser 420 425 430 Val Ala Arg Arg Ala Gln Ser Gln Pro His Gly Asp Gly Arg Val Leu 435 440 445 Gln Gly Leu Val Pro Thr Gly Ser 450 455 4242PRTStreptomyces sp. PsTaAH-137 42Met Asp Thr Pro Gly Ser Leu Ser Gln Glu Ile Tyr Asp Val Val Gly 1 5 10 15 Ile Gly Phe Gly Pro Ser Asn Leu Ser Leu Ala Val Ala Leu Glu Glu 20 25 30 Gln Gly Ala Ser Ser Ala Gln His Pro Val 35 40 43447PRTSalinispora arenicola 43Met Ser Asn Gln His Glu Thr Tyr Asp Leu Val Gly Ile Gly Phe Gly 1 5 10 15 Pro Ser Asn Leu Ser Leu Ala Ile Ala Leu Lys Glu Tyr Glu Ala Asn 20 25 30 Gly Gln Glu Asn Gly Ile Ser Thr Leu Phe Phe Glu Arg Gln Ser Ser 35 40 45 Phe Gly Trp His Arg Asn Met Leu Leu Pro Ser Thr Thr Met Gln Ile 50 55 60 Ser Phe Leu Lys Asp Leu Val Thr Phe Arg Asn Pro Thr Ser Gly Phe 65 70 75 80 Ser Phe Ile Ser Tyr Leu His Ala Ser Gly Arg Leu Pro Gln Phe Val 85 90 95 Asn Asn Gln Asp Phe Phe Pro Thr Arg Gln Glu Phe His Gln Tyr Leu 100 105 110 Glu Trp Ala Glu Glu Arg Met Ala Gly Arg Val Ala Tyr Gly Ser Glu 115 120 125 Val Thr Ser Ile Arg Leu Pro Ser Gly Thr Val Pro Glu Leu Ser Asp 130 135 140 Arg Leu Arg Leu Glu Val Thr Asp Ala Ala Gly Arg Val Gly Arg Val 145 150 155 160 Val Glu Ala Arg Asn Val Val Ile Ser Thr Gly Leu Val Pro Arg Met 165 170 175 Pro Glu Gly Ile Glu Arg Asp Glu Arg Val Trp His Ser Ser Glu Phe 180 185 190 Leu Gln Lys Tyr Arg Arg Met Asn Pro Gly Asp Leu Arg Arg Val Ala 195 200 205 Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ile Thr Arg Phe Leu His 210 215 220 Asp Glu Leu Pro His Ala Glu Val Trp Val Val Ile Pro Ser Tyr Gly 225 230 235 240 Tyr Ser Val Ala Asp Asp Thr Pro Phe Ala Asn Gln Ile Phe Asp Pro 245 250 255 Glu Ala Val Asp Asp Tyr Tyr Phe Gly Thr Glu Gln Thr Arg Asp Ala 260 265 270 Phe Trp Arg Tyr His Arg Asn Thr Asn Tyr Ser Val Val Asp Asp Glu 275 280 285 Val Ile Arg Asp Leu Tyr Arg Arg Val Tyr Asp Ala Glu Val Arg Gly 290 295 300 Ile Lys Arg Leu Gln Ile Leu Asn Leu Thr Arg Ile Thr Gly Val Lys 305 310 315 320 Arg Ala Ala Ala Glu Thr Arg Val Glu Leu Gln Val Gly Pro Asp Ser 325 330 335 Glu Val Arg Glu Leu Asp Val Asp Ala Leu Val Cys Ala Thr Gly Tyr 340 345 350 Asp Gly Met Glu Pro Thr His Leu Leu Gly Asp Leu Asp Arg Leu Cys 355 360 365 Leu Arg Asp Lys Ala Gly Arg His Gln Ile Glu Arg Asp Tyr Arg Ile 370 375 380 Ala Thr Ala Pro Glu Met Arg Cys Gly Ile Tyr Leu Gln Gly Gly Thr 385 390 395

400 Glu His Thr His Gly Leu Ser Ser Ser Leu Leu Ser Asn Ile Ala Val 405 410 415 Arg Ser Gly Glu Ile Ala Asp Ser Ile Val Ser Arg Arg Ala Arg His 420 425 430 Asn Ser Glu Tyr Ala Leu Ala Ala Gly Ala Glu Gly Asp Thr Cys 435 440 445 44447 PRTSalinispora arenicola 44Met Ser Asn Gln His Glu Thr Tyr Asp Leu Val Gly Ile Gly Phe Gly 1 5 10 15 Pro Ser Asn Leu Ser Leu Ala Ile Ala Leu Lys Glu Tyr Glu Ala Asn 20 25 30 Gly Gln Glu Asn Gly Ile Ser Thr Leu Phe Phe Glu Arg Gln Ser Ser 35 40 45 Phe Gly Trp His Arg Asn Met Leu Leu Pro Ser Thr Thr Met Gln Ile 50 55 60 Ser Phe Leu Lys Asp Leu Val Thr Phe Arg Asn Pro Thr Ser Gly Phe 65 70 75 80 Ser Phe Ile Ser Tyr Leu His Ala Ser Gly Arg Leu Pro Gln Phe Val 85 90 95 Asn Asn Gln Asp Phe Phe Pro Thr Arg Gln Glu Phe His Gln Tyr Leu 100 105 110 Glu Trp Ala Glu Glu Arg Met Ala Gly Arg Val Ala Tyr Gly Ser Glu 115 120 125 Val Thr Ser Ile Arg Leu Pro Ser Gly Thr Val Pro Glu Leu Ser Asp 130 135 140 Arg Leu Arg Leu Glu Val Thr Asp Ala Ala Gly Arg Val Gly Arg Val 145 150 155 160 Val Glu Ala Arg Asn Val Val Ile Ser Thr Gly Leu Val Pro Arg Met 165 170 175 Pro Glu Gly Ile Glu Arg Asp Glu Arg Val Trp His Ser Ser Glu Phe 180 185 190 Leu Gln Lys Tyr Arg Arg Met Asn Pro Gly Asp Leu Arg Arg Val Ala 195 200 205 Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ile Thr Arg Phe Leu His 210 215 220 Asp Glu Leu Pro His Ala Glu Val Trp Val Val Ile Pro Ser Tyr Gly 225 230 235 240 Tyr Ser Val Ala Asp Asp Thr Pro Phe Ala Asn Gln Ile Phe Asp Pro 245 250 255 Glu Ala Val Asp Asp Tyr Tyr Phe Gly Thr Glu Gln Thr Arg Asp Ala 260 265 270 Phe Trp Arg Tyr His Arg Asn Thr Asn Tyr Ser Val Val Asp Asp Glu 275 280 285 Val Ile Arg Asp Leu Tyr Arg Arg Val Tyr Asp Ala Glu Val Arg Gly 290 295 300 Ile Lys Arg Leu Gln Ile Leu Asn Leu Thr Arg Ile Thr Gly Val Lys 305 310 315 320 Arg Ala Ala Ala Glu Thr Arg Val Glu Leu Gln Val Gly Pro Asp Ser 325 330 335 Glu Val Arg Glu Leu Asp Val Asp Ala Leu Val Cys Ala Thr Gly Tyr 340 345 350 Asp Gly Met Glu Pro Thr His Leu Leu Gly Asp Leu Asp Arg Leu Cys 355 360 365 Leu Arg Asp Lys Ala Gly Arg His Gln Ile Glu Arg Asp Tyr Arg Ile 370 375 380 Ala Thr Ala Pro Glu Met Arg Cys Gly Ile Tyr Leu Gln Gly Gly Thr 385 390 395 400 Glu His Thr His Gly Leu Ser Ser Ser Leu Leu Ser Asn Ile Ala Val 405 410 415 Arg Ser Gly Glu Ile Ala Asp Ser Ile Val Ser Arg Arg Ala Arg His 420 425 430 Asn Ser Glu Tyr Ala Leu Ala Ala Gly Ala Glu Gly Asp Thr Cys 435 440 445 45447 PRTSalinispora pacifica 45Met Ser Asn Gln His Glu Thr Tyr Asp Leu Val Gly Ile Gly Phe Gly 1 5 10 15 Pro Ser Asn Leu Ser Leu Ala Ile Ala Leu Lys Glu Tyr Glu Ala Asn 20 25 30 Gly Gln Glu Asn Gly Ile Ser Thr Leu Phe Phe Glu Arg Gln Ser Ser 35 40 45 Phe Gly Trp His Arg Asn Met Leu Leu Pro Ser Thr Thr Met Gln Ile 50 55 60 Ser Phe Leu Lys Asp Leu Val Thr Phe Arg Asn Pro Thr Ser Gly Phe 65 70 75 80 Ser Phe Ile Ser Tyr Leu His Ala Ser Gly Arg Leu Pro Gln Phe Val 85 90 95 Asn Asn Gln Asp Phe Phe Pro Thr Arg Gln Glu Phe His Gln Tyr Leu 100 105 110 Glu Trp Ala Glu Glu Arg Met Ala Gly Arg Val Ala Tyr Cys Ser Glu 115 120 125 Val Thr Ser Ile Arg Leu Pro Ser Gly Thr Val Pro Glu Leu Ser Asp 130 135 140 Arg Leu Arg Leu Glu Val Thr Asp Ala Ala Gly Arg Val Gly Arg Val 145 150 155 160 Val Glu Ala Arg Asn Val Val Ile Ser Thr Gly Leu Val Pro Arg Met 165 170 175 Pro Glu Gly Ile Glu Arg Asp Glu Arg Val Trp His Ser Ser Glu Phe 180 185 190 Leu Gln Lys Tyr Arg Arg Met Asn Pro Gly Asp Leu Arg Arg Val Ala 195 200 205 Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ile Thr Arg Phe Leu His 210 215 220 Asp Glu Leu Pro His Ala Glu Val Trp Val Val Ile Pro Ser Tyr Gly 225 230 235 240 Tyr Ser Val Ala Asp Asp Thr Pro Phe Ala Asn Gln Ile Phe Asp Pro 245 250 255 Glu Ala Val Asp Asp Tyr Tyr Phe Gly Thr Glu Gln Thr Arg Asp Ala 260 265 270 Phe Trp Arg Tyr His Arg Asn Thr Asn Tyr Ser Val Val Asp Asp Glu 275 280 285 Val Ile Arg Asp Leu Tyr Arg Arg Val Tyr Asp Ala Glu Val Arg Gly 290 295 300 Ile Lys Arg Leu Gln Ile Leu Asn Leu Thr Arg Ile Thr Gly Val Lys 305 310 315 320 Arg Ala Ala Ala Glu Thr Arg Val Glu Leu Gln Val Gly Pro Asp Ser 325 330 335 Glu Val Arg Glu Leu Asp Val Asp Ala Leu Val Cys Ala Thr Gly Tyr 340 345 350 Asp Gly Met Glu Pro Thr His Leu Leu Gly Asp Leu Asp Arg Leu Cys 355 360 365 Leu Arg Asp Lys Ala Gly Arg His Gln Ile Glu Arg Asp Tyr Arg Ile 370 375 380 Ala Thr Ala Pro Glu Met Arg Cys Gly Ile Tyr Leu Gln Gly Gly Thr 385 390 395 400 Glu His Thr His Gly Leu Ser Ser Ser Leu Leu Ser Asn Ile Ala Val 405 410 415 Arg Ser Gly Glu Ile Ala Asp Ser Ile Val Ser Arg Arg Ala Arg His 420 425 430 Asn Ser Glu Tyr Ala Leu Ala Ala Gly Ala Glu Gly Asp Thr Cys 435 440 445 46432 PRTActinomadura atramentaria 46Val Thr Gly Pro Ala Thr Asp Ala Asp Asp Ile Leu Asp Ile Val Gly 1 5 10 15 Val Gly Phe Gly Pro Ser Asn Leu Ala Leu Ala Val Ala Val Arg Glu 20 25 30 His Asn Ala Asp Arg Pro Ala Ala Glu His Leu Thr Gln Val Tyr Phe 35 40 45 Glu Lys Gln Pro Ala Phe Gly Trp His Arg Gly Met Leu Ile Asp Gly 50 55 60 Ala Thr Met Gln Val Ser Phe Ile Lys Asp Leu Val Thr Met Arg Asn 65 70 75 80 Pro Ala Ser Glu Tyr Gly Phe Leu Ser Tyr Leu His Asp Asn Asp Arg 85 90 95 Leu Ala Asp Phe Ile Asn His Lys Ser Leu Phe Pro Ser Arg Val Glu 100 105 110 Phe His Asp Tyr Leu Glu Trp Val Ala Arg Arg Phe Gln Asp Val Ala 115 120 125 Arg Tyr Gly Ser Glu Val Val Ala Met Arg Pro Gly Pro Gly Gly Asp 130 135 140 His Ile Glu Val Ile Val Arg Arg Gly Gly Glu His Arg Val Gln Arg 145 150 155 160 Ala Arg Asn Val Val Val Ala Val Gly Gln Glu Pro Ala Leu Pro Asp 165 170 175 Asp Ile Glu Leu Gly Asp Arg Ile Trp His Cys Ala Gln Leu Leu Glu 180 185 190 Arg Val Glu Arg Leu Thr Glu Glu Pro Arg Arg Ala Val Val Val Gly 195 200 205 Ala Gly Gln Ser Ala Ala Glu Thr Thr Glu Phe Leu His Arg Arg Phe 210 215 220 Glu Asn Ala Glu Val Ser Ala Ile Phe Leu Arg Tyr Gly Tyr Ser Val 225 230 235 240 Ala Asp Asp Thr Pro Phe Ala Asn Arg Ile Phe Asp Pro Glu Ser Val 245 250 255 Asp Val Phe Tyr Gly Ala Pro Glu Asn Val Lys Arg Met Leu Phe Asp 260 265 270 Tyr His Arg Asn Thr Asn Tyr Ser Val Val Asp Gln Glu Leu Ala Asp 275 280 285 Glu Leu Tyr Arg Arg Val Tyr Gln Glu Arg Val Arg Gly Val Glu Arg 290 295 300 Leu Arg Ile Leu Asn Ala Ser Arg Leu His Ala Val Arg Arg Asp Val 305 310 315 320 Thr Gly Asp Gly Leu Arg Val Asp Val Glu His Leu Pro Thr Gly Glu 325 330 335 Lys Arg Ser Phe Gly Val Asp Leu Val Val Tyr Ala Thr Gly Tyr Arg 340 345 350 Pro Ile Asp Pro Ala Asn Val Leu Gly Glu Val Ala Glu Tyr Cys Arg 355 360 365 Arg Asp Ala Gly Lys Arg Pro Ala Ile Thr Arg Asp Tyr Arg Leu Glu 370 375 380 Thr Asp Asp Arg Leu Arg Ala Gly Ile Tyr Leu Gln Gly Gly Thr Glu 385 390 395 400 Gln Thr His Gly Ile Ser Ala Gln Leu Leu Ser Asn Thr Ala Val Arg 405 410 415 Ala Gly Glu Ile Val Arg Ser Ile Ala Gly Ala Arg Val Gly Ala Val 420 425 430 47431PRTStreptomyces drozdowiczii 47Met Thr Val Asn Leu Gly Ser Thr Ser Val Leu Glu Val Ala Gly Ile 1 5 10 15 Gly Phe Gly Pro Ser Asn Met Ala Leu Ala Ile Ala Leu Glu Glu Met 20 25 30 His Gly Ala Arg Ala Asn Ser Pro Gly Pro Ala Met Glu Phe Phe Glu 35 40 45 Lys Gln Pro Ala Phe Gly Trp His Arg Gly Met Leu Met Glu Asp Ala 50 55 60 Thr Met Gln Val Ser Phe Leu Lys Asp Leu Ala Thr Met Arg Asp Pro 65 70 75 80 Gln Ser Arg Tyr Thr Phe Met Ala Tyr Leu Lys Ala Lys Gly Arg Ile 85 90 95 Ala Arg Phe Ile Asn Ser Lys Thr Leu Phe Pro Leu Arg Val Glu Phe 100 105 110 His Asp Tyr Leu Glu Trp Val Ala Asp Leu Leu Ala Pro Val Val Ser 115 120 125 Tyr Gly Ser Asp Val Leu Ala Ile Arg Pro Val Val Glu Asp Gly Val 130 135 140 Met Glu Cys Leu Asp Val Val Val Arg Thr Ser Ala Gly Asp Gly Glu 145 150 155 160 Pro Ile Val Arg Arg Ala Arg Asn Val Val Ile Gly Thr Gly Leu Thr 165 170 175 Pro Arg Leu Pro Asp Gly Thr Glu Glu Ser Ala Arg Val Trp His Ser 180 185 190 Ser Arg Leu Met Asp Arg Ala Ala Ser Ile Ala Ala Ala Pro Arg Gly 195 200 205 Phe Val Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ala Thr Glu Tyr 210 215 220 Leu His Arg Ser Phe Pro Gly Thr Pro Val Ser Ala Val Phe Ala Arg 225 230 235 240 Tyr Gly Tyr Ser Val Ala Asp Asp Ser Pro Phe Thr Asn Gly Ile Phe 245 250 255 Asp Pro Glu Ala Val Asp Glu Phe Tyr Ala Ala Ser Arg Asp Val Lys 260 265 270 Gln Asp Leu Leu Asp Tyr His Gly Asn Thr Asn Tyr Ala Val Val Asp 275 280 285 Leu Ser Leu Thr Glu Glu Leu Tyr Arg Arg Ala Tyr Gln Glu Glu Val 290 295 300 Leu Gly Arg Glu Arg Leu Arg Phe His Asn Ala Ser Arg Val Leu Lys 305 310 315 320 Val Glu Glu His Pro Asp Arg Val Arg Val Thr Val Glu His Leu Pro 325 330 335 Asp Arg Thr Val Glu Thr Leu Asp Ala Asp Ala Val Val Tyr Ala Thr 340 345 350 Gly Tyr Arg Pro Ser Asp Pro Thr Pro Leu Leu Gln Asn Leu Leu Pro 355 360 365 Glu Cys Lys Leu Asp Asp Ala Gly Arg Ile Thr Leu Asp Arg Asp Tyr 370 375 380 Arg Ile Val Thr Ser Gly Asp Val Arg Cys Gly Ile Tyr Leu His Gly 385 390 395 400 Ala Ser Ala Glu Cys Thr His Gly Leu Ser Ala Gly Leu Leu Ser Asn 405 410 415 Thr Ala Val Arg Ser Gly Glu Ile Ala Asp Ser Ile Ile Lys Arg 420 425 430 48448PRTStreptomyces sp. RSD-27 48Met Gly Ile Thr Gly Arg Arg Asp Glu Glu Ile Tyr Asp Val Ile Gly 1 5 10 15 Ile Gly Phe Gly Pro Ser Asn Met Ser Leu Ala Ile Ala Leu Gln Glu 20 25 30 His Gly Ala Gly Val Pro Leu His Pro Val Arg Ser His Phe Phe Glu 35 40 45 Arg Gln Pro Thr Phe Gly Trp His Arg Asn Met Leu Leu Pro Ser Thr 50 55 60 Thr Met Gln Ile Ser Phe Leu Lys Asp Leu Ala Thr Phe Arg Asn Pro 65 70 75 80 Met Ser Arg Phe Ser Phe Val Ser Tyr Leu His Ala Ser Asn Arg Leu 85 90 95 Val Gln Phe Val Asn Asn Gln Ser Phe Ile Pro Thr Arg Gln Glu Phe 100 105 110 His Gln Tyr Leu Glu Trp Ala Ala Ala Gly Leu Arg Asp Gln Val Thr 115 120 125 Tyr Gly Ala Glu Val Thr Ser Val Arg Pro Val Thr Ala Ala Gly Ser 130 135 140 Arg Thr Pro Asp Leu Leu Glu Val Glu Val Arg Thr Gly Asp Glu Val 145 150 155 160 Ser Val Val Thr Ala Arg Asn Val Val Val Ser Thr Gly Leu Val Pro 165 170 175 Arg Met Pro Glu Gly Val Pro Ala Gly Glu Arg Val Trp His Ser Ser 180 185 190 Glu Phe Leu Ala Arg Phe Asn Ala Gln Asp Pro Ala Glu Leu Lys Ser 195 200 205 Val Ala Val Val Gly Ala Gly Gln Ser Ala Ala Glu Val Thr Arg Phe 210 215 220 Leu Tyr Asp Ser Leu Pro His Ala Glu Val Ser Ala Val Ile Pro Ser 225 230 235 240 Tyr Gly Tyr Ser Val Ala Asp Asp Thr Pro Phe Ala Asn Gln Val Phe 245 250 255 Asp Pro Asp Thr Val Asp Glu Tyr Tyr Phe Gly Thr Glu Gly Ala Arg 260 265 270 Asp Ala Phe Trp Arg Tyr His Arg Asn Thr Asn Tyr Ser Val Val Asp 275 280 285 Ala Asp Val Ile Arg Ser Leu Tyr Gln Arg Trp Tyr Asp Glu Gln Val 290 295 300 Arg Gly Val Gln Arg Leu Arg Phe Arg Asn Leu Thr Arg Val Asp Gly 305 310 315 320 Val Glu Gly Ser Gly Ser Gly Ala Arg Met Val Leu Arg Ser Leu Leu 325 330 335 Asp Asp Ser Arg Glu Glu Leu Ala Val Asp Ala Val Val Phe Ala Ser 340 345 350 Gly Tyr Asp Gly Leu Asp Pro Ala Arg Leu Leu Gly Glu Asp Phe Asp 355 360 365 Arg His Phe Gln Arg Asp Ala Ala Gly Arg His Arg Val Glu Arg Asp 370 375 380 Tyr Arg Leu Val Ser Thr Ser Gly Leu Thr Cys Gly Val Tyr Leu Gln 385 390 395 400 Gly Gly Thr Glu His Ser His Gly Leu Thr Ser Ala Leu Leu Ser Asn 405 410 415 Ile Ala Ile Arg Ser Gly Glu Ile Ala Asp Ser Ile Val Leu Arg Arg 420 425 430 Thr Glu Arg Glu Leu Gly Arg His Ala Glu Glu Ala Pro Ser Ala Ala 435 440 445 49434 PRTActinoalloteichus spitiensis 49Met Asp Gly Ser Phe Pro Val Asp Gly Asn Gln Val Ser Asp Val

Val 1 5 10 15 Gly Val Gly Phe Gly Pro Ser Asn Leu Ala Leu Ala Val Ala Val Ala 20 25 30 Glu His Asn Glu Ala Val Gly Pro Glu Glu Arg Leu Arg Ala Arg Phe 35 40 45 Leu Glu Arg Gln Pro Asp Phe Gly Trp His Arg Gly Met Leu Leu Pro 50 55 60 Asp Thr Thr Leu Gln Val Ser Phe Leu Lys Asp Leu Val Ser Leu Arg 65 70 75 80 Asn Pro Arg Ser Ser Phe Ser Phe Ile Ser Tyr Leu His Asp Arg Asn 85 90 95 Arg Leu Val Asp Phe Val Asn His Gln Cys Phe Phe Pro Ser Arg Arg 100 105 110 Glu Tyr His Asp Tyr Leu Glu Trp Val Ala Gly Arg Phe Val Asp Ser 115 120 125 Val His Tyr Asp His Asp Val Val Asp Val Leu Pro Val His Glu Gly 130 135 140 Pro Asp Val Val Ala Phe Asp Val Val Ala Val Gln Gly Gly Ala Gly 145 150 155 160 Ala Thr Arg Arg Leu Arg Thr Arg Asn Val Val Leu Ala Pro Gly Leu 165 170 175 Glu Pro Val Leu Pro Gln Gly Ile Thr Pro Ser Asp Arg Val Trp His 180 185 190 Ser Ser Glu Leu Leu His Arg Leu Asp Gly Phe Arg Asp Arg Leu Pro 195 200 205 Asp Arg Pro Arg Phe Val Val Val Gly Ala Gly Gln Ser Ala Ala Glu 210 215 220 Val Met Ala His Leu His Gly Val Phe Pro Lys Ala Thr Val Arg Ser 225 230 235 240 Val Cys Ser Arg Tyr Gly Phe Ala Pro Ala Asp Asp Ser Pro Phe Val 245 250 255 Asn Gln Leu Phe Asp Pro Ala Ala Val Asp Glu Phe Phe Glu Ala Ala 260 265 270 Leu Pro Ala Arg Glu Asn Ile Leu Arg Val His Ala Gly Thr Asn Tyr 275 280 285 Ser Ala Val Asp Gly Asp Leu Ile Ser Glu Leu Tyr Arg Arg Ser Tyr 290 295 300 Gln Glu Arg Val Ser Gly Glu Pro Arg Leu His Phe Glu Arg Leu Ala 305 310 315 320 Arg Val Val Ala Thr Glu Glu Arg Asp Glu Glu Val Ser Val Ser Val 325 330 335 Leu Ser Leu Thr Asp Gly Arg Val Thr Asp Arg Gly Cys Asp Val Val 340 345 350 Val Leu Ala Thr Gly Tyr Arg Pro Arg Asp Ala Leu Arg Pro Leu Gly 355 360 365 Gln Leu Ala Ala Leu Cys Lys Leu Asp Ala Asn Gly Trp Pro Arg Val 370 375 380 Glu Arg Asn Tyr Arg Ile Thr Thr Thr Glu Thr Val Arg Ala Gly Ile 385 390 395 400 Tyr Leu Gln Gly Gly Thr Glu His Ser His Gly Leu Ser Ser Thr Leu 405 410 415 Leu Ser Asn Leu Ala Val Arg Ser Gly Glu Ile Thr Arg Ala Leu Ala 420 425 430 Ala Pro 50446PRTStreptomyces sp. PBH53 50Met Thr Arg Leu Ala Gly Gln Ala Pro Thr Ala Gln His Ser Pro Glu 1 5 10 15 Ser Glu Val Arg Asp Val Thr Gly Ile Gly Phe Gly Ala Ala Asn Leu 20 25 30 Ala Leu Ala Val Ala Leu His Glu Ser Gly Ala Gly Gly Arg Ala Leu 35 40 45 Phe Leu Glu Lys Gln Lys Glu Phe Gly Trp His Arg Gly Met Leu Ile 50 55 60 Glu Gly Ser Ser Leu Gln Val Ser Phe Leu Lys Asp Ile Ala Thr Met 65 70 75 80 Arg Asn Pro Thr Ser Asp Phe Gly Phe Leu Ser Tyr Leu Gln Glu Lys 85 90 95 Gly Arg Leu Val Asp Phe Ile Asn Gln His Thr Leu Leu Pro Ser Arg 100 105 110 Ile Glu Tyr His Asp Tyr Leu Gln Trp Ala Ala Asp Arg Leu Gly His 115 120 125 Met Val Glu Tyr Gly Val Glu Ala Thr Gly Val Arg Pro Val Thr Asp 130 135 140 Ala Gly Glu Val Val Ala Leu Asp Val Leu Ala Gly Asp Arg Val Val 145 150 155 160 Thr Arg Thr Arg Asn Leu Val Ile Ala Ser Gly Leu Arg Pro Arg Leu 165 170 175 Pro Glu Gly Ala Glu Thr Gly Glu Arg Val Trp His Ser Ser Gln Leu 180 185 190 Leu His Arg Leu Pro Ala Phe Asp Glu Arg Pro Pro Arg Arg Ala Val 195 200 205 Val Val Gly Ala Gly Gln Ser Ala Ala Glu Val Ala Ala His Leu Met 210 215 220 Glu Arg Tyr Pro Gln Ala Glu Val Cys Ala Val Phe Ser Arg Tyr Gly 225 230 235 240 Tyr Ser Val Ala Asp Ser Ser Pro Phe Ala Asn Arg Val Phe Asp Pro 245 250 255 Ala Ala Val Asp Asp Phe Tyr Phe Ala Pro Pro Glu Val Lys Gln Ala 260 265 270 Ile Met Arg Tyr His Gly Gly Thr Asn Tyr Ala Val Val Asp Glu Asp 275 280 285 Val Leu Gln Gly Leu Tyr Arg Arg Gln Tyr Glu Gln Lys Val Thr Gly 290 295 300 Thr Pro Arg Leu Arg Val Met Asn Ala Ser Arg Leu Val Ser Val Glu 305 310 315 320 Pro Arg Gly Glu Thr Ala Ala Val Arg Val Glu Phe Leu Pro Thr Gly 325 330 335 Glu His Ala Asp Leu Asp Ala Asp Leu Val Val Tyr Ala Thr Gly Tyr 340 345 350 Arg Ser Ala Asp Pro Ala Glu Leu Leu Gly Gly Val Ala Gly Ser Leu 355 360 365 Arg Arg Asp Ala Ala Gly Gln Val Leu Ile Gly Arg Asp Tyr Arg Leu 370 375 380 Ser Thr Thr Gly Asp Phe Arg Cys Gly Ile Tyr Val Gln Gly Ala Thr 385 390 395 400 Glu Ala Thr His Gly Ile Ala Ser Thr Leu Leu Ser Met Val Ala Val 405 410 415 Arg Ala Gly Glu Ile Ala Gln Ser Ile Ile Gly Gly Arg Arg Asp Pro 420 425 430 Asp Arg Thr Ala Gly Thr Lys Ala Val Ala Gly Asn Arg Gly 435 440 445 51447 PRTSalinispora arenicola 51Met Ser Asn Gln His Glu Thr Tyr Asp Leu Val Gly Ile Gly Phe Gly 1 5 10 15 Pro Ser Asn Leu Ser Leu Ala Ile Ala Leu Lys Glu Tyr Glu Ala Asn 20 25 30 Gly Gln Glu Asn Gly Ile Ser Thr Leu Phe Phe Glu Arg Gln Ser Ser 35 40 45 Phe Gly Trp His Arg Asn Met Leu Leu Pro Ser Thr Thr Met Gln Ile 50 55 60 Ser Phe Leu Lys Asp Leu Val Thr Phe Arg Asn Pro Thr Ser Gly Phe 65 70 75 80 Ser Phe Ile Ser Tyr Leu His Ala Ser Gly Arg Leu Pro Gln Phe Val 85 90 95 Asn Asn Gln Asp Phe Phe Pro Thr Arg Gln Glu Phe His Gln Tyr Leu 100 105 110 Glu Trp Ala Glu Glu Arg Met Ala Gly Arg Val Ala Tyr Gly Ser Glu 115 120 125 Val Thr Ser Ile Arg Leu Pro Ser Gly Thr Val Pro Glu Leu Ser Asp 130 135 140 Arg Leu Arg Leu Glu Val Thr Asp Ala Ala Gly Arg Val Gly Arg Val 145 150 155 160 Val Glu Ala Arg Asn Val Val Ile Ser Thr Gly Leu Val Pro Arg Met 165 170 175 Pro Glu Gly Ile Glu Arg Asp Glu Arg Val Trp His Ser Ser Glu Phe 180 185 190 Leu Gln Lys Tyr Arg Arg Met Asn Pro Gly Asp Leu Arg Arg Val Ala 195 200 205 Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ile Thr Arg Phe Leu His 210 215 220 Asp Glu Leu Pro His Ala Glu Val Trp Val Val Ile Pro Ser Tyr Gly 225 230 235 240 Tyr Ser Val Ala Asp Asp Thr Pro Phe Ala Asn Gln Ile Phe Asp Pro 245 250 255 Glu Ala Val Asp Asp Tyr Tyr Phe Gly Thr Glu Gln Thr Arg Asp Ala 260 265 270 Phe Trp Arg Tyr His Arg Asn Thr Asn Tyr Ser Val Val Asp Asp Glu 275 280 285 Val Ile Arg Asp Leu Tyr Arg Arg Val Tyr Asp Ala Glu Val Arg Gly 290 295 300 Ile Lys Arg Leu Gln Ile Leu Asn Leu Thr Arg Ile Thr Gly Val Lys 305 310 315 320 Arg Ala Ala Ala Glu Thr Arg Val Glu Leu Gln Val Gly Pro Asp Ser 325 330 335 Glu Val Arg Glu Leu Asp Val Asp Ala Leu Val Cys Ala Thr Gly Tyr 340 345 350 Asp Gly Met Glu Pro Thr His Leu Leu Gly Asp Leu Asp Arg Leu Cys 355 360 365 Leu Arg Asp Lys Ala Gly Arg His Gln Ile Glu Arg Asp Tyr Arg Ile 370 375 380 Ala Thr Ala Pro Glu Met Arg Cys Gly Ile Tyr Leu Gln Gly Gly Thr 385 390 395 400 Glu His Thr His Gly Leu Ser Ser Ser Leu Leu Ser Asn Ile Ala Val 405 410 415 Arg Ser Gly Glu Ile Ala Asp Ser Ile Val Ser Arg Arg Ala Arg His 420 425 430 Asn Ser Glu Tyr Ala Leu Ala Ala Gly Ala Glu Gly Asp Thr Cys 435 440 445 52431 PRTStreptomyces sp. MNU77 52Val Glu Ala Ser Ala Ser Val Thr Asp Val Val Gly Val Gly Phe Gly 1 5 10 15 Pro Ala Asn Leu Ala Leu Ala Ile Ala Leu Arg Glu Leu Gly Ala Gly 20 25 30 Pro Pro Gly Gly Asp Gly Leu Thr Ala Ala Phe Leu Glu Ala Gln Pro 35 40 45 Gln Phe Gly Trp His Ser Gly Met Leu Ile Glu Asp Ser Thr Met Gln 50 55 60 Val Ser Phe Leu Lys Asp Leu Val Thr Pro Arg Asn Pro Val Ser Pro 65 70 75 80 Phe Ser Phe Val Ala Tyr Leu His Ala Val Gly Arg Leu Gly Arg Phe 85 90 95 Met Asp Ser Lys Met Met Tyr Pro Leu Arg Ile Glu Phe His Asn Tyr 100 105 110 Leu Glu Trp Val Ala Gly His Phe Ala Asn Gln Val Ala Tyr Ser Arg 115 120 125 Arg Val Thr Ala Leu Arg Pro Val His Gly Gln Asp Gly Val Glu Ala 130 135 140 Leu Asp Val Val Ala Arg Asp Ala Asp Gly Thr Glu Arg Val Leu Arg 145 150 155 160 Ala Arg Ser Val Val Leu Ala Cys Gly Leu Arg Pro Arg Leu Pro Glu 165 170 175 Gly Leu Thr Gly Ser Asp Arg Val Trp His Thr Ala Asp Leu Leu Pro 180 185 190 Arg Ala Arg Arg Leu Leu Glu Ser Gly Ala Ala Pro Thr Ser Phe Val 195 200 205 Val Leu Gly Ala Gly Gln Ser Ser Ala Glu Ala Ala His Tyr Leu His 210 215 220 Arg Thr Phe Thr Arg Ser Ser Val Ser Val Val His Ser Arg Tyr Gly 225 230 235 240 Phe Ser Val Ser Asp Asp Ser Pro Phe Ala Asn Ala Val Phe Gly Ala 245 250 255 Lys Ala Val Asp Glu Phe Tyr Gly Ala Pro Asp Glu Val Lys Arg Met 260 265 270 Val Leu Asp Tyr His Ala Asn Thr Asn Tyr Ala Val Val Asp Glu Asp 275 280 285 Leu Ile His Arg Leu Tyr Gly Asp Val Tyr Arg Glu Ser Leu Thr Gly 290 295 300 Asp Asp Arg Leu Arg Phe His His Leu Ser Arg Leu Ser Thr Val Thr 305 310 315 320 Pro Gly Glu Asp Ala Val Arg Val Glu Val Glu Ala Leu His Asp Gly 325 330 335 Arg Arg Thr Val Ile Asp Ala Asp Ala Leu Val Cys Ala Thr Gly Tyr 340 345 350 Arg Pro Ser Asp Pro Ala Asp Leu Met Gly Asp Leu Leu Pro Leu Cys 355 360 365 Ala Arg Asp Glu Gln Asp Arg Leu Val Leu Asp Arg Asp Arg Arg Leu 370 375 380 Val Thr Arg Glu Pro Leu Ala Gly Gly Val Tyr Val Thr Gly Tyr Gly 385 390 395 400 Glu His Thr His Gly Ile Ala Glu Ser Leu Leu Ser Leu Thr Ala Gln 405 410 415 Arg Ala Gly Glu Leu Thr Glu Ala Leu Ala Lys Thr Phe Val Thr 420 425 430 53425PRTMicromonospora pattaloongensis 53Met Ser Glu Thr Asp Ser Ala Thr Val Arg Gln Val Val Gly Val Gly 1 5 10 15 Phe Gly Pro Ala Asn Leu Ala Leu Ala Ile Ala Ala Gly Glu Val Ala 20 25 30 Gly Pro Asp Gly Arg Thr Leu Leu Asp Glu Cys Val Phe Leu Glu Arg 35 40 45 Gln Pro Ser Phe Gly Trp His Arg Gly Met Leu Leu Asp Gly Ala Thr 50 55 60 Met Gln Val Ser Phe Leu Lys Asp Leu Ala Thr Leu Arg Ser Pro Ser 65 70 75 80 Ser Arg Tyr Thr Phe Thr Ser Tyr Leu His Asp Val Gly Arg Leu Thr 85 90 95 Asp Phe Ile Asn Ser Lys Thr Leu Tyr Pro Tyr Arg Thr Asp Phe His 100 105 110 Thr Tyr Leu Glu Trp Ala Ala Asp Arg Leu Pro Ala Asp Val Arg Tyr 115 120 125 Gly Thr Glu Val Val Ser Val Thr Pro Glu Arg Thr Asp Asp Val Val 130 135 140 Arg Glu Leu Leu Val Arg Thr Gly Asp Gly Arg Thr Phe Arg Thr Arg 145 150 155 160 Asn Leu Val Ile Gly Thr Gly Met Thr Pro Cys Phe Pro Asp Gly Val 165 170 175 Gln Arg Gly Pro Arg Val Trp His Ser Ala Glu Leu Leu Thr Arg Leu 180 185 190 Ala Ala Pro Ala Pro Thr Arg Pro Arg Thr Phe Ala Val Val Gly Ala 195 200 205 Gly Gln Ser Ala Ala Glu Val Val Glu His Leu His Ala Thr His Pro 210 215 220 Glu Ala Asp Val His Ala Ile Phe Gly Arg Phe Gly Tyr Ser Met Ser 225 230 235 240 Asp Asp Ser Pro Phe Ala Asn Gln Ile Phe Asp Pro Asp Ser Val Asp 245 250 255 Glu Phe Tyr His Ala Pro Gly Glu Val Arg Asp Ala Leu Met Gly Tyr 260 265 270 His Ala Asn Thr Asn Tyr Ser Val Val Asp Leu Asp Leu Ile Arg Ser 275 280 285 Leu His Gly Thr Ala Tyr Arg Glu His Ile Ala Gly Arg Arg Arg Leu 290 295 300 His Phe His His Ala Ser Arg Ile Thr Arg Gln Thr Val Thr Gly Glu 305 310 315 320 Gly Val His Leu Asp Val Glu Phe Leu Pro Thr Gly Thr Ile Arg Gln 325 330 335 Ile Asp Ala Asp Ala Ile Val Tyr Ala Thr Gly Tyr Arg Pro Ser Asp 340 345 350 Pro Arg Gln Leu Leu Gly Asp Leu Ala Asp Glu Cys Lys Thr Asp Asp 355 360 365 Arg Gly Arg Leu Ala Leu Ala Arg Asp Tyr Arg Val Ile Thr Ser Asp 370 375 380 Gly Val Arg Cys Gly Ile Tyr Val His Gly Ala Ala Ala Glu Arg Thr 385 390 395 400 His Gly Leu Ser Ala Gly Leu Leu Ser Asn Val Ala Val Arg Ala Gly 405 410 415 Glu Ile Leu Ala Ala Ile Arg Ser Leu 420 425 54450PRTStreptacidiphilus carbonis 54Met Gly Ala Arg Glu Asn Ala Thr Tyr Asp Val Val Gly Ile Gly Phe 1 5 10 15 Gly Pro Ser Asn Leu Ser Leu Ala Ile Ala Leu Glu Glu Arg Cys Ala 20 25 30 Asn Val Leu Thr Asn Ser Ile Thr Ser Ala Phe Phe Glu Arg Gln Ser 35 40 45 Ser Phe Gly Trp His Arg Asn Met Leu Leu Pro Ser Ala Thr Met Gln 50 55 60 Ile Ser Phe Leu Lys Asp Leu Val Thr Phe Arg Asn Pro Val Ser Arg 65 70 75 80 Phe Ser Phe Val Ala Phe Leu His Ala Lys Gly Arg Leu Gly Gln Phe 85 90

95 Val Asn Arg Lys Asp Phe Phe Pro Thr Arg Gln Glu Phe His Gln Tyr 100 105 110 Leu Glu Trp Ala Ala Ala Lys Met Ala Asp Ala Val Thr Tyr Asp Ser 115 120 125 Thr Val Thr Ser Val Gln Leu Pro Pro Asp His Gly Ser Gly Gly Asp 130 135 140 Gly Tyr Val Gln Leu Glu Val Arg Asp Thr Ala Ala Gly Ser Thr Arg 145 150 155 160 Arg Val Asn Thr Arg Asn Val Val Val Ser Thr Gly Leu Val Pro Arg 165 170 175 Met Pro Asp Gly Ile Ala Arg Asp Asp Arg Val Trp His Ser Ser Glu 180 185 190 Phe Leu Thr Arg Tyr Gly Arg Thr Asp Pro Glu Val Leu Arg Ser Val 195 200 205 Ala Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ile Thr Gln Phe Phe 210 215 220 His Gly Arg Leu Pro His Ala Gln Val His Ala Ile Met Pro Ser Tyr 225 230 235 240 Gly Tyr Ser Val Ala Asp Asp Thr Pro Phe Ala Asn Gln Val Phe Asp 245 250 255 Ala Asp Ala Val Glu Asp Tyr Tyr Asp Gly Asp Glu Pro Ala Arg Asp 260 265 270 Ala Phe Trp Arg Tyr His Arg Asn Thr Asn Tyr Gly Val Val Asp Ser 275 280 285 Ala Asp Ile Gln Ala Leu Tyr Gln Thr Gln Tyr Asp Glu Gly Val Ala 290 295 300 Gly Ala Lys Arg Leu His Phe His Asn Leu Thr Lys Val Arg Ala Val 305 310 315 320 Glu Arg Asn Gly Ser Ala Arg Arg Val Thr Leu Gln Ser Leu Arg His 325 330 335 His Glu Val Arg Gln Leu Asp Val Asp Ala Ile Val Phe Ala Thr Gly 340 345 350 Tyr Ala Ser Met Asp Pro Thr Gln Leu Leu Gly Asp Leu Asp Arg Tyr 355 360 365 Cys Leu Arg Asp Glu Ser Gly His His Arg Val Thr Arg Asp Tyr Arg 370 375 380 Leu Val Thr Thr Pro Glu Leu Ser Cys Gly Ile Tyr Leu Gln Gly Gly 385 390 395 400 Thr Glu His Thr His Gly Leu Thr Ser Ser Leu Leu Ser Asn Ile Ala 405 410 415 Val Arg Ser Gly Glu Ile Ala Asp Ser Ile Ile Cys Arg Arg Ala Glu 420 425 430 Ser Glu Leu Ala Thr Ile Ala Ala Glu Val Arg Glu Ala Val Ala Glu 435 440 445 Arg Leu 450 55448PRTStreptomyces sp. MnatMP-M27 55Met Thr Asp Ser Ala Pro Gly Asp Arg Thr Val Asp Val Thr Gly Ile 1 5 10 15 Gly Phe Gly Pro Ser Asn Leu Ala Leu Ala Thr Ala Leu Ala Glu Pro 20 25 30 Ser Ala Thr Gly Pro Gly Arg Pro Leu Glu Ala Val Tyr Phe Glu Arg 35 40 45 Lys Asn Arg Phe Ser Trp His Gly Gly Met Leu Leu Asp Gly Ala Thr 50 55 60 Met Gln Ile Ser Phe Leu Lys Asp Leu Val Thr Leu Arg Asp Pro Arg 65 70 75 80 Ser Pro Tyr Ser Phe Leu Ser Tyr Leu His His Ala Gly Arg Leu Ser 85 90 95 Asp Phe Ile Asn His Lys Leu Leu Phe Pro Ser Arg Ile Glu Phe His 100 105 110 Asp Tyr Leu Glu Trp Val Ala Gly Phe Phe Glu Glu Gln Val Val Tyr 115 120 125 Gly Ser Glu Val Val Asp Val Arg Pro Val Ala Arg Glu Asp Ala Val 130 135 140 Glu His Met Asp Val Val Val Arg Gln Arg Thr Ala Ala Gly Glu Arg 145 150 155 160 Thr Val Val Gln Arg Thr Arg Asp Leu Val Val Ala Thr Gly Leu Glu 165 170 175 Pro Ser Leu Pro Pro Gly Thr Val Cys Ser Asp Arg Val Trp His Ser 180 185 190 Ser Glu Leu Leu Tyr Arg Val Glu Arg Leu Pro Pro Thr Pro Arg Arg 195 200 205 Ile Val Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ala Ala Glu Phe 210 215 220 Leu His Ser Arg Phe Pro Ser Thr Asp Ile Cys Ala Val Phe Ser Arg 225 230 235 240 Tyr Gly Tyr Ser Pro Ser Asp Asp Ser Pro Phe Ala Asn Arg Ile Phe 245 250 255 Asp Pro Ala Ala Val Asp Asp Tyr Cys Ala Ala Ala Pro Glu Thr Arg 260 265 270 Arg Met Leu Leu Asp Tyr His Arg Asn Thr Asn Tyr Ser Val Val Asp 275 280 285 Pro Glu Leu Ile Asp Glu Leu Tyr Arg Arg Val Tyr Gln Glu Lys Val 290 295 300 Arg Gly Arg Pro Arg Leu Asn Ile Leu Gly Ala Ser Arg Leu Thr Ala 305 310 315 320 Ala Glu Pro Ala Gly Asp Gly Val Asp Val Val Val Glu Ser Leu Val 325 330 335 Thr Gly Glu Arg Thr Pro Met Arg Ala Asp Cys Val Val Tyr Ala Thr 340 345 350 Gly Tyr Arg Pro Thr Asp Ala Arg Gly Leu Leu Gly Ser Met Ala Gly 355 360 365 Leu Cys Lys Ala Asp Glu Leu Gly Arg Leu Glu Ala Asp Arg Arg Tyr 370 375 380 Arg Val Ile Thr Glu Gly Asp Val Arg Cys Ala Ile Tyr Leu Gln Gly 385 390 395 400 Ala Thr Glu His Ser His Gly Ile Ser Ser Ser Leu Leu Ser Asn Thr 405 410 415 Ala Val Arg Ala Gly Glu Ile Ala Asp Ala Ile Arg Ala Asp Ala Val 420 425 430 Arg Ala Gly Ala Arg Ala Thr Thr Arg Ser Gln Pro Gln Pro Gln Thr 435 440 445 56452 PRTPseudonocardia sp. EC080625-04 56Met Cys Thr Cys Lys Ser Asp Val Tyr Asp Val Val Gly Ile Gly Phe 1 5 10 15 Gly Pro Ser Asn Leu Ser Leu Ala Ile Ala Leu Gly Glu His Gln Gly 20 25 30 Asn Arg Ala Gly His Pro Val Lys Ala Ala Phe Phe Glu Arg Gln Gln 35 40 45 Ser Phe Gly Trp His Arg Asn Met Leu Leu Pro Glu Thr Thr Met Gln 50 55 60 Ile Ser Phe Met Lys Asp Leu Val Thr Phe Arg Asn Pro Arg Ser Arg 65 70 75 80 Phe Ser Phe Val Asn Tyr Leu His Glu Ser Gly Arg Leu Thr Gln Phe 85 90 95 Cys Asn Asn Gln Asp Phe Phe Pro Thr Arg Gln Glu Phe His Arg Tyr 100 105 110 Leu Glu Trp Val Gly Ser Ser Phe Asp Asp Gln Val Ser Tyr Asp Ser 115 120 125 Glu Val Leu Gly Val Thr Leu Ala Pro Glu Pro Cys Glu Cys Ala Gln 130 135 140 Arg Tyr Leu Lys Leu Glu Ile Ser Asn Gly Ala Ile Gly Ala Thr Glu 145 150 155 160 Ile Val Asn Ala Arg Asn Ile Ser Ile Ser Thr Gly Leu Val Pro Lys 165 170 175 Val Pro Asp Asn Val Ala Thr Gly Asp Arg Ile Trp His Ser Ser Gln 180 185 190 Phe Leu Glu Lys Leu Arg Asp Val Asp Pro Ala Asp Leu Arg Asn Val 195 200 205 Ala Val Val Gly Gly Gly Gln Ser Ala Ala Glu Ile Ala Arg Tyr Leu 210 215 220 His Ala Thr Leu Pro Glu Ala Gln Ile Tyr Ala Ile Val Pro Ser Tyr 225 230 235 240 Gly Tyr Ser Val Ala Asp Asp Thr Pro Phe Ala Asn Gln Val Phe Asp 245 250 255 Pro Glu Ala Val Asp Asp Tyr Tyr Phe Gly Ser Asp Glu Thr Arg Asp 260 265 270 Ala Phe Trp Arg Tyr His Arg Asn Thr Asn Tyr Ser Val Val Asp Asp 275 280 285 Asp Ile Ile Arg Asp Leu His Arg Ala Ser Tyr Ala Glu Gln Val Thr 290 295 300 Gly Glu Arg Arg Leu His Phe Leu Asn Leu Thr Arg Val Arg Ala Val 305 310 315 320 Thr Arg Asn Gly Ala Thr Asn Arg Val Ser Leu His Ser Leu Ile Asp 325 330 335 Arg Glu Thr Arg Glu Leu Asp Ile Asp Ala Leu Val Leu Ala Thr Gly 340 345 350 Tyr Thr Glu Met Thr Pro Thr Gly Leu Ile Gly Asp Val Asp His Phe 355 360 365 Cys His Arg Asp Pro Glu Gly Arg Tyr Arg Ile Glu Arg Asp Tyr Arg 370 375 380 Leu Met Thr Asp Pro Glu Phe Pro Cys Gly Ile Tyr Leu Gln Gly Gly 385 390 395 400 Thr Glu His Thr His Gly Leu Thr Ser Ser Leu Leu Ser Asn Val Ala 405 410 415 Val Arg Gly Gly Glu Ile Ala Asp Ser Val Ile Thr Arg Thr Arg Ala 420 425 430 Asp Ala Pro Thr Met Gln Arg Ser Thr Arg Arg Ile Glu Gln Ala Trp 435 440 445 Glu Arg Ala Gly 450 57452PRTPseudonocardia sp. HH130629-09 57Met Cys Thr Cys Lys Ser Asp Val Tyr Asp Val Val Gly Ile Gly Phe 1 5 10 15 Gly Pro Ser Asn Leu Ser Leu Ala Ile Ala Leu Gly Glu His Gln Gly 20 25 30 Asn Arg Ala Gly His Pro Val Lys Ala Ala Phe Phe Glu Arg Gln Gln 35 40 45 Ser Phe Gly Trp His Arg Asn Met Leu Leu Pro Glu Thr Thr Met Gln 50 55 60 Ile Ser Phe Met Lys Asp Leu Val Thr Phe Arg Asn Pro Arg Ser Arg 65 70 75 80 Phe Ser Phe Val Asn Tyr Leu His Glu Ser Gly Arg Leu Thr Gln Phe 85 90 95 Cys Asn Asn Gln Asp Phe Phe Pro Thr Arg Gln Glu Phe His Arg Tyr 100 105 110 Leu Glu Trp Val Gly Ser Ser Phe Asp Asp Gln Val Ser Tyr Asp Ser 115 120 125 Glu Val Leu Gly Val Thr Leu Ala Pro Glu Pro Cys Glu Cys Ala Gln 130 135 140 Leu Tyr Leu Lys Leu Glu Ile Ser Asn Gly Ala Ile Gly Ala Thr Glu 145 150 155 160 Ile Val Asn Ala Arg Asn Ile Ser Ile Ser Thr Gly Leu Val Pro Lys 165 170 175 Val Pro Asp Asn Val Pro Thr Gly Asp Arg Ile Trp His Ser Ser Gln 180 185 190 Phe Leu Glu Lys Leu Arg Asp Val Asp Pro Ala Asp Leu Arg Asn Val 195 200 205 Ala Val Val Gly Gly Gly Gln Ser Ala Ala Glu Ile Ala Arg Tyr Leu 210 215 220 His Ala Thr Leu Pro Glu Ala Gln Ile Tyr Ala Ile Val Pro Ser Tyr 225 230 235 240 Gly Tyr Ser Val Ala Asp Asp Thr Pro Phe Ala Asn Gln Val Phe Asp 245 250 255 Pro Glu Ala Val Asp Asp Tyr Tyr Phe Gly Ser Asp Glu Thr Arg Asp 260 265 270 Ala Phe Trp Arg Tyr His Arg Asn Thr Asn Tyr Ser Val Val Asp Asp 275 280 285 Asp Ile Ile Arg Asp Leu His Arg Ala Ser Tyr Ala Glu Gln Val Thr 290 295 300 Gly Glu Arg Arg Leu His Phe Leu Asn Leu Thr Arg Val Arg Ala Val 305 310 315 320 Thr Arg Asn Gly Ala Thr Asn Arg Val Ser Leu His Ser Leu Ile Asp 325 330 335 Arg Glu Thr Arg Glu Leu Asp Ile Asp Ala Leu Val Leu Ala Thr Gly 340 345 350 Tyr Thr Glu Met Thr Pro Thr Gly Leu Ile Gly Asp Val Asp His Phe 355 360 365 Cys His Arg Asp Pro Glu Gly Arg Tyr Arg Ile Glu Arg Asp Tyr Arg 370 375 380 Leu Met Thr Asp Pro Glu Phe Pro Cys Gly Ile Tyr Leu Gln Gly Gly 385 390 395 400 Thr Glu His Thr His Gly Leu Thr Ser Ser Leu Leu Ser Asn Val Ala 405 410 415 Val Arg Gly Gly Glu Ile Ala Asp Ser Val Ile Thr Arg Thr Arg Ala 420 425 430 Asp Ala Pro Thr Met Gln Arg Ser Thr Arg Arg Ile Glu Gln Ala Trp 435 440 445 Glu Arg Ala Gly 450 58450PRTStreptomyces parvulus 58Met Gly Ile Thr Gly Arg Arg Asn Glu Glu Ile Leu Asp Val Val Gly 1 5 10 15 Ile Gly Phe Gly Pro Ser Asn Leu Ser Leu Ala Ile Ala Leu Glu Glu 20 25 30 His Gly Ala Ser Ala Pro Arg His Pro Val Thr Ser His Phe Phe Glu 35 40 45 Arg Gln Pro Thr Phe Gly Trp His Arg Asn Met Leu Leu Pro Ser Thr 50 55 60 Thr Met Gln Ile Ser Phe Leu Lys Asp Leu Ala Thr Phe Arg Asn Pro 65 70 75 80 Met Ser Arg Phe Ser Phe Ile Ser Tyr Leu His Ala Ser Asp Arg Leu 85 90 95 Val Gln Phe Val Asn Asn Gln Asp Phe Phe Pro Thr Arg Gln Glu Phe 100 105 110 His Gln Tyr Leu Glu Trp Ala Ala Ser Gly Leu Ser Asp Arg Val Thr 115 120 125 Tyr Gly Ala Glu Val Thr Ala Ile Arg Pro Gly Ser Asp Gly Asn Gly 130 135 140 Leu Ser Pro Asp Leu Leu Glu Val Glu Ala Arg Thr Ala Asp Gly Thr 145 150 155 160 Thr Arg Val Val Thr Ala Arg Asn Val Ala Ile Ser Thr Gly Leu Val 165 170 175 Pro Arg Leu Pro Glu Gly Val Thr Ala Asp Glu Arg Val Trp His Ser 180 185 190 Ser Gln Phe Leu Ser Arg Phe Asn Ala Gln Ser Pro Asp Asp Leu Lys 195 200 205 Ser Val Ala Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ile Thr Arg 210 215 220 Phe Leu His Asp Ala Leu Pro His Ala Gln Val Cys Ala Val Val Pro 225 230 235 240 Ser Tyr Gly Tyr Ser Val Ala Asp Asp Thr Pro Phe Ala Asn Gln Val 245 250 255 Phe Asp Pro Ala Ala Val Asp Asp Tyr Tyr Phe Gly Thr Asp Arg Gly 260 265 270 Arg Asp Ala Phe Trp Arg Tyr His Arg Asn Thr Asn Tyr Ser Val Val 275 280 285 Asp Ala Asp Val Ile Arg Asp Leu His Gln Arg Thr Tyr Asp Glu Glu 290 295 300 Val Arg Gly Thr Arg Arg Leu His Phe Arg Asn Leu Thr Arg Val Ala 305 310 315 320 Glu Val Glu Arg Ser Gly Ser Thr Thr Arg Val Val Leu Arg Ser Leu 325 330 335 Leu Asp Asp Arg Thr Glu Asp Leu Ser Val Asp Ala Leu Val Phe Ala 340 345 350 Thr Gly Tyr Asp Gly Leu Asp Pro Val Arg Leu Leu Gly Asp Phe Asp 355 360 365 Arg His Phe Arg Arg Asp Ala Ala Gly Arg His Arg Leu Glu Arg Asp 370 375 380 Tyr Arg Leu Val Pro Ala Thr Asp Leu Thr Cys Gly Val Tyr Leu Gln 385 390 395 400 Gly Gly Thr Glu His Ser His Gly Leu Ser Ser Ser Leu Leu Ser Asn 405 410 415 Ile Ala Val Arg Ser Gly Glu Ile Ala Asp Ser Ile Val Leu Arg Arg 420 425 430 Thr Glu Arg Glu Leu Glu Arg Asp Arg Pro Val Glu Val Ala Pro Pro 435 440 445 Val Ala 450 59430PRTStreptomyces sp. CFMR 7 59Met Ala Ile Arg Ala Gly Ser His Ile Leu Asp Val Val Gly Ile Gly 1 5 10 15 Phe Gly Pro Ser Asn Leu Ala Leu Ala Ile Ala Leu Gln Glu Met Ile 20 25 30 Lys Ala Asp Thr Gly Arg Thr Glu Tyr Ala Met Ala Phe His Glu Arg 35 40 45 Gln Pro Arg Phe Gly Trp His Arg Gly Met Leu Met Glu Asp Ala Thr 50 55 60 Met Gln Val Ser Phe Leu Lys Asp Leu Ala Thr Met Arg Asn Ala Thr 65 70 75 80 Ser Arg Tyr Thr Phe Val Ala Tyr Leu Gln Glu Gln Gly Arg Val Ala 85 90 95 Glu Phe Ile Asn Ser Lys Thr Leu Tyr Pro Leu Arg Val Glu Phe His 100 105

110 Asp Tyr Leu Glu Trp Ala Ala Gln Gln Phe Asp Ala Ser Val Ser Tyr 115 120 125 Gly Ser Glu Ile Val Ala Val Arg Pro Val Ile Glu Ser Gly Ser Val 130 135 140 Glu Tyr Val Asp Val Val Ala Arg Ser Ala Ser Gly Gly Ser Ser Thr 145 150 155 160 Val Val Gln Arg Ala Arg Asn Val Val Ile Gly Met Gly Leu Thr Pro 165 170 175 Arg Leu Pro Asp Gly Ile Glu Glu Ser Glu Arg Ile Trp His Ser Ser 180 185 190 Gln Leu Leu His Arg Ala Asp Ser Leu Pro Tyr Arg Pro Arg Asn Phe 195 200 205 Val Val Val Gly Ser Gly Gln Ser Ala Ala Glu Val Ala Asp Tyr Leu 210 215 220 His Arg Thr Phe Ser Asp Ala Asn Val His Thr Val Leu Ser Arg Tyr 225 230 235 240 Gly Tyr Ser Val Ala Asp Asp Ser Pro Phe Ala Asn Gly Val Phe Asp 245 250 255 Pro Glu Ala Val Asp Arg Phe Tyr Thr Ser Ser Ala Asp Ala Lys Gln 260 265 270 Arg Leu Leu Asp Tyr His Gly Asn Thr Asn Tyr Ser Val Val Asp Leu 275 280 285 Glu Val Ser Gln Asp Leu Tyr Arg Arg Ser Tyr Gln Glu Lys Val Leu 290 295 300 Gly Lys Gln Arg Leu Arg Met Leu Asn Ser Ser Arg Val Thr Ser Ala 305 310 315 320 Glu Glu His Ala Asp Gly Val Arg Val Thr Val Glu Ala Met Asp Ser 325 330 335 Gly Ser Val Arg Thr Met Asp Ala Asp Val Ile Val Tyr Ala Thr Gly 340 345 350 Tyr Arg Pro Ser Asp Ala Ala Pro Leu Leu Ser Glu Leu Ala Gly Glu 355 360 365 Cys Lys Arg Asp Glu Glu Gly Arg Leu Ala Val Glu Arg Asp Tyr Arg 370 375 380 Val Ile Thr Ser Glu Ala Val Arg Cys Gly Ile Tyr Val His Gly Ala 385 390 395 400 Val Thr Glu His Ser His Gly Leu Ser Ala Gly Leu Leu Ser Asn Thr 405 410 415 Ala Val Arg Ser Gly Glu Ile Ala Arg Ser Ile Leu Arg Arg 420 425 430 60430PRTStreptomyces sp. DvalAA-19 60Met Ala Ile Arg Ala Gly Ser His Ile Ser Asp Val Val Gly Ile Gly 1 5 10 15 Phe Gly Pro Ser Asn Leu Ala Leu Ala Ile Ala Leu Gln Glu Met Ile 20 25 30 Lys Ala Asp Thr Gly Arg Thr Glu Tyr Ala Met Ala Phe His Glu Arg 35 40 45 Gln Pro Arg Phe Gly Trp His Arg Gly Met Leu Met Glu Asp Ala Thr 50 55 60 Met Gln Val Ser Phe Leu Lys Asp Leu Ala Thr Met Arg Asn Ala Thr 65 70 75 80 Ser Arg Tyr Thr Phe Val Ala Tyr Leu Gln Glu Lys Gly Arg Val Ala 85 90 95 Glu Phe Ile Asn Ser Lys Thr Leu Tyr Pro Leu Arg Val Glu Phe His 100 105 110 Asp Tyr Leu Glu Trp Ala Ala Gln Gln Phe Asp Ala Ser Val Ser Tyr 115 120 125 Gly Ser Glu Ile Val Ala Val Arg Pro Val Ile Glu Ser Gly Ser Val 130 135 140 Glu Tyr Val Asp Val Val Ala Arg Ser Ala Ser Gly Gly Ser Ser Thr 145 150 155 160 Val Val Gln Arg Ala Arg Asn Val Val Ile Gly Met Gly Leu Thr Pro 165 170 175 Arg Leu Pro Asp Gly Ile Glu Glu Ser Glu Arg Ile Trp His Ser Ser 180 185 190 Gln Leu Leu His Arg Ala Asp Ser Leu Pro Tyr Arg Pro Arg Asn Phe 195 200 205 Val Val Val Gly Ser Gly Gln Ser Ala Ala Glu Val Ala Asp Tyr Leu 210 215 220 His Arg Thr Phe Ser Asp Ala Asn Val His Thr Val Leu Ser Arg Tyr 225 230 235 240 Gly Tyr Ser Val Ala Asp Asp Ser Pro Phe Ala Asn Gly Val Phe Asp 245 250 255 Pro Glu Ala Val Asp Arg Phe Tyr Thr Ser Ser Ala Asp Ala Lys Gln 260 265 270 Arg Leu Leu Asp Tyr His Gly Asn Thr Asn Tyr Ser Val Val Asp Leu 275 280 285 Glu Val Ser Gln Asp Leu Tyr Arg Arg Ser Tyr Gln Glu Lys Val Leu 290 295 300 Gly Lys Gln Arg Leu Arg Met Leu Asn Ser Ser Arg Val Thr Ser Ala 305 310 315 320 Glu Glu His Ala Asp Gly Val Arg Val Thr Val Glu Ala Met Asp Ser 325 330 335 Gly Ser Val Arg Thr Met Asp Ala Asp Val Ile Val Tyr Ala Thr Gly 340 345 350 Tyr Arg Pro Ser Asp Ala Ala Pro Leu Leu Ser Glu Leu Ala Gly Glu 355 360 365 Cys Lys Arg Asp Glu Glu Gly Arg Leu Ala Val Glu Arg Asp Tyr Arg 370 375 380 Val Ile Thr Ser Glu Ala Val Arg Cys Gly Ile Tyr Val His Gly Ala 385 390 395 400 Val Thr Glu His Ser His Gly Leu Ser Ala Gly Leu Leu Ser Asn Thr 405 410 415 Ala Val Arg Ser Gly Glu Ile Ala Arg Ser Ile Leu Arg Arg 420 425 430 61424PRTRhodococcus fascians 61Met Gly Ala Gln Ser Gly Ser Ser Val Ala Asp Val Val Gly Val Gly 1 5 10 15 Phe Gly Pro Ser Asn Leu Ala Leu Ala Ile Ala Leu Gln Glu Ser Ile 20 25 30 Gln Pro Gly Pro Val Pro Ala Lys Phe Ser Met Lys Phe Tyr Glu Leu 35 40 45 Gln Pro Arg Phe Gly Trp His Arg Gly Met Leu Met Glu Asp Ala Thr 50 55 60 Met Gln Val Ser Phe Leu Lys Asp Leu Ala Thr Met Arg Asn Pro Met 65 70 75 80 Ser Arg Tyr Thr Phe Val Ser Tyr Leu Arg Glu Lys Glu Arg Ile Ala 85 90 95 Glu Phe Ile Asn Ser Lys Thr Leu Tyr Pro Leu Arg Val Glu Phe His 100 105 110 Asp Tyr Leu Glu Trp Ala Ala Ser Gln Phe Gln Ser Asn Val Ser Tyr 115 120 125 Gly Ser Glu Ile Lys Asp Ile Arg Pro Val Val Glu Asn Gly Val Val 130 135 140 Glu Tyr Val Asp Val Val Gly Pro Asp Asp Val Val Gln Arg Ala Arg 145 150 155 160 Asn Ile Val Ile Gly Met Gly Leu Thr Pro Arg Leu Pro Asp Gly Val 165 170 175 Asn Arg Ser Glu Arg Ile Trp His Ser Ser Gln Leu Leu Gly Arg Ala 180 185 190 Ala Ala Val Thr Tyr Val Pro Gln Asn Phe Val Val Val Gly Ser Gly 195 200 205 Gln Ser Ala Ala Glu Val Ala Asp Tyr Leu His Arg Thr Phe Pro Arg 210 215 220 Ala Asn Val His Thr Val Leu Ser Arg Tyr Gly Tyr Ser Val Ala Asp 225 230 235 240 Asp Ser Pro Tyr Ala Asn Gly Ile Phe Asp Pro Glu Gly Val Asp Arg 245 250 255 Phe Phe Ser Ala Pro Thr Asp Glu Lys Gln Arg Leu Leu Glu Tyr His 260 265 270 Ala Asn Thr Asn Tyr Ser Val Val Asp Leu Asp Ile Ser Gln Ser Leu 275 280 285 Tyr Leu Lys Ser Tyr Gln Glu Lys Val Leu Gly Lys Gln Arg Leu Arg 290 295 300 Met Ile Asn Thr Ser Arg Val Thr Ser Val Asp Glu Asp Thr Asp Gly 305 310 315 320 Val Arg Val Glu Val Thr Ser Ser Ala Thr Gly Leu Thr His Thr Ile 325 330 335 Glu Ala Asp Val Ile Val Tyr Ala Thr Gly Tyr Arg Pro Ser Asp Pro 340 345 350 Ala Pro Leu Leu Gln Gly Leu Met Arg Glu Cys Lys His Asp Glu Gln 355 360 365 Gly Arg Leu Ser Val Gly Arg Asp Tyr Arg Val Thr Thr Ser Asp Ala 370 375 380 Val Arg Ala Gly Ile Tyr Val His Gly Ala Ser Thr Glu His Ser His 385 390 395 400 Gly Leu Ser Ala Gly Leu Leu Ser Asn Thr Ala Val Arg Ser Gly Glu 405 410 415 Ile Ala Gln Ser Ile Leu Arg Arg 420 62424PRTRhodococcus fascians 62Met Gly Ala Gln Ser Gly Ser Ser Val Ala Asp Val Val Gly Val Gly 1 5 10 15 Phe Gly Pro Ser Asn Leu Ala Leu Ala Ile Ala Leu Gln Glu Ser Ile 20 25 30 Gln Pro Gly Pro Val Pro Ala Lys Phe Ser Met Lys Phe Tyr Glu Leu 35 40 45 Gln Pro Arg Phe Gly Trp His Arg Gly Met Leu Met Glu Asp Ala Thr 50 55 60 Met Gln Val Ser Phe Leu Lys Asp Leu Ala Thr Met Arg Asn Pro Met 65 70 75 80 Ser Arg Tyr Thr Phe Val Ser Tyr Leu Arg Glu Lys Glu Arg Ile Ala 85 90 95 Glu Phe Ile Asn Ser Lys Thr Leu Tyr Pro Leu Arg Val Glu Phe His 100 105 110 Asp Tyr Leu Glu Trp Ala Ala Ser Gln Phe Gln Ser Asn Val Ser Tyr 115 120 125 Gly Ser Glu Ile Lys Asp Ile Arg Pro Val Val Glu Asn Gly Val Val 130 135 140 Glu Tyr Val Asp Val Val Gly Pro Asp Asp Val Val Gln Arg Ala Arg 145 150 155 160 Asn Ile Val Ile Gly Met Gly Leu Thr Pro Arg Leu Pro Asp Gly Val 165 170 175 Asn Arg Ser Glu Arg Ile Trp His Ser Ser Gln Leu Leu Gly Arg Ala 180 185 190 Ala Ala Val Thr Tyr Val Pro Gln Asn Phe Val Val Val Gly Ser Gly 195 200 205 Gln Ser Ala Ala Glu Val Ala Asp Tyr Leu His Arg Thr Phe Pro Arg 210 215 220 Ala Asn Val His Thr Val Leu Ser Arg Tyr Gly Tyr Ser Val Ala Asp 225 230 235 240 Asp Ser Pro Tyr Ala Asn Gly Ile Phe Asp Pro Glu Gly Val Asp Arg 245 250 255 Phe Phe Ser Ala Pro Thr Asp Glu Lys Gln Arg Leu Leu Glu Tyr His 260 265 270 Ala Asn Thr Asn Tyr Ser Val Val Asp Leu Asp Ile Ser Gln Ser Leu 275 280 285 Tyr Leu Lys Ser Tyr Gln Glu Lys Val Leu Gly Lys Gln Arg Leu Arg 290 295 300 Met Ile Asn Thr Ser Arg Val Thr Ser Val Asp Glu Asp Thr Asp Gly 305 310 315 320 Val Arg Val Glu Val Thr Ser Ser Ala Thr Gly Leu Thr His Thr Ile 325 330 335 Glu Ala Asp Val Ile Val Tyr Ala Thr Gly Tyr Arg Pro Ser Asp Pro 340 345 350 Ala Pro Leu Leu Gln Gly Leu Met Arg Glu Cys Lys His Asp Glu Gln 355 360 365 Gly Arg Leu Ser Val Gly Arg Asp Tyr Arg Val Thr Thr Ser Asp Ala 370 375 380 Val Arg Ala Gly Ile Tyr Val His Gly Ala Ser Thr Glu His Ser His 385 390 395 400 Gly Leu Ser Ala Gly Leu Leu Ser Asn Thr Ala Val Arg Ser Gly Glu 405 410 415 Ile Ala Gln Ser Ile Leu Arg Arg 420 63424PRTRhodococcus fascians 63Met Gly Ala Gln Ser Gly Ser Ser Val Ala Asp Val Val Gly Val Gly 1 5 10 15 Phe Gly Pro Ser Asn Leu Ala Leu Ala Ile Ala Leu Gln Glu Ser Ile 20 25 30 Gln Pro Gly Pro Val Pro Ala Lys Phe Ser Met Lys Phe Tyr Glu Leu 35 40 45 Gln Pro Arg Phe Gly Trp His Arg Gly Met Leu Met Glu Asp Ala Thr 50 55 60 Met Gln Val Ser Phe Leu Lys Asp Leu Ala Thr Met Arg Asn Pro Met 65 70 75 80 Ser Arg Tyr Thr Phe Val Ser Tyr Leu Arg Glu Lys Glu Arg Ile Ala 85 90 95 Glu Phe Ile Asn Ser Lys Thr Leu Tyr Pro Leu Arg Val Glu Phe His 100 105 110 Asp Tyr Leu Glu Trp Ala Ala Ser Gln Phe Gln Ser Asn Val Ser Tyr 115 120 125 Gly Ser Glu Ile Lys Asp Ile Arg Pro Val Val Glu Asn Gly Val Val 130 135 140 Glu Tyr Val Asp Val Val Gly Pro Asp Asp Val Val Gln Arg Ala Arg 145 150 155 160 Asn Ile Val Ile Gly Met Gly Leu Thr Pro Arg Leu Pro Asp Gly Val 165 170 175 Asn Arg Ser Glu Arg Ile Trp His Ser Ser Gln Leu Leu Gly Arg Ala 180 185 190 Ala Ala Val Thr Tyr Val Pro Gln Asn Phe Val Val Val Gly Ser Gly 195 200 205 Gln Ser Ala Ala Glu Val Ala Asp Tyr Leu His Arg Thr Phe Pro Arg 210 215 220 Ala Asn Val His Thr Val Leu Ser Arg Tyr Gly Tyr Ser Val Ala Asp 225 230 235 240 Asp Ser Pro Tyr Ala Asn Gly Ile Phe Asp Pro Glu Gly Val Asp Arg 245 250 255 Phe Phe Ser Ala Pro Thr Asp Glu Lys Gln Arg Leu Leu Glu Tyr His 260 265 270 Ala Asn Thr Asn Tyr Ser Val Val Asp Leu Asp Ile Ser Gln Ser Leu 275 280 285 Tyr Leu Lys Ser Tyr Gln Glu Lys Val Leu Gly Lys Gln Arg Leu Arg 290 295 300 Met Ile Asn Thr Ser Arg Val Thr Ser Val Asp Glu Asp Thr Asp Gly 305 310 315 320 Val Arg Val Glu Val Thr Ser Ser Ala Thr Gly Leu Thr His Thr Ile 325 330 335 Glu Ala Asp Val Ile Val Tyr Ala Thr Gly Tyr Arg Pro Ser Asp Pro 340 345 350 Ala Pro Leu Leu Gln Gly Leu Met Arg Glu Cys Lys His Asp Glu Gln 355 360 365 Gly Arg Leu Ser Val Gly Arg Asp Tyr Arg Val Thr Thr Ser Asp Ala 370 375 380 Val Arg Ala Gly Ile Tyr Val His Gly Ala Ser Thr Glu His Ser His 385 390 395 400 Gly Leu Ser Ala Gly Leu Leu Ser Asn Thr Ala Val Arg Ser Gly Glu 405 410 415 Ile Ala Gln Ser Ile Leu Arg Arg 420 64424PRTRhodococcus fascians 64Met Gly Ala Gln Ser Gly Ser Ser Val Ala Asp Val Val Gly Val Gly 1 5 10 15 Phe Gly Pro Ser Asn Leu Ala Leu Ala Ile Ala Leu Gln Glu Ser Ile 20 25 30 Gln Pro Gly Pro Val Pro Ala Lys Phe Ser Met Lys Phe Tyr Glu Leu 35 40 45 Gln Pro Arg Phe Gly Trp His Arg Gly Met Leu Met Glu Asp Ala Thr 50 55 60 Met Gln Val Ser Phe Leu Lys Asp Leu Ala Thr Met Arg Asn Pro Met 65 70 75 80 Ser Arg Tyr Thr Phe Val Ser Tyr Leu Arg Glu Lys Glu Arg Ile Ala 85 90 95 Glu Phe Ile Asn Ser Lys Thr Leu Tyr Pro Leu Arg Val Glu Phe His 100 105 110 Asp Tyr Leu Glu Trp Ala Ala Ser Gln Phe Gln Ser Asn Val Ser Tyr 115 120 125 Gly Ser Glu Ile Lys Asp Ile Arg Pro Val Val Glu Asn Gly Val Val 130 135 140 Glu Tyr Val Asp Val Val Gly Pro Asp Asp Val Val Gln Arg Ala Arg 145 150 155 160 Asn Ile Val Ile Gly Met Gly Leu Thr Pro Arg Leu Pro Asp Gly Val 165 170 175 Asn Arg Ser Glu Arg Ile Trp His Ser Ser Gln Leu Leu Gly Arg Ala 180 185 190 Ala Ala Val Thr Tyr Val Pro Gln Asn Phe Val Val Val Gly Ser Gly 195 200 205 Gln Ser Ala Ala Glu Val Ala Asp Tyr Leu His Arg Thr Phe Pro Arg 210 215 220 Ala Asn Val His Thr Val Leu Ser Arg Tyr Gly Tyr Ser Val Ala Asp 225 230 235 240 Asp Ser Pro Tyr Ala Asn Gly Ile Phe Asp

Pro Glu Gly Val Asp Arg 245 250 255 Phe Phe Ser Ala Pro Thr Asp Glu Lys Gln Arg Leu Leu Glu Tyr His 260 265 270 Ala Asn Thr Asn Tyr Ser Val Val Asp Leu Asp Ile Ser Gln Ser Leu 275 280 285 Tyr Leu Lys Ser Tyr Gln Glu Lys Val Leu Gly Lys Gln Arg Leu Arg 290 295 300 Met Ile Asn Thr Ser Arg Val Thr Ser Val Asp Glu Asp Thr Asp Gly 305 310 315 320 Val Arg Val Glu Val Thr Ser Ser Ala Thr Gly Leu Thr His Thr Ile 325 330 335 Glu Ala Asp Val Ile Val Tyr Ala Thr Gly Tyr Arg Pro Ser Asp Pro 340 345 350 Ala Pro Leu Leu Gln Gly Leu Met Arg Glu Cys Lys His Asp Glu Gln 355 360 365 Gly Arg Leu Ser Val Gly Arg Asp Tyr Arg Val Thr Thr Ser Asp Ala 370 375 380 Val Arg Ala Gly Ile Tyr Val His Gly Ala Ser Thr Glu His Ser His 385 390 395 400 Gly Leu Ser Ala Gly Leu Leu Ser Asn Thr Ala Val Arg Ser Gly Glu 405 410 415 Ile Ala Gln Ser Ile Leu Arg Arg 420 65424PRTRhodococcus fascians 65Met Gly Ala Gln Ser Gly Ser Ser Val Ala Asp Val Val Gly Val Gly 1 5 10 15 Phe Gly Pro Ser Asn Leu Ala Leu Ala Ile Ala Leu Gln Glu Ser Ile 20 25 30 Gln Pro Gly Pro Val Pro Ala Lys Phe Ser Met Lys Phe Tyr Glu Leu 35 40 45 Gln Pro Arg Phe Gly Trp His Arg Gly Met Leu Met Glu Asp Ala Thr 50 55 60 Met Gln Val Ser Phe Leu Lys Asp Leu Ala Thr Met Arg Asn Pro Met 65 70 75 80 Ser Arg Tyr Thr Phe Val Ser Tyr Leu Arg Glu Lys Glu Arg Ile Ala 85 90 95 Glu Phe Ile Asn Ser Lys Thr Leu Tyr Pro Leu Arg Val Glu Phe His 100 105 110 Asp Tyr Leu Glu Trp Ala Ala Ser Gln Phe Gln Ser Asn Val Ser Tyr 115 120 125 Gly Ser Glu Ile Lys Asp Ile Arg Pro Val Val Glu Asn Gly Val Val 130 135 140 Glu Tyr Val Asp Val Val Gly Pro Asp Asp Val Val Gln Arg Ala Arg 145 150 155 160 Asn Ile Val Ile Gly Met Gly Leu Thr Pro Arg Leu Pro Asp Gly Val 165 170 175 Asn Arg Ser Glu Arg Ile Trp His Ser Ser Gln Leu Leu Gly Arg Ala 180 185 190 Ala Ala Val Thr Tyr Val Pro Gln Asn Phe Val Val Val Gly Ser Gly 195 200 205 Gln Ser Ala Ala Glu Val Ala Asp Tyr Leu His Arg Thr Phe Pro Arg 210 215 220 Ala Asn Val His Thr Val Leu Ser Arg Tyr Gly Tyr Ser Val Ala Asp 225 230 235 240 Asp Ser Pro Tyr Ala Asn Gly Ile Phe Asp Pro Glu Gly Val Asp Arg 245 250 255 Phe Phe Ser Ala Pro Thr Asp Glu Lys Gln Arg Leu Leu Glu Tyr His 260 265 270 Ala Asn Thr Asn Tyr Ser Val Val Asp Leu Asp Ile Ser Gln Ser Leu 275 280 285 Tyr Leu Lys Ser Tyr Gln Glu Lys Val Leu Gly Lys Gln Arg Leu Arg 290 295 300 Met Ile Asn Thr Ser Arg Val Thr Ser Val Asp Glu Asp Thr Asp Gly 305 310 315 320 Val Arg Val Glu Val Thr Ser Ser Ala Thr Gly Leu Thr His Thr Ile 325 330 335 Glu Ala Asp Val Ile Val Tyr Ala Thr Gly Tyr Arg Pro Ser Asp Pro 340 345 350 Ala Pro Leu Leu Gln Gly Leu Met Arg Glu Cys Lys His Asp Glu Gln 355 360 365 Gly Arg Leu Ser Val Gly Arg Asp Tyr Arg Val Thr Thr Ser Asp Ala 370 375 380 Val Arg Ala Gly Ile Tyr Val His Gly Ala Ser Thr Glu His Ser His 385 390 395 400 Gly Leu Ser Ala Gly Leu Leu Ser Asn Thr Ala Val Arg Ser Gly Glu 405 410 415 Ile Ala Gln Ser Ile Leu Arg Arg 420 66424PRTRhodococcus fascians 66Met Gly Ala Gln Ser Gly Ser Ser Val Ala Asp Val Val Gly Val Gly 1 5 10 15 Phe Gly Pro Ser Asn Leu Ala Leu Ala Ile Ala Leu Gln Glu Ser Ile 20 25 30 Gln Pro Gly Pro Val Pro Ala Lys Phe Ser Met Lys Phe Tyr Glu Leu 35 40 45 Gln Pro Arg Phe Gly Trp His Arg Gly Met Leu Met Glu Asp Ala Thr 50 55 60 Met Gln Val Ser Phe Leu Lys Asp Leu Ala Thr Met Arg Asn Pro Met 65 70 75 80 Ser Arg Tyr Thr Phe Val Ser Tyr Leu Arg Glu Lys Glu Arg Ile Ala 85 90 95 Glu Phe Ile Asn Ser Lys Thr Leu Tyr Pro Leu Arg Val Glu Phe His 100 105 110 Asp Tyr Leu Glu Trp Ala Ala Ser Gln Phe Gln Ser Asn Val Ser Tyr 115 120 125 Gly Ser Glu Ile Lys Asp Ile Arg Pro Val Val Glu Asn Gly Val Val 130 135 140 Glu Tyr Val Asp Val Val Gly Pro Asp Asp Val Val Gln Arg Ala Arg 145 150 155 160 Asn Ile Val Ile Gly Met Gly Leu Thr Pro Arg Leu Pro Asp Gly Val 165 170 175 Asn Arg Ser Glu Arg Ile Trp His Ser Ser Gln Leu Leu Gly Arg Ala 180 185 190 Ala Ala Val Thr Tyr Val Pro Gln Asn Phe Val Val Val Gly Ser Gly 195 200 205 Gln Ser Ala Ala Glu Val Ala Asp Tyr Leu His Arg Thr Phe Pro Arg 210 215 220 Ala Asn Val His Thr Val Leu Ser Arg Tyr Gly Tyr Ser Val Ala Asp 225 230 235 240 Asp Ser Pro Tyr Ala Asn Gly Ile Phe Asp Pro Glu Gly Val Asp Arg 245 250 255 Phe Phe Ser Ala Pro Thr Asp Glu Lys Gln Arg Leu Leu Glu Tyr His 260 265 270 Ala Asn Thr Asn Tyr Ser Val Val Asp Leu Asp Ile Ser Gln Ser Leu 275 280 285 Tyr Leu Lys Ser Tyr Gln Glu Lys Val Leu Gly Lys Gln Arg Leu Arg 290 295 300 Met Ile Asn Thr Ser Arg Val Thr Ser Val Asp Glu Asp Thr Asp Gly 305 310 315 320 Val Arg Val Glu Val Thr Ser Ser Ala Thr Gly Leu Thr His Thr Ile 325 330 335 Glu Ala Asp Val Ile Val Tyr Ala Thr Gly Tyr Arg Pro Ser Asp Pro 340 345 350 Ala Pro Leu Leu Gln Gly Leu Met Arg Glu Cys Lys His Asp Glu Gln 355 360 365 Gly Arg Leu Ser Val Gly Arg Asp Tyr Arg Val Thr Thr Ser Asp Ala 370 375 380 Val Arg Ala Gly Ile Tyr Val His Gly Ala Ser Thr Glu His Ser His 385 390 395 400 Gly Leu Ser Ala Gly Leu Leu Ser Asn Thr Ala Val Arg Ser Gly Glu 405 410 415 Ile Ala Gln Ser Ile Leu Arg Arg 420 67424PRTRhodococcus fascians 67Met Gly Ala Gln Ser Gly Ser Ser Val Ala Asp Val Val Gly Val Gly 1 5 10 15 Phe Gly Pro Ser Asn Leu Ala Leu Ala Ile Ala Leu Gln Glu Ser Ile 20 25 30 Gln Pro Gly Pro Val Pro Ala Lys Phe Ser Met Lys Phe Tyr Glu Leu 35 40 45 Gln Pro Arg Phe Gly Trp His Arg Gly Met Leu Met Glu Asp Ala Thr 50 55 60 Met Gln Val Ser Phe Leu Lys Asp Leu Ala Thr Met Arg Asn Pro Met 65 70 75 80 Ser Arg Tyr Thr Phe Val Ser Tyr Leu Arg Glu Lys Glu Arg Ile Ala 85 90 95 Glu Phe Ile Asn Ser Lys Thr Leu Tyr Pro Leu Arg Val Glu Phe His 100 105 110 Asp Tyr Leu Glu Trp Ala Ala Ser Gln Phe Gln Ser Asn Val Ser Tyr 115 120 125 Gly Ser Glu Ile Lys Asp Ile Arg Pro Val Val Glu Asn Gly Val Val 130 135 140 Glu Tyr Val Asp Val Val Gly Pro Asp Asp Val Val Gln Arg Ala Arg 145 150 155 160 Asn Ile Val Ile Gly Met Gly Leu Thr Pro Arg Leu Pro Asp Gly Val 165 170 175 Asn Arg Ser Glu Arg Ile Trp His Ser Ser Gln Leu Leu Gly Arg Ala 180 185 190 Ala Ala Val Thr Tyr Val Pro Gln Asn Phe Val Val Val Gly Ser Gly 195 200 205 Gln Ser Ala Ala Glu Val Ala Asp Tyr Leu His Arg Thr Phe Pro Arg 210 215 220 Ala Asn Val His Thr Val Leu Ser Arg Tyr Gly Tyr Ser Val Ala Asp 225 230 235 240 Asp Ser Pro Tyr Ala Asn Gly Ile Phe Asp Pro Glu Gly Val Asp Arg 245 250 255 Phe Phe Ser Ala Pro Thr Asp Glu Lys Gln Arg Leu Leu Glu Tyr His 260 265 270 Ala Asn Thr Asn Tyr Ser Val Val Asp Leu Asp Ile Ser Gln Ser Leu 275 280 285 Tyr Leu Lys Ser Tyr Gln Glu Lys Val Leu Gly Lys Gln Arg Leu Arg 290 295 300 Met Ile Asn Thr Ser Arg Val Thr Ser Val Asp Glu Asp Thr Asp Gly 305 310 315 320 Val Arg Val Glu Val Thr Ser Ser Ala Thr Gly Leu Thr His Thr Ile 325 330 335 Glu Ala Asp Val Ile Val Tyr Ala Thr Gly Tyr Arg Pro Ser Asp Pro 340 345 350 Ala Pro Leu Leu Gln Gly Leu Met Arg Glu Cys Lys His Asp Glu Gln 355 360 365 Gly Arg Leu Ser Val Gly Arg Asp Tyr Arg Val Thr Thr Ser Asp Ala 370 375 380 Val Arg Ala Gly Ile Tyr Val His Gly Ala Ser Thr Glu His Ser His 385 390 395 400 Gly Leu Ser Ala Gly Leu Leu Ser Asn Thr Ala Val Arg Ser Gly Glu 405 410 415 Ile Ala Gln Ser Ile Leu Arg Arg 420 68424PRTRhodococcus fascians 68Met Gly Ala Gln Ser Gly Ser Ser Val Ala Asp Val Val Gly Val Gly 1 5 10 15 Phe Gly Pro Ser Asn Leu Ala Leu Ala Ile Ala Leu Gln Glu Ser Ile 20 25 30 Gln Pro Gly Pro Val Pro Ala Lys Phe Ser Met Lys Phe Tyr Glu Leu 35 40 45 Gln Pro Arg Phe Gly Trp His Arg Gly Met Leu Met Glu Asp Ala Thr 50 55 60 Met Gln Val Ser Phe Leu Lys Asp Leu Ala Thr Met Arg Asn Pro Met 65 70 75 80 Ser Arg Tyr Thr Phe Val Ser Tyr Leu Arg Glu Lys Glu Arg Ile Ala 85 90 95 Glu Phe Ile Asn Ser Lys Thr Leu Tyr Pro Leu Arg Val Glu Phe His 100 105 110 Asp Tyr Leu Glu Trp Ala Ala Ser Gln Phe Gln Ser Asn Val Ser Tyr 115 120 125 Gly Ser Glu Ile Lys Asp Ile Arg Pro Val Val Glu Asn Gly Val Val 130 135 140 Glu Tyr Val Asp Val Val Gly Pro Asp Asp Val Val Gln Arg Ala Arg 145 150 155 160 Asn Ile Val Ile Gly Met Gly Leu Thr Pro Arg Leu Pro Asp Gly Val 165 170 175 Asn Arg Ser Glu Arg Ile Trp His Ser Ser Gln Leu Leu Gly Arg Ala 180 185 190 Ala Ala Val Thr Tyr Val Pro Gln Asn Phe Val Val Val Gly Ser Gly 195 200 205 Gln Ser Ala Ala Glu Val Ala Asp Tyr Leu His Arg Thr Phe Pro Arg 210 215 220 Ala Asn Val His Thr Val Leu Ser Arg Tyr Gly Tyr Ser Val Ala Asp 225 230 235 240 Asp Ser Pro Tyr Ala Asn Gly Ile Phe Asp Pro Glu Gly Val Asp Arg 245 250 255 Phe Phe Ser Ala Pro Thr Asp Glu Lys Gln Arg Leu Leu Glu Tyr His 260 265 270 Ala Asn Thr Asn Tyr Ser Val Val Asp Leu Asp Ile Ser Gln Ser Leu 275 280 285 Tyr Leu Lys Ser Tyr Gln Glu Lys Val Leu Gly Lys Gln Arg Leu Arg 290 295 300 Met Ile Asn Thr Ser Arg Val Thr Ser Val Asp Glu Asp Thr Asp Gly 305 310 315 320 Val Arg Val Glu Val Thr Ser Ser Ala Thr Gly Leu Thr His Thr Ile 325 330 335 Glu Ala Asp Val Ile Val Tyr Ala Thr Gly Tyr Arg Pro Ser Asp Pro 340 345 350 Ala Pro Leu Leu Gln Gly Leu Met Arg Glu Cys Lys His Asp Glu Gln 355 360 365 Gly Arg Leu Ser Val Gly Arg Asp Tyr Arg Val Thr Thr Ser Asp Ala 370 375 380 Val Arg Ala Gly Ile Tyr Val His Gly Ala Ser Thr Glu His Ser His 385 390 395 400 Gly Leu Ser Ala Gly Leu Leu Ser Asn Thr Ala Val Arg Ser Gly Glu 405 410 415 Ile Ala Gln Ser Ile Leu Arg Arg 420 69424PRTRhodococcus fascians 69Met Gly Ala Gln Ser Gly Ser Ser Val Ala Asp Val Val Gly Val Gly 1 5 10 15 Phe Gly Pro Ser Asn Leu Ala Leu Ala Ile Ala Leu Gln Glu Ser Ile 20 25 30 Gln Pro Gly Pro Val Pro Ala Lys Phe Ser Met Lys Phe Tyr Glu Leu 35 40 45 Gln Pro Arg Phe Gly Trp His Arg Gly Met Leu Met Glu Asp Ala Thr 50 55 60 Met Gln Val Ser Phe Leu Lys Asp Leu Ala Thr Met Arg Asn Pro Met 65 70 75 80 Ser Arg Tyr Thr Phe Val Ser Tyr Leu Arg Glu Lys Glu Arg Ile Ala 85 90 95 Glu Phe Ile Asn Ser Lys Thr Leu Tyr Pro Leu Arg Val Glu Phe His 100 105 110 Asp Tyr Leu Glu Trp Ala Ala Ser Gln Phe Gln Ser Asn Val Ser Tyr 115 120 125 Gly Ser Glu Ile Lys Asp Ile Arg Pro Val Val Glu Asn Gly Val Val 130 135 140 Glu Tyr Val Asp Val Val Gly Pro Asp Asp Val Val Gln Arg Ala Arg 145 150 155 160 Asn Ile Val Ile Gly Met Gly Leu Thr Pro Arg Leu Pro Asp Gly Val 165 170 175 Asn Arg Ser Glu Arg Ile Trp His Ser Ser Gln Leu Leu Gly Arg Ala 180 185 190 Ala Ala Val Thr Tyr Val Pro Gln Asn Phe Val Val Val Gly Ser Gly 195 200 205 Gln Ser Ala Ala Glu Val Ala Asp Tyr Leu His Arg Thr Phe Pro Arg 210 215 220 Ala Asn Val His Thr Val Leu Ser Arg Tyr Gly Tyr Ser Val Ala Asp 225 230 235 240 Asp Ser Pro Tyr Ala Asn Gly Ile Phe Asp Pro Glu Gly Val Asp Arg 245 250 255 Phe Phe Ser Ala Pro Thr Asp Glu Lys Gln Arg Leu Leu Glu Tyr His 260 265 270 Ala Asn Thr Asn Tyr Ser Val Val Asp Leu Asp Ile Ser Gln Ser Leu 275 280 285 Tyr Leu Lys Ser Tyr Gln Glu Lys Val Leu Gly Lys Gln Arg Leu Arg 290 295 300 Met Ile Asn Thr Ser Arg Val Thr Ser Val Asp Glu Asp Thr Asp Gly 305 310 315 320 Val Arg Val Glu Val Thr Ser Ser Ala Thr Gly Leu Thr His Thr Ile 325 330 335 Glu Ala Asp Val Ile Val Tyr Ala Thr Gly Tyr Arg Pro Ser Asp Pro 340 345 350 Ala Pro Leu Leu Gln Gly Leu Met Arg Glu Cys Lys His Asp Glu Gln 355 360 365 Gly Arg Leu Ser Val Gly Arg Asp Tyr Arg Val Thr Thr Ser Asp Ala 370 375 380 Val Arg Ala Gly Ile Tyr Val His Gly Ala Ser Thr Glu

His Ser His 385 390 395 400 Gly Leu Ser Ala Gly Leu Leu Ser Asn Thr Ala Val Arg Ser Gly Glu 405 410 415 Ile Ala Gln Ser Ile Leu Arg Arg 420 70424PRTRhodococcus fascians 70Met Gly Ala Gln Ser Gly Ser Ser Val Ala Asp Val Val Gly Val Gly 1 5 10 15 Phe Gly Pro Ser Asn Leu Ala Leu Ala Ile Ala Leu Gln Glu Ser Ile 20 25 30 Gln Pro Gly Pro Val Pro Ala Lys Phe Ser Met Lys Phe Tyr Glu Leu 35 40 45 Gln Pro Arg Phe Gly Trp His Arg Gly Met Leu Met Glu Asp Ala Thr 50 55 60 Met Gln Val Ser Phe Leu Lys Asp Leu Ala Thr Met Arg Asn Pro Met 65 70 75 80 Ser Arg Tyr Thr Phe Val Ser Tyr Leu Arg Glu Lys Glu Arg Ile Ala 85 90 95 Glu Phe Ile Asn Ser Lys Thr Leu Tyr Pro Leu Arg Val Glu Phe His 100 105 110 Asp Tyr Leu Glu Trp Ala Ala Ser Gln Phe Gln Ser Asn Val Ser Tyr 115 120 125 Gly Ser Glu Ile Lys Asp Ile Arg Pro Val Val Glu Asn Gly Val Val 130 135 140 Glu Tyr Val Asp Val Val Gly Pro Asp Asp Val Val Gln Arg Ala Arg 145 150 155 160 Asn Ile Val Ile Gly Met Gly Leu Thr Pro Arg Leu Pro Asp Gly Val 165 170 175 Asn Arg Ser Glu Arg Ile Trp His Ser Ser Gln Leu Leu Gly Arg Ala 180 185 190 Ala Ala Val Thr Tyr Val Pro Gln Asn Phe Val Val Val Gly Ser Gly 195 200 205 Gln Ser Ala Ala Glu Val Ala Asp Tyr Leu His Arg Thr Phe Pro Arg 210 215 220 Ala Asn Val His Thr Val Leu Ser Arg Tyr Gly Tyr Ser Val Ala Asp 225 230 235 240 Asp Ser Pro Tyr Ala Asn Gly Ile Phe Asp Pro Glu Gly Val Asp Arg 245 250 255 Phe Phe Ser Ala Pro Thr Asp Glu Lys Gln Arg Leu Leu Glu Tyr His 260 265 270 Ala Asn Thr Asn Tyr Ser Val Val Asp Leu Asp Ile Ser Gln Ser Leu 275 280 285 Tyr Leu Lys Ser Tyr Gln Glu Lys Val Leu Gly Lys Gln Arg Leu Arg 290 295 300 Met Ile Asn Thr Ser Arg Val Thr Ser Val Asp Glu Asp Thr Asp Gly 305 310 315 320 Val Arg Val Glu Val Thr Ser Ser Ala Thr Gly Leu Thr His Thr Ile 325 330 335 Glu Ala Asp Val Ile Val Tyr Ala Thr Gly Tyr Arg Pro Ser Asp Pro 340 345 350 Ala Pro Leu Leu Gln Gly Leu Met Arg Glu Cys Lys His Asp Glu Gln 355 360 365 Gly Arg Leu Ser Val Gly Arg Asp Tyr Arg Val Thr Thr Ser Asp Ala 370 375 380 Val Arg Ala Gly Ile Tyr Val His Gly Ala Ser Thr Glu His Ser His 385 390 395 400 Gly Leu Ser Ala Gly Leu Leu Ser Asn Thr Ala Val Arg Ser Gly Glu 405 410 415 Ile Ala Gln Ser Ile Leu Arg Arg 420 71424PRTRhodococcus fascians 71Met Gly Ala Gln Ser Gly Ser Ser Val Ala Asp Val Val Gly Val Gly 1 5 10 15 Phe Gly Pro Ser Asn Leu Ala Leu Ala Ile Ala Leu Gln Glu Ser Ile 20 25 30 Gln Pro Gly Pro Val Pro Ala Lys Phe Ser Met Lys Phe Tyr Glu Leu 35 40 45 Gln Pro Arg Phe Gly Trp His Arg Gly Met Leu Met Glu Asp Ala Thr 50 55 60 Met Gln Val Ser Phe Leu Lys Asp Leu Ala Thr Met Arg Asn Pro Met 65 70 75 80 Ser Arg Tyr Thr Phe Val Ser Tyr Leu Arg Glu Lys Glu Arg Ile Ala 85 90 95 Glu Phe Ile Asn Ser Lys Thr Leu Tyr Pro Leu Arg Val Glu Phe His 100 105 110 Asp Tyr Leu Glu Trp Ala Ala Ser Gln Phe Gln Ser Asn Val Ser Tyr 115 120 125 Gly Ser Glu Ile Lys Asp Ile Arg Pro Val Val Glu Asn Gly Val Val 130 135 140 Glu Tyr Val Asp Val Val Gly Pro Asp Asp Val Val Gln Arg Ala Arg 145 150 155 160 Asn Ile Val Ile Gly Met Gly Leu Thr Pro Arg Leu Pro Asp Gly Val 165 170 175 Asn Arg Ser Glu Arg Ile Trp His Ser Ser Gln Leu Leu Gly Arg Ala 180 185 190 Ala Ala Val Thr Tyr Val Pro Gln Asn Phe Val Val Val Gly Ser Gly 195 200 205 Gln Ser Ala Ala Glu Val Ala Asp Tyr Leu His Arg Thr Phe Pro Arg 210 215 220 Ala Asn Val His Thr Val Leu Ser Arg Tyr Gly Tyr Ser Val Ala Asp 225 230 235 240 Asp Ser Pro Tyr Ala Asn Gly Ile Phe Asp Pro Glu Gly Val Asp Arg 245 250 255 Phe Phe Ser Ala Pro Thr Asp Glu Lys Gln Arg Leu Leu Glu Tyr His 260 265 270 Ala Asn Thr Asn Tyr Ser Val Val Asp Leu Asp Ile Ser Gln Ser Leu 275 280 285 Tyr Leu Lys Ser Tyr Gln Glu Lys Val Leu Gly Lys Gln Arg Leu Arg 290 295 300 Met Ile Asn Thr Ser Arg Val Thr Ser Val Asp Glu Asp Thr Asp Gly 305 310 315 320 Val Arg Val Glu Val Thr Ser Ser Ala Thr Gly Leu Thr His Thr Ile 325 330 335 Glu Ala Asp Val Ile Val Tyr Ala Thr Gly Tyr Arg Pro Ser Asp Pro 340 345 350 Ala Pro Leu Leu Gln Gly Leu Met Arg Glu Cys Lys His Asp Glu Gln 355 360 365 Gly Arg Leu Ser Val Gly Arg Asp Tyr Arg Val Thr Thr Ser Asp Ala 370 375 380 Val Arg Ala Gly Ile Tyr Val His Gly Ala Ser Thr Glu His Ser His 385 390 395 400 Gly Leu Ser Ala Gly Leu Leu Ser Asn Thr Ala Val Arg Ser Gly Glu 405 410 415 Ile Ala Gln Ser Ile Leu Arg Arg 420 72447PRTSalinispora arenicola 72Met Ser Asn Gln His Glu Thr Tyr Asp Leu Val Gly Ile Gly Phe Gly 1 5 10 15 Pro Ser Asn Leu Ser Leu Ala Ile Ala Leu Lys Glu Tyr Glu Ala Asn 20 25 30 Gly Gln Glu Asn Gly Ile Ser Thr Leu Phe Phe Glu Arg Gln Ser Ser 35 40 45 Phe Gly Trp His Arg Asn Met Leu Leu Pro Ser Thr Thr Met Gln Ile 50 55 60 Ser Phe Leu Lys Asp Leu Val Thr Phe Arg Asn Pro Thr Ser Gly Phe 65 70 75 80 Ser Phe Ile Ser Tyr Leu His Ala Ser Gly Arg Leu Pro Gln Phe Val 85 90 95 Asn Asn Gln Asp Phe Phe Pro Thr Arg Gln Glu Phe His Gln Tyr Leu 100 105 110 Glu Trp Ala Glu Glu Arg Met Ala Gly Arg Val Ala Tyr Gly Ser Glu 115 120 125 Val Thr Ser Ile Arg Leu Pro Ser Gly Thr Val Pro Glu Leu Ser Asp 130 135 140 Arg Leu Arg Leu Glu Val Thr Asp Ala Ala Gly Arg Val Gly Arg Val 145 150 155 160 Val Glu Ala Arg Asn Val Val Ile Ser Thr Gly Leu Val Pro Arg Met 165 170 175 Pro Glu Gly Ile Glu Arg Asp Glu Arg Val Trp His Ser Ser Glu Phe 180 185 190 Leu Gln Lys Tyr Arg Arg Met Asn Pro Gly Asp Leu Arg Arg Val Ala 195 200 205 Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ile Thr Arg Phe Leu His 210 215 220 Asp Glu Leu Pro His Ala Glu Val Trp Val Val Ile Pro Ser Tyr Gly 225 230 235 240 Tyr Ser Val Ala Asp Asp Thr Pro Phe Ala Asn Gln Ile Phe Asp Pro 245 250 255 Glu Ala Val Asp Asp Tyr Tyr Phe Gly Thr Glu Gln Thr Arg Asp Ala 260 265 270 Phe Trp Arg Tyr His Arg Asn Thr Asn Tyr Ser Val Val Asp Asp Glu 275 280 285 Val Ile Arg Asp Leu Tyr Arg Arg Val Tyr Asp Ala Glu Val Arg Gly 290 295 300 Ile Lys Arg Leu Gln Ile Leu Asn Leu Thr Arg Ile Thr Gly Val Lys 305 310 315 320 Arg Ala Ala Ala Glu Thr Arg Val Glu Leu Gln Val Gly Pro Asp Ser 325 330 335 Glu Val Arg Glu Leu Asp Val Asp Ala Leu Val Cys Ala Thr Gly Tyr 340 345 350 Asp Gly Met Glu Pro Thr His Leu Leu Gly Asp Leu Asp Arg Leu Cys 355 360 365 Leu Arg Asp Lys Ala Gly Arg His Gln Ile Glu Arg Asp Tyr Arg Ile 370 375 380 Ala Thr Ala Pro Glu Met Arg Cys Gly Ile Tyr Leu Gln Gly Gly Thr 385 390 395 400 Glu His Thr His Gly Leu Ser Ser Ser Leu Leu Ser Asn Ile Ala Val 405 410 415 Arg Ser Gly Glu Ile Ala Asp Ser Ile Val Ser Arg Arg Ala Arg His 420 425 430 Asn Ser Glu Tyr Ala Leu Ala Ala Gly Ala Glu Gly Asp Thr Cys 435 440 445 73447PRTSalinispora arenicola 73Met Ser Asn Gln His Glu Thr Tyr Asp Leu Val Gly Ile Gly Phe Gly 1 5 10 15 Pro Ser Asn Leu Ser Leu Ala Ile Ala Leu Lys Glu Tyr Glu Ala Asn 20 25 30 Gly Gln Glu Asn Gly Ile Ser Thr Leu Phe Phe Glu Arg Gln Ser Ser 35 40 45 Phe Gly Trp His Arg Asn Met Leu Leu Pro Ser Thr Thr Met Gln Ile 50 55 60 Ser Phe Leu Lys Asp Leu Val Thr Phe Arg Asn Pro Thr Ser Gly Phe 65 70 75 80 Ser Phe Ile Ser Tyr Leu His Ala Ser Gly Arg Leu Pro Gln Phe Val 85 90 95 Asn Asn Gln Asp Phe Phe Pro Thr Arg Gln Glu Phe His Gln Tyr Leu 100 105 110 Glu Trp Ala Glu Glu Arg Met Ala Gly Arg Val Ala Tyr Gly Ser Glu 115 120 125 Val Thr Ser Ile Arg Leu Pro Ser Gly Thr Val Pro Glu Leu Ser Asp 130 135 140 Arg Leu Arg Leu Glu Val Thr Asp Ala Ala Gly Arg Val Gly Arg Val 145 150 155 160 Val Glu Ala Arg Asn Val Val Ile Ser Thr Gly Leu Val Pro Arg Met 165 170 175 Pro Glu Gly Ile Glu Arg Asp Glu Arg Val Trp His Ser Ser Glu Phe 180 185 190 Leu Gln Lys Tyr Arg Arg Met Asn Pro Gly Asp Leu Arg Arg Val Ala 195 200 205 Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ile Thr Arg Phe Leu His 210 215 220 Asp Glu Leu Pro His Ala Glu Val Trp Val Val Ile Pro Ser Tyr Gly 225 230 235 240 Tyr Ser Val Ala Asp Asp Thr Pro Phe Ala Asn Gln Ile Phe Asp Pro 245 250 255 Glu Ala Val Asp Asp Tyr Tyr Phe Gly Thr Glu Gln Thr Arg Asp Ala 260 265 270 Phe Trp Arg Tyr His Arg Asn Thr Asn Tyr Ser Val Val Asp Asp Glu 275 280 285 Val Ile Arg Asp Leu Tyr Arg Arg Val Tyr Asp Ala Glu Val Arg Gly 290 295 300 Ile Lys Arg Leu Gln Ile Leu Asn Leu Thr Arg Ile Thr Gly Val Lys 305 310 315 320 Arg Ala Ala Ala Glu Thr Arg Val Glu Leu Gln Val Gly Pro Asp Ser 325 330 335 Glu Val Arg Glu Leu Asp Val Asp Ala Leu Val Cys Ala Thr Gly Tyr 340 345 350 Asp Gly Met Glu Pro Thr His Leu Leu Gly Asp Leu Asp Arg Leu Cys 355 360 365 Leu Arg Asp Lys Ala Gly Arg His Gln Ile Glu Arg Asp Tyr Arg Ile 370 375 380 Ala Thr Ala Pro Glu Met Arg Cys Gly Ile Tyr Leu Gln Gly Gly Thr 385 390 395 400 Glu His Thr His Gly Leu Ser Ser Ser Leu Leu Ser Asn Ile Ala Val 405 410 415 Arg Ser Gly Glu Ile Ala Asp Ser Ile Val Ser Arg Arg Ala Arg His 420 425 430 Asn Ser Glu Tyr Ala Leu Ala Ala Gly Ala Glu Gly Asp Thr Cys 435 440 445 74447 PRTSalinispora arenicola 74Met Ser Asn Gln His Glu Thr Tyr Asp Leu Val Gly Ile Gly Phe Gly 1 5 10 15 Pro Ser Asn Leu Ser Leu Ala Ile Ala Leu Lys Glu Tyr Glu Ala Asn 20 25 30 Gly Gln Glu Asn Gly Ile Ser Thr Leu Phe Phe Glu Arg Gln Ser Ser 35 40 45 Phe Gly Trp His Arg Asn Met Leu Leu Pro Ser Thr Thr Met Gln Ile 50 55 60 Ser Phe Leu Lys Asp Leu Val Thr Phe Arg Asn Pro Thr Ser Gly Phe 65 70 75 80 Ser Phe Ile Ser Tyr Leu His Ala Ser Gly Arg Leu Pro Gln Phe Val 85 90 95 Asn Asn Gln Asp Phe Phe Pro Thr Arg Gln Glu Phe His Gln Tyr Leu 100 105 110 Glu Trp Ala Glu Glu Arg Met Ala Gly Arg Val Ala Tyr Gly Ser Glu 115 120 125 Val Thr Ser Ile Arg Leu Pro Ser Gly Thr Val Pro Glu Leu Ser Asp 130 135 140 Arg Leu Arg Leu Glu Val Thr Asp Ala Ala Gly Arg Val Gly Arg Val 145 150 155 160 Val Glu Ala Arg Asn Val Val Ile Ser Thr Gly Leu Val Pro Arg Met 165 170 175 Pro Glu Gly Ile Glu Arg Asp Glu Arg Val Trp His Ser Ser Glu Phe 180 185 190 Leu Gln Lys Tyr Arg Arg Met Asn Pro Gly Asp Leu Arg Arg Val Ala 195 200 205 Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ile Thr Arg Phe Leu His 210 215 220 Asp Glu Leu Pro His Ala Glu Val Trp Val Val Ile Pro Ser Tyr Gly 225 230 235 240 Tyr Ser Val Ala Asp Asp Thr Pro Phe Ala Asn Gln Ile Phe Asp Pro 245 250 255 Glu Ala Val Asp Asp Tyr Tyr Phe Gly Thr Glu Gln Thr Arg Asp Ala 260 265 270 Phe Trp Arg Tyr His Arg Asn Thr Asn Tyr Ser Val Val Asp Asp Glu 275 280 285 Val Ile Arg Asp Leu Tyr Arg Arg Val Tyr Asp Ala Glu Val Arg Gly 290 295 300 Ile Lys Arg Leu Gln Ile Leu Asn Leu Thr Arg Ile Thr Gly Val Lys 305 310 315 320 Arg Ala Ala Ala Glu Thr Arg Val Glu Leu Gln Val Gly Pro Asp Ser 325 330 335 Glu Val Arg Glu Leu Asp Val Asp Ala Leu Val Cys Ala Thr Gly Tyr 340 345 350 Asp Gly Met Glu Pro Thr His Leu Leu Gly Asp Leu Asp Arg Leu Cys 355 360 365 Leu Arg Asp Lys Ala Gly Arg His Gln Ile Glu Arg Asp Tyr Arg Ile 370 375 380 Ala Thr Ala Pro Glu Met Arg Cys Gly Ile Tyr Leu Gln Gly Gly Thr 385 390 395 400 Glu His Thr His Gly Leu Ser Ser Ser Leu Leu Ser Asn Ile Ala Val 405 410 415 Arg Ser Gly Glu Ile Ala Asp Ser Ile Val Ser Arg Arg Ala Arg His 420 425 430 Asn Ser Glu Tyr Ala Leu Ala Ala Gly Ala Glu Gly Asp Thr Cys 435 440 445 75447 PRTSalinispora arenicola 75Met Ser Asn Gln His Glu Thr Tyr Asp Leu Val Gly Ile Gly Phe Gly 1 5 10 15 Pro Ser Asn Leu Ser Leu Ala Ile Ala Leu Lys Glu Tyr Glu Ala Asn 20 25 30 Gly Gln Glu Asn Gly Ile Ser Thr Leu Phe Phe Glu Arg Gln Ser

Ser 35 40 45 Phe Gly Trp His Arg Asn Met Leu Leu Pro Ser Thr Thr Met Gln Ile 50 55 60 Ser Phe Leu Lys Asp Leu Val Thr Phe Arg Asn Pro Thr Ser Gly Phe 65 70 75 80 Ser Phe Ile Ser Tyr Leu His Ala Ser Gly Arg Leu Pro Gln Phe Val 85 90 95 Asn Asn Gln Asp Phe Phe Pro Thr Arg Gln Glu Phe His Gln Tyr Leu 100 105 110 Glu Trp Ala Glu Glu Arg Met Ala Gly Arg Val Ala Tyr Gly Ser Glu 115 120 125 Val Thr Ser Ile Arg Leu Pro Ser Gly Thr Val Pro Glu Leu Ser Asp 130 135 140 Arg Leu Arg Leu Glu Val Thr Asp Ala Ala Gly Arg Val Gly Arg Val 145 150 155 160 Val Glu Ala Arg Asn Val Val Ile Ser Thr Gly Leu Val Pro Arg Met 165 170 175 Pro Glu Gly Ile Glu Arg Asp Glu Arg Val Trp His Ser Ser Glu Phe 180 185 190 Leu Gln Lys Tyr Arg Arg Met Asn Pro Gly Asp Leu Arg Arg Val Ala 195 200 205 Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ile Thr Arg Phe Leu His 210 215 220 Asp Glu Leu Pro His Ala Glu Val Trp Val Val Ile Pro Ser Tyr Gly 225 230 235 240 Tyr Ser Val Ala Asp Asp Thr Pro Phe Ala Asn Gln Ile Phe Asp Pro 245 250 255 Glu Ala Val Asp Asp Tyr Tyr Phe Gly Thr Glu Gln Thr Arg Asp Ala 260 265 270 Phe Trp Arg Tyr His Arg Asn Thr Asn Tyr Ser Val Val Asp Asp Glu 275 280 285 Val Ile Arg Asp Leu Tyr Arg Arg Val Tyr Asp Ala Glu Val Arg Gly 290 295 300 Ile Lys Arg Leu Gln Ile Leu Asn Leu Thr Arg Ile Thr Gly Val Lys 305 310 315 320 Arg Ala Ala Ala Glu Thr Arg Val Glu Leu Gln Val Gly Pro Asp Ser 325 330 335 Glu Val Arg Glu Leu Asp Val Asp Ala Leu Val Cys Ala Thr Gly Tyr 340 345 350 Asp Gly Met Glu Pro Thr His Leu Leu Gly Asp Leu Asp Arg Leu Cys 355 360 365 Leu Arg Asp Lys Ala Gly Arg His Gln Ile Glu Arg Asp Tyr Arg Ile 370 375 380 Ala Thr Ala Pro Glu Met Arg Cys Gly Ile Tyr Leu Gln Gly Gly Thr 385 390 395 400 Glu His Thr His Gly Leu Ser Ser Ser Leu Leu Ser Asn Ile Ala Val 405 410 415 Arg Ser Gly Glu Ile Ala Asp Ser Ile Val Ser Arg Arg Ala Arg His 420 425 430 Asn Ser Glu Tyr Ala Leu Ala Ala Gly Ala Glu Gly Asp Thr Cys 435 440 445 76447 PRTSalinispora arenicola 76Met Ser Asn Gln His Glu Thr Tyr Asp Leu Val Gly Ile Gly Phe Gly 1 5 10 15 Pro Ser Asn Leu Ser Leu Ala Ile Ala Leu Lys Glu Tyr Glu Ala Asn 20 25 30 Gly Gln Glu Asn Gly Ile Ser Thr Leu Phe Phe Glu Arg Gln Ser Ser 35 40 45 Phe Gly Trp His Arg Asn Met Leu Leu Pro Ser Thr Thr Met Gln Ile 50 55 60 Ser Phe Leu Lys Asp Leu Val Thr Phe Arg Asn Pro Thr Ser Gly Phe 65 70 75 80 Ser Phe Ile Ser Tyr Leu His Ala Ser Gly Arg Leu Pro Gln Phe Val 85 90 95 Asn Asn Gln Asp Phe Phe Pro Thr Arg Gln Glu Phe His Gln Tyr Leu 100 105 110 Glu Trp Ala Glu Glu Arg Met Ala Gly Arg Val Ala Tyr Cys Ser Glu 115 120 125 Val Thr Ser Ile Arg Leu Pro Ser Gly Thr Val Pro Glu Leu Ser Asp 130 135 140 Arg Leu Arg Leu Glu Val Thr Asp Ala Ala Gly Arg Val Gly Arg Val 145 150 155 160 Val Glu Ala Arg Asn Val Val Ile Ser Thr Gly Leu Val Pro Arg Met 165 170 175 Pro Glu Gly Ile Glu Arg Asp Glu Arg Val Trp His Ser Ser Glu Phe 180 185 190 Leu Gln Lys Tyr Arg Arg Met Asn Pro Gly Asp Leu Arg Arg Val Ala 195 200 205 Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ile Thr Arg Phe Leu His 210 215 220 Asp Glu Leu Pro His Ala Glu Val Trp Val Val Ile Pro Ser Tyr Gly 225 230 235 240 Tyr Ser Val Ala Asp Asp Thr Pro Phe Ala Asn Gln Ile Phe Asp Pro 245 250 255 Glu Ala Val Asp Asp Tyr Tyr Phe Gly Thr Glu Gln Thr Arg Asp Ala 260 265 270 Phe Trp Arg Tyr His Arg Asn Thr Asn Tyr Ser Val Val Asp Asp Glu 275 280 285 Val Ile Arg Asp Leu Tyr Arg Arg Val Tyr Asp Ala Glu Val Arg Gly 290 295 300 Ile Lys Arg Leu Gln Ile Leu Asn Leu Thr Arg Ile Thr Gly Val Lys 305 310 315 320 Arg Ala Ala Ala Glu Thr Arg Val Glu Leu Gln Val Gly Pro Asp Ser 325 330 335 Glu Val Arg Glu Leu Asp Val Asp Ala Leu Val Cys Ala Thr Gly Tyr 340 345 350 Asp Gly Met Glu Pro Thr His Leu Leu Gly Asp Leu Asp Arg Leu Cys 355 360 365 Leu Arg Asp Lys Ala Gly Arg His Gln Ile Glu Arg Asp Tyr Arg Ile 370 375 380 Ala Thr Ala Pro Glu Met Arg Cys Gly Ile Tyr Leu Gln Gly Gly Thr 385 390 395 400 Glu His Thr His Gly Leu Ser Ser Ser Leu Leu Ser Asn Ile Ala Val 405 410 415 Arg Ser Gly Glu Ile Ala Asp Ser Ile Val Ser Arg Arg Ala Arg His 420 425 430 Asn Ser Glu Tyr Ala Leu Ala Ala Gly Ala Glu Gly Asp Thr Cys 435 440 445 77447 PRTSalinispora arenicola 77Met Ser Asn Gln His Glu Thr Tyr Asp Leu Val Gly Ile Gly Phe Gly 1 5 10 15 Pro Ser Asn Leu Ser Leu Ala Ile Ala Leu Lys Glu Tyr Glu Ala Asn 20 25 30 Gly Gln Glu Asn Gly Ile Ser Thr Leu Phe Phe Glu Arg Gln Ser Ser 35 40 45 Phe Gly Trp His Arg Asn Met Leu Leu Pro Ser Thr Thr Met Gln Ile 50 55 60 Ser Phe Leu Lys Asp Leu Val Thr Phe Arg Asn Pro Thr Ser Gly Phe 65 70 75 80 Ser Phe Ile Ser Tyr Leu His Ala Ser Gly Arg Leu Pro Gln Phe Val 85 90 95 Asn Asn Gln Asp Phe Phe Pro Thr Arg Gln Glu Phe His Gln Tyr Leu 100 105 110 Glu Trp Ala Glu Glu Arg Met Ala Gly Arg Val Ala Tyr Cys Ser Glu 115 120 125 Val Thr Ser Ile Arg Leu Pro Ser Gly Thr Val Pro Glu Leu Ser Asp 130 135 140 Arg Leu Arg Leu Glu Val Thr Asp Ala Ala Gly Arg Val Gly Arg Val 145 150 155 160 Val Glu Ala Arg Asn Val Val Ile Ser Thr Gly Leu Val Pro Arg Met 165 170 175 Pro Glu Gly Ile Glu Arg Asp Glu Arg Val Trp His Ser Ser Glu Phe 180 185 190 Leu Gln Lys Tyr Arg Arg Met Asn Pro Gly Asp Leu Arg Arg Val Ala 195 200 205 Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ile Thr Arg Phe Leu His 210 215 220 Asp Glu Leu Pro His Ala Glu Val Trp Val Val Ile Pro Ser Tyr Gly 225 230 235 240 Tyr Ser Val Ala Asp Asp Thr Pro Phe Ala Asn Gln Ile Phe Asp Pro 245 250 255 Glu Ala Val Asp Asp Tyr Tyr Phe Gly Thr Glu Gln Thr Arg Asp Ala 260 265 270 Phe Trp Arg Tyr His Arg Asn Thr Asn Tyr Ser Val Val Asp Asp Glu 275 280 285 Val Ile Arg Asp Leu Tyr Arg Arg Val Tyr Asp Ala Glu Val Arg Gly 290 295 300 Ile Lys Arg Leu Gln Ile Leu Asn Leu Thr Arg Ile Thr Gly Val Lys 305 310 315 320 Arg Ala Ala Ala Glu Thr Arg Val Glu Leu Gln Val Gly Pro Asp Ser 325 330 335 Glu Val Arg Glu Leu Asp Val Asp Ala Leu Val Cys Ala Thr Gly Tyr 340 345 350 Asp Gly Met Glu Pro Thr His Leu Leu Gly Asp Leu Asp Arg Leu Cys 355 360 365 Leu Arg Asp Lys Ala Gly Arg His Gln Ile Glu Arg Asp Tyr Arg Ile 370 375 380 Ala Thr Ala Pro Glu Met Arg Cys Gly Ile Tyr Leu Gln Gly Gly Thr 385 390 395 400 Glu His Thr His Gly Leu Ser Ser Ser Leu Leu Ser Asn Ile Ala Val 405 410 415 Arg Ser Gly Glu Ile Ala Asp Ser Ile Val Ser Arg Arg Ala Arg His 420 425 430 Asn Ser Glu Tyr Ala Leu Ala Ala Gly Ala Glu Gly Asp Thr Cys 435 440 445 78447 PRTSalinispora pacifica 78Met Ser Asn Gln His Glu Thr Tyr Asp Leu Val Gly Ile Gly Phe Gly 1 5 10 15 Pro Ser Asn Leu Ser Leu Ala Ile Ala Leu Lys Glu Tyr Glu Ala Asn 20 25 30 Gly Gln Glu Asn Gly Ile Ser Thr Leu Phe Phe Glu Arg Gln Ser Ser 35 40 45 Phe Gly Trp His Arg Asn Met Leu Leu Pro Ser Thr Thr Met Gln Ile 50 55 60 Ser Phe Leu Lys Asp Leu Val Thr Phe Arg Asn Pro Thr Ser Gly Phe 65 70 75 80 Ser Phe Ile Ser Tyr Leu His Ala Ser Gly Arg Leu Pro Gln Phe Val 85 90 95 Asn Asn Gln Asp Phe Phe Pro Thr Arg Gln Glu Phe His Gln Tyr Leu 100 105 110 Glu Trp Ala Glu Glu Arg Met Ala Gly Arg Val Ala Tyr Cys Ser Glu 115 120 125 Val Thr Ser Ile Arg Leu Pro Ser Gly Thr Val Pro Glu Leu Ser Asp 130 135 140 Arg Leu Arg Leu Glu Val Thr Asp Ala Ala Gly Arg Val Gly Arg Val 145 150 155 160 Val Glu Ala Arg Asn Val Val Ile Ser Thr Gly Leu Val Pro Arg Met 165 170 175 Pro Glu Gly Ile Glu Arg Asp Glu Arg Val Trp His Ser Ser Glu Phe 180 185 190 Leu Gln Lys Tyr Arg Arg Met Asn Pro Gly Asp Leu Arg Arg Val Ala 195 200 205 Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ile Thr Arg Phe Leu His 210 215 220 Asp Glu Leu Pro His Ala Glu Val Trp Val Val Ile Pro Ser Tyr Gly 225 230 235 240 Tyr Ser Val Ala Asp Asp Thr Pro Phe Ala Asn Gln Ile Phe Asp Pro 245 250 255 Glu Ala Val Asp Asp Tyr Tyr Phe Gly Thr Glu Gln Thr Arg Asp Ala 260 265 270 Phe Trp Arg Tyr His Arg Asn Thr Asn Tyr Ser Val Val Asp Asp Glu 275 280 285 Val Ile Arg Asp Leu Tyr Arg Arg Val Tyr Asp Ala Glu Val Arg Gly 290 295 300 Ile Lys Arg Leu Gln Ile Leu Asn Leu Thr Arg Ile Thr Gly Val Lys 305 310 315 320 Arg Ala Ala Ala Glu Thr Arg Val Glu Leu Gln Val Gly Pro Asp Ser 325 330 335 Glu Val Arg Glu Leu Asp Val Asp Ala Leu Val Cys Ala Thr Gly Tyr 340 345 350 Asp Gly Met Glu Pro Thr His Leu Leu Gly Asp Leu Asp Arg Leu Cys 355 360 365 Leu Arg Asp Lys Ala Gly Arg His Gln Ile Glu Arg Asp Tyr Arg Ile 370 375 380 Ala Thr Ala Pro Glu Met Arg Cys Gly Ile Tyr Leu Gln Gly Gly Thr 385 390 395 400 Glu His Thr His Gly Leu Ser Ser Ser Leu Leu Ser Asn Ile Ala Val 405 410 415 Arg Ser Gly Glu Ile Ala Asp Ser Ile Val Ser Arg Arg Ala Arg His 420 425 430 Asn Ser Glu Tyr Ala Leu Ala Ala Gly Ala Glu Gly Asp Thr Cys 435 440 445 79433 PRTStreptomyces aureofaciens 79Val Gly Glu Arg Gln Arg Ser Gly Val Val Ala Gly Thr Gly Ile Val 1 5 10 15 Asp Val Ala Gly Ile Gly Phe Gly Pro Ser Asn Leu Ala Leu Ala Ala 20 25 30 Ala Ile Ala Glu Ile Ala Gly Glu Ala Pro Val Ser Ala Arg Phe Phe 35 40 45 Glu Ala Gln Pro Arg Phe Gly Trp His Arg Gly Met Leu Ile Glu Gly 50 55 60 Ala Thr Met Gln Val Ser Tyr Leu Lys Asp Leu Val Thr Met Arg Asn 65 70 75 80 Pro Thr Ser Pro Tyr Ser Phe Leu Cys Tyr Leu Gln Ala Arg Gly Arg 85 90 95 Leu Ala Asp Phe Ile Asn Thr Lys Ser Pro Tyr Pro Leu Arg Val Glu 100 105 110 Phe His Asp Tyr Leu Glu Trp Val Ala Glu Ser Phe Ala Asp Leu Val 115 120 125 Ser Tyr Gly Ala Arg Val Val Ser Val Glu Pro Val Ser Ala Glu Gln 130 135 140 Gly Val Glu Phe Leu Asp Val His Phe Val Ala Pro Asp Gly Thr Arg 145 150 155 160 Gln Val Gln Arg Ala Arg Asn Leu Val Ile Ala Ala Gly Ile Glu Pro 165 170 175 Arg Leu Pro Ala Gly Leu Pro Ala Ser Pro Arg Ile Trp His Thr Ala 180 185 190 Lys Phe Leu Pro Glu Val Asp Arg Ile Ala Arg Gln Asp Pro Arg Ser 195 200 205 Phe Val Val Leu Gly Ser Gly Gln Ser Ala Ala Glu Ala Ile Glu His 210 215 220 Leu His Ala Arg Phe Pro Arg Ala Gln Val His Ser Val His Ala Arg 225 230 235 240 Tyr Gly Phe Ser Val Ala Asp Asp Ser Pro Phe Ala Asn Gln Val Phe 245 250 255 Asn Pro Glu Ala Val Asp Arg Phe His Thr Ala Pro Asp Asp Val Arg 260 265 270 Gln Arg Leu Ile Asp Tyr His Ala Ser Thr Asn Tyr Ser Val Val Asp 275 280 285 Ala Asp Leu Leu His Ser Leu Phe Gln Gln Ala Tyr Leu Glu Lys Val 290 295 300 Ala Gly Asn Pro Arg Leu Asn Phe His Asn Val Ser Arg Val Ser Glu 305 310 315 320 Val Thr Glu Thr Pro Asp Gly Leu Arg Ile Asp Val Glu Ser Leu Ser 325 330 335 Ser Gly Thr Ser Thr Val Ile Glu Ala Gln Ala Leu Val Cys Ala Thr 340 345 350 Gly Tyr Thr Arg Thr Asp Pro Ala Val Phe Leu Asp Gly Leu Leu Pro 355 360 365 His Cys Pro Leu Asp Asp Gln Gly Arg Leu Arg Leu Asp Arg Glu His 370 375 380 Arg Val Val Thr Asp Glu Ser Val Arg Cys Gly Ile Tyr Val Gln Gly 385 390 395 400 Phe Gly Glu His Ser His Gly Leu Ser Glu Thr Leu Leu Ser Leu Ser 405 410 415 Ala Val Arg Ala Gly Glu Ile Gly Asp Met Leu Val Lys Ala Leu Ser 420 425 430 Gly 80447PRT Streptomyces sp. OK885 80Met Gly Ala Arg Glu Thr Glu Val Tyr Asp Val Val Gly Val Gly Phe 1 5 10 15 Gly Pro Ser Asn Leu Ser Leu Ala Val Ala Ile Gln Glu His Asn Ser 20 25 30 Ser Thr Ser Asp Arg Pro Leu Thr Ala Ala Phe Phe Glu Arg Gln Glu 35 40 45 Ala Phe Gly Trp His Arg Asn Met Leu Leu Pro Ala Ala Thr Met Gln 50 55 60 Ile Pro Phe Leu Lys Asp Ile Ala Thr Phe Arg Asn Pro Ala Ser Arg 65 70 75 80 Tyr Ser Phe Val Ala Tyr Leu His Ala Ser Gly Arg

Leu Ala Gly Phe 85 90 95 Val Asn Asn Gln Thr Phe Phe Pro Thr Arg Arg Glu Phe His Arg Tyr 100 105 110 Leu Glu Trp Val Ala Ala Asn Phe Thr Asp Gln Val Ser Tyr Gly Cys 115 120 125 Glu Val Val Gly Leu Arg Leu Ser Gly Gln Gly Thr Gly Ala Gly Ala 130 135 140 Pro Ala His Leu Glu Ile Glu Val Ala Gly Gly Ala Gly Arg Gln Arg 145 150 155 160 Ser Ser Val Arg Ala Arg Asn Val Val Val Ser Thr Gly Leu Val Pro 165 170 175 Arg Met Pro Glu Gly Val Leu Gly Asp Asp Arg Val Trp His Ser Ser 180 185 190 Glu Phe Leu Thr Arg Phe Arg Gly Leu Lys Pro Val Asp Leu Arg Ala 195 200 205 Val Ala Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ile Thr Arg Phe 210 215 220 Val His Asp Ala Ala Pro His Ala Gln Val Tyr Ser Val Ile Pro Ser 225 230 235 240 Tyr Gly Tyr Ala Leu Ala Asp Asp Thr Pro Phe Ala Asn Gln Val Phe 245 250 255 Asp Pro Ala Ala Val Asp Asp Tyr Phe Phe Gly Thr Asp Arg Ala Arg 260 265 270 Gln Ala Phe Trp Asp Tyr His Lys Asn Thr Asn Tyr Ser Val Val Asp 275 280 285 Asp Asp Val Ile Arg Asp Leu Tyr Arg Arg Ser Tyr Asp Glu Glu Val 290 295 300 Asn Gly Ala Arg Arg Leu His Phe Leu Asn Leu Thr Arg Val Gly Glu 305 310 315 320 Val Lys Arg Ala Gly Asp Glu Thr Arg Val Leu Leu Met Asn Gly Glu 325 330 335 Arg Arg Glu Leu Glu Val Asp Leu Cys Val Phe Ala Thr Gly Tyr His 340 345 350 Gly Met Glu Pro Ala Gly Val Leu Gly Asp Leu Ala Pro Tyr Cys Leu 355 360 365 Arg Asp Glu Ala Gly Arg Leu Arg Val Glu Arg Asp Tyr Arg Leu Val 370 375 380 Thr Gly Pro Glu Leu Pro Gly Gly Ile Tyr Leu Gln Gly Gly Thr Glu 385 390 395 400 His Thr His Gly Leu Ser Ser Ser Leu Leu Ser Asn Ile Ala Val Arg 405 410 415 Ser Gly Glu Ile Ala Glu Ser Ile Val Ser Arg His Arg Ile Glu Arg 420 425 430 Glu Leu Gly Gln Val His Pro Ala Glu Pro Ala Gly Lys Ile Arg 435 440 445 81441 PRTPseudonocardia sp. AL041005-10 81Met Asp Thr Asp Asp Met Gly Thr Tyr Asp Phe Val Gly Ile Gly Phe 1 5 10 15 Gly Pro Ser Asn Leu Ser Leu Ala Ala Ala Leu Arg Asp Ala Ser Ser 20 25 30 Ser Asp Ala Ser Pro Val Arg Gly His Phe Phe Glu Ala Gln Pro Ser 35 40 45 Phe Gly Trp His Arg Asn Met Leu Leu Pro Ser Ala Lys Met Gln Val 50 55 60 Ser Phe Leu Lys Asp Leu Val Thr Phe Arg Asn Pro His Ser Arg Phe 65 70 75 80 Ser Phe Val Ser Tyr Leu His Glu Met Asn Arg Leu Pro Gln Phe Ala 85 90 95 Asn Asn Asn Asp Phe Phe Pro Thr Arg Arg Glu Phe His Gln Tyr Leu 100 105 110 Glu Trp Val Ala Gly His Phe Ala Asp Ser Val Thr Tyr Gly Ala Arg 115 120 125 Val Thr Gly Ile Glu Pro Ile Cys Gly Gly Ala Thr Ala Gly Pro His 130 135 140 Asp Arg Phe Arg Ile Thr Ile Ala Ser Gly Lys Asp Ala Leu Ala Thr 145 150 155 160 Thr Arg Val Glu Ala Tyr Asn Val Val Leu Ala Thr Gly Leu Thr Pro 165 170 175 Arg Met Pro Glu Gly Ser Val Arg Asp Asp Arg Val Trp His Ser Ser 180 185 190 Glu Phe Leu Glu Arg Phe Gly Ser Cys Ser Ser Ala Ser Leu Arg Arg 195 200 205 Val Ala Val Val Gly Ala Gly Gln Ser Ala Ala Glu Ile Ala Arg Phe 210 215 220 Cys Tyr Asp His Ala Pro Asn Ala Thr Ile Ser Ala Ile Leu Pro Ser 225 230 235 240 Tyr Gly Tyr Ser Ile Ala Asp Asn Thr Pro Phe Ala Asn Arg Val Phe 245 250 255 Asp Pro Gly Ala Val Asp Asp Tyr Tyr Phe Ser Asp Pro Leu Gly Lys 260 265 270 Asp Arg Leu Trp Glu Ser His Arg Asn Thr Asn Tyr Ser Val Val Asp 275 280 285 Asp Glu Val Ile Arg Ser Leu Phe Gln Arg Gln Tyr Asp Asp Glu Val 290 295 300 Arg Gly Val Glu Arg Leu Gln Ile Ile Asn Leu Ala Arg Val Ala Asn 305 310 315 320 Ile Lys Arg Ser Gly Asp Glu Thr Arg Val Thr Ile His Ser Leu Ala 325 330 335 Arg Asp Glu His Phe Asp Leu Asp Val Asp Val Val Val Cys Ala Thr 340 345 350 Gly Tyr Glu Ala Met Gly Ala Asp Gly Val Leu Ala Gly Leu Asp Ala 355 360 365 Phe Cys Pro Arg Asp Asp Arg Gly Arg His Arg Val Glu Arg Asp Tyr 370 375 380 Arg Leu Ile Thr Thr Asp Asp Leu Thr Ala Gly Ile Tyr Leu Gln Gly 385 390 395 400 Gly Thr Glu His Thr His Gly Leu Thr Ser Ser Leu Leu Ser Asn Leu 405 410 415 Ala Thr Arg Ser Gly Glu Ile Ala Ser Ser Leu Arg Ser Ser Arg Arg 420 425 430 Val Gly Ser Ala Gly Gly Asp Arg Trp 435 440 82224PRTMycobacterium marinum 82Met Tyr Glu Arg Pro Gly Tyr Ser Ala Ile Glu Pro Ala Ala Val Leu 1 5 10 15 Asp Leu Leu Thr Ala Asn Pro Leu Gly Leu Val Val Thr Ile Asp Gly 20 25 30 Ala Arg Pro Leu Ala Thr His Ala Pro Val Leu Phe Ser Gln Gly Pro 35 40 45 Asn Gly Val Ala Gln Ala Glu Val Ala Ser Gly Asp Ala Pro Leu Val 50 55 60 Gly Ser Leu Leu Val Gly His Met Asn Ala Asp Asn Pro Gln Trp Arg 65 70 75 80 Gly Met Gln Lys Gly Gly Arg Val Leu Val Ala Phe Gln Gly Pro His 85 90 95 Gly Tyr Val Ser Pro Ser Val Tyr Gly Val Thr Pro Ala Ser Pro Thr 100 105 110 Trp Asn Phe Thr Ala Val His Ile Ala Gly Thr Leu Glu Pro Ile Ala 115 120 125 Asp Pro Glu Ser Thr Phe Glu Leu Val Cys Asp Thr Ala Arg Arg Leu 130 135 140 Glu Ala Arg Phe Gly His Gly Trp Arg Gln Glu Pro Ser Leu Asp Tyr 145 150 155 160 Phe Arg Arg Ile Val Ser Gly Val Gly Ala Phe Glu Ile Gln Val Glu 165 170 175 Ser Val Gln Thr Met Phe Lys Leu Ser Gln Glu Gln Pro Pro Val Leu 180 185 190 Arg Arg Arg Val Ala Glu His Phe Glu Ser Ser Asp Ser Val Leu His 195 200 205 Gln Glu Leu Ala Asp Leu Met Arg Lys His Val Phe Pro Lys Pro Ile 210 215 220 83218PRTLentzea flaviverrucosa 83Met Phe Val Pro Ala Gln Tyr Arg Glu Pro His Gly His Trp Ile Thr 1 5 10 15 Asp Leu Val Arg Gly His Pro Leu Ala Gln Leu Val Ser Asn Gly Pro 20 25 30 Ala Gly Ser Ser Pro Tyr Val Thr His Ala Pro Ile Ile Leu Asp Pro 35 40 45 Gly His Pro Asp Pro His Pro Asp Asp Leu His Gly Ala Val Leu Trp 50 55 60 Gly His Leu Asn Arg Ala Asn Pro His Trp Ala Ala Leu Gly Asp Gly 65 70 75 80 Thr Glu Val Thr Ala Val Phe Thr Gly Pro Gly Ser Tyr Val Ser Pro 85 90 95 Thr Val Tyr Glu Arg Thr Pro Ala Ala Pro Thr Trp Asp Phe Thr Ala 100 105 110 Val His Val Arg Gly Thr Leu Arg Arg Val Leu Asp Ala Glu Gln Thr 115 120 125 Leu Ala Thr Val Thr Ala Thr Val Arg Ala Phe Glu Ala Asp His Gly 130 135 140 Thr Gly Trp Ser Met Glu Ser Ser Leu Asp Tyr Phe Asp Gln Leu Leu 145 150 155 160 Pro Gly Val Gly Ala Phe Arg Leu Ala Val Thr Gly Val Asp Ala Met 165 170 175 Phe Lys Leu Ser Gln Glu Gln Pro Pro Glu Val Arg Leu Arg Val Arg 180 185 190 Asp His Phe Ala Gly Ser Glu Arg Thr His His Cys Leu Ile Ala Glu 195 200 205 Met Met Asp Arg Leu Pro Val Ala Glu His 210 215 84217PRTStreptomyces aureofaciens 84Val Phe Thr Pro Lys Leu Tyr Gln Val Asp Gly Asp Asp Trp Pro Leu 1 5 10 15 Arg Ile Ile Glu Arg His Pro Leu Ala Val Leu Val Ser Asn Gly Asp 20 25 30 Pro Val Pro Asn Ala Thr His Val Pro Val Ile Ala Pro Pro Asp Ala 35 40 45 Ala Pro Glu Asp Ala Leu Ser Gly Met Arg Leu Trp Ala His Leu Thr 50 55 60 Arg Ala Asn Pro His Trp Gln Gln Leu Ala Ala Ala Gly Gly Gly Pro 65 70 75 80 Ala Lys Leu Val Phe His Gly Pro Asn Gly Tyr Val Thr Pro Ser Leu 85 90 95 Tyr Ser Ala Asp Met Val Ala Pro Thr Trp Asn Tyr Val Ala Val His 100 105 110 Leu Glu Gly Thr Val Glu Leu Ala Gly Asp Asp Glu Thr Leu Ala Ile 115 120 125 Val His Thr Thr Ala Gln Thr Leu Glu Asp Arg Phe Gly Asp Gly Met 130 135 140 Ala Leu Ala Pro Ser Leu Glu Tyr His Arg Gln Ile Val Gly Ala Val 145 150 155 160 Gly Gly Leu Phe Phe Thr Val Thr Lys Val Asp Val Met Phe Lys Leu 165 170 175 Ser Gln Glu Lys Asp Pro Glu Val Gln Gln Arg Val Leu Asp Arg Phe 180 185 190 Ala Ala Ser Gly Ser Gly Leu His Arg Glu Val Ala Asp Thr Met Arg 195 200 205 Ala Leu Arg Leu Gly Gly Ser Ala Gly 210 215 85224PRTStreptomyces diastatochromogenes 85Val Tyr Ile Pro Asp Leu Tyr Arg Thr Asp Asp Lys Glu Trp Pro Val 1 5 10 15 Arg Ile Leu Glu Glu Asn Pro Leu Gly Leu Leu Thr Thr His Ala Ser 20 25 30 Ser Ser Ala Pro Pro Phe Ala Thr His Leu Pro Val Ile Ile Pro Ser 35 40 45 Gly Ser Arg Asp Ala Leu Leu Gln Asp Glu Lys Trp Arg Gly Ala Thr 50 55 60 Leu Leu Gly His Met Asn Arg Ala Asn Pro His Trp Gln Ser Leu Ala 65 70 75 80 Asp Gly Thr Pro Ala Arg Ile Val Phe Gln Gly Pro Gly Ala Tyr Val 85 90 95 Ser Pro Ser Val Tyr His Thr Asp Pro Ala Ala Pro Thr Trp Asp Phe 100 105 110 Thr Ala Val His Val Gln Gly Thr Leu Trp Pro Val Arg Asp Glu Ala 115 120 125 Glu Thr Leu Ala Ile Val Thr Ala Thr Ala Thr Glu Leu Glu Arg Lys 130 135 140 Phe Gly Thr Gly Trp Cys Pro His Ser Ser Thr Glu Tyr Phe Arg Gln 145 150 155 160 Leu Leu Ala Gly Val Gly Ala Phe Glu Leu Arg Val Asp Thr Met Asp 165 170 175 Ala Met Phe Lys Leu Ser Gln Glu Lys Ser His Glu Ile Arg Asn Gly 180 185 190 Val Val Asp Trp Phe Val Gln Gly Gln His Gly Arg Ser Arg Glu Leu 195 200 205 Ala Ser Leu Met Ala Glu Phe Tyr Lys Asp Asp Arg Gly Thr Gly Ala 210 215 220 86215PRTStreptomyces sp. DvalAA-43 86Met Phe Val Pro Ser His Tyr Arg Glu Pro Asp Gly Ser Trp Met Ile 1 5 10 15 Asp Leu Ile Arg Ala Asn Pro Met Ala Ile Met Ala Ile Asn Gly Ser 20 25 30 Ser Ala Asp Gly Pro Phe Ala Thr His Leu Pro Val Ile Pro Asp Pro 35 40 45 Ala Ala Thr Gly Arg Arg Ser Ala Asp Leu Ser Gly Ala Thr Leu Leu 50 55 60 Gly His Met Asn Arg Ala Asn Pro Gln Trp Ala Ala Leu Glu Ser Gly 65 70 75 80 Gly Val Ala Leu Leu Ile Phe Thr Gly Pro His Gly Tyr Val Ser Pro 85 90 95 Thr Val Tyr Glu Met Ala Pro Ala Ala Pro Thr Trp Asn Phe Thr Ser 100 105 110 Val His Val His Gly Met Val Glu Lys Ile Asp Ser Thr Glu Glu Thr 115 120 125 Leu Gly Val Val Lys Ser Thr Val Thr Ala Leu Glu Thr Asp Phe Gly 130 135 140 Thr Asp Trp Asp Met Ser Gly Ser Val Asp Tyr Phe Arg Lys Ile Val 145 150 155 160 Pro Ala Val Gly Ala Phe Arg Phe Thr Val Ser Gly Ala Glu Gly Met 165 170 175 Phe Lys Leu Ser Gln Glu Gln Pro Ala Glu Val Arg Asp Arg Val Gln 180 185 190 Thr Ser Phe Ser Cys Arg Glu Gln Gly Arg Tyr Arg Glu Thr Ala Glu 195 200 205 Leu Met Gly Arg Leu Pro Gly 210 215 87218PRTCollimonas fungivorans 87Met Tyr Val Pro Glu Tyr Tyr Arg Val Asp Glu Asn Thr Ala Arg Glu 1 5 10 15 Leu Val Tyr Arg His Pro Leu Ala Leu Leu Val Cys Asn Gly Asn Asn 20 25 30 Gly Leu Pro Trp Ala Thr His Leu Pro Ala Ile Phe Pro Pro Glu Thr 35 40 45 Arg Lys Leu Leu Asp Gln Gly Glu Ser Ile Ile Gly Lys Thr Met Tyr 50 55 60 Gly His Met Asn Arg Ile Asn Pro His Trp Asn Ala Leu Gln Ala Gly 65 70 75 80 Ser Ala Leu Leu Ile Phe Gln Gly Pro Asn Ser Tyr Val Ser Pro Thr 85 90 95 Val Tyr Glu Val Thr Pro Ala Ala Pro Thr Trp Asn Phe Thr Ser Thr 100 105 110 His Leu Arg Gly Thr Leu Arg Pro Ile Asp Glu Arg Asp Gln Ile Leu 115 120 125 Glu Ile Val Arg Trp Thr Val Ala Thr Phe Glu Lys Glu Phe Cys Thr 130 135 140 Asn Trp Asp Leu Thr Glu Ser Ile Pro Tyr Phe Glu Arg Ile Val His 145 150 155 160 Gly Val Gly Ala Phe Ala Phe Glu Val Glu Ser Phe Asp Ser Met Phe 165 170 175 Lys Leu Ser Gln Glu Gln Pro Ala Ala Ile Gln Glu Arg Val Val Asn 180 185 190 Ser Phe Ala Ser Ser Ser His Cys Pro His Lys Glu Ile Ala Asp Leu 195 200 205 Met Gln Arg Thr Asn Ser Lys Asn Lys Lys 210 215 88231PRTStreptomyces reticuli 88Val Tyr Glu Arg Pro Leu Tyr Arg Glu Asp Arg Asp Gly Val Val Leu 1 5 10 15 Ala Phe Leu His His His Pro Leu Ala Leu Val Val Thr Ala His Glu 20 25 30 Gly Val Pro Val Ala Thr His Ala Pro Val Leu Phe Arg His Gly Pro 35 40 45 Asp Gly Ala Asp Ala Glu Ala Val Ala Ala Gly Thr Val Pro Leu Ala 50 55 60 Gly Ser Thr Leu Ile Gly His Met Asn Val Glu Asn Pro Gln Trp Arg 65 70 75 80 Arg Met Arg Ser Gly Asp Gln Ala Leu Ile Val Phe Gln Gly Pro His 85 90 95 Gly Tyr Val Ser Pro Thr Val Tyr Asp Val Thr Pro Ala Ala Pro Thr 100 105 110 Trp Asn Phe Thr Ala Val His Val Thr Gly Thr Val Glu Pro Thr Ala 115 120 125 Glu Pro Ala Asp Val Leu Asp Ile Val Ser Asp Thr

Ala Arg Arg Leu 130 135 140 Glu Gly Arg Phe Gly Arg Gly Trp Asp Gln Glu Ser Ser Leu Asp Tyr 145 150 155 160 Phe Arg Gln Ile Ala Pro Gly Val Gly Ala Phe Thr Leu Arg Val Glu 165 170 175 Ser Val Gln Thr Met Phe Lys Leu Ser Gln Glu Lys Pro Thr Pro Met 180 185 190 Arg Arg Arg Val Ala Glu Gln Phe Glu Ala Ser Glu Ser Gly Thr His 195 200 205 Arg Ala Leu Ala Gly Met Met Arg Ala His Gly Leu Thr Asp Ala Asp 210 215 220 Glu Glu Arg Glu Thr Ala Gly 225 230 89231PRTStreptomyces scabies 89Met Phe Val Pro Asp Pro Tyr Arg Glu Pro Asp Gly Ser Trp Met Thr 1 5 10 15 Glu Leu Ile Arg Leu Asn Pro Phe Ala Leu Leu Val Ser Asn Gly Pro 20 25 30 Ala Asp Ala Asp Pro Tyr Ala Thr His Leu Pro Val Leu Arg Asp Pro 35 40 45 Glu Trp Thr Gly Glu Trp Thr Glu Asp Leu Ala Gly Gly Arg Leu Val 50 55 60 Gly His Met Asn Arg Glu Asn Pro His Trp Thr Ala Leu Glu Thr Gly 65 70 75 80 Thr Pro Val Leu Ile Thr Phe Thr Gly Pro His Ala Tyr Val Ser Pro 85 90 95 Thr Val Tyr Asp Ile Thr Pro Ala Ala Pro Thr Trp Asp Phe Thr Ser 100 105 110 Val His Val His Gly Val Phe His Lys Ile Glu Ala Ala Ala Pro Gly 115 120 125 Glu Asp Thr Leu Glu Val Cys Lys Asp Thr Val Lys Ala Tyr Glu Arg 130 135 140 Asp Phe Gly Ala Ala Lys Ala Trp Asp Met Ser Arg Ser Ile Asp Tyr 145 150 155 160 Phe Ala Thr Ile Leu Pro Ala Val Gly Ala Phe Arg Val Glu Ile Thr 165 170 175 Gly Ala Glu Gly Met Phe Lys Leu Ser Gln Glu Gln Asp Gln Glu Ile 180 185 190 Arg Glu Arg Val Gln Lys Asp Phe Ala Leu Arg Asp Ser Thr Gln Tyr 195 200 205 Arg Glu Thr Ala Asp Leu Met Asp Arg Met Glu Lys Thr Gly Thr Val 210 215 220 Gln Gly Cys Pro Val His His 225 230 90214PRTKutzneria albida 90Met Phe Val Pro Ser His Tyr Arg Glu Pro Asp Val Ser Trp Met Val 1 5 10 15 Asp Leu Met Arg Gln Asn Pro Leu Ala Leu Leu Ala Ser Asn Gly Asn 20 25 30 Pro Ala Asp Gly Pro Phe Ala Thr His Leu Pro Val Ile Thr Asp Pro 35 40 45 Ala Trp Asp Gly Pro Pro Ala Glu Lys Leu Ala Gly Trp Pro Leu Leu 50 55 60 Gly His Met Asn Arg Ala Asn Pro Gln Trp Thr Ala Leu Glu Asn Gly 65 70 75 80 Ala Thr Val Leu Leu Thr Phe Thr Gly Pro His Ala Tyr Val Ser Pro 85 90 95 Thr Val Tyr Glu Ile Ser Pro Ala Ala Pro Thr Trp Asn Phe Thr Ser 100 105 110 Val His Ala His Gly Val Val Glu Lys Ile Glu Ser Ile Glu Glu Thr 115 120 125 Leu Glu Val Val Gln Ala Thr Val Lys Val Phe Glu Lys Phe Phe Gly 130 135 140 Asp Ser Trp Asp Met Thr Glu Ser Leu Gly Tyr Phe Arg Lys Ile Val 145 150 155 160 Pro Ala Val Gly Ala Phe Arg Ile Arg Val Thr Arg Ala Asp Gly Met 165 170 175 Phe Lys Leu Ser Gln Glu Gln Lys Pro Glu Val Arg Lys Arg Val Val 180 185 190 Thr Ser Phe Ser Glu Arg Gly Cys Gly Arg His Ala Gln Thr Ala Ala 195 200 205 Leu Met Thr Gln Leu Pro 210 91216PRTStreptomyces albus 91Met Phe Val Pro Pro Glu Tyr Arg Pro Asp Asp Pro Glu Trp Leu Ile 1 5 10 15 Glu Val Ile Arg Ser His Pro Leu Ala Cys Leu Val Thr Asn Gly Pro 20 25 30 Asp Gly Pro Arg Ala Ser His Val Pro Val Ile Pro Asp Pro Glu Gln 35 40 45 Phe Pro Ser Gly Met Pro Ala Arg Glu Gly Glu Val Ala Gly Arg Arg 50 55 60 Leu Phe Gly His Met Asn Arg Leu Asn Pro His Trp Ala Ala Leu Gln 65 70 75 80 Gly Gly Ala Gln Ala Leu Leu Val Phe Gln Gly Pro Asn Gly Tyr Val 85 90 95 Ser Pro Thr Val Tyr Glu Tyr Thr Pro Ala Ala Pro Thr Trp Asp Phe 100 105 110 Thr Ala Val His Val Arg Gly Trp Leu Glu Pro Val Gly Asp Arg Glu 115 120 125 Ser Ser Leu Gln Ile Ile Thr Glu Thr Val Ala Ala Tyr Glu Arg Asp 130 135 140 Leu Gly Thr Gly Trp Asp Met Thr Glu Ser Leu Gly Tyr Phe Arg Gln 145 150 155 160 Leu Leu Pro Gly Val Gly Ala Phe Arg Leu Ala Ile Asp Thr Val Asp 165 170 175 Gly Met Phe Lys Leu Ser Gln Glu Gln Ser Pro Glu Val Arg Glu Arg 180 185 190 Val Ala Cys Glu Phe Ala Ala Arg Ala Glu Ala Arg Gly Thr Ala Leu 195 200 205 Ala Glu His Ile Gln Arg Thr Lys 210 215 92218PRTRhodococcus fascians 92Met Tyr Val Pro Arg Ile Tyr Lys Ala Ser Asp Arg Thr Trp Leu Arg 1 5 10 15 Arg Val Val Ala Gln Tyr Pro Phe Ala Ala Leu Ile Ser Asn Gly Pro 20 25 30 Lys Ala Pro Tyr Ala Thr His Leu Pro Val Ile Cys Ala Pro Cys Ala 35 40 45 Pro Ser Glu Ser Glu Asp Leu Glu Gly Ser Thr Leu Phe Gly His Met 50 55 60 Asn Arg Ala Asn Pro His Trp Asp Ser Leu Val Asp Gly Ala Asp Ala 65 70 75 80 Gln Leu Ile Phe Thr Gly Pro His Gly Tyr Val Thr Pro Ser Val Tyr 85 90 95 Gln Arg Asp Ser Val Ala Pro Thr Trp Asn Tyr Val Ser Val His Leu 100 105 110 Arg Gly Lys Leu Gln Pro Val Ala Asp Phe Glu Glu Thr Leu Lys Val 115 120 125 Val Gln Leu Thr Val Ser Thr Tyr Glu Gln Lys Phe Gly Ser Gly Trp 130 135 140 Glu Met Asp Ser Ser Leu Asp His Tyr Arg Arg Ile Gly Pro Ala Val 145 150 155 160 Gly Ala Phe Ser Phe Glu Val Glu Ser Ala Asp Gly Met Phe Lys Leu 165 170 175 Ser Gln Glu Gln Asn Leu Glu Thr Arg Arg Arg Val Ala Asp His Phe 180 185 190 Ser Ala Asn His Ala Gly Arg Gly Lys Glu Leu Ala Ser Phe Met Arg 195 200 205 Glu Tyr Ser His Gly Asp Tyr Asn Asn Phe 210 215 93231PRTStreptomyces neyagawaensis 93Met Phe Val Pro Asp Pro Tyr Arg Glu Pro Asp Gly Ser Trp Met Thr 1 5 10 15 Glu Leu Ile Arg Leu Asn Pro Phe Ala Leu Leu Val Ser Asn Gly Pro 20 25 30 Ala Asp Ala Asp Pro Tyr Ala Thr His Leu Pro Val Ile Arg Asp Pro 35 40 45 Glu Trp Thr Gly Ala Trp Thr Glu Asn Leu Ala Gly Gly Arg Leu Ile 50 55 60 Gly His Met Asn Arg Glu Asn Pro His Trp Thr Ala Leu Glu Asn Gly 65 70 75 80 Thr Pro Val Leu Ile Thr Phe Thr Gly Pro His Ala Tyr Val Ser Pro 85 90 95 Thr Val Tyr Asp Ile Thr Pro Ala Ala Pro Thr Trp Asp Phe Thr Ser 100 105 110 Val His Val His Gly Val Phe Glu Lys Ile Glu Ala Ala Ala Pro Gly 115 120 125 Glu Asp Ser Leu Glu Val Cys Lys Asp Thr Val Lys Ala Tyr Glu Arg 130 135 140 Asp Phe Gly Ala Ala Lys Ala Trp Asp Met Ser Arg Ser Ile Asp Tyr 145 150 155 160 Phe Ala Thr Ile Leu Pro Ala Val Gly Ala Phe Arg Val Glu Ile Thr 165 170 175 Gly Ala Glu Gly Met Phe Lys Leu Ser Gln Glu Gln Asp Glu Glu Ile 180 185 190 Arg Glu Arg Val Arg Glu Asp Phe Ala Leu Arg Asp Ser Ser Gln Tyr 195 200 205 Arg Glu Thr Ala Glu Leu Met Asp Arg Met Glu Lys Thr Gly Thr Ile 210 215 220 Lys Gly Cys Pro Val His His 225 230 94220PRTKutzneria buriramensis 94Met Phe Val Pro His His Tyr His Glu Pro Asn Glu Ser Trp Met Thr 1 5 10 15 Asp Leu Ile Arg Glu Asn Pro Leu Ala Glu Leu Val Ser Asn Gly Asn 20 25 30 Gly Pro Ala Gly Pro Phe Ala Thr His Val Pro Val Ile Pro Asp Pro 35 40 45 His Asp Pro Asp Arg Pro Pro Gly Glu Ile Val Gly Ala Thr Leu Trp 50 55 60 Gly His Met Asn Arg Ser Asn Pro His Trp Ala Ala Leu Glu Ser Glu 65 70 75 80 Thr Pro Val Val Ile Val Phe Thr Gly Pro His Ala Tyr Val Ser Pro 85 90 95 Thr Leu Tyr Gln Arg Thr Pro Ala Ala Pro Thr Trp Asn Phe Thr Ala 100 105 110 Val His Ala Arg Gly Leu Leu Arg Arg Val Asp Ala Glu Ala Ala Gly 115 120 125 Asp Glu Thr Leu Glu Thr Val Met Ala Thr Val Arg Ala Phe Glu Ala 130 135 140 Arg Phe Gly Ala Gly Trp Ala Met Ser Glu Ser Val Glu Tyr Phe Arg 145 150 155 160 Arg Ile Val Pro Ala Val Gly Ala Phe Arg Val Thr Val Ser His Val 165 170 175 Asp Gly Met Phe Lys Leu Ser Gln Glu Gln Asp Ala Asp Val Arg Ala 180 185 190 Arg Val Arg Glu Ser Phe Ala Glu Arg Glu Ser Ser Asn His Lys Ala 195 200 205 Ile Ala Ala Met Met Gly Arg Leu Ala Asp Ala Glu 210 215 220 95214PRTStreptomyces yanglinensis 95Met Phe Val Pro Ser Gln Tyr Arg Glu Pro Asp Val Ser Trp Met Val 1 5 10 15 Asp Leu Met Arg Asp Asn Pro Leu Ala Leu Met Ala Ser Asn Gly Thr 20 25 30 Ala Ala Asp Gly Pro Tyr Ala Thr His Leu Pro Val Ile Thr Asp Pro 35 40 45 Gly Trp Glu Gly Pro Pro Ala Ala Asp Leu Ala Gly Met Leu Leu Leu 50 55 60 Gly His Met Asn Arg Ala Asn Pro His Trp Ser Ala Leu Glu Asp Gly 65 70 75 80 Gln Thr Ile Leu Leu Thr Phe Thr Gly Pro His Ala Tyr Val Ser Pro 85 90 95 Thr Val Tyr Asp Ile Thr Pro Ala Ala Pro Thr Trp Asn Phe Thr Ser 100 105 110 Val His Val Arg Gly Thr Val Glu Lys Ile Ala Thr Thr Glu Glu Thr 115 120 125 Leu Glu Val Val Lys Ser Thr Val Arg Ala Tyr Glu Lys Glu Phe Gly 130 135 140 Asp Ser Trp Asp Met Asn Ala Ser Leu Asp Tyr Phe Arg Lys Ile Val 145 150 155 160 Pro Gly Val Gly Ala Phe His Val Arg Val Thr Arg Ala Glu Ala Met 165 170 175 Phe Lys Leu Ser Gln Glu Gln Ser Pro Glu Val Arg Asp Arg Val Val 180 185 190 Arg Ser Phe Ala Gly Arg Gly Cys Thr Arg His Ala Gln Ala Ala Asp 195 200 205 Leu Met Thr Arg Leu Pro 210 96214PRTStreptomyces griseochromogenes 96Met Phe Val Pro Ser His Tyr Arg Glu Pro Asp Val Ser Trp Met Val 1 5 10 15 Asp Leu Met Arg Gly Asn Pro Leu Ala Leu Met Ala Ser Asn Gly Thr 20 25 30 Pro Ala Asp Gly Pro Phe Ala Thr His Leu Pro Val Ile Thr Asp Pro 35 40 45 Gln Trp Glu Gly Ser Pro Thr Ala Asp Leu Ala Gly Met Pro Leu Leu 50 55 60 Gly His Met Asn Arg Ala Asn Pro His Trp Ala Ala Leu Glu Thr Gly 65 70 75 80 Ser Ala Ile Leu Leu Thr Phe Thr Gly Pro His Ala Tyr Val Ser Pro 85 90 95 Thr Val Tyr Asp Val Thr Pro Ala Ala Pro Thr Trp Asn Phe Thr Ser 100 105 110 Val His Val His Gly Val Val Glu Lys Ile Glu Ser Thr Glu Glu Thr 115 120 125 Leu Asp Val Val Gln Ala Thr Val Gln Ala Phe Glu Gly Glu Phe Gly 130 135 140 Asp Ser Trp Asp Met Ser Glu Ser Val Asp Tyr Phe Arg Lys Ile Val 145 150 155 160 Thr Gly Val Gly Ala Phe Arg Val Arg Val Thr Lys Ala Glu Gly Met 165 170 175 Phe Lys Leu Ser Gln Glu Gln Arg Pro Glu Ile Arg Glu Arg Val Val 180 185 190 Gln Ser Phe Ala Gly Arg Glu Cys Thr Arg His Val Gln Thr Ala Asp 195 200 205 Leu Met Asn Arg Leu Pro 210 97215PRTFrankia sp. AvcImisc_feature(75)..(75)Xaa can be any naturally occurring amino acid 97Met Phe Val Pro Cys His Tyr Arg Ala Pro Asn Val Ser Met Met Val 1 5 10 15 Asp Leu Met Arg Glu Asn Pro Leu Ala Leu Met Val Ser Asn Gly Ala 20 25 30 Pro Gly Ala Val Pro Phe Ala Thr His Leu Pro Val Ile Thr Asp Pro 35 40 45 Cys Trp Asp Gly Gln Ala Gly Pro Asp Leu Gly Gly Met Val Leu Leu 50 55 60 Gly His Leu Asn Arg Ala Asn Pro His Trp Xaa Ala Leu Glu Thr Gly 65 70 75 80 Ser Met Ile Leu Leu Thr Phe Thr Gly Pro His Ala Tyr Val Ser Pro 85 90 95 Thr Val Tyr Gly Leu Thr Pro Ala Ala Pro Thr Trp Asp Phe Thr Ser 100 105 110 Val His Val His Gly Val Val Glu Lys Leu Thr Thr Thr Glu Glu Thr 115 120 125 Leu Glu Val Val Arg Ala Thr Val Leu Ala Phe Glu Gln Glu Phe Gly 130 135 140 Asp Gly Trp Asp Met Thr Asp Ser Leu Gly Tyr Phe Arg Arg Ile Val 145 150 155 160 Pro Arg Val Gly Ala Phe Arg Leu Arg Val Thr Gly Ala Gln Gly Met 165 170 175 Phe Lys Leu Ser Gln Glu Gln Thr Pro Glu Ile Arg Glu Arg Val Ala 180 185 190 Arg Ser Phe Ala Ala His Gly Ser Thr Arg His Ala Gln Thr Ala Glu 195 200 205 Leu Ile Ser Arg Leu Pro His 210 215 98214PRTStreptomyces incarnatus 98Met Phe Val Pro Ser Phe Tyr Arg Glu Pro Asp Ser Ala Trp Met Val 1 5 10 15 Asp Leu Ile Arg Gly Asn Pro Leu Ala Leu Ala Val Thr Asn Gly Ser 20 25 30 Pro Glu Asp Gly Pro Phe Ala Thr His Leu Pro Val Ile Phe Asp Pro 35 40 45 Glu Thr Ser Gly Asp Trp Ser Gly Glu Leu Pro Gly Ala Thr Leu Leu 50 55 60 Gly His Met Asn Arg Ala Asn Pro His Trp Ala Ala Leu Glu Thr Gly 65 70 75 80 Ser Val Leu Leu Leu Thr Phe Thr Gly Pro His Ser Tyr Val Ser Pro 85 90 95 Thr Val Tyr Glu Thr Thr Pro Ala Ala Pro Thr Trp Asn Phe Thr Ala 100 105 110 Val His Val Arg Gly Val Val Glu Lys Ile Ser Ser Thr Glu Glu Thr 115 120 125 Leu Gly Val Val Gln Ser Thr Val Arg Ala Tyr Glu Gly Ala Phe Gly 130 135 140 Asp Gly Trp Asp Met Ser Glu Ser Leu Asp Tyr Phe Arg Lys Ile Val 145 150 155 160 Pro Ala Val Gly Ala Phe Arg Phe Thr Val Thr Gly Ala Glu Gly Met 165

170 175 Phe Lys Leu Ser Gln Glu Gln Pro Gly Glu Val Arg Glu Arg Val Arg 180 185 190 Asp Ala Phe Gly Gln Ser Gly Cys Ala Tyr Arg Arg Glu Val Ala Gly 195 200 205 Leu Met Ser Arg Leu Pro 210 99214PRTStreptomyces sp. MUSC136T 99Met Phe Val Pro Pro Gln Tyr Arg Glu Pro Asp Gly Ser Trp Met Val 1 5 10 15 Asp Leu Met Arg Arg Asn Pro Leu Ala Leu Cys Val Thr Asn Gly Asp 20 25 30 Ala Ala Asp Gly Pro Tyr Ala Thr His Leu Pro Val Ile Arg Asp Pro 35 40 45 Gly Met Thr Gly Glu Trp Ala Glu Asp Leu Ser Gly Gly Thr Leu Leu 50 55 60 Gly His Met Asn Leu Gln Asn Pro His Trp Ala Ala Leu Arg Asp Gly 65 70 75 80 Gln Ser Val Leu Leu Val Phe Thr Gly Pro His Ala Tyr Val Ser Pro 85 90 95 Thr Val Tyr Glu Lys Ser Pro Ala Ala Pro Thr Trp Asp Phe Thr Ala 100 105 110 Val His Val His Gly Thr Val Glu Lys Leu Thr Ser Ala Gln Asp Thr 115 120 125 Leu Asp Val Val Lys Ser Thr Val Arg Ala Phe Glu Ser Asp Leu Gly 130 135 140 Thr Gly Trp Asp Met Thr Glu Ser Glu Ala Tyr Phe Asp Gln Leu Leu 145 150 155 160 Pro Gly Val Gly Ala Phe Arg Val Glu Val Thr Gly Ala Glu Gly Met 165 170 175 Phe Lys Leu Ser Gln Glu Gln Gln Pro His Val Arg Asp Arg Val His 180 185 190 Asp Ala Phe Ala Glu Arg Pro Cys Gly Arg His Arg Glu Thr Ala Glu 195 200 205 Leu Met Ala Arg Leu Pro 210 100216PRTStreptomyces albulus 100Met Phe Val Pro Pro Glu Tyr Arg Pro Asp Asp Pro Glu Trp Leu Ile 1 5 10 15 Glu Val Ile Arg Ser His Pro Leu Ala Cys Leu Val Thr Asn Gly Pro 20 25 30 Asp Gly Pro Arg Ala Ser His Val Pro Val Ile Pro Asp Pro Glu Gln 35 40 45 Phe Pro Ser Gly Met Pro Ala Arg Glu Gly Glu Val Ala Gly Arg Arg 50 55 60 Leu Phe Gly His Met Asn Arg Leu Asn Pro His Trp Ala Ala Leu Gln 65 70 75 80 Gly Gly Ala Gln Ala Leu Leu Val Phe Gln Gly Pro Asn Gly Tyr Val 85 90 95 Ser Pro Thr Val Tyr Glu Tyr Thr Pro Ala Ala Pro Thr Trp Asp Phe 100 105 110 Thr Ala Val His Val Arg Gly Trp Leu Glu Pro Val Gly Asp Arg Glu 115 120 125 Ser Ser Leu Gln Ile Ile Thr Glu Thr Val Ala Ala Tyr Glu Arg Asp 130 135 140 Leu Gly Thr Gly Trp Asp Met Thr Glu Ser Leu Gly Tyr Phe Arg Gln 145 150 155 160 Leu Leu Pro Gly Val Gly Ala Phe Arg Leu Ala Ile Asp Thr Val Asp 165 170 175 Gly Met Phe Lys Leu Ser Gln Glu Gln Ser Pro Glu Val Arg Glu Arg 180 185 190 Val Ala Cys Glu Phe Ala Ala Arg Ala Glu Ala Arg Gly Thr Ala Leu 195 200 205 Ala Glu His Ile Gln Arg Thr Lys 210 215 101214PRTStreptomyces tsukubaensis 101Met Phe Val Pro Ser Met Tyr Arg Ala Pro Asp Ser Ser Trp Met Val 1 5 10 15 Asn Leu Ile Arg Glu Asn Pro Leu Ala Leu Ala Val Ala Asn Gly Ser 20 25 30 Pro Glu Asn Gly Pro Phe Ala Thr His Leu Pro Val Val Phe Asp Pro 35 40 45 Glu Thr Ser Ala Asp Pro Ala Gly Glu Leu Pro Gly Thr Thr Leu Leu 50 55 60 Gly His Met Asn Arg Ala Asn Pro His Trp Ala Ala Leu Glu Thr Gly 65 70 75 80 Ser Val Leu Leu Leu Thr Phe Thr Gly Pro Asn Ser Tyr Val Ser Pro 85 90 95 Ser Val Tyr Gly Val Thr Pro Ala Ala Pro Thr Trp Asn Phe Thr Ala 100 105 110 Val His Val Arg Gly Val Val Glu Lys Ile Ser Ser Leu Glu Glu Ser 115 120 125 Leu Asp Val Val Gln Ser Thr Val Arg Ala Phe Glu Gly Ala Phe Gly 130 135 140 Asn Gly Trp Asp Met Thr Glu Ser Leu Gly Tyr Phe Arg Arg Ile Ala 145 150 155 160 Pro Ala Val Gly Ala Phe Arg Leu Thr Val Thr Gly Ala Glu Gly Met 165 170 175 Phe Lys Leu Ser Gln Glu Gln Pro Gly Asp Val Arg Arg Arg Val Arg 180 185 190 Glu Ser Phe Gly Gln Ser Ala Cys Arg Tyr Arg Arg Glu Thr Ala Gly 195 200 205 Leu Met Ser Arg Leu Pro 210 102214PRTStreptomyces himastatinicus 102Met Phe Val Pro Ser His Tyr Arg Glu Pro Asp Ser Ser Trp Met Val 1 5 10 15 Asp Ile Ile Arg Gly Asn Pro Leu Ala Leu Met Met Ser Asn Gly Ala 20 25 30 Ala Gly Glu Pro Pro Phe Ala Thr His Leu Pro Val Ile Pro Asp Pro 35 40 45 Ala Met Thr Gly Asp Trp Ser Glu Arg Leu Ser Glu Ala Thr Leu Leu 50 55 60 Gly His Met Asn Arg Asp Asn Pro Gln Trp Gln Ala Leu Glu Asp Gly 65 70 75 80 Ala Val Val Arg Ile Ala Phe Ser Gly Pro His Ala Tyr Val Ser Pro 85 90 95 Thr Leu Tyr Gly Val Thr Pro Ala Ala Pro Thr Trp Asn Phe Thr Ser 100 105 110 Val His Val Arg Gly Val Val Glu Arg Ile Pro Ser Thr Glu Glu Thr 115 120 125 Leu Glu Val Val Lys Ser Thr Val Arg Ala Phe Glu Ala Asp Phe Gly 130 135 140 Glu Gly Trp Asp Met Ala Ala Ser Ile Asp Tyr Phe Arg Lys Ile Val 145 150 155 160 Pro Gly Val Gly Ala Phe Arg Ile Met Val Arg Asn Val Asp Gly Met 165 170 175 Phe Lys Leu Ser Gln Glu Gln Gln Pro Glu Val Arg Asp Arg Val Arg 180 185 190 Lys Ser Phe Ala Gly Arg Glu Cys Gly Arg His Gln Glu Thr Ala Ala 195 200 205 Tyr Met Ser Arg Leu Pro 210 103231PRTStreptomyces flaveolus 103Met Tyr Glu Arg Pro Leu Tyr Arg Glu Asp Cys Asp Gly Val Val Leu 1 5 10 15 Ala Phe Leu Arg His Asn Pro Leu Ala Met Val Val Thr Ser His Asp 20 25 30 Asp Val Pro Val Ala Thr His Ala Pro Val Leu Phe Arg His Gly Pro 35 40 45 Asp Gly Ala Asp Ala Glu Ala Val Ala Ala Gly Thr Val Pro Leu Ala 50 55 60 Gly Ser Thr Leu Ile Gly His Met Asn Val Glu Asn Pro Gln Trp Arg 65 70 75 80 Arg Met Arg Ser Gly Asp Arg Ala Leu Ile Val Phe Gln Gly Pro His 85 90 95 Gly Tyr Val Ser Pro Thr Val Tyr Gly Val Thr Pro Ala Ala Pro Thr 100 105 110 Trp Asp Phe Ile Ala Val His Val Asn Gly Thr Val Glu Pro Thr Ala 115 120 125 Asp Pro Ala Ala Val Leu Asp Ile Val Ser Asp Thr Ala Arg Arg Leu 130 135 140 Glu Ser Gly Phe Gly Arg Gly Trp Asp Gln Glu Ser Ser Leu Asp Tyr 145 150 155 160 Phe Arg Gln Ile Ala Pro Gly Val Gly Ala Phe Thr Leu Arg Val Asp 165 170 175 Ser Val Gln Thr Met Phe Lys Leu Ser Gln Glu Lys Pro Ala Pro Met 180 185 190 Arg Arg Arg Val Val Glu Gln Phe Glu Ala Ser Glu Ser Gly Thr His 195 200 205 Arg Ala Leu Ala Ser Val Met Arg Asp Arg Gly Leu Thr Glu Ala Asp 210 215 220 Glu Glu Arg Glu Thr Ala Gly 225 230 104214PRTStreptomyces auranticaus 104Met Phe Val Pro Ser Gln Tyr Arg Gln Pro Asp Ser Ser Trp Met Leu 1 5 10 15 Asp Leu Ile His Gly Asn Pro Leu Ala Leu Phe Val Ser Asn Gly Ser 20 25 30 Pro Glu Ala Gly Pro Phe Ala Thr His Leu Pro Val Ile Gln Asp Pro 35 40 45 Glu Trp Thr Gly Glu Trp Ser Asp Asp Leu Ser Gly Gly Arg Leu Leu 50 55 60 Gly His Met Asn Arg Ala Asn Pro His Trp Lys Ala Leu Glu Ser Gly 65 70 75 80 Thr Val Asn Leu Leu Thr Phe Thr Gly Pro His Gly Tyr Val Ser Pro 85 90 95 Thr Val Tyr Arg Thr Thr Pro Ala Ala Pro Thr Trp Asn Phe Thr Ser 100 105 110 Val His Val His Gly Val Val Glu Lys Ile Asp Gly Ile Glu Asn Thr 115 120 125 Leu Glu Val Val Lys Ala Thr Val Arg Ala Tyr Glu Gly Ala Phe Gly 130 135 140 Ala Gly Trp Asp Met Thr Glu Ser Leu Asp Tyr Phe Arg Lys Ile Val 145 150 155 160 Pro Ala Val Gly Ala Phe Gln Phe Arg Val Thr Gly Ala Glu Gly Met 165 170 175 Phe Lys Leu Ser Gln Glu Gln Pro Asp Asp Val Gln Glu Arg Val Arg 180 185 190 Glu Ser Phe Gly Gly Arg Glu Cys Thr Arg His Gln Ala Ala Ala Gln 195 200 205 Leu Met Asp Lys Leu Arg 210 105223PRTStreptomyces sp. RJA2928 105Met Phe Val Pro Gln His Tyr Arg Thr Asp Asp Arg Arg Trp Pro Val 1 5 10 15 Arg Ile Val Gln Asp Asn Pro Leu Ala Leu Leu Met Ser Thr Arg Asp 20 25 30 Gly Arg Ala Pro Phe Ala Ser His Val Pro Val Ile Val Leu Pro Arg 35 40 45 Gln Arg Glu Glu Leu Glu Arg Thr Gly Arg Trp Gln Gly Ala Val Leu 50 55 60 His Gly His Met Asn Arg Ala Asn Pro His Trp Lys Ser Leu Ala Asp 65 70 75 80 Gly Gln Pro Ala Gly Leu Val Phe Gln Gly Pro Ala Gly Tyr Val Ser 85 90 95 Pro Ala Val Tyr Asn Thr Ser Pro Ala Val Pro Thr Trp Asn Phe Thr 100 105 110 Ala Val His Val Gln Gly Arg Leu Lys Leu Val Ala Asp Glu Glu Ala 115 120 125 Thr Leu Gly Val Val Ser Ala Thr Ala Arg Gln Leu Glu Glu Arg Phe 130 135 140 Gly Ala Arg Trp Thr Val Glu Pro Ser Val Asp His Phe Arg Gln Ile 145 150 155 160 Leu Pro Gly Val Gly Ala Phe Glu Leu Arg Val Glu Glu Cys Asp Ser 165 170 175 Met Phe Lys Leu Ser Gln Glu Lys Glu His Glu Val Arg His Ala Val 180 185 190 Met Asp Trp Cys Ala Arg Ser Pro Arg Gly Arg Ser Asn Asp Leu Ala 195 200 205 Ala Val Met Arg Asp Tyr Tyr Pro Pro Thr Thr Thr Trp Pro Ser 210 215 220 106215PRTFrankia alni str. ACN14A 106Met Phe Val Pro Cys His Tyr Arg Ala Pro Asn Val Ser Met Met Val 1 5 10 15 Asp Leu Met Arg Glu Asn Pro Leu Ala Leu Met Val Ser Asn Gly Ala 20 25 30 Pro Gly Ala Val Pro Phe Ala Thr His Leu Pro Val Ile Thr Asp Pro 35 40 45 Cys Trp Asp Gly Gln Ala Gly Pro Asp Leu Gly Gly Met Val Leu Leu 50 55 60 Gly His Leu Asn Arg Ala Asn Pro His Trp Ala Ala Leu Glu Thr Gly 65 70 75 80 Ser Met Ile Leu Leu Thr Phe Thr Gly Pro His Ala Tyr Val Ser Pro 85 90 95 Thr Val Tyr Gly Leu Thr Pro Ala Ala Pro Thr Trp Asp Phe Thr Ser 100 105 110 Val His Val His Gly Val Val Glu Lys Leu Thr Thr Thr Glu Glu Thr 115 120 125 Leu Glu Val Val Arg Ala Thr Val Leu Ala Phe Glu Gln Glu Phe Gly 130 135 140 Asp Gly Trp Asp Met Thr Asp Ser Leu Gly Tyr Phe Arg Arg Ile Val 145 150 155 160 Pro Arg Val Gly Ala Phe Arg Leu Arg Val Thr Gly Ala Gln Gly Met 165 170 175 Phe Lys Leu Ser Gln Glu Gln Thr Pro Glu Ile Arg Glu Arg Val Ala 180 185 190 Arg Ser Phe Ala Ala His Gly Ser Thr Arg His Ala Gln Thr Ala Glu 195 200 205 Leu Ile Ser Arg Leu Pro His 210 215 107218PRTActinosynnema mirum 107Met His Val Pro Pro Met Tyr Arg Ala Asp Asp Glu Asp Arg Ala Arg 1 5 10 15 Gln Val Val His Asp Tyr Pro Leu Ala Thr Leu Val Ser Asn Gly Pro 20 25 30 Arg Val Pro His Ala Thr His Leu Pro Val Val Ala Ala Pro Gly Ala 35 40 45 Pro Gln Val Gly Gly Leu Ala Gly Ser Thr Leu Trp Gly His Leu Asn 50 55 60 Arg Ala Asn Ala His Trp Arg Ala Leu Ala Gly Gly Val Pro Ala Val 65 70 75 80 Leu Val Phe Thr Gly Pro His Ala Tyr Ile Thr Pro Ala Ile Tyr Arg 85 90 95 Thr Thr Pro Ala Val Pro Thr Trp Asp Phe Val Ser Val His Leu His 100 105 110 Gly Arg Val Glu Pro Ile Asp Gly Glu Ala Gly Thr Leu Glu Val Val 115 120 125 Lys Arg Thr Ala Glu Leu Phe Glu Ser Ala Phe Gly Ala Gly Trp Ala 130 135 140 Ala Glu Pro Ser His Gly His Phe Ala Arg Ile Val Ser Gly Val Gly 145 150 155 160 Ala Phe Arg Phe His Val Glu Ser Val Asp Ser Met Phe Lys Leu Ser 165 170 175 Gln Glu Lys Asp Arg Asp Val Arg Val Arg Ile Ile Ala Ser Leu Arg 180 185 190 Glu Ala Ser Gly Pro Ala Ala Glu Leu Gly Arg Ile Met His Glu His 195 200 205 Gly Leu Gly Gly Arg Gly Ala Glu Gly Ala 210 215 108213PRTKutzneria sp. 744 108Met Phe Val Pro Gly Pro Tyr His Ala Pro Glu Asp Arg Trp Leu Val 1 5 10 15 Asp Leu Val Arg Gly His Pro Leu Ala Gln Leu Ala Ser Asn Gly Ala 20 25 30 Gly Gly Ala Ala Pro His Ile Thr His Val Pro Ile Ile Val Asp Pro 35 40 45 Glu Leu Asp Gly Pro Val Asp Arg Leu Val Gly Ile Thr Leu Trp Gly 50 55 60 His Met Asn Arg Ala Asn Pro His Trp Ala Ala Leu Gly Gly Ala Ala 65 70 75 80 Asn Val Val Ala Thr Phe Ala Gly Pro Asn Ala Tyr Val Ser Pro Ala 85 90 95 Val Tyr Arg Thr Ala Pro Ala Ala Pro Thr Trp Asn Phe Thr Ser Val 100 105 110 Gln Val Arg Gly Glu Leu Arg Lys Val Glu Ser Ala Asp Asp Thr Leu 115 120 125 Ala Thr Val Arg Ala Thr Val Ala Ala Leu Glu Ser Arg Phe Gly Ala 130 135 140 Gly Trp Asp Met Thr Gly Ser Leu Asp Tyr Phe Arg Arg Ile Leu Pro 145 150 155 160 Gly Val Gly Ala Phe Arg Leu Arg Val Ala Glu Ala Asp Gly Met Phe 165 170 175 Lys Leu Ser Gln Glu Gln Gln Pro Ala Ile Arg Arg Arg Val Arg His 180 185 190 Ser Phe Gly Gly Cys Glu Ala Thr Arg Ala Val Ala Gly Leu Met Asp 195 200 205 Arg Leu Pro Thr Glu 210 109214PRTKibdelosporangium sp. MJ126-NF4 109Met His Val Pro Pro Met Tyr Glu Ala Pro Asp Pro Ala Trp Ile Pro 1 5 10 15 Ala Leu Ile Arg Ala His Pro Leu Ala Thr Leu Val Thr Ala Pro Asp 20 25

30 Gly Ile Pro Ala Ala Ser His Val Pro Met Ile Ile Arg Arg Thr Pro 35 40 45 Asp Asp Glu Arg Leu Thr Leu Val Gly His Met Asn Arg Met Asn Pro 50 55 60 Gln Phe Lys Ala Ile Gly Asp Gly Cys Pro Ala Leu Leu Val Phe Thr 65 70 75 80 Gly Pro His Gly Tyr Val Ser Pro Thr Val Tyr Gly Phe Thr Pro Ala 85 90 95 Ala Pro Thr Trp Asn Phe Ala Val Val His Ala Ser Gly Thr Leu Ser 100 105 110 Pro Leu Pro Ala Gly Pro Asp Thr Leu Glu Val Ile Ile Asp Thr Val 115 120 125 Thr Ala Leu Glu Gly Gln Leu Gly Asn Gly Trp Gln Met Arg Asp Ser 130 135 140 Leu Glu Tyr Phe Asp Gln Leu Leu Pro Gly Val Gly Ala Phe Ser Val 145 150 155 160 Gln Val Asp Arg Val Glu Ala Met Tyr Lys Leu Ser Gln Glu Gln Glu 165 170 175 Pro Thr Thr Arg Glu Thr Val Ala Ala Ala Phe Glu Ala Arg Ser Ser 180 185 190 Asp Leu Ala Ala Met Met Arg Val Cys Leu Asp Val Glu Arg Ser Thr 195 200 205 Leu Gly Asn Arg Val Gly 210 110252PRTMycobacterium xenopi 110Met Leu Ser Leu Leu Pro Phe Arg Ala Gln Ala Ile Ala Gln Glu Ile 1 5 10 15 Ala Ala Ser Arg His Arg Asp Ala Val Thr Val Arg Gln Arg Pro Val 20 25 30 Gly Asp Tyr Pro Pro Lys Arg Tyr Leu Glu Thr Asp Pro Asp Arg Leu 35 40 45 Arg Ala Val Ile Glu Arg Tyr Arg Phe Ala Thr Leu Ile Ser Ala Arg 50 55 60 Ala Thr Asp Glu Pro Val Val Thr Gln Leu Pro Leu Thr Leu Asp Thr 65 70 75 80 Ser Arg Gly Ser His Gly Val Leu Phe Gly His Met Asp Leu Ala Asn 85 90 95 Pro His Ala Glu Leu Leu Asp Gly Arg Pro Val Leu Ala Leu Phe His 100 105 110 Gly Pro Asn Gly Tyr Ile Pro Pro His Gln Ser Asn Gln Leu Pro Thr 115 120 125 Trp Asn Ser Ile Thr Val Glu Val Arg Gly Arg Ala Arg Ile Leu Arg 130 135 140 Asp Lys Asp Ala Val Val Asp Gly Leu Arg Gly Ile Ala Ala Ala Ala 145 150 155 160 Asp Pro Ser Pro Gly Gly Phe Arg Leu Thr Arg Glu Ala Ala Ser Asp 165 170 175 Glu Arg Leu Phe Pro Phe Leu Val Gly Phe Glu Ile Asp Ile Asp Glu 180 185 190 Met Val Gly Arg Phe Lys Leu Ser Gln Asp Arg Asp Asp Arg Asp Arg 195 200 205 Trp Leu Ala Ala Arg Thr Leu Ala His Gly Leu Glu Gln Asp Asp Arg 210 215 220 Asp Leu Ile Ala Ser Ile Val Glu Leu Pro Leu Asp Arg Asp Asp Asp 225 230 235 240 Pro Ile Pro Leu Arg Arg Ala Arg Thr Ser Gly Thr 245 250 111214PRTStreptomyces mirabilis 111Met Phe Val Pro Ser Phe Tyr Arg Glu Pro Asp Ser Ser Trp Met Val 1 5 10 15 Asp Leu Ile Arg Gly Asn Pro Leu Ala Leu Ala Ala Ala Asn Gly Ser 20 25 30 Pro Glu Glu Gly Pro Phe Ala Thr His Leu Pro Val Ile Phe Asp Pro 35 40 45 Glu Thr Ser Gly Asp Trp Ser Gly Glu Leu Pro Gly Ala Thr Leu Leu 50 55 60 Gly His Met Asn Arg Ala Asn Pro His Trp Ala Ala Leu Ala Thr Gly 65 70 75 80 Ser Val Leu Leu Leu Thr Phe Thr Gly Pro His Ser Tyr Val Ser Pro 85 90 95 Thr Val Tyr Glu Val Thr Pro Ala Ala Pro Thr Trp Asn Phe Thr Ala 100 105 110 Val His Val Arg Gly Val Val Glu Lys Ile Asp Ser Ile Glu Glu Thr 115 120 125 Leu Gly Val Val Gln Ser Thr Val Arg Ala Phe Glu Gly Ala Phe Gly 130 135 140 Asp Gly Trp Asp Met Thr Glu Ser Leu Gly Tyr Phe Arg Lys Ile Val 145 150 155 160 Pro Asp Val Gly Ala Phe Arg Phe Thr Val Thr Gly Ala Glu Gly Met 165 170 175 Phe Lys Leu Ser Gln Glu Gln Pro Gly Glu Val Arg Glu Arg Val Arg 180 185 190 Glu Ser Phe Gly His Ser Ala Cys Ala Tyr Lys Arg Glu Thr Ala Gly 195 200 205 Leu Met Ser Arg Leu Pro 210 112214PRTStreptomyces scabrisporus 112Met Phe Val Pro Arg His Tyr Arg Glu Pro Asp Ser Ser Trp Met Val 1 5 10 15 Asp Leu Ile Arg Ala Asn Pro Leu Ala Leu Ala Val Met Asn Gly Asp 20 25 30 Pro Ser Ala Gly Pro Phe Ala Thr His Leu Pro Val Ile Pro Asp Pro 35 40 45 Gln Met Thr Pro Ser Trp Ser Asp Asp Leu Ser Gly Ala Thr Leu Leu 50 55 60 Gly His Met Asn Arg Ala Asn Pro His Trp Lys Ala Leu Glu Thr Gly 65 70 75 80 Thr Val Leu Leu Leu Thr Phe Thr Gly Pro His Gly Tyr Val Ser Pro 85 90 95 Thr Val Tyr Glu Val Thr Pro Ala Ala Pro Thr Trp Asn Phe Thr Ser 100 105 110 Val His Val Arg Gly Val Val Glu Arg Ile Asp Ser Leu Glu Glu Thr 115 120 125 Leu Gly Val Val Arg Ala Thr Ala Leu Ala Phe Glu Ser Glu Phe Gly 130 135 140 Ala Gly Trp Asp Gln Thr Glu Ser Val Asp Tyr Phe Arg Lys Ile Val 145 150 155 160 Pro Gly Val Gly Ala Phe Arg Val Thr Val Thr Gly Ala Glu Gly Met 165 170 175 Phe Lys Leu Ser Gln Glu Gln Pro Ala Glu Val Arg Glu Arg Val Arg 180 185 190 Gln Ser Phe Ser Thr Arg Ala Cys Ser Leu Gln Arg Glu Thr Ala Glu 195 200 205 Leu Met Thr Arg Leu Pro 210 113224PRTStreptomyces sp. TAA040 113Val Phe Val Pro Thr His Tyr Arg Glu Pro Asp Gly Ser Trp Met Ala 1 5 10 15 Asp Leu Met Arg Glu Asn Pro Leu Ala Leu Ala Val Thr Asp Gly Gly 20 25 30 Ala Gly Asp Gly Pro Phe Ala Thr His Leu Pro Val Val Pro Asp Pro 35 40 45 Gly Thr Thr Gly Asp Trp Pro Asn Gly Leu Lys Gly Ala Thr Leu Leu 50 55 60 Gly His Met Asn Arg Ala Asn Pro His Trp Arg Ala Leu Glu Thr Gly 65 70 75 80 Gly Val Val Leu Leu Ala Phe Thr Gly Pro His Ala Tyr Val Ser Pro 85 90 95 Thr Val Tyr Glu Val Thr Pro Ala Ala Pro Thr Trp Asn Phe Thr Ser 100 105 110 Val His Val Arg Gly Val Val Asp Arg Ile Asp Ser Pro Glu Glu Thr 115 120 125 Leu Asp Val Val Arg Thr Thr Ala Leu Val Tyr Glu Ala Arg Phe Gly 130 135 140 Ala Gly Trp Asp Gln Ala Ala Ser Leu Asp Tyr Phe Arg Arg Ile Val 145 150 155 160 Pro Ala Val Gly Ala Phe Arg Ile Ala Val Thr Ser Ala Glu Gly Met 165 170 175 Phe Lys Leu Ser Gln Glu Gln Pro Ala Glu Val Arg Glu Arg Val His 180 185 190 Arg Ser Phe Ser Gly Arg Glu Cys Gly Arg His Arg Asp Thr Ala Ala 195 200 205 Leu Met Glu Arg Leu Pro Arg Thr Gly Ala Glu Pro Pro Val Gly Arg 210 215 220 114243PRTActinoalloteichus cyanogriseus 114Met Phe Val Pro His Gln Tyr Arg Ala Ala Asp Thr Arg Pro Leu Val 1 5 10 15 Glu Leu Ile Arg Ser Phe Pro Leu Ala Thr Leu Val Ser His Ala Asp 20 25 30 Gly Ala Leu Phe Ala Thr His Val Pro Val Leu Leu Ala Ala Asp Ala 35 40 45 Asp Ala Gly Arg Asp Val Pro Asp Pro Ala Asp Leu Thr Ile Leu Gly 50 55 60 His Leu Asn Arg Leu Asn Pro His Arg Asp Ala Leu Ala Gly Gly Gly 65 70 75 80 Ala Cys Leu Leu Thr Phe Thr Gly Pro His Ser Tyr Val Ser Pro Ala 85 90 95 His Tyr Gly Arg Asp Thr Ala Ala Pro Thr Trp Asn Phe Thr Ser Val 100 105 110 His Val His Gly His Leu Thr Pro Leu Asp Ser Thr Glu Asp Thr Arg 115 120 125 His Val Val Arg Ser Thr Ala Leu Leu Tyr Glu Arg Arg Phe Gly Ala 130 135 140 Gly Trp Asp Met Thr Gly Ser Leu Asp Tyr Phe Glu Gln Leu Leu Pro 145 150 155 160 Gly Val Ser Ala Phe Arg Val Asp Val Gly Thr Val Glu Gly Met Phe 165 170 175 Lys Leu Gly Gln Glu Gln Pro Gly His Ala Arg Gln Gly Val Leu Ala 180 185 190 Ala Phe Thr Ser Pro Gly Ala Pro Pro His Gln Arg Ala Val Ala Glu 195 200 205 Leu Met Arg Arg Phe Pro Pro Asp Ala Ala Gly Gly Val Pro Gly Cys 210 215 220 Pro Ala Gln Ser Ala Ala Arg Met Ser Pro Pro Ala Asp Ala Ile Arg 225 230 235 240 Gly Glu His 115214PRTStreptomyces sp. HNS054 115Met Phe Val Pro Asn Phe Tyr Arg Glu Pro Asp Ala Ser Trp Met Val 1 5 10 15 Asp Leu Val Arg Gly Asn Pro Leu Ala Leu Ala Val Ser Asn Gly Cys 20 25 30 Pro Glu Asp Gly Pro Phe Ala Thr His Leu Pro Val Ile Phe Asp Pro 35 40 45 Ala Arg Tyr Gly Asp Leu Pro Gly Glu Leu Ala Gly Ala Thr Leu Leu 50 55 60 Gly His Met Asn Arg Ala Asn Pro His Trp Pro Ala Leu Gln Thr Gly 65 70 75 80 Gly Ile Leu Leu Leu Thr Phe Thr Gly Pro His Ser Tyr Val Ser Pro 85 90 95 Thr Ala Tyr Gly Thr Thr Pro Ala Ala Pro Thr Trp Asn Phe Thr Ala 100 105 110 Val His Ala Arg Gly Val Val Glu Lys Ile Asp Ser Thr Glu Glu Thr 115 120 125 Leu Asp Val Val Lys Ala Thr Val Arg Ala Tyr Glu Gly Glu Phe Gly 130 135 140 Asp Gly Trp Asp Met Thr Glu Ser Leu Gly Tyr Phe Arg Lys Ile Val 145 150 155 160 Pro Ala Val Gly Ala Phe Arg Leu Thr Val Thr Arg Ala Glu Gly Met 165 170 175 Phe Lys Leu Ser Gln Glu Gln Pro Ala Glu Val Arg Glu Arg Val Arg 180 185 190 Glu Ser Phe Glu Gln Ser Ala Cys Arg Tyr Lys Arg Glu Thr Ala Gly 195 200 205 Leu Met Ser Arg Leu Pro 210 116238PRTStreptomyces sp. AW19M42 116Met Tyr Val Pro Asp His Tyr Gln Gly Ser Pro Glu Ala Ala Leu Thr 1 5 10 15 Val Val Arg Ala Gly Pro Leu Ala Thr Leu Val Thr Gly Ala Asp Pro 20 25 30 Trp Pro Leu Ala Thr His Leu Pro Val Val Val Pro Ala Asp Val Glu 35 40 45 Ala Ala Leu Glu His Gly Pro Val Asp Leu Arg Gly His Arg Leu Ile 50 55 60 Gly His Leu Asn Arg Ala Asn Pro His Trp Arg Gln Leu Ser Ala Gly 65 70 75 80 Glu Gln Pro Ser Leu Leu Ile Phe Arg Gly Pro His Gly Tyr Ile Ser 85 90 95 Pro Val Val Tyr Glu Ser Thr Pro Ala Ala Pro Thr Trp Asn Phe Thr 100 105 110 Ala Val His Val His Gly Thr Ile Arg Pro Leu Pro Ala Gly Lys Glu 115 120 125 Thr Leu Asp Val Ile His Arg Thr Val Glu Val Leu Glu Gly Gly Phe 130 135 140 Gly His Gly Trp Asp Met Arg Gly Ser Leu Glu Tyr Phe Glu Lys Ile 145 150 155 160 Val Pro His Val Gly Ala Phe Glu Phe Gln Val Ala Glu Val Asp Gly 165 170 175 Met Phe Lys Leu Ser Gln Glu Leu Asp Glu Glu Thr Arg Glu Arg Thr 180 185 190 Thr His His Phe Ala Thr Ser Ala His Gly Thr His Arg Glu Leu Ala 195 200 205 Cys Glu Met Ala Arg Leu Ser Thr Ala Ala Glu Thr Lys Asp Gly Ala 210 215 220 Ser Glu Gly Ala Ser Gly Ser Ser Ser Lys Arg Gly Thr Ala 225 230 235 117221PRTSalinispora pacifica 117Met Phe Val Pro Ser Pro Tyr Arg Glu Pro Asp Gly Ser Trp Thr Val 1 5 10 15 Asp Leu Met Arg Arg Asn Pro Leu Ala Leu Leu Val Thr Ser Ser Asp 20 25 30 Lys Thr Asp Val Pro Tyr Ala Thr His Leu Pro Val Ile Phe Asp Pro 35 40 45 Cys Met Pro Glu Glu Asp Tyr Ser Asp Pro Ala Arg Phe Val Leu Leu 50 55 60 Gly His Met Asn Arg Ala Asn Pro His Trp Lys Ala Leu Ala Thr Gly 65 70 75 80 Met Pro Thr Leu Val Val Phe Ser Gly Ser His Ala Tyr Val Ser Pro 85 90 95 Thr Val Tyr Asp Lys Ser Pro Ala Ala Pro Thr Trp Asn Phe Thr Ala 100 105 110 Ala His Ala Arg Gly Val Leu Glu Lys Ile Glu Ser Ala Glu Glu Thr 115 120 125 Leu Gly Val Ile Gly Ser Thr Val Arg Ala Phe Glu Ala Asp Phe Gly 130 135 140 Thr Asp Trp Asp Met Thr Gln Ser Val Gly Tyr Phe Arg Lys Ile Leu 145 150 155 160 Pro Gly Val Gly Ala Phe Arg Ile Ala Val Ser Ser Ile Asp Ser Met 165 170 175 Phe Lys Leu Ser Gln Glu Gln Pro Pro Glu Val Arg Asp Arg Val Gly 180 185 190 Cys Ala Phe Ala Glu Ser Ala Ser Thr Arg His Arg Glu Val Ala Gly 195 200 205 Leu Met Asn Arg Leu Ala Val Pro Lys Gln Val Thr Val 210 215 220 118221PRTSalinispora pacifica 118Met Phe Val Pro Ser Pro Tyr Arg Glu Pro Asp Gly Ser Trp Thr Val 1 5 10 15 Asp Leu Met Arg Arg Asn Pro Leu Ala Leu Leu Val Thr Ser Ser Asp 20 25 30 Lys Thr Asp Val Pro Tyr Ala Thr His Leu Pro Val Ile Phe Asp Pro 35 40 45 Cys Met Pro Glu Glu Asp Tyr Ser Asp Pro Ala Arg Phe Val Leu Leu 50 55 60 Gly His Met Asn Arg Ala Asn Pro His Trp Lys Ala Leu Ala Thr Gly 65 70 75 80 Met Pro Thr Leu Val Val Phe Ser Gly Ser His Ala Tyr Val Ser Pro 85 90 95 Thr Val Tyr Asp Lys Ser Pro Ala Ala Pro Thr Trp Asn Phe Thr Ala 100 105 110 Ala His Ala Arg Gly Val Leu Glu Lys Ile Glu Ser Ala Glu Glu Thr 115 120 125 Leu Gly Val Ile Gly Ser Thr Val Arg Ala Phe Glu Ala Asp Phe Gly 130 135 140 Thr Asp Trp Asp Met Thr Gln Ser Val Gly Tyr Phe Arg Lys Ile Leu 145 150 155 160 Pro Gly Val Gly Ala Phe Arg Ile Ala Val Ser Ser Ile Asp Ser Met 165 170 175 Phe Lys Leu Ser Gln Glu Gln Pro Pro Glu Val Arg Asp Arg Val Gly 180 185 190 Cys Ala Phe Ala Glu Ser Ala Ser Thr Arg His Arg Glu Val Ala Gly 195 200 205 Leu Met Asn Arg Leu Ala Val Pro Lys Gln Val Thr Val 210 215 220 119221PRTSalinispora tropica 119Met Phe Val Pro Ser Pro Tyr Arg Glu Pro Asp Gly Ser Trp Thr Val 1 5 10 15 Asp Leu Met Arg Arg Asn Pro Leu Ala Leu Leu Val Thr Ser Ser Asp

20 25 30 Lys Thr Asp Ile Pro Tyr Ala Thr His Leu Pro Val Ile Phe Asp Pro 35 40 45 Arg Met Pro Glu Glu Asp Tyr Ser Asp Pro Ala Arg Phe Val Leu Leu 50 55 60 Gly His Met Asn Arg Ala Asn Pro His Trp Lys Ala Leu Ala Thr Gly 65 70 75 80 Met Pro Thr Leu Val Val Phe Ser Gly Ser His Ala Tyr Val Ser Pro 85 90 95 Thr Val Tyr Asp Lys Ser Pro Ala Ala Pro Thr Trp Asn Phe Thr Ala 100 105 110 Ala His Ala Arg Gly Val Leu Glu Lys Ile Glu Ser Ala Glu Glu Thr 115 120 125 Leu Gly Val Ile Gly Ser Thr Val Arg Ala Phe Glu Ala Asp Phe Gly 130 135 140 Ala Asp Trp Asp Met Ala Gln Ser Val Gly Tyr Phe Arg Lys Ile Leu 145 150 155 160 Pro Gly Val Gly Ala Phe Arg Ile Ala Val Ser Ser Ile Asp Ser Met 165 170 175 Phe Lys Leu Ser Gln Glu Gln Ser Pro Glu Val Arg Asp Arg Val Gly 180 185 190 Cys Ala Phe Ala Glu Ser Ala Ser Thr Arg His Arg Glu Val Ala Asp 195 200 205 Leu Met Asn Arg Leu Ala Val Pro Lys Gln Val Thr Val 210 215 220 120221PRTSalinispora arenicola 120Met Phe Val Pro Ser Pro Tyr Arg Glu Pro Asp Gly Ser Trp Thr Val 1 5 10 15 Asp Leu Met Arg Arg Asn Pro Leu Ala Leu Leu Val Thr Ser Ser Asp 20 25 30 Lys Thr Asp Val Pro Tyr Ala Thr His Leu Pro Val Ile Phe Asp Pro 35 40 45 Cys Met Pro Glu Glu Asp Tyr Ser Asp Pro Ala Arg Phe Val Leu Leu 50 55 60 Gly His Met Asn Arg Ala Asn Pro His Trp Lys Ala Leu Ala Thr Gly 65 70 75 80 Met Pro Thr Leu Val Val Phe Ser Gly Ser His Ala Tyr Val Ser Pro 85 90 95 Thr Val Tyr Asp Lys Ser Pro Ala Ala Pro Thr Trp Asn Phe Thr Ala 100 105 110 Ala His Ala Arg Gly Val Leu Glu Lys Ile Glu Ser Ala Glu Glu Ala 115 120 125 Leu Gly Val Ile Gly Ser Thr Val Arg Ala Phe Glu Ala Asp Phe Gly 130 135 140 Thr Asp Trp Asp Met Thr Gln Ser Val Gly Tyr Phe Arg Lys Ile Leu 145 150 155 160 Pro Gly Val Gly Ala Phe Arg Ile Ala Val Ser Ser Ile Asp Ser Met 165 170 175 Phe Lys Leu Ser Gln Glu Gln Pro Pro Glu Val Arg Asp Arg Val Gly 180 185 190 Cys Ala Phe Ala Glu Ser Ala Ser Thr Arg His Arg Glu Val Ala Gly 195 200 205 Leu Met Asn Arg Leu Ala Val Pro Lys Arg Val Thr Val 210 215 220 121221PRTSalinispora arenicola 121Met Phe Val Pro Ser Pro Tyr Arg Glu Pro Asp Gly Ser Trp Thr Val 1 5 10 15 Asp Leu Met Arg Arg Asn Pro Leu Ala Leu Leu Val Thr Ser Ser Asp 20 25 30 Lys Thr Asp Val Pro Tyr Ala Thr His Leu Pro Val Ile Phe Asp Pro 35 40 45 Cys Met Pro Glu Glu Asp Tyr Ser Asp Pro Ala Arg Phe Val Leu Leu 50 55 60 Gly His Met Asn Arg Ala Asn Pro His Trp Lys Ala Leu Ala Thr Gly 65 70 75 80 Met Pro Thr Leu Val Val Phe Ser Gly Ser His Ala Tyr Val Ser Pro 85 90 95 Thr Val Tyr Asp Lys Ser Pro Ala Ala Pro Thr Trp Asn Phe Thr Ala 100 105 110 Ala His Ala Arg Gly Val Leu Glu Lys Ile Glu Ser Ala Glu Glu Ala 115 120 125 Leu Gly Val Ile Gly Ser Thr Val Arg Ala Phe Glu Ala Asp Phe Gly 130 135 140 Thr Asp Trp Asp Met Thr Gln Ser Val Gly Tyr Phe Arg Lys Ile Leu 145 150 155 160 Pro Gly Val Gly Ala Phe Arg Ile Ala Val Ser Ser Ile Asp Ser Met 165 170 175 Phe Lys Leu Ser Gln Glu Gln Pro Pro Glu Val Arg Asp Arg Val Gly 180 185 190 Cys Ala Phe Ala Glu Ser Ala Ser Thr Arg His Arg Glu Val Ala Gly 195 200 205 Leu Met Asn Arg Leu Ala Val Pro Lys Arg Val Thr Val 210 215 220 122221PRTSalinispora tropica 122Met Phe Val Pro Ser Pro Tyr Arg Glu Pro Asp Gly Ser Trp Thr Val 1 5 10 15 Asp Leu Met Arg Arg Asn Pro Leu Ala Leu Leu Val Thr Ser Ser Asp 20 25 30 Lys Thr Asp Ile Pro Tyr Ala Thr His Leu Pro Val Ile Phe Asp Pro 35 40 45 Arg Met Pro Glu Glu Asp Tyr Ser Asp Pro Ala Arg Phe Val Leu Leu 50 55 60 Gly His Met Asn Arg Ala Asn Pro His Trp Lys Ala Leu Ala Thr Gly 65 70 75 80 Met Pro Thr Leu Val Val Phe Ser Gly Ser His Ala Tyr Val Ser Pro 85 90 95 Thr Val Tyr Asp Lys Ser Pro Ala Ala Pro Thr Trp Asn Phe Thr Ala 100 105 110 Ala His Ala Arg Gly Val Leu Glu Lys Ile Glu Ser Ala Glu Glu Thr 115 120 125 Leu Gly Val Ile Gly Ser Thr Val Arg Ala Phe Glu Ala Asp Phe Gly 130 135 140 Thr Asp Trp Asp Met Ala Gln Ser Val Gly Tyr Phe Arg Lys Ile Leu 145 150 155 160 Pro Gly Val Gly Ala Phe Arg Ile Ala Val Ser Ser Ile Asp Ser Met 165 170 175 Phe Lys Leu Ser Gln Glu Gln Ser Pro Glu Val Arg Asp Arg Val Gly 180 185 190 Cys Ala Phe Ala Glu Ser Ala Ser Thr Arg His Arg Glu Val Ala Asp 195 200 205 Leu Met Asn Arg Leu Ala Val Pro Lys Gln Val Thr Val 210 215 220 123221PRTSalinispora tropica 123Met Phe Val Pro Ser Pro Tyr Arg Glu Pro Asp Gly Ser Trp Thr Val 1 5 10 15 Asp Leu Met Arg Arg Asn Pro Leu Ala Leu Leu Val Thr Ser Ser Asp 20 25 30 Lys Thr Asp Ile Pro Tyr Ala Thr His Leu Pro Val Ile Phe Asp Pro 35 40 45 Arg Met Pro Glu Glu Asp Tyr Ser Asp Pro Ala Arg Phe Val Leu Leu 50 55 60 Gly His Met Asn Arg Ala Asn Pro His Trp Lys Ala Leu Ala Thr Gly 65 70 75 80 Met Pro Thr Leu Val Val Phe Ser Gly Ser His Ala Tyr Val Ser Pro 85 90 95 Thr Val Tyr Asp Lys Ser Pro Ala Ala Pro Thr Trp Asn Phe Thr Ala 100 105 110 Ala His Ala Arg Gly Val Leu Glu Lys Ile Glu Ser Ala Glu Glu Thr 115 120 125 Leu Gly Val Ile Gly Ser Thr Val Arg Ala Phe Glu Ala Asp Phe Gly 130 135 140 Thr Asp Trp Asp Met Ala Gln Ser Val Gly Tyr Phe Arg Lys Ile Leu 145 150 155 160 Pro Gly Val Gly Ala Phe Arg Ile Ala Val Ser Ser Ile Asp Ser Met 165 170 175 Phe Lys Leu Ser Gln Glu Gln Ser Pro Glu Val Arg Asp Arg Val Gly 180 185 190 Cys Ala Phe Ala Glu Ser Ala Ser Thr Arg His Arg Glu Val Ala Asp 195 200 205 Leu Met Asn Arg Leu Ala Val Pro Lys Gln Val Thr Val 210 215 220 124221PRTSalinispora tropica 124Met Phe Val Pro Ser Pro Tyr Arg Glu Pro Asp Gly Ser Trp Thr Val 1 5 10 15 Asp Leu Met Arg Arg Asn Pro Leu Ala Leu Leu Val Thr Ser Ser Asp 20 25 30 Lys Thr Asp Ile Pro Tyr Ala Thr His Leu Pro Val Ile Phe Asp Pro 35 40 45 Arg Met Pro Glu Glu Asp Tyr Ser Asp Pro Ala Arg Phe Val Leu Leu 50 55 60 Gly His Met Asn Arg Ala Asn Pro His Trp Lys Ala Leu Val Thr Gly 65 70 75 80 Met Pro Thr Leu Val Val Phe Ser Gly Ser His Ala Tyr Val Ser Pro 85 90 95 Thr Val Tyr Asp Lys Ser Pro Ala Ala Pro Thr Trp Asn Phe Thr Ala 100 105 110 Ala His Ala Arg Gly Val Leu Glu Lys Ile Glu Ser Ala Glu Glu Thr 115 120 125 Leu Gly Val Ile Gly Ser Thr Val Arg Ala Phe Glu Ala Asp Phe Gly 130 135 140 Thr Asp Trp Asp Met Ala Gln Ser Val Gly Tyr Phe Arg Lys Ile Leu 145 150 155 160 Pro Gly Val Gly Ala Phe Arg Ile Ala Val Ser Ser Ile Asp Ser Met 165 170 175 Phe Lys Leu Ser Gln Glu Gln Ser Pro Glu Val Arg Asp Arg Val Gly 180 185 190 Cys Ala Phe Ala Glu Ser Ala Ser Thr Arg His Arg Glu Val Ala Asp 195 200 205 Leu Met Asn Arg Leu Ala Val Pro Lys Gln Val Thr Val 210 215 220 125225PRTStreptomyces sp. PsTaAH-137 125Met Phe Val Pro Ser Phe Tyr Arg Glu Pro Asp Ser Ser Trp Met Val 1 5 10 15 Asp Leu Ile Arg Gly Asn Pro Leu Ala Leu Ala Val Ala Asn Gly Pro 20 25 30 Ala Glu Asp Gly Pro Phe Ala Thr His Leu Pro Val Ile Phe Asp Pro 35 40 45 Glu Thr Ser Ala Asp Val Ser Gly Glu Leu Pro Gly Val Thr Leu Leu 50 55 60 Gly His Met Asn Arg Ala Asn Pro His Trp Ser Ala Leu Gln Asp Gly 65 70 75 80 Gly Val Leu Leu Leu Thr Phe Thr Gly Pro His Ser Tyr Val Ser Pro 85 90 95 Thr Val Tyr Glu Lys Ser Pro Ala Ala Pro Thr Trp Asn Phe Thr Ser 100 105 110 Val His Val Arg Gly Val Val Glu Lys Ile Ser Ser Ile Glu Glu Thr 115 120 125 Leu Glu Val Val Gln Ala Thr Val Arg Ala Phe Glu Gly Ala Phe Gly 130 135 140 Asp Gly Trp Asp Met Thr Gly Ser Leu Asp Tyr Phe Arg Lys Ile Val 145 150 155 160 Pro Ala Val Gly Ala Phe Arg Phe Thr Val Thr Gly Ala Glu Gly Met 165 170 175 Phe Lys Leu Ser Gln Glu Gln Pro Gly Glu Val Arg Glu Arg Val Arg 180 185 190 Glu Ser Phe Gly Gln Ser Ala Cys Thr Tyr Lys Arg Glu Thr Ala Gly 195 200 205 Leu Met Asn Arg Leu Ala Gln Thr Glu Asp Val Thr Val Ser Ser Gly 210 215 220 Ala 225 126213PRTSalinispora arenicola 126Met Leu Val Pro His Met Tyr Glu Ala Pro Ser Ala Ala Gln Val Asp 1 5 10 15 Ala Val Ile Thr Gly His Pro Met Ala Val Leu Val Thr Asn Gly Pro 20 25 30 Asp Val Pro His Ala Thr His Leu Pro Val Ile Arg Thr Val Asp Thr 35 40 45 Glu Gln Thr Gly Pro Gly Ser Val Leu Leu Gly His Met Asn Arg Thr 50 55 60 Asn Pro His Trp Ser Ala Leu Thr Ser Gly Thr Pro Gly Lys Leu Ile 65 70 75 80 Phe Thr Gly Pro Asn Thr Tyr Val Cys Pro Val Leu Tyr Gln Thr Glu 85 90 95 Pro Ala Ala Pro Thr Trp Asp Phe Val Val Val His Val Ser Gly Arg 100 105 110 Val Met Pro Leu Asp Ala Gly Glu Pro Thr Leu Ala Val Val Gln Arg 115 120 125 Thr Ala Ala Thr Leu Glu Gly Ala Phe Gly Ala Gly Trp Asp His Thr 130 135 140 Gly Ser Ile Asp Tyr Phe Arg Ser Ile Val Gly Gly Val Gly Ala Phe 145 150 155 160 Glu Phe Val Val Glu Gln Val Glu Ser Met Phe Lys Leu Ser Gln Glu 165 170 175 Lys Asp His Thr Val Arg Gln Arg Leu Ile Asp Asp Phe Thr Ser Ala 180 185 190 Pro Arg Asn Gly Ser Ala Gln Val Gly Gln Leu Met Ser Asp Leu Asn 195 200 205 Leu Gly Val Ala Pro 210 127213PRTSalinispora arenicola 127Met Leu Val Pro His Met Tyr Glu Ala Pro Ser Ala Ala Gln Val Asp 1 5 10 15 Ala Val Ile Thr Gly His Pro Met Ala Val Leu Val Thr Asn Gly Pro 20 25 30 Asp Val Pro His Ala Thr His Leu Pro Val Ile Arg Thr Val Asp Thr 35 40 45 Glu Gln Thr Gly Pro Gly Ser Val Leu Leu Gly His Met Asn Arg Thr 50 55 60 Asn Pro His Trp Ser Ala Leu Thr Ser Gly Thr Pro Gly Lys Leu Ile 65 70 75 80 Phe Thr Gly Pro Asn Thr Tyr Val Cys Pro Val Leu Tyr Gln Thr Glu 85 90 95 Pro Ala Ala Pro Thr Trp Asp Phe Val Val Val His Val Ser Gly Arg 100 105 110 Val Met Pro Leu Asp Ala Gly Glu Pro Thr Leu Ala Val Val Gln Arg 115 120 125 Thr Ala Ala Thr Leu Glu Gly Ala Phe Gly Ala Gly Trp Asp His Thr 130 135 140 Gly Ser Ile Asp Tyr Phe Arg Ser Ile Val Gly Gly Val Gly Ala Phe 145 150 155 160 Glu Phe Val Val Glu Gln Val Glu Ser Met Phe Lys Leu Ser Gln Glu 165 170 175 Lys Asp His Thr Val Arg Gln Arg Leu Ile Asp Asp Phe Thr Ser Ala 180 185 190 Pro Arg Asn Gly Ser Ala Gln Val Gly Gln Leu Met Ser Asp Leu Asn 195 200 205 Leu Gly Val Ala Pro 210 128213PRTSalinispora pacifica 128Met Leu Val Pro His Met Tyr Glu Ala Pro Ser Ala Ala Gln Val Asp 1 5 10 15 Ala Val Ile Thr Gly His Pro Met Ala Val Leu Val Thr Asn Gly Pro 20 25 30 Asp Val Pro His Ala Thr His Leu Pro Val Ile Arg Thr Val Asp Thr 35 40 45 Glu Gln Thr Gly Pro Gly Ser Val Leu Leu Gly His Met Asn Arg Thr 50 55 60 Asn Pro His Trp Ser Ala Leu Thr Ser Gly Thr Pro Gly Lys Leu Ile 65 70 75 80 Phe Thr Gly Pro Asn Thr Tyr Val Cys Pro Val Leu Tyr Gln Thr Glu 85 90 95 Pro Ala Ala Pro Thr Trp Asp Phe Val Val Val His Val Ser Gly Arg 100 105 110 Val Met Pro Leu Asp Ala Gly Glu Pro Thr Leu Ala Val Val Gln Arg 115 120 125 Thr Ala Ala Thr Leu Glu Gly Ala Phe Gly Ala Gly Trp Asp His Thr 130 135 140 Gly Ser Ile Asp Tyr Phe Arg Ser Ile Val Gly Gly Val Gly Ala Phe 145 150 155 160 Glu Phe Val Val Glu Gln Val Glu Ser Met Phe Lys Leu Ser Gln Glu 165 170 175 Lys Asp His Thr Val Arg Gln Arg Leu Ile Asp Asp Phe Thr Ser Ala 180 185 190 Pro Arg Asn Gly Ser Thr Gln Val Gly Gln Leu Met Ser Asp Leu Asn 195 200 205 Leu Gly Val Ala Pro 210 129232PRTActinomadura atramentaria 129Val Phe Val Pro Pro Gln Tyr Arg Pro Arg Gly Arg Ser Trp Thr Leu 1 5 10 15 Glu Thr Val Arg Ser Asn Pro Leu Ala Met Leu Val Thr Arg Gly Glu 20 25 30 Arg Ala Leu Pro Trp Ile Thr His Leu Pro Val Ile Thr His Pro Glu 35 40 45 Arg Pro Pro Ala Glu Leu Pro Gly Ala Thr Leu Leu Gly His Met Asn 50 55 60 Ala Ala Asn Pro His Trp Ala Ala Val Ala Ser Gly Gly Pro Gly Thr 65 70 75 80 Leu Val Phe Thr Gly Pro His Gly Tyr Val Ser Pro

Thr Val Tyr Glu 85 90 95 Leu Pro Val Ala Ala Pro Thr Trp Asp Phe Val Ala Val His Val His 100 105 110 Gly Thr Leu Arg Pro Leu Asp Thr Pro Glu Asp Ala Arg Arg Val Val 115 120 125 Arg Trp Thr Val Glu Ala Tyr Glu Gly Thr His Gly Thr Gly Trp Asp 130 135 140 Pro Glu Gly Ser Leu Asp Tyr Phe Asp Lys Ile Leu Pro Gly Val Arg 145 150 155 160 Ala Phe Glu Phe His Val Glu Ser Val Asp Gly Met Tyr Lys Leu Ser 165 170 175 Gln Glu Gln Glu Pro Glu Thr Arg Arg Arg Val Val Arg Ser Phe Ala 180 185 190 Ala Ser Gly Arg Gly Ala His Ala Glu Leu Ser Ala Leu Ile Asp Arg 195 200 205 Phe Gly Asp Pro Gly Pro Gly Ala Pro Ala Thr Gly Cys Pro Ala Ala 210 215 220 Arg Glu Ala Gly Asp Gly Ala Arg 225 230 130218PRTStreptomyces drozdowiczii 130Met Phe Val Pro Pro Met Tyr Arg Thr Glu Asn Glu Gly Arg Leu Arg 1 5 10 15 Gln Val Met Glu Arg Tyr Pro Leu Ala Met Leu Val Thr Asn Gly Glu 20 25 30 Pro Thr Pro Tyr Ala Thr His Leu Pro Val Ile Phe Asp Gln Asn Gly 35 40 45 Ala Pro Gly Thr Asp Gly Pro Val Gly Ala Thr Leu Leu Gly His Leu 50 55 60 Asn Arg Asn Asn Pro His Trp Arg Thr Leu Thr Asp Gly Leu Ala Ala 65 70 75 80 Lys Leu Val Phe Thr Gly Pro His Ser Tyr Ile Thr Pro Thr Leu Tyr 85 90 95 Glu Thr Thr Pro Ala Ala Pro Thr Trp Asn Phe Val Thr Val His Leu 100 105 110 Glu Gly Thr Leu His Pro Val Thr Asp Leu Glu Glu Thr Leu Gly Val 115 120 125 Leu Gln Ala Thr Val Glu Thr Phe Glu Ser Ala Phe Gly Asn Lys Trp 130 135 140 Glu Met Asp Ser Ser Leu Asp Tyr Phe Arg His Ile Gly Pro Ala Val 145 150 155 160 Gly Ala Phe Arg Phe Val Val Thr Ser Ala Asp Gly Met Phe Lys Leu 165 170 175 Ser Gln Glu Lys Thr Pro Glu Ile Gln His Arg Ile Ala Asp Arg Leu 180 185 190 Ile Gly Thr Glu Thr Gly Thr Arg His Glu Leu Gly Ala Leu Met Ala 195 200 205 Glu Leu Thr Leu Gly Asp Arg Asp Gly Val 210 215 131200PRTStreptomyces sp. RSD-27 131Met Val Asp Leu Val Arg Gly His Pro Met Ala Leu Ala Val Ala Asn 1 5 10 15 Gly Ser Pro Glu Asp Gly Pro Phe Ala Thr His Leu Pro Val Ile Phe 20 25 30 Asp Pro Val Thr Ser Gly Gln Trp Thr Gly Glu Leu Pro Gly Ala Thr 35 40 45 Leu Leu Gly His Met Asn Arg Ala Asn Pro His Trp Ala Ala Leu Glu 50 55 60 Thr Gly Gly Val Leu Leu Leu Thr Phe Thr Gly Pro His Ser Tyr Val 65 70 75 80 Ser Pro Thr Val Tyr Ala Lys Ser Pro Ala Ala Pro Thr Trp Asn Phe 85 90 95 Thr Ser Val His Val Arg Gly Val Val Glu Lys Ile Asp Ser Ile Glu 100 105 110 Glu Thr Leu Glu Val Val Gln Ser Thr Val Arg Ala Phe Glu Gly Ala 115 120 125 Phe Gly Asp Gly Trp Asp Met Thr Gly Ser Leu Asp Tyr Phe Arg Lys 130 135 140 Ile Val Pro Asp Val Gly Ala Phe Arg Leu Thr Val Thr Gly Ala Glu 145 150 155 160 Gly Met Phe Lys Leu Ser Gln Glu Gln Pro Gly Glu Val Arg Glu Arg 165 170 175 Val Arg Glu Ser Phe Gly Gln Ser Ala Cys Thr Tyr Arg Arg Glu Thr 180 185 190 Ala Gly Leu Met Gly Arg Leu Pro 195 200 132200PRTStreptomyces sp. YR375 132Met Val Asp Leu Leu Arg Asn Asn Pro Leu Ala Leu Met Val Ser Asn 1 5 10 15 Gly Asp Ala Ala Ala Ala Pro Phe Ala Thr His Leu Pro Val Ile Pro 20 25 30 Asp Pro Ala Met Thr Asp Glu Trp Ser Ala Asp Leu Ser Gly Ala Thr 35 40 45 Leu Leu Gly His Met Asn Arg Gly Asn Pro His Trp Lys Ala Leu Glu 50 55 60 Thr Gly Asp Val Val Leu Leu Thr Phe Thr Gly Pro His Ala Tyr Val 65 70 75 80 Ser Pro Thr Val Tyr Glu Val Thr Pro Ala Ala Pro Thr Trp Asn Phe 85 90 95 Thr Ser Val His Val Arg Gly Val Val Glu Lys Ile Asp Ser Ala Glu 100 105 110 Glu Thr Leu Glu Val Val Gln Ser Thr Val Arg Ala Phe Glu Ala Asp 115 120 125 Phe Gly Asp Asp Trp Asp Met Thr Glu Ser Leu Gly Tyr Phe Arg Arg 130 135 140 Ile Val Pro Ala Val Gly Ala Phe Arg Leu Thr Val Ser Gly Ala Glu 145 150 155 160 Gly Met Phe Lys Leu Ser Gln Glu Gln Lys Pro Glu Val Arg Glu Arg 165 170 175 Val Gln Lys Ala Phe Ser Gly Arg Glu Cys Gly Arg His Arg Glu Thr 180 185 190 Ala Ser Phe Met Ser Arg Leu Pro 195 200 133241PRTActinoalloteichus spitiensis 133Met Phe Val Pro Asp Gln Tyr Arg Ala Ala Asp Asn Arg Pro Leu Val 1 5 10 15 Glu Leu Ile Arg Ser Phe Pro Leu Ala Thr Leu Val Ser His Ala Glu 20 25 30 Gly Thr Leu Phe Ala Thr His Val Pro Val Leu Leu Ala Ala Asp Ala 35 40 45 Asp Ala Gly Arg Asp Val Pro Glu Pro Ala Asp Leu Thr Ile Leu Gly 50 55 60 His Leu Asp Arg Arg Asn Pro His Arg Ala Ala Leu Ala Ala Gly Gly 65 70 75 80 Pro Cys Leu Leu Thr Phe Thr Gly Pro His Ser Tyr Val Ser Pro Ala 85 90 95 His Tyr Gly Arg Glu Thr Ala Ala Pro Thr Trp Asn Phe Thr Ala Val 100 105 110 His Val His Gly Arg Leu Thr Pro Leu Asp Gly Ala Glu Asp Thr Arg 115 120 125 His Val Val Arg Ser Thr Ala Leu Leu Tyr Glu Arg Arg Phe Gly Ala 130 135 140 Gly Trp Asp Thr Thr Gly Ser Leu Asp Tyr Phe Glu Gln Leu Leu Pro 145 150 155 160 Gly Val Ser Ala Phe Arg Val Asp Val Ser Thr Val Glu Gly Met Phe 165 170 175 Lys Leu Gly Gln Glu Gln Pro Gly Tyr Ala Arg Gln Gly Val Val Ala 180 185 190 Ala Phe Thr Ser Pro Gly Ala Pro Pro His Gln Arg Ala Val Ala Glu 195 200 205 Leu Met Arg Arg Phe Ala Pro Asp Ser Pro Asp Asp Gly Gly Pro Gly 210 215 220 Cys Pro Val Arg Ala Pro Ala Lys Pro Glu Pro Ala Thr Arg Gly Glu 225 230 235 240 Arg 134200PRTStreptomyces sp. Ncost-T6T-1 134Met Val Asp Leu Met Arg Ser Asn Pro Leu Ala Leu Met Val Ser Asn 1 5 10 15 Gly Ser Pro Glu Ala Ser Pro Phe Ala Thr His Leu Pro Val Ile Phe 20 25 30 Asp Pro Gly Asp Ala Ala Asp Leu Ala Glu Asp Leu Ala Arg Leu Pro 35 40 45 Leu Leu Gly His Met Asn Arg Ala Asn Pro His Trp Ser Ala Leu Gln 50 55 60 Asp Asp Ala Val Val Leu Leu Ser Phe Thr Gly Pro His Ala Tyr Val 65 70 75 80 Ser Pro Thr Val Tyr Asp Val Thr Pro Ala Ala Pro Thr Trp Asn Phe 85 90 95 Thr Ser Val His Val His Gly Val Val Glu Lys Phe Asp Ser Thr Glu 100 105 110 Glu Thr Leu Glu Val Val Gln Ala Thr Val Arg Ala Phe Glu Glu Lys 115 120 125 Phe Gly Asn Asn Trp Asp Met Thr Asp Ser Ile Asp Tyr Phe Arg Lys 130 135 140 Ile Val His Asp Val Gly Ala Phe Arg Ile Arg Val Thr Lys Ala Glu 145 150 155 160 Gly Met Phe Lys Leu Ser Gln Glu Gln Glu Pro Glu Ile Arg Asp Arg 165 170 175 Val Val Gln Ser Phe Thr Gly Arg Gly Cys Thr Arg His Ala Gln Thr 180 185 190 Ala Thr Leu Met Ser Arg Leu Pro 195 200 135231PRTStreptomyces sp. PBH53 135Val Tyr Glu Arg Pro Leu Tyr Arg Glu Asp Arg Asp Gly Val Val Leu 1 5 10 15 Ala Phe Leu His His His Pro Leu Ala Leu Val Val Thr Ala His Glu 20 25 30 Gly Val Pro Val Ala Thr His Ala Pro Val Leu Phe Arg His Gly Pro 35 40 45 Asp Gly Ala Asp Ala Glu Ala Val Ala Ala Gly Thr Val Pro Leu Ala 50 55 60 Gly Ser Thr Leu Ile Gly His Met Asn Val Glu Asn Pro Gln Trp Arg 65 70 75 80 Arg Met Arg Ser Gly Asp Arg Ala Leu Ile Val Phe Gln Gly Pro His 85 90 95 Gly Tyr Val Ser Pro Thr Val Tyr Asp Val Thr Pro Ala Ala Pro Thr 100 105 110 Trp Asn Phe Thr Ala Val His Val Thr Gly Thr Val Glu Pro Thr Ala 115 120 125 Glu Pro Ala Asp Val Leu Asp Ile Val Ser Asp Thr Ala Arg Arg Leu 130 135 140 Glu Gly Arg Phe Gly Arg Gly Trp Asp Gln Glu Ser Ser Leu Asp Tyr 145 150 155 160 Phe Arg Gln Ile Ala Pro Gly Val Gly Ala Phe Thr Leu Arg Val Glu 165 170 175 Ser Val Gln Thr Met Phe Lys Leu Ser Gln Glu Lys Pro Thr Pro Met 180 185 190 Arg Arg Arg Val Ala Glu Gln Phe Glu Ala Ser Glu Ser Gly Thr His 195 200 205 Arg Ala Leu Ala Gly Met Met Arg Ala His Gly Leu Thr Asp Ala Asp 210 215 220 Glu Glu Arg Glu Thr Ala Gly 225 230 136213PRTSalinispora arenicola 136Met Leu Val Pro His Met Tyr Glu Ala Pro Ser Ala Ala Gln Val Asp 1 5 10 15 Ala Val Ile Thr Gly His Pro Met Ala Val Leu Val Thr Asn Gly Pro 20 25 30 Asp Val Pro His Ala Thr His Leu Pro Val Ile Arg Thr Val Asp Thr 35 40 45 Glu Gln Thr Gly Pro Gly Ser Val Leu Leu Gly His Met Asn Arg Thr 50 55 60 Asn Pro His Trp Ser Ala Leu Thr Ser Gly Thr Pro Gly Lys Leu Ile 65 70 75 80 Phe Thr Gly Pro Asn Thr Tyr Val Cys Pro Val Leu Tyr Gln Thr Glu 85 90 95 Pro Ala Ala Pro Thr Trp Asp Phe Val Val Val His Val Ser Gly Arg 100 105 110 Val Met Pro Leu Asp Ala Gly Glu Pro Thr Leu Ala Val Val Gln Arg 115 120 125 Thr Ala Ala Thr Leu Glu Gly Ala Phe Gly Ala Gly Trp Asp His Thr 130 135 140 Gly Ser Ile Asp Tyr Phe Arg Ser Ile Val Gly Gly Val Gly Ala Phe 145 150 155 160 Glu Phe Val Val Glu Gln Val Glu Ser Met Phe Lys Leu Ser Gln Glu 165 170 175 Lys Asp His Thr Val Arg Gln Arg Leu Ile Asp Asp Phe Thr Ser Ala 180 185 190 Pro Arg Asn Gly Ser Ala Gln Val Gly Gln Leu Met Ser Asp Leu Asn 195 200 205 Leu Gly Val Ala Pro 210 137219PRTStreptomyces sp. MNU77 137Met Phe Val Pro Arg Ile Tyr Gln Val Asp Gly Glu His Trp Pro Ser 1 5 10 15 Glu Ile Ile Asp Arg His Pro Leu Ala Leu Leu Thr Thr Asn Gly Asp 20 25 30 Asp Val Pro His Ala Thr His Val Pro Val Ile Arg Pro Pro His Asp 35 40 45 Glu Gln Leu Val Gly Ser Glu Leu Leu Val His Met Asn Arg Ala Asn 50 55 60 Pro His Trp Ala Ala Leu Ser Asp His Asp Ala Ala Lys Leu Val Phe 65 70 75 80 Gln Gly Pro Asp Gly Tyr Val Thr Pro Ser Val Tyr His Val Glu Pro 85 90 95 Ala Val Pro Thr Trp Asp Phe Val Thr Val His Leu Thr Gly Thr Leu 100 105 110 Arg Ile Ser Glu Asp Val Asp Glu Val Leu Ser Ile Val Thr Ala Thr 115 120 125 Ala Arg Thr Leu Glu Arg Arg Phe Gly Ala Gly Phe Asp Val Asp Arg 130 135 140 Ala Ala Asp His His Ala Arg Ile Ala Ser Gly Val Gly Ala Ile Arg 145 150 155 160 Phe Arg Val Thr Lys Ala Glu Ala Met Phe Lys Phe Ser Gln Glu Lys 165 170 175 Asp Ala Glu Ile Arg Asp Arg Val Met Gln Trp Phe Glu Asp Ser Asp 180 185 190 Ile Gly Glu Tyr Ala Asp Leu Gly Arg Leu Met Arg Gln Phe Leu Asp 195 200 205 Arg Pro Asp Ile Thr Ala Pro Ala Ala Ala Gly 210 215 138217PRTMicromonospora halophytica 138Met Phe Val Pro Arg Ser Phe Ala Val Glu Asp Ala Gly Pro Val Val 1 5 10 15 Glu Leu Met Arg Ser Asn Pro Leu Ala Cys Phe Val Leu Gly Gly Glu 20 25 30 Ser Pro Ser Val Ser His Leu Pro Val Val Phe Ala Asp Asp Asp Glu 35 40 45 Arg Asp Asp Leu Ala Gly Ile Thr Leu Leu Thr His Met Asn Arg Gln 50 55 60 Asn Pro Leu Trp Gly Ser Leu Ser Asp Gly Ala Arg Val Leu Val Val 65 70 75 80 Phe Gln Gly Pro His Gly Tyr Val Ser Pro Thr Val Tyr Gly Val Ser 85 90 95 Pro Ala Ala Pro Thr Trp Asn Phe Thr Val Val His Ala His Gly Val 100 105 110 Val Arg Leu Leu Gly Ala Gly Glu Pro Ala Leu Arg Val Val Lys Arg 115 120 125 Thr Val Gln Val Leu Glu Gly Arg Phe Gly Ala Gly Trp Asp Met Thr 130 135 140 Gly Ser Leu Gly Tyr Phe Glu Arg Ile Val His Ala Val Gly Ala Leu 145 150 155 160 Glu Ile His Val Asp Ala Val Gln Ser Met Phe Lys Leu Ser Gln Asp 165 170 175 Gln Pro Val Glu Leu Gln Ser Lys Val Ala Ala Ala Phe Ala Gly Ser 180 185 190 Gly Arg Gly Thr His Arg Glu Leu Ala Glu Gln Met Tyr Thr His Leu 195 200 205 Arg Leu Lys Ala Asp Val Asp Gly Phe 210 215 139214PRTStreptacidiphilus carbonis 139Met Phe Val Pro Pro Pro Tyr Arg Pro Pro Asp Gly Ser Trp Thr Ala 1 5 10 15 Glu Leu Ile Arg Ser Asn Pro Leu Ala Ile Leu Ala Ser Asn Gly Ser 20 25 30 Thr Ala Asp Gly Pro Phe Ala Thr His Leu Pro Val Ile Pro Asp Pro 35 40 45 Gly Thr Pro Asp Leu Leu Ser Ala Glu Leu Thr Gly Ala Val Leu Leu 50 55 60 Gly His Met Asn Arg Ala Asn Pro His Trp Ala Ala Leu Ala Glu Gly 65 70 75 80 Gly Thr Ser Leu Leu Thr Phe Thr Gly Pro His Ala Tyr Val Ser Pro 85 90 95 Thr Val Tyr Gly Val Thr Pro Ala Ala Pro Thr Trp Asn Phe Thr Ser 100 105 110 Val His Ala Arg Gly Thr Ile Glu Arg Ile Glu Ser Ser Glu Glu Thr 115 120 125 Leu Glu Val Val Lys Ala Thr Val Arg Ala Phe Glu Glu Arg Phe Gly 130 135 140 Ala Glu Trp Asp Met Ser Glu Ser Ile Ser Tyr Phe Arg Gln Ile Leu 145 150 155 160 Pro Gly Val Gly Gly

Phe Arg Phe Thr Val Thr Gly Thr Asp Gly Met 165 170 175 Phe Lys Leu Ser Gln Glu Gln Ala Pro Glu Ile Arg Cys Arg Val Gln 180 185 190 Arg Ser Phe Thr Gly Arg Glu Cys Ser Arg His Arg Glu Thr Ala Ala 195 200 205 Leu Met Gly Ser Leu Pro 210 140223PRTStreptomyces sp. MnatMP-M27 140Met Phe Val Pro Gln His Tyr Arg Thr Asp Asp Arg Arg Trp Pro Val 1 5 10 15 Arg Ile Val Gln Asp Asn Pro Leu Ala Leu Leu Met Ser Thr Arg Asp 20 25 30 Gly Arg Ala Pro Phe Ala Ser His Val Pro Val Ile Val Leu Pro Arg 35 40 45 Gln Arg Glu Glu Leu Glu Arg Thr Gly Arg Trp Gln Gly Ala Val Leu 50 55 60 His Gly His Met Asn Arg Ala Asn Pro His Trp Lys Ser Leu Ala Asp 65 70 75 80 Gly Gln Pro Ala Gly Leu Val Phe Gln Gly Pro Ala Gly Tyr Val Ser 85 90 95 Pro Ala Val Tyr Asn Thr Ser Pro Ala Val Pro Thr Trp Asn Phe Thr 100 105 110 Ala Val His Val Gln Gly Arg Leu Lys Leu Val Ala Asp Glu Glu Ala 115 120 125 Thr Leu Gly Val Val Ser Ala Thr Ala Arg Gln Leu Glu Glu Arg Phe 130 135 140 Gly Ala Arg Trp Thr Val Glu Pro Ser Val Asp His Phe Arg Gln Ile 145 150 155 160 Leu Pro Gly Val Gly Ala Phe Glu Leu Arg Val Glu Glu Cys Asp Ser 165 170 175 Met Phe Lys Leu Ser Gln Glu Lys Glu His Glu Val Arg His Ala Val 180 185 190 Met Asp Trp Cys Ala Arg Ser Pro Arg Gly Arg Ser Asn Asp Leu Ala 195 200 205 Ala Val Met Arg Asp Tyr Tyr Pro Pro Thr Thr Ala Trp Pro Ser 210 215 220 141220PRTPseudonocardia sp. EC080625-04 141Met Phe Val Pro Glu Gln Tyr Arg Glu Gln Asp Ser Asn Trp Met Leu 1 5 10 15 Asp Ile Val Arg Ser Asn Pro Leu Ala Leu Met Ala Ser Asp Gly Thr 20 25 30 Pro Glu Gly Cys Gly Pro Ala Ala Thr His Leu Pro Cys Ile Pro Asp 35 40 45 Pro Ser Ala Pro His Asp Trp Ser Asp Gly Pro Arg Gly Ala Val Leu 50 55 60 Leu Gly His Met Asn Arg Ala Asn Pro Gln Trp Arg His Leu His Asp 65 70 75 80 Gly Gln Thr Val Leu Leu Val Phe Thr Gly Pro His Ala Tyr Val Ser 85 90 95 Pro Ala Val Tyr Asp Thr Thr Pro Ala Ala Pro Thr Trp Asp Phe Thr 100 105 110 Ala Val His Val His Gly Val Val Thr Lys Leu Glu Pro His Lys Ala 115 120 125 Glu Arg Thr Thr Leu Asp Val Val Thr Asp Thr Val Thr Ala Leu Glu 130 135 140 Gly Arg Phe Gly Ala Gly Trp Asp Met Thr Asp Ser Ile Glu Tyr Phe 145 150 155 160 His Arg Leu Leu Pro Gly Val Gly Ala Phe Arg Val Arg Val Gly Ser 165 170 175 Ala Glu Gly Met Phe Lys Leu Ser Gln Glu Gln Pro Ser Asp Ile Arg 180 185 190 Asp Arg Val Arg Cys His Phe Ala Ala Ala Gln His Gly Arg Ser Ser 195 200 205 Glu Ile Ala His Leu Met Thr Thr Leu Asp Gly His 210 215 220 142220PRTPseudonocardia sp. HH130629-09 142Met Phe Val Pro Glu Gln Tyr Arg Glu Gln Asp Ser Asn Trp Met Leu 1 5 10 15 Asp Ile Val Arg Ser Asn Pro Leu Ala Leu Met Ala Ser Asp Gly Thr 20 25 30 Pro Glu Gly Cys Gly Pro Ala Ala Thr His Leu Pro Cys Ile Pro Asp 35 40 45 Pro Ser Ala Pro His Asp Trp Ser Asp Gly Pro Arg Gly Ala Val Leu 50 55 60 Leu Gly His Met Asn Arg Ala Asn Pro Gln Trp Arg His Leu His Asp 65 70 75 80 Gly Gln Thr Val Leu Leu Val Phe Thr Gly Pro His Ala Tyr Val Ser 85 90 95 Pro Ala Val Tyr Asp Thr Thr Pro Ala Ala Pro Thr Trp Asp Phe Thr 100 105 110 Ala Val His Val His Gly Val Val Thr Lys Leu Glu Pro His Lys Ala 115 120 125 Glu Arg Thr Thr Leu Asp Val Val Thr Asp Thr Val Thr Ala Leu Glu 130 135 140 Gly Arg Phe Gly Ala Gly Trp Asp Met Thr Asp Ser Ile Glu Tyr Phe 145 150 155 160 His Arg Leu Leu Pro Gly Val Gly Ala Phe Arg Val Arg Val Gly Ser 165 170 175 Ala Glu Gly Met Phe Lys Leu Ser Gln Glu Gln Pro Ser Asp Ile Arg 180 185 190 Asp Arg Val Arg Cys His Phe Ala Ala Ala Gln His Gly Arg Ser Ser 195 200 205 Glu Ile Ala His Leu Met Thr Thr Leu Asp Gly His 210 215 220 143214PRTStreptomyces parvulus 143Met Phe Val Pro Ser Phe Tyr Arg Glu Pro Ser Asn Ser Trp Met Val 1 5 10 15 Asp Leu Ile Arg Gly Asn Pro Leu Ala Leu Ala Val Ala Asn Gly Gln 20 25 30 Pro Asp Glu Gly Pro Phe Ala Thr His Leu Pro Val Ile Phe Asp Pro 35 40 45 Asp His Pro Leu Asp Arg Asp Asp Asp Leu Thr Gly Ala Thr Leu Leu 50 55 60 Gly His Met Asn Arg Ala Asn Pro His Trp Gly Ser Leu Glu Thr Gly 65 70 75 80 Gly Val Leu Leu Leu Thr Phe Thr Gly Pro His Ser Tyr Val Ser Pro 85 90 95 Thr Val Tyr Glu Val Thr Pro Ala Ala Pro Thr Trp Asn Phe Thr Ala 100 105 110 Val His Val Arg Gly Val Val Glu Lys Leu Asp Ser Thr Asp Glu Thr 115 120 125 Leu Ala Val Val Gln Ser Thr Val Arg Ala Phe Glu Gly Glu Phe Gly 130 135 140 Asn Gly Trp Asp Met Thr Asp Ser Leu Gly Tyr Phe Arg Lys Ile Ala 145 150 155 160 Pro Gly Val Gly Ala Phe Arg Phe Thr Val Thr Gly Ala Glu Gly Met 165 170 175 Phe Lys Leu Ser Gln Glu Gln Pro Gly Glu Val Arg Asp Arg Val Arg 180 185 190 Glu Ser Phe Gly Gln Ser Gly Cys Val His Lys Arg Gly Thr Ala Gly 195 200 205 Leu Met Ser Arg Leu Pro 210 144214PRTStreptomyces sp. OK885 144Met Phe Val Pro Asp Pro Tyr Arg Glu Pro Asn Thr Thr Trp Met Val 1 5 10 15 Asp Leu Ile Arg Arg Asn Pro Leu Ala Leu Leu Thr Thr Asn Gly Pro 20 25 30 Ala Glu Cys Gly Pro Phe Ala Thr His Leu Pro Val Ile Gln Asp Pro 35 40 45 Gly Met Thr Ala Glu Trp Ser Ala Asp Leu Ser Gly Ser Leu Leu Leu 50 55 60 Gly His Met Asn Ala Gln Asn Pro His Trp Ser Ala Leu Arg Asp Gly 65 70 75 80 Asp Ser Val Leu Leu Ala Phe Thr Gly Pro His Ala Tyr Val Ser Pro 85 90 95 Thr Val Tyr Gln Lys Ile Pro Ala Ala Pro Thr Trp Asn Phe Thr Ser 100 105 110 Val His Val His Gly Val Ile Glu Lys Ile Glu Ser Glu Glu Glu Thr 115 120 125 Leu Thr Val Val Arg Ser Thr Val Arg Ala Phe Glu Glu Glu Phe Gly 130 135 140 Thr Asp Trp Asn Met Glu Gly Ser Val Asp Tyr Phe Arg Lys Ile Leu 145 150 155 160 Pro Gly Val Gly Ala Phe Arg Ile Thr Val Ser Arg Ala Asp Gly Met 165 170 175 Phe Lys Leu Ser Gln Glu Gln Glu Pro Gln Ile Arg Asp Arg Val Arg 180 185 190 Gln Ser Phe Ala Gln Arg Lys Cys Ser Leu His Arg Glu Thr Ala Asp 195 200 205 Leu Met Gly Arg Leu Pro 210 145218PRTStreptomyces sp. CFMR 7 145Met Tyr Val Pro Ser Ile Tyr Gln Ala Glu Asp Arg Ala Trp Leu Arg 1 5 10 15 His Val Val Glu Arg Tyr Pro Leu Ala Thr Val Ile Thr Asn Gly Pro 20 25 30 Gln Ala Pro Tyr Ala Thr His Val Pro Val Ile Pro Ala Pro Asp Thr 35 40 45 Thr Ser Trp Asn Asp Gly Pro Glu Gly Ala Thr Leu Leu Gly His Met 50 55 60 Asn Arg Ala Asn Ser His Trp Gly Ser Leu Thr Asp Gly Thr His Ala 65 70 75 80 Gln Leu Val Phe Thr Gly Pro Asn Gly Tyr Val Ser Pro Thr Val Tyr 85 90 95 Glu Thr Ser Pro Ala Ala Pro Thr Trp Asn Phe Val Ser Val His Leu 100 105 110 Arg Gly Arg Leu Arg Pro Ile Ser Asp Phe Glu Glu Thr Leu Glu Val 115 120 125 Val Arg Leu Thr Val Glu Ala Tyr Glu Lys Asn Phe Gly Asp Gly Trp 130 135 140 Glu Met Asp Ser Ser Leu Glu Tyr Phe Arg Asn Ile Gly Pro Ala Val 145 150 155 160 Gly Gly Phe Arg Phe Asp Val Glu Ser Ala Asp Gly Met Phe Lys Leu 165 170 175 Ser Gln Glu Lys His Pro Glu Thr Arg Arg Arg Ile Ala Asp Arg Phe 180 185 190 Gly Gly Arg Arg Ser Gly Arg Ala Thr Glu Leu Ala Phe Phe Met Arg 195 200 205 Gln Phe Thr Ser Ala Asp His His Ala Ser 210 215 146218PRTStreptomyces sp. DvalAA-19 146Met Tyr Val Pro Ser Ile Tyr Gln Ala Glu Asp Arg Ala Trp Leu Arg 1 5 10 15 His Val Val Glu Arg Tyr Pro Leu Ala Thr Val Ile Thr Asn Gly Pro 20 25 30 Gln Ala Pro Tyr Ala Thr His Val Pro Val Ile Pro Ala Pro Asp Thr 35 40 45 Thr Ser Trp Asn Asp Gly Pro Glu Gly Ala Thr Leu Leu Gly His Met 50 55 60 Asn Arg Ala Asn Ser His Trp Gly Ser Leu Thr Asp Gly Thr His Ala 65 70 75 80 Gln Leu Val Phe Thr Gly Pro Asn Gly Tyr Val Ser Pro Thr Ile Tyr 85 90 95 Glu Thr Ser Pro Ala Ala Pro Thr Trp Asn Phe Val Ser Val His Leu 100 105 110 Arg Gly Arg Leu Arg Pro Ile Ser Asp Phe Glu Glu Thr Leu Glu Val 115 120 125 Val Arg Leu Thr Val Glu Ala Tyr Glu Lys Asn Phe Gly Asp Gly Trp 130 135 140 Glu Met Asp Ser Ser Leu Glu Tyr Phe Arg Asn Ile Gly Pro Ala Val 145 150 155 160 Gly Gly Phe Arg Phe Asp Val Glu Ser Ala Asp Gly Met Phe Lys Leu 165 170 175 Ser Gln Glu Lys His Pro Glu Thr Arg Arg Arg Ile Ala Asp Arg Phe 180 185 190 Gly Gly Arg Arg Ser Gly Arg Ala Thr Glu Leu Ala Phe Phe Met Arg 195 200 205 Gln Phe Thr Ser Ala Asp Arg His Ala Ser 210 215 147218PRTRhodococcus fascians 147Met Tyr Val Pro Arg Ile Tyr Lys Ala Ser Asp Arg Thr Trp Leu Arg 1 5 10 15 Arg Val Val Ala Gln Tyr Pro Phe Ala Ala Leu Ile Ser Asn Gly Pro 20 25 30 Lys Ala Pro Tyr Ala Thr His Leu Pro Val Ile Cys Ala Pro Cys Ala 35 40 45 Pro Ser Glu Ser Glu Asp Leu Glu Gly Ser Thr Leu Phe Gly His Met 50 55 60 Asn Arg Ala Asn Pro His Trp Asp Ser Leu Val Asp Gly Ala Asp Ala 65 70 75 80 Gln Leu Ile Phe Thr Gly Pro His Gly Tyr Val Thr Pro Ser Val Tyr 85 90 95 Gln Arg Asp Ser Val Ala Pro Thr Trp Asn Tyr Val Ser Val His Leu 100 105 110 Arg Gly Lys Leu Gln Pro Val Ala Asp Phe Glu Glu Thr Leu Lys Val 115 120 125 Val Gln Leu Thr Val Ser Thr Tyr Glu Gln Lys Phe Gly Ser Gly Trp 130 135 140 Glu Met Asp Ser Ser Leu Asp His Tyr Arg Arg Ile Gly Pro Ala Val 145 150 155 160 Gly Ala Phe Ser Phe Glu Val Glu Ser Ala Asp Gly Met Phe Lys Leu 165 170 175 Ser Gln Glu Gln Asn Leu Glu Thr Arg Arg Arg Val Ala Asp His Phe 180 185 190 Ser Ala Asn His Ala Gly Arg Gly Lys Glu Leu Ala Ser Phe Met Arg 195 200 205 Glu Tyr Ser His Gly Asp Tyr Asn Asn Phe 210 215 148218PRTRhodococcus fascians 148Met Tyr Val Pro Arg Ile Tyr Lys Ala Ser Asp Arg Thr Trp Leu Arg 1 5 10 15 Arg Val Val Ala Gln Tyr Pro Phe Ala Ala Leu Ile Ser Asn Gly Pro 20 25 30 Lys Ala Pro Tyr Ala Thr His Leu Pro Val Ile Cys Ala Pro Cys Ala 35 40 45 Pro Ser Glu Ser Glu Asp Leu Glu Gly Ser Thr Leu Phe Gly His Met 50 55 60 Asn Arg Ala Asn Pro His Trp Asp Ser Leu Val Asp Gly Ala Asp Ala 65 70 75 80 Gln Leu Ile Phe Thr Gly Pro His Gly Tyr Val Thr Pro Ser Val Tyr 85 90 95 Gln Arg Asp Ser Val Ala Pro Thr Trp Asn Tyr Val Ser Val His Leu 100 105 110 Arg Gly Lys Leu Gln Pro Val Ala Asp Phe Glu Glu Thr Leu Lys Val 115 120 125 Val Gln Leu Thr Val Ser Thr Tyr Glu Gln Lys Phe Gly Ser Gly Trp 130 135 140 Glu Met Asp Ser Ser Leu Asp His Tyr Arg Arg Ile Gly Pro Ala Val 145 150 155 160 Gly Ala Phe Ser Phe Glu Val Glu Ser Ala Asp Gly Met Phe Lys Leu 165 170 175 Ser Gln Glu Gln Asn Leu Glu Thr Arg Arg Arg Val Ala Asp His Phe 180 185 190 Ser Ala Asn His Ala Gly Arg Gly Lys Glu Leu Ala Ser Phe Met Arg 195 200 205 Glu Tyr Ser His Gly Asp Tyr Asn Asn Phe 210 215 149218PRTRhodococcus fascians 149Met Tyr Val Pro Arg Ile Tyr Lys Ala Ser Asp Arg Thr Trp Leu Arg 1 5 10 15 Arg Val Val Ala Gln Tyr Pro Phe Ala Ala Leu Ile Ser Asn Gly Pro 20 25 30 Lys Ala Pro Tyr Ala Thr His Leu Pro Val Ile Cys Ala Pro Cys Ala 35 40 45 Pro Ser Glu Ser Glu Asp Leu Glu Gly Ser Thr Leu Phe Gly His Met 50 55 60 Asn Arg Ala Asn Pro His Trp Asp Ser Leu Val Asp Gly Ala Asp Ala 65 70 75 80 Gln Leu Ile Phe Thr Gly Pro His Gly Tyr Val Thr Pro Ser Val Tyr 85 90 95 Gln Arg Asp Ser Val Ala Pro Thr Trp Asn Tyr Val Ser Val His Leu 100 105 110 Arg Gly Lys Leu Gln Pro Val Ala Asp Phe Glu Glu Thr Leu Lys Val 115 120 125 Val Gln Leu Thr Val Ser Thr Tyr Glu Gln Lys Phe Gly Ser Gly Trp 130 135 140 Glu Met Asp Ser Ser Leu Asp His Tyr Arg Arg Ile Gly Pro Ala Val 145 150 155 160 Gly Ala Phe Ser Phe Glu Val Glu Ser Ala Asp Gly Met Phe Lys Leu 165 170 175 Ser Gln Glu Gln Asn Leu Glu Thr Arg Arg Arg Val Ala Asp His Phe 180 185 190 Ser Ala Asn His Ala Gly Arg Gly Lys Glu Leu Ala Ser Phe Met Arg 195 200 205 Glu Tyr Ser His Gly Asp Tyr Asn Asn Phe 210 215 150218PRTRhodococcus fascians 150Met Tyr Val Pro Arg Ile Tyr Lys Ala Ser Asp Arg Thr Trp Leu Arg 1 5 10

15 Arg Val Val Ala Gln Tyr Pro Phe Ala Ala Leu Ile Ser Asn Gly Pro 20 25 30 Lys Ala Pro Tyr Ala Thr His Leu Pro Val Ile Cys Ala Pro Cys Ala 35 40 45 Pro Ser Glu Ser Glu Asp Leu Glu Gly Ser Thr Leu Phe Gly His Met 50 55 60 Asn Arg Ala Asn Pro His Trp Asp Ser Leu Val Asp Gly Ala Asp Ala 65 70 75 80 Gln Leu Ile Phe Thr Gly Pro His Gly Tyr Val Thr Pro Ser Val Tyr 85 90 95 Gln Arg Asp Ser Val Ala Pro Thr Trp Asn Tyr Val Ser Val His Leu 100 105 110 Arg Gly Lys Leu Gln Pro Val Ala Asp Phe Glu Glu Thr Leu Lys Val 115 120 125 Val Gln Leu Thr Val Ser Thr Tyr Glu Gln Lys Phe Gly Ser Gly Trp 130 135 140 Glu Met Asp Ser Ser Leu Asp His Tyr Arg Arg Ile Gly Pro Ala Val 145 150 155 160 Gly Ala Phe Ser Phe Glu Val Glu Ser Ala Asp Gly Met Phe Lys Leu 165 170 175 Ser Gln Glu Gln Asn Leu Glu Thr Arg Arg Arg Val Ala Asp His Phe 180 185 190 Ser Ala Asn His Ala Gly Arg Gly Lys Glu Leu Ala Ser Phe Met Arg 195 200 205 Glu Tyr Ser His Gly Asp Tyr Asn Asn Phe 210 215 151218PRTRhodococcus fascians 151Met Tyr Val Pro Arg Ile Tyr Lys Ala Ser Asp Arg Thr Trp Leu Arg 1 5 10 15 Arg Val Val Ala Gln Tyr Pro Phe Ala Ala Leu Ile Ser Asn Gly Pro 20 25 30 Lys Ala Pro Tyr Ala Thr His Leu Pro Val Ile Cys Ala Pro Cys Ala 35 40 45 Pro Ser Glu Ser Glu Asp Leu Glu Gly Ser Thr Leu Phe Gly His Met 50 55 60 Asn Arg Ala Asn Pro His Trp Asp Ser Leu Val Asp Gly Ala Asp Ala 65 70 75 80 Gln Leu Ile Phe Thr Gly Pro His Gly Tyr Val Thr Pro Ser Val Tyr 85 90 95 Gln Arg Asp Ser Val Ala Pro Thr Trp Asn Tyr Val Ser Val His Leu 100 105 110 Arg Gly Lys Leu Gln Pro Val Ala Asp Phe Glu Glu Thr Leu Lys Val 115 120 125 Val Gln Leu Thr Val Ser Thr Tyr Glu Gln Lys Phe Gly Ser Gly Trp 130 135 140 Glu Met Asp Ser Ser Leu Asp His Tyr Arg Arg Ile Gly Pro Ala Val 145 150 155 160 Gly Ala Phe Ser Phe Glu Val Glu Ser Ala Asp Gly Met Phe Lys Leu 165 170 175 Ser Gln Glu Gln Asn Leu Glu Thr Arg Arg Arg Val Ala Asp His Phe 180 185 190 Ser Ala Asn His Ala Gly Arg Gly Lys Glu Leu Ala Ser Phe Met Arg 195 200 205 Glu Tyr Ser His Gly Asp Tyr Asn Asn Phe 210 215 152218PRTRhodococcus fascians 152Met Tyr Val Pro Arg Ile Tyr Lys Ala Ser Asp Arg Thr Trp Leu Arg 1 5 10 15 Arg Val Val Ala Gln Tyr Pro Phe Ala Ala Leu Ile Ser Asn Gly Pro 20 25 30 Lys Ala Pro Tyr Ala Thr His Leu Pro Val Ile Cys Ala Pro Cys Ala 35 40 45 Pro Ser Glu Ser Glu Asp Leu Glu Gly Ser Thr Leu Phe Gly His Met 50 55 60 Asn Arg Ala Asn Pro His Trp Asp Ser Leu Val Asp Gly Ala Asp Ala 65 70 75 80 Gln Leu Ile Phe Thr Gly Pro His Gly Tyr Val Thr Pro Ser Val Tyr 85 90 95 Gln Arg Asp Ser Val Ala Pro Thr Trp Asn Tyr Val Ser Val His Leu 100 105 110 Arg Gly Lys Leu Gln Pro Val Ala Asp Phe Glu Glu Thr Leu Lys Val 115 120 125 Val Gln Leu Thr Val Ser Thr Tyr Glu Gln Lys Phe Gly Ser Gly Trp 130 135 140 Glu Met Asp Ser Ser Leu Asp His Tyr Arg Arg Ile Gly Pro Ala Val 145 150 155 160 Gly Ala Phe Ser Phe Glu Val Glu Ser Ala Asp Gly Met Phe Lys Leu 165 170 175 Ser Gln Glu Gln Asn Leu Glu Thr Arg Arg Arg Val Ala Asp His Phe 180 185 190 Ser Ala Asn His Ala Gly Arg Gly Lys Glu Leu Ala Ser Phe Met Arg 195 200 205 Glu Tyr Ser His Gly Asp Tyr Asn Asn Phe 210 215 153218PRTRhodococcus fascians 153Met Tyr Val Pro Arg Ile Tyr Lys Ala Ser Asp Arg Thr Trp Leu Arg 1 5 10 15 Arg Val Val Ala Gln Tyr Pro Phe Ala Ala Leu Ile Ser Asn Gly Pro 20 25 30 Lys Ala Pro Tyr Ala Thr His Leu Pro Val Ile Cys Ala Pro Cys Ala 35 40 45 Pro Ser Glu Ser Glu Asp Leu Glu Gly Ser Thr Leu Phe Gly His Met 50 55 60 Asn Arg Ala Asn Pro His Trp Asp Ser Leu Val Asp Gly Ala Asp Ala 65 70 75 80 Gln Leu Ile Phe Thr Gly Pro His Gly Tyr Val Thr Pro Ser Val Tyr 85 90 95 Gln Arg Asp Ser Val Ala Pro Thr Trp Asn Tyr Val Ser Val His Leu 100 105 110 Arg Gly Lys Leu Gln Pro Val Ala Asp Phe Glu Glu Thr Leu Lys Val 115 120 125 Val Gln Leu Thr Val Ser Thr Tyr Glu Gln Lys Phe Gly Ser Gly Trp 130 135 140 Glu Met Asp Ser Ser Leu Asp His Tyr Arg Arg Ile Gly Pro Ala Val 145 150 155 160 Gly Ala Phe Ser Phe Glu Val Glu Ser Ala Asp Gly Met Phe Lys Leu 165 170 175 Ser Gln Glu Gln Asn Leu Glu Thr Arg Arg Arg Val Ala Asp His Phe 180 185 190 Ser Ala Asn His Ala Gly Arg Gly Lys Glu Leu Ala Ser Phe Met Arg 195 200 205 Glu Tyr Ser His Gly Asp Tyr Asn Asn Phe 210 215 154218PRTRhodococcus fascians 154Met Tyr Val Pro Arg Ile Tyr Lys Ala Ser Asp Arg Thr Trp Leu Arg 1 5 10 15 Arg Val Val Ala Gln Tyr Pro Phe Ala Ala Leu Ile Ser Asn Gly Pro 20 25 30 Lys Ala Pro Tyr Ala Thr His Leu Pro Val Ile Cys Ala Pro Cys Ala 35 40 45 Pro Ser Glu Ser Glu Asp Leu Glu Gly Ser Thr Leu Phe Gly His Met 50 55 60 Asn Arg Ala Asn Pro His Trp Asp Ser Leu Val Asp Gly Ala Asp Ala 65 70 75 80 Gln Leu Ile Phe Thr Gly Pro His Gly Tyr Val Thr Pro Ser Val Tyr 85 90 95 Gln Arg Asp Ser Val Ala Pro Thr Trp Asn Tyr Val Ser Val His Leu 100 105 110 Arg Gly Lys Leu Gln Pro Val Ala Asp Phe Glu Glu Thr Leu Lys Val 115 120 125 Val Gln Leu Thr Val Ser Thr Tyr Glu Gln Lys Phe Gly Ser Gly Trp 130 135 140 Glu Met Asp Ser Ser Leu Asp His Tyr Arg Arg Ile Gly Pro Ala Val 145 150 155 160 Gly Ala Phe Ser Phe Glu Val Glu Ser Ala Asp Gly Met Phe Lys Leu 165 170 175 Ser Gln Glu Gln Asn Leu Glu Thr Arg Arg Arg Val Ala Asp His Phe 180 185 190 Ser Ala Asn His Ala Gly Arg Gly Lys Glu Leu Ala Ser Phe Met Arg 195 200 205 Glu Tyr Ser His Gly Asp Tyr Asn Asn Phe 210 215 155218PRTRhodococcus fascians 155Met Tyr Val Pro Arg Ile Tyr Lys Ala Ser Asp Arg Thr Trp Leu Arg 1 5 10 15 Arg Val Val Ala Gln Tyr Pro Phe Ala Ala Leu Ile Ser Asn Gly Pro 20 25 30 Lys Ala Pro Tyr Ala Thr His Leu Pro Val Ile Cys Ala Pro Cys Ala 35 40 45 Pro Ser Glu Ser Glu Asp Leu Glu Gly Ser Thr Leu Phe Gly His Met 50 55 60 Asn Arg Ala Asn Pro His Trp Asp Ser Leu Val Asp Gly Ala Asp Ala 65 70 75 80 Gln Leu Ile Phe Thr Gly Pro His Gly Tyr Val Thr Pro Ser Val Tyr 85 90 95 Gln Arg Asp Ser Val Ala Pro Thr Trp Asn Tyr Val Ser Val His Leu 100 105 110 Arg Gly Lys Leu Gln Pro Val Ala Asp Phe Glu Glu Thr Leu Lys Val 115 120 125 Val Gln Leu Thr Val Ser Thr Tyr Glu Gln Lys Phe Gly Ser Gly Trp 130 135 140 Glu Met Asp Ser Ser Leu Asp His Tyr Arg Arg Ile Gly Pro Ala Val 145 150 155 160 Gly Ala Phe Ser Phe Glu Val Glu Ser Ala Asp Gly Met Phe Lys Leu 165 170 175 Ser Gln Glu Gln Asn Leu Glu Thr Arg Arg Arg Val Ala Asp His Phe 180 185 190 Ser Ala Asn His Ala Gly Arg Gly Lys Glu Leu Ala Ser Phe Met Arg 195 200 205 Glu Tyr Ser His Gly Asp Tyr Asn Asn Phe 210 215 156218PRTRhodococcus fascians 156Met Tyr Val Pro Arg Ile Tyr Lys Ala Ser Asp Arg Thr Trp Leu Arg 1 5 10 15 Arg Val Val Ala Gln Tyr Pro Phe Ala Ala Leu Ile Ser Asn Gly Pro 20 25 30 Lys Ala Pro Tyr Ala Thr His Leu Pro Val Ile Cys Ala Pro Cys Ala 35 40 45 Pro Ser Glu Ser Glu Asp Leu Glu Gly Ser Thr Leu Phe Gly His Met 50 55 60 Asn Arg Ala Asn Pro His Trp Asp Ser Leu Val Asp Gly Ala Asp Ala 65 70 75 80 Gln Leu Ile Phe Thr Gly Pro His Gly Tyr Val Thr Pro Ser Val Tyr 85 90 95 Gln Arg Asp Ser Val Ala Pro Thr Trp Asn Tyr Val Ser Val His Leu 100 105 110 Arg Gly Lys Leu Gln Pro Val Ala Asp Phe Glu Glu Thr Leu Lys Val 115 120 125 Val Gln Leu Thr Val Ser Thr Tyr Glu Gln Lys Phe Gly Ser Gly Trp 130 135 140 Glu Met Asp Ser Ser Leu Asp His Tyr Arg Arg Ile Gly Pro Ala Val 145 150 155 160 Gly Ala Phe Ser Phe Glu Val Glu Ser Ala Asp Gly Met Phe Lys Leu 165 170 175 Ser Gln Glu Gln Asn Leu Glu Thr Arg Arg Arg Val Ala Asp His Phe 180 185 190 Ser Ala Asn His Ala Gly Arg Gly Lys Glu Leu Ala Ser Phe Met Arg 195 200 205 Glu Tyr Ser His Gly Asp Tyr Asn Asn Phe 210 215 157218PRTRhodococcus fascians 157Met Tyr Val Pro Arg Ile Tyr Lys Ala Ser Asp Arg Thr Trp Leu Arg 1 5 10 15 Arg Val Val Ala Gln Tyr Pro Phe Ala Ala Leu Ile Ser Asn Gly Pro 20 25 30 Lys Ala Pro Tyr Ala Thr His Leu Pro Val Ile Cys Ala Pro Cys Ala 35 40 45 Pro Ser Glu Ser Glu Asp Leu Glu Gly Ser Thr Leu Phe Gly His Met 50 55 60 Asn Arg Ala Asn Pro His Trp Asp Ser Leu Val Asp Gly Ala Asp Ala 65 70 75 80 Gln Leu Ile Phe Thr Gly Pro His Gly Tyr Val Thr Pro Ser Val Tyr 85 90 95 Gln Arg Asp Ser Val Ala Pro Thr Trp Asn Tyr Val Ser Val His Leu 100 105 110 Arg Gly Lys Leu Gln Pro Val Ala Asp Phe Glu Glu Thr Leu Lys Val 115 120 125 Val Gln Leu Thr Val Ser Thr Tyr Glu Gln Lys Phe Gly Ser Gly Trp 130 135 140 Glu Met Asp Ser Ser Leu Asp His Tyr Arg Arg Ile Gly Pro Ala Val 145 150 155 160 Gly Ala Phe Ser Phe Glu Val Glu Ser Ala Asp Gly Met Phe Lys Leu 165 170 175 Ser Gln Glu Gln Asn Leu Glu Thr Arg Arg Arg Val Ala Asp His Phe 180 185 190 Ser Ala Asn His Ala Gly Arg Gly Lys Glu Leu Ala Ser Phe Met Arg 195 200 205 Glu Tyr Ser His Gly Asp Tyr Asn Asn Phe 210 215 158227PRTStreptomyces sp. CNT360 158Met Tyr Val Pro Gln His Phe Ala Val Asp Glu Thr Glu Pro Val Val 1 5 10 15 Glu Leu Ile Arg Ala Asn Pro Leu Ala Val Phe Val Thr Thr Gln Gly 20 25 30 Gly Val Pro Val Ala Ser His Ile Pro Val Val Phe Ala Ser Glu Asp 35 40 45 Glu Ala Glu Gln Ala Asp Asp Leu Val Gly Val Thr Leu Phe Gly His 50 55 60 Leu Asn Val Gln Asn Pro Gln Tyr Gly Val Leu Ala Asp Gly Asp Arg 65 70 75 80 Val Leu Val Val Phe Gln Gly Ser His Gly Tyr Ile Ser Pro Thr Val 85 90 95 Tyr Asp Thr Val Pro Ala Ala Pro Thr Trp Asn Phe Ser Ala Val His 100 105 110 Val Thr Gly Thr Val Arg Leu Leu Gly Pro Gly Glu Pro Ala Leu Lys 115 120 125 Val Val Arg Arg Thr Val Thr Ala Leu Glu Arg Arg Phe Gly Ala Gly 130 135 140 Trp Asp Met Thr Glu Ser Leu Pro Tyr Phe Glu Arg Ile Val Pro Gly 145 150 155 160 Val Gly Ala Phe Glu Ile Ala Val Glu Ala Val Asp Ser Ile Phe Lys 165 170 175 Leu Ser Gln Asp Gln Pro Ala Glu Leu Arg Asp Lys Ala Glu Cys Ala 180 185 190 Phe Arg Asn Ser Asp Ala Gly Val His Arg Glu Leu Ala Ala Gln Met 195 200 205 Arg Arg His Asn Gly Ala Ala Cys Ser His Gln Glu Arg Thr Ala Arg 210 215 220 Asp Gly Asp 225 159213PRTSalinispora arenicola 159Met Leu Val Pro His Met Tyr Glu Ala Pro Ser Ala Ala Gln Val Asp 1 5 10 15 Ala Val Ile Thr Gly His Pro Met Ala Val Leu Val Thr Asn Gly Pro 20 25 30 Asp Val Pro His Ala Thr His Leu Pro Val Ile Arg Thr Val Asp Thr 35 40 45 Glu Gln Thr Gly Pro Gly Ser Val Leu Leu Gly His Met Asn Arg Thr 50 55 60 Asn Pro His Trp Ser Ala Leu Thr Ser Gly Thr Pro Gly Lys Leu Ile 65 70 75 80 Phe Thr Gly Pro Asn Thr Tyr Val Cys Pro Val Leu Tyr Gln Thr Glu 85 90 95 Pro Ala Ala Pro Thr Trp Asp Phe Val Val Val His Val Ser Gly Arg 100 105 110 Val Met Pro Leu Asp Ala Gly Glu Pro Thr Leu Ala Val Val Gln Arg 115 120 125 Thr Ala Ala Thr Leu Glu Gly Ala Phe Gly Ala Gly Trp Asp His Thr 130 135 140 Gly Ser Ile Asp Tyr Phe Arg Ser Ile Val Gly Gly Val Gly Ala Phe 145 150 155 160 Glu Phe Val Val Glu Gln Val Glu Ser Met Phe Lys Leu Ser Gln Glu 165 170 175 Lys Asp His Thr Val Arg Gln Arg Leu Ile Asp Asp Phe Thr Ser Ala 180 185 190 Pro Arg Asn Gly Ser Ala Gln Val Gly Gln Leu Met Ser Asp Leu Asn 195 200 205 Leu Gly Val Ala Pro 210 160213PRTSalinispora arenicola 160Met Leu Val Pro His Met Tyr Glu Ala Pro Ser Ala Ala Gln Val Asp 1 5 10 15 Ala Val Ile Thr Gly His Pro Met Ala Val Leu Val Thr Asn Gly Pro 20 25 30 Asp Val Pro His Ala Thr His Leu Pro Val Ile Arg Thr Val Asp Thr 35 40 45 Glu Gln Thr Gly Pro Gly Ser Val Leu Leu Gly His Met Asn Arg Thr 50 55 60 Asn Pro His Trp Ser Ala Leu Thr Ser Gly Thr Pro Gly Lys Leu Ile 65 70 75 80 Phe Thr Gly Pro Asn Thr Tyr Val Cys Pro Val Leu Tyr Gln Thr Glu

85 90 95 Pro Ala Ala Pro Thr Trp Asp Phe Val Val Val His Val Ser Gly Arg 100 105 110 Val Met Pro Leu Asp Ala Gly Glu Pro Thr Leu Ala Val Val Gln Arg 115 120 125 Thr Ala Ala Thr Leu Glu Gly Ala Phe Gly Ala Gly Trp Asp His Thr 130 135 140 Gly Ser Ile Asp Tyr Phe Arg Ser Ile Val Gly Gly Val Gly Ala Phe 145 150 155 160 Glu Phe Val Val Glu Gln Val Glu Ser Met Phe Lys Leu Ser Gln Glu 165 170 175 Lys Asp His Thr Val Arg Gln Arg Leu Ile Asp Asp Phe Thr Ser Ala 180 185 190 Pro Arg Asn Gly Ser Ala Gln Val Gly Gln Leu Met Ser Asp Leu Asn 195 200 205 Leu Gly Val Ala Pro 210 161213PRTSalinispora arenicola 161Met Leu Val Pro His Met Tyr Glu Ala Pro Ser Ala Ala Gln Val Asp 1 5 10 15 Ala Val Ile Thr Gly His Pro Met Ala Val Leu Val Thr Asn Gly Pro 20 25 30 Asp Val Pro His Ala Thr His Leu Pro Val Ile Arg Thr Val Asp Thr 35 40 45 Glu Gln Thr Gly Pro Gly Ser Val Leu Leu Gly His Met Asn Arg Thr 50 55 60 Asn Pro His Trp Ser Ala Leu Thr Ser Gly Thr Pro Gly Lys Leu Ile 65 70 75 80 Phe Thr Gly Pro Asn Thr Tyr Val Cys Pro Val Leu Tyr Gln Thr Glu 85 90 95 Pro Ala Ala Pro Thr Trp Asp Phe Val Val Val His Val Ser Gly Arg 100 105 110 Val Met Pro Leu Asp Ala Gly Glu Pro Thr Leu Ala Val Val Gln Arg 115 120 125 Thr Ala Ala Thr Leu Glu Gly Ala Phe Gly Ala Gly Trp Asp His Thr 130 135 140 Gly Ser Ile Asp Tyr Phe Arg Ser Ile Val Gly Gly Val Gly Ala Phe 145 150 155 160 Glu Phe Val Val Glu Gln Val Glu Ser Met Phe Lys Leu Ser Gln Glu 165 170 175 Lys Asp His Thr Val Arg Gln Arg Leu Ile Asp Asp Phe Thr Ser Ala 180 185 190 Pro Arg Asn Gly Ser Ala Gln Val Gly Gln Leu Met Ser Asp Leu Asn 195 200 205 Leu Gly Val Ala Pro 210 162213PRTSalinispora arenicola 162Met Leu Val Pro His Met Tyr Glu Ala Pro Ser Ala Ala Gln Val Asp 1 5 10 15 Ala Val Ile Thr Gly His Pro Met Ala Val Leu Val Thr Asn Gly Pro 20 25 30 Asp Val Pro His Ala Thr His Leu Pro Val Ile Arg Thr Val Asp Thr 35 40 45 Glu Gln Thr Gly Pro Gly Ser Val Leu Leu Gly His Met Asn Arg Thr 50 55 60 Asn Pro His Trp Ser Ala Leu Thr Ser Gly Thr Pro Gly Lys Leu Ile 65 70 75 80 Phe Thr Gly Pro Asn Thr Tyr Val Cys Pro Val Leu Tyr Gln Thr Glu 85 90 95 Pro Ala Ala Pro Thr Trp Asp Phe Val Val Val His Val Ser Gly Arg 100 105 110 Val Met Pro Leu Asp Ala Gly Glu Pro Thr Leu Ala Val Val Gln Arg 115 120 125 Thr Ala Ala Thr Leu Glu Gly Ala Phe Gly Ala Gly Trp Asp His Thr 130 135 140 Gly Ser Ile Asp Tyr Phe Arg Ser Ile Val Gly Gly Val Gly Ala Phe 145 150 155 160 Glu Phe Val Val Glu Gln Val Glu Ser Met Phe Lys Leu Ser Gln Glu 165 170 175 Lys Asp His Thr Val Arg Gln Arg Leu Ile Asp Asp Phe Thr Ser Ala 180 185 190 Pro Arg Asn Gly Ser Ala Gln Val Gly Gln Leu Met Ser Asp Leu Asn 195 200 205 Leu Gly Val Ala Pro 210 163213PRTSalinispora arenicola 163Met Leu Val Pro His Met Tyr Glu Ala Pro Ser Ala Ala Gln Val Asp 1 5 10 15 Ala Val Ile Thr Gly His Pro Met Ala Val Leu Val Thr Asn Gly Pro 20 25 30 Asp Val Pro His Ala Thr His Leu Pro Val Ile Arg Thr Val Asp Thr 35 40 45 Glu Gln Thr Gly Pro Gly Ser Val Leu Leu Gly His Met Asn Arg Thr 50 55 60 Asn Pro His Trp Ser Ala Leu Thr Ser Gly Thr Pro Gly Lys Leu Ile 65 70 75 80 Phe Thr Gly Pro Asn Thr Tyr Val Cys Pro Val Leu Tyr Gln Thr Glu 85 90 95 Pro Ala Ala Pro Thr Trp Asp Phe Val Val Val His Val Ser Gly Arg 100 105 110 Val Met Pro Leu Asp Ala Gly Glu Pro Thr Leu Ala Val Val Gln Arg 115 120 125 Thr Ala Ala Thr Leu Glu Gly Ala Phe Gly Ala Gly Trp Asp His Thr 130 135 140 Gly Ser Ile Asp Tyr Phe Arg Ser Ile Val Gly Gly Val Gly Ala Phe 145 150 155 160 Glu Phe Val Val Glu Gln Val Glu Ser Met Phe Lys Leu Ser Gln Glu 165 170 175 Lys Asp His Thr Val Arg Gln Arg Leu Ile Asp Asp Phe Thr Ser Ala 180 185 190 Pro Arg Asn Gly Ser Thr Gln Val Gly Gln Leu Met Ser Asp Leu Asn 195 200 205 Leu Gly Val Ala Pro 210 164213PRTSalinispora arenicola 164Met Leu Val Pro His Met Tyr Glu Ala Pro Ser Ala Ala Gln Val Asp 1 5 10 15 Ala Val Ile Thr Gly His Pro Met Ala Val Leu Val Thr Asn Gly Pro 20 25 30 Asp Val Pro His Ala Thr His Leu Pro Val Ile Arg Thr Val Asp Thr 35 40 45 Glu Gln Thr Gly Pro Gly Ser Val Leu Leu Gly His Met Asn Arg Thr 50 55 60 Asn Pro His Trp Ser Ala Leu Thr Ser Gly Thr Pro Gly Lys Leu Ile 65 70 75 80 Phe Thr Gly Pro Asn Thr Tyr Val Cys Pro Val Leu Tyr Gln Thr Glu 85 90 95 Pro Ala Ala Pro Thr Trp Asp Phe Val Val Val His Val Ser Gly Arg 100 105 110 Val Met Pro Leu Asp Ala Gly Glu Pro Thr Leu Ala Val Val Gln Arg 115 120 125 Thr Ala Ala Thr Leu Glu Gly Ala Phe Gly Ala Gly Trp Asp His Thr 130 135 140 Gly Ser Ile Asp Tyr Phe Arg Ser Ile Val Gly Gly Val Gly Ala Phe 145 150 155 160 Glu Phe Val Val Glu Gln Val Glu Ser Met Phe Lys Leu Ser Gln Glu 165 170 175 Lys Asp His Thr Val Arg Gln Arg Leu Ile Asp Asp Phe Thr Ser Ala 180 185 190 Pro Arg Asn Gly Ser Thr Gln Val Gly Gln Leu Met Ser Asp Leu Asn 195 200 205 Leu Gly Val Ala Pro 210 165213PRTSalinispora pacifica 165Met Leu Val Pro His Met Tyr Glu Ala Pro Ser Ala Ala Gln Val Asp 1 5 10 15 Ala Val Ile Thr Gly His Pro Met Ala Val Leu Val Thr Asn Gly Pro 20 25 30 Asp Val Pro His Ala Thr His Leu Pro Val Ile Arg Thr Val Asp Thr 35 40 45 Glu Gln Thr Gly Pro Gly Ser Val Leu Leu Gly His Met Asn Arg Thr 50 55 60 Asn Pro His Trp Ser Ala Leu Thr Ser Gly Thr Pro Gly Lys Leu Ile 65 70 75 80 Phe Thr Gly Pro Asn Thr Tyr Val Cys Pro Val Leu Tyr Gln Thr Glu 85 90 95 Pro Ala Ala Pro Thr Trp Asp Phe Val Val Val His Val Ser Gly Arg 100 105 110 Val Met Pro Leu Asp Ala Gly Glu Pro Thr Leu Ala Val Val Gln Arg 115 120 125 Thr Ala Ala Thr Leu Glu Gly Ala Phe Gly Ala Gly Trp Asp His Thr 130 135 140 Gly Ser Ile Asp Tyr Phe Arg Ser Ile Val Gly Gly Val Gly Ala Phe 145 150 155 160 Glu Phe Val Val Glu Gln Val Glu Ser Met Phe Lys Leu Ser Gln Glu 165 170 175 Lys Asp His Thr Val Arg Gln Arg Leu Ile Asp Asp Phe Thr Ser Ala 180 185 190 Pro Arg Asn Gly Ser Thr Gln Val Gly Gln Leu Met Ser Asp Leu Asn 195 200 205 Leu Gly Val Ala Pro 210 166217PRTStreptomyces aureofaciens 166Val Phe Thr Pro Lys Leu Tyr Gln Val Asp Gly Asp Asp Trp Pro Leu 1 5 10 15 Arg Ile Ile Glu Arg His Pro Leu Ala Val Leu Val Ser Asn Gly Asp 20 25 30 Pro Val Pro Asn Ala Thr His Val Pro Val Ile Ala Pro Pro Asp Ala 35 40 45 Ala Pro Glu Asp Ala Leu Ser Gly Met Arg Leu Trp Ala His Leu Thr 50 55 60 Arg Ala Asn Pro His Trp Gln Gln Leu Ala Ala Ala Gly Gly Gly Pro 65 70 75 80 Ala Lys Leu Val Phe His Gly Pro Asn Gly Tyr Val Thr Pro Ser Leu 85 90 95 Tyr Ser Ala Asp Met Val Ala Pro Thr Trp Asn Tyr Val Ala Val His 100 105 110 Leu Glu Gly Thr Val Glu Leu Ala Gly Asp Asp Glu Thr Leu Ala Ile 115 120 125 Val His Thr Thr Ala Gln Thr Leu Glu Asp Arg Phe Gly Asp Gly Met 130 135 140 Ala Leu Ala Pro Ser Leu Glu Tyr His Arg Gln Ile Val Gly Ala Val 145 150 155 160 Gly Gly Leu Phe Phe Thr Val Thr Lys Val Asp Val Met Phe Lys Leu 165 170 175 Ser Gln Glu Lys Asp Pro Glu Val Gln Gln Arg Val Leu Asp Arg Phe 180 185 190 Ala Ala Ser Gly Ser Gly Leu His Arg Glu Val Ala Asp Thr Met Arg 195 200 205 Ala Leu Arg Leu Gly Gly Ser Ala Gly 210 215 167700PRTStreptomyces sp. CFMR 7 167Val Arg Asn Ala His Ala Thr His Pro Asp Asp Asp Pro Val Gly Thr 1 5 10 15 Thr Thr Glu Arg Pro Tyr Asp Leu Leu Gly Ile Gly Phe Gly Pro Ser 20 25 30 Asn Leu Ala Leu Ala Val Cys Ala Arg Glu Gln Lys Leu Pro Leu Ser 35 40 45 Cys Leu Phe Val Glu Arg Gln Asp Thr Val Ala Trp His Pro Gly Met 50 55 60 Leu Ile Asp Gly Ala Arg Met Gln Ile Ser Phe Leu Lys Asp Leu Val 65 70 75 80 Ser Leu Arg Asn Pro Ser Ser Pro Tyr Ser Phe Leu Gln Tyr Thr Lys 85 90 95 Ala Lys Gly Arg Leu Glu Arg Phe Val Asn Leu Asn Glu Ser Arg Pro 100 105 110 Thr Arg Ile Glu Tyr Asp Asp Tyr Leu Lys Trp Val Ala Gln Asp Phe 115 120 125 Ala Asp Gln Val Arg Phe Gly Ser Gln Val Asp Arg Val Thr Pro Val 130 135 140 Gln Gly Pro Asp Gly Gly Asp Leu Ser Leu Phe Arg Val Glu Thr Gln 145 150 155 160 Asp Val Ala Thr Gly Arg His Ser Val His Tyr Ala Arg Asn Val Val 165 170 175 His Ala Gly Gly Gly Arg Pro Pro Ala Arg Thr Ala Gly Val Ala Glu 180 185 190 Val Ser Ser Val Val His Ser Ser Glu Phe Leu Thr Arg Phe Pro Asp 195 200 205 Gln Phe Lys Asp His Asp Gly Ala Tyr Arg Phe Val Val Val Gly Gly 210 215 220 Gly Gln Ser Ala Gly Glu Ile Ser Glu Tyr Leu Leu Asp His Tyr Asp 225 230 235 240 Arg Ala Glu Val His Val Val Val Ser Gly Tyr Thr Leu Leu Pro Thr 245 250 255 Asp Asn Ser Pro Phe Val Asn Glu Gln Phe Tyr Ser Gly Asn Ala Asp 260 265 270 Ala Phe Tyr Arg Met Arg Pro Glu Gln Arg Ala Ala Val Ser Gly Arg 275 280 285 Leu Arg Ala Ala Asn Tyr Gly Val Val Arg Glu Asp Leu Leu Glu Arg 290 295 300 Leu Phe Asn Thr Asp Tyr Leu Asp Gln Val Lys Gly Arg Lys Arg Leu 305 310 315 320 His Ile His Pro Phe Ser Arg Leu Ser Glu Val Arg Glu Asn Gly Asp 325 330 335 Ala Leu Ala Val Thr Leu Arg Gln His Leu Asp Glu Gly Pro Glu Glu 340 345 350 Pro Leu Arg Cys Asp Gly Val Val Leu Ala Thr Gly Tyr Asp Arg Ser 355 360 365 Leu Asp Pro Ala Val Phe Gly Asp Val Leu Pro His Leu Thr Ala Gly 370 375 380 Glu Gly Glu Gly Val Gly Gly Val Ala Leu Ser Arg His Tyr Arg Ala 385 390 395 400 Arg Thr Ser Pro Glu Leu Arg Ala Gly Leu Tyr Leu Gln Gly Phe Gly 405 410 415 Glu Ala Gln Phe Gly Leu Gly Asp Thr Leu Leu Ser Leu Leu Pro Phe 420 425 430 Arg Ser Gln Glu Ile Val Glu Asp Ile Ala Asp Arg Val Pro Val Ala 435 440 445 Gly Val Gly Gly Cys Pro Val Met Ser Pro Tyr Gly Ser Gly Val Val 450 455 460 Ser Thr Ser Pro His Gly Pro Ala Arg Ser Ala Val Tyr Pro Pro Lys 465 470 475 480 Trp Tyr Leu Glu His Asp Arg Glu Lys Leu Tyr Gly Leu Met Glu Arg 485 490 495 Phe Arg Phe Ala Thr Leu Ile Ser Ala Arg Ser Gly Asp Gln Pro Phe 500 505 510 Ala Thr His Leu Pro Leu Ile Leu Asp Arg Ser Arg Gly Ala Asn Gly 515 520 525 Val Leu Phe Gly His Leu Asp Arg Gly Asn Glu His Ala Asp Leu Ile 530 535 540 Asp Gly Arg His Met Leu Ala Val Phe His Gly Pro Asn Ala Tyr Met 545 550 555 560 Pro Pro Gly Val Phe Glu Ser Asp Pro Leu Pro Thr Trp Asn Ser Met 565 570 575 Ser Val His Val Arg Gly Arg Val Arg Val Val Arg Asp Arg Asp Ala 580 585 590 Leu Val His Gly Leu Ile Gly Ile Ala Glu Arg Ser Gln Pro Asp Asn 595 600 605 Arg Leu Ala Ala Asp Asp Pro Arg Ile Asp Arg Ile Ile Gly Ser Ile 610 615 620 Val Gly Phe Glu Phe Glu Val Glu Glu Leu Val Gly Arg Phe Lys Leu 625 630 635 640 Ser Gln Asp Arg Asp Glu Thr Asp Arg Arg His Ala Ala Val Ala Leu 645 650 655 Ala Arg Ala Thr Glu Arg Gly Glu Arg Asp Phe Ile Glu Tyr Val Val 660 665 670 Gly Leu Ser Leu Ile Thr Glu Asp Asp Pro Arg Asp Leu Ala Gly Arg 675 680 685 Pro Leu Ser Pro Leu Ala Ile Gly Gly Val His Glu 690 695 700 168672PRTMicromonospora tulbaghiae 168Met Arg Asn Asp Pro Ala Pro Asp Ala Arg Ser Ser Glu Pro Gly Ser 1 5 10 15 Glu Gln Asn Pro Tyr Asp Leu Ile Gly Val Gly Phe Gly Pro Ser Asn 20 25 30 Leu Ala Leu Ala Ile Ala Ala Glu Glu Leu Asp Gly Glu Arg Thr Cys 35 40 45 Leu Phe Phe Glu Arg Ser Pro Ser Leu Gln Trp His Pro Gly Met Leu 50 55 60 Leu Glu Gly Ser Arg Met Gln Ile Ser Phe Leu Lys Asp Leu Val Ser 65 70 75 80 Leu Arg Asn Pro Ala Ser Pro Tyr Thr Phe Leu Gln Tyr Ala Lys Ala 85 90 95 Lys Asp Arg Leu Glu Arg Phe Val Asn Leu Ser Glu Phe Arg Pro Thr 100 105 110 Arg Leu Glu Tyr Gln Asp Tyr Leu Arg Trp Val Ala Glu Phe Phe Ala 115 120 125 Gly Gln Val Arg Tyr His Thr Glu Val Thr Arg Val Ser Pro Val Arg 130 135 140 Arg Pro Gly Glu Asp Val His Arg Leu Phe Arg Val Glu Ala Arg Asp 145 150 155

160 Ile Arg Thr Gly Glu Thr Thr Val His His Ala Ala Asn Val Val His 165 170 175 Ala Ala Gly Gly Arg Pro Arg Leu Pro Pro Gly Gly Val Cys Ala Ser 180 185 190 Pro Ala Val Ile His Ser Ser Asp Phe Leu Pro His Phe Pro Glu Arg 195 200 205 Phe Ala Asp Arg Ser Arg Pro Tyr Glu Phe Ala Val Ala Gly Asp Gly 210 215 220 Gln Ser Ala Gly Glu Val Ala Leu Tyr Leu Met Arg Thr Tyr Pro Glu 225 230 235 240 Ser Arg Val His Leu Phe Leu Ser Gly Gln Ala Leu Arg Ala Thr Asp 245 250 255 Asn Ser Pro Phe Val Asn Glu Gln Phe Phe Glu Ser Ser Ala Asn Ala 260 265 270 Phe Ser Ala Arg Pro Arg Asp Glu Arg Thr Ala Leu Arg Ala Glu Leu 275 280 285 Arg Asn Thr Asn Tyr Gly Val Val Glu Ala Gly Thr Leu Asp Asp Leu 290 295 300 Tyr Arg Thr Val Tyr Asp Asp Glu Val Arg Gly Arg His Arg Leu Ile 305 310 315 320 Val His Pro Ala Thr Arg Val Val Ala Val Arg Glu Gly Asp Glu Gly 325 330 335 Pro Leu Val Ala Ile Leu Asp Arg Arg Ser Gly Ala Glu Gly Glu Ile 340 345 350 Arg Cys Asp Gly Val Val Leu Ala Thr Gly Tyr Val Arg Ala Leu Asp 355 360 365 Glu Ser Ile Phe Ser Glu Leu Thr Pro Phe Leu Arg Thr Glu Ser Asp 370 375 380 Lys Leu Leu Leu Ser Gly Tyr Arg Val Arg Thr Thr Ala Glu Val Ala 385 390 395 400 Gly Gly Phe Tyr Val Gln Gly Tyr Gly Glu Gln His Phe Gly Leu Gly 405 410 415 Asp Thr Leu Leu Ser Leu Leu Pro Phe Arg Ser Arg Gln Ile Phe Thr 420 425 430 Asp Ile Cys Arg Arg Thr Pro Pro Pro Arg Gln Ala Val Ala Val Ser 435 440 445 Asp Ala Ser Ala Tyr Pro Pro Pro His Tyr Leu Glu His Asp Pro Glu 450 455 460 Lys Leu Tyr Ala Val Met Glu Arg Phe Asn Phe Ala Thr Val Ile Ser 465 470 475 480 Ala Arg Ala Ala Glu Asp Pro Val Val Thr His Val Pro Leu Thr Leu 485 490 495 Asp Arg Ser Arg Gly Ala His Gly Val Leu Phe Gly His Leu Asp Arg 500 505 510 Ala Asn Pro His Ala Gln Leu Ile Asp Gly Lys Gln Val Thr Val Val 515 520 525 Phe His Gly Pro Asn Thr Tyr Leu Ser Pro Tyr Ala Leu Glu Thr Asp 530 535 540 Ala Leu Pro Thr Trp Asn Ser Met Asn Val His Val Gly Gly Arg Gly 545 550 555 560 Arg Leu Leu Ala Asp Arg Ala Ala Leu Val Thr Gly Leu Ser Gly Ile 565 570 575 Cys Glu Lys Ser Asp Pro Gly Val Asp Ser Tyr Arg Leu Asp Pro Asp 580 585 590 Asp Pro Arg Ile Asp Arg Leu Val Asp Tyr Val Val Gly Phe Glu Ile 595 600 605 Glu Ile Gln Ala Leu Val Gly Arg Phe Lys Leu Ser Gln Glu Leu Asp 610 615 620 Asp Arg Asn Arg Arg Leu Ala Ala Ser Ala Leu Met Ala Thr Ala Arg 625 630 635 640 Arg Asp Glu Ser Glu Val Ile Gly Lys Val Phe Gly Met Ser Pro Val 645 650 655 Asn Gly Arg Gln Asn Gly Ser Ser Ala Leu Trp Ser Ala His Ser Arg 660 665 670 169661PRTAmycolatopsis alba 169Met Arg Asn Asp Ala Pro Pro Asn Pro Leu Thr Ala Glu Leu Gly Ala 1 5 10 15 Glu Gly Asn Pro Tyr Asp Leu Ile Gly Val Gly Phe Gly Pro Ser Asn 20 25 30 Leu Ala Leu Ala Ile Ala Ala Glu Glu Leu Asp Ser Glu Arg Asn Cys 35 40 45 Leu Phe Phe Glu Arg Ser Ser Arg Leu Arg Trp His Pro Gly Met Leu 50 55 60 Ile Asp Gly Ser Arg Met Gln Ile Ser Phe Leu Lys Asp Leu Val Ser 65 70 75 80 Leu Arg Asn Leu Ala Ser Pro Tyr Thr Phe Leu Gln Tyr Thr Lys Ala 85 90 95 Lys Gly Arg Leu Glu Gln Phe Val Asn Leu Asn Asp Phe Arg Pro Thr 100 105 110 Arg Leu Glu Tyr Gln Asp Tyr Leu Glu Trp Val Ala Glu Ser Phe Ser 115 120 125 Gly Gln Val Arg Tyr Asn Ser Glu Val Thr Arg Val Thr Pro Val Arg 130 135 140 Arg Thr Gly Glu Asp Ala His Arg Leu Phe Arg Val Glu Ala Arg Asp 145 150 155 160 Val Val Thr Gly Gln Thr Thr Val Arg Tyr Ala Ala Asn Val Val His 165 170 175 Ala Ala Gly Gly Arg Pro Arg Leu Pro Asp Gly Gly Val Cys Asp Ser 180 185 190 Pro Ala Val Val His Ser Ser Asp Phe Leu Pro Arg Phe Pro Gly His 195 200 205 Phe Ala Asp Arg Ser Arg Pro Tyr Glu Phe Gly Val Ala Gly Asp Gly 210 215 220 Gln Ser Ala Gly Glu Ile Ala Ala Tyr Leu Leu Ser Arg Tyr Pro Ala 225 230 235 240 Ser Arg Val His Leu Leu Leu Ser Gly Ser Ala Leu Arg Ala Ala Asp 245 250 255 Ser Asn Pro Phe Val Asn Glu Gln Phe Phe Glu Gly Arg Ala Asn His 260 265 270 Phe His Ala Arg Thr Lys Pro Asp Arg Thr Gly Leu Leu Ala Glu Leu 275 280 285 Arg Asn Thr Asn Tyr Ala Val Val Glu Pro Gly Phe Leu Asp Asp Leu 290 295 300 Tyr Arg Leu Val Tyr Asp Asp Glu Val Arg Gly Thr Arg Arg Leu Ile 305 310 315 320 Val His Pro Gly Thr Lys Val Thr Ala Val Gly Ala Asp Gly Ala Ser 325 330 335 Leu Arg Val Ala Val Thr Asp Arg Arg Gly Gly Asp Glu Glu Met Arg 340 345 350 Cys Asp Gly Val Val Leu Ala Thr Gly Tyr Val Arg Ala Leu Asp Glu 355 360 365 Ser Met Phe Ala Asp Leu Leu Pro Phe Leu Arg Glu Glu Ser Gly Asp 370 375 380 Leu Val Leu Ser Pro Asp Tyr Arg Val Gly Thr Thr Ala Glu Leu Glu 385 390 395 400 Gly Gly Phe Tyr Val Gln Gly Tyr Gly Glu Ser Ser Phe Gly Leu Gly 405 410 415 Asp Thr Leu Leu Ser Leu Leu Pro Phe Arg Ala Lys Gln Ile Phe Thr 420 425 430 Asp Ile Cys Lys Gln Thr Pro Pro Pro Val Arg Thr Arg Arg Pro Val 435 440 445 Glu Val Ser Lys Ala Ser Ala Tyr Pro Pro Pro His Tyr Val Glu Thr 450 455 460 Asp Pro Lys Lys Ile Tyr Ala Val Met Glu Arg Phe Ser Phe Ala Thr 465 470 475 480 Leu Ile Ser Ala Arg Gly Ala Glu Asp Pro Val Val Thr His Leu Pro 485 490 495 Leu Thr Leu Asp Arg Ala Arg Gly Ala His Gly Val Leu Phe Gly His 500 505 510 Leu Asp Arg Ala Asn Pro His Val Gln Leu Ile Asp Gly His Gln Leu 515 520 525 Thr Val Leu Phe His Gly Pro Asn Ala Tyr Leu Ser Pro Gln Val Phe 530 535 540 Glu Thr Ser Val Leu Pro Thr Trp Asn Ser Met Asn Val His Val Arg 545 550 555 560 Gly Arg Gly Arg Leu Leu Pro Asp Arg Ala Ala Leu Leu Ala Gly Leu 565 570 575 Ser Gly Ile Cys Val Lys Ser Asp Pro Gly Asp Asp Ser Tyr Arg Leu 580 585 590 Asp Leu Asp Asp Pro Arg Ile Asp Arg Met Ile Glu His Ile Val Gly 595 600 605 Phe Glu Ile Glu Ile His Glu Leu Val Gly Arg Phe Lys Leu Ser Gln 610 615 620 Glu Leu Asp Asp Gln Asn Arg Met Leu Ala Ala Ser Ala Leu Ser Ala 625 630 635 640 Thr Ala Arg Arg Gly Glu Leu Glu Leu Ile Glu Glu Val Val Gly Leu 645 650 655 Asn Val Val Gln Gly 660 170682PRTMycobacterium sp. IS-1556 170Met Thr Ser Met Pro Pro Gly Glu Gly His Asp Ser Asp Leu Asp Phe 1 5 10 15 Ile Gly Ile Gly Phe Gly Pro Ser Asn Leu Ala Leu Ala Val Ala Ala 20 25 30 Asp Glu Ile Val Pro Asp Arg Lys Gly Leu Phe Phe Glu Arg Ser Gly 35 40 45 Thr Phe Gln Trp His Pro Gly Met Leu Leu Asp Gly Thr Lys Met Gln 50 55 60 Ile Ser Phe Leu Lys Asp Leu Ala Thr Leu Arg Asn Pro Ala Ser Arg 65 70 75 80 Tyr Thr Phe Leu Gln Tyr Ala Lys Ala Arg Gly Arg Leu Glu Gln Phe 85 90 95 Val Asn Leu His Glu Phe His Pro Ser Arg Leu Glu Tyr Asn Asp Tyr 100 105 110 Leu Arg Trp Val Ala Glu Phe Phe Thr Asp Arg Val Cys Tyr Asn Thr 115 120 125 Ile Val Thr Ala Val Val Pro Val Gly His Ser Pro Ser Ser Asn Gly 130 135 140 His Leu Thr Arg Phe Arg Val His Val Arg Asp Met Ala Thr Gly Ala 145 150 155 160 Glu Ser Cys Phe Phe Thr Ala Asn Val Ile Phe Gly Gly Gly Gly Val 165 170 175 Pro Arg Leu Leu Gly Ala Arg Ala Asp Ala Ser Ala Val Leu His Ser 180 185 190 Ser Ala Phe Leu Pro Asn Phe Thr Asn Arg Phe Asn Glu Ser Gln Lys 195 200 205 Pro Tyr Arg Phe Ala Val Ile Gly Asn Gly Gln Ser Ala Ala Glu Ile 210 215 220 Val Asp Tyr Leu Leu Asn His Tyr Pro Gly Ala Thr Ile His Leu Phe 225 230 235 240 Ile Ser Asp Cys Thr Leu Arg Ala Thr Asp His Ser Pro Phe Ile Asn 245 250 255 Glu His Phe Phe Ser Thr Ser Ala Ala Asp Phe Tyr Asn His Pro Pro 260 265 270 Ala Gln Arg Val Ala Leu Arg Ser Ala Leu Arg Ser Thr Asn Tyr Gly 275 280 285 Val Val Asp Ala Asp Leu Leu Gln Lys Leu Tyr Gln Ile Thr Tyr Leu 290 295 300 Asp Glu Val Lys Gly Cys Arg Arg Leu Leu Leu His Arg Glu Ser Arg 305 310 315 320 Leu Ser Gln Ile Glu Glu Ile Asp Asp Gln Val Val Ala Ser Phe Glu 325 330 335 Asp Arg Phe Ser Gly Asp Ser Ser Glu Phe His Phe Asp Gly Ala Val 340 345 350 Leu Ala Thr Gly Tyr Glu Arg Val Leu Asp Ala Glu Val Phe Arg His 355 360 365 Val Leu Pro His Val Leu Trp Asp Glu Ser Gly Ala Ile Ser Leu Thr 370 375 380 Arg Ser Cys Arg Val Asn Thr Val Pro Ala Val Thr Ala Arg Leu Phe 385 390 395 400 Leu Gln Gly Tyr Gly Glu Ala Trp Phe Gly Ile Gly Asp Thr Leu Leu 405 410 415 Ser Leu Leu Pro Phe Arg Ala Gln Ala Ile Ala Gln Glu Ile Gly Asn 420 425 430 Ala Pro Ser Gly Ala Pro Ile Arg Arg Lys Gln Arg Val His Gly Glu 435 440 445 Tyr Pro Pro Lys Arg Tyr Leu Glu Thr Asp Pro Asp Arg Leu His Asp 450 455 460 Val Ile Asn Arg Tyr Arg Phe Ala Thr Leu Val Ser Ala Ser Gly Val 465 470 475 480 Asp Glu Pro Val Val Thr Gln Leu Pro Leu Thr Leu Asp Thr Ser Arg 485 490 495 Gly Ser Leu Gly Val Leu Phe Gly His Met Asp Phe Ala Asn Pro His 500 505 510 Thr Glu Leu Leu Asp Gly Arg Arg Val Leu Val Leu Phe His Gly Pro 515 520 525 Asn Gly Tyr Ile Ser Pro His Val Tyr Glu Ser Ala Gln Leu Pro Thr 530 535 540 Trp Asn Ser Ile Thr Val Glu Val Arg Gly Arg Ala Arg Ile Leu Arg 545 550 555 560 Asp Lys Asp Ala Val Val Asn Gly Leu Arg Gly Ile Ala Ala Ala Ala 565 570 575 Asp Pro Thr Pro Gly Gly Phe Arg Leu Thr Arg Glu Ala Ala Ser Asp 580 585 590 Gln Arg Leu Phe Pro Leu Leu Val Gly Phe Glu Ile Asp Ile Asp Asp 595 600 605 Met Arg Gly Arg Phe Lys Leu Ser Gln Glu Arg Asp Asp Arg Asp Arg 610 615 620 Trp His Ala Ala His Ala Leu Ala Asn Gly Val Glu Gln Asp Asp Arg 625 630 635 640 Asp Leu Ile Ser Ser Ile Val Gly Leu Pro Leu Asp Val Asp Glu Glu 645 650 655 Pro Lys Pro Gln Gln Gln Ala Gln Ile His Gln Tyr Gly Asn Ala Pro 660 665 670 Ala Asp Thr Ala Tyr Arg Arg Val Asp Gly 675 680 171710PRTStreptomyces sp. Root55 171Met Ser Ser Glu Ala Gly Ala Val Phe Pro Cys Ala Asn Gly Arg Pro 1 5 10 15 Ala Ala Glu Val Ala Pro Gly Pro Ser Arg Gly Ser His Pro Ala Asp 20 25 30 Pro Tyr Asp Leu Ile Gly Val Gly Phe Gly Pro Ser Asn Met Ala Leu 35 40 45 Ala Ile Ala Val Glu Glu Leu Asp Pro Gly Arg Ser Cys Leu Phe Leu 50 55 60 Glu Arg Asn Thr Gly Val Arg Trp His Pro Gly Met Leu Ile Glu Gly 65 70 75 80 Ala Arg Met Gln Ile Ser Tyr Leu Lys Asp Leu Val Ser Leu Arg Asn 85 90 95 Leu Ala Ser Pro Tyr Thr Phe Leu Ser Tyr Leu Lys Ala Lys Gly Arg 100 105 110 Leu Glu Lys Phe Ile Asn Val Gly Ala Ser Arg Pro Thr Arg Leu Glu 115 120 125 Tyr Gln Asp Tyr Leu Ser Trp Val Ala Glu Asp Phe Gly His Val Val 130 135 140 Arg Tyr Glu Ser Glu Val Val Ala Val Val Pro Val Ala Gly Pro Gly 145 150 155 160 Ser Glu Thr Leu Asp Leu Leu Arg Val Arg Val Arg Asp Ala Gly Ser 165 170 175 Ala Glu Phe His Asp Leu Tyr Ala Arg Asn Val Val His Ala Gly Gly 180 185 190 Gly Thr Pro Arg Arg Gly Ala Pro Gly Gln Ile Cys Asp Ala Ser Ser 195 200 205 Val Ile His Ser Ser Thr Phe Leu Asp Ala Phe Pro Ala Arg Phe Pro 210 215 220 Asp His Asp Ala Ala Leu Asp Leu Gly Val Val Gly Asp Gly Gln Ser 225 230 235 240 Ala Ala Glu Ile Thr Ser His Val Leu Lys Gly Tyr Pro Asn Ala Arg 245 250 255 Val His Leu Phe Val Pro Gly Tyr Ala Leu Arg Ala Thr Asp Asn Asn 260 265 270 Pro Phe Ala Asn Glu Gln Phe Tyr Gln Arg Asn Ala Gly Glu Phe Tyr 275 280 285 Ala Ser Gly Ala Arg Arg Arg Thr Ile Leu Arg Thr Glu Leu Arg Asn 290 295 300 Thr Asn Tyr Gly Ala Val Glu Ala Gly His Leu Asp Glu Leu Tyr Asp 305 310 315 320 Ile Thr Tyr Ala Asp Glu Val Arg Gly Ala Pro Arg Leu Val Val His 325 330 335 Arg Ala Ser His Val Ser Arg Val Val Glu Asp Gly Glu Arg Leu Ser 340 345 350 Val Glu Val Arg Asp Arg Thr Asp Gly Pro Asp Arg Thr Met Val Cys 355 360 365 Asp Gly Leu Val Leu Ala Thr Gly Tyr Thr Arg Glu Leu His Pro Ala 370 375 380 Val Phe Gly Glu Leu Thr Pro Leu Leu Ser Arg Asp Asp Ser Gly Glu 385 390 395 400 Leu Leu Val Thr Ala Asp Cys Arg Val Arg Thr Asp Glu Arg Val Thr 405 410 415 Ala Gly Phe Tyr Val Gln Gly Tyr Ala Glu Ser Ala Tyr Gly Ile Gly 420 425 430 Asp Thr Leu Leu Ser Leu Leu Pro Phe Arg Ser Gln Gln Ile

Val Asp 435 440 445 Asp Ile Arg Gly Arg Leu Pro Ala Gly Arg Pro Val Ala Val Glu Glu 450 455 460 Ser Ala Pro Tyr Pro Pro Ser His Tyr Val Glu Thr Asp Leu Asp Arg 465 470 475 480 Ile Arg Ser Leu Met Glu Arg Phe Asn Phe Ala Thr Val Ile Ser Val 485 490 495 Ala Arg Asp Ala Arg Val Leu Val Thr His Val Pro Leu Val Val Glu 500 505 510 Arg Asp Arg Gly Gly Glu His Gly Met Leu Ile Gly His Leu Asp Arg 515 520 525 Ser Asn Pro Gln Val Glu Leu Leu Arg Asp Arg Pro Val Thr Val Val 530 535 540 Phe His Gly Pro Asp Ala Tyr Leu Ser Pro Asp Val Leu Lys Thr Asp 545 550 555 560 Arg Leu Pro Thr Trp Asn Ser Met Ser Val His Val Arg Gly His Ala 565 570 575 Arg Leu Phe Ser Gly Arg Asp Glu Leu Met Arg Val Phe Asn Gly Leu 580 585 590 Cys Glu Gln Ala Glu Gly Glu Ser Gly Ser Tyr Trp Leu Arg Pro Asp 595 600 605 Asp Thr Arg Ile Glu Gln Leu Arg Gly Gln Val Val Gly Phe Glu Val 610 615 620 Asp Ile His Glu Leu Thr Gly Arg Phe Lys Leu Ser Gln Glu Leu Asp 625 630 635 640 Glu Ala Asn Arg Glu Leu Ala Ala Ala Asp Met Ala Arg Gly Thr Ser 645 650 655 Ala Glu Arg Gln Ala Phe Ile Glu Arg Ala Phe Asp Leu Gln Pro Arg 660 665 670 Pro Asp Val Leu Gly Pro Pro Gly Gly Pro Gly Val Gly Gly Cys Pro 675 680 685 Val Gly Gly Ala Arg Ala Ala Gly Gly Thr Thr Ala Val Ala Asp Asn 690 695 700 Glu Arg Glu Thr Ala Arg 705 710 172627PRTStreptomyces sp. 2AW 172Met Leu Asp Leu Leu Gly Ile Gly Phe Gly Pro Ser Asn Val Ala Leu 1 5 10 15 Ala Ala Ala Met Ala Glu Gly Gly Lys Pro Pro Arg Ala Leu Phe Leu 20 25 30 Glu Ala Lys Glu Arg Phe Gly Trp His Pro Gly Met Leu Leu Asp Gly 35 40 45 Ala Arg Met Gln Ile Ser Phe Leu Lys Asp Leu Val Thr Leu Arg Asn 50 55 60 Pro Glu Ser Pro Tyr Ser Phe Leu Ala Tyr Leu Lys Ala Lys Gly Arg 65 70 75 80 Leu Glu Glu Phe Ala Asn Leu Arg Glu Phe Tyr Pro Ser Arg Ile Glu 85 90 95 Phe Gln Asp Tyr Leu Arg Trp Val Ala Gly His Phe Glu His Gln Ala 100 105 110 Val Phe Gly Ala Arg Val Ala Ser Val Ser Pro Asp Phe Gly Ile Asp 115 120 125 Gly Met Ala Arg Ser Phe Thr Val Arg Ala Glu Leu Ala Asp Ser Gly 130 135 140 Glu Tyr Val Thr Tyr Gln Ala Arg Asn Val Val Tyr Ala Pro Gly Gly 145 150 155 160 Thr Pro Asn Arg Val Ala Gly Val Ala Pro Arg Asp Glu Arg Val Ile 165 170 175 His Thr Ala Glu Phe Leu Glu Arg Phe Pro Lys Ser Phe Pro Asp His 180 185 190 Ser Ala Asp Leu Ser Phe Ala Val Val Gly Gly Gly Gln Ser Ala Ala 195 200 205 Glu Ile Ile Glu Tyr Ile Leu Ala Lys Tyr Pro Leu Ser Arg Val His 210 215 220 Ala Ile Leu Pro Gly Tyr Ser Phe Arg Pro Ala Asp Asp Ser Pro Tyr 225 230 235 240 Ser Asn Glu Val Phe Phe Ser Ala Glu Val Asp Asp His Phe Thr Ala 245 250 255 His Asp Gln Ala Ala Arg Leu Ala Glu Ala Arg Ser Thr Asn Tyr Gly 260 265 270 Val Val Asp Leu Asp Leu Ile Glu Asp Leu Tyr Arg Met Gly Tyr Glu 275 280 285 Asp Gln Val Arg Gly Asn Val Pro Arg Leu Thr Phe Cys Arg Ser Ser 290 295 300 Arg Leu Leu Ser Ala Asp Ala Gly Pro Ser Gly Ile Glu Val Thr Val 305 310 315 320 Gly Gly Pro Glu Gly Ser Arg Ser Leu Asn Leu Asp Gly Leu Val Leu 325 330 335 Ala Thr Gly Tyr His Arg Glu Leu Asp Pro Glu Met Phe Arg Asp Val 340 345 350 Ile Pro His Leu Gln Arg Asn Glu Ser Gly Asn Phe Leu Val Ser Arg 355 360 365 Ala Tyr Arg Ala Asp Ser Val Pro Glu Leu Thr Ala Gly Ile Tyr Phe 370 375 380 Gln Gly Leu Thr Glu Leu Ser His Gly Ile Gly Asp Thr Leu Leu Ser 385 390 395 400 Leu Leu Ser Phe Arg Ser Ala Glu Ile Ala Glu Asp Val Arg Lys Arg 405 410 415 Ser Glu Val Pro Ser Ala Asp Glu Val Glu Tyr Pro Pro Ala Arg His 420 425 430 Ile Glu Pro Tyr Arg Ala Ala Ile Leu Glu Thr Leu Gln Arg Phe Pro 435 440 445 Leu Ala Thr Leu Ile Ser Ser Asp Asp Glu Ser Glu Val Phe Ala Thr 450 455 460 His Leu Pro Leu Ile Leu Asp Arg Glu Arg Gly Glu Gln Gly Val Leu 465 470 475 480 Phe Gly His Leu Asp Val Gly Asn Pro Gln Val Pro Asn Leu Asn Gly 485 490 495 Arg Arg Val Leu Ala Val Phe His Gly Pro Asn Ser Tyr Ile Ser Pro 500 505 510 Arg Thr Tyr Thr Thr Asp Gln Leu Pro Thr Trp Asn Tyr Val Ala Val 515 520 525 His Val Arg Gly His Val Arg Val Leu Glu Asn Gln Asp Gln Val Val 530 535 540 Ser Gly Leu Ala Ser Ile Ser Glu Lys Ala Asp Arg Ser Asp Gly Ala 545 550 555 560 Tyr Arg Leu Asp Glu Asn Asp Ser Arg Ile Glu Lys Leu Ile Gly Gly 565 570 575 Ile Val Gly Phe Glu Leu Asp Ile Glu Ser Leu Thr Gly Arg Phe Lys 580 585 590 Leu Ser Gln Asp Arg Ser Asp Glu Asp Arg Lys Arg Ala Met Ala Val 595 600 605 Leu Arg Glu Gly Ala Gly Asp Glu His His Asp Phe Val Ala Arg Ile 610 615 620 His Gln Gln 625 173703PRTStreptomyces sp. SolWspMP-5a-2 173Met Pro Lys Lys Gly Gly Ala Val Thr Pro Arg Ala Gln Gly Leu Pro 1 5 10 15 Ser Gly Glu Ala Gly Pro Ala Pro Arg Arg Gly Thr Asp Pro Ala Asp 20 25 30 Pro Leu Asp Leu Ile Gly Ile Gly Phe Gly Pro Ser Asn Leu Ala Leu 35 40 45 Ala Ile Ala Ala Glu Glu Leu Asp Pro Ala Ala Asp Arg Leu Phe Leu 50 55 60 Glu Arg Asn Ala Gly Val His Trp His Pro Gly Met Leu Leu Glu Gly 65 70 75 80 Ala Arg Met Gln Ile Ser Tyr Leu Lys Asp Leu Val Ser Leu Arg Asn 85 90 95 Leu Ala Ser Pro Tyr Thr Phe Leu Ser Tyr Leu Lys Ala Lys Gly Arg 100 105 110 Leu Glu Lys Phe Ile Asn Ile Gly Val Thr Arg Pro Thr Arg Leu Glu 115 120 125 Tyr Gln Asp Tyr Leu Thr Trp Val Ala Gly His Phe Ala Asp Val Val 130 135 140 Arg Tyr Arg Ser Glu Val Val Ser Val Thr Pro Val Ser Gly Pro Gly 145 150 155 160 Ser Thr Ala Leu Asp Leu Leu His Val Arg Val Arg Asp Thr Ala Thr 165 170 175 Gly Thr Pro Tyr Ser Leu Tyr Ala Arg Asn Val Val His Ala Gly Gly 180 185 190 Gly Thr Pro Arg Arg Gly Thr Pro Asp Arg Ile Cys Asp Thr Pro Ser 195 200 205 Val Ile His Ser Ser Arg Phe Leu Pro Ala Phe Pro Arg Arg Phe Pro 210 215 220 Asp His Asp Ala Ala Leu Asp Leu Gly Val Val Gly Asp Gly Gln Ser 225 230 235 240 Ala Ala Glu Ile Ala Ala His Met Leu Thr His Tyr Pro Asp Ala Thr 245 250 255 Val His Leu Phe Val Pro Gly Tyr Ala Leu Arg Ala Thr Asp Asn Asn 260 265 270 Pro Phe Val Asn Glu Gln Phe Tyr Arg His Asn Ala Asp Ala Phe Tyr 275 280 285 Ala Asp Glu Pro His Arg Arg Ala Leu Leu Arg Thr Glu Leu Arg Asn 290 295 300 Thr Asn Tyr Gly Ala Val Glu Ala Gly Tyr Leu Asp Thr Leu Tyr Asp 305 310 315 320 Ile Thr Tyr Ala Asp Glu Val Arg Gly Ala Pro Arg Leu Leu Val His 325 330 335 Arg Gly Cys Asp Val Thr Arg Ile Thr Glu Asp Gly Pro Arg Leu Asp 340 345 350 Val Leu Val Arg Asp Arg Thr Gly Gly Pro Asp Arg Thr Val Arg Cys 355 360 365 Asp Gly Val Val Leu Ala Thr Gly Tyr Thr Arg Ala Leu Asp Pro Ala 370 375 380 Val Phe Ala Gly Leu Asp Pro Leu Leu Arg Arg Asp Glu Ser Gly Ala 385 390 395 400 Leu Leu Val Ser Ala Asp Cys Arg Val Asp Ala Glu Ala Pro Leu Thr 405 410 415 Ala Gly Phe Tyr Val Gln Gly Tyr Ala Glu Gly Ala Tyr Gly Ile Gly 420 425 430 Asp Thr Leu Leu Ser Leu Leu Pro Phe Arg Ser Gln Arg Ile Ile Asp 435 440 445 Asp Leu Arg Ala Arg Arg Pro Glu Asp Leu Pro Ser Gly Gly Pro Tyr 450 455 460 Pro Pro Asp His Tyr Val Glu Lys Asp Leu Glu Arg Val Arg Ala Val 465 470 475 480 Met Glu Arg Phe Asn Phe Ala Thr Val Ile Ser Ala Asp Arg Asp Ala 485 490 495 Arg Val Leu Val Thr His Val Pro Leu Val Val Glu Arg Asp Arg Gly 500 505 510 Gly Glu His Gly Thr Leu Ile Gly His Leu Asp Arg Ser Asn Pro Gln 515 520 525 Val Glu Leu Leu Arg Asp Arg Pro Val Thr Val Val Phe His Gly Pro 530 535 540 Asn Ser Tyr Leu Ser Pro Asp Val Leu Thr Thr Asp Lys Leu Pro Thr 545 550 555 560 Trp Asn Ser Met Ser Val His Val Arg Gly His Ala Arg Leu Phe Ser 565 570 575 Gly Arg Asp Glu Leu Met Arg Val Phe Asn Gly Leu Cys Glu Gln Ala 580 585 590 Glu Pro Gly Pro Gly Ser Tyr Arg Leu Arg Pro Asp Asp Glu Arg Ile 595 600 605 Asp Gln Leu Leu Gly His Val Val Gly Phe Glu Val Asp Ile Gln Glu 610 615 620 Val Thr Gly Arg Phe Lys Leu Ser Gln Asp Leu Asp Glu Asp Asn Arg 625 630 635 640 Ala Leu Ala Ala Ala Asp Met Gln Arg Asp Leu Gly Glu Glu Arg Arg 645 650 655 Thr Phe Val Ala Asp Val Phe Asp Leu Ala Pro Arg Pro Asp Gly Pro 660 665 670 Glu Ala Gly Pro Arg Ala Cys Gly Cys Pro Leu Gly Gly Pro Pro Ala 675 680 685 Gly Thr Gly Ala Ala Leu Ala Glu Glu Ala Gly Gln Thr Val Arg 690 695 700 174694PRTStreptomyces sp. ScaeMP-e83 174Val Arg Asn Ala His Ala Thr His Pro Asp Asp Asp Pro Val Gly Thr 1 5 10 15 Thr Thr Glu Arg Pro Tyr Asp Leu Leu Gly Ile Gly Phe Gly Pro Ser 20 25 30 Asn Leu Ala Leu Ala Val Cys Ala Arg Glu Gln Lys Leu Pro Leu Ser 35 40 45 Cys Leu Phe Val Glu Arg Gln Asp Thr Val Ala Trp His Pro Gly Met 50 55 60 Leu Ile Asp Gly Ala Arg Met Gln Ile Ser Phe Leu Lys Asp Leu Val 65 70 75 80 Ser Leu Arg Asp Pro Ser Ser Pro Tyr Ser Phe Leu Arg Tyr Thr Lys 85 90 95 Ala Lys Gly Arg Leu Glu Arg Phe Val Asn Leu Asn Glu Ser Arg Pro 100 105 110 Thr Arg Ile Glu Tyr Asp Asp Tyr Leu Lys Trp Val Ala Gln Asp Phe 115 120 125 Ala Asp Gln Val Arg Phe Gly Ser Gln Val Asp Arg Val Thr Pro Val 130 135 140 Gln Gly Pro Asp Gly Gly Asp Leu Ser Leu Phe Arg Val Glu Thr Glu 145 150 155 160 Asp Val Ala Thr Gly Arg Arg Ser Val His Tyr Ala Arg Asn Val Val 165 170 175 His Ala Gly Gly Gly Arg Pro Pro Thr Arg Thr Ala Gly Val Ala Glu 180 185 190 Val Pro Ser Val Val His Ser Ser Glu Phe Leu Thr Arg Phe Pro Gly 195 200 205 Gln Phe Lys Asp His Asp Gly Ala Tyr Arg Phe Val Val Val Gly Gly 210 215 220 Gly Gln Ser Ala Gly Glu Ile Ser Glu Tyr Leu Leu Asp His Tyr Asp 225 230 235 240 Arg Ala Glu Val His Val Val Val Pro Gly Tyr Thr Leu Leu Pro Thr 245 250 255 Asp Asn Ser Pro Phe Val Asn Glu Gln Phe Tyr Ser Gly Asn Ala Asp 260 265 270 Ala Phe Tyr Arg Met Arg Pro Glu Gln Arg Ala Ala Val Ser Gly Arg 275 280 285 Leu Arg Ala Ala Asn Tyr Gly Val Val Arg Glu Asp Leu Leu Glu Arg 290 295 300 Leu Phe Asn Thr Asp Tyr Leu Asp Gln Val Lys Gly Arg Lys Arg Leu 305 310 315 320 His Ile His Ser Phe Ser Arg Leu Ser Glu Val Arg Glu Asp Gly Glu 325 330 335 Ala Leu Ala Val Thr Leu Gln Pro Arg Leu Asp Glu Gly Pro Glu Glu 340 345 350 Ser Leu Arg Cys Asp Gly Val Val Leu Ala Thr Gly Tyr Asp Arg Ser 355 360 365 Leu Asp Pro Ala Val Phe Gly Asp Val Leu Pro His Leu Thr Pro Gly 370 375 380 Glu Gly Glu Gly Ala Ala Gly Val Val Leu Ser Arg His Tyr Arg Ala 385 390 395 400 Arg Thr Ser Pro Glu Leu Arg Ala Gly Leu Tyr Leu Gln Gly Phe Gly 405 410 415 Glu Ala Gln Phe Gly Leu Gly Asp Thr Leu Leu Ser Leu Leu Pro Phe 420 425 430 Arg Ser Gln Glu Ile Val Glu Asp Ile Ala Asp Arg Val Pro Ala Ala 435 440 445 Gly Val Gly Gly Cys Pro Val Met Ser Pro Tyr Gly Ser Gly Val Val 450 455 460 Ser Thr Ser Pro His Gly Pro Val Pro Ser Ala Val Tyr Pro Pro Lys 465 470 475 480 Trp Tyr Leu Glu His Asp Arg Glu Lys Leu Tyr Gly Leu Met Glu Arg 485 490 495 Phe Arg Phe Ala Thr Leu Ile Ser Ala Arg Ser Gly Asp Glu Pro Phe 500 505 510 Ala Thr His Leu Pro Leu Ile Leu Asp Arg Ser Arg Gly Ala Asn Gly 515 520 525 Val Leu Phe Gly His Leu Asp Arg Gly Asn Glu His Ala Glu Leu Ile 530 535 540 Asp Gly Arg His Met Leu Ala Val Phe His Gly Pro Asn Ala Tyr Met 545 550 555 560 Pro Pro Gly Val Phe Glu Ser Asp Pro Leu Pro Thr Trp Asn Ser Met 565 570 575 Ser Val His Val Arg Gly Arg Val Arg Ala Val Arg Asp Gln Asp Ala 580 585 590 Leu Val Arg Gly Leu Ile Gly Ile Ala Glu Arg Ser Gln Pro Asp Asn 595 600 605 Arg Leu Ala Ala Asp Asp Pro Arg Ile Asp Arg Ile Ile Gly Ser Ile 610 615 620 Val Gly Phe Glu Phe Glu Val Glu Glu Leu Val Gly Arg Phe Lys Leu 625 630 635 640 Ser Gln Asp Arg Asp Glu Thr Asp Arg Arg His Ala Ala Val Ala Leu 645 650 655 Ala Arg Ala Thr Glu Arg Gly Glu Arg Asp Phe Ile Glu Tyr Val Val 660 665 670 Gly Leu Ser Leu Ile Thr Glu Asp Asp Pro Arg Asp Leu Ala Gly Arg 675 680 685 Pro Leu Ser Pro Ser Pro

690 175682PRTMycobacterium sp. GA-0227b 175Met Thr Ser Met Pro Pro Gly Glu Gly His Asp Ser Asp Leu Asp Phe 1 5 10 15 Ile Gly Ile Gly Phe Gly Pro Ser Asn Leu Ala Leu Ala Val Ala Ala 20 25 30 Asp Glu Ile Val Pro Asp Arg Lys Gly Leu Phe Phe Glu Arg Ser Gly 35 40 45 Thr Phe Gln Trp His Pro Gly Met Leu Leu Asp Gly Thr Lys Met Gln 50 55 60 Ile Ser Phe Leu Lys Asp Leu Ala Thr Leu Arg Asn Pro Ala Ser Arg 65 70 75 80 Tyr Thr Phe Leu Gln Tyr Ala Lys Ala Arg Gly Arg Leu Glu Gln Phe 85 90 95 Val Asn Leu His Glu Phe His Pro Ser Arg Leu Glu Tyr Asn Asp Tyr 100 105 110 Leu Arg Trp Val Ala Glu Phe Phe Thr Asp Arg Val Cys Tyr Asn Thr 115 120 125 Ile Val Thr Ala Val Val Pro Val Gly His Ser Pro Ser Ser Asn Gly 130 135 140 His Leu Thr Arg Phe Arg Val His Val Arg Asp Met Ala Thr Gly Ala 145 150 155 160 Glu Ser Cys Phe Phe Thr Ala Asn Val Ile Phe Gly Gly Gly Gly Val 165 170 175 Pro Arg Leu Leu Gly Ala Arg Ala Asp Ala Ser Ala Val Leu His Ser 180 185 190 Ser Ala Phe Leu Pro Asn Phe Thr Asn Arg Phe Asn Glu Ser Gln Lys 195 200 205 Pro Tyr Arg Phe Ala Val Ile Gly Asn Gly Gln Ser Ala Ala Glu Ile 210 215 220 Val Asp Tyr Leu Leu Asn His Tyr Pro Gly Ala Thr Ile His Leu Phe 225 230 235 240 Ile Ser Asp Cys Thr Leu Arg Ala Thr Asp His Ser Pro Phe Ile Asn 245 250 255 Glu His Phe Phe Ser Thr Ser Ala Ala Asp Phe Tyr Asn His Pro Pro 260 265 270 Ala Gln Arg Val Ala Leu Arg Ser Ala Leu Arg Ser Thr Asn Tyr Gly 275 280 285 Val Val Asp Ala Asp Leu Leu Gln Lys Leu Tyr Gln Ile Thr Tyr Leu 290 295 300 Asp Glu Val Lys Gly Cys Arg Arg Leu Leu Leu His Arg Glu Ser Arg 305 310 315 320 Leu Ser Gln Ile Glu Glu Ile Asp Asp Gln Val Val Ala Ser Phe Glu 325 330 335 Asp Arg Phe Ser Gly Asp Ser Ser Glu Phe His Phe Asp Gly Ala Val 340 345 350 Leu Ala Thr Gly Tyr Glu Arg Val Leu Asp Ala Glu Val Phe Arg His 355 360 365 Val Leu Pro His Val Leu Trp Asp Glu Ser Gly Ala Ile Ser Leu Thr 370 375 380 Arg Ser Cys Arg Val Asn Thr Val Pro Ala Val Thr Ala Arg Leu Phe 385 390 395 400 Leu Gln Gly Tyr Gly Glu Ala Trp Phe Gly Ile Gly Asp Thr Leu Leu 405 410 415 Ser Leu Leu Pro Phe Arg Ala Gln Ala Ile Ala Gln Glu Ile Gly Asn 420 425 430 Ala Pro Ser Gly Ala Pro Ile Arg Arg Lys Gln Arg Val His Gly Glu 435 440 445 Tyr Pro Pro Lys Arg Tyr Leu Glu Thr Asp Pro Asp Arg Leu His Asp 450 455 460 Val Ile Asn Arg Tyr Arg Phe Ala Thr Leu Val Ser Ala Ser Gly Val 465 470 475 480 Asp Glu Pro Val Val Thr Gln Leu Pro Leu Thr Leu Asp Thr Ser Arg 485 490 495 Gly Ser Leu Gly Val Leu Phe Gly His Met Asp Phe Ala Asn Pro His 500 505 510 Thr Glu Leu Leu Asp Gly Arg Arg Val Leu Val Leu Phe His Gly Pro 515 520 525 Asn Gly Tyr Ile Ser Pro His Val Tyr Glu Ser Ala Gln Leu Pro Thr 530 535 540 Trp Asn Ser Ile Thr Val Glu Val Arg Gly Arg Ala Arg Ile Leu Arg 545 550 555 560 Asp Lys Asp Ala Val Val Asn Gly Leu Arg Gly Ile Ala Ala Ala Ala 565 570 575 Asp Pro Thr Pro Gly Gly Phe Arg Leu Thr Arg Glu Ala Ala Ser Asp 580 585 590 Gln Arg Leu Phe Pro Leu Leu Val Gly Phe Glu Ile Asp Ile Asp Asp 595 600 605 Met Arg Gly Arg Phe Lys Leu Ser Gln Glu Arg Asp Asp Arg Asp Arg 610 615 620 Trp His Ala Ala His Ala Leu Ala Asn Gly Val Glu Gln Asp Asp Arg 625 630 635 640 Asp Leu Ile Ser Ser Ile Val Gly Leu Pro Leu Asp Val Asp Glu Glu 645 650 655 Pro Lys Pro Gln Gln Gln Ala Gln Ile His Gln Tyr Gly Asn Ala Pro 660 665 670 Ala Asp Thr Ala Tyr Arg Arg Val Asp Gly 675 680 176682PRTMycobacterium sp. GA-1999 176Met Thr Ser Met Pro Pro Gly Glu Gly His Asp Ser Asp Leu Asp Phe 1 5 10 15 Ile Gly Ile Gly Phe Gly Pro Ser Asn Leu Ala Leu Ala Val Ala Ala 20 25 30 Asp Glu Ile Val Pro Asp Arg Lys Gly Leu Phe Phe Glu Arg Ser Gly 35 40 45 Thr Phe Gln Trp His Pro Gly Met Leu Leu Asp Gly Thr Lys Met Gln 50 55 60 Ile Ser Phe Leu Lys Asp Leu Ala Thr Leu Arg Asn Pro Ala Ser Arg 65 70 75 80 Tyr Thr Phe Leu Gln Tyr Ala Lys Ala Arg Gly Arg Leu Glu Gln Phe 85 90 95 Val Asn Leu His Glu Phe His Pro Ser Arg Leu Glu Tyr Asn Asp Tyr 100 105 110 Leu Arg Trp Val Ala Glu Phe Phe Thr Asp Arg Val Cys Tyr Asn Thr 115 120 125 Ile Val Thr Ala Val Val Pro Val Gly His Ser Pro Ser Ser Asn Gly 130 135 140 His Leu Thr Arg Phe Arg Val His Val Arg Asp Met Ala Thr Gly Ala 145 150 155 160 Glu Ser Cys Phe Phe Thr Ala Asn Val Ile Phe Gly Gly Gly Gly Val 165 170 175 Pro Arg Leu Leu Gly Ala Arg Ala Asp Ala Ser Ala Val Leu His Ser 180 185 190 Ser Ala Phe Leu Pro Asn Phe Thr Asn Arg Phe Asn Glu Ser Gln Lys 195 200 205 Pro Tyr Arg Phe Ala Val Ile Gly Asn Gly Gln Ser Ala Ala Glu Ile 210 215 220 Val Asp Tyr Leu Leu Asn His Tyr Pro Gly Ala Thr Ile His Leu Phe 225 230 235 240 Ile Ser Asp Cys Thr Leu Arg Ala Thr Asp His Ser Pro Phe Ile Asn 245 250 255 Glu His Phe Phe Ser Thr Ser Ala Ala Asp Phe Tyr Asn His Pro Pro 260 265 270 Ala Gln Arg Val Ala Leu Arg Ser Ala Leu Arg Ser Thr Asn Tyr Gly 275 280 285 Val Val Asp Ala Asp Leu Leu Gln Lys Leu Tyr Gln Ile Thr Tyr Leu 290 295 300 Asp Glu Val Lys Gly Cys Arg Arg Leu Leu Leu His Arg Glu Ser Arg 305 310 315 320 Leu Ser Gln Ile Glu Glu Ile Asp Asp Gln Val Val Ala Ser Phe Glu 325 330 335 Asp Arg Phe Ser Gly Asp Ser Ser Glu Phe His Phe Asp Gly Ala Val 340 345 350 Leu Ala Thr Gly Tyr Glu Arg Val Leu Asp Ala Glu Val Phe Arg His 355 360 365 Val Leu Pro His Val Leu Trp Asp Glu Ser Gly Ala Ile Ser Leu Thr 370 375 380 Arg Ser Cys Arg Val Asn Thr Val Pro Ala Val Thr Ala Arg Leu Phe 385 390 395 400 Leu Gln Gly Tyr Gly Glu Ala Trp Phe Gly Ile Gly Asp Thr Leu Leu 405 410 415 Ser Leu Leu Pro Phe Arg Ala Gln Ala Ile Ala Gln Glu Ile Gly Asn 420 425 430 Ala Pro Ser Gly Ala Pro Ile Arg Arg Lys Gln Arg Val His Gly Glu 435 440 445 Tyr Pro Pro Lys Arg Tyr Leu Glu Thr Asp Pro Asp Arg Leu His Asp 450 455 460 Val Ile Asn Arg Tyr Arg Phe Ala Thr Leu Val Ser Ala Ser Gly Val 465 470 475 480 Asp Glu Pro Val Val Thr Gln Leu Pro Leu Thr Leu Asp Thr Ser Arg 485 490 495 Gly Ser Leu Gly Val Leu Phe Gly His Met Asp Phe Ala Asn Pro His 500 505 510 Thr Glu Leu Leu Asp Gly Arg Arg Val Leu Val Leu Phe His Gly Pro 515 520 525 Asn Gly Tyr Ile Ser Pro His Val Tyr Glu Ser Ala Gln Leu Pro Thr 530 535 540 Trp Asn Ser Ile Thr Val Glu Val Arg Gly Arg Ala Arg Ile Leu Arg 545 550 555 560 Asp Lys Asp Ala Val Val Asn Gly Leu Arg Gly Ile Ala Ala Ala Ala 565 570 575 Asp Pro Thr Pro Gly Gly Phe Arg Leu Thr Arg Glu Ala Ala Ser Asp 580 585 590 Gln Arg Leu Phe Pro Leu Leu Val Gly Phe Glu Ile Asp Ile Asp Asp 595 600 605 Met Arg Gly Arg Phe Lys Leu Ser Gln Glu Arg Asp Asp Arg Asp Arg 610 615 620 Trp His Ala Ala His Ala Leu Ala Asn Gly Val Glu Gln Asp Asp Arg 625 630 635 640 Asp Leu Ile Ser Ser Ile Val Gly Leu Pro Leu Asp Val Asp Glu Glu 645 650 655 Pro Lys Pro Gln Gln Gln Ala Gln Ile His Gln Tyr Gly Asn Ala Pro 660 665 670 Ala Asp Thr Ala Tyr Arg Arg Val Asp Gly 675 680 1777041DNAArtificial SequenceSynthetic plasmid 177tatggctgcc gcgcggcacc aggccgctgc tgtgatgatg atgatgatgg ctgctgccca 60tggtatatct ccttcttaaa gttaaacaaa attatttcta gaggggaatt gttatccgct 120cacaattccc ctatagtgag tcgtattaat ttcgcgggat cgagatctcg atcctctacg 180ccggacgcat cgtggccggc atcaccggcg ccacaggtgc ggttgctggc gcctatatcg 240ccgacatcac cgatggggaa gatcgggctc gccacttcgg gctcatgagc gcttgtttcg 300gcgtgggtat ggtggcaggc cccgtggccg ggggactgtt gggcgccatc tccttgcatg 360caccattcct tgcggcggcg gtgctcaacg gcctcaacct actactgggc tgcttcctaa 420tgcaggagtc gcataaggga gagcgtcgag atcccggaca ccatcgaatg gcgcaaaacc 480tttcgcggta tggcatgata gcgcccggaa gagagtcaat tcagggtggt gaatgtgaaa 540ccagtaacgt tatacgatgt cgcagagtat gccggtgtct cttatcagac cgtttcccgc 600gtggtgaacc aggccagcca cgtttctgcg aaaacgcggg aaaaagtgga agcggcgatg 660gcggagctga attacattcc caaccgcgtg gcacaacaac tggcgggcaa acagtcgttg 720ctgattggcg ttgccacctc cagtctggcc ctgcacgcgc cgtcgcaaat tgtcgcggcg 780attaaatctc gcgccgatca actgggtgcc agcgtggtgg tgtcgatggt agaacgaagc 840ggcgtcgaag cctgtaaagc ggcggtgcac aatcttctcg cgcaacgcgt cagtgggctg 900atcattaact atccgctgga tgaccaggat gccattgctg tggaagctgc ctgcactaat 960gttccggcgt tatttcttga tgtctctgac cagacaccca tcaacagtat tattttctcc 1020catgaagacg gtacgcgact gggcgtggag catctggtcg cattgggtca ccagcaaatc 1080gcgctgttag cgggcccatt aagttctgtc tcggcgcgtc tgcgtctggc tggctggcat 1140aaatatctca ctcgcaatca aattcagccg atagcggaac gggaaggcga ctggagtgcc 1200atgtccggtt ttcaacaaac catgcaaatg ctgaatgagg gcatcgttcc cactgcgatg 1260ctggttgcca acgatcagat ggcgctgggc gcaatgcgcg ccattaccga gtccgggctg 1320cgcgttggtg cggatatctc ggtagtggga tacgacgata ccgaagacag ctcatgttat 1380atcccgccgt taaccaccat caaacaggat tttcgcctgc tggggcaaac cagcgtggac 1440cgcttgctgc aactctctca gggccaggcg gtgaagggca atcagctgtt gcccgtctca 1500ctggtgaaaa gaaaaaccac cctggcgccc aatacgcaaa ccgcctctcc ccgcgcgttg 1560gccgattcat taatgcagct ggcacgacag gtttcccgac tggaaagcgg gcagtgagcg 1620caacgcaatt aatgtaagtt agctcactca ttaggcaccg ggatctcgac cgatgccctt 1680gagagccttc aacccagtca gctccttccg gtgggcgcgg ggcatgacta tcgtcgccgc 1740acttatgact gtcttcttta tcatgcaact cgtaggacag gtgccggcag cgctctgggt 1800cattttcggc gaggaccgct ttcgctggag cgcgacgatg atcggcctgt cgcttgcggt 1860attcggaatc ttgcacgccc tcgctcaagc cttcgtcact ggtcccgcca ccaaacgttt 1920cggcgagaag caggccatta tcgccggcat ggcggccgac gcgctgggct acgtcttgct 1980ggcgttcgcg acgcgaggct ggatggcctt ccccattatg attcttctcg cttccggcgg 2040catcgggatg cccgcgttgc aggccatgct gtccaggcag gtagatgacg accatcaggg 2100acagcttcaa ggatcgctcg cggctcttac cagcctaact tcgatcactg gaccgctgat 2160cgtcacggcg atttatgccg cctcggcgag cacatggaac gggttggcat ggattgtagg 2220cgccgcccta taccttgtct gcctccccgc gttgcgtcgc ggtgcatgga gccgggccac 2280ctcgacctga atggaagccg gcggcacctc gctaacggat tcaccactcc aagaattgga 2340gccaatcaat tcttgcggag aactgtgaat gcgcaaacca acccttggca gaacatatcc 2400atcgcgtccg ccatctccag cagccgcacg cggcgcatct cgggcagcgt tgggtcctgg 2460ccacgggtgc gcatgatcgt gctcctgtcg ttgaggaccc ggctaggctg gcggggttgc 2520cttactggtt agcagaatga atcaccgata cgcgagcgaa cgtgaagcga ctgctgctgc 2580aaaacgtctg cgacctgagc aacaacatga atggtcttcg gtttccgtgt ttcgtaaagt 2640ctggaaacgc ggaagtcagc gccctgcacc attatgttcc ggatctgcat cgcaggatgc 2700tgctggctac cctgtggaac acctacatct gtattaacga agcgctggca ttgaccctga 2760gtgatttttc tctggtcccg ccgcatccat accgccagtt gtttaccctc acaacgttcc 2820agtaaccggg catgttcatc atcagtaacc cgtatcgtga gcatcctctc tcgtttcatc 2880ggtatcatta cccccatgaa cagaaatccc ccttacacgg aggcatcagt gaccaaacag 2940gaaaaaaccg cccttaacat ggcccgcttt atcagaagcc agacattaac gcttctggag 3000aaactcaacg agctggacgc ggatgaacag gcagacatct gtgaatcgct tcacgaccac 3060gctgatgagc tttaccgcag ctgcctcgcg cgtttcggtg atgacggtga aaacctctga 3120cacatgcagc tcccggagac ggtcacagct tgtctgtaag cggatgccgg gagcagacaa 3180gcccgtcagg gcgcgtcagc gggtgttggc gggtgtcggg gcgcagccat gacccagtca 3240cgtagcgata gcggagtgta tactggctta actatgcggc atcagagcag attgtactga 3300gagtgcacca tatatgcggt gtgaaatacc gcacagatgc gtaaggagaa aataccgcat 3360caggcgctct tccgcttcct cgctcactga ctcgctgcgc tcggtcgttc ggctgcggcg 3420agcggtatca gctcactcaa aggcggtaat acggttatcc acagaatcag gggataacgc 3480aggaaagaac atgtgagcaa aaggccagca aaaggccagg aaccgtaaaa aggccgcgtt 3540gctggcgttt ttccataggc tccgcccccc tgacgagcat cacaaaaatc gacgctcaag 3600tcagaggtgg cgaaacccga caggactata aagataccag gcgtttcccc ctggaagctc 3660cctcgtgcgc tctcctgttc cgaccctgcc gcttaccgga tacctgtccg cctttctccc 3720ttcgggaagc gtggcgcttt ctcatagctc acgctgtagg tatctcagtt cggtgtaggt 3780cgttcgctcc aagctgggct gtgtgcacga accccccgtt cagcccgacc gctgcgcctt 3840atccggtaac tatcgtcttg agtccaaccc ggtaagacac gacttatcgc cactggcagc 3900agccactggt aacaggatta gcagagcgag gtatgtaggc ggtgctacag agttcttgaa 3960gtggtggcct aactacggct acactagaag gacagtattt ggtatctgcg ctctgctgaa 4020gccagttacc ttcggaaaaa gagttggtag ctcttgatcc ggcaaacaaa ccaccgctgg 4080tagcggtggt ttttttgttt gcaagcagca gattacgcgc agaaaaaaag gatctcaaga 4140agatcctttg atcttttcta cggggtctga cgctcagtgg aacgaaaact cacgttaagg 4200gattttggtc atgagattat caaaaaggat cttcacctag atccttttaa attaaaaatg 4260aagttttaaa tcaatctaaa gtatatatga gtaaacttgg tctgacagtt accaatgctt 4320aatcagtgag gcacctatct cagcgatctg tctatttcgt tcatccatag ttgcctgact 4380ccccgtcgtg tagataacta cgatacggga gggcttacca tctggcccca gtgctgcaat 4440gataccgcga gacccacgct caccggctcc agatttatca gcaataaacc agccagccgg 4500aagggccgag cgcagaagtg gtcctgcaac tttatccgcc tccatccagt ctattaattg 4560ttgccgggaa gctagagtaa gtagttcgcc agttaatagt ttgcgcaacg ttgttgccat 4620tgctgcaggc atcgtggtgt cacgctcgtc gtttggtatg gcttcattca gctccggttc 4680ccaacgatca aggcgagtta catgatcccc catgttgtgc aaaaaagcgg ttagctcctt 4740cggtcctccg atcgttgtca gaagtaagtt ggccgcagtg ttatcactca tggttatggc 4800agcactgcat aattctctta ctgtcatgcc atccgtaaga tgcttttctg tgactggtga 4860gtactcaacc aagtcattct gagaatagtg tatgcggcga ccgagttgct cttgcccggc 4920gtcaacacgg gataataccg cgccacatag cagaacttta aaagtgctca tcattggaaa 4980acgttcttcg gggcgaaaac tctcaaggat cttaccgctg ttgagatcca gttcgatgta 5040acccactcgt gcacccaact gatcttcagc atcttttact ttcaccagcg tttctgggtg 5100agcaaaaaca ggaaggcaaa atgccgcaaa aaagggaata agggcgacac ggaaatgttg 5160aatactcata ctcttccttt ttcaatatta ttgaagcatt tatcagggtt attgtctcat 5220gagcggatac atatttgaat gtatttagaa aaataaacaa ataggggttc cgcgcacatt 5280tccccgaaaa gtgccacctg acgtctaaga aaccattatt atcatgacat taacctataa 5340aaataggcgt atcacgaggc cctttcgtct tcaagaattc tcatgtttga cagcttatca 5400tcgataagct ttaatgcggt agtttatcac agttaaattg ctaacgcagt caggcaccgt 5460gtatgaaatc taacaatgcg ctcatcgtca tcctcggcac cgtcaccctg gatgctgtag 5520gcataggctt ggttatgccg gtactgccgg gcctcttgcg ggatatccgg atatagttcc 5580tcctttcagc aaaaaacccc tcaagacccg tttagaggcc ccaaggggtt atgctagtta 5640ttgctcagcg gtggcagcag ccaactcagc ttcctttcgg gctttgttag cagccggatc 5700ctcagcccct gttccccgct gctgccttgc ttccggtgga gcggtccggg tcgcaccggc 5760cgccggtgat cgaccgggcg atctcgcccg cgcggaccgc caccatggac agcagggtgg 5820aggcgatgcc gtgggtcgcc tcggtggcgc cctggacgta gatgccgcac cggaaatccc 5880cggtggtgcc gagccggtag tcgcggccga tcagcaactc ccccgcctcg tcccggcgga 5940gggcgccgga gacgccgccg agcagttcgg ccgggtcggt ggagtcgtac ccggtggcgt 6000acacgaccag gtcggcgtcc aggtcggtgt gttcgcccgt

gggcaggaac tccacgcgta 6060cggcggcgga ttcctggcgc ggttcgacgg acaccaggcg ggaggcgttc atcacccgca 6120gccgcggggc gccggacacc ttctgctcgt actggcggcg gtagaggccc tggaggacgt 6180cctcgtcgac gacggcgtag ttggtgccgc cgtggtagcg catgatggcc tgcttgacct 6240cgggcggggc gaagtagaag tcgtccacgg cggccgggtc gaagacgcgg ttggcgaacg 6300ggctggagtc ggcgacgctg tagccgtagc gggcgaacac cgcgcacacc tcggcctgcg 6360ggtagcggtc catgaggtgc gcggcgacct cggccgcgct ctggccggcg ccgaccacga 6420cggcccggcg gggcgggcgt tcgtcgaacg cgggcagccg gtgcagcaac tgggagctgt 6480gccagacgcg ttcgccggtc tccgcgccct cgggcagccg ggggcgcagg ccggaggcga 6540ggacgaggtt tctggtccgg gcgaccaccc ggtccccggc gagcacgtcg agcgcgacga 6600cctcaccggc ttcggtcacc ggccgcacac cggtggcctc cacgccgtac tcgaccaggt 6660ggttcagccg gtcggcggcc cactggaggt agtcgtggta ctcgatccgg gagggcagca 6720gggtgtgctg gttgatgaag tcgaccagcc ggtccttctc ctggagatag gacaggaatc 6780cgaaatcact ggtgggattg cgcatcgtgg cgatgtcctt gagaaaggac acctggagcg 6840aggagccccc caggagcatc ccccgatgcc agccgaattc cttctgcttc tccaggaaaa 6900gggccttccc ggcggcttcg gattcatgga gcgccaccgc cagggcgaga ttcgcggcac 6960cgaatccgat tccggtgacg tccagtactt ctgattccgg gctctgctgc gcagtggatg 7020attgctctgc gagccgggtc a 70411787426DNAArtificial SequenceSynthetic plasmid 178gtaggagggc gtggatatgt cctgcgggta aactatagtc gttgagagga ggagtctgac 60tcctgttgat agatccagta atgacctcag aactccatct ggatttgttc agaacgctcg 120gttgccgccg ggcgtttttt attggtgaga ataggtcttg acggctggcg agaggtgcgg 180ggaggatctg accgacgcgg tccacacgtg gcaccgcgat gctgttgtgg gcacaatcgt 240gccggttggt aggatccggt taattaagca gtaccagatc tgactgagtg accaaaggag 300gcggacatat gacccggctc gcagagcaat catccactgc gcagcagagc ccggaatcag 360aagtactgga cgtcaccgga atcggattcg gtgccgcgaa tctcgccctg gcggtggcgc 420tccatgaatc cgaagccgcc gggaaggccc ttttcctgga gaagcagaag gaattcggct 480ggcatcgggg gatgctcctg gggggctcct cgctccaggt gtcctttctc aaggacatcg 540ccacgatgcg caatcccacc agtgatttcg gattcctgtc ctatctccag gagaaggacc 600ggctggtcga cttcatcaac cagcacaccc tgctgccctc ccggatcgag taccacgact 660acctccagtg ggccgccgac cggctgaacc acctggtcga gtacggcgtg gaggccaccg 720gtgtgcggcc ggtgaccgaa gccggtgagg tcgtcgcgct cgacgtgctc gccggggacc 780gggtggtcgc ccggaccaga aacctcgtcc tcgcctccgg cctgcgcccc cggctgcccg 840agggcgcgga gaccggcgaa cgcgtctggc acagctccca gttgctgcac cggctgcccg 900cgttcgacga acgcccgccc cgccgggccg tcgtggtcgg cgccggccag agcgcggccg 960aggtcgccgc gcacctcatg gaccgctacc cgcaggccga ggtgtgcgcg gtgttcgccc 1020gctacggcta cagcgtcgcc gactccagcc cgttcgccaa ccgcgtcttc gacccggccg 1080ccgtggacga cttctacttc gccccgcccg aggtcaagca ggccatcatg cgctaccacg 1140gcggcaccaa ctacgccgtc gtcgacgagg acgtcctcca gggcctctac cgccgccagt 1200acgagcagaa ggtgtccggc gccccgcggc tgcgggtgat gaacgcctcc cgcctggtgt 1260ccgtcgaacc gcgccaggaa tccgccgccg tacgcgtgga gttcctgccc acgggcgaac 1320acaccgacct ggacgccgac ctggtcgtgt acgccaccgg gtacgactcc accgacccgg 1380ccgaactgct cggcggcgtc tccggcgccc tccgccggga cgaggcgggg gagttgctga 1440tcggccgcga ctaccggctc ggcaccaccg gggatttccg gtgcggcatc tacgtccagg 1500gcgccaccga ggcgacccac ggcatcgcct ccaccctgct gtccatggtg gcggtccgcg 1560cgggcgagat cgcccggtcg atcaccggcg gccggtgcga cccggaccgc tccaccggaa 1620gcaaggcagc agcggggaac aggggctgag gatccccggg taccttcgaa aaaaaaaggc 1680tccaaaagga gcctttaatt gttcctccag accttacttg accggcgctc actgcccgct 1740ttccagtcgg gaaacctgtc gtgccagctg cattaatgaa tcggccaacg cgcggggaga 1800ggcggtttgc gtattgggcg ctcttccgct tcctcgctca ctgactcgct gcgctcggtc 1860gttcggctgc ggcgagcggt atcagctcac tcaaaggcgg taatacggtt atccacagaa 1920tcaggggata acgcaggaaa gaacatgtga gcaaaaggcc agcaaaaggc caggaaccgt 1980aaaaaggccg cgttgctggc gtttttccat aggctccgcc cccctgacga gcatcacaaa 2040aatcgacgct caagtcagag gtggcgaaac ccgacaggac tataaagata ccaggcgttt 2100ccccctggaa gctccctcgt gcgctctcct gttccgaccc tgccgcttac cggatacctg 2160tccgcctttc tcccttcggg aagcgtggcg ctttctcata gctcacgctg taggtatctc 2220agttcggtgt aggtcgttcg ctccaagctg ggctgtgtgc acgaaccccc cgttcagccc 2280gaccgctgcg ccttatccgg taactatcgt cttgagtcca acccggtaag acacgactta 2340tcgccactgg cagcagccac tggtaacagg attagcagag cgaggtatgt aggcggtgct 2400acagagttct tgaagtggtg gcctaactac ggctacacta gaagaacagt atttggtatc 2460tgcgctctgc tgaagccagt taccttcgga aaaagagttg gtagctcttg atccggcaaa 2520caaaccaccg ctggtagcgg tggttttttt gtttgcaagc agcagattac gcgcagaaaa 2580aaaggatctc aagaagatcc tttgatcttt tctacggggt ctgacgctca gtggaacgaa 2640aactcacgtt aagggatttt ggtcatgaga ttatcaaaaa ggatcttcac ctagatcctt 2700ttggttcatg tgcagctcca ctgctttaga ctctacatct gtatgaagtc ttcagatcct 2760ctacgccgga cgcatcgtgg ccggatctaa aaaaaagccc gctcattagg cgggctgaca 2820gttaccaatg cttaatcagt gaggcaccta tctcagcgat ctgtctattt cgttcatcca 2880tagttgcctg actccccgtc gtgtagataa ctacgatacg ggagggctta ccatctggcc 2940ccagtgctgc aatgataccg cgagacccac gctcaccggc tccagattta tcagcaataa 3000accagccagc cggaagggcc gagcgcagaa gtggtcctgc aactttatcc gcctccatcc 3060agtctattaa ttgttgccgg gaagctagag taagtagttc gccagttaat agtttgcgca 3120acgttgttgc cattgctaca ggcatcgtgg tgtcacgctc gtcgtttggt atggcttcat 3180tcagctccgg ttcccaacga tcaaggcgag ttacatgatc ccccatgttg tgcaaaaaag 3240cggttagctc cttcggtcct ccgatcgttg tcagaagtaa gttggccgca gtgttatcac 3300tcatggttat ggcagcactg cataattctc ttactgtcat gccatccgta agatgctttt 3360ctgtgactgg tgagtactca accaagtcat tctgagaata gtgtatgcgg cgaccgagtt 3420gctcttgccc ggcgtcaata cgggataata ccgcgccaca tagcagaact ttaaaagtgc 3480tcatcattgg aaaacgttct tcggggcgaa aactctcaag gatcttaccg ctgttgagat 3540ccagttcgat gtaacccact cgtgcaccca actgatcttc agcatctttt actttcacca 3600gcgtttctgg gtgagcaaaa acaggaaggc aaagtgccgc aaaaaaggga ataagggcga 3660cacggaaatg ttgaatactc atactcttcc tttttcaata ttattgaagc atttatcagg 3720gttattgtct catgagcgga tacatatttg aatgtattta gaaaaataaa caaatagggg 3780ttccgcgcac atttccccga aaagtgccac ctggcgcgcc acaaaacagc agggaagcag 3840cgcttttccg ctgcataacc ctgcttcggg gtcattatag cgattttttc ggtatatcca 3900tcctttttcg cacgatatac aggattttgc caaagggttc gtgtagactt tccttggtgt 3960atccaacggc gtcagccggg caggataggt gaagtaggcc cacccgcgag cgggtgttcc 4020ttcttcactg tcccttattc gcacctggcg gtgctcaacg ggaatcctgc tctgcgaggc 4080tggccggcta ccgccggcgt aacagatgag ggcaagcgga tggctgatga aaccaagcca 4140accaggaagg gcagcccacc tatcaaggtg tactgccttc cagacgaacg aagagcgatt 4200gaggaaaagg cggcggcggc cggcatgagc ctgtcggcct acctgctggc cgtcggccag 4260ggctacaaaa tcacgggcgt cgtggactat gagcacgtcg gcgcgcctct agtatgcagg 4320agtggggagg cacgatggcc gctttggtcg acctcaacga gacgatgaag ccgtggaacg 4380acaccacccc ggcggccctg ctggaccaca cccggcacta caccttcgac gtctgatcat 4440cactgacgaa tcgaggtcga ggaaccgagc gtccgaggaa cagaggcgct tatcggttgg 4500ccgcgagatt cctgtcgatc ctctcgtgca gcgcgattcc gagggaaacg gaaacgttga 4560gagactcggt ctggctcatc atggggatgg aaaccgaggc ggaagacgcc tcctcgaaca 4620ggtcggaagg cccacccttt tcgctgccga acagcaaggc cagccgatcc ggattgtccc 4680cgagttcctt cacggaaatg tcgccatccg ccttgagcgt catcagctgc ataccgctgt 4740cccgaatgaa ggcgatggcc tcctcgcgac cggagagaac gacgggaagg gagaagacgt 4800aacctcggct ggccctttgg agacgccggt ccgcgatgct ggtgatgtca ctgtcgacca 4860ggatgatccc cgacgctccg agcgcgagcg acgtgcgtac tatcgcgccg atgttcccga 4920cgatcttcac cccgtcgaga acgacgacgt ccccacgccg gctcgcgata tcgccgaacc 4980tggccgggcg agggacgcgg gcgatgccga atgtcttggc cttccgctcc cccttgaaca 5040actggttgac gatcgaggag tcgatgaggc ggaccggtat gttctgccgc ccgcacagat 5100ccagcaactc agatggaaaa ggactgctgt cgctgccgta gacctcgatg aactccaccc 5160cggccgcgat gctgtgcatg aggggctcga cgtcctcgat caacgttgtc tttatgttgg 5220atcgcgacgg cttggtgaca tcgatgatcc gctgcaccgc gggatcggac ggatttgcga 5280tggtgtccaa ctcagtcatg gtcgtcctac cggctgctgt gttcagtgac gcgattcctg 5340gggtgtgaca ccctacgcga cgatggcgga tggctgccct gaccggcaat caccaacgca 5400aggggaagac tacgccttcc actagaccgg tcgacctgca ggcctgctgg cgccggacgg 5460ggcttcagac gtttcgggtg ctgggttgtt gtctctggac agtgatccat gggaaactac 5520tcagcaccac caatgttccc aaaagaaagc gcaggtcagc gcccatgagc caatatctag 5580gcatgtcgcc cttcatcgct cccgaggtcc ctgagcacct tctcgacact gttcgcgtct 5640tcctgtacgc gcgtcagtct aagggccggt ccgacggctc agacgtgtcg accgaagcac 5700agctcgcggc cggtcgtgcg ttggtcgcgt ctcgcaacgc ccaggggggt gcgcgctggg 5760tcgtggcagg tgagttcgtg gacgtcgggc gctccggctg ggacccgaac gtgacccgtg 5820ccgacttcga gcgcatgatg ggcgaagtcc gcgccggcga aggtgacgtt gtcgttgtga 5880atgagctttc ccggctcact cgcaagggcg cccatgacgc gctcgaaatc gacaacgaat 5940tgaagaagca cggcgtgcgc ttcatgtcgg ttcttgagcc gttccttgac acgtctaccc 6000ctatcggcgt cgccattttc gcgctgatcg ctgcccttgc gaaacaggac agtgacctga 6060aggcggagcg cctgaagggt gcgaaagacg agattgccgc gctgggtggc gttcactcgt 6120cttccgcccc gttcggaatg cgcgccgtgc gcaagaaggt cgataatctc gtgatctccg 6180ttcttgagcc ggacgaagac aacccggatc acgtcgagct agttgagcgc atggcgaaaa 6240tgtcgttcga gggcgtgtcc gacaacgcca ttgcaacgac cttcgagaag gaaaagatcc 6300cgtcgcccgg aatggctgag agacgcgcca cggaaaagcg tcttgcgtcc atcaaggcac 6360gtcgcctgaa cggcgctgaa aagccgatca tgtggcgcgc tcaaacggtc cgatggattc 6420tcaaccatcc cgcaatcggc ggtttcgcat tcgagcgtgt gaagcacggt aaggcgcaca 6480tcaacgtcat acggcgcgac cccggcggca agccgctaac gccccacacg ggcattctca 6540gcggctcgaa gtggcttgag cttcaagaga agcgttccgg gaagaatctc agcgaccgga 6600agcctggggc cgaagtcgaa ccgacgcttc tgagcgggtg gcgtttcctg gggtgccgaa 6660tctgcggcgg ctcaatgggt cagtcccagg gtggccgtaa gcgcaacggc gaccttgccg 6720aaggcaatta catgtgcgcc aacccgaagg ggcacggcgg cttgtcggtc aagcgcagcg 6780aactggacga gttcgttgct tcgagggtgt gggcacggct ccgcacagcc gacatggaag 6840atgaacacga tcaggcatgg attgccgccg ctgcggagcg cttcgccctt cagcacgacc 6900tagcgggggt ggccgatgag cggcgcgaac aacaggcgca cctagacaac gtgcggcgct 6960ccatcaagga ccttcaggcg gaccgtaagg ccggtctgta cgtcgggcgt gaagagctgg 7020aaacgtggcg ctcaacggtg ctgcaatacc ggtcctacga agcggagtgc acgacccgac 7080tcgctgagct tgacgagaag atgaacggca gcacccgcgt tccgtctgag tggttcagcg 7140gcgaagaccc gacggccgaa gggggcatct gggcaagctg ggacgtgtac gagcgtcggg 7200agttcctgag cttcttcctt gactccgtca tggtcgaccg ggggcgccac cctgagacga 7260agaaatacat ccccctgaag gaccgtgtga cgctcaagtg ggcggagctg ctgaaggagg 7320aagacgaagc gagcgaagcc actgagcggg agcttgcggc gctgtaggta caatcataat 7380gaggctagac tacagacgcg aagaatctcg tgctttcagc ttcgat 74261796396DNAArtificial SequenceSynthetic plasmid 179tatgtacgaa cgtccgctgt accgggagga ttgcgacggc gtcgtcctgg cgtttctgcg 60acacaaccca ctggcaatgg tcgtcacctc gcacgacgac gtcccggtgg ccacccacgc 120gccggtgctg ttccggcacg gacccgacgg cgccgacgcc gaggccgtcg ccgcgggcac 180cgtcccgctc gccggctcca ccctgatcgg ccacatgaac gtcgagaacc cgcagtggcg 240ccggatgcgc tccggcgacc gggcgctcat cgtcttccag ggcccgcacg gctatgtctc 300gccgacggtc tacggggtca cgcccgcggc ccccacctgg gacttcatcg ccgtccacgt 360gaacggcaca gtggagccca ccgccgaccc cgccgccgtg ctggacatcg tctccgacac 420cgcccggcgg ctggagtccg gcttcgggcg cggctgggac caggagtcct ccctcgacta 480cttccgccag atcgcgcccg gcgtgggcgc cttcaccctg cgggtcgatt ccgtgcagac 540gatgttcaag ctcagccagg agaagcccgc cccgatgcgg cggcgcgtgg tcgagcagtt 600cgaagcaagc gagtccggca cccaccgcgc cctggccagc gtgatgcgcg accgcggact 660caccgaagcc gacgaggagc gggagacagc cggatgagga tccggctgct aacaaagccc 720gaaaggaagc tgagttggct gctgccaccg ctgagcaata actagcataa ccccttgggg 780cctctaaacg ggtcttgagg ggttttttgc tgaaaggagg aactatatcc ggatatcccg 840caagaggccc ggcagtaccg gcataaccaa gcctatgcct acagcatcca gggtgacggt 900gccgaggatg acgatgagcg cattgttaga tttcatacac ggtgcctgac tgcgttagca 960atttaactgt gataaactac cgcattaaag cttatcgatg ataagctgtc aaacatgaga 1020attcttgaag acgaaagggc ctcgtgatac gcctattttt ataggttaat gtcatgataa 1080taatggtttc ttagacgtca ggtggcactt ttcggggaaa tgtgcgcgga acccctattt 1140gtttattttt ctaaatacat tcaaatatgt atccgctcat gagacaataa ccctgataaa 1200tgcttcaata atattgaaaa aggaagagta tgagtattca acatttccgt gtcgccctta 1260ttcccttttt tgcggcattt tgccttcctg tttttgctca cccagaaacg ctggtgaaag 1320taaaagatgc tgaagatcag ttgggtgcac gagtgggtta catcgaactg gatctcaaca 1380gcggtaagat ccttgagagt tttcgccccg aagaacgttt tccaatgatg agcactttta 1440aagttctgct atgtggcgcg gtattatccc gtgttgacgc cgggcaagag caactcggtc 1500gccgcataca ctattctcag aatgacttgg ttgagtactc accagtcaca gaaaagcatc 1560ttacggatgg catgacagta agagaattat gcagtgctgc cataaccatg agtgataaca 1620ctgcggccaa cttacttctg acaacgatcg gaggaccgaa ggagctaacc gcttttttgc 1680acaacatggg ggatcatgta actcgccttg atcgttggga accggagctg aatgaagcca 1740taccaaacga cgagcgtgac accacgatgc ctgcagcaat ggcaacaacg ttgcgcaaac 1800tattaactgg cgaactactt actctagctt cccggcaaca attaatagac tggatggagg 1860cggataaagt tgcaggacca cttctgcgct cggcccttcc ggctggctgg tttattgctg 1920ataaatctgg agccggtgag cgtgggtctc gcggtatcat tgcagcactg gggccagatg 1980gtaagccctc ccgtatcgta gttatctaca cgacggggag tcaggcaact atggatgaac 2040gaaatagaca gatcgctgag ataggtgcct cactgattaa gcattggtaa ctgtcagacc 2100aagtttactc atatatactt tagattgatt taaaacttca tttttaattt aaaaggatct 2160aggtgaagat cctttttgat aatctcatga ccaaaatccc ttaacgtgag ttttcgttcc 2220actgagcgtc agaccccgta gaaaagatca aaggatcttc ttgagatcct ttttttctgc 2280gcgtaatctg ctgcttgcaa acaaaaaaac caccgctacc agcggtggtt tgtttgccgg 2340atcaagagct accaactctt tttccgaagg taactggctt cagcagagcg cagataccaa 2400atactgtcct tctagtgtag ccgtagttag gccaccactt caagaactct gtagcaccgc 2460ctacatacct cgctctgcta atcctgttac cagtggctgc tgccagtggc gataagtcgt 2520gtcttaccgg gttggactca agacgatagt taccggataa ggcgcagcgg tcgggctgaa 2580cggggggttc gtgcacacag cccagcttgg agcgaacgac ctacaccgaa ctgagatacc 2640tacagcgtga gctatgagaa agcgccacgc ttcccgaagg gagaaaggcg gacaggtatc 2700cggtaagcgg cagggtcgga acaggagagc gcacgaggga gcttccaggg ggaaacgcct 2760ggtatcttta tagtcctgtc gggtttcgcc acctctgact tgagcgtcga tttttgtgat 2820gctcgtcagg ggggcggagc ctatggaaaa acgccagcaa cgcggccttt ttacggttcc 2880tggccttttg ctggcctttt gctcacatgt tctttcctgc gttatcccct gattctgtgg 2940ataaccgtat taccgccttt gagtgagctg ataccgctcg ccgcagccga acgaccgagc 3000gcagcgagtc agtgagcgag gaagcggaag agcgcctgat gcggtatttt ctccttacgc 3060atctgtgcgg tatttcacac cgcatatatg gtgcactctc agtacaatct gctctgatgc 3120cgcatagtta agccagtata cactccgcta tcgctacgtg actgggtcat ggctgcgccc 3180cgacacccgc caacacccgc tgacgcgccc tgacgggctt gtctgctccc ggcatccgct 3240tacagacaag ctgtgaccgt ctccgggagc tgcatgtgtc agaggttttc accgtcatca 3300ccgaaacgcg cgaggcagct gcggtaaagc tcatcagcgt ggtcgtgaag cgattcacag 3360atgtctgcct gttcatccgc gtccagctcg ttgagtttct ccagaagcgt taatgtctgg 3420cttctgataa agcgggccat gttaagggcg gttttttcct gtttggtcac tgatgcctcc 3480gtgtaagggg gatttctgtt catgggggta atgataccga tgaaacgaga gaggatgctc 3540acgatacggg ttactgatga tgaacatgcc cggttactgg aacgttgtga gggtaaacaa 3600ctggcggtat ggatgcggcg ggaccagaga aaaatcactc agggtcaatg ccagcgcttc 3660gttaatacag atgtaggtgt tccacagggt agccagcagc atcctgcgat gcagatccgg 3720aacataatgg tgcagggcgc tgacttccgc gtttccagac tttacgaaac acggaaaccg 3780aagaccattc atgttgttgc tcaggtcgca gacgttttgc agcagcagtc gcttcacgtt 3840cgctcgcgta tcggtgattc attctgctaa ccagtaaggc aaccccgcca gcctagccgg 3900gtcctcaacg acaggagcac gatcatgcgc acccgtggcc aggacccaac gctgcccgag 3960atgcgccgcg tgcggctgct ggagatggcg gacgcgatgg atatgttctg ccaagggttg 4020gtttgcgcat tcacagttct ccgcaagaat tgattggctc caattcttgg agtggtgaat 4080ccgttagcga ggtgccgccg gcttccattc aggtcgaggt ggcccggctc catgcaccgc 4140gacgcaacgc ggggaggcag acaaggtata gggcggcgcc tacaatccat gccaacccgt 4200tccatgtgct cgccgaggcg gcataaatcg ccgtgacgat cagcggtcca gtgatcgaag 4260ttaggctggt aagagccgcg agcgatcctt gaagctgtcc ctgatggtcg tcatctacct 4320gcctggacag catggcctgc aacgcgggca tcccgatgcc gccggaagcg agaagaatca 4380taatggggaa ggccatccag cctcgcgtcg cgaacgccag caagacgtag cccagcgcgt 4440cggccgccat gccggcgata atggcctgct tctcgccgaa acgtttggtg gcgggaccag 4500tgacgaaggc ttgagcgagg gcgtgcaaga ttccgaatac cgcaagcgac aggccgatca 4560tcgtcgcgct ccagcgaaag cggtcctcgc cgaaaatgac ccagagcgct gccggcacct 4620gtcctacgag ttgcatgata aagaagacag tcataagtgc ggcgacgata gtcatgcccc 4680gcgcccaccg gaaggagctg actgggttga aggctctcaa gggcatcggt cgagatcccg 4740gtgcctaatg agtgagctaa cttacattaa ttgcgttgcg ctcactgccc gctttccagt 4800cgggaaacct gtcgtgccag ctgcattaat gaatcggcca acgcgcgggg agaggcggtt 4860tgcgtattgg gcgccagggt ggtttttctt ttcaccagtg agacgggcaa cagctgattg 4920cccttcaccg cctggccctg agagagttgc agcaagcggt ccacgctggt ttgccccagc 4980aggcgaaaat cctgtttgat ggtggttaac ggcgggatat aacatgagct gtcttcggta 5040tcgtcgtatc ccactaccga gatatccgca ccaacgcgca gcccggactc ggtaatggcg 5100cgcattgcgc ccagcgccat ctgatcgttg gcaaccagca tcgcagtggg aacgatgccc 5160tcattcagca tttgcatggt ttgttgaaaa ccggacatgg cactccagtc gccttcccgt 5220tccgctatcg gctgaatttg attgcgagtg agatatttat gccagccagc cagacgcaga 5280cgcgccgaga cagaacttaa tgggcccgct aacagcgcga tttgctggtg acccaatgcg 5340accagatgct ccacgcccag tcgcgtaccg tcttcatggg agaaaataat actgttgatg 5400ggtgtctggt cagagacatc aagaaataac gccggaacat tagtgcaggc agcttccaca 5460gcaatggcat cctggtcatc cagcggatag ttaatgatca gcccactgac gcgttgcgcg 5520agaagattgt gcaccgccgc tttacaggct tcgacgccgc ttcgttctac catcgacacc 5580accacgctgg cacccagttg atcggcgcga gatttaatcg ccgcgacaat ttgcgacggc 5640gcgtgcaggg ccagactgga ggtggcaacg ccaatcagca acgactgttt gcccgccagt 5700tgttgtgcca cgcggttggg aatgtaattc agctccgcca tcgccgcttc cactttttcc 5760cgcgttttcg cagaaacgtg gctggcctgg ttcaccacgc gggaaacggt ctgataagag 5820acaccggcat actctgcgac atcgtataac gttactggtt tcacattcac caccctgaat 5880tgactctctt ccgggcgcta tcatgccata ccgcgaaagg ttttgcgcca ttcgatggtg 5940tccgggatct cgacgctctc ccttatgcga ctcctgcatt aggaagcagc ccagtagtag 6000gttgaggccg ttgagcaccg ccgccgcaag gaatggtgca tgcaaggaga tggcgcccaa 6060cagtcccccg gccacggggc ctgccaccat acccacgccg aaacaagcgc tcatgagccc 6120gaagtggcga gcccgatctt ccccatcggt gatgtcggcg atataggcgc cagcaaccgc 6180acctgtggcg ccggtgatgc cggccacgat gcgtccggcg tagaggatcg agatctcgat 6240cccgcgaaat taatacgact cactataggg gaattgtgag cggataacaa ttcccctcta 6300gaaataattt tgtttaactt taagaaggag atataccatg ggcagcagcc atcatcatca 6360tcatcacagc agcggcctgg tgccgcgcgg cagcca 63961806781DNAArtificial SequenceSynthetic plasmid 180gtaggagggc

gtggatatgt cctgcgggta aactatagtc gttgagagga ggagtctgac 60tcctgttgat agatccagta atgacctcag aactccatct ggatttgttc agaacgctcg 120gttgccgccg ggcgtttttt attggtgaga ataggtcttg acggctggcg agaggtgcgg 180ggaggatctg accgacgcgg tccacacgtg gcaccgcgat gctgttgtgg gcacaatcgt 240gccggttggt aggatccggt taattaagca gtaccagatc tgactgagtg accaaaggag 300gcggacatat gtacgaacgt ccgctgtacc gggaggattg cgacggcgtc gtcctggcgt 360ttctgcgaca caacccactg gcaatggtcg tcacctcgca cgacgacgtc ccggtggcca 420cccacgcgcc ggtgctgttc cggcacggac ccgacggcgc cgacgccgag gccgtcgccg 480cgggcaccgt cccgctcgcc ggctccaccc tgatcggcca catgaacgtc gagaacccgc 540agtggcgccg gatgcgctcc ggcgaccggg cgctcatcgt cttccagggc ccgcacggct 600atgtctcgcc gacggtctac ggggtcacgc ccgcggcccc cacctgggac ttcatcgccg 660tccacgtgaa cggcacagtg gagcccaccg ccgaccccgc cgccgtgctg gacatcgtct 720ccgacaccgc ccggcggctg gagtccggct tcgggcgcgg ctgggaccag gagtcctccc 780tcgactactt ccgccagatc gcgcccggcg tgggcgcctt caccctgcgg gtcgattccg 840tgcagacgat gttcaagctc agccaggaga agcccgcccc gatgcggcgg cgcgtggtcg 900agcagttcga agcaagcgag tccggcaccc accgcgccct ggccagcgtg atgcgcgacc 960gcggactcac cgaagccgac gaggagcggg agacagccgg atgaggatcc ccgggtacct 1020tcgaaaaaaa aaggctccaa aaggagcctt taattgttcc tccagacctt acttgaccgg 1080cgctcactgc ccgctttcca gtcgggaaac ctgtcgtgcc agctgcatta atgaatcggc 1140caacgcgcgg ggagaggcgg tttgcgtatt gggcgctctt ccgcttcctc gctcactgac 1200tcgctgcgct cggtcgttcg gctgcggcga gcggtatcag ctcactcaaa ggcggtaata 1260cggttatcca cagaatcagg ggataacgca ggaaagaaca tgtgagcaaa aggccagcaa 1320aaggccagga accgtaaaaa ggccgcgttg ctggcgtttt tccataggct ccgcccccct 1380gacgagcatc acaaaaatcg acgctcaagt cagaggtggc gaaacccgac aggactataa 1440agataccagg cgtttccccc tggaagctcc ctcgtgcgct ctcctgttcc gaccctgccg 1500cttaccggat acctgtccgc ctttctccct tcgggaagcg tggcgctttc tcatagctca 1560cgctgtaggt atctcagttc ggtgtaggtc gttcgctcca agctgggctg tgtgcacgaa 1620ccccccgttc agcccgaccg ctgcgcctta tccggtaact atcgtcttga gtccaacccg 1680gtaagacacg acttatcgcc actggcagca gccactggta acaggattag cagagcgagg 1740tatgtaggcg gtgctacaga gttcttgaag tggtggccta actacggcta cactagaaga 1800acagtatttg gtatctgcgc tctgctgaag ccagttacct tcggaaaaag agttggtagc 1860tcttgatccg gcaaacaaac caccgctggt agcggtggtt tttttgtttg caagcagcag 1920attacgcgca gaaaaaaagg atctcaagaa gatcctttga tcttttctac ggggtctgac 1980gctcagtgga acgaaaactc acgttaaggg attttggtca tgagattatc aaaaaggatc 2040ttcacctaga tccttttggt tcatgtgcag ctccactgct ttagactcta catctgtatg 2100aagtcttcag atcctctacg ccggacgcat cgtggccgga tctaaaaaaa agcccgctca 2160ttaggcgggc tgacagttac caatgcttaa tcagtgaggc acctatctca gcgatctgtc 2220tatttcgttc atccatagtt gcctgactcc ccgtcgtgta gataactacg atacgggagg 2280gcttaccatc tggccccagt gctgcaatga taccgcgaga cccacgctca ccggctccag 2340atttatcagc aataaaccag ccagccggaa gggccgagcg cagaagtggt cctgcaactt 2400tatccgcctc catccagtct attaattgtt gccgggaagc tagagtaagt agttcgccag 2460ttaatagttt gcgcaacgtt gttgccattg ctacaggcat cgtggtgtca cgctcgtcgt 2520ttggtatggc ttcattcagc tccggttccc aacgatcaag gcgagttaca tgatccccca 2580tgttgtgcaa aaaagcggtt agctccttcg gtcctccgat cgttgtcaga agtaagttgg 2640ccgcagtgtt atcactcatg gttatggcag cactgcataa ttctcttact gtcatgccat 2700ccgtaagatg cttttctgtg actggtgagt actcaaccaa gtcattctga gaatagtgta 2760tgcggcgacc gagttgctct tgcccggcgt caatacggga taataccgcg ccacatagca 2820gaactttaaa agtgctcatc attggaaaac gttcttcggg gcgaaaactc tcaaggatct 2880taccgctgtt gagatccagt tcgatgtaac ccactcgtgc acccaactga tcttcagcat 2940cttttacttt caccagcgtt tctgggtgag caaaaacagg aaggcaaagt gccgcaaaaa 3000agggaataag ggcgacacgg aaatgttgaa tactcatact cttccttttt caatattatt 3060gaagcattta tcagggttat tgtctcatga gcggatacat atttgaatgt atttagaaaa 3120ataaacaaat aggggttccg cgcacatttc cccgaaaagt gccacctggc gcgccacaaa 3180acagcaggga agcagcgctt ttccgctgca taaccctgct tcggggtcat tatagcgatt 3240ttttcggtat atccatcctt tttcgcacga tatacaggat tttgccaaag ggttcgtgta 3300gactttcctt ggtgtatcca acggcgtcag ccgggcagga taggtgaagt aggcccaccc 3360gcgagcgggt gttccttctt cactgtccct tattcgcacc tggcggtgct caacgggaat 3420cctgctctgc gaggctggcc ggctaccgcc ggcgtaacag atgagggcaa gcggatggct 3480gatgaaacca agccaaccag gaagggcagc ccacctatca aggtgtactg ccttccagac 3540gaacgaagag cgattgagga aaaggcggcg gcggccggca tgagcctgtc ggcctacctg 3600ctggccgtcg gccagggcta caaaatcacg ggcgtcgtgg actatgagca cgtcggcgcg 3660cctctagtat gcaggagtgg ggaggcacga tggccgcttt ggtcgacctc aacgagacga 3720tgaagccgtg gaacgacacc accccggcgg ccctgctgga ccacacccgg cactacacct 3780tcgacgtctg atcatcactg acgaatcgag gtcgaggaac cgagcgtccg aggaacagag 3840gcgcttatcg gttggccgcg agattcctgt cgatcctctc gtgcagcgcg attccgaggg 3900aaacggaaac gttgagagac tcggtctggc tcatcatggg gatggaaacc gaggcggaag 3960acgcctcctc gaacaggtcg gaaggcccac ccttttcgct gccgaacagc aaggccagcc 4020gatccggatt gtccccgagt tccttcacgg aaatgtcgcc atccgccttg agcgtcatca 4080gctgcatacc gctgtcccga atgaaggcga tggcctcctc gcgaccggag agaacgacgg 4140gaagggagaa gacgtaacct cggctggccc tttggagacg ccggtccgcg atgctggtga 4200tgtcactgtc gaccaggatg atccccgacg ctccgagcgc gagcgacgtg cgtactatcg 4260cgccgatgtt cccgacgatc ttcaccccgt cgagaacgac gacgtcccca cgccggctcg 4320cgatatcgcc gaacctggcc gggcgaggga cgcgggcgat gccgaatgtc ttggccttcc 4380gctccccctt gaacaactgg ttgacgatcg aggagtcgat gaggcggacc ggtatgttct 4440gccgcccgca cagatccagc aactcagatg gaaaaggact gctgtcgctg ccgtagacct 4500cgatgaactc caccccggcc gcgatgctgt gcatgagggg ctcgacgtcc tcgatcaacg 4560ttgtctttat gttggatcgc gacggcttgg tgacatcgat gatccgctgc accgcgggat 4620cggacggatt tgcgatggtg tccaactcag tcatggtcgt cctaccggct gctgtgttca 4680gtgacgcgat tcctggggtg tgacacccta cgcgacgatg gcggatggct gccctgaccg 4740gcaatcacca acgcaagggg aagactacgc cttccactag accggtcgac ctgcaggcct 4800gctggcgccg gacggggctt cagacgtttc gggtgctggg ttgttgtctc tggacagtga 4860tccatgggaa actactcagc accaccaatg ttcccaaaag aaagcgcagg tcagcgccca 4920tgagccaata tctaggcatg tcgcccttca tcgctcccga ggtccctgag caccttctcg 4980acactgttcg cgtcttcctg tacgcgcgtc agtctaaggg ccggtccgac ggctcagacg 5040tgtcgaccga agcacagctc gcggccggtc gtgcgttggt cgcgtctcgc aacgcccagg 5100ggggtgcgcg ctgggtcgtg gcaggtgagt tcgtggacgt cgggcgctcc ggctgggacc 5160cgaacgtgac ccgtgccgac ttcgagcgca tgatgggcga agtccgcgcc ggcgaaggtg 5220acgttgtcgt tgtgaatgag ctttcccggc tcactcgcaa gggcgcccat gacgcgctcg 5280aaatcgacaa cgaattgaag aagcacggcg tgcgcttcat gtcggttctt gagccgttcc 5340ttgacacgtc tacccctatc ggcgtcgcca ttttcgcgct gatcgctgcc cttgcgaaac 5400aggacagtga cctgaaggcg gagcgcctga agggtgcgaa agacgagatt gccgcgctgg 5460gtggcgttca ctcgtcttcc gccccgttcg gaatgcgcgc cgtgcgcaag aaggtcgata 5520atctcgtgat ctccgttctt gagccggacg aagacaaccc ggatcacgtc gagctagttg 5580agcgcatggc gaaaatgtcg ttcgagggcg tgtccgacaa cgccattgca acgaccttcg 5640agaaggaaaa gatcccgtcg cccggaatgg ctgagagacg cgccacggaa aagcgtcttg 5700cgtccatcaa ggcacgtcgc ctgaacggcg ctgaaaagcc gatcatgtgg cgcgctcaaa 5760cggtccgatg gattctcaac catcccgcaa tcggcggttt cgcattcgag cgtgtgaagc 5820acggtaaggc gcacatcaac gtcatacggc gcgaccccgg cggcaagccg ctaacgcccc 5880acacgggcat tctcagcggc tcgaagtggc ttgagcttca agagaagcgt tccgggaaga 5940atctcagcga ccggaagcct ggggccgaag tcgaaccgac gcttctgagc gggtggcgtt 6000tcctggggtg ccgaatctgc ggcggctcaa tgggtcagtc ccagggtggc cgtaagcgca 6060acggcgacct tgccgaaggc aattacatgt gcgccaaccc gaaggggcac ggcggcttgt 6120cggtcaagcg cagcgaactg gacgagttcg ttgcttcgag ggtgtgggca cggctccgca 6180cagccgacat ggaagatgaa cacgatcagg catggattgc cgccgctgcg gagcgcttcg 6240cccttcagca cgacctagcg ggggtggccg atgagcggcg cgaacaacag gcgcacctag 6300acaacgtgcg gcgctccatc aaggaccttc aggcggaccg taaggccggt ctgtacgtcg 6360ggcgtgaaga gctggaaacg tggcgctcaa cggtgctgca ataccggtcc tacgaagcgg 6420agtgcacgac ccgactcgct gagcttgacg agaagatgaa cggcagcacc cgcgttccgt 6480ctgagtggtt cagcggcgaa gacccgacgg ccgaaggggg catctgggca agctgggacg 6540tgtacgagcg tcgggagttc ctgagcttct tccttgactc cgtcatggtc gaccgggggc 6600gccaccctga gacgaagaaa tacatccccc tgaaggaccg tgtgacgctc aagtgggcgg 6660agctgctgaa ggaggaagac gaagcgagcg aagccactga gcgggagctt gcggcgctgt 6720aggtacaatc ataatgaggc tagactacag acgcgaagaa tctcgtgctt tcagcttcga 6780t 67811816264DNAArtificial SequenceSynthetic plasmid 181atctacgtct gtcgagaagt ttctgatcga aaagttcgac agcgtctccg acctgatgca 60gctctcgcag ggcgaagaat ctcgtgcttt cagcttcgat gtaggagggc gtggatatgt 120cctgcgggta aactatagtc gttgagagga ggagtctgac tcctgttgat agatccagta 180atgacctcag aactccatct ggatttgttc agaacgctcg gttgccgccg ggcgtttttt 240attggtgaga ataggtcttg acggctggcg agaggtgcgg ggaggatctg accgacgcgg 300tccacacgtg gcaccgcgat gctgttgtgg gcacaatcgt gccggttggt aggatccggt 360taattaagca gtaccagatc tgactgagtg accaaaggag gcggacatat gtacgaacgt 420ccgctgtacc gggaggattg cgacggcgtc gtcctggcgt ttctgcgaca caacccactg 480gcaatggtcg tcacctcgca cgacgacgtc ccggtggcca cccacgcgcc ggtgctgttc 540cggcacggac ccgacggcgc cgacgccgag gccgtcgccg cgggcaccgt cccgctcgcc 600ggctccaccc tgatcggcca catgaacgtc gagaacccgc agtggcgccg gatgcgctcc 660ggcgaccggg cgctcatcgt cttccagggc ccgcacggct atgtctcgcc gacggtctac 720ggggtcacgc ccgcggcccc cacctgggac ttcatcgccg tccacgtgaa cggcacagtg 780gagcccaccg ccgaccccgc cgccgtgctg gacatcgtct ccgacaccgc ccggcggctg 840gagtccggct tcgggcgcgg ctgggaccag gagtcctccc tcgactactt ccgccagatc 900gcgcccggcg tgggcgcctt caccctgcgg gtcgattccg tgcagacgat gttcaagctc 960agccaggaga agcccgcccc gatgcggcgg cgcgtggtcg agcagttcga agcaagcgag 1020tccggcaccc accgcgccct ggccagcgtg atgcgcgacc gcggactcac cgaagccgac 1080gaggagcggg agacagccgg atgaggatcc ccgggtacct tcgaaaaaaa aaggctccaa 1140aaggagcctt taattgttcc tccagacctt acttgaccgg cgctcactgc ccgctttcca 1200gtcgggaaac ctgtcgtgcc agctgcatta atgaatcggc caacgcgcgg ggagaggcgg 1260tttgcgtatt gggcgctctt ccgcttcctc gctcactgac tcgctgcgct cggtcgttcg 1320gctgcggcga gcggtatcag ctcactcaaa ggcggtaata cggttatcca cagaatcagg 1380ggataacgca ggaaagaaca tgtgagcaaa aggccagcaa aaggccagga accgtaaaaa 1440ggccgcgttg ctggcgtttt tccataggct ccgcccccct gacgagcatc acaaaaatcg 1500acgctcaagt cagaggtggc gaaacccgac aggactataa agataccagg cgtttccccc 1560tggaagctcc ctcgtgcgct ctcctgttcc gaccctgccg cttaccggat acctgtccgc 1620ctttctccct tcgggaagcg tggcgctttc tcatagctca cgctgtaggt atctcagttc 1680ggtgtaggtc gttcgctcca agctgggctg tgtgcacgaa ccccccgttc agcccgaccg 1740ctgcgcctta tccggtaact atcgtcttga gtccaacccg gtaagacacg acttatcgcc 1800actggcagca gccactggta acaggattag cagagcgagg tatgtaggcg gtgctacaga 1860gttcttgaag tggtggccta actacggcta cactagaaga acagtatttg gtatctgcgc 1920tctgctgaag ccagttacct tcggaaaaag agttggtagc tcttgatccg gcaaacaaac 1980caccgctggt agcggtggtt tttttgtttg caagcagcag attacgcgca gaaaaaaagg 2040atctcaagaa gatcctttga tcttttctac ggggtctgac gctcagtgga acgaaaactc 2100acgttaaggg attttggtca tgagattatc aaaaaggatc ttcacctaga tccttttggt 2160tcatgtgcag ctccatcagc aaaaggggat gataagttta tcaccaccga ctatttgcaa 2220cagtgccgtt gatcgtgcta tgatcgactg atgtcatcag cggtggagtg caatgtcgtg 2280caatacgaat ggcgaaaagc cgagctcatc ggtcagcttc tcaaccttgg ggttaccccc 2340ggcggtgtgc tgctggtcca cagctccttc cgtagcgtcc ggcccctcga agatgggcca 2400cttggactga tcgaggccct gcgtgctgcg ctgggtccgg gagggacgct cgtcatgccc 2460tcgtggtcag gtctggacga cgagccgttc gatcctgcca cgtcgcccgt tacaccggac 2520cttggagttg tctctgacac attctggcgc ctgccaaatg taaagcgcag cgcccatcca 2580tttgcctttg cggcagcggg gccacaggca gagcagatca tctctgatcc attgcccctg 2640ccacctcact cgcctgcaag cccggtcgcc cgtgtccatg aactcgatgg gcaggtactt 2700ctcctcggcg tgggacacga tgccaacacg acgctgcatc ttgccgagtt gatggcaaag 2760gttccctatg gggtgccgag acactgcacc attcttcagg atggcaagtt ggtacgcgtc 2820gattatctcg agaatgacca ctgctgtgag cgctttgcct tggcggacag gtggctcaag 2880gagaagagcc ttcagaagga aggtccagtc ggtcatgcct ttgctcggtt gatccgctcc 2940cgcgacattg tggcgacagc cctgggtcaa ctgggccgag atccgttgat cttcctgcat 3000ccgccagagg cgggatgcga agaatgcgat gccgctcgcc agtcgattgg ctgagctcat 3060gagcggagaa cgagatgacg ttggaggggc aaggtcgcgc tgattgctgg ggcaacacgt 3120ggagcggatc ggggattgtc tttcttcagc tcgctgatga tatgctgacg ctcaatgccg 3180tttggcctcc gactaacgaa aatcccgcat ttggacggct gatccgattg gcacggcgga 3240cggcgaatgg cggagcagac gctcgtccgg gggcaatgag atatgaaaaa gcctgaactc 3300accgcgacgt atcgggccct ggccagctag ctagagtcga cctgcaggtc cccggggatc 3360ggtcttgcct tgctcgtcgg tgatgtactt caccagctcc gcgaagtcgc tcttcttgat 3420ggagcgcatg gggacgtgct tggcaatcac gcgcaccccc cggccgtttt agcggctaaa 3480aaagtcatgg ctctgccctc gggcggacca cgcccatcat gaccttgcca agctcgtcct 3540gcttctcttc gatcttcgcc agcagggcga ggatcgtggc atcaccgaac cgcgccgtgc 3600gcgggtcgtc ggtgagccag agtttcagca ggccgcccag gcggcccagg tcgccattga 3660tgcgggccag ctcgcggacg tgctcatagt ccacgacgcc cgtgattttg tagccctggc 3720cgacggccag caggtaggcc gacaggctca tgccggccgc cgccgccttt tcctcaatcg 3780ctcttcgttc gtctggaagg cagtacacct tgataggtgg gctgcccttc ctggttggct 3840tggtttcatc agccatccgc ttgccctcat ctgttacgcc ggcggtagcc ggccagcctc 3900gcagagcagg attcccgttg agcaccgcca ggtgcgaata agggacagtg aagaaggaac 3960acccgctcgc gggtgggcct acttcaccta tcctgcccgg ctgacgccgt tggatacacc 4020aaggaaagtc tacacgaacc ctttggcaaa atcctgtata tcgtgcgaaa aaggatggat 4080ataccgaaaa aatcgctata atgaccccga agcagggtta tgcagcggaa aagatccgtc 4140gacctgcagg catgcaagct ctagcgattc cagacgtccc gaaggcgtgg cgcggcttcc 4200ccgtgccgga gcaatcgccc tgggtgggtt acacgacgcc cctctatggc ccgtactgac 4260ggacacaccg aagccccggc ggcaaccctc agcggatgcc ccggggcttc acgttttccc 4320aggtcagaag cggttttcgg gagtagtgcc ccaactgggg taacctttga gttctctcag 4380ttgggggcgt agggtcgccg acatgacaca aggggttgtg accggggtgg acacgtacgc 4440gggtgcttac gaccgtcagt cgcgcgagcg cgaaaattcg agcgcagcaa gcccagcgac 4500acagcgtagc gccaacgaag acaaggcggc cgaccttcag cgcgaagtcg agcgcgacgg 4560gggccggttc aggttcgtcg ggcatttcag cgaagcgccg ggcacgtcgg cgttcgggac 4620ggcggagcgc ccggagttcg aacgcatcct gaacgaatgc cgcgccgggc ggctcaacat 4680gatcattgtc tatgacgtgt cgcgcttctc gcgcctgaag gtcatggacg cgattccgat 4740tgtctcggaa ttgctcgccc tgggcgtgac gattgtttcc actcaggaag gcgtcttccg 4800gcagggaaac gtcatggacc tgattcacct gattatgcgg ctcgacgcgt cgcacaaaga 4860atcttcgctg aagtcggcga agattctcga cacgaagaac cttcagcgcg aattgggcgg 4920gtacgtcggc gggaaggcgc cttacggctt cgagcttgtt tcggagacga aggagatcac 4980gcgcaacggc cgaatggtca atgtcgtcat caacaagctt gcgcactcga ccactcccct 5040taccggaccc ttcgagttcg agcccgacgt aatccggtgg tggtggcgtg agatcaagac 5100gcacaaacac cttcccttca agccgggcag tcaagccgcc attcacccgg gcagcatcac 5160ggggctttgt aagcgcatgg acgctgacgc cgtgccgacc cggggcgaga cgattgggaa 5220gaagaccgct tcaagcgcct gggacccggc aaccgttatg cgaatccttc gggacccgcg 5280tattgcgggc ttcgccgctg aggtgatcta caagaagaag ccggacggca cgccgaccac 5340gaagattgag ggttaccgca ttcagcgcga cccgatcacg ctccggccgg tcgagcttga 5400ttgcggaccg atcatcgagc ccgctgagtg gtatgagctt caggcgtggt tggacggcag 5460ggggcgcggc aaggggcttt cccgggggca agccattctg tccgccatgg acaagctgta 5520ctgcgagtgt ggcgccgtca tgacttcgaa gcgcggggaa gaatcgatca aggactctta 5580ccgctgccgt cgccggaagg tggtcgaccc gtccgcacct gggcagcacg aaggcacgtg 5640caacgtcagc atggcggcac tcgacaagtt cgttgcggaa cgcatcttca acaagatcag 5700gcacgccgaa ggcgacgaag agacgttggc gcttctgtgg gaagccgccc gacgcttcgg 5760caagctcact gaggcgcctg agaagagcgg cgaacgggcg aaccttgttg cggagcgcgc 5820cgacgccctg aacgcccttg aagagctgta cgaagaccgc gcggcaggcg cgtacgacgg 5880acccgttggc aggaagcact tccggaagca acaggcagcg ctgacgctcc ggcagcaagg 5940ggcggaagag cggcttgccg aacttgaagc cgccgaagcc ccgaagcttc cccttgacca 6000atggttcccc gaagacgccg acgctgaccc gaccggccct aagtcgtggt gggggcgcgc 6060gtcagtagac gacaagcgcg tgttcgtcgg gctcttcgta gacaagatcg ttgtcacgaa 6120gtcgactacg ggcagggggc agggaacgcc catcgagaag cgcgcttcga tcacgtgggc 6180gaagccgccg accgacgacg acgaagacga cgcccaggac ggcacggaag acgtagcggc 6240gtagcgagac acccgggaag cctg 6264

Claims

1. A method for preparing a piperazic acid (Piz)-containing product comprising: (i) providing N.sup.5--OH-Ornithine or derivative thereof; (ii) providing a suitable enzyme comprising a N.sup.5--OH Ornithine cyclase/dehydratase; and (iii) optionally, buffer salts, a NADPH cofactor, Fe.sup.+2 salts, and a catalytic Flavin Adenine Dinucleotide (FAD) cofactor.

2. The method of claim 1 further comprising: (i) providing an ornithine or a derivative thereof; and (ii) providing a suitable enzyme comprising an ornithine N.sup.5 hydroxylase.

3. The method of claim 1, wherein (i) the N.sup.5--OH-Ornithine or derivative thereof is an enantiopure L-Ornithine or derivative thereof; (ii) the enzyme comprising N.sup.5--OH Ornithine cyclase/dehydratase is a L-N.sup.5--OH Ornithine cyclase/dehydratase or a PzbB enzyme; or (iii) the enzyme comprising ornithine N.sup.5 hydroxylase is an L-ornithine N.sup.5--OHase or a PzbA enzyme.

4. The method of claim 1, wherein the method is carried out in the absence of O.sub.2, substantially no O.sub.2, or in the presence of low O.sub.2.

5. The method of claim 2 wherein the method comprises a coupled enzyme assay.

6. The method of claim 1, wherein the piperazic acid (Piz)-containing product comprises a compound of formula: ##STR00023## wherein: R.sup.5 is a hydrogen, an alkyl, a piperazic acid, an acetyl, or a carboxyl protecting group; each R.sup.1 and R.sup.2 are independently selected from hydrogen or an amino protecting group, wherein R.sup.1 and R.sup.2 may be taken together to form a fused bicyclic or tricyclic amino protecting group; and each R.sup.3 and R.sup.4 are independently selected from a hydrogen, a halo (optionally, a chloro, a fluoro, a bromo, or a iodo), or a hydroxyl.

7. The method of claim 1, wherein R.sup.1 and R.sup.2 are not simultaneously hydrogen.

8. The method of claim 1, wherein the piperazic acid (Piz)-containing product is used as a starting material in a synthetic method of making a bioactive Piz-containing composition selected from the group consisting of: (i) an antibacterial agent, an antibiotic agent, an antitumor agent, an antiviral agent, an immunomodulatory agent, or an anti-inflammatory agent; (ii) a molecular probe, anticancer drug, or drug lead; (iii) a metalloprotease inhibitor, a caspase inhibitor, an angiotensin converting enzyme (ACE) inhibitor, an inflammatory peptide C5a antagonist, an oxytocin receptor antagonist, or a matylastin type-IV collagenase inhibitor; (iv) a dehydropiperazic acid; a chloropiperazic acid; a hydroxypiperazic acid; a monamycin, an aurantimycin, an antrimycin, an azinothricin, a luzopeptin, a kettapeptin, a quinoxapeptin, a lydiamycin, a piperazimycin, or a sangamide; or (v) sanglifehrin A, pandanamide A, azinothricin, Sch392583, luzopeptin A, kutzernide 2, piperazic acid, L-piperazic acid, antrimycin, kettapeptin, GE3, A83586C, chloptosin, himastatin, luzopeptin, quinoxapeptin, lydiamycin, piperazimycin, sanglifehrin, sangamide NVP018, sangamide NVP019, sanglifehrin, Sch 382583; chloptosin, himastatin, verucopeptin, luzopeptin A, L-156,602, aurantimycin A, or L-156,373.

9. A transgenic microorganism comprising an artificial DNA construct comprising, as operably associated components in the 5' to 3' direction of transcription: (I) (a) a promoter functional in the microorganism; (b) (i) a first polynucleotide comprising a nucleotide sequence encoding a first polypeptide having a L-Ornithine N.sup.5 hydroxylase activity; (ii) a second polynucleotide comprising a nucleotide sequence encoding a second polypeptide having a L-Ornithine N.sup.5 cyclase activity or L-Ornithine N.sup.5 dehydratase activity; or (iii) a third polynucleotide comprising a nucleotide sequence encoding a third polypeptide having a L-Ornithine N.sup.5 hydroxylase activity and a L-Ornithine N.sup.5 cyclase activity or L-Ornithine N.sup.5 dehydratase activity; and (c) a transcriptional termination sequence; or (II) (a) a promoter functional in the microorganism; (b) (i) a first polynucleotide comprising a nucleotide sequence encoding a first polypeptide having PzbA activity; (ii) a second polynucleotide comprising a nucleotide sequence encoding a second polypeptide having PzbB activity; or (iii) a third polynucleotide comprising a nucleotide sequence encoding a first polypeptide having PzbA activity and PzbB activity; and (c) a transcriptional termination sequence; wherein, the transgenic microorganism accumulates increased levels of a piperazic acid (Piz)-containing product, optionally L-Piz, compared to a microorganism not comprising the DNA construct.

10. The transgenic microorganism of claim 9, wherein the microorganism comprises: (a) (i) a nucleotide sequence encoding a polypeptide selected from SEQ ID NO: 1-SEQ ID NO: 81 or SEQ ID NO: 167-SEQ ID NO: 176 or a sequence at least 25% identical thereto having L-Ornithine N.sup.5 hydroxylase activity; and (ii) a nucleotide sequence encoding a polypeptide selected from SEQ ID NO: 82-SEQ ID NO: 166 or SEQ ID NO: 167-SEQ ID NO: 176 or a sequence at least 25% identical thereto having L-Ornithine N.sup.5 cyclase activity and L-Ornithine N.sup.5 dehydratase activity; or (b) a nucleotide sequence encoding a polypeptide selected from SEQ ID NO: 167-SEQ ID NO: 176 or a sequence at least 25% identical thereto having L-Ornithine N.sup.5 hydroxylase activity, L-Ornithine N.sup.5 cyclase activity, and L-Ornithine N.sup.5 dehydratase activity.

11. The transgenic microorganism of claim 9 comprising: (i) a PzbA ortholog with at least about 25% identity to SEQ ID NO: 1-SEQ ID NO: 81 or SEQ ID NO: 167-SEQ ID NO: 176 and has PzbA activity to produce a piperazic acid (Piz)-containing product; (ii) a PzbB ortholog with at least about 25% identity to SEQ ID NO: 82-SEQ ID NO: 166 or SEQ ID NO: 167-SEQ ID NO: 176 and has PzbB activity to produce a piperazic acid (Piz)-containing product; or (iii) a PzbAB ortholog with at least about 25% identity to or SEQ ID NO: 167-SEQ ID NO: 176 and has PzbA and PzbB activity to produce a piperazic acid (Piz)-containing product.

12. The transgenic microorganism of claim 9, wherein the microorganism is an Actinobacteria selected from the group consisting of Streptomyces, Corynebacterium, Kutzneria, and Actinomadura; is a heterologous population of microorganisms; is an Actinobacteria (optionally, an actinomycete); or is selected from the group consisting of Streptomyces lividans or Corynebacterium glutamicum, optionally carrying one or more copies of a native or non-native pzbA and optionally carrying one or more copies of pzbB.

13. The transgenic microorganism of claim 9, wherein the transgenic microorganism overproduces L-Ornithine; the pzbA or the pzbB are cloned from a sanglifehrin biosynthetic locus of Streptomyces flaveolus; or a piperazic acid (Piz)-containing product accumulates within the microorganism.

14. A method for producing a piperazic acid (Piz)-containing product comprising: (i) providing a transgenic microorganism capable of accumulating a piperazic acid (Piz)-containing product; (ii) cultivating the microorganism; and (iii) isolating accumulated piperazic acid (Piz)-containing product.

15. The method of claim 14, comprising: providing a transgenic microorganism and providing a feedstock, wherein the transgenic microorganism comprises at least one copy of pzbA and at least one copy of pzbB under a constitutive promoter; and the at least one pzbA is optionally a native copy.

16. The method of claim 14, wherein the transgenic microorganism is (i) a heterologous population of microorganisms; (ii) an Actinobacteria (optionally, an actinomycete); or (ii) selected from the group consisting of Streptomyces lividans or Corynebacterium glutamicum, optionally carrying one or more copies of a native or non-native pzbA and optionally carrying one or more copies of pzbB.

17. The method of claim 14, wherein pzbA or pzbB are cloned from a sanglifehrin biosynthetic locus of Streptomyces flaveolus; or a piperazic acid (Piz)-containing product accumulates within the microorganism.

18. The method of claim 14, wherein the method is carried out in the absence of O.sub.2, substantially no O.sub.2, or in the presence of low O.sub.2.

19. The method of claim 14, wherein the piperazic acid (Piz)-containing product comprises a compound of formula: ##STR00024## wherein: R.sup.5 is a hydrogen, an alkyl, a piperazic acid, an acetyl, or a carboxyl protecting group; each R.sup.1 and R.sup.2 are independently selected from hydrogen or an amino protecting group, wherein R.sup.1 and R.sup.2 may be taken together to form a fused bicyclic or tricyclic amino protecting group; and each R.sup.3 and R.sup.4 are independently selected from a hydrogen, a halo (optionally, a chloro, a fluoro, a bromo, or a iodo), or hydroxyl.

20. The method of claim 14, wherein R.sup.1 and R.sup.2 are not simultaneously hydrogen.