Patent application title: MODIFIED ANTIBODIES
Inventors:
IPC8 Class: AA61K39395FI
USPC Class:
1 1
Class name:
Publication date: 2018-11-29
Patent application number: 20180339043
Abstract:
Provided herein are modified antibodies, pharmaceutical compositions
thereof, as well as nucleic acids, and methods for making and discovering
the same. The modified antibodies described herein are modified with a
peptide. The peptide binds at or near the antigen binding site of the
antibody at physiological pH, thus reducing binding affinity of the
antibody for a target antigen. At acidic pH, the binding interaction of
the peptide at or near the antigen binding site is disrupted, thus
enabling binding with a target antigen.Claims:
1. A modified antibody comprising a formula: A-L-P wherein A is an
antibody or antibody fragment that binds to a target antigen, P is a
peptide that reduces binding of A to the target antigen at physiological
pH and that does not reduce binding of A to the target antigen at acidic
pH, and L is a linking moiety that connects A to P at physiological pH
and in a tumor microenvironment and L is bound to A outside an antigen
binding site.
2. (canceled)
3. The modified antibody of claim 1, wherein at physiological pH P is reversibly bound to A at or near the antigen binding site.
4. The modified antibody of claim 1, wherein P inhibits the binding of A to the target antigen at physiological pH and P does not inhibit the binding of A to the target antigen at acidic pH.
5. The modified antibody of claim 1, wherein in tissue other than the tumor microenvironment, P sterically blocks A from binding to the target antigen.
6. (canceled)
7. The modified antibody of claim 1, wherein the modified antibody has an increased binding affinity for the target antigen in the tumor microenvironment compared to the binding affinity of the modified antibody for the target antigen in a non-tumor microenvironment.
8. The modified antibody of claim 1, wherein P comprises a peptide sequence with at least one histidine.
9. The modified antibody of claim 8, wherein the histidine forms a binding interaction at or near the antigen binding site of A at physiological pH.
10.-19. (canceled)
20. The modified antibody of claim 8, wherein at acidic pH P is reversibly bound to L.
21. The modified antibody of claim 20, wherein L comprises a peptide sequence with at least one aspartic acid or glutamic acid, or a combination thereof.
22. The modified antibody of claim 21, wherein the histidine of P forms an interaction with the aspartic acid or glutamic acid of L.
23.-39. (canceled)
40. The modified antibody of claim 1, wherein A is a full length antibody, a single-chain antibody, an Fab fragment, an Fab' fragment, an (Fab')2 fragment, an Fv fragment, a divalent single chain antibody, bispecific antibody, a trispecific antibody, a tetraspecific antibody, or an antibody drug conjugate.
41.-49. (canceled)
50. The modified antibody of claim 1, wherein the target antigen is CTLA4 and P comprises an amino acid sequence selected from the group consisting of Peptide 1, Peptide 2, Peptide 5, Peptide 6, Peptide 10, Peptide 13, Peptide 26, Peptide 14, and Peptide 15.
51.-60. (canceled)
61. The modified antibody of claim 1, wherein the target antigen is PD-L1 and P comprises an amino acid sequence selected from the group consisting of Peptide 20, Peptide 27, Peptide 21, Peptide 22, Peptide 23, Peptide 28, Peptide 29, Peptide 30, Peptide 31, and Peptide 24.
62.-76. (canceled)
77. The modified antibody of claim 1, wherein P comprises a peptide sequence with at least two histidines.
78. (canceled)
79. The modified antibody of claim 77, wherein P comprises a peptide sequence with at least two histidines and at least two cysteines.
80. The modified antibody of claim 1, wherein P comprises a peptide sequence with at least two charged amino acid residues wherein the charged amino acid residues are selected from the group consisting of aspartate, glutamate, and histidine.
81. (canceled)
82. The modified antibody of claim 1, wherein P comprises a peptide sequence with at least three charged amino acid residues wherein the charged amino acid residues are selected from the group consisting of aspartate, glutamate, and histidine.
83. (canceled)
84. The modified antibody of claim 82, wherein P comprises a peptide sequence with at least one histidine and at least two aspartates.
85. The modified antibody of claim 1, wherein P comprises a peptide sequence with at least one cysteine.
86. (canceled)
87. The modified antibody of claim 1, wherein P comprises a peptide sequence with at least two cysteine amino acid residues.
88. (canceled)
89. The modified antibody of claim 87, wherein P comprises a peptide sequence with at least two cysteines and at least three charged amino acid residues wherein the charged amino acid residues are selected from the group consisting of aspartate, glutamate, and histidine.
90.-93. (canceled)
94. The modified antibody of claim 1, wherein P does not comprise a lysine or arginine.
95. The modified antibody of claim 1, wherein P comprises at least one histidine and at least one aspartate.
96. The modified antibody of claim 1, wherein P comprises at least one histidine and at least one glutamate.
97. The modified antibody of claim 1, wherein P comprises at least one histidine and at least two glutamates.
98. The modified antibody of claim 1, wherein P comprises at least two histidines and at least one aspartate or at least one glutamate.
99. The modified antibody of claim 1, wherein P comprises at least one histidine, wherein at least one hydrogen bonding amino acid residue is within two amino acid positions to the histidine, wherein the hydrogen bonding amino acid residue is selected from the group consisting of serine, threonine, tyrosine, asparagine, and glutamine.
100.-105. (canceled)
106. The modified antibody of claim 1, wherein A-L-P does not comprise a protease cleavage site that releases A from P in a tumor microenvironment.
107. The modified antibody of claim 1, wherein L comprises a peptide sequence with at least one histidine.
108. The modified antibody of claim 107, wherein at acidic pH L is reversibly bound to P.
109. The modified antibody of claim 108, wherein P comprises a peptide sequence with at least one aspartic acid or glutamic acid, or a combination thereof.
110. The modified antibody of claim 109, wherein the histidine of L forms an interaction with the aspartic acid or glutamic acid of P.
111. A pharmaceutical composition, comprising: (a) a modified antibody according to claim 1; and (b) a pharmaceutically acceptable excipient.
Description:
CROSS-REFERENCE
[0001] This application claims the benefit of U.S. Provisional Application No. 62/511,771 filed May 26, 2017 which is incorporated by reference herein in its entirety.
REFERENCE TO A SEQUENCE LISTING
[0002] The instant application contains a Sequence Listing which has been filed electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on May 24, 2018, is named 52426-701_201_SL.txt and is 73,393bytes in size.
SUMMARY OF THE INVENTION
[0003] Disclosed herein, in some embodiments, are modified antibodies comprising a formula: A-L-P wherein A is an antibody or antibody fragment that binds to a target antigen, P is a peptide that reduces binding of A to the target antigen at physiological pH and that does not reduce binding of A to the target antigen at acidic pH, and L is a linking moiety that connects A to P at physiological pH and in a tumor microenvironment and L is bound to A outside an antigen binding site. In some instances, at physiological pH P is reversibly bound to A through ionic, electrostatic, hydrophobic, Pi-stacking, and H-bonding interactions, or a combination thereof. In some instances, at physiological pH P is reversibly bound to A at or near the antigen binding site. In some instances, P inhibits the binding of A to the target antigen at physiological pH and P does not inhibit the binding of A to the target antigen at acidic pH. In some instances, in tissue other than the tumor microenvironment, P sterically blocks A from binding to the target antigen. In some instances, at the tumor microenvironment, P is removed from the antigen binding site, and the antigen binding site of A is exposed. In some instances, the modified antibody has an increased binding affinity for the target antigen in the tumor microenvironment compared to the binding affinity of the modified antibody for the target antigen in a non-tumor microenvironment. In some instances, P comprises a peptide sequence with at least one histidine. In some instances, the histidine forms a binding interaction at or near the antigen binding site of A at physiological pH. In some instances, at acidic pH P is reversibly bound to A in a region of A that is not the antigen binding site. In some instances, at acidic pH P is reversibly bound to A in a region of A that is not the antigen binding site through ionic, electrostatic, hydrophobic, Pi-stacking and H-bonding interactions, or a combination thereof. In some instances, P is resistant to cleavage by a protease. In some instances, physiological pH is about pH 7.4. In some instances, acidic pH is about pH 6.0 to about pH 7.0. In some instances, P comprises a peptide sequence of at least 6 amino acids in length. In some instances, P comprises a peptide sequence of at least 10 amino acids in length. In some instances, P comprises a peptide sequence of at least 6 to 20 amino acids in length. In some instances, P comprises a modified amino acid, a non-natural amino acid, or a modified non-natural amino acids, or combination thereof. In some instances, the modified amino acid or modified non-natural amino acid comprises a post-translational modification. In some instances, at acidic pH P is reversibly bound to L. In some instances, L comprises a peptide sequence with at least one aspartic acid or glutamic acid, or a combination thereof. In some instances, the histidine of P forms an interaction with the aspartic acid or glutamic acid of L. In some instances, L is a peptide sequence having at least 5 to no more than 50 amino acids. In some instances, L has a formula selected from the group consisting of: (GS).sub.n, wherein n is an integer from 6 to 20 (SEQ ID NO: 1); (G.sub.2S).sub.n, wherein n is an integer from 4 to 13 (SEQ ID NO: 2); (G.sub.3S).sub.n, wherein n is an integer from 3 to 10 (SEQ ID NO: 3); and (G.sub.4S).sub.n, wherein n is an integer from 2 to 8 (SEQ ID NO: 4); and (G).sub.n, wherein n is an integer from 12 to 40 (SEQ ID NO: 5). In some instances, L has a formula comprising (GGSGGD).sub.n, wherein n is an integer from 2 to 6 (SEQ ID NO: 8). In some instances, L has a formula comprising (GGSGGE).sub.n, wherein n is an integer from 2 to 6 (SEQ ID NO: 9). In some instances, L has a formula comprising (GGGSGSGGGGS).sub.n, wherein n is an integer from 1 to 3 (SEQ ID NO: 6). In some instances, L has a formula comprising (GGGGGPGGGGP) .sub.n, wherein n is an integer from 1 to 3 (SEQ ID NO: 7). In some instances, L has a formula selected from (GX).sub.n, wherein X is serine, aspartic acid, glutamic acid, threonine, or proline and n is at least 20 (SEQ ID NO: 24); (GGX).sub.n, wherein X is serine, aspartic acid, glutamic acid, threonine, or proline and n is at least 13 (SEQ ID NO: 25); (GGGX).sub.n, wherein X is serine, aspartic acid, glutamic acid, threonine, or proline and n is at least 10 (SEQ ID NO: 26); (GGGGX).sub.n, wherein X is serine, aspartic acid, glutamic acid, threonine, or proline and n is at least 8 (SEQ ID NO: 27); (G.sub.zX).sub.n, wherein X is serine, aspartic acid, glutamic acid, threonine, or proline and n is at least 15, and z is between 1 and 20 (SEQ ID NO: 28). In some instances, L is resistant to cleavage by a protease. In some instances, L comprises a modified amino acid. In some instances, the modified amino acid comprises a post-translational modification. In some instances, L comprises a non-natural amino acid or a modified non-natural amino acid, or combination thereof. In some instances, the modified non-natural amino acid comprises a post-translational modification. In some instances, the target antigen is selected from the group consisting of: 4-1BB, CTLA4, PD-1, and PD-L1. In some instances, the target antigen is 4-1BB. In some instances, the target antigen is CTLA4. In some instances, the target antigen is PD-1. In some instances, the target antigen is PD-L1. In some instances, A is a full length antibody, a single-chain antibody, an Fab fragment, an Fab' fragment, an (Fab')2 fragment, an Fv fragment, a divalent single chain antibody, bispecific antibody, a trispecific antibody, a tetraspecific antibody, or an antibody drug conjugate. In some instances, A is selected from the group consisting of utomilumab, urelumab, ipilimumab, tremelimumab, pembrolizumab, nivolumab, and atezolizumab. In some instances, A is utomilumab. In some instances, A is urelumab. In some instances, A is ipilimumab. In some instances, A is tremelimumab. In some instances, A is pembrolizumab. In some instances, A is nivolumab. In some instances, A is atezolizumab. In some instances, P comprises an amino acid sequence selected from the group consisting of Peptide 1, Peptide 2, Peptide 5, Peptide 6, Peptide 10, Peptide 13, Peptide 26, Peptide 14, Peptide 15, Peptide 20, Peptide 27, Peptide 21, Peptide 22, Peptide 23, Peptide 28, Peptide 29, Peptide 30, Peptide 31, and Peptide 24. In some instances, the target antigen is CTLA4 and P comprises an amino acid sequence selected from the group consisting of Peptide 1, Peptide 2, Peptide 5, Peptide 6, Peptide 10, Peptide 13, Peptide 26, Peptide 14, and Peptide 15. In some instances, the target antigen is CTLA4 and P comprises an amino acid sequence according to Peptide 1. In some instances, the target antigen is CTLA4 and P comprises an amino acid sequence according to Peptide 2. In some instances, the target antigen is CTLA4 and P comprises an amino acid sequence according to Peptide 5. In some instances, the target antigen is CTLA4 and P comprises an amino acid sequence according to Peptide 6. In some instances, the target antigen is CTLA4 and P comprises an amino acid sequence according to Peptide 10. In some instances, the target antigen is CTLA4 and P comprises an amino acid sequence according to Peptide 13. In some instances, the target antigen is CTLA4 and P comprises an amino acid sequence according to Peptide 26. In some instances, the target antigen is CTLA4 and P comprises an amino acid sequence according to Peptide 14. In some instances, the target antigen is CTLA4 and P comprises an amino acid sequence according to Peptide 15. In some instances, the target antigen is CTLA4 and P comprises an amino acid sequence selected from the group consisting of Peptide 10, Peptide 13, Peptide 26, Peptide 14, and Peptide 15. In some instances, the target antigen is PD-L1 and P comprises an amino acid sequence selected from the group consisting of Peptide 20, Peptide 27, Peptide 21, Peptide 22, Peptide 23, Peptide 28, Peptide 29, Peptide 30, Peptide 31, and Peptide 24. In some instances, the target antigen is PD-L1 and P comprises an amino acid sequence according to Peptide 20. In some instances, the target antigen is PD-L1 and P comprises an amino acid sequence according to Peptide 27. In some instances, the target antigen is PD-L1 and P comprises an amino acid sequence according to Peptide 21. In some instances, the target antigen is PD-L1 and P comprises an amino acid sequence according to Peptide 22. In some instances, the target antigen is PD-L1 and P comprises an amino acid sequence according to Peptide 23. In some instances, the target antigen is PD-L1 and P comprises an amino acid sequence according to Peptide 28. In some instances, the target antigen is PD-L1 and P comprises an amino acid sequence according to Peptide 29. In some instances, the target antigen is PD-L1 and P comprises an amino acid sequence according to Peptide 30. In some instances, the target antigen is PD-L1 and P comprises an amino acid sequence according to Peptide 31. In some instances, the target antigen is PD-L1 and P comprises an amino acid sequence according to Peptide 24. In some instances, the target antigen is PD-L1 and P comprises an amino acid sequence selected from the group consisting of Peptide 27, Peptide 22, Peptide 23, and Peptide 31. In some instances, A comprises a kappa light chain amino acid sequence according to SEQ ID NO: 68. In some instances, A comprises a heavy chain amino acid sequence according to SEQ ID NO: 70. In some instances, the modified antibody comprises an amino acid sequence according to SEQ ID NO: 69. In some instances, P comprises an amino acid sequence selected from the group consisting of Peptide 1, Peptide 2, Peptide 5, Peptide 6, Peptide 10, Peptide 13, Peptide 26, Peptide 14, Peptide 15, Peptide 20, Peptide 21, Peptide 22, Peptide 23, Peptide 31, and Peptide 24. In some instances, P comprises a peptide sequence with at least two histidines. In some instances, P comprises an amino acid sequence selected from the group consisting of Peptide 5, Peptide 13, Peptide 26, Peptide 14, Peptide 15, Peptide 31, and Peptide 24. In some instances, P comprises a peptide sequence with at least two histidines and at least two cysteines. In some instances, P comprises a peptide sequence with at least two charged amino acid residues wherein the charged amino acid residues are selected from the group consisting of aspartate, glutamate, and histidine. In some instances, P comprises an amino acid sequence selected from the group consisting of Peptide 1, Peptide 2, Peptide 5, Peptide 6, Peptide 10, Peptide 13, Peptide 26, Peptide 14, Peptide 15, Peptide 20, Peptide 27, Peptide 21, Peptide 22, Peptide 23, Peptide 28, Peptide 29, Peptide 30, Peptide 31, and Peptide 24. In some instances, P comprises a peptide sequence with at least three charged amino acid residues wherein the charged amino acid residues are selected from the group consisting of aspartate, glutamate, and histidine. In some instances, P comprises an amino acid sequence selected from the group consisting of Peptide 1, Peptide 2, Peptide 5, Peptide 10, Peptide 13, Peptide 26, Peptide 14, Peptide 15, Peptide 21, Peptide 23, Peptide 28, Peptide 31, and Peptide 24. In some instances, P comprises a peptide sequence with at least one histidine and at least two aspartates. In some instances, P comprises a peptide sequence with at least one cysteine. In some instances, P comprises an amino acid sequence selected from the group consisting of Peptide 5, Peptide 6, Peptide 10, Peptide 13, Peptide 26, Peptide 14, Peptide 15, Peptide 22, Peptide 23, Peptide 29, Peptide 30, Peptide 31, and Peptide 24. In some instances, P comprises a peptide sequence with at least two cysteine amino acid residues. In some instances, P comprises an amino acid sequence selected from the group consisting of Peptide 6, Peptide 10, Peptide 13, Peptide 26, Peptide 14, Peptide 22, Peptide 23, Peptide 29, Peptide 30, Peptide 31, and Peptide 24. In some instances, P comprises a peptide sequence with at least two cysteines and at least three charged amino acid residues wherein the charged amino acid residues are selected from the group consisting of aspartate, glutamate, and histidine. In some instances, P comprises an amino acid sequence of formula GGX, wherein X is cysteine, alanine, proline, methionine, histidine, or leucine. In some instances, P comprises an amino acid sequence selected from the group consisting of Peptide 5, Peptide 6, Peptide 10, Peptide 13, Peptide 26, Peptide 14, Peptide 15, Peptide 22, Peptide 23, Peptide 29, Peptide 31, and Peptide 24. In some instances, P comprises an amino acid sequence of GGC. In some instances, P comprises an amino acid sequence selected from the group consisting of Peptide 5, Peptide 6, Peptide 13, Peptide 26, Peptide 14, Peptide 31, and Peptide 24. In some instances, P does not comprise a lysine or arginine. In some instances, P comprises at least one histidine and at least one aspartate. In some instances, P comprises at least one histidine and at least one glutamate. In some instances, P comprises at least one histidine and at least two glutamates. In some instances, P comprises at least two histidines and at least one aspartate or at least one glutamate. In some instances, P comprises at least one histidine, wherein at least one hydrogen bonding amino acid residue is within two amino acid positions to the histidine, wherein the hydrogen bonding amino acid residue is selected from the group consisting of serine, threonine, tyrosine, asparagine, and glutamine. In some instances, the hydrogen bonding amino acid residue is within one amino acid position to the histidine. In some instances, the hydrogen bonding amino acid residue is serine. In some instances, the hydrogen bonding amino acid residue is threonine. In some instances, the hydrogen bonding amino acid residue is tyrosine. In some instances, the hydrogen bonding amino acid residue is asparagine. In some instances, the hydrogen bonding amino acid residue is glutamine. In some instances, A-L-P does not comprise a protease cleavage site that releases A from P in a tumor microenvironment. In some instances, L comprises a peptide sequence with at least one histidine. In some instances, at acidic pH L is reversibly bound to P. In some instances, P comprises a peptide sequence with at least one aspartic acid or glutamic acid, or a combination thereof. In some instances, the histidine of L forms an interaction with the aspartic acid or glutamic acid of P.
[0004] Disclosed herein, in some embodiments, are pharmaceutical compositions, comprising: (a) a modified antibody according to any of the disclosures herein; and (b) a pharmaceutically acceptable excipient.
BRIEF DESCRIPTION OF THE DRAWINGS
[0005] The novel features of the invention are set forth with particularity in the appended claims. A better understanding of the features and advantages of the present invention will be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the invention are utilized, and the accompanying drawings of which:
[0006] FIG. 1 exemplifies an antibody that does not comprise a peptide modification. Such antibodies bind to unique antigens that exist in abundance in tumor tissue. But, the unique antigens are also found in some healthy tissues, which can trigger systemic immune activation in a subject, and cause toxicity.
[0007] FIG. 2 shows an exemplary modified antibody. In this example, the modified antibody is linked to a peptide which binds at or near the antigen binding site of the modified antibody at pH 7.4. This reduces binding of the modified antibody to its target antigen in healthy tissue. In tumor tissue, the acidic tumor microenvironment disrupts the interaction of the peptide with the modified antibody. The antigen binding site of the modified antibody is exposed, and the modified antibody selectively binds to its target antigen in tumor tissue.
[0008] FIG. 3 shows an exemplary modified antibody. The peptide is linked to the antibody via a linking moiety. The linking moiety creates a stable link between the antibody and peptide. The peptide prevents the antibody from binding to its target antigen in physiological pH, non-diseased tissue. A pH switch in tumor microenvironments modulates the peptide/antibody affinity. The peptide is released in tumor tissue, and enables the antibody to bind to its target antigen.
[0009] FIG. 4 shows an exemplary modified antibody. In this example, the peptide is engineered to contain a histidine. At physiological pH, the histidine of the peptide interacts with the antibody binding site. At acidic pH, such as in a tumor microenvironment, the interaction between the peptide and the antibody binding site is disfavored because the histidine is protonated. The antibody binding site is available for binding to its target antigen in a tumor microenvironment.
[0010] FIG. 5 is an exemplary schematic of phage panning screening platform to identify pH responsive peptide candidates.
[0011] FIG. 6 illustrates a phagemid ELISA of a collection of enriched clones resulting from three rounds of biopanning against anti-mouse CTLA-4 (clone 9D9).
[0012] FIG. 7 is an exemplary phagemid competition ELISA from a collection of enriched clones isolated after three rounds of biopanning against anti-mouse CTLA-4 (clone 9D9).
[0013] FIG. 8 is an exemplary pH-dependent "binding" assay of a collection of enriched clones isolated after three rounds of biopanning against anti-mouse CTLA-4 (clone 9D9).
[0014] FIG. 9 illustrates a pH-dependent "dissociation" assay of a collection of enriched clones isolated after three rounds of biopanning against anti-mouse CTLA-4 (clone 9D9).
[0015] FIG. 10A-FIG. 10B illustrate pH responsive anti-CTLA4 peptide candidates identified with phage panning screening platform. FIG. 10A illustrates peptide candidates identified that exhibit pH dependent binding to anti-CTLA4. FIG. 10B illustrates peptide candidates identified that exhibit pH dependent dissociation to anti-CTLA4.
[0016] FIG. 11A-FIG. 11C illustrate significant pH responsiveness of unoptimized peptide candidates Peptide 5 (FIG. 11A), Peptide 6 (FIG. 11B) and Peptide 10 (FIG. 11C).
[0017] FIG. 12 illustrates multiple pH response anti-CTLA4 peptide candidates with pH dependent dissociation identified from biased library.
[0018] FIG. 13A-FIG. 13B illustrate pH biased library generated peptide candidates Peptide 14 (FIG. 13A) and Peptide 15 (FIG. 13B).
[0019] FIG. 14 illustrates a Peptide 10 ELISA to anti-mouse antibody (clone 9D9).
[0020] FIG. 15 illustrates a Peptide 10 competition ELISA.
[0021] FIG. 16A-FIG. 16C illustrate octet binding curve of Peptide 15 (FIG. 16A), Peptide 17 (FIG. 16C) and Peptide 18 (FIG. 16C).
[0022] FIG. 17 illustrates pH-dependent binding of a-mCTLA-4 Fab to Peptide 15 by ELISA.
[0023] FIG. 18 illustrates CTLA4 antibody/ligand competition ELISA.
[0024] FIG. 19 illustrates a phagemid ELISA of a collection of enriched clones resulting from biopanning against PD-L1 antibody.
[0025] FIG. 20 illustrates anti-PD-L1 phage competition ELISA.
[0026] FIG. 21 illustrates pH-dependent phagemid PD-L1 antibody binding ELISA.
[0027] FIG. 22 illustrates pH-dependent phagemid PD-L1 antibody dissociation ELISA.
[0028] FIG. 23 illustrates Peptide 23 PD-L1 antibody binding.
[0029] FIG. 24 illustrates Peptide 23 PD-L1 competition ELISA.
[0030] FIG. 25 illustrates PD-L1 antibody/ligand competition ELISA.
DETAILED DESCRIPTION OF THE INVENTION
[0031] Protein-based therapies, including antibody therapies, are effective treatments for a variety of diseases. A strategy to improve toxicity and side effects of such treatments is to engineer a peptide that binds to the protein-based therapy at physiological pH, but does not bind to the protein-based therapy at acidic pH. While peptides have been shown to bind to antibodies with varying affinities, peptides which bind to antibodies in a pH dependent manner are not known. These pH-dependent peptides enable the protein-based therapy to be activated in certain acidic microenvironments while not affecting healthy tissues.
Certain Definitions
[0032] The terminology used herein is for the purpose of describing particular cases only and is not intended to be limiting. As used herein, the singular forms "a", "an" and "the" are intended to include the plural forms as well, unless the context clearly indicates otherwise. Furthermore, to the extent that the terms "including", "includes", "having", "has", "with", or variants thereof are used in either the detailed description and/or the claims, such terms are intended to be inclusive in a manner similar to the term "comprising."
[0033] The term "about" or "approximately" means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, e.g., the limitations of the measurement system. For example, "about" can mean within 1 or more than 1 standard deviation, per the practice in the given value. Where particular values are described in the application and claims, unless otherwise stated the term "about" should be assumed to mean an acceptable error range for the particular value.
[0034] As used herein, "physiological pH" is used to refer to the pH of a non-diseased state cellular environment. In some embodiments, physiological pH is greater than pH 6.9. In some embodiments, physiological pH is about pH 7.0 to about pH 8.0. In some embodiments, physiological pH is about 7.4.
[0035] Described herein are modified antibodies, pharmaceutical compositions thereof, as well as nucleic acids, and methods for discovering the same.
[0036] The modified antibodies described herein are connected by a linking moiety to a peptide. The peptide is designed to reduce binding of the modified antibody to its target antigen when at physiological pH. At acidic pH, for example at a tumor microenvironment, the peptide does not reduce binding of the modified antibody to its target antigen. The peptide is designed to activate the modified antibody at tumor microenvironments, thus improving the safety profile of such therapies. While antibody-based therapies have proven effective for some diseases in some cases, there is a need for increased targeting of antibodies to the disease site to reduce systemic-based toxicities.
[0037] Disclosed herein, in certain embodiments, are modified antibodies comprising a formula:
A-L-P
wherein A is an antibody or antibody fragment that binds to a target antigen, P is a peptide that reduces binding of A to the target antigen at physiological pH, and that does not reduce binding of A to the target antigen at acidic pH, and L is a linking moiety that connects A to P at physiological pH and in a tumor microenvironment and L is bound to A outside an antigen binding site.
Peptide (P)
[0038] The peptide of the modified antibodies, in some embodiments, reversibly binds to A in such a way that P sterically blocks, inhibits, or reduces the binding of affinity of A for its target antigen at physiological pH. In some embodiments, P reversibly binds to A through ionic, electrostatic, hydrophobic, Pi-stacking, or H-bonding interactions, or a combination thereof. In some embodiments, P binds to the antigen binding site of A at physiological pH. In some embodiments, P binds to A at amino acid residues which are near the antigen binding site of A. In some embodiments, P binds to amino acid residues within the antigen binding site.
[0039] In some embodiments, at acidic pH, P is not reversibly bound to the antigen binding site of A. In some embodiments, at acidic pH, P is not reversibly bound to amino acid residues near the antigen binding site of A. The peptide activates the modified antibody at acidic pH by exposing the antigen binding site of A for engagement with its respective target antigen. In some cases, P has a different conformation at acidic pH, compared to the conformation of P at physiological pH. In some embodiments, at acidic pH, P does not form any interactions with A. In some embodiments, at acidic pH, P does not form any interactions with the linking moiety (L). In some embodiments, at acidic pH, P forms an interaction with L. In some embodiments, P and L reversibly bind through ionic, electrostatic, hydrophobic, Pi-stacking, or H-bonding interactions, or a combination thereof.
[0040] In some cases, P comprises a peptide sequence. In some cases, P comprises a peptide sequence disclosed in Table 1. In some cases, P comprises a peptide sequence at least 80% identical to a peptide sequence disclosed in Table 1. In some cases, P comprises a peptide sequence at least 90% identical to a peptide sequence disclosed in Table 1. In some cases, P comprises a peptide sequence at least 95% identical to a peptide sequence disclosed in Table 1. In some cases, the peptides disclosed herein are linear peptides. In some cases, the peptides disclosed herein are cyclic peptides.
TABLE-US-00001 TABLE 1 Peptide Sequences (P) SEQ Peptide ID Sequence ID NO CTLA4 peptides Peptide 1 TLDDMSHVILYA 29 Peptide 2 VISDNHQIVWDL 30 Peptide 3 LTTQDHPLTILL 31 Peptide 4 GGWICHWLEPQEACTY 32 Peptide 5 GGCFEEHEQLVFQTHC 33 Peptide 6 GGCILPGQHESQAIAC 34 Peptide 7 GGCLSQMDFHDWLQYC 35 Peptide 8 GGTDCYLWDYKASCHQ 36 Peptide 9 GGKCDSLSYWQEIECS 37 Peptide 10 GGADCLLHDWDSACQI 38 Peptide 11 MQNVDEAPPLLL 39 Peptide 12 TNDWQGLLLNVF 40 Peptide 13 GGCQDSMFHHPNHC 41 Peptide 26 GGCGMHQHPLFVDC 42 Peptide 14 GGCSLSQHPNHSDC 43 Peptide 15 GGPCNQVECHHQFT 44 Peptide 16 GGCPSLHPQWIHVC 45 Peptide 17 GGCFDSANQHPNIVIC 46 Peptide 18 GGCHQDIEMPIYWC 47 Peptide 19 GGCQIHDPHTWHLC 48 PD-L1 peptides Peptide 20 QLFYPSTYHIID 49 Peptide 27 QVSPLYFYEELA 50 Peptide 21 HQALLDFYGDY 51 Peptide 22 GGMCHELFYSNLNWCQ 52 Peptide 23 GGHCVDMVDFYQQTCQ 53 Peptide 28 VDLLDGSLQDFY 54 Peptide 29 GGLCSTFYEPQVDICY 55 Peptide 30 SDFSGLLFYDYQ 56 Peptide 31 GGCVHFFHHQRPDC 57 Peptide 24 GGCHNKSGLFYHYC 58 Peptide 25 GGCFYPGHHHQLLC 59
[0041] In some embodiments, P comprises an amino acid sequence selected from the group consisting of Peptide 1, Peptide 2, Peptide 5, Peptide 6, Peptide 10, Peptide 13, Peptide 26, Peptide 14, Peptide 15, Peptide 20, Peptide 27, Peptide 21, Peptide 22, Peptide 23, Peptide 28, Peptide 29, Peptide 30, Peptide 31, and Peptide 24. In some embodiments, P comprises an amino acid sequence selected from the group consisting of Peptide 10, Peptide 13, Peptide 26, Peptide 14, Peptide 15, Peptide 27, Peptide 22, Peptide 23, and Peptide 31. In some embodiments, P comprises an amino acid sequence selected from the group consisting of Peptide 15 and Peptide 23. In some embodiments, P comprises an amino acid sequence of Peptide 15. In some embodiments, P comprises an amino acid sequence of Peptide 23.
[0042] In some embodiments, P is designed to incorporate amino acid residues which cause a conformational change when triggered by an environmental change. In some cases, the environmental change is the difference in pH from normal, healthy tissue to an acidic pH that is found at tumor microenvironments.
[0043] Cancer cells in a solid tumor are able to form a tumor microenvironment in their surroundings to support the growth and metastasis of the cancer cells. A tumor microenvironment is often hypoxic. As the tumor mass increases, the interior of the tumor grows farther away from existing blood supply, which leads to difficulties in fully supplying oxygen to the tumor microenvironment. As a result, the tumor cells tend to rely on energy generated from lactic acid fermentation, which does not require oxygen. As a consequence of using lactic acid fermentation is that the tumor microenvironment is acidic (approximately pH 6.0-6.9) in contrast to other parts of the body which are typically either neutral or slightly basic. For example, human blood plasma has a pH of about 7.4.
[0044] In some embodiments, P contains at least one histidine residue. In some embodiments, at physiological pH, at least one histidine residue of P forms a binding interaction with at least one amino acid residue of the antigen binding site of A. In some embodiments, at physiological pH, at least one histidine residue of P forms a binding interaction with at least one amino acid residue that is near the antigen binding site of A. In some embodiments, at acidic pH, at least one histidine residue of P forms a binding interaction with a glutamic acid or aspartic acid located on L.
[0045] In some embodiments, P contains more than one histidine residue. In some embodiments, P contains at least two histidine residues. In some embodiments, at physiological pH, at least two histidine residues of P form a binding interaction with an amino acid residue of the antigen binding site of A. In some embodiments, at physiological pH, at least two histidine residues of P form a binding interaction with an amino acid residue that is near the antigen binding site of A. In some embodiments, at physiological pH, at least two histidine residues of P form binding interactions with amino acid residues that are at or near the antigen binding site of A. In some embodiments, at acidic pH, at least two histidine residues of P form a binding interaction with a glutamic acid or aspartic acid located on L.
[0046] In some embodiments, P contains at least two charged amino acid residues. In some embodiments, P contains at least three charged amino acid residues. In some embodiments, the charged amino acid residues are selected from the group consisting of lysine, arginine, histidine, aspartate, and glutamate. In some embodiments, the charged amino acid residues are selected from the group consisting of glutamate, histidine, and aspartate. In some embodiments, P contains at least glutamate and histidine. In some embodiments, P contains histidine and aspartate. In some embodiments, P contains aspartate and glutamate. In some embodiments, P contains at least one histidine and at least two aspartate residues. In some embodiments, P contains at least two histidine and at least one glutamate residues. In some embodiments, P contains at least one histidine and at least two glutamate residues. In some embodiments, P contains at least two histidine and at least one aspartate residues.
[0047] In some embodiments, P contains at least two polar amino acid residues. In some embodiments, P contains at least three polar amino acids. In some embodiments, P contains at least four polar amino acids. In some embodiments, the polar amino acid residues are selected from the group consisting of serine, threonine, cysteine, asparagine, glutamine, and tyrosine. In some embodiments, P contains at least one glutamine. In some embodiments, P contains at least two glutamines. In some embodiments, P contains at least one glutamine and at least one serine. In some embodiments, P contains at least one glutamine and at least one cysteine. In some embodiments, P contains at least one glutamine and at least one asparagine. In some embodiments, P contains at least two glutamines and at least one threonine. In some embodiments, P contains at least two glutamines, and at least one asparagine. In some embodiments, P contains at least two glutamines, at least one asparagine, and at least one cysteine. In some embodiments, P contains at least two glutamines, at least one asparagine, at least one cysteine, and at least one threonine.
[0048] In some embodiments, P contains at least one cysteine. In some embodiments, P contains at least two cysteines. In some embodiments, P contains at least three cysteines.
[0049] In some embodiments, P contains at least one glutamine and at least one methionine. In some embodiments, P contains at least two glutamines and at least one methionine. In some embodiments, P contains at least two glutamines at least one methionine, and at least one threonine.
[0050] In some embodiments, P contains at least one charged amino acid residue and at least one polar amino acid residue. In some embodiments, P contains at least one charged amino acid residue and at least two polar amino acid residues. In some embodiments, P contains at least one charged amino acid residue and at least three polar amino acid residues. In some embodiments, P contains at least two charged amino acid residues and at least one polar amino acid residues. In some embodiments, P contains at least two charged amino acid residues and at least two polar amino acid residues. In some embodiments, P contains at least two charged amino acid residues and at least three polar amino acid residues. In some embodiments, P contains at least two charged amino acid residues and at least four polar amino acid residues. In some embodiments, P contains at least three charged amino acid residues and at least one polar amino acid residues. In some embodiments, P contains at least three charged amino acid residues and at least two polar amino acid residues. In some embodiments, P contains at least three charged amino acid residues and at least three polar amino acid residues. In some embodiments, P contains at least two histidine and at least two cysteine residues. In some embodiments, P contains at least three charged amino acid residues and at least two cysteines. In some embodiments, P contains at least one histidine, at least one serine, and at least one glutamine. In some embodiments, P contains at least one histidine, at least one asparagine, and at least one glutamine.
[0051] In some embodiments, P comprises the sequence of GGX, wherein X is cysteine, alanine, proline, methionine, histidine, or leucine. In some embodiments, P comprises the sequence GGC. In some embodiments, P comprises the sequence GGP. In some embodiments, P comprises the sequence GGA. In some embodiments, P comprises the sequence GGP. In some embodiments, P comprises the sequence GGM. In some embodiments, P comprises the sequence GGH. In some embodiments, P comprises the sequence GGL.
[0052] In some embodiments, P does not contain a tryptophan residue. In some embodiments, P does not contain an arginine residue. In some embodiments, P does not contain a lysine residue. In some embodiments, P does not contain a lysine residue or an arginine residue. In some embodiments, P does not contain a lysine residue, an arginine residue, or a tryptophan residue.
[0053] In some embodiments, P comprises at least one histidine, wherein at least one hydrogen bonding amino acid residue is within two amino acid positions to the histidine. In some embodiments, the hydrogen bonding amino acid residue is serine, threonine, tyrosine, asparagine, glutamine or a combination thereof.
[0054] In some embodiments, the hydrogen bonding amino acid residue is within one amino acid position to the histidine. In some embodiments, serine is within one amino acid position to the histidine. In some embodiments, threonine is within one amino acid position to the histidine. In some embodiments, tyrosine is within one amino acid position to the histidine. In some embodiments, asparagine is within one amino acid position to the histidine. In some embodiments, glutamine is within one amino acid position to the histidine.
[0055] In some embodiments, the hydrogen bonding amino acid residue is two amino acid positions away from the histidine. In some embodiments, serine is two amino acid positions away from the histidine. In some embodiments, threonine is two amino acid positions away from the histidine. In some embodiments, tyrosine is two amino acid positions away from the histidine. In some embodiments, asparagine is two amino acid positions away from the histidine. In some embodiments, glutamine is two amino acid positions away from the histidine.
[0056] In some embodiments, P contains at least one aromatic amino acid residue. In some embodiments, P contains at least two aromatic amino acid residues. In some embodiments, P contains phenylalanine and tyrosine. In some embodiments, the phenylalanine and the tyrosine are next to each other in the amino acid sequence of P. In some embodiments, P contains two phenylalanines. In some embodiments, the phenylalanines are next to each other in the amino acid sequence of P.
[0057] In some embodiments, P is a peptide sequence at least 5 amino acids in length. In some embodiments, P is a peptide sequence at least 6 amino acids in length. In some embodiments, P is a peptide sequence at least 10 amino acids in length. In some embodiments, P is a peptide sequence at least 20 amino acids in length. In some embodiments, P is resistant to cleavage by a protease.
[0058] In some embodiments, P is not a natural binding partner of A. In some embodiments, P does not comprise a mimotope. In some embodiments, P contains a random amino acid sequence that does not share any sequence homology to the natural binding partner of A. It is advantageous to use sequences that do not share any sequence homology to the natural binding partner of A to allow for greater flexibility in the peptide design. This allows for building a larger library of candidate peptide sequences for screening. In some instances, P is a modified binding partner for A which contains amino acid changes that at least slightly decrease affinity and/or avidity of binding to A. In some embodiments, P contains no or substantially no homology to A's natural binding partner. In some embodiments, P is no more than 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, or 80% similar to the natural binding partner of A.
[0059] In some embodiments, P comprises a modified amino acid or non-natural amino acid, or a modified non-natural amino acid, or a combination thereof. In some embodiments, the modified amino acid or a modified non-natural amino acid comprises a post-translational modification. In some embodiments P comprises a modification including, but not limited to acetylation, acylation, ADP-ribosylation, amidation, covalent attachment of flavin, covalent attachment of a heme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid or lipid derivative, covalent attachment of phosphatidylinositol, cross-linking, cyclization, disulfide bond formation, demethylation, formation of covalent crosslinks, formation of cystine, formation of pyroglutamate, formylation, gamma carboxylation, glycosylation, GPI anchor formation, hydroxylation, iodination, methylation, myristoylation, oxidation, proteolytic processing, phosphorylation, prenylation, racemization, selenoylation, sulfation, transfer-RNA mediated addition of amino acids to proteins such as arginylation, and ubiquitination. Modifications are made anywhere to P including the peptide backbone, the amino acid side chains, and the terminus.
Linking Moiety (L)
[0060] In some embodiments, L is a peptide sequence of at least 5 amino acid residues. In some embodiments, L is a peptide sequence of no more than 50 amino acids. Regarding the amino acid composition of L, peptides are selected with properties that confer flexibility and facilitate a conformational change of P during a change in pH.
[0061] In some embodiments, L comprises a peptide sequence with at least one histidine. In some embodiments, at acidic pH L is reversibly bound to P. In some embodiments, P comprises a peptide sequence with at least one aspartic acid or glutamic acid, or a combination thereof. In some embodiments, the histidine of L forms an interaction with the aspartic acid or glutamic acid of P.
[0062] In some embodiments, L is resistant to protease cleavage. For example, glycine and serine residues generally provide protease resistance. Examples of suitable linking moieties for connecting A or C to P include, but are not limited to (GS).sub.n, wherein n is an integer from 6 to 20 (SEQ ID NO: 1); (G.sub.2S).sub.n, wherein n is an integer from 4 to 13 (SEQ ID NO: 2); (G.sub.3S).sub.n, wherein n is an integer from 3 to 10 (SEQ ID NO: 3); and (G.sub.4S).sub.n, wherein n is an integer from 2 to 8 (SEQ ID NO: 4); and (G).sub.n, wherein n is an integer from 12 to 40 (SEQ ID NO: 5). Additional examples include, but are not limited to, (GGGSGSGGGGS).sub.n, wherein n is an integer from 1 to 3 (SEQ ID NO: 6), or (GGGGGPGGGGP).sub.n, wherein n is an integer from 1 to 3 (SEQ ID NO: 7).
[0063] In some embodiments, L binds to P at acidic pH, for example, at a tumor microenvironment. In some embodiments, at acidic pH, L is reversibly bound to P. In some embodiments, the interaction of L and P at acidic pH is mediated through a histidine residue on P and a glutamic acid or aspartic acid residue on L. Examples of such linking moieties include, but are not limited to, (GGSGGD).sub.n, wherein n is an integer from 2 to 6 (SEQ ID NO: 8); or (GGSGGE).sub.n, wherein n is an integer from 2 to 6 (SEQ ID NO: 9).
[0064] In some embodiments, L has a formula comprising, (GS).sub.x(GGSGGD).sub.y (GS).sub.z, wherein x is an integer from 0 to 20, y is an integer from 2 to 6, and z is an integer from 0 to 20 (SEQ ID NO: 10). In some embodiments, L has a formula comprising, (G.sub.2S).sub.x(GGSGGD).sub.y (G.sub.2S).sub.z, wherein x is an integer from 0 to 13, y is an integer from 2 to 6, and z is an integer from 0 to 13 (SEQ ID NO: 11). In some embodiments, L has a formula comprising, (G.sub.3S).sub.x(GGSGGD).sub.y (G.sub.3S).sub.z, wherein x is an integer from 0 to 10, y is an integer from 2 to 6, and z is an integer from 0 to 10 (SEQ ID NO: 12). In some embodiments, L has a formula comprising, (G.sub.4S).sub.x(GGSGGD).sub.y (G.sub.4S).sub.z, wherein x is an integer from 0 to 8, y is an integer from 2 to 6, and z is an integer from 0 to 8 (SEQ ID NO: 13). In some embodiments, L has a formula comprising, (G).sub.x(GGSGGD).sub.y (G).sub.z, wherein x is an integer from 0 to 40, y is an integer from 2 to 6, and z is an integer from 0 to 40 (SEQ ID NO: 14). In some embodiments, L has a formula comprising, (GGGSGSGGGGS).sub.x(GGSGGD).sub.y (GGGSGSGGGGS).sub.z, wherein x is an integer from 0 to 3, y is an integer from 2 to 6, and z is an integer from 0 to 3 (SEQ ID NO: 15). In some embodiments, L has a formula comprising, (GGGSGSGGGGP).sub.x(GGSGGD).sub.y (GGGSGSGGGGP).sub.z, wherein x is an integer from 0 to 3, y is an integer from 2 to 6, and z is an integer from 0 to 3 (SEQ ID NO: 16).
[0065] In some embodiments, L has a formula comprising, (GS).sub.x(GGSGGE).sub.y(GS).sub.z, wherein x is an integer from 0 to 20, y is an integer from 2 to 6, and z is an integer from 0 to 20 (SEQ ID NO: 17). In some embodiments, L has a formula comprising, (G.sub.2S).sub.x(GGSGGE).sub.y (G.sub.2S).sub.z, wherein x is an integer from 0 to 13, y is an integer from 2 to 6, and z is an integer from 0 to 13 (SEQ ID NO: 18). In some embodiments, L has a formula comprising, (G.sub.3S).sub.x(GGSGGE).sub.y (G.sub.3S).sub.z, wherein x is an integer from 0 to 10, y is an integer from 2 to 6, and z is an integer from 0 to 10 (SEQ ID NO: 19). In some embodiments, L has a formula comprising, (G.sub.4S).sub.x(GGSGGE).sub.y (G.sub.4S).sub.z, wherein x is an integer from 0 to 8, y is an integer from 2 to 6, and z is an integer from 0 to 8 (SEQ ID NO: 20). In some embodiments, L has a formula comprising, (G).sub.x(GGSGGE).sub.y(G).sub.z, wherein x is an integer from 0 to 40, y is an integer from 2 to 6, and z is an integer from 0 to 40 (SEQ ID NO: 21). In some embodiments, L has a formula comprising, (GGGSGSGGGGS).sub.x(GGSGGE).sub.y (GGGSGSGGGGS).sub.z, wherein x is an integer from 0 to 3, y is an integer from 2 to 6, and z is an integer from 0 to 3 (SEQ ID NO: 22). In some embodiments, L has a formula comprising, (GGGSGSGGGGP).sub.x(GGSGGE).sub.y (GGGSGSGGGGP).sub.z, wherein x is an integer from 0 to 3, y is an integer from 2 to 6, and z is an integer from 0 to 3 (SEQ ID NO: 23).
[0066] Additional examples of linking moieties include, but are not limited to wherein L has a formula selected from (GX).sub.n, wherein X is serine, aspartic acid, glutamic acid, threonine, or proline and n is at least 20 (SEQ ID NO: 24); (GGX).sub.n, wherein X is serine, aspartic acid, glutamic acid, threonine, or proline and n is at least 13 (SEQ ID NO: 25); (GGGX).sub.n, wherein X is serine, aspartic acid, glutamic acid, threonine, or proline and n is at least 10 (SEQ ID NO: 26); (GGGGX).sub.n, wherein X is serine, aspartic acid, glutamic acid, threonine, or proline and n is at least 8 (SEQ ID NO: 27); (G.sub.zX).sub.n, wherein X is serine, aspartic acid, glutamic acid, threonine, or proline and n is at least 15, and z is between 1 and 20 (SEQ ID NO: 28).
[0067] In some embodiments, L comprises a modified amino acid or non-natural amino acid, or a modified non-natural amino acid, or a combination thereof. In some embodiments, the modified amino acid or a modified non-natural amino acid comprises a post-translational modification. In some embodiments L comprises a modification including, but not limited, to acetylation, acylation, ADP-ribosylation, amidation, covalent attachment of flavin, covalent attachment of a heme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid or lipid derivative, covalent attachment of phosphatidylinositol, cross-linking, cyclization, disulfide bond formation, demethylation, formation of covalent crosslinks, formation of cystine, formation of pyroglutamate, formylation, gamma carboxylation, glycosylation, GPI anchor formation, hydroxylation, iodination, methylation, myristoylation, oxidation, proteolytic processing, phosphorylation, prenylation, racemization, selenoylation, sulfation, transfer-RNA mediated addition of amino acids to proteins such as arginylation, and ubiquitination. Modifications are made anywhere to L including the peptide backbone, or the amino acid side chains.
Antibody or Antibody Fragments (A)
[0068] In some embodiments, A is a full length antibody, a single-chain antibody, a Fab Fragment, an Fab' fragment, an (Fab')2 fragment, an Fv fragment, a divalent single chain antibody, a bispecific antibody, trispecific antibody, tetraspecific antibody, or an antibody drug conjugate.
[0069] In some embodiments A is an antagonist, agonist, conditionally active antibody, or a sweeping body.
[0070] In some embodiments, A is an antibody or antibody fragment including, but not limited to, utomilumab, urelumab, ipilimumab, tremelimumab, pembrolizumab, nivolumab, and atezolizumab. In some embodiments, A is utomilumab. In some embodiments, A is urelumab. In some embodiments, A is ipilimumab. In some embodiments, A is tremelimumab. In some embodiments, A is pembrolizumab. In some embodiments, A is nivolumab. In some embodiments, A is atezolizumab.
[0071] In some embodiments, A binds to a target antigen. In some embodiments, the target antigen includes, but is not limited to, 4-1BB, CTLA4, PD-1, and PD-L1. In some embodiments, the target antigen is 4-1BB. In some embodiments, the target antigen is CTLA4. In some embodiments, the target antigen is PD-1. In some embodiments, the target antigen is PD-L1.
[0072] In some embodiments, A contains a modification so as to increase the bioavailability, improve stability, or solubility of the modified antibody. In some embodiments, A is conjugated to polyethylene glycol, polysialic acid (PSA), HPMA copolymer, dextran, albumin, a glycosyl group or a combination thereof.
[0073] In some embodiments, A comprises a modified amino acid or non-natural amino acid, or a modified non-natural amino acid, or a combination thereof. In some embodiments, the modified amino acid or a modified non-natural amino acid comprises a post-translational modification. In some embodiments A comprises a modification including, but not limited to acetylation, acylation, ADP-ribosylation, amidation, covalent attachment of flavin, covalent attachment of a heme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid or lipid derivative, covalent attachment of phosphatidylinositol, cross-linking, cyclization, disulfide bond formation, demethylation, formation of covalent crosslinks, formation of cystine, formation of pyroglutamate, formylation, gamma carboxylation, glycosylation, GPI anchor formation, hydroxylation, iodination, methylation, myristoylation, oxidation, proteolytic processing, phosphorylation, prenylation, racemization, selenoylation, sulfation, transfer-RNA mediated addition of amino acids to proteins such as arginylation, and ubiquitination. Modifications are made anywhere to A including the peptide backbone, the amino acid side chains, or the termini or terminus.
Modified Antibodies (A-L-P)
[0074] Disclosed herein, in certain embodiments, are modified antibodies comprising a formula:
A-L-P
wherein A is an antibody or antibody fragment that binds to a target antigen, P is a peptide that reduces binding of A to the target antigen at physiological pH, and that does not reduce binding of A to the target antigen at acidic pH, and L is a linking moiety that connects A to P at physiological pH and in a tumor microenvironment, and L is bound to A outside an antigen binding site.
[0075] In some embodiments, A-L-P does not comprise a protease cleavage site that releases A from P in a tumor microenvironment. It is advantageous that L and P are not cleaved from the molecule so that P can bind and re-bind to A depending upon the microenvironment. For example, in a tumor microenvironment, P is not bound to A thereby exposing the antigen binding site of A to its target antigen. However, because P is not cleaved from the molecule in the tumor microenvironment, if A-L-P were to then diffuse into a non-tumor microenvironment, P can then resume binding interactions with A, thereby preventing A from interacting with its target antigen in the non-tumor microenvironment.
[0076] In some embodiments, the modified antibodies disclosed herein comprise more than one P, one for each region of the antibody that contains the antigen binding site, connected to A by L. In some instances, L for each of the Ps is the same. In some instances, L for each of the P is different. In some embodiments, the Ps for each region of the antibody that contains the antigen binding site is the same. In some embodiments, the Ps for each region of the antibody that contains the antigen binding site is different. In some embodiments, the modified antibodies disclosed herein comprise one P.
[0077] In some embodiments, P is not a natural binding partner of A. In some embodiments, P does not comprise a mimotope. In some embodiments, P contains a random amino acid sequence that does not share any sequence homology to the natural binding partner of A. It is advantageous to use sequences that do not share any sequence homology to the natural binding part of A to allow for greater flexibility in the peptide design. This allows for building a larger library of candidate peptide sequences for screening.
[0078] In some embodiments, the target antigen to which the antibody or antibody fragment (A) binds is CTLA4, peptide (P) is Peptide 15, and linking moiety (L) is GSSGGSGGSGGSGGGSGGGSGGSSGT (SEQ ID NO: 60). In some embodiments, the target antigen to which the antibody or antibody fragment (A) binds is CTLA4, peptide (P) is Peptide 10, and linking moiety (L) is GSSGGSGGSGGSGGGSGGGSGGSSGT (SEQ ID NO: 60). In some embodiments, the target antigen to which the antibody or antibody fragment (A) binds is CTLA4, peptide (P) is Peptide 13, and linking moiety (L) is GSSGGSGGSGGSGGGSGGGSGGSSGT (SEQ ID NO: 60). In some embodiments, the target antigen to which the antibody or antibody fragment (A) binds is CTLA4, peptide (P) is Peptide 26, and linking moiety (L) is GSSGGSGGSGGSGGGSGGGSGGSSGT (SEQ ID NO: 60). In some embodiments, the target antigen to which the antibody or antibody fragment (A) binds is CTLA4, peptide (P) is Peptide 14, and linking moiety (L) is GSSGGSGGSGGSGGGSGGGSGGSSGT (SEQ ID NO: 60). In some embodiments, the target antigen to which the antibody or antibody fragment (A) binds is CTLA4, peptide (P) is Peptide 1, and linking moiety (L) is GSSGGSGGSGGSGGGSGGGSGGSSGT (SEQ ID NO: 60). In some embodiments, the target antigen to which the antibody or antibody fragment (A) binds is CTLA4, peptide (P) is Peptide 2, and linking moiety (L) is GSSGGSGGSGGSGGGSGGGSGGSSGT (SEQ ID NO: 60). In some embodiments, the target antigen to which the antibody or antibody fragment (A) binds is CTLA4, peptide (P) is Peptide 5, and linking moiety (L) is GSSGGSGGSGGSGGGSGGGSGGSSGT (SEQ ID NO: 60). In some embodiments, the target antigen to which the antibody or antibody fragment (A) binds is CTLA4, peptide (P) is Peptide 6, and linking moiety (L) is GSSGGSGGSGGSGGGSGGGSGGSSGT (SEQ ID NO: 60).
[0079] In some embodiments, the antibody or antibody fragment (A) that binds to a target antigen is Atezolizumab, peptide (P) is Peptide 23, and linking moiety (L) is GSSGGSGGSGGSGGGSGGGSGGSSGT (SEQ ID NO: 60). In some embodiments, the antibody or antibody fragment (A) that binds to a target antigen is Atezolizumab, peptide (P) is Peptide 27, and linking moiety (L) is GSSGGSGGSGGSGGGSGGGSGGSSGT (SEQ ID NO: 60). In some embodiments, the antibody or antibody fragment (A) that binds to a target antigen is Atezolizumab, peptide (P) is Peptide 22, and linking moiety (L) is GSSGGSGGSGGSGGGSGGGSGGSSGT (SEQ ID NO: 60). In some embodiments, the antibody or antibody fragment (A) that binds to a target antigen is Atezolizumab, peptide (P) is Peptide 31, and linking moiety (L) is GSSGGSGGSGGSGGGSGGGSGGSSGT (SEQ ID NO: 60). In some embodiments, the antibody or antibody fragment (A) that binds to a target antigen is Atezolizumab, peptide (P) is Peptide 20, and linking moiety (L) is GSSGGSGGSGGSGGGSGGGSGGSSGT (SEQ ID NO: 60). In some embodiments, the antibody or antibody fragment (A) that binds to a target antigen is Atezolizumab, peptide (P) is Peptide 21, and linking moiety (L) is GSSGGSGGSGGSGGGSGGGSGGSSGT (SEQ ID NO: 60). In some embodiments, the antibody or antibody fragment (A) that binds to a target antigen is Atezolizumab, peptide (P) is Peptide 28, and linking moiety (L) is GSSGGSGGSGGSGGGSGGGSGGSSGT (SEQ ID NO: 60). In some embodiments, the antibody or antibody fragment (A) that binds to a target antigen is Atezolizumab, peptide (P) is Peptide 29, and linking moiety (L) is GSSGGSGGSGGSGGGSGGGSGGSSGT (SEQ ID NO: 60). In some embodiments, the antibody or antibody fragment (A) that binds to a target antigen is Atezolizumab, peptide (P) is Peptide 30, and linking moiety (L) is GSSGGSGGSGGSGGGSGGGSGGSSGT (SEQ ID NO: 60). In some embodiments, the antibody or antibody fragment (A) that binds to a target antigen is Atezolizumab, peptide (P) is Peptide 24, and linking moiety (L) is GSSGGSGGSGGSGGGSGGGSGGSSGT (SEQ ID NO: 60).
[0080] In some embodiments, the target antigen to which the antibody or antibody fragment (A) binds is PD-L1, peptide (P) is Peptide 23, and linking moiety (L) is GSSGGSGGSGGSGGGSGGGSGGSSGT (SEQ ID NO: 60). In some embodiments, the target antigen to which the antibody or antibody fragment (A) binds is PD-L1, peptide (P) is Peptide 27, and linking moiety (L) is GSSGGSGGSGGSGGGSGGGSGGSSGT (SEQ ID NO: 60). In some embodiments, the target antigen to which the antibody or antibody fragment (A) binds is PD-L1, peptide (P) is Peptide 22, and linking moiety (L) is GSSGGSGGSGGSGGGSGGGSGGSSGT (SEQ ID NO: 60). In some embodiments, the target antigen to which the antibody or antibody fragment (A) binds is PD-L1, peptide (P) is Peptide 31, and linking moiety (L) is GSSGGSGGSGGSGGGSGGGSGGSSGT (SEQ ID NO: 60). In some embodiments, the target antigen to which the antibody or antibody fragment (A) binds is PD-L1, peptide (P) is Peptide 20, and linking moiety (L) is GSSGGSGGSGGSGGGSGGGSGGSSGT (SEQ ID NO: 60). In some embodiments, the target antigen to which the antibody or antibody fragment (A) binds is PD-L1, peptide (P) is Peptide 21, and linking moiety (L) is GSSGGSGGSGGSGGGSGGGSGGSSGT (SEQ ID NO: 60). In some embodiments, the target antigen to which the antibody or antibody fragment (A) binds is PD-L1, peptide (P) is Peptide 28, and linking moiety (L) is GSSGGSGGSGGSGGGSGGGSGGSSGT (SEQ ID NO: 60). In some embodiments, the target antigen to which the antibody or antibody fragment (A) binds is PD-L1, peptide (P) is Peptide 29, and linking moiety (L) is GSSGGSGGSGGSGGGSGGGSGGSSGT (SEQ ID NO: 60). In some embodiments, the target antigen to which the antibody or antibody fragment (A) binds is PD-L1, peptide (P) is Peptide 30, and linking moiety (L) is GSSGGSGGSGGSGGGSGGGSGGSSGT (SEQ ID NO: 60). In some embodiments, the target antigen to which the antibody or antibody fragment (A) binds is PD-L1, peptide (P) is Peptide 24, and linking moiety (L) is GSSGGSGGSGGSGGGSGGGSGGSSGT (SEQ ID NO: 60).
Polynucleotides Encoding Modified Antibodies
[0081] Also provided, in some embodiments, are polynucleotide molecules encoding a modified antibody described herein. In some embodiments, the polynucleotide molecules are provided as a DNA construct. In other embodiments, the polynucleotide molecules are provided as a messenger RNA transcript.
[0082] The polynucleotide molecules are constructed by known methods such as by combining the genes encoding the domains either separated by peptide linkers or, in other embodiments, directly linked by a peptide bond, into a single genetic construct operably linked to a suitable promoter, and optionally a suitable transcription terminator, and expressing it in bacteria or other appropriate expression system such as, for example CHO cells. Depending on the vector system and host utilized, any number of suitable transcription and translation elements, including constitutive and inducible promoters, may be used. The promoter is selected such that it drives the expression of the polynucleotide in the respective host cell.
[0083] In some embodiments, the polynucleotide is inserted into a vector, preferably an expression vector, which represents a further embodiment. This recombinant vector can be constructed according to known methods. Vectors of particular interest include plasmids, phagemids, phage derivatives, virii (e.g., retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, lentiviruses, and the like), and cosmids.
[0084] A variety of expression vector/host systems may be utilized to contain and express the polynucleotide encoding the polypeptide of the described antigen-binding protein. Examples of expression vectors for expression in E. coli are pSKK (Le Gall et al., J Immunol Methods. (2004) 285(1):111-27) or pcDNA5 (Invitrogen) for expression in mammalian cells.
[0085] Thus, the modified antibodies as described herein, in some embodiments, are produced by introducing a vector encoding the protein as described above into a host cell and culturing said host cell under conditions whereby the protein domains are expressed, may be isolated and, optionally, further purified.
Pharmaceutical Compositions
[0086] Also provided, in some embodiments, are pharmaceutical compositions comprising a modified antibody described herein, a vector comprising the polynucleotide encoding the polypeptide of the modified antibody or a host cell transformed by this vector and at least one pharmaceutically acceptable carrier. The term "pharmaceutically acceptable carrier" includes, but is not limited to, any carrier that does not interfere with the effectiveness of the biological activity of the ingredients and that is not toxic to the patient to whom it is administered. Examples of suitable pharmaceutical carriers include phosphate buffered saline solutions, water, emulsions, such as oil/water emulsions, various types of wetting agents, sterile solutions etc. Such carriers can be formulated by conventional methods and can be administered to the subject at a suitable dose. Preferably, the compositions are sterile. These compositions may also contain adjuvants such as preservative, emulsifying agents and dispersing agents. Prevention of the action of microorganisms may be ensured by the inclusion of various antibacterial and antifungal agents.
[0087] In some embodiments of the pharmaceutical compositions, the modified antibody described herein is encapsulated in nanoparticles. In some embodiments, the nanoparticles are fullerenes, liquid crystals, liposome, quantum dots, superparamagnetic nanoparticles, dendrimers, or nanorods. In other embodiments of the pharmaceutical compositions, the modified antibody, is attached to liposomes. In some instances, the modified antibody is conjugated to the surface of liposomes. In some instances, the modified antibody is encapsulated within the shell of a liposome. In some instances, the liposome is a cationic liposome.
[0088] The modified antibodies described herein are contemplated for use as a medicament. Administration is effected by different ways, e.g. by intravenous, intraperitoneal, subcutaneous, intramuscular, topical or intradermal administration. In some embodiments, the route of administration depends on the kind of therapy and the kind of compound contained in the pharmaceutical composition. The dosage regimen will be determined by the attending physician and other clinical factors. Dosages for any one patient depends on many factors, including the patient's size, body surface area, age, sex, the particular compound to be administered, time and route of administration, the kind of therapy, general health and other drugs being administered concurrently. An "effective dose" refers to amounts of the active ingredient that are sufficient to affect the course and the severity of the disease, leading to the reduction or remission of such pathology and may be determined using known methods.
Methods for Discovering Modified Antibodies that are Conditionally Active at Tumor Microenvironments
[0089] Disclosed herein, in some embodiments, are methods for identifying peptides which reduce binding of the modified antibody to its target antigen when at physiological pH but do not affect target antigen binding at acidic pH.
[0090] In some embodiments, a modified antibody is tested for binding to a target antigen at a range of pH, from about pH 3 to about pH 12. In a further aspect, the testing step further includes testing for antigen binding within a pH range from about pH 5 to pH 10. In a further aspect, the testing step includes testing for antigen binding within a pH range from about pH 6 to pH 8. In a further aspect, the testing step further includes testing for antigen binding within a pH range from about pH 6.7 to pH 7.5.
[0091] In additional embodiments, P is identified by directed evolution techniques. In some embodiments, P is engineered to introduce one, two, or more ionizable groups which interact at protein-protein interfaces. Such ionizable groups, for example, interact with A at the antigen binding site or near the antigen binding site at physiological pH to block binding of A to its target antigen. Such ionizable groups, for example, are engineered into P using a histidine scanning library approach.
Methods for Generating Modified Antibodies
[0092] Methods for generating an antibody (or fragment thereof) for a given target are known in the art. The structure of antibodies and fragments thereof, variable regions of heavy and light chains of an antibody (VH and VL) Fv, F(ab')2, Fab fragments, single chain antibodies (scAb), single chain variable regions (scFv), complementarity determining regions (CDR), and domain antibodies (dAbs) are well understood. Methods for generating a polypeptide having a desired antigen-binding domain of a target antigen are known in the art.
[0093] Methods for modifying antibodies or antibody fragments to couple additional polypeptides are known in the art. For example, peptides and linking moieties are coupled to modify antibodies to generate the modified antibodies of the disclosure.
[0094] In some embodiments, A, L, and P are expressed in a nucleic acid construct. In some embodiments, A, L, and P are expressed in the same nucleic acid construct. In some instances, the nucleic acid constructs include, but are not limited to, constructs which are capable of expression in a prokaryotic or eukaryotic cell.
[0095] In some embodiments, P is coupled to L and A through covalent binding. For example, A and L are expressed as a single transcript, and the terminal residue of L is a cysteine. P is then coupled to L and A by a cysteine-cysteine disulfide bridge.
EXAMPLES
Example 1
Screening of Candidate Peptides
[0096] To identify peptides for conjugation to or expression with an antibody of interest, a library of candidate peptides are generated. The candidate peptides have variable amino acid sequences and variable amino acid lengths. The candidate peptides are then screened for their ability to bind to the antibody of interest at pH 7.4 and at pH 6.0. Those candidate peptides that bind to the antibody of interest at pH 6.0 are eliminated. Candidate peptides that bind to the antibody of interest at pH 7.4, but not at pH 6.0, are sequenced and motifs are analyzed.
Example 2
Screening of Modified Antibody Libraries
[0097] Libraries of candidate modified antibodies having different amino acid sequences in the peptide and linker lengths and various points of attachment to the antibody are generated.
[0098] The libraries are introduced via expression vectors resulting in display of the modified antibodies on the surface of bacterial cells. After expansion of the libraries by culture, cells displaying the modified antibodies are tested for their abilities to bind to target antigens at pH 7.4 and at pH 6.0. Cells are contacted with fluorescently labeled target antigen and the cells are sorted by FACs to isolate those cells which can bind to the fluorescently labeled target antigen at pH 6.0, but not at pH 7.4. The cells can be subjected to additional cycles by expansion by growth in culture and again by subjecting the culture to all or part of the screening steps.
Example 3
In Vitro Screening of a Modified Antibody for pH Dependent Binding Affinity for its Target Antigen
[0099] An immunoabsorbant target displacement assay (TDA) is described herein for discovery and validation of a modified antibody for selective binding to its target antigen at an acidic pH. In the TDA assay, the ability of a modified antibody to bind to its target antigen is measured. The assay is conducted at pH 7.4, and then repeated at pH 6.0.
[0100] Briefly, the target antigen is adsorbed to the wells of an ELISA plate overnight at 4.degree. C. The plate is blocked by addition of 2% non-fat dry milk in PBS, about 0.5% (v/v) Tween20 (PBST), and incubation at room temperature for about 1 hour. The plate is then washed about three times with PBST. About 50 .mu.l of superblock is added. About 50 .mu.l of the modified antibody is dissolved in superblock and incubated at about 37.degree. C. for different periods of time. The plate is washed about three times with PBST. About 100 ml of anti-huIgG-HRP is added in about 2% NEM/PBST and incubated at room temperature for about 1 hour. The plate is washed about four times with PBST and about twice with PBS. The assay is developed using TMB (Thermo Scientific) as per manufacturer's instructions.
Example 4
Cytotoxicity Assay for Assessing pH Dependent Selectivity of Modified Antibodies
[0101] Modified antibodies are selected which demonstrate binding to its target antigen at pH 6.0, but with minimal or no binding to its target antigen at pH 7.4 conditions. A candidate antibody, and a peptide-modified candidate antibody validated in Example 3, is tested in a cell based cytotoxicity assay.
[0102] Cell Culture: A549 (human epithelial cell line derived from a lung carcinoma tissue), or an alternative cancer cell line (DU145, LNCaP, or PC-3 cells) can be obtained from, for example, the ATCC. Human umbilical vein endothelial cells (HUVEC) can be isolated from human umbilical veins as described. (Grant et al., "Matrigel induces thymosin h 4 gene in differentiating endothelial cells", J Cell Sci 1995; 108:3685-94). HUVEC cells can be used as a positive control as a cell line that express ATP synthase on the cell surface. Cells can be cultured in DMEM (Life Technologies, Carlsbad, Calif.) with 1% penicillin streptomycin and 10% serum replacement medium 3 (Sigma, St. Louis, Mo.) to minimize the presence of plasminogen. Low-pH (6.7) medium can be prepared by reducing bicarbonate to 10 mmol/L at 5% CO2 and supplementing with 34 mmol/L NaCl to maintain osmolality or incubation of 22 mmol/L bicarbonate medium under 17% CO2 conditions. The method of lowering pH used can be varied by experimental constraints and assay.
[0103] Flow cytometry: To assure ATP synthase is functional on the cell surface of the tumor cell line, flow cytometry experiments can be performed. For example, A549 Cell lines can be cultured in varying pH medium (10, 22, and 44 mmol/L bicarbonate DMEM), under hypoxia (0.5% 02, 5% CO2, N2 balanced) versus normoxia (21% O2, 5% CO2) for 0, 12, 24, 48, and 72 hours. Live cells can be blocked, incubated with anti-.beta.-subunit antibody, washed, blocked, incubated with a secondary goat anti-rabbit antibody-FITC (Southern Biotech, Birmingham, Ala.), and again washed, with all steps performed at 4 degrees C. Propidium iodide (BD Biosciences, San Jose, Calif.) can be included with all samples to discriminate cells with compromised membranes. The mean fluorescent intensity of FITC in 10,000 cells can be quantified by FACSCalibur flow cytometer (Becton Dickinson, Franklin Lakes, N.J.) and cells with propidium iodide uptake can be excluded to eliminate detection of mitochondrial ATP synthase on CELLQuest software (BD Biosciences).
[0104] Cell surface ATP generation assay: A549 or 1-LN cells (60,000 per well) in 96-well plates can be refreshed with medium and treated with a candidate antibody, a peptide-modified candidate antibody, anti-beta-subunit antibody, rabbit IgG raised to bovine serum albumin (Organon Teknika, West Chester, Pa.), piceatannol (a known inhibitor of ATP synthase F1 used as a positive control, Sigma), or medium alone for 30 minutes at 37 degrees C., 5% CO2. Cells can be then incubated with 0.05 mmol/L ADP for 20 seconds. Supernatants can be removed and assayed for ATP production by CellTiterGlo luminescence assay (Promega, Madison, Wis.) as described (23). Cell lysates can be similarly analyzed to confirm that intracellular pools of ATP did not vary under any conditions. Recordings can be made on the Luminoskan Ascent (Thermo Labsystems, Helsinki, Finland). Data are expressed in moles of ATP per cell based on standards determined for each independent experiment.
[0105] Cell proliferation assay: The effect of the candidate modified antibody on cancer cell lines can be assessed with a 3-(4,5-dimethylthiazol-2-yl)-5-(3-carboxymethoxyphenyl)-2-(4-sulfophenyl)- -2H-tetrazolium, inner salt (MTS) proliferation assay in serum-free medium. Relative cell numbers in each well of a 96-well microplate after incubation for 20 hours, 37 degrees C., and 5% CO.sub.2 in the presence or absence of the candidate antibody can be determined using the AQueous One Cell Proliferation Assay (Promega) per protocol of the manufacturer. Medium pH can be regulated at 5% CO.sub.2 through bicarbonate concentration.
[0106] Assessment of cellular cytotoxicity: To quantify cell death and cell lysis, the activity of lactate dehydrogenase (LDH) released from the cytosol into supernatant can be measured with the Cytotoxicity Detection kit (Roche, Indianapolis, Ind.). Cancer cells (e.g. A549 cells) (5,000 per well) treated with a candidate antibody, a peptide-modified candidate antibody, anti-beta-subunit antibody, rabbit IgG, cariporide, and Triton X (a detergent used to permeabilize cells as a positive control) can be incubated at 37 degrees C. and 5% CO.sub.2 or 17% CO.sub.2 for 15 hours at neutral and low pH conditions, respectively. An index of cytotoxicity can be calculated by dividing the average absorbance from treated samples in quadruplicate by the average absorbance from untreated samples in quadruplicate corresponding to the same pH medium.
[0107] Assessment of cellular necrosis and apoptosis: To determine the mode of candidate antibody induced cell death a histone-DNA ELISA can be performed. The effects of a candidate antibody, a peptide-modified candidate antibody, anti-beta-subunit antibody, rabbit IgG, and cariporide on A549 cells (5,000 per well) can be determined using an ELISA apoptosis and necrosis assay (Roche) that is dependent on detection of extranuclear histone-DNA fragments. Apoptosis or necrosis can be determined from, respectively, the cell lysates or supernatants of quadruplicate samples after 15 hours of incubation at 37 degrees C., in the presence or absence of agents. The apoptotic or necrotic indices can be calculated by dividing the average absorbance from treated samples in quadruplicate by the average absorbance from untreated samples in quadruplicate corresponding to the same pH medium. Medium pH can be regulated by incubation at 5% CO2 or 17% CO.sub.2.
Example 5
Biopanning
[0108] Biopanning with m13 phagemid p8 or p3 displayed peptide libraries was either performed with Fc immobilized anti-mouse CTLA-4 antibody (clone 9D9) on 96-well ELISA plates or with biotin-conjugated antibody immobilized on streptavidin coated paramagnetic beads. Following binding to target and washing steps, specifically bound phage were recovered by elution at pH 2.2 and in some instances recovery occurred through the use of acidic buffers of higher pH levels. Enrichment of specific binding clones was accomplished by 3-4 rounds of successive biopanning and amplification. After 3 or 4 rounds of biopanning phage pools were infected into TG1 cells and plated out on LB-ampicillin/agar plates for clonal isolation and subsequent characterization.
Example 6
Phagemid Hit Identification ELISA
[0109] For hit identification, individual colonies were grown in 96-deep well plates for 2-4 hours and infected with helper phage to produce peptide displayed phagemid following an overnight growth. The next day the deep well plates were centrifuged to separate the soluble phagemid from the E. coli cells. The phagemid containing supernatants were then combined with PBS-Tween 20 (0.05%)+BSA (1%) pH neutral blocking buffer and incubated in previously antibody (anti-mouse CTLA-4, clone 9D9) coated and blocked wells. After binding at 4 degrees the plates were washed and specifically bound phage were detected by anti-m13 HRP conjugated antibodies using standard TMB-based chromogenic ELISA procedures. Daughter plates or individual wells were subjected to standard DNA sequencing for peptide identification.
Example 7
Phagemid Competition ELISA Assay
[0110] Phagemid peptide clones were next tested to determine whether they bound within the antigen binding space of the antibody, by target-based competition assay. Antibody (anti-mouse CTLA-4, clone 9D9) immobilized and blocked 96-well ELISA plates similar to above were prepared. Mouse CTLA-4 was added to the well to block the antigen binding site. After a brief incubation period phagemid supernatants were added to the wells. Following an incubation at 4 degrees the plates were washed and specifically bound phage were detected by anti-m13 HRP conjugated antibodies using standard TMB-based chromogenic ELISA procedures. Phagemid clones binding within the antigenic binding pocket would be blocked and be identified by a decreased ELISA signal, compared to a well lacking previous antigen blockade.
Example 8
Phagemid pH "Binding" ELISA
[0111] To assess the pH dependent binding attributes of each of the individual clones, an ELISA similar to that described above was performed, but instead of combining the supernatants into pH neutral buffers they were combined with acidic pH buffered blocking buffer to achieve acidic pH levels such as pH 5.4 and then transferred into antibody (anti-mouse CTLA-4, clone 9D9) coated and blocked wells. Following incubation at 4 degrees the plates were washed and then all subsequent steps buffers used were neutral pH. As before, the specifically bound phage were similarly detected by anti-m13 HRP conjugated antibodies using standard TMB-based chromogenic ELISA procedures.
[0112] Table 2 below shows the ELISA results for pH-dependent phagemid 9D9 Antibody binding.
TABLE-US-00002 TABLE 2 pH-dependent phagemid 9D9 Antibody binding ELISA. ELISA Plate ELISA signal signal Ratio wells pH 7.2 pH 5.4 5.4:7.2 A07 2.173 1.546 0.712 B07 0.567 0.177 0.312 C07 1.700 0.799 0.470 D07 1.753 1.136 0.648 E07 0.501 0.219 0.436 F07 0.477 0.054 0.113 G07 0.738 0.062 0.084 H07 1.687 1.096 0.650 A08 1.616 0.215 0.133 B08 0.125 0.045 0.359 C08 1.956 1.222 0.625 D08 1.004 0.278 0.276 E08 1.153 0.119 0.103 F08 2.415 1.651 0.684 G08 2.291 2.037 0.889 H08 1.099 0.539 0.491 A09 0.837 0.329 0.392 B09 2.283 1.836 0.804 C09 1.352 0.220 0.162 D09 1.055 0.260 0.247 E09 0.538 0.059 0.110 F09 0.949 0.264 0.278 G09 1.266 0.516 0.408 H09 0.422 0.066 0.156 A10 1.088 0.304 0.279 B10 1.147 0.495 0.431 C10 1.530 0.234 0.153 D10 1.842 1.105 0.600 E10 0.844 0.276 0.327 F10 2.154 1.645 0.764 G10 1.034 0.375 0.363 H10 0.425 0.174 0.409 A11 0.626 0.217 0.347 B11 0.851 0.306 0.360 C11 0.861 0.181 0.211 D11 1.358 0.570 0.420 E11 0.990 0.430 0.434 F11 1.699 0.958 0.564 G11 0.053 0.049 0.915 H11 2.369 2.110 0.891 A12 0.518 0.257 0.496 B12 0.331 0.148 0.447 C12 0.295 0.049 0.168 D12 1.103 0.208 0.189 E12 1.263 0.246 0.195 F12 0.593 0.283 0.478 G12 1.064 0.432 0.406 H12 3.031 1.749 0.577
Example 9
Phagemid "Dissociation" Assay
[0113] To determine pH dependent dissociation attributes of the individual phagemid displayed peptides, an ELISA similar to that described above was performed. Phagemid supernatants were combined with neutral pH PBS-Tween 20, BSA containing blocking buffer and then transferred into antibody (anti-mouse CTLA-4, clone 9D9) coated and blocked wells. After binding at 4 degrees the plates were washed extensively. In the next step the phage were incubated with either neutral or acidic pH buffers, such as pH 5.4 for approximately 30 minutes and then washed again at neutral pH. As described previously the specifically bound phage were similarly detected by anti-m13 HRP conjugated antibodies using standard TMB-based chromogenic ELISA procedures.
[0114] Table 3 below shows the ELISA results for pH-dependent phagemid 9D9 Antibody dissociation.
TABLE-US-00003 TABLE 3 pH-dependent phagemid 9D9 Antibody dissociation ELISA. ELISA signal ELISA signal Plate wells pH 7.2 pH 5.4 Ratio 5.4:7.2 A07 1.996 2.054 1.029 B07 0.578 0.377 0.652 C07 1.681 1.487 0.885 D07 1.851 1.775 0.959 E07 0.474 0.444 0.937 F07 0.400 0.063 0.156 G07 0.633 0.072 0.113 H07 1.611 1.541 0.956 A08 1.449 0.494 0.341 B08 0.113 0.043 0.386 C08 1.948 1.818 0.933 D08 0.947 0.575 0.607 E08 1.068 0.182 0.170 F08 2.421 1.986 0.820 G08 2.305 2.250 0.976 H08 1.007 0.980 0.974 A09 0.747 0.689 0.922 B09 2.372 2.129 0.897 C09 1.302 0.388 0.298 D09 0.987 0.617 0.625 E09 0.477 0.072 0.150 F09 0.866 0.556 0.642 G09 1.169 1.022 0.874 H09 0.302 0.054 0.179 A10 0.964 0.542 0.562 B10 1.250 0.833 0.666 C10 1.507 0.346 0.230 D10 1.896 1.815 0.957 E10 0.755 0.524 0.694 F10 2.184 2.180 0.998 G10 0.984 0.918 0.933 H10 0.371 0.354 0.955 A11 0.562 0.468 0.831 B11 0.928 0.714 0.770 C11 0.651 0.467 0.717 D11 1.383 0.978 0.707 E11 0.912 0.919 1.008 F11 1.581 1.595 1.009 G11 0.049 0.042 0.862 H11 2.382 2.320 0.974 A12 0.474 0.457 0.964 B12 0.380 0.278 0.732 C12 0.283 0.048 0.169 D12 1.055 0.266 0.252 E12 1.159 0.363 0.313 F12 0.505 0.490 0.969 G12 0.857 0.745 0.870 H12 2.366 0.184 0.078
Example 10
Peptide Antibody Dissociation
[0115] To determine pH dependent antibody dissociation attributes of the individual peptides identified through biopanning described above, the corresponding biotinylated peptides were chemically synthesized an ELISA similar to the phagemid antibody binding example described above was performed. To begin, peptides were immobilized on neutravidin coated and blocked wells. After unbound peptides were washed away, dilution series of anti-mouse CTLA-4 antibody (clone 9D9) were added to corresponding wells of peptides. After binding at 4 degrees the plates were washed extensively as before. Next the peptides were incubated with either neutral or acidic pH buffers for approximately 30 minutes and then washed again. The specifically peptide bound antibodies were detected by either anti-mouse Fc or anti-mouse kappa chain HRP conjugated antibodies using standard TMB-based chromogenic ELISA procedures. The effects of pH upon affinity were determined by standard EC50 analysis of each of the distinct pH dilution series binding curves and comparison of their respective EC50 values.
[0116] Similar approach was taken to determine pH-dependent antibody dissociation attributes of the individual peptides to PD-L1 antibody.
TABLE-US-00004 TABLE 4 pH-dependent CTLA-4 antibody-peptide dissociation. SEQ ID EC50 [M] EC50 [M] pH 6.0: pH 7.2 Peptide sequence NO pH 7.2 pH 6.0 EC 50 ratio 1 TLDDMSHVILYA 29 2.9E-09 1.9E-08 6.7 2 VISDNHQIVWDL 30 1.8E-09 9.5E-09 5.2 3 LTTQDHPLTILL 31 2.2E-09 7.9E-09 3.5 4 GGWICHWLEPQEACTY 32 1.9E-09 4.1E-09 2.1 5 GGCFEEHEQLVFQTHC 33 2.5E-10 2.5E-09 9.6 6 GGCILPGQHESQAIAC 34 1.2E-10 1.7E-09 15.0 7 GGCLSQMDFHDWLQYC 35 7.8E-09 2.5E-08 3.2 8 GGTDCYLWDYKASCHQ 36 2.4E-09 5.3E-09 2.2 9 GGKCDSLSYWQEIECS 37 5.9E-09 1.4E-08 2.4 10 GGADCLLHDWDSACQI 38 5.5E-11 8.7E-10 15.8 11 MQNVDEAPPLLL 39 7.0E-09 1.1E-08 1.5 12 TNDWQGLLLNVF 40 4.0E-09 5.1E-09 1.3 13 GGCQDSMFHHPNHC 41 7.4E-09 3.6E-08 4.9 26 GGCGMHQHPLFVDC 42 1.6E-10 3.3E-09 20.9 14 GGCSLSQHPNHSDC 43 4.6E-10 4.1E-09 8.9 15 PCNQVECHHQFT 61 4.3E-10 5.4E-09 12.4 23 GGHCVDMVDFYQQTCQ 53 Inactive -- -- (Control)
TABLE-US-00005 TABLE 5 pH-dependent PD-L1 antibody-peptide dissociation. SEQ pH 6.0: pH pH 5.4: pH ID EC50 [M] EC50 [M] EC50 [M] 7.2 EC 50 7.2 EC 50 Peptide sequence NO pH 7.2 pH 6.0 pH 5.4 ratio ratio 20 QLFYPSTYHIID 49 1.3E-10 2.1E-10 8.4E-10 1.7 6.7 27 QVSPLYFYEELA 50 4.2E-10 9.0E-10 3.3E-09 2.2 7.8 21 HQALLDFYGDY 51 7.5E-10 1.8E-09 4.8E-09 2.5 6.4 22 GGMCHELFYSNLNWCQ 52 4.5E-11 7.0E-11 3.5E-10 1.5 7.8 23 GGHCVDMVDFYQQTCQ 53 3.0E-10 1.3E-09 3.9E-09 4.3 12.9 28 VDLLDGSLQDFY 54 1.8E-09 4.7E-09 9.1E-09 2.6 5.0 29 GGLCSTFYEPQVDICY 55 2.3E-10 4.9E-10 1.5E-09 2.1 6.5 30 SDFSGLLFYDYQ 56 9.5E-10 2.2E-09 5.6E-09 2.3 5.9 31 GGCVHFFEIHQRPDC 57 1.6E-10 3.6E-10 1.5E-09 2.3 9.4 24 GGCHNKSGLFYHYC 58 2.0E-10 5.6E-10 1.3E-09 2.8 6.6 10 GGADCLLHDWDSACQI 38 Inactive -- -- -- -- (Control)
Example 11
Peptide Antibody Competition
[0117] To determine whether the peptides could inhibit mouse CTLA-4 from binding the 9D9 antibody a competition binding assay was utilized. Briefly, 9D9 antibody was preincubated against a dilution series of peptides. Following this incubation the peptide-antibody complexes were transferred to mouse CTLA-4 coated and blocked ELISA plates and incubated further. Following a brief binding period the plates were washed and target bound antibody was detected by either anti-mouse Fc or anti-mouse kappa chain HRP conjugated antibodies using standard TMB-based chromogenic ELISA procedures. The effects of competition were determined by standard IC50 analysis.
Example 12
pH-dependent Binding Analysis by ForteBio Octet Bio-Layer Interferometry (BLI)
[0118] To determine pH-dependent binding properties of peptides to mouse anti-CTLA-4 antibody, clone 9D9, monovalent antibody Fab fragment (mCTLA-4 Fab) was used on a ForteBio Octet Red96 System. Peptides with C-terminal biotinylation were captured on ForteBio High Precision Streptavidin (SAX) biosensors at 0.4 .mu.g/ml in 50 mM sodium phosphate buffer, pH 7.4 with 150 mM NaCl, 0.1% BSA and 0.02% Tween-20 (pH 7.4 Assay Buffer).
[0119] For analysis of neutral pH binding, after loading, sensors were base-lined in pH 7.4 Assay Buffer followed by association with mCTLA-4 Fab (2-fold dilution series starting at 2.5 .mu.M) in pH 7.4 Assay Buffer and dissociation in pH 7.4 Assay Buffer.
[0120] For analysis of acidic pH binding, after loading, sensors were base-lined in 50 mM sodium phosphate buffer, pH 6.0 with 150 mM NaCl, 0.1% BSA and 0.02% Tween-20 (pH 6.0 Assay Buffer) followed by association with mCTLA-4 Fab (2-fold dilution series starting at 2.5 .mu.M) in pH 6.0 Assay Buffer and dissociation in pH 6.0 Assay Buffer.
[0121] Affinity measurements were determined by ForteBio Octet analysis software using global fitting.
Example 13
Anti-mCTLA-4 (Clone 9D9) Fab Binding to Peptide 15 by ELISA
[0122] Binding of anti-mouse CTLA-4 (clone 9D9) (Bio X Cell, Cat #BE0164) Fab fragment to Peptide 15 was determined by ELISA in 96-well plate. Briefly, 100 nM Peptide 15 with C-terminal biotin was captured on Neutravidin coated plates for 1 hour in PBS-T (50 mM phosphate buffered saline pH 7.4+0.05% Tween-20)+0.5% BSA. After washing in PBS-T, mCTLA-4 Fab diluted in either pH 7.4 Binding Buffer (50 mM sodium phosphate+150 mM NaCl+0.5% BSA+0.05% Tween-20, pH 7.4) or pH 6.0 Binding Buffer (50 mM sodium phosphate+150 mM NaCl+0.5% BSA+0.05% Tween-20, pH 6.0) was captured for 1 hour. After capture, wells were washed with either pH 7.4 Binding Buffer or pH 6.0 Binding Buffer, followed by additional 5-minute incubation with the appropriate pH Binding Buffer. Detection was performed with HRP conjugated goat anti-mouse IgG H+L (Southern Biotech.) for 1 hour at 1/2000 dilution in PBS-T+0.5% BSA followed by TMB (3-minute development) with acid stop. Absorbance at 450 nm was determined and data analysis was performed in GraphPad Prism by nonlinear regression with 4-parameter logistic curve. Data is expressed as mean+SD. All ELISA steps were performed at room temperature.
Example 14
Mammalian Expression of Reformatted Antibody Peptide Fusions
[0123] This example outlines a way to reformat peptides found above into recombinant antibody fusions. Antibodies are comprised of a full length heavy chain framework complexed with an antibody light chain. The heavy chain used is either a mouse Fc gamma 2a or mouse Fc gamma 2b isotype. The full length heavy chain and light chain sequences for 9D9 (anti-CTLA-4, clone 9D9, Curran et. al) are synthesized for expression in mammalian cells. Additional light chain constructs with 9D9 binding peptides fused by flexible linkers are similarly synthesized. The individual antibody light chain constructs are co-transfected along with the heavy chain expression vector in mammalian cells. Specifically the proteins are transiently produced in HEK293 suspension cell-based systems. The resulting proteins are harvested from the media after 5-7 days and FPLC purified to >95% purity via Protein A chromatography. Proteins are dialyzed and exchanged into pH 7.4 PBS, sterile filtered, quantitated by A280 absorbance, and stored either at 4 degrees or -80 degrees for longer term storage.
[0124] Listed below are exemplary antibody sequences comprising light chain with the peptide and heavy chain sequences.
TABLE-US-00006 Antibody-peptide fusion Isotype Light Chain + peptide Heavy Chain 9D9 + peptide 10 Mouse IgG2b Peptide 10-9D9 light chain 9D9 heavy chain (mouse fusion (mouse kappa) IgG2b) 9D9 + peptide 13 Mouse IgG2b Peptide 13-9D9 light chain 9D9 heavy chain (mouse fusion (mouse kappa) IgG2b) 9D9 + peptide 14 Mouse IgG2b Peptide 14-9D9 light chain 9D9 heavy chain (mouse fusion (mouse kappa) IgG2b) 9D9 + peptide 15 Mouse IgG2b Peptide 15-9D9 light chain 9D9 heavy chain (mouse fusion (mouse kappa) IgG2b) 9D9 + peptide 10 Mouse IgG2a Peptide 10-9D9 light chain 9D9 heavy chain (mouse fusion (mouse kappa) IgG2a) 9D9 + peptide 13 Mouse IgG2a Peptide 13-9D9 light chain 9D9 heavy chain (mouse fusion (mouse kappa) IgG2a) 9D9 + peptide 14 Mouse IgG2a Peptide 14-9D9 light chain 9D9 heavy chain (mouse fusion (mouse kappa) IgG2a) 9D9 + peptide 15 Mouse IgG2a Peptide 15-9D9 light chain 9D9 heavy chain (mouse fusion (mouse kappa) IgG2a) Atezolizumab + peptide 23 Human IgG1 Peptide 23-Atezolizumab light Atezolizumab heavy chain chain fusion (human kappa) (human IgG1)
TABLE-US-00007 9D9 light chain (mouse kappa) (SEQ ID NO: 62) DIVMTQTTLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGV PDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPYTFGGGTKLEIKRADAAPTVSIFPPS SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLT KDEYERHNSYTCEATHKTSTSPIVKSFNRNEC Peptide 10-9D9 light chain fusion (mouse kappa) (SEQ ID NO: 63) GGADCLLHDWDSACQIGSSGGSGGSGGSGGGSGGGSGGSSGTDIVMTQTTLSLPVSLGDQ ASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISR VEAEDLGVYYCFQGSHVPYTEGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNE YPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHK TSTSPIVKSFNRNEC Peptide 13-9D9 light chain fusion (mouse kappa) (SEQ ID NO: 64) GGCQDSMFHHPNHCGSSGGSGGSGGSGGGSGGGSGGSSGTDIVMTQTTLSLPVSLGDQAS ISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRV EAEDLGVYYCFQGSHVPYTEGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNEY PKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTS TSPIVKSFNRNEC Peptide 14-9D9 light chain fusion (mouse kappa) (SEQ ID NO: 65) GGCSLSQHPNHSDCGSSGGSGGSGGSGGGSGGGSGGSSGTDIVMTQTTLSLPVSLGDQASI SCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVE AEDLGVYYCFQGSHVPYTEGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNEYP KDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTST SPIVKSFNRNEC Peptide 15-9D9 light chain fusion (mouse kappa) (SEQ ID NO: 66) GGPCNQVECHHQFTGSSGGSGGSGGSGGGSGGGSGGSSGTDIVMTQTTLSLPVSLGDQAS ISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRV EAEDLGVYYCFQGSHVPYTEGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNEY PKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTS TSPIVKSFNRNEC 9D9 heavy chain (mouse IgG2b) (SEQ ID NO: 67) EAKLQESGPVLVKPGASVKMSCKASGYTFTDYYMNWVKQSHGKSLEWIGVINPYNGDTSY NQKFKGKATLTVDKSSSTAYMELNSLTSEDSAVYYCARYYGSWFAYWGQGTLITVSTAKT TPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLY TMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGPISTINPCPPCKECHKCPAPN LEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVRISWFVNNVEVHTAQTQTH REDYNSTIRVVSALPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYIL PPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKL DIKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK Atezolizumab light chain (human kappa) (SEQ ID NO: 68) DIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQKPGKAPKWYSASFLYSGVPSRF SGSGSGTDFTLTISSLQPEDFATYYCQQYLYHPATEGQGTKVEIKRTVAAPSVFIFPPSDEQL KSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADY EKHKVYACEVTHQGLSSPVTKSFNRGEC Peptide 23-Atezolizumab light chain fusion (human kappa) (SEQ ID NO: 69) GGHCVDMVDFYQQTCQGSSGGSGGSGGSGGGSGGGSGGSSGTDIQMTQSPSSLSASVGD RVTITCRASQDVSTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFSGSGSGTDFTLTISSLQP EDFATYYCQQYLYHPATFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPR EAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLS SPVTKSFNRGEC Atezolizumab heavy chain (human IgG1) (SEQ ID NO: 70) EVQLVESGGGLVQPGGSLRLSCAASGFTFSDSWIHWVRQAPGKGLEWVAWISPYGGSTYY ADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARRHWPGGFDYWGQGTLVTVSSA STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLG GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYASTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLP PSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Example 15
In Vitro Cell Based pH Dependent Binding of Masked 9D9 Antibodies
[0125] Masked 9D9 antibody binding is evaluated in isogenic 293 cells that stably express mouse CTLA-4 (mCTLA-4). Briefly, parent Flp-In 293 cells that harbor a single FRT recombination site are expanded in complete culture medium (DMEM GlutaMax 10% FBS) prior to transfection. Once sufficient parent cells are grown, cells are transfected with two vectors, one encoded the Flp recombinase and the other encoded mCTLA-4 plus a hygromycin B resistance gene. Cells successfully transfected are selected using hygromycin B. After several days of growth in the presence of hygromycin B, cellular foci are picked and expanded. Expanded foci are tested for mCTLA-4 expression via flow cytometry using the unmasked 9D9 antibody. Cells that express mCTLA-4 (mCTLA-4 293) are expanded further and cryopreserved.
[0126] mCTLA-4_293 cells are then used to evaluate pH dependent binding of masked 9D9 antibodies. mCTLA-4_293 cells are grown to 50%-75% confluence, washed, incubated in buffered EDTA, and gently scraped from the culture dish surface. Parent 293 cells are expanded in parallel and used as controls. Cells are transferred to a 15 mL falcon tube, spun down, and washed 3 times. Cells are washed with complete culture medium in the absence of bicarb, supplemented with MES and adjusted to pH 6.0, or supplemented with HEPES and adjusted to pH 7.4. Cell are concentrated then incubated with unmasked or masked 9D9 antibodies for 1 h at RT in complete culture medium plus MES pH 6.0 or HEPES pH 7.4. Cells are washed 3 times in complete culture medium plus MES pH 6.0 or HEPES pH 7.4. Cells are then fixed in buffered formalin for 15 min RT and washed 3 times in PBS pH 7.4. Cells are concentrated then incubated with secondary AlexaFluor 555 anti-mouse antibody for 1 hr at RT in PBS 5% BSA 0.1% tween. Cells are washed 3 times with PBS 0.1% tween and analyzed by flow cytometry.
Example 16
In Vivo Efficacy Evaluation of Masked 9D9 Antibodies
[0127] Efficacy of masked 9D9 antibodies is evaluated relative to parent 9D9 in C57BL/6 or BALB/c mice bearing syngeneic MC38 tumor xenografts. Briefly, mice are subcutaneously injected with 2 million MC38 tumor cells, respectively. Tumor volumes are recorded 3 times weekly. Mice bearing palpable tumors (50-75 mm.sup.3) are randomized into treatment groups with comparable mean tumor volumes. Antibodies formulated in PBS pH 7.4 are administered twice weekly intraperitoneally (IP) 200 .mu.g per dose in a volume of 200 .mu.L (10 mg/kg IP b.i.w). Matched isotype antibodies are used as negative controls. Percent tumor growth inhibition (TGI %) is determined after two weeks of dosing for antibody treatment groups relative to isotype controls.
Example 17
Tumor Actuated Binding of Masked 9D9 Antibodies Using In Vivo Near Infrared Imaging
[0128] Selective tumor binding of masked near infrared (NIR) labeled 9D9 antibodies is evaluated relative to parent NIR 9D9 in mice bearing MC38 or CT26 tumor xenografts. Antibodies are labeled with the NIR imaging probe, IRDye-800CW-NHS (IRDye 800CW-N-hydroxysuccinimide ester) according to manufacturer's instructions. Briefly, they are incubated in the dark at room temperature with IRDye800CW in 1.0 M potassium phosphate buffer (pH 9.0) for 2 hours. The unconjugated dye is removed by desalting spin columns and purified according to manufacturer's instructions. NIR masked 9D9, NIR 9D9, or NIR labeled isotype control are administered intravenously to MC38 bearing C57Bl/6 mice via the tail vein. Forty-eight hours after administration of the NIR labeled antibodies, probe uptake and tissue distribution in the tumor bearing mice is measured using a small-animal NIR scanner (IVIS Spectrum In Vivo Imaging System). During imaging, the mice are anesthetized with isoflurane gas and placed in the prone position.
Example 18
In Vivo Efficacy Evaluation of Masked anti-CTLA-4 Antibodies
[0129] Efficacy of masked anti-CTLA-4 antibodies is evaluated relative to parent anti-CTLA-4 antibody in C57BL/6 or BALB/c mice bearing syngeneic MC38 or CT26 tumor xenografts, respectively. Mice are subcutaneously injected with 1 million CT26 or 2 million MC38 tumor cells. Tumor volumes are recorded 3 times weekly for four weeks. Mice bearing palpable tumors (50-100 mm.sup.3) are randomized into treatment groups with comparable mean tumor volumes. Antibodies formulated in PBS pH 7.4 are administered twice weekly intraperitoneally (IP) 200 m per dose in a volume of 200 .mu.L (10 mg/kg IP b.i.w). Matched isotype antibodies are used as negative controls. Percent tumor growth inhibition (TGI %) is determined after three weeks from first dose for antibody treatment groups relative to isotype controls.
Example 19
In Vivo Safety Evaluation of Masked anti-CTLA-4 Antibodies in Combination with anti-PD-1 Antibodies
[0130] Five-week old female NOD mice are administered masked anti-CTLA-4 antibodies, parent anti-CTLA-4 antibody, anti-PD-1 antibody, and/or isotype controls in combination at 10 mg/kg intraperitoneally each article on days 0, 4 and 7. The following six combinations are used: 1) isotype controls, 2) parent anti-CTLA-4 antibody plus isotype control, 3) masked anti-CTLA-4 antibody plus isotype control, 4) anti-PD-1 antibody plus isotype control, 5) anti-PD-1 antibody plus parent anti-CTLA-4, or 6) anti-PD-1 antibody plus masked anti-CTLA-4 antibody. Mice are monitored daily for the induction of diabetes by glucosuria plus confirmation of two consecutive blood glucose levels .gtoreq.250 mg/dL. Monitoring is continued for a minimum of 7 days until 48 hours have passed with no new incidents of glucosuria.
Example 20
In Vivo Peripheral T-Cell Activation Using Masked anti-CTLA-4 Antibodies Alone or in Combination with anti-PD-1 Antibody
[0131] Four to six week old C57Bl/6 mice are administered masked anti-CTLA-4 antibody, parent anti-CTLA-4 antibody, isotype control, anti-PD-1 antibody plus isotype control, anti-PD-1 antibody plus parent anti-CTLA-4 antibody, or anti-PD-1 antibody plus masked anti-CTLA-4 antibody at 10 mg/kg intraperitoneally each article on days 0, 4 and 7. On day 14 animals are euthanized. Blood and spleen are harvested from animals. Blood is stored in EDTA blood collection tubes. Spleens are digested using the mouse spleen dissociation kit from Miltenyi Biotec. Lymphocytes from blood and spleen derived cells are enriched using a Ficoll gradient. Enriched lymphocytes are stained for FoxP3 followed by either Ki67 or ICOS and measured via flow cytometry. Percent Ki67 or ICOS positive cells are calculated from total number of FoxP3 positive cells.
[0132] While preferred embodiments of the present invention have been shown and described herein, it will be obvious to those skilled in the art that such embodiments are provided by way of example only. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the invention. It should be understood that various alternatives to the embodiments of the invention described herein may be employed in practicing the invention. It is intended that the following claims define the scope of the invention and that methods and structures within the scope of these claims and their equivalents be covered thereby.
Sequence CWU
1
1
70140PRTArtificial SequenceDescription of Artificial Sequence Synthetic
polypeptideMISC_FEATURE(1)..(40)This sequence may encompass 6-20 'GS'
repeating units wherein some positions may be absent 1Gly Ser Gly
Ser Gly Ser Gly Ser Gly Ser Gly Ser Gly Ser Gly Ser 1 5
10 15 Gly Ser Gly Ser Gly Ser Gly Ser
Gly Ser Gly Ser Gly Ser Gly Ser 20 25
30 Gly Ser Gly Ser Gly Ser Gly Ser 35
40 239PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptideMISC_FEATURE(1)..(39)This sequence may
encompass 4-13 'GGS' repeating units wherein some positions may be
absent 2Gly Gly Ser Gly Gly Ser Gly Gly Ser Gly Gly Ser Gly Gly Ser Gly 1
5 10 15 Gly Ser Gly
Gly Ser Gly Gly Ser Gly Gly Ser Gly Gly Ser Gly Gly 20
25 30 Ser Gly Gly Ser Gly Gly Ser
35 340PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptideMISC_FEATURE(1)..(40)This
sequence may encompass 3-10 'GGGS' repeating units wherein some
positions may be absent 3Gly Gly Gly Ser Gly Gly Gly Ser Gly Gly Gly Ser
Gly Gly Gly Ser 1 5 10
15 Gly Gly Gly Ser Gly Gly Gly Ser Gly Gly Gly Ser Gly Gly Gly Ser
20 25 30 Gly Gly Gly
Ser Gly Gly Gly Ser 35 40 440PRTArtificial
SequenceDescription of Artificial Sequence Synthetic
polypeptideMISC_FEATURE(1)..(40)This sequence may encompass 2-8 'GGGGS'
repeating units wherein some positions may be absent 4Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly 1 5
10 15 Gly Gly Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Gly Ser Gly Gly 20 25
30 Gly Gly Ser Gly Gly Gly Gly Ser 35
40 540PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptideMISC_FEATURE(1)..(40)This sequence may
encompass 12-40 'G' repeating units wherein some positions may be
absent 5Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly 1
5 10 15 Gly Gly Gly
Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly 20
25 30 Gly Gly Gly Gly Gly Gly Gly Gly
35 40 633PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptideMISC_FEATURE(1)..(33)This
sequence may encompass 1-3 'GGGSGSGGGGS' repeating units wherein
some positions may be absent 6Gly Gly Gly Ser Gly Ser Gly Gly Gly Gly Ser
Gly Gly Gly Ser Gly 1 5 10
15 Ser Gly Gly Gly Gly Ser Gly Gly Gly Ser Gly Ser Gly Gly Gly Gly
20 25 30 Ser
733PRTArtificial SequenceDescription of Artificial Sequence Synthetic
polypeptideMISC_FEATURE(1)..(33)This sequence may encompass 1-3
'GGGGGPGGGGP' repeating units wherein some positions may be absent
7Gly Gly Gly Gly Gly Pro Gly Gly Gly Gly Pro Gly Gly Gly Gly Gly 1
5 10 15 Pro Gly Gly Gly
Gly Pro Gly Gly Gly Gly Gly Pro Gly Gly Gly Gly 20
25 30 Pro 836PRTArtificial
SequenceDescription of Artificial Sequence Synthetic
polypeptideMISC_FEATURE(1)..(36)This sequence may encompass 2-6 'GGSGGD'
repeating units wherein some positions may be absent 8Gly Gly Ser Gly
Gly Asp Gly Gly Ser Gly Gly Asp Gly Gly Ser Gly 1 5
10 15 Gly Asp Gly Gly Ser Gly Gly Asp Gly
Gly Ser Gly Gly Asp Gly Gly 20 25
30 Ser Gly Gly Asp 35 936PRTArtificial
SequenceDescription of Artificial Sequence Synthetic
polypeptideMISC_FEATURE(1)..(36)This sequence may encompass 2-6 'GGSGGE'
repeating units wherein some positions may be absent 9Gly Gly Ser Gly
Gly Glu Gly Gly Ser Gly Gly Glu Gly Gly Ser Gly 1 5
10 15 Gly Glu Gly Gly Ser Gly Gly Glu Gly
Gly Ser Gly Gly Glu Gly Gly 20 25
30 Ser Gly Gly Glu 35 10116PRTArtificial
SequenceDescription of Artificial Sequence Synthetic
polypeptideMISC_FEATURE(1)..(40)This region may encompass 0-20 'GS'
repeating units wherein some positions may be
absentMISC_FEATURE(41)..(76)This region may encompass 2-6 'GGSGGD'
repeating units wherein some positions may be
absentMISC_FEATURE(77)..(116)This region may encompass 0-20 'GS'
repeating units wherein some positions may be absent 10Gly Ser Gly
Ser Gly Ser Gly Ser Gly Ser Gly Ser Gly Ser Gly Ser 1 5
10 15 Gly Ser Gly Ser Gly Ser Gly Ser
Gly Ser Gly Ser Gly Ser Gly Ser 20 25
30 Gly Ser Gly Ser Gly Ser Gly Ser Gly Gly Ser Gly Gly
Asp Gly Gly 35 40 45
Ser Gly Gly Asp Gly Gly Ser Gly Gly Asp Gly Gly Ser Gly Gly Asp 50
55 60 Gly Gly Ser Gly
Gly Asp Gly Gly Ser Gly Gly Asp Gly Ser Gly Ser 65 70
75 80 Gly Ser Gly Ser Gly Ser Gly Ser Gly
Ser Gly Ser Gly Ser Gly Ser 85 90
95 Gly Ser Gly Ser Gly Ser Gly Ser Gly Ser Gly Ser Gly Ser
Gly Ser 100 105 110
Gly Ser Gly Ser 115 11114PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptideMISC_FEATURE(1)..(39)This
region may encompass 0-13 'GGS' repeating units wherein some
positions may be absentMISC_FEATURE(40)..(75)This region may encompass
2-6 'GGSGGD' repeating units wherein some positions may be
absentMISC_FEATURE(76)..(114)This region may encompass 0-13 'GGS'
repeating units wherein some positions may be absent 11Gly Gly Ser
Gly Gly Ser Gly Gly Ser Gly Gly Ser Gly Gly Ser Gly 1 5
10 15 Gly Ser Gly Gly Ser Gly Gly Ser
Gly Gly Ser Gly Gly Ser Gly Gly 20 25
30 Ser Gly Gly Ser Gly Gly Ser Gly Gly Ser Gly Gly Asp
Gly Gly Ser 35 40 45
Gly Gly Asp Gly Gly Ser Gly Gly Asp Gly Gly Ser Gly Gly Asp Gly 50
55 60 Gly Ser Gly Gly
Asp Gly Gly Ser Gly Gly Asp Gly Gly Ser Gly Gly 65 70
75 80 Ser Gly Gly Ser Gly Gly Ser Gly Gly
Ser Gly Gly Ser Gly Gly Ser 85 90
95 Gly Gly Ser Gly Gly Ser Gly Gly Ser Gly Gly Ser Gly Gly
Ser Gly 100 105 110
Gly Ser 12116PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptideMISC_FEATURE(1)..(40)This region may encompass
0-10 'GGGS' repeating units wherein some positions may be
absentMISC_FEATURE(41)..(76)This region may encompass 2-6 'GGSGGD'
repeating units wherein some positions may be
absentMISC_FEATURE(77)..(116)This region may encompass 0-10 'GGGS'
repeating units wherein some positions may be absent 12Gly Gly Gly
Ser Gly Gly Gly Ser Gly Gly Gly Ser Gly Gly Gly Ser 1 5
10 15 Gly Gly Gly Ser Gly Gly Gly Ser
Gly Gly Gly Ser Gly Gly Gly Ser 20 25
30 Gly Gly Gly Ser Gly Gly Gly Ser Gly Gly Ser Gly Gly
Asp Gly Gly 35 40 45
Ser Gly Gly Asp Gly Gly Ser Gly Gly Asp Gly Gly Ser Gly Gly Asp 50
55 60 Gly Gly Ser Gly
Gly Asp Gly Gly Ser Gly Gly Asp Gly Gly Gly Ser 65 70
75 80 Gly Gly Gly Ser Gly Gly Gly Ser Gly
Gly Gly Ser Gly Gly Gly Ser 85 90
95 Gly Gly Gly Ser Gly Gly Gly Ser Gly Gly Gly Ser Gly Gly
Gly Ser 100 105 110
Gly Gly Gly Ser 115 13116PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptideMISC_FEATURE(1)..(40)This
region may encompass 0-8 'GGGGS' repeating units wherein some
positions may be absentMISC_FEATURE(41)..(76)This region may encompass
2-6 'GGSGGD' repeating units wherein some positions may be
absentMISC_FEATURE(77)..(116)This region may encompass 0-8 'GGGGS'
repeating units wherein some positions may be absent 13Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly 1 5
10 15 Gly Gly Gly Ser Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Gly Gly 20 25
30 Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Ser Gly Gly
Asp Gly Gly 35 40 45
Ser Gly Gly Asp Gly Gly Ser Gly Gly Asp Gly Gly Ser Gly Gly Asp 50
55 60 Gly Gly Ser Gly
Gly Asp Gly Gly Ser Gly Gly Asp Gly Gly Gly Gly 65 70
75 80 Ser Gly Gly Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser 85 90
95 Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
Ser Gly 100 105 110
Gly Gly Gly Ser 115 14116PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptideMISC_FEATURE(1)..(40)This
region may encompass 0-40 'G' repeating units wherein some positions
may be absentMISC_FEATURE(41)..(76)This region may encompass 2-6 'GGSGGD'
repeating units wherein some positions may be
absentMISC_FEATURE(77)..(116)This region may encompass 0-40 'G' repeating
units wherein some positions may be absent 14Gly Gly Gly Gly Gly Gly
Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly 1 5
10 15 Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly
Gly Gly Gly Gly Gly 20 25
30 Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Ser Gly Gly Asp Gly
Gly 35 40 45 Ser
Gly Gly Asp Gly Gly Ser Gly Gly Asp Gly Gly Ser Gly Gly Asp 50
55 60 Gly Gly Ser Gly Gly Asp
Gly Gly Ser Gly Gly Asp Gly Gly Gly Gly 65 70
75 80 Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly
Gly Gly Gly Gly Gly 85 90
95 Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly
100 105 110 Gly Gly
Gly Gly 115 15102PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptideMISC_FEATURE(1)..(33)This
region may encompass 0-3 'GGGSGSGGGGS' repeating units wherein some
positions may be absentMISC_FEATURE(34)..(69)This region may encompass
2-6 'GGSGGD' repeating units wherein some positions may be
absentMISC_FEATURE(70)..(102)This region may encompass 0-3 'GGGSGSGGGGS'
repeating units wherein some positions may be absent 15Gly Gly Gly
Ser Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Ser Gly 1 5
10 15 Ser Gly Gly Gly Gly Ser Gly Gly
Gly Ser Gly Ser Gly Gly Gly Gly 20 25
30 Ser Gly Gly Ser Gly Gly Asp Gly Gly Ser Gly Gly Asp
Gly Gly Ser 35 40 45
Gly Gly Asp Gly Gly Ser Gly Gly Asp Gly Gly Ser Gly Gly Asp Gly 50
55 60 Gly Ser Gly Gly
Asp Gly Gly Gly Ser Gly Ser Gly Gly Gly Gly Ser 65 70
75 80 Gly Gly Gly Ser Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Ser Gly 85 90
95 Ser Gly Gly Gly Gly Ser 100
16102PRTArtificial SequenceDescription of Artificial Sequence Synthetic
polypeptideMISC_FEATURE(1)..(33)This region may encompass 0-3
'GGGSGSGGGGP' repeating units wherein some positions may be
absentMISC_FEATURE(34)..(69)This region may encompass 2-6 'GGSGGD'
repeating units wherein some positions may be
absentMISC_FEATURE(70)..(102)This region may encompass 0-3 'GGGSGSGGGGP'
repeating units wherein some positions may be absent 16Gly Gly Gly
Ser Gly Ser Gly Gly Gly Gly Pro Gly Gly Gly Ser Gly 1 5
10 15 Ser Gly Gly Gly Gly Pro Gly Gly
Gly Ser Gly Ser Gly Gly Gly Gly 20 25
30 Pro Gly Gly Ser Gly Gly Asp Gly Gly Ser Gly Gly Asp
Gly Gly Ser 35 40 45
Gly Gly Asp Gly Gly Ser Gly Gly Asp Gly Gly Ser Gly Gly Asp Gly 50
55 60 Gly Ser Gly Gly
Asp Gly Gly Gly Ser Gly Ser Gly Gly Gly Gly Pro 65 70
75 80 Gly Gly Gly Ser Gly Ser Gly Gly Gly
Gly Pro Gly Gly Gly Ser Gly 85 90
95 Ser Gly Gly Gly Gly Pro 100
17116PRTArtificial SequenceDescription of Artificial Sequence Synthetic
polypeptideMISC_FEATURE(1)..(40)This region may encompass 0-20 'GS'
repeating units wherein some positions may be
absentMISC_FEATURE(41)..(76)This region may encompass 2-6 'GGSGGE'
repeating units wherein some positions may be
absentMISC_FEATURE(77)..(116)This region may encompass 0-20 'GS'
repeating units wherein some positions may be absent 17Gly Ser Gly
Ser Gly Ser Gly Ser Gly Ser Gly Ser Gly Ser Gly Ser 1 5
10 15 Gly Ser Gly Ser Gly Ser Gly Ser
Gly Ser Gly Ser Gly Ser Gly Ser 20 25
30 Gly Ser Gly Ser Gly Ser Gly Ser Gly Gly Ser Gly Gly
Glu Gly Gly 35 40 45
Ser Gly Gly Glu Gly Gly Ser Gly Gly Glu Gly Gly Ser Gly Gly Glu 50
55 60 Gly Gly Ser Gly
Gly Glu Gly Gly Ser Gly Gly Glu Gly Ser Gly Ser 65 70
75 80 Gly Ser Gly Ser Gly Ser Gly Ser Gly
Ser Gly Ser Gly Ser Gly Ser 85 90
95 Gly Ser Gly Ser Gly Ser Gly Ser Gly Ser Gly Ser Gly Ser
Gly Ser 100 105 110
Gly Ser Gly Ser 115 18114PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptideMISC_FEATURE(1)..(39)This
region may encompass 0-13 'GGS' repeating units wherein some
positions may be absentMISC_FEATURE(40)..(75)This region may encompass
2-6 'GGSGGE' repeating units wherein some positions may be
absentMISC_FEATURE(76)..(114)This region may encompass 0-13 'GGS'
repeating units wherein some positions may be absent 18Gly Gly Ser
Gly Gly Ser Gly Gly Ser Gly Gly Ser Gly Gly Ser Gly 1 5
10 15 Gly Ser Gly Gly Ser Gly Gly Ser
Gly Gly Ser Gly Gly Ser Gly Gly 20 25
30 Ser Gly Gly Ser Gly Gly Ser Gly Gly Ser Gly Gly Glu
Gly Gly Ser 35 40 45
Gly Gly Glu Gly Gly Ser Gly Gly Glu Gly Gly Ser Gly Gly Glu Gly 50
55 60 Gly Ser Gly Gly
Glu Gly Gly Ser Gly Gly Glu Gly Gly Ser Gly Gly 65 70
75 80 Ser Gly Gly Ser Gly Gly Ser Gly Gly
Ser Gly Gly Ser Gly Gly Ser 85 90
95 Gly Gly Ser Gly Gly Ser Gly Gly Ser Gly Gly Ser Gly Gly
Ser Gly 100 105 110
Gly Ser 19116PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptideMISC_FEATURE(1)..(40)This region may encompass
0-10 'GGGS' repeating units wherein some positions may be
absentMISC_FEATURE(41)..(76)This region may encompass 2-6 'GGSGGE'
repeating units wherein some positions may be
absentMISC_FEATURE(77)..(116)This region may encompass 0-10 'GGGS'
repeating units wherein some positions may be absent 19Gly Gly Gly
Ser Gly Gly Gly Ser Gly Gly Gly Ser Gly Gly Gly Ser 1 5
10 15 Gly Gly Gly Ser Gly Gly Gly Ser
Gly Gly Gly Ser Gly Gly Gly Ser 20 25
30 Gly Gly Gly Ser Gly Gly Gly Ser Gly Gly Ser Gly Gly
Glu Gly Gly 35 40 45
Ser Gly Gly Glu Gly Gly Ser Gly Gly Glu Gly Gly Ser Gly Gly Glu 50
55 60 Gly Gly Ser Gly
Gly Glu Gly Gly Ser Gly Gly Glu Gly Gly Gly Ser 65 70
75 80 Gly Gly Gly Ser Gly Gly Gly Ser Gly
Gly Gly Ser Gly Gly Gly Ser 85 90
95 Gly Gly Gly Ser Gly Gly Gly Ser Gly Gly Gly Ser Gly Gly
Gly Ser 100 105 110
Gly Gly Gly Ser 115 20116PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptideMISC_FEATURE(1)..(40)This
region may encompass 0-8 'GGGGS' repeating units wherein some
positions may be absentMISC_FEATURE(41)..(76)This region may encompass
2-6 'GGSGGE' repeating units wherein some positions may be
absentMISC_FEATURE(77)..(116)This region may encompass 0-8 'GGGGS'
repeating units wherein some positions may be absent 20Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly 1 5
10 15 Gly Gly Gly Ser Gly Gly Gly Gly
Ser Gly Gly Gly Gly Ser Gly Gly 20 25
30 Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Ser Gly Gly
Glu Gly Gly 35 40 45
Ser Gly Gly Glu Gly Gly Ser Gly Gly Glu Gly Gly Ser Gly Gly Glu 50
55 60 Gly Gly Ser Gly
Gly Glu Gly Gly Ser Gly Gly Glu Gly Gly Gly Gly 65 70
75 80 Ser Gly Gly Gly Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser 85 90
95 Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
Ser Gly 100 105 110
Gly Gly Gly Ser 115 21116PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptideMISC_FEATURE(1)..(40)This
region may encompass 0-40 'G' repeating units wherein some positions
may be absentMISC_FEATURE(41)..(76)This region may encompass 2-6 'GGSGGE'
repeating units wherein some positions may be
absentMISC_FEATURE(77)..(116)This region may encompass 0-40 'G' repeating
units wherein some positions may be absent 21Gly Gly Gly Gly Gly Gly
Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly 1 5
10 15 Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly
Gly Gly Gly Gly Gly 20 25
30 Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Ser Gly Gly Glu Gly
Gly 35 40 45 Ser
Gly Gly Glu Gly Gly Ser Gly Gly Glu Gly Gly Ser Gly Gly Glu 50
55 60 Gly Gly Ser Gly Gly Glu
Gly Gly Ser Gly Gly Glu Gly Gly Gly Gly 65 70
75 80 Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly
Gly Gly Gly Gly Gly 85 90
95 Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly
100 105 110 Gly Gly
Gly Gly 115 22102PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptideMISC_FEATURE(1)..(33)This
region may encompass 0-3 'GGGSGSGGGGS' repeating units wherein some
positions may be absentMISC_FEATURE(34)..(69)This region may encompass
2-6 'GGSGGE' repeating units wherein some positions may be
absentMISC_FEATURE(70)..(102)This region may encompass 0-3 'GGGSGSGGGGS'
repeating units wherein some positions may be absent 22Gly Gly Gly
Ser Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Ser Gly 1 5
10 15 Ser Gly Gly Gly Gly Ser Gly Gly
Gly Ser Gly Ser Gly Gly Gly Gly 20 25
30 Ser Gly Gly Ser Gly Gly Glu Gly Gly Ser Gly Gly Glu
Gly Gly Ser 35 40 45
Gly Gly Glu Gly Gly Ser Gly Gly Glu Gly Gly Ser Gly Gly Glu Gly 50
55 60 Gly Ser Gly Gly
Glu Gly Gly Gly Ser Gly Ser Gly Gly Gly Gly Ser 65 70
75 80 Gly Gly Gly Ser Gly Ser Gly Gly Gly
Gly Ser Gly Gly Gly Ser Gly 85 90
95 Ser Gly Gly Gly Gly Ser 100
23102PRTArtificial SequenceDescription of Artificial Sequence Synthetic
polypeptideMISC_FEATURE(1)..(33)This region may encompass 0-3
'GGGSGSGGGGP' repeating units wherein some positions may be
absentMISC_FEATURE(34)..(69)This region may encompass 2-6 'GGSGGE'
repeating units wherein some positions may be
absentMISC_FEATURE(70)..(102)This region may encompass 0-3 'GGGSGSGGGGP'
repeating units wherein some positions may be absent 23Gly Gly Gly
Ser Gly Ser Gly Gly Gly Gly Pro Gly Gly Gly Ser Gly 1 5
10 15 Ser Gly Gly Gly Gly Pro Gly Gly
Gly Ser Gly Ser Gly Gly Gly Gly 20 25
30 Pro Gly Gly Ser Gly Gly Glu Gly Gly Ser Gly Gly Glu
Gly Gly Ser 35 40 45
Gly Gly Glu Gly Gly Ser Gly Gly Glu Gly Gly Ser Gly Gly Glu Gly 50
55 60 Gly Ser Gly Gly
Glu Gly Gly Gly Ser Gly Ser Gly Gly Gly Gly Pro 65 70
75 80 Gly Gly Gly Ser Gly Ser Gly Gly Gly
Gly Pro Gly Gly Gly Ser Gly 85 90
95 Ser Gly Gly Gly Gly Pro 100
2440PRTArtificial SequenceDescription of Artificial Sequence Synthetic
polypeptideMISC_FEATURE(1)..(40)This sequence may encompass at least 20
'GX' repeating units wherein some positions may be
absentMOD_RES(2)..(2)Ser, Asp, Glu, Thr or ProMOD_RES(4)..(4)Ser, Asp,
Glu, Thr or ProMOD_RES(6)..(6)Ser, Asp, Glu, Thr or
ProMOD_RES(8)..(8)Ser, Asp, Glu, Thr or ProMOD_RES(10)..(10)Ser, Asp,
Glu, Thr or ProMOD_RES(12)..(12)Ser, Asp, Glu, Thr or
ProMOD_RES(14)..(14)Ser, Asp, Glu, Thr or ProMOD_RES(16)..(16)Ser, Asp,
Glu, Thr or ProMOD_RES(18)..(18)Ser, Asp, Glu, Thr or
ProMOD_RES(20)..(20)Ser, Asp, Glu, Thr or ProMOD_RES(22)..(22)Ser, Asp,
Glu, Thr or ProMOD_RES(24)..(24)Ser, Asp, Glu, Thr or
ProMOD_RES(26)..(26)Ser, Asp, Glu, Thr or ProMOD_RES(28)..(28)Ser, Asp,
Glu, Thr or ProMOD_RES(30)..(30)Ser, Asp, Glu, Thr or
ProMOD_RES(32)..(32)Ser, Asp, Glu, Thr or ProMOD_RES(34)..(34)Ser, Asp,
Glu, Thr or ProMOD_RES(36)..(36)Ser, Asp, Glu, Thr or
ProMOD_RES(38)..(38)Ser, Asp, Glu, Thr or ProMOD_RES(40)..(40)Ser, Asp,
Glu, Thr or Pro 24Gly Xaa Gly Xaa Gly Xaa Gly Xaa Gly Xaa Gly Xaa Gly Xaa
Gly Xaa 1 5 10 15
Gly Xaa Gly Xaa Gly Xaa Gly Xaa Gly Xaa Gly Xaa Gly Xaa Gly Xaa
20 25 30 Gly Xaa Gly Xaa Gly
Xaa Gly Xaa 35 40 2539PRTArtificial
SequenceDescription of Artificial Sequence Synthetic
polypeptideMISC_FEATURE(1)..(39)This sequence may encompass at least 13
'GGX' repeating units wherein some positions may be
absentMOD_RES(3)..(3)Ser, Asp, Glu, Thr or ProMOD_RES(6)..(6)Ser, Asp,
Glu, Thr or ProMOD_RES(9)..(9)Ser, Asp, Glu, Thr or
ProMOD_RES(12)..(12)Ser, Asp, Glu, Thr or ProMOD_RES(15)..(15)Ser, Asp,
Glu, Thr or ProMOD_RES(18)..(18)Ser, Asp, Glu, Thr or
ProMOD_RES(21)..(21)Ser, Asp, Glu, Thr or ProMOD_RES(24)..(24)Ser, Asp,
Glu, Thr or ProMOD_RES(27)..(27)Ser, Asp, Glu, Thr or
ProMOD_RES(30)..(30)Ser, Asp, Glu, Thr or ProMOD_RES(33)..(33)Ser, Asp,
Glu, Thr or ProMOD_RES(36)..(36)Ser, Asp, Glu, Thr or
ProMOD_RES(39)..(39)Ser, Asp, Glu, Thr or Pro 25Gly Gly Xaa Gly Gly Xaa
Gly Gly Xaa Gly Gly Xaa Gly Gly Xaa Gly 1 5
10 15 Gly Xaa Gly Gly Xaa Gly Gly Xaa Gly Gly Xaa
Gly Gly Xaa Gly Gly 20 25
30 Xaa Gly Gly Xaa Gly Gly Xaa 35
2640PRTArtificial SequenceDescription of Artificial Sequence Synthetic
polypeptideMISC_FEATURE(1)..(40)This sequence may encompass at least 10
'GGGX' repeating units wherein some positions may be
absentMOD_RES(4)..(4)Ser, Asp, Glu, Thr or ProMOD_RES(8)..(8)Ser, Asp,
Glu, Thr or ProMOD_RES(12)..(12)Ser, Asp, Glu, Thr or
ProMOD_RES(16)..(16)Ser, Asp, Glu, Thr or ProMOD_RES(20)..(20)Ser, Asp,
Glu, Thr or ProMOD_RES(24)..(24)Ser, Asp, Glu, Thr or
ProMOD_RES(28)..(28)Ser, Asp, Glu, Thr or ProMOD_RES(32)..(32)Ser, Asp,
Glu, Thr or ProMOD_RES(36)..(36)Ser, Asp, Glu, Thr or
ProMOD_RES(40)..(40)Ser, Asp, Glu, Thr or Pro 26Gly Gly Gly Xaa Gly Gly
Gly Xaa Gly Gly Gly Xaa Gly Gly Gly Xaa 1 5
10 15 Gly Gly Gly Xaa Gly Gly Gly Xaa Gly Gly Gly
Xaa Gly Gly Gly Xaa 20 25
30 Gly Gly Gly Xaa Gly Gly Gly Xaa 35
40 2740PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptideMISC_FEATURE(1)..(40)This sequence may
encompass at least 8 'GGGGX' repeating units wherein some positions
may be absentMOD_RES(5)..(5)Ser, Asp, Glu, Thr or
ProMOD_RES(10)..(10)Ser, Asp, Glu, Thr or ProMOD_RES(15)..(15)Ser, Asp,
Glu, Thr or ProMOD_RES(20)..(20)Ser, Asp, Glu, Thr or
ProMOD_RES(25)..(25)Ser, Asp, Glu, Thr or ProMOD_RES(30)..(30)Ser, Asp,
Glu, Thr or ProMOD_RES(35)..(35)Ser, Asp, Glu, Thr or
ProMOD_RES(40)..(40)Ser, Asp, Glu, Thr or Pro 27Gly Gly Gly Gly Xaa Gly
Gly Gly Gly Xaa Gly Gly Gly Gly Xaa Gly 1 5
10 15 Gly Gly Gly Xaa Gly Gly Gly Gly Xaa Gly Gly
Gly Gly Xaa Gly Gly 20 25
30 Gly Gly Xaa Gly Gly Gly Gly Xaa 35
40 28315PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptideMISC_FEATURE(1)..(315)This sequence may
encompass at least 15 'GZX' repeating units wherein 'Z' is an
integer between 1-20 and some positions may be
absentMISC_FEATURE(1)..(20)This region may encompass 1-20 'G' repeating
units wherein some positions may be absentMOD_RES(21)..(21)Ser, Asp,
Glu, Thr or ProMISC_FEATURE(22)..(41)This region may encompass 1-20 'G'
repeating units wherein some positions may be
absentMOD_RES(42)..(42)Ser, Asp, Glu, Thr or
ProMISC_FEATURE(43)..(62)This region may encompass 1-20 'G' repeating
units wherein some positions may be absentMOD_RES(63)..(63)Ser, Asp,
Glu, Thr or ProMISC_FEATURE(64)..(83)This region may encompass 1-20 'G'
repeating units wherein some positions may be
absentMOD_RES(84)..(84)Ser, Asp, Glu, Thr or
ProMISC_FEATURE(85)..(104)This region may encompass 1-20 'G' repeating
units wherein some positions may be absentMOD_RES(105)..(105)Ser, Asp,
Glu, Thr or ProMISC_FEATURE(106)..(125)This region may encompass 1-20 'G'
repeating units wherein some positions may be
absentMOD_RES(126)..(126)Ser, Asp, Glu, Thr or
ProMISC_FEATURE(127)..(146)This region may encompass 1-20 'G' repeating
units wherein some positions may be absentMOD_RES(147)..(147)Ser, Asp,
Glu, Thr or ProMISC_FEATURE(148)..(167)This region may encompass 1-20 'G'
repeating units wherein some positions may be
absentMOD_RES(168)..(168)Ser, Asp, Glu, Thr or
ProMISC_FEATURE(169)..(188)This region may encompass 1-20 'G' repeating
units wherein some positions may be absentMOD_RES(189)..(189)Ser, Asp,
Glu, Thr or ProMISC_FEATURE(190)..(209)This region may encompass 1-20 'G'
repeating units wherein some positions may be
absentMOD_RES(210)..(210)Ser, Asp, Glu, Thr or
ProMISC_FEATURE(211)..(230)This region may encompass 1-20 'G' repeating
units wherein some positions may be absentMOD_RES(231)..(231)Ser, Asp,
Glu, Thr or ProMISC_FEATURE(232)..(251)This region may encompass 1-20 'G'
repeating units wherein some positions may be
absentMOD_RES(252)..(252)Ser, Asp, Glu, Thr or
ProMISC_FEATURE(253)..(272)This region may encompass 1-20 'G' repeating
units wherein some positions may be absentMOD_RES(273)..(273)Ser, Asp,
Glu, Thr or ProMISC_FEATURE(274)..(293)This region may encompass 1-20 'G'
repeating units wherein some positions may be
absentMOD_RES(294)..(294)Ser, Asp, Glu, Thr or
ProMISC_FEATURE(295)..(314)This region may encompass 1-20 'G' repeating
units wherein some positions may be absentMOD_RES(315)..(315)Ser, Asp,
Glu, Thr or Pro 28Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly
Gly Gly 1 5 10 15
Gly Gly Gly Gly Xaa Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly
20 25 30 Gly Gly Gly Gly Gly
Gly Gly Gly Gly Xaa Gly Gly Gly Gly Gly Gly 35
40 45 Gly Gly Gly Gly Gly Gly Gly Gly Gly
Gly Gly Gly Gly Gly Xaa Gly 50 55
60 Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly
Gly Gly Gly 65 70 75
80 Gly Gly Gly Xaa Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly
85 90 95 Gly Gly Gly Gly
Gly Gly Gly Gly Xaa Gly Gly Gly Gly Gly Gly Gly 100
105 110 Gly Gly Gly Gly Gly Gly Gly Gly Gly
Gly Gly Gly Gly Xaa Gly Gly 115 120
125 Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly
Gly Gly 130 135 140
Gly Gly Xaa Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly 145
150 155 160 Gly Gly Gly Gly Gly
Gly Gly Xaa Gly Gly Gly Gly Gly Gly Gly Gly 165
170 175 Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly
Gly Gly Xaa Gly Gly Gly 180 185
190 Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly
Gly 195 200 205 Gly
Xaa Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly 210
215 220 Gly Gly Gly Gly Gly Gly
Xaa Gly Gly Gly Gly Gly Gly Gly Gly Gly 225 230
235 240 Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly
Xaa Gly Gly Gly Gly 245 250
255 Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly
260 265 270 Xaa Gly
Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly 275
280 285 Gly Gly Gly Gly Gly Xaa Gly
Gly Gly Gly Gly Gly Gly Gly Gly Gly 290 295
300 Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly Xaa 305
310 315 2912PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 29Thr
Leu Asp Asp Met Ser His Val Ile Leu Tyr Ala 1 5
10 3012PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 30Val Ile Ser Asp Asn His Gln Ile Val Trp
Asp Leu 1 5 10 3112PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 31Leu
Thr Thr Gln Asp His Pro Leu Thr Ile Leu Leu 1 5
10 3216PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 32Gly Gly Trp Ile Cys His Trp Leu Glu Pro
Gln Glu Ala Cys Thr Tyr 1 5 10
15 3316PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 33Gly Gly Cys Phe Glu Glu His Glu Gln Leu
Val Phe Gln Thr His Cys 1 5 10
15 3416PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 34Gly Gly Cys Ile Leu Pro Gly Gln His Glu
Ser Gln Ala Ile Ala Cys 1 5 10
15 3516PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 35Gly Gly Cys Leu Ser Gln Met Asp Phe His
Asp Trp Leu Gln Tyr Cys 1 5 10
15 3616PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 36Gly Gly Thr Asp Cys Tyr Leu Trp Asp Tyr
Lys Ala Ser Cys His Gln 1 5 10
15 3716PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 37Gly Gly Lys Cys Asp Ser Leu Ser Tyr Trp
Gln Glu Ile Glu Cys Ser 1 5 10
15 3816PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 38Gly Gly Ala Asp Cys Leu Leu His Asp Trp
Asp Ser Ala Cys Gln Ile 1 5 10
15 3912PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 39Met Gln Asn Val Asp Glu Ala Pro Pro Leu
Leu Leu 1 5 10 4012PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 40Thr
Asn Asp Trp Gln Gly Leu Leu Leu Asn Val Phe 1 5
10 4114PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 41Gly Gly Cys Gln Asp Ser Met Phe His His
Pro Asn His Cys 1 5 10
4214PRTArtificial SequenceDescription of Artificial Sequence Synthetic
peptide 42Gly Gly Cys Gly Met His Gln His Pro Leu Phe Val Asp Cys 1
5 10 4314PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 43Gly
Gly Cys Ser Leu Ser Gln His Pro Asn His Ser Asp Cys 1 5
10 4414PRTArtificial SequenceDescription
of Artificial Sequence Synthetic peptide 44Gly Gly Pro Cys Asn Gln
Val Glu Cys His His Gln Phe Thr 1 5 10
4514PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 45Gly Gly Cys Pro Ser Leu His Pro Gln Trp
Ile His Val Cys 1 5 10
4614PRTArtificial SequenceDescription of Artificial Sequence Synthetic
peptide 46Gly Gly Cys Phe Asp Ser Ala Asn Gln His Pro Asn Met Cys 1
5 10 4714PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 47Gly
Gly Cys His Gln Asp Ile His His Pro Ile Tyr Trp Cys 1 5
10 4814PRTArtificial SequenceDescription
of Artificial Sequence Synthetic peptide 48Gly Gly Cys Gln Ile His
Asp Pro His Thr Trp His Leu Cys 1 5 10
4912PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 49Gln Leu Phe Tyr Pro Ser Thr Tyr His Ile
Ile Asp 1 5 10 5012PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 50Gln
Val Ser Pro Leu Tyr Phe Tyr Glu Glu Leu Ala 1 5
10 5111PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 51His Gln Ala Leu Leu Asp Phe Tyr Gly Asp
Tyr 1 5 10 5216PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 52Gly
Gly Met Cys His Glu Leu Phe Tyr Ser Asn Leu Asn Trp Cys Gln 1
5 10 15 5316PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 53Gly
Gly His Cys Val Asp Met Val Asp Phe Tyr Gln Gln Thr Cys Gln 1
5 10 15 5412PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 54Val
Asp Leu Leu Asp Gly Ser Leu Gln Asp Phe Tyr 1 5
10 5516PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 55Gly Gly Leu Cys Ser Thr Phe Tyr Glu Pro
Gln Val Asp Ile Cys Tyr 1 5 10
15 5612PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 56Ser Asp Phe Ser Gly Leu Leu Phe Tyr Asp
Tyr Gln 1 5 10 5714PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 57Gly
Gly Cys Val His Phe Phe His His Gln Arg Pro Asp Cys 1 5
10 5814PRTArtificial SequenceDescription
of Artificial Sequence Synthetic peptide 58Gly Gly Cys His Asn Lys
Ser Gly Leu Phe Tyr His Tyr Cys 1 5 10
5914PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 59Gly Gly Cys Phe Tyr Pro Gly His His His
Gln Leu Leu Cys 1 5 10
6026PRTArtificial SequenceDescription of Artificial Sequence Synthetic
peptide 60Gly Ser Ser Gly Gly Ser Gly Gly Ser Gly Gly Ser Gly Gly Gly
Ser 1 5 10 15 Gly
Gly Gly Ser Gly Gly Ser Ser Gly Thr 20 25
6112PRTArtificial SequenceDescription of Artificial Sequence Synthetic
peptide 61Pro Cys Asn Gln Val Glu Cys His His Gln Phe Thr 1
5 10 62219PRTMus sp. 62Asp Ile Val Met Thr
Gln Thr Thr Leu Ser Leu Pro Val Ser Leu Gly 1 5
10 15 Asp Gln Ala Ser Ile Ser Cys Arg Ser Ser
Gln Ser Ile Val His Ser 20 25
30 Asn Gly Asn Thr Tyr Leu Glu Trp Tyr Leu Gln Lys Pro Gly Gln
Ser 35 40 45 Pro
Lys Leu Leu Ile Tyr Lys Val Ser Asn Arg Phe Ser Gly Val Pro 50
55 60 Asp Arg Phe Ser Gly Ser
Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile 65 70
75 80 Ser Arg Val Glu Ala Glu Asp Leu Gly Val Tyr
Tyr Cys Phe Gln Gly 85 90
95 Ser His Val Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys
100 105 110 Arg Ala
Asp Ala Ala Pro Thr Val Ser Ile Phe Pro Pro Ser Ser Glu 115
120 125 Gln Leu Thr Ser Gly Gly Ala
Ser Val Val Cys Phe Leu Asn Asn Phe 130 135
140 Tyr Pro Lys Asp Ile Asn Val Lys Trp Lys Ile Asp
Gly Ser Glu Arg 145 150 155
160 Gln Asn Gly Val Leu Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp Ser
165 170 175 Thr Tyr Ser
Met Ser Ser Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu 180
185 190 Arg His Asn Ser Tyr Thr Cys Glu
Ala Thr His Lys Thr Ser Thr Ser 195 200
205 Pro Ile Val Lys Ser Phe Asn Arg Asn Glu Cys 210
215 63261PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
63Gly Gly Ala Asp Cys Leu Leu His Asp Trp Asp Ser Ala Cys Gln Ile 1
5 10 15 Gly Ser Ser Gly
Gly Ser Gly Gly Ser Gly Gly Ser Gly Gly Gly Ser 20
25 30 Gly Gly Gly Ser Gly Gly Ser Ser Gly
Thr Asp Ile Val Met Thr Gln 35 40
45 Thr Thr Leu Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser
Ile Ser 50 55 60
Cys Arg Ser Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu 65
70 75 80 Glu Trp Tyr Leu Gln
Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr 85
90 95 Lys Val Ser Asn Arg Phe Ser Gly Val Pro
Asp Arg Phe Ser Gly Ser 100 105
110 Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala
Glu 115 120 125 Asp
Leu Gly Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr 130
135 140 Phe Gly Gly Gly Thr Lys
Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro 145 150
155 160 Thr Val Ser Ile Phe Pro Pro Ser Ser Glu Gln
Leu Thr Ser Gly Gly 165 170
175 Ala Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn
180 185 190 Val Lys
Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn 195
200 205 Ser Trp Thr Asp Gln Asp Ser
Lys Asp Ser Thr Tyr Ser Met Ser Ser 210 215
220 Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His
Asn Ser Tyr Thr 225 230 235
240 Cys Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe
245 250 255 Asn Arg Asn
Glu Cys 260 64259PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 64Gly Gly Cys Gln Asp Ser
Met Phe His His Pro Asn His Cys Gly Ser 1 5
10 15 Ser Gly Gly Ser Gly Gly Ser Gly Gly Ser Gly
Gly Gly Ser Gly Gly 20 25
30 Gly Ser Gly Gly Ser Ser Gly Thr Asp Ile Val Met Thr Gln Thr
Thr 35 40 45 Leu
Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser Cys Arg 50
55 60 Ser Ser Gln Ser Ile Val
His Ser Asn Gly Asn Thr Tyr Leu Glu Trp 65 70
75 80 Tyr Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu
Leu Ile Tyr Lys Val 85 90
95 Ser Asn Arg Phe Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser
100 105 110 Gly Thr
Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Leu 115
120 125 Gly Val Tyr Tyr Cys Phe Gln
Gly Ser His Val Pro Tyr Thr Phe Gly 130 135
140 Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala
Ala Pro Thr Val 145 150 155
160 Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser
165 170 175 Val Val Cys
Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys 180
185 190 Trp Lys Ile Asp Gly Ser Glu Arg
Gln Asn Gly Val Leu Asn Ser Trp 195 200
205 Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser
Ser Thr Leu 210 215 220
Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu 225
230 235 240 Ala Thr His Lys
Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg 245
250 255 Asn Glu Cys 65259PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
65Gly Gly Cys Ser Leu Ser Gln His Pro Asn His Ser Asp Cys Gly Ser 1
5 10 15 Ser Gly Gly Ser
Gly Gly Ser Gly Gly Ser Gly Gly Gly Ser Gly Gly 20
25 30 Gly Ser Gly Gly Ser Ser Gly Thr Asp
Ile Val Met Thr Gln Thr Thr 35 40
45 Leu Ser Leu Pro Val Ser Leu Gly Asp Gln Ala Ser Ile Ser
Cys Arg 50 55 60
Ser Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr Leu Glu Trp 65
70 75 80 Tyr Leu Gln Lys Pro
Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val 85
90 95 Ser Asn Arg Phe Ser Gly Val Pro Asp Arg
Phe Ser Gly Ser Gly Ser 100 105
110 Gly Thr Asp Phe Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp
Leu 115 120 125 Gly
Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr Phe Gly 130
135 140 Gly Gly Thr Lys Leu Glu
Ile Lys Arg Ala Asp Ala Ala Pro Thr Val 145 150
155 160 Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr
Ser Gly Gly Ala Ser 165 170
175 Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn Val Lys
180 185 190 Trp Lys
Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser Trp 195
200 205 Thr Asp Gln Asp Ser Lys Asp
Ser Thr Tyr Ser Met Ser Ser Thr Leu 210 215
220 Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser
Tyr Thr Cys Glu 225 230 235
240 Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser Phe Asn Arg
245 250 255 Asn Glu Cys
66259PRTArtificial SequenceDescription of Artificial Sequence Synthetic
polypeptide 66Gly Gly Pro Cys Asn Gln Val Glu Cys His His Gln Phe Thr
Gly Ser 1 5 10 15
Ser Gly Gly Ser Gly Gly Ser Gly Gly Ser Gly Gly Gly Ser Gly Gly
20 25 30 Gly Ser Gly Gly Ser
Ser Gly Thr Asp Ile Val Met Thr Gln Thr Thr 35
40 45 Leu Ser Leu Pro Val Ser Leu Gly Asp
Gln Ala Ser Ile Ser Cys Arg 50 55
60 Ser Ser Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr
Leu Glu Trp 65 70 75
80 Tyr Leu Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile Tyr Lys Val
85 90 95 Ser Asn Arg Phe
Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser 100
105 110 Gly Thr Asp Phe Thr Leu Lys Ile Ser
Arg Val Glu Ala Glu Asp Leu 115 120
125 Gly Val Tyr Tyr Cys Phe Gln Gly Ser His Val Pro Tyr Thr
Phe Gly 130 135 140
Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Asp Ala Ala Pro Thr Val 145
150 155 160 Ser Ile Phe Pro Pro
Ser Ser Glu Gln Leu Thr Ser Gly Gly Ala Ser 165
170 175 Val Val Cys Phe Leu Asn Asn Phe Tyr Pro
Lys Asp Ile Asn Val Lys 180 185
190 Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn Ser
Trp 195 200 205 Thr
Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser Thr Leu 210
215 220 Thr Leu Thr Lys Asp Glu
Tyr Glu Arg His Asn Ser Tyr Thr Cys Glu 225 230
235 240 Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val
Lys Ser Phe Asn Arg 245 250
255 Asn Glu Cys 67453PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 67Glu Ala Lys Leu Gln Glu
Ser Gly Pro Val Leu Val Lys Pro Gly Ala 1 5
10 15 Ser Val Lys Met Ser Cys Lys Ala Ser Gly Tyr
Thr Phe Thr Asp Tyr 20 25
30 Tyr Met Asn Trp Val Lys Gln Ser His Gly Lys Ser Leu Glu Trp
Ile 35 40 45 Gly
Val Ile Asn Pro Tyr Asn Gly Asp Thr Ser Tyr Asn Gln Lys Phe 50
55 60 Lys Gly Lys Ala Thr Leu
Thr Val Asp Lys Ser Ser Ser Thr Ala Tyr 65 70
75 80 Met Glu Leu Asn Ser Leu Thr Ser Glu Asp Ser
Ala Val Tyr Tyr Cys 85 90
95 Ala Arg Tyr Tyr Gly Ser Trp Phe Ala Tyr Trp Gly Gln Gly Thr Leu
100 105 110 Ile Thr
Val Ser Thr Ala Lys Thr Thr Pro Pro Ser Val Tyr Pro Leu 115
120 125 Ala Pro Gly Cys Gly Asp Thr
Thr Gly Ser Ser Val Thr Leu Gly Cys 130 135
140 Leu Val Lys Gly Tyr Phe Pro Glu Ser Val Thr Val
Thr Trp Asn Ser 145 150 155
160 Gly Ser Leu Ser Ser Ser Val His Thr Phe Pro Ala Leu Leu Gln Ser
165 170 175 Gly Leu Tyr
Thr Met Ser Ser Ser Val Thr Val Pro Ser Ser Thr Trp 180
185 190 Pro Ser Gln Thr Val Thr Cys Ser
Val Ala His Pro Ala Ser Ser Thr 195 200
205 Thr Val Asp Lys Lys Leu Glu Pro Ser Gly Pro Ile Ser
Thr Ile Asn 210 215 220
Pro Cys Pro Pro Cys Lys Glu Cys His Lys Cys Pro Ala Pro Asn Leu 225
230 235 240 Glu Gly Gly Pro
Ser Val Phe Ile Phe Pro Pro Asn Ile Lys Asp Val 245
250 255 Leu Met Ile Ser Leu Thr Pro Lys Val
Thr Cys Val Val Val Asp Val 260 265
270 Ser Glu Asp Asp Pro Asp Val Arg Ile Ser Trp Phe Val Asn
Asn Val 275 280 285
Glu Val His Thr Ala Gln Thr Gln Thr His Arg Glu Asp Tyr Asn Ser 290
295 300 Thr Ile Arg Val Val
Ser Ala Leu Pro Ile Gln His Gln Asp Trp Met 305 310
315 320 Ser Gly Lys Glu Phe Lys Cys Lys Val Asn
Asn Lys Asp Leu Pro Ser 325 330
335 Pro Ile Glu Arg Thr Ile Ser Lys Ile Lys Gly Leu Val Arg Ala
Pro 340 345 350 Gln
Val Tyr Ile Leu Pro Pro Pro Ala Glu Gln Leu Ser Arg Lys Asp 355
360 365 Val Ser Leu Thr Cys Leu
Val Val Gly Phe Asn Pro Gly Asp Ile Ser 370 375
380 Val Glu Trp Thr Ser Asn Gly His Thr Glu Glu
Asn Tyr Lys Asp Thr 385 390 395
400 Ala Pro Val Leu Asp Ser Asp Gly Ser Tyr Phe Ile Tyr Ser Lys Leu
405 410 415 Asp Ile
Lys Thr Ser Lys Trp Glu Lys Thr Asp Ser Phe Ser Cys Asn 420
425 430 Val Arg His Glu Gly Leu Lys
Asn Tyr Tyr Leu Lys Lys Thr Ile Ser 435 440
445 Arg Ser Pro Gly Lys 450
68214PRTArtificial SequenceDescription of Artificial Sequence Synthetic
polypeptide 68Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser
Val Gly 1 5 10 15
Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Asp Val Ser Thr Ala
20 25 30 Val Ala Trp Tyr Gln
Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35
40 45 Tyr Ser Ala Ser Phe Leu Tyr Ser Gly
Val Pro Ser Arg Phe Ser Gly 50 55
60 Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser
Leu Gln Pro 65 70 75
80 Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Leu Tyr His Pro Ala
85 90 95 Thr Phe Gly Gln
Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala 100
105 110 Pro Ser Val Phe Ile Phe Pro Pro Ser
Asp Glu Gln Leu Lys Ser Gly 115 120
125 Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg
Glu Ala 130 135 140
Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln 145
150 155 160 Glu Ser Val Thr Glu
Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser 165
170 175 Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr
Glu Lys His Lys Val Tyr 180 185
190 Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys
Ser 195 200 205 Phe
Asn Arg Gly Glu Cys 210 69256PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
69Gly Gly His Cys Val Asp Met Val Asp Phe Tyr Gln Gln Thr Cys Gln 1
5 10 15 Gly Ser Ser Gly
Gly Ser Gly Gly Ser Gly Gly Ser Gly Gly Gly Ser 20
25 30 Gly Gly Gly Ser Gly Gly Ser Ser Gly
Thr Asp Ile Gln Met Thr Gln 35 40
45 Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr
Ile Thr 50 55 60
Cys Arg Ala Ser Gln Asp Val Ser Thr Ala Val Ala Trp Tyr Gln Gln 65
70 75 80 Lys Pro Gly Lys Ala
Pro Lys Leu Leu Ile Tyr Ser Ala Ser Phe Leu 85
90 95 Tyr Ser Gly Val Pro Ser Arg Phe Ser Gly
Ser Gly Ser Gly Thr Asp 100 105
110 Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr
Tyr 115 120 125 Tyr
Cys Gln Gln Tyr Leu Tyr His Pro Ala Thr Phe Gly Gln Gly Thr 130
135 140 Lys Val Glu Ile Lys Arg
Thr Val Ala Ala Pro Ser Val Phe Ile Phe 145 150
155 160 Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr
Ala Ser Val Val Cys 165 170
175 Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val
180 185 190 Asp Asn
Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln 195
200 205 Asp Ser Lys Asp Ser Thr Tyr
Ser Leu Ser Ser Thr Leu Thr Leu Ser 210 215
220 Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys
Glu Val Thr His 225 230 235
240 Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys
245 250 255
70448PRTArtificial SequenceDescription of Artificial Sequence Synthetic
polypeptide 70Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro
Gly Gly 1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asp Ser
20 25 30 Trp Ile His Trp Val
Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35
40 45 Ala Trp Ile Ser Pro Tyr Gly Gly Ser
Thr Tyr Tyr Ala Asp Ser Val 50 55
60 Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn
Thr Ala Tyr 65 70 75
80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95 Ala Arg Arg His
Trp Pro Gly Gly Phe Asp Tyr Trp Gly Gln Gly Thr 100
105 110 Leu Val Thr Val Ser Ser Ala Ser Thr
Lys Gly Pro Ser Val Phe Pro 115 120
125 Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala
Leu Gly 130 135 140
Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn 145
150 155 160 Ser Gly Ala Leu Thr
Ser Gly Val His Thr Phe Pro Ala Val Leu Gln 165
170 175 Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val
Val Thr Val Pro Ser Ser 180 185
190 Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro
Ser 195 200 205 Asn
Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr 210
215 220 His Thr Cys Pro Pro Cys
Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser 225 230
235 240 Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr
Leu Met Ile Ser Arg 245 250
255 Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro
260 265 270 Glu Val
Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala 275
280 285 Lys Thr Lys Pro Arg Glu Glu
Gln Tyr Ala Ser Thr Tyr Arg Val Val 290 295
300 Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn
Gly Lys Glu Tyr 305 310 315
320 Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr
325 330 335 Ile Ser Lys
Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu 340
345 350 Pro Pro Ser Arg Glu Glu Met Thr
Lys Asn Gln Val Ser Leu Thr Cys 355 360
365 Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu
Trp Glu Ser 370 375 380
Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp 385
390 395 400 Ser Asp Gly Ser
Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser 405
410 415 Arg Trp Gln Gln Gly Asn Val Phe Ser
Cys Ser Val Met His Glu Ala 420 425
430 Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro
Gly Lys 435 440 445
User Contributions:
Comment about this patent or add new information about this topic: