CLL1-SPECIFIC MULTI-CHAIN CHIMERIC ANTIGEN RECEPTOR

Abstract

The present invention relates to a new generation of chimeric antigen receptors (CAR) referred to as multi-chain CARs, which are made specific to the antigen CLL1. Such CARs aim to redirect immune cell specificity and reactivity toward malignant cells expressing the tumor antigen CLL1. The alpha, beta and gamma polypeptides composing these CARs are designed to assemble in juxtamembrane position, which forms flexible architecture closer to natural receptors, that confers optimal signal transduction. The invention encompasses the polynucleotides, vectors encoding said multi-chain CAR and the isolated cells expressing them at their surface, in particularly for their use in immunotherapy. The invention opens the way to efficient adoptive immunotherapy strategies for treating cancer, especially leukemia.

Description

FIELD OF THE INVENTION

[0001] The present invention relates to a new generation of chimeric antigen receptors (CAR) referred to as multi-chain CARs, which are made specific to the antigen CLL1. Such CARs aim to redirect immune cell specificity and reactivity toward malignant cells expressing the tumor antigen CLL1. The polypeptides composing these CARs are designed to assemble in juxtamembrane position, which forms flexible architecture closer to natural receptors, that confers tunable signal transduction. The invention encompasses the polynucleotides, vectors encoding said multi-chain CAR and the isolated cells resulting from their heterologous expression in immune cells, in particularly for their use in immunotherapy. The invention opens the way to efficient adoptive immunotherapy strategies for treating cancer, especially acute myeloid leukemia (AML).

BACKGROUND OF THE INVENTION

[0002] Adoptive immunotherapy, which involves the transfer of antigen-specific T cells generated ex vivo, is a promising strategy to treat viral infections and cancer. The T cells used for adoptive immunotherapy can be generated either by expansion of antigen-specific T cells or redirection of T cells through genetic engineering (Park, Rosenberg et al. (2011) Treating Cancer with Genetically Engineered T Cells. Trends Biotechnol. 29(11): 550-557) Transfer of viral antigen specific T cells is a well-established procedure used for the treatment of transplant associated viral infections and rare viral-related malignancies. Similarly, isolation and transfer of tumor specific T cells has been shown to be successful in treating melanoma.

[0003] Novel specificities in T cells have been successfully generated through the genetic transfer of transgenic T cell receptors or chimeric antigen receptors (CARs) (Jena, Dotti et al. (2010) Redirecting T-cell specificity by introducing a tumor-specific chimeric antigen receptor. Blood. 116(7): 1035-1044). CARs are synthetic receptors consisting of a targeting moiety that is associated with one or more signaling domains to form a single-chain fusion molecule. However, this approach has so far proven efficiency only with respect to patients with acute lymphoblastic leukemia (ALL) by targeting malignant B cells bearing the antigen CD19 (Porter, D. L. et al. (2011) Chimeric Antigen Receptor-Modified T Cells in Chronic Lymphoid Leukemia. N. Engl. J. Med. 365:725-733).

[0004] Induction treatments for acute myeloid leukemia (AML) have remained largely unchanged for nearly 50 years and AML remains a disease of poor prognosis. Acute myeloid leukemia (AML) is a disease characterized by the rapid proliferation of immature myeloid cells in the bone marrow resulting in dysfunctional hematopoiesis. Although standard induction chemotherapy can induce complete remissions, many patients eventually relapse and succumb to the disease, calling for the development of novel therapeutics for AML.

[0005] Meanwhile, induction treatments for acute myeloid leukemia (AML) have remained largely unchanged for nearly 50 years and AML remains a disease of poor prognosis. AML is a disease characterized by the rapid proliferation of immature myeloid cells in the bone marrow resulting in dysfunctional hematopoiesis. Although standard induction chemotherapy can induce complete remissions, many patients eventually relapse and succumb to the disease, calling for the development of novel therapeutics for AML. Recent advances in the immunophenotyping of AML cells have revealed several AML associated cell surface antigens that may act as targets for future therapies.

[0006] Among others, CLL1 (C-Type Lectin-Like Molecule-1) appears to be an interesting tumoral antigen target as it is expressed by leukemic blasts at diagnosis from 85-92% of AML patients analysed It is a 75 kDa member of the group V C-type lectin-like receptor family of molecules. Group V molecules have a lectin-like domain that binds to non-sugar ligands. CLL1 is a 265 aminoacid type II transmembrane glycoprotein (Uniprot database: Q5QGZ9 for human protein encoded by gene n.degree. 160364 in "Entrez Gene" database) that contains a 200 AA extracellular domain. CLL1 is also referred to in the literature and databases as MICL, CLEC12 and KLRL1.

[0007] Bakker et al, 2004 has shown that the CLL1 antigen is associated with AML stem cells. Like some other antigens (such as CD33), CLL1 is a cell surface protein that is specifically expressed on most malignant lymphoid stem cells (AML LSC), while not being expressed on normal HSC (Van Rhenen et al, 2007). Meanwhile, CLL1 was revealed to be a diagnostic marker in AML (Larsen et al, 2012). Anti-CLL-1 antibodies enable both AML-specific stem-cell detection and possibly antigen-targeting as distinguishing malignant cells from normal stem cells both at diagnosis and in remission (van Rhenen et al, 2007). However, none of these antibodies have been reported to date as being tested in clinical trials as therapeutic antibodies.

[0008] Monoclonal antibodies have often been used to treat lymphomas, but their use in leukemias has been more limited. Gemtuzumab ozogamicin (Mylotarg.RTM.) is a monoclonal antibody with a cell poison attached to it. Previously approved to treat AML in older patients, it was withdrawn from the market after studies found some toxicity associated with the product (press release of Dec. 10, 2010 in PMLIVE "ASH: Pfizer eyes re-launch of Mylotarg"). Other monoclonal therapeutic antibodies have shown adverse effects over the last decade (Klastersky, J. (2006) "Adverse effects of the humanized antibodies used as cancer therapeutics" Current Opinion in Oncology. 18(4):316-320)

[0009] In the publication of Zhang et al (2011), micellar nanoparticles covalently decorated with CLL1-targeting peptides have been described for targeted drug delivery (daunorubicin); these "targeting nanomicelles" transport the drug load to the interior of cells expressing CLL1 and to LSCs isolated from clinical specimens in vitro. It was showed that CLL1-targeting nanomicelles had the potential to be used for targeted drug delivery to leukemia stem cells. However, no therapeutic effects could be attributed to the CCL-1 targeting peptide per se.

[0010] In view of the above, the inventors have pursued a new approach to target CCL1 using immune cells endowed with specific chimeric antigen receptors based on anti-CLL1 monoclonal antibodies, which redirect immune cell specificity towards CLL1 positive cells

[0011] In the context of developing therapeutic grade engineered immune cells that can target malignant or infected cells, the inventors have sought for improved CAR architectures, which would be closer to natural ones and likely to behave accordingly using any extracellular mono or multi-specific ligand binding domains. In WO2014039523, they described a new generation of CARs involving separate polypeptide sub-units according to the present invention, referred to as "multi-chain CARs". According to this architecture, the signaling domains and co-stimulatory domains are located on different polypeptide chains. Such multi-chain CARs can be derived from Fc.epsilon.RI (see FIG. 1), by replacing the high affinity IgE binding domain of Fc.epsilon.RI alpha chain by an extracellular ligand-binding domain such as scFv, whereas the N and/or C-termini tails of Fc.epsilon.RI beta and/or gamma chains are fused to signal transducing domains and co-stimulatory domains respectively. The extracellular ligand binding domain has the role of redirecting T-cell specificity towards cell targets, while the signal transducing domains activate the immune cell response. The fact that the different polypeptides derived from the alpha, beta and gamma polypeptides from Fc.epsilon.RI are transmembrane polypeptides sitting in juxtamembrane position provides a more flexible architecture to CARs, improving specificity towards the targeted molecule and reducing background activation of immune cells.

[0012] The inventors have now designed multi-chain CAR bearing scFv extracellular domain binding CLL1, which are particularly suited to target malignant cells bearing CLL1 as a marker. This was achieved, whereas very few antibodies had been so far described to act efficiently against CLL1 positive cells for treating or preventing leukemia, in particular AML.

[0013] For the purposes of the invention, inventors have now provided T cells expressing anti-CLL1 multi chain CARS. Due to the design and architecture of these new anti-CLL1 CARs and to the properties of the present engineered immune cells, the kinetic of action and activity of engineered immune cells is unexpectedly modified so that less tumor cells may escape and long term effect is observed with reduced GVHD and side effects.

[0014] These original CARs specifically bind to and affect the survival of CLL1 positive T cells, in particular to malignant CLL1 positive cells developing during AML and selectively alter the viability of these malignant cells, with an expectation of displaying less toxic side effects including cytokine release. Moreover, the present invention provides with engineered allogeneic immune cells that may be used as "off-the-shelf" allogeneic therapeutic products. As a further advantage of the invention, the CAR positive engineered cells can be made compatible (i.e. resistant) with chemotherapy or immunodepleting treatments, thereby enabling synergistic effects between chemotherapy and immunotherapy.

SUMMARY OF THE INVENTION

[0015] The inventors have generated CLL1 specific multi-chain (mcCAR) having different design and comprising different scFV derived from anti-CLL1 specific antibodies. Said multi-chain CARs are preferably based on the alpha, beta and gamma polypeptides from Fc.epsilon.RI as detailed herein.

[0016] In particular, The Inventors have developed anti-CLL1 specific multi-chain CAR (mcCAR) comprising VL and VL chains derived from SC02-357, SC02-378, SC02-161, M26, M31, G4, M22, M29, M2, M5, G12, 21.26 and 1075.7 antibodies, with different architectures and identified highly specific and very selective mcCARs constructions that bind to CLL1 expressing cells and selectively destroy CLL1 expressing cancer cells.

[0017] Following non-specific activation in vitro (e.g. with anti CD3/CD28 coated beads and recombinant IL2), primary T-cells from donors have been transformed with polynucleotides expressing these mcCARs using viral transduction. In certain instances, the T-cells were further engineered to create less or non-alloreactive T-cells, more especially by disruption of a component of TCR (.alpha..beta.-T-Cell receptors) to prevent Graft versus host reaction.

[0018] Immune-cells endowed with CLL1 specific CARs according to the invention may be further engineered to create T cells resistant to anti-cancer drugs, to be used in combination or sequentially with said classical anti-cancer drugs.

[0019] The resulting engineered T-cells displayed reactivity in-vitro against CLL1 positive cells to various extend, showing that the mcCARs of the present invention contribute to antigen dependent activation, and also proliferation, of the T-cells, making them useful for immunotherapy.

[0020] The resulting engineered T-cells displayed reactivity in-vivo against CLL1 positive cells and significantly reduce the number of cancer cells in vivo.

[0021] The engineered T-cells of the invention are designed to display in-vivo reactivity against CLL1 positive cells, can be used in concomitance with anti-cancer drugs, are well tolerated. In a particular embodiment, the engineered T-cells of the invention remain efficient even after several administrations, making them useful for immunotherapy as a first treatment (induction), as a consolidation treatment, as a treatment in combination with classical anticancer chemotherapy. The polypeptides and polynucleotide sequences encoding the CARs of the present invention are detailed in the present specification.

[0022] According to a further aspect, the CLL1 specific CARs of the present invention comprises at least one epitope tagging sequence such as a CD20 mimotope, allowing a depletion of said immune cells by the use of antibodies against such epitope, to modulate the immune response of the CAR positive cells (i.e occurrence of adverse effect during their use in immunotherapy such as acytokine storm). Preferably, said at least one epitope is inserted in the extracellular ligand binding domain of the CAR, more preferably on the alpha chain of the multi-chain CAR exemplified herein.

[0023] The engineered immune cells of the present invention are particularly useful for therapeutic applications such as acute myeloma leukemia (AML) treatments.

DESCRIPTION OF THE FIGURES

[0024] FIG. 1: Schematic representation of the native Fc.epsilon.RI from which derivate the multi-chain CAR architecture according to the invention.

[0025] FIG. 2: General structure of the polycistronic construct encoding the CLL1 multi-chain CAR according to the invention.

[0026] FIG. 3: Different architectures of the CLL1 specific multi-chain CAR according to the invention. From left to right: polypeptide gamma (fused to ITAM of CD3zeta), polypeptide alpha (fused to ScFv), polypeptide beta (fused to co-stimulatory domain from either CD28 or 41BB). A and B: polypeptide beta is fused to co-stimulatory domain from 41BB, VL and VH fragments being in opposite orders. C and D: polypeptide beta is fused to co-stimulatory domain from CD28, VL and VH fragments being in opposite orders.

[0027] In FIG. 3 C, and in FIG. 4, VL and VH fragments are in opposite order as compared to construction in FIG. 3D. In FIG. 3C and in FIG. 4, the VL fragment of the extracellular CLL1 ligand binding domain is fused to a transmembrane polypeptide from the alpha chain of high-affinity IgE receptor (Fc.epsilon.RI), more precisely to a peptide comprising a CD8 fragment and a fragment of the alpha chain of high-affinity IgE receptor (Fc.epsilon.RI).

[0028] FIG. 4: Two architectures of the CLL1 specific multi-chain CAR according to the invention (mcCLL1-41BB and mcCLL1-CD28) wherein the alpha fragment comprises a VL fragment is linked to a polypeptide comprising a CD8 fragment and to a VH fragment, and the beta chain comprises a co-stimulatory domain located in the C-terminus of the beta chain, said co-stimulatory domain is from 41BB (mcCLL1-41BB) or from CD28 (mcCLL1-CD28).

[0029] FIGS. 5A and 5B: Schematic representation of different strategies based mAb-epitope tagging using for instance the CD20 mimotope for T cell depletion designed to mitigate possible side effects associated with CAR positive cells injection: V1 and v2 represents either VH or VL chain respectively, TM: transmembrane domain, L: linker.

[0030] (A) extracellular anti-CLL1 ligand binding domain part of the multi-chain architecture according to the present invention, which does not include an epitope tagging sequence for sorting or depleting cells; V1: anti-CLL1 monoclonal antibody VH; L: GS linker; V2: anti-CLL1 monoclonal antibody VH; Hinge: preferably CD8 hinge; TM: preferably Fc.epsilon.RI.gamma.-TM-IC.

[0031] (B) extracellular anti-CLL1 domain of the multi-chain architectures according to the invention including at least one epitope inserted in the extracellular ligand binding domain of the CAR, wherein said epitope is inserted between the VH and VL chains; said epitope being bordered by different linkers;

[0032] (C): both architectures presented here correspond to examples where two epitopes are inserted in the extracellular ligand binding domain of the CAR, one is inserted between the N-terminal end of the CAR and the VH chain, said epitope being bordered by at least one or two linkers; the second epitope is inserted between the VH and VL chains, said 2.sup.nd epitope being also bordered by 2 at least one or two linkers. The architectures illustrated herein differ by the linkers used bordering the 2.sup.nd epitope.

[0033] (D): both architectures presented here correspond to examples where two epitopes are inserted in the extracellular ligand binding domain of the CAR, one is inserted between the VH and VL chains; the other epitope is inserted between the VL chain and the hinge, each said epitope being also bordered by at least one or two linkers. The architectures illustrated herein differ by the linkers used bordering the 1.sup.st epitope.

[0034] (E): one architecture is presented where two epitopes are inserted in the extracellular domain of the CAR, one is inserted between the N-terminal end of the CAR and the VH chain, said epitope being bordered by at least one or two linkers; the second epitope is inserted between the VL chain and the hinge, said 2.sup.nd epitope being also bordered by such linkers.

[0035] (F): both architectures presented here correspond to examples, where three epitopes are inserted in the extracellular domain of the CAR, one is inserted between the N-terminal end of the CAR and the VH chain, said epitope being bordered by at least one or two linkers; the second epitope is inserted between the VH and VL chains, said epitope being also bordered by such linkers, and the third epitope being inserted between the VL chain et the hinge. These two architectures differ by the linkers used bordering the 2.sup.nd epitope.

[0036] (G): extracellular anti-CLL1 domains of the multi-chain architectures according to the invention, where at least two epitopes (preferably CD20 epitopes) are inserted in the extracellular ligand binding domain between the hinge and the anti CLL1 VH and VL chains. In the third exemplary architecture, one CD34 epitope is included between two CD20 epitopes. Further architectures can be considered where CD34 replaces any other previous CD20 epitopes.

[0037] (H): extracellular anti-CLL1 domains of the multi-chain architectures according to the invention, where at least two epitopes are inserted at the extremity of in the extracellular ligand binding domain.

TABLE-US-00001 TABLE 1 Exemplary sequences of the alpha polypeptide component of CLL1 multi-chain CAR Functional domains description SEQ ID # Raw amino acid sequence Fc.epsilon.Rl.gamma.-SP signal peptide SEQ ID NO. 1 MAPAMESPTLLCVALLFFAPDGV LA CD8.alpha.hinge hinge SEQ ID NO. 2 TTTPAPRPPTPAPTIASQPLSLRPE ACRPAAGGAVHTRGLDFACD VH See Table 5 G45X3Linker Linker VH-VL SEQ ID NO. 3 GGGGSGGGGSGGGGS VL See Table 5 Fc.epsilon.Rl.gamma.-TM-IC Fc Receptor for IgE, SEQ ID NO. 4 FFIPLLVVILFAVDTGLFISTQQQVT alpha chain, FLLKIKRTRKGFRLLNPHPKPNPKN transmembrane and N intracellular domain

TABLE-US-00002 TABLE 2 Exemplary sequences of the beta polypeptide component of CLL1 multi-chain CAR Functional domains description SEQ ID # Raw amino acid sequence Fc.epsilon.Rl.gamma.-.DELTA.ITAM Fc Receptor for IgE, SEQ ID NO. 5 MDTESNRRANLALPQEPSSVPAF beta chain, without EVLEISPQEVSSGRLLKSASSPPLH ITAM TWLTVLKKEQEFLGVTQILTAMIC LCFGTVVCSVLDISHIEGDIFSSFKA GYPFWGAIFFSISGMLSIISERRNA TYLVRGSLGANTASSIAGGTGITILI INLKKSLAYIHIHSCQKFFETKCFM ASFSTEIVVMMLFLTILGLGSAVSL TICGAGEELKGNKVPE 41BB IC 41BB co-stimulatory SEQ ID NO. 6 KRGRKKLLYIFKQPFMRPVQTTQE domain EDGCSCRFPEEEEGGCEL CD28-IC CD28 co-stimulatory SEQ ID NO. 7 RSKRSRGGHSDYMNMTPRRPGP domain TRKHYQPYAPPRDFAAYRS

TABLE-US-00003 TABLE 3 Exemplary sequences of the gamma polypeptide component of CLL1 multi-chain CAR Functional domains description SEQ ID # Raw amino acid sequence Fc.epsilon.Rl.gamma.-SP signal peptide SEQ ID NO. 8 MIPAVVLLLLLLVEQAAA Fc.epsilon. Rl.gamma.-.DELTA.ITAM Fc Receptor for IgE, SEQ ID NO. 9 LGEPQLCYILDAILFLYGIVLTLLYCR gamma chain, without LKIQVRKAAITSYEKS ITAM CD3zeta SEQ ID NO. 10 RVKFSRSADAPAYQQGQNQLYN CD3-IC intracellular domain ELNLGRREEYDVLDKRRGRDPEM comprising ITAM GGKPRRKNPQEGLYNELQKDKM AEAYSEIGMKGERRRGKGHDGLY QGLSTATKDTYDALHMQALPPR

TABLE-US-00004 TABLE 4 skip peptides linking the polypeptides forming the multi-subunit CAR Functional domains description SEQ ID # Raw amino acid sequence GSG-P2A GSG-P2A ribosomal SEQ ID NO. 11 GSGATNFSLLKQAGDVEENPGP skip peptide GSG-T2A GSG-T2A ribosomal SEQ ID NO. 12 GSGEGRGSLLTCGDVEENPGP skip peptide

TABLE-US-00005 TABLE 5 Sequence of variable regions of exemplary anti-CLL1 VH and VL chains, and their respective CDRs ScFv sequences SEQ ID # Raw amino acid sequence SC02-357 heavy SEQ ID NO. 13 QVQLQESGPGLVKPSETLSLTCVVSGGSISSSNWWSWVRQPPGKGLE chain variable WIGEIYHSGSPNYNPSLKSRVTISVDKSKNQFSLKLSSVTAADTAVYYSSS region GGFFDYWGQGTLVTVSS CDR1 SEQ ID NO. 37 GSISSSNWWS CDR2 SEQ ID NO. 38 WIGEIYHSGSPDY CDR3 SEQ ID NO. 39 KVSTGGFFDY SC02-378 heavy SEQ ID NO. 14 QVQLQESGPGLVKPSETLSLTCVVSGGSISSSNWWSWVRQPPGKGLE chain variable WIGEIYHSGSPNYNPSLKSRVTISVDKSKNQFSLKLSSVTAADTAVYYCAR region SSSGGFFDYWGQGTLVTVSS CDR1 SEQ ID NO. 40 GSISSSNWWS CDR2 SEQ ID NO. 41 WIGEIYHSGSPNY CDR3 SEQ ID NO. 42 RSSSGGFFDY SC02-161 heavy SEQ ID NO. 15 QVQLQESGPGLVKPSETLSLTCVVSGGSISSSNWWSWVRQPPGKGLE chain variable WIGEIYHSGSPNYNPSLKSRVTISVDKSKNQFSLKLSSVTAADTAVYYCAR region QTTAGSFDYWGQGTLVTVSS CDR1 SEQ ID NO. 43 GSISSSNWWS CDR2 SEQ ID NO. 44 WIGEIYHSGSPNY CDR3 SEQ ID NO. 45 RQTTAGSFDY SC02-357 & SC02- SEQ ID NO. 16 DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYA 378 & SC02-161 ASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTPPTFGQG light chain variable TKVEIK region CDR1 SEQ ID NO. 46 QSISSYLN CDR2 SEQ ID NO. 47 LLIYAASSLQS CDR3 SEQ ID NO. 48 QQSYSTPP M26 heavy chain SEQ ID NO. 17 EVQLQQSGPELVKPGASVKMSCKASGYTFTSYFIHWVKQKPGQGLEWI variable region GFINPYNDGSKYNEKFKGKATLTSDKSSSTAYMELSSLTSEDSAVYYCTRD DGYYGYAMDYWGQGTSVTVSS CDR1 SEQ ID NO. 49 GYTFTSYFIH CDR2 SEQ ID NO. 50 WIGFINPYNDGSKY CDR3 SEQ ID NO. 51 TRDDGYYGYAMDY M26 light chain SEQ ID NO. 18 DIQMTQSPSSLSASLGERVSLTCRATQELSGYLSWLQQKPDGTIKRLIYA variable region ASTLDSGVPKRFSGNRSGSDYSLTISSLESEDFADYYCLQYAIYPYTFGGG TKLEIKR CDR1 SEQ ID NO. 52 QELSGYLS CDR2 SEQ ID NO. 53 RLIYAASTLDS CDR3 SEQ ID NO. 54 LQYAIYPY M31 heavy chain SEQ ID NO. 19 EVQLQQSGPELVKPGASVKMSCKASGYTFTSYVMHWVKQKPGQGLE variable region WIGYINPYNDGTKYNEKFKGKATLTSDTSSSTAYMELNSLTSEDSAVYFC ARPIYFDNDYFDYWGQGTTLKVSS CDR1 SEQ ID NO. 55 GYTFTSYVMH CDR2 SEQ ID NO. 56 WIGYINPYNDGTKY CDR3 SEQ ID NO. 57 ARPIYFDNDY M31 light chain SEQ ID NO. 20 TIVLTQSPASLAVSLGQRATISCRASESVDSYGNSFMHWYQQKPGQPPK variable region LLIYLASNLESGVPARFSGSGSRTDFTLTIDPVEADDAATYYCQQNNYDP WTFGGGTKLEIK CDR1 SEQ ID NO. 58 ESVDSYGNSFMH CDR2 SEQ ID NO. 59 LLIYLASNLES CDR3 SEQ ID NO. 60 QQNNYDPW G4 heavy chain SEQ ID NO. 21 EVQLQQSGPELVKPGASMKISCKASGYSFTGYTMNWVKQSHEKNLEW1 variable region GPINPYNDGTIYNPNFKGKATLTVDKASSTAYMELLSLTSDDPAVYYCAR TDDYDDYTMDYWGQGTSVIVSS CDR1 SEQ ID NO. 61 QQNNYDPW CDR2 SEQ ID NO. 62 WIGPINPYNDGTIY CDR3 SEQ ID NO. 63 ARTDDYDDYTMDY G4 light chain SEQ ID NO. 22 EIQMTQTPSSLSASLGDRVTISCRASHDISNYLNWYQQKPDGTLKLLIYYT variable region SRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGKTLLWTFGGG TKLEIK CDR1 SEQ ID NO. 64 HDISNYLN CDR2 SEQ ID NO. 65 LLIYYTSRLHS CDR3 SEQ ID NO. 66 QQGKTLLW M22 heavy chain SEQ ID NO. 23 QVQLQQPGAELVKPGASVKLSCKASGYTFTRYWMHWVKQRPGQGLE variable region WIGNIDPSDTETHYNQQFKDKATLTVDKSSSTAYMQLSSLTSEDSAVYY CAIYYGNPSYYAMDYWGQGTSVTVSS CDR1 SEQ ID NO. 67 GYTFTRYWMH CDR2 SEQ ID NO. 68 WIGNIDPSDTETHY CDR3 SEQ ID NO. 69 AIYYGNPSYYAMDY M22 light chain SEQ ID NO. 24 DIVMTQSPSSLTVTAGEKVTMSCKSSQNLLNSGNQKKYLNWYQQKPG variable region QPPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYFCQND YSYPFTFGAGTKLELK CDR1 SEQ ID NO. 70 QNLLNSGNQKKYLN CDR2 SEQ ID NO. 71 LLIYWASTRES CDR3 SEQ ID NO. 72 QNDYSYPF M29 heavy chain SEQ ID NO. 25 EVQLQQSGPELVKPGASVKMSCKASGYIFTSYVMYWVKQKPGQGLEW variable region IGYINPYNDGTKYNEKFKGKATLTSDKSSSTAYMELSSLTSEDSAVYYCAR YYDYDYYFDYWGQGTTLTVSS CDR1 SEQ ID NO. 73 GYIFTSYVMY CDR2 SEQ ID NO. 74 WIGYINPY CDR3 SEQ ID NO. 75 ARYYDYDYYFDY M29 light chain SEQ ID NO. 26 DIQMTQSPSSLSASLGGKVTITCKASQDINKYIAWYQHKPGKGPRLLIHY variable region TSTLQPGIPSRFSGSGSGRDYSFSISNLEPEDIATYYCLQYDYLWTFGGGT KLEIK CDR1 SEQ ID NO. 76 QDINKYIA CDR2 SEQ ID NO. 77 LLIHYTSTLQP CDR3 SEQ ID NO. 78 LQYDYLW M2 heavy chain SEQ ID NO. 27 EVQLRQSGPELVKPGASVKMSCKASGYTFTSYFMHWVKQKPGQGLEW variable region IGFINPYNDGTKYNEKFKGKATLTSDKSSSTAYMELNSLTSEDSAVYYCTR DDGYYDYAMDYWGQGTSVTVSS CDR1 SEQ ID NO. 79 GYTFTSYFMH CDR2 SEQ ID NO. 80 WIGFINPYNDGTKY CDR3 SEQ ID NO. 81 TRDDGYYDYAMDY M2 light chain SEQ ID NO. 28 DIQMTQSPSSLSASLGERVSLTCRASQEISVYLSWLQQKPDGTIKRLIYAA variable region STLDSGVPERFSGSRSGSDYSLTISSLESEDFADYYCLQYASYPYTFGGGTK LEIKR CDR1 SEQ ID NO. 82 QEISVYLS CDR2 SEQ ID NO. 83 RLIYAASTLDS CDR3 SEQ ID NO. 84 LQYASYPY M5 heavy chain SEQ ID NO. 29 EVQLQQSGAELVRPGASVKLSCTASGFNIKDDYIHWVKQRPEQGLEWI variable region GWIDPEKGDTAYASKFQDKATITSDTSSNTAYLQLSSLTSEDTAVYYCTLT GRFDYWGQGTTLTVSS CDR1 SEQ ID NO. 85 GFNIKDDYIH CDR2 SEQ ID NO. 86 WIGWIDPEKGDTAYAS CDR3 SEQ ID NO. 87 TLTGRFDY M5 light chain SEQ ID NO. 30 DIVMSQSPSSLAVSVGEKVTMSCKSSQSLLYSSNQKNNLAWYQQKPGQ variable region SPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQQYYS YRTFGGGTKLEIK CDR1 SEQ ID NO. 88 QSLLYSSNQKNNLA CDR2 SEQ ID NO. 89 LLIYWASTRES CDR3 SEQ ID NO. 90 QQYYSYR G12 heavy chain SEQ ID NO. 31 QVQLQQPGAELVKPGASMKMSCKASGYTFPSSNIHWLKQTPGQGLE variable region WIGVIYPGNGDTSYNQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAIYFC ARVYNWHFDVWGAGTTVTVSS CDR1 SEQ ID NO. 91 GYTFPSSNIH CDR2 SEQ ID NO. 92 WIGVIYPGNGDTSY CDR3 SEQ ID NO. 93 AIYFVYNWHFDV G12 light chain SEQ ID NO. 32 NIVLTQSPASLAVSLGQRATISCRASESVDGYGDIFMLWYQQKPGQPPK variable region LLIYFASNLESGVPARFSGSGSRTDFTLTIDPVEADDAATYYCQQNNEDP YTFGGGTKLEIKR CDR1 SEQ ID NO. 94 ESVDGYGDIFML CDR2 SEQ ID NO. 95 LLIYFASNLES CDR3 SEQ ID NO. 96 QQNNEDPY 21.26 heavy chain SEQ ID NO. 33 QVQLQQPGAELVKPGTSVKLSCKASGYTFTRYWMHWVKQRPGQGLE variable region WIGMIHPSSGSTSYNEKVKNKATLTVDRSSTTAYMQLSSLTSEDSAVYYC ARDGDYYYGTGDYWGQGTTLTVSS CDR1 SEQ ID NO. 97 GYTFTRYWMH CDR2 SEQ ID NO. 98 MIHPSSGSTSYNEKVK CDR3 SEQ ID NO. 99 RDGDYYYGTGDY 21.26 light chain SEQ ID NO. 34 QIVLSQSPAILSASPGEKVTMTCRASSSINYMHWYQQKPGSSPKPWIFA variable region TSNLASGVPSRFSGSGSGTSYSLTISRVEAEDAATYYCQQWRSDRALTFG AGTKLEL CDR1 SEQ ID NO. 100 RASSSINYMH CDR2 SEQ ID NO. 101 PWIFATSNLAS CDR3 SEQ ID NO. 102 QQWRSDRALT 1075.7 heavy chain SEQ ID NO.35 DIQLQESGPGLVKPSQSLSLTCSVTGYSITSAYYWNWIRQFPGNKLEWM variable region GYISYDGRNNYNPSLKNRISITRDTSKNQFFLKLNSVTTEDTATYYCAKEG DYDVGNYYAMDYWGQGTSVTVSS CDR1 SEQ ID NO. 103 GYSITSAYYWN CDR2 SEQ ID NO. 104 YISYDGRNNYNPSLKN CDR3 SEQ ID NO. 105 AKEGDYDVGNYYAMDY 1075.7 light chain SEQ ID NO.36 ENVLTQSPAIMSASPGEKVTMTCRASSNVISSYVHWYQQRSGASPKLW variable region lYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQYSGYPLTF GAGTKLEL CDR1 SEQ ID NO. 106 RASSNVISSYVH CDR2 SEQ ID NO. 107 LWIYSTSNLAS CDR3 SEQ ID NO. 108 QQYSGYPLT

TABLE-US-00006 TABLE 6 Exemplary Polypeptides forming anti-CLL1 multi-chain CAR Multi Precursor CLL1 multi-chain CAR polypeptide structure chain Gamma polypeptide Beta polypeptide CAR Fc.epsilon.RI Alpha polypeptide Co- Desig- Fc.epsilon.RI .gamma. - CD3.zeta.- Fc.epsilon.RI.gamma. - CD8.alpha. G4SX3 Fc.epsilon.RI.gamma. - Fc.epsilon.RI.gamma.- stimulalion. nation .gamma.-SP .DELTA.ITAM IC P2A SP hinge VH Linker VL TM-IC T2A .DELTA.ITAM domain anti-CLL1 SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SC02-357 NO. 8 NO. 9 NO. 10 NO. 11 NO. 1 NO. 2 NO. 13 NO. 3 NO. 16 NO. 4 NO. 12 NO. 5 NO. 6 (41BB) anti-CLL1 SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SC02-357 NO. 8 NO. 9 NO. 10 NO. 11 NO. 1 NO. 2 NO. 13 NO. 3 NO. 16 NO. 4 NO. 12 NO. 5 NO. 7 (CD28) anti-CLL1 SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SC02-378 NO. 8 NO. 9 NO. 10 NO. 11 NO. 1 NO. 2 NO. 14 NO. 3 NO. 16 NO. 4 NO. 12 NO. 5 NO. 6 (41BB) anti-CLL1 SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SC02-378 NO. 8 NO. 9 NO. 10 NO. 11 NO. 1 NO. 2 NO. 14 NO. 3 NO. 16 NO. 4 NO. 12 NO. 5 NO. 7 (CD28) anti-CLL1 SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SC02-161 NO. 8 NO. 9 NO. 10 NO. 11 NO. 1 NO. 2 NO. 15 NO. 3 NO. 16 NO. 4 NO. 12 NO. 5 NO. 6 (41BB) anti-CLL1 SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SC02-161 NO. 8 NO. 9 NO. 10 NO. 11 NO. 1 NO. 2 NO. 15 NO. 3 NO. 16 NO. 4 NO. 12 NO. 5 NO. 7 (CD28) anti-CLL1 SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID M26 NO. 8 NO. 9 NO. 10 NO. 11 NO. 1 NO. 2 NO. 17 NO. 3 NO. 18 NO. 4 NO. 12 NO. 5 NO. 6 (41BB) Multi Precursor CLL1 multi-chain CAR polypeptide structure (following of Table 6) chain Gamma polypeptide Beta polypeptide CAR Fc.epsilon.RI Alpha polypeptide Co- Desig- Fc.epsilon.RI .gamma. - CD3.zeta.- Fc.epsilon.RI.gamma. - CD8.alpha. G4SX3 Fc.epsilon.RI.gamma. - Fc.epsilon.RI.gamma.- stimulalion. nation .gamma.-SP .DELTA.ITAM IC P2A SP hinge VH Linker VL TM-IC T2A .DELTA.ITAM domain anti-CLL1 SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID M26 NO. 8 NO. 9 NO. 10 NO. 11 NO. 1 NO. 2 NO. 17 NO. 3 NO. 18 NO. 4 NO. 12 NO. 5 NO. 7 (CD28) anti-CLL1 SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID M31 (41BB) NO. 8 NO. 9 NO. 10 NO. 11 NO. 1 NO. 2 NO. 19 NO. 3 NO. 20 NO. 4 NO. 12 NO. 5 NO. 6 anti-CLL1 SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID M31 NO. 8 NO. 9 NO. 10 NO. 11 NO. 1 NO. 2 NO. 19 NO. 3 NO. 20 NO. 4 NO. 12 NO. 5 NO. 7 (CD28) anti-CLL1 SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID G4 (41BB) NO. 8 NO. 9 NO. 10 NO. 11 NO. 1 NO. 2 NO. 21 NO. 3 NO. 22 NO. 4 NO. 12 NO. 5 NO. 6 anti-CLL1 SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID G4 (CD28) NO. 8 NO. 9 NO. 10 NO. 11 NO. 1 NO. 2 NO. 21 NO. 3 NO. 22 NO. 4 NO. 12 NO. 5 NO. 7 anti-CLL1 SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID M22 (41BB) NO. 8 NO. 9 NO. 10 NO. 11 NO. 1 NO. 2 NO. 23 NO. 3 NO. 24 NO. 4 NO. 12 NO. 5 NO. 6 anti-CLL1 SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID M22 CD28) NO. 8 NO. 9 NO. 10 NO. 11 NO. 1 NO. 2 NO. 23 NO. 3 NO. 24 NO. 4 NO. 12 NO. 5 NO. 7 anti-CLL1 SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID M29 41BB) NO. 8 NO. 9 NO. 10 NO. 11 NO. 1 NO. 2 NO. 25 NO. 3 NO. 26 NO. 4 NO. 12 NO. 5 NO. 6 anti-CLL1 SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID M29 NO. 8 NO. 9 NO. 10 NO. 11 NO. 1 NO. 2 NO. 25 NO. 3 NO. 26 NO. 4 NO. 12 NO. 5 NO. 7 (CD28) anti-CLL1 SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID M2 (41BB) NO. 8 NO. 9 NO. 10 NO. 11 NO. 1 NO. 2 NO. 27 NO. 3 NO. 28 NO. 4 NO. 12 NO. 5 NO. 6 anti-CLL1 SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID M2 (CD28) NO. 8 NO. 9 NO. 10 NO. 11 NO. 1 NO. 2 NO. 27 NO. 3 NO. 28 NO. 4 NO. 12 NO. 5 NO. 7 anti-CLL1 SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID M5 (41BB) NO. 8 NO. 9 NO. 10 NO. 11 NO. 1 NO. 2 NO. 29 NO. 3 NO. 30 NO. 4 NO. 12 NO. 5 NO. 6 anti-CLL1 SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID M5 (CD28) NO. 8 NO. 9 NO. 10 NO. 11 NO. 1 NO. 2 NO. 29 NO. 3 NO. 30 NO. 4 NO. 12 NO. 5 NO. 7 anti-CLL1 SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID G12 (41BB) NO. 8 NO. 9 NO. 10 NO. 11 NO. 1 NO. 2 NO. 31 NO. 3 NO. 32 NO. 4 NO. 12 NO. 5 NO. 6 anti-CLL1 SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID G12 (CD28) NO. 8 NO. 9 NO. 10 NO. 11 NO. 1 NO. 2 NO. 31 NO. 3 NO. 32 NO. 4 NO. 12 NO. 5 NO. 7 anti-CLL1 SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID 21.26 NO. 8 NO. 9 NO. 10 NO. 11 NO. 1 NO. 2 NO. 33 NO. 3 NO. 34 NO. 4 NO. 12 NO. 5 NO. 6 (41BB) anti-CLL1 SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID 21.26 NO. 8 NO. 9 NO. 10 NO. 11 NO. 1 NO. 2 NO. 33 NO. 3 NO. 34 NO. 4 NO. 12 NO. 5 NO. 7 (CD28) anti-CLL1 SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID 1075.7 NO. 8 NO. 9 NO. 10 NO. 11 NO. 1 NO. 2 NO. 35 NO. 3 NO. 36 NO. 4 NO. 12 NO. 5 NO. 6 (41BB) anti-CLL1 SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID 1075.7 NO. 8 NO. 9 NO. 10 NO. 11 NO. 1 NO. 2 NO. 35 NO. 3 NO. 36 NO. 4 NO. 12 NO. 5 NO. 7 (CD28)

[0038] Unless specifically defined herein, all technical and scientific terms used have the same meaning as commonly understood by a skilled artisan in the fields of gene therapy, biochemistry, genetics, and molecular biology.

[0039] All methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, with suitable methods and materials being described herein. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including definitions, will prevail. Further, the materials, methods, and examples are illustrative only and are not intended to be limiting, unless otherwise specified.

[0040] The practice of the present invention will employ, unless otherwise indicated, conventional techniques of cell biology, cell culture, molecular biology, transgenic biology, microbiology, recombinant DNA, and immunology, which are within the skill of the art. Such techniques are explained fully in the literature. See, for example, Current Protocols in Molecular Biology (Frederick M. AUSUBEL, 2000, Wiley and son Inc, Library of Congress, USA); Molecular Cloning: A Laboratory Manual, Third Edition, (Sambrook et al, 2001, Cold Spring Harbor, N.Y.: Cold Spring Harbor Laboratory Press); Oligonucleotide Synthesis (M. J. Gait ed., 1984); Mullis et al. U.S. Pat. No. 4,683,195; Nucleic Acid Hybridization (B. D. Harries & S. J. Higgins eds. 1984); Transcription And Translation (B. D. Hames & S. J. Higgins eds. 1984); Culture Of Animal Cells (R. I. Freshney, Alan R. Liss, Inc., 1987); Immobilized Cells And Enzymes (IRL Press, 1986); B. Perbal, A Practical Guide To Molecular Cloning (1984); the series, Methods In ENZYMOLOGY (J. Abelson and M. Simon, eds.-in-chief, Academic Press, Inc., New York), specifically, Vols. 154 and 155 (Wu et al. eds.) and Vol. 185, "Gene Expression Technology" (D. Goeddel, ed.); Gene Transfer Vectors For Mammalian Cells (J. H. Miller and M. P. Calos eds., 1987, Cold Spring Harbor Laboratory); Immunochemical Methods In Cell And Molecular Biology (Mayer and Walker, eds., Academic Press, London, 1987); Handbook Of Experimental Immunology, Volumes I-IV (D. M. Weir and C. C. Blackwell, eds., 1986); and Manipulating the Mouse Embryo, (Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1986).

[0041] The present invention relates to:

[0042] 1) A CLL1 specific multi-chain Chimeric Antigen Receptor (mc CAR) comprising at least:

[0043] a first transmembrane polypeptide comprising at least one extracellular ligand-binding domain, wherein the at least one extracellular ligand-binding domain binds to the cell surface CLL1 antigen; and;

[0044] a second polypeptide comprising at least one signal-transducing domain;

[0045] wherein the signal transducing domain(s) of the multi-chain Chimeric Antigen Receptor is present on a polypeptide distinct from that carrying the extracellular ligand-binding domain(s).

[0046] 2) The CLL1 specific multi-chain Chimeric Antigen Receptor of embodiment 1, wherein said signal-transducing domain containing polypeptide is a transmembrane polypeptide.

[0047] 3) The CLL1 specific multi-chain Chimeric Antigen Receptor of embodiment 1 or embodiment 2, wherein at least one transmembrane polypeptide comprises a part of Fc receptor.

[0048] 4) The CLL1 specific multi-chain Chimeric Antigen Receptor of embodiment 3, wherein said part of Fc receptor is selected from the group consisting of: (a) Fc.epsilon.RI alpha chain, (b) Fc.epsilon.RI beta chain and (c) Fc.epsilon.RI gamma chain.

[0049] 5) The CLL1 specific multi-chain Chimeric Antigen Receptor of embodiment 3 or embodiment 4, where a transmembrane polypeptide from the alpha chain of high-affinity IgE receptor (Fc.epsilon.RI) fused to an extracellular CLL1 ligand binding domain.

[0050] 6) A CLL1 specific multi-chain Chimeric Antigen Receptor (mc CAR) according to any one of embodiment 3 to embodiment 5 further comprising:

[0051] said second transmembrane polypeptide from the gamma or beta chain of Fc.epsilon.RI fused to a signal transducing domain;

[0052] 7) A CLL1 specific multi-chain Chimeric Antigen Receptor (mc CAR) according to any one of embodiment 3 to embodiment 6, further comprising:

[0053] a third transmembrane polypeptide from the gamma or beta chain of Fc.epsilon.RI comprising a co-stimulatory domain.

[0054] 8) A CLL1 specific multi-chain Chimeric Antigen Receptor according to any one of embodiments 1 to 7, wherein said CLL1 ligand binding domain fused to said alpha chain of Fc.epsilon.RI is a single-chain variable fragment (scFv) comprising heavy (V.sub.H) and light (V.sub.L) chains conferring specificity to CLL1.

[0055] 9) A CLL1 specific multi-chain Chimeric Antigen Receptor of embodiment 8, wherein said V.sub.H comprises a polypeptide sequence displaying at least 90% identity to one selected SEQ ID NO. 13, 14, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33 and 35.

[0056] 10) A CLL1 specific multi-chain Chimeric Antigen Receptor of embodiment 8, wherein said V.sub.L comprises a polypeptide displaying at least 90% identity to one selected from SEQ ID NO. 16, 18, 20, 22, 24, 26, 28, 30, 32, 34 and 36.

[0057] 11) A CLL1 specific multi-chain Chimeric Antigen Receptor of any one of embodiment 4 to embodiment 10, wherein said alpha chain of Fc.epsilon.RI is fused to said extracellular ligand-binding domain by a hinge from CD8.alpha., IgG1 or FcRIII.alpha. proteins.

[0058] 12) A CLL1 specific multi-chain Chimeric Antigen Receptor of embodiment 11, wherein said hinge comprises a polypeptide sequence displaying at least 90% identity to SEQ ID NO. 2.

[0059] 13) A CLL1 specific multi-chain Chimeric Antigen Receptor according to any one of embodiments 3 to 12, wherein said signal transducing domain fused to the gamma or beta chain of Fc.epsilon.RI is from the TCR zeta chain, the FC.epsilon.R.beta. chain, the Fc.epsilon.RI.gamma. chain, or includes an immunoreceptor tyrosine-based activation motif (ITAM).

[0060] 14) A CLL1 specific multi-chain Chimeric Antigen Receptor according to embodiment 13, wherein said signal transducing domain is from CD3zeta.

[0061] 15) A CLL1 specific multi-chain Chimeric Antigen Receptor according to embodiment 14, wherein said signal transducing domain comprises a polypeptide sequence displaying at least 90% identity to SEQ ID NO. 10.

[0062] 16) A CLL1 specific multi-chain Chimeric Antigen Receptor according to any one of embodiments 1 to 15, wherein said second or third polypeptide comprises a co-stimulatory domain from the cytoplasmic domain of a costimulatory molecule selected from CD27, CD28, 4-1BB, OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, CD8, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83, and any combination thereof.

[0063] 17) A CLL1 specific multi-chain Chimeric Antigen Receptor according to embodiment 16, wherein said co-stimulatory domain is from 4-1BB and comprises a polypeptide sequence displaying at least 90% identity to SEQ ID NO. 6.

[0064] 18) A CLL1 specific multi-chain Chimeric Antigen Receptor according to embodiment 16, wherein said co-stimulatory domain is from CD28 and comprises a polypeptide sequence displaying at least 90% identity to SEQ ID NO. 7.

[0065] 19) A CLL1 specific multi-chain Chimeric Antigen Receptor according to anyone of embodiment 1 to 18, wherein at least one epitope is inserted in at least one of the extracellular domain(s) of said CAR.

[0066] 20) A CLL1 specific multi-chain Chimeric Antigen Receptor according to embodiment 19, wherein said at least one epitope is inserted in one extracellular ligand binding domain of said CAR.

[0067] 21) A CLL1 specific multi-chain Chimeric Antigen Receptor according to embodiment 20, wherein said at least one epitope is inserted in the extracellular domain of said CAR that binds CLL1.

[0068] 22) A CLL1 specific multi-chain Chimeric Antigen Receptor according to any one of embodiments 19 to 21, wherein the extracellular binding domain comprises 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 mAb-specific epitopes.

[0069] 23) A CLL1 specific multi-chain Chimeric Antigen Receptor according to embodiment 22, wherein the extracellular binding domain comprises 1, 2, 3 or, 4 mAb-specific epitopes.

[0070] 24) A CLL1 specific multi-chain Chimeric Antigen Receptor according to embodiment 23, wherein the extracellular binding domain comprises 2, 3 or, 4 mAb-specific epitopes

[0071] 25) A CLL1 specific multi-chain Chimeric Antigen Receptor according to embodiment 23, wherein the extracellular binding domain comprises one of the following sequences:

[0072] V.sub.1-L.sub.1-V.sub.2-(L).sub.x-Epitope1-(L).sub.x-;

[0073] V.sub.1-L.sub.1-V.sub.2-(L).sub.x-Epitope1-(L).sub.x-Epitope2-(L).sub.x-;

[0074] V.sub.1-L.sub.1-V.sub.2-(L).sub.x-Epitope1-(L).sub.x-Epitope2-(L).- sub.x-Epitope3-(L).sub.x-;

[0075] (L).sub.x-Epitope1-(L).sub.x-V.sub.1-L.sub.1-V.sub.2;

[0076] (L).sub.x-Epitope1-(L).sub.x-Epitope2-(L).sub.x-V.sub.1-L.sub.1-V.sub.2;

[0077] Epitope1-(L).sub.x-Epitope2-(L).sub.x-Epitope3-(L).sub.x-V.sub.1-L- .sub.1-V.sub.2;

[0078] (L).sub.x-Epitope1-(L).sub.x-V.sub.1-L.sub.1-V.sub.2-(L).sub.x-Epitope2-(- L).sub.x;

[0079] (L).sub.x-Epitope1-(L).sub.x-V.sub.1-L.sub.1-V.sub.2-(L).sub.x-Epitope2-(- L).sub.x-Epitope3-(L).sub.x-;

[0080] (L).sub.x-Epitope1-(L).sub.x-V.sub.1-L.sub.1-V.sub.2-(L).sub.x-Epitope2-(- L).sub.x-Epitope3-(L).sub.x-Epitope4-(L).sub.x-;

[0081] (L).sub.x-Epitope1-(L).sub.x-Epitope2-(L).sub.x-V.sub.1-L.sub.1-V.sub.2-(- L).sub.x-Epitope3-(L).sub.x-;

[0082] (L).sub.x-Epitope1-(L).sub.x-Epitope2-(L).sub.x-V.sub.1-L.sub.1-V.sub.2-(- L).sub.x-Epitope3-(L).sub.x-Epitope4-(L).sub.x-;

[0083] V.sub.1-(L).sub.x-Epitope1-(L).sub.x-V.sub.2;

[0084] V.sub.1-(L).sub.x-Epitope1-(L).sub.x-V.sub.2-(L).sub.x-Epitope2-(L).sub.x- ;

[0085] V.sub.1-(L).sub.x-Epitope1-(L).sub.x-V.sub.2-(L).sub.x-Epitope2-(- L).sub.x-Epitope3-(L).sub.x;

[0086] V.sub.1-(L).sub.x-Epitope1-(L).sub.x-V.sub.2-(L).sub.x-Epitope2-(L).sub.x- -Epitope3-(L).sub.x-Epitope4-(L).sub.x;

[0087] (L).sub.x-Epitope1-(L).sub.x-V.sub.1-(L).sub.x-Epitope2-(L).sub.x-V.sub.2- ; or,

[0088] (L).sub.x-Epitope1-(L).sub.x-V.sub.1-(L).sub.x-Epitope2-(L).sub.x-V.sub.2- -(L).sub.x-Epitope3-(L).sub.x;

[0089] wherein,

[0090] V.sub.1 is V.sub.L and V.sub.2 is V.sub.H or V.sub.1 is V.sub.H and V.sub.2 is V.sub.L;

[0091] L.sub.1 is a linker suitable to link the V.sub.H chain to the V.sub.L chain;

[0092] L is a linker comprising glycine and serine residues, and each occurrence of L in the extracellular binding domain can be identical or different to other occurrence of L in the same extracellular binding domain, and,

[0093] x is 0 or 1 and each occurrence of x is selected independently from the others; and,

[0094] Epitope 1, Epitope 2 and Epitope 3 are mAb-specific epitopes and can be identical or differents.

[0095] 26) A CLL1 specific multi-chain Chimeric Antigen Receptor according to embodiment 22, wherein the extracellular binding domain comprises the following sequence:

[0096] V.sub.1-L.sub.1-V.sub.2-L-Epitope1; V.sub.1-L.sub.1-V.sub.2-L-Epitope1-L; V.sub.1-L.sub.1-V.sub.2-L-Epitope1-L-Epitope2; V.sub.1-L.sub.1-V.sub.2-L-Epitope1-L-Epitope2-L; V.sub.1-L.sub.1-V.sub.2-L-Epitope1-L-Epitope2-L-Epitope3; V.sub.1-L.sub.1-V.sub.2-L-Epitope1-L-Epitope2-L-Epitope3-L; V.sub.1-L.sub.1-V.sub.2-Epitope1; V.sub.1-L.sub.1-V.sub.2-Epitope1-L; V.sub.1-L.sub.1-V.sub.2-Epitope1-L-Epitope2; V.sub.1-L.sub.1-V.sub.2-Epitope1-L-Epitope2-L; V.sub.1-L.sub.1-V.sub.2-Epitope1-L-Epitope2-L-Epitope3; V.sub.L-L.sub.1-V.sub.2-Epitope1-L-Epitope2-L-Epitope3-L; Epitope1-V.sub.L-L.sub.1-V.sub.2; Epitope1-L-V.sub.L-L.sub.1-V.sub.2; L-Epitope1-V.sub.L-L.sub.1-V.sub.2; L-Epitope1-L-V.sub.L-L.sub.1-V.sub.2; Epitope1-L-Epitope2-V.sub.L-L.sub.1-V.sub.2; Epitope1-L-Epitope2-L-V.sub.L-L.sub.1-V.sub.2; L-Epitope1-L-Epitope2-V.sub.L-L.sub.1-V.sub.2; L-Epitope1-L-Epitope2-L-V.sub.L-L.sub.1-V.sub.2; Epitope1-L-Epitope2-L-Epitope3-V.sub.L-L.sub.1-V.sub.2; Epitope1-L-Epitope2-L-Epitope3-L-V.sub.L-L.sub.1-V.sub.2; L-Epitope1-L-Epitope2-L-Epitope3-V.sub.1-L.sub.1-V.sub.2; L-Epitope1-L-Epitope2-L-Epitope3-L-V.sub.1-L.sub.1-V.sub.2; V.sub.1-L-Epitope1-L-V.sub.2; L-Epitope1-L-V.sub.1-L-Epitope2-L-V.sub.2; V.sub.1-L-Epitope1-L-V.sub.2-L-Epitope2-L; V.sub.1-L-Epitope1-L-V.sub.2-L-Epitope2-L-Epitope3; V.sub.1-L-Epitope1-L-V.sub.2-L-Epitope2-Epitope3; V.sub.1-L-Epitope1-L-V.sub.2-L-Epitope2-L-Epitope3-Epitope4; L-Epitope1-L-V.sub.1-L-Epitope2-L-V.sub.2-L-Epitope3-L; Epitope1-L-V.sub.1-L-Epitope2-L-V.sub.2-L-Epitope3-L; L-Epitope1-L-V.sub.1-L-Epitope2-L-V.sub.2-L-Epitope3; L-Epitope1-L-V.sub.1-L.sub.1-V.sub.2-L-Epitope2-L; L-Epitope1-L-V.sub.1-L.sub.1-V.sub.2-L-Epitope2-L-Epitope3; L-Epitope1-L-V.sub.1-L.sub.1-V.sub.2-L-Epitope2-Epitope3, or Epitope1-L-V.sub.1-L.sub.1-V.sub.2-L-Epitope2-L-Epitope3-Epitope4

[0097] wherein

[0098] V.sub.1 is V.sub.L and V.sub.2 is V.sub.H or V.sub.1 is V.sub.H and V.sub.2 is V.sub.L;

[0099] L.sub.1 is any linker suitable to link the V.sub.H chain to the V.sub.L chain;

[0100] L is a linker comprising glycine and serine residues, and each occurrence of L in the extracellular binding domain can be identical or different to other occurrence of L in the same extracellular binding domain, and,

[0101] epitope 1, epitope 2 and epitope 3 are mAb-specific epitopes and can be identical or differents.

[0102] 27) A CLL1 specific multi-chain Chimeric Antigen Receptor according to embodiment 25 or 26, wherein L.sub.1 is a linker comprising Glycine and/or Serine.

[0103] 28) A CLL1 specific multi-chain Chimeric Antigen Receptor according to embodiment 27, wherein L.sub.1 is a linker comprising the amino acid sequence (Gly-Gly-Gly-Ser), or (Gly-Gly-Gly-Gly-Ser).sub.n where n is 1, 2, 3, 4 or 5.

[0104] 29) A CLL1 specific multi-chain Chimeric Antigen Receptor according to embodiment 27, wherein L.sub.1 is a linker comprising the amino acid sequence (Gly.sub.4Ser).sub.4 or (Gly.sub.4Ser).sub.3.

[0105] 30) A CLL1 specific multi-chain Chimeric Antigen Receptor according to embodiment 27, wherein L is a linker having an amino acid sequence selected from SGG, GGS, SGGS, SSGGS, GGGG, SGGGG, GGGGS, SGGGGS, GGGGGS, SGGGGGS, SGGGGG, GSGGGGS, GGGGGGGS, SGGGGGGG, SGGGGGGGS, or SGGGGSGGGGS.

[0106] 31) A CLL1 specific multi-chain Chimeric Antigen Receptor according to embodiment 30, wherein L is a SGGGG, GGGGS or SGGGGS.

[0107] 32) A CLL1 specific multi-chain Chimeric Antigen Receptor according to embodiment 22, wherein said mAb-specific epitope(s) is(are) specifically recognized by ibritumomab, tiuxetan, muromonab-CD3, tositumomab, abciximab, basiliximab, brentuximab vedotin, cetuximab, infliximab, rituximab, alemtuzumab, bevacizumab, certolizumab pegol, daclizumab, eculizumab, efalizumab, gemtuzumab, natalizumab, omalizumab, palivizumab, ranibizumab, tocilizumab, trastuzumab, vedolizumab, adalimumab, belimumab, canakinumab, denosumab, golimumab, ipilimumab, ofatumumab, panitumumab, QBEND-10, alemtuzumab or ustekinumab.

[0108] 33) A CLL1 specific multi-chain Chimeric Antigen Receptor according to embodiment 22, wherein mAb-specific epitope is one comprising an amino acid sequence selected from SEQ ID NO 109, SEQ ID NO 110, SEQ ID NO 111, SEQ ID NO 112, SEQ ID NO 113, SEQ ID NO 114, SEQ ID NO 115 and SEQ ID NO 116.

[0109] 34) A CLL1 specific multi-chain Chimeric Antigen Receptor according to embodiment 25 or 26, wherein Epitope 1 is an mAb-specific epitope having an amino acid sequence of SEQ ID NO 109.

[0110] 35) A CLL1 specific multi-chain Chimeric Antigen Receptor according to embodiment 25 or 26, wherein Epitope 2 is an mAb-specific epitope having an amino acid sequence of SEQ ID NO 109.

[0111] 36) A CLL1 specific multi-chain Chimeric Antigen Receptor according to embodiment 25 or 26, wherein Epitope 3 is an mAb-specific epitope having an amino acid sequence of SEQ ID NO 109 or SEQ ID NO 117 or SEQ ID NO 118.

[0112] 37) A CLL1 specific multi-chain Chimeric Antigen Receptor according to embodiment 25 or 26, wherein Epitope 4 is an mAb-specific epitope having an amino acid sequence of SEQ ID NO 109.

[0113] 38) A CLL1 specific multi-chain Chimeric Antigen Receptor according to any one of embodiments 1 to 37, comprising a polypeptide sequence displaying at least 80% identity to the full amino acid sequence of anti-CLL1 SC02-357, anti-CLL1 SC02-378, anti-CLL1 SC02-161, anti-CLL1 M26, anti-CLL1 M31, anti-CLL1 G4, anti-CLL1 M22, anti-CLL1 M29, anti-CLL1 M2, anti-CLL1 M5, anti-CLL1 G12, anti-CLL1 21.26 and anti-CLL1 1075.7 as referred to in Table 6.

[0114] 39) A polynucleotide comprising a nucleic acid sequence encoding a CLL1 specific multi-chain Chimeric Antigen Receptor according to any one of embodiments 1 to 38.

[0115] 40) A vector comprising a polynucleotide of embodiment 39.

[0116] 41) An engineered immune cell expressing at the cell surface membrane an anti-CLL1 mcCAR according to any one of embodiments 1 to 38.

[0117] 42) An engineered immune cell according to embodiment 41, derived from inflammatory T-lymphocytes, cytotoxic T-lymphocytes, regulatory T-lymphocytes or helper T-lymphocytes.

[0118] 43) An engineered cell according to any one of embodiments 41 or 42 for use in therapy.

[0119] 44) An engineered cell according to any one of embodiments 412 to 43 for use in therapy, wherein the patient is a human.

[0120] 45) An engineered cell according to any one of embodiments 41 to 44 for use in therapy, wherein the condition is a pre-malignant or malignant cancer condition characterized by CLL1-expressing cells.



[0121] 46) An engineered cell according to any one of embodiments 41 to 45 use in therapy, wherein the condition is a condition which is characterized by an overabundance of CLL1-expressing cells.

[0122] 47) An engineered cell according to any one of embodiments 41 to 46 for use in therapy, wherein the condition is a hematological cancer condition.

[0123] 48) An engineered cell according to any one of embodiments 41 to 47 for use in therapy, wherein the hematological cancer condition is leukemia.

[0124] 49) An engineered cell according to any one of embodiments 41 to 48 for use in therapy, wherein the leukemia is acute myelogenous leukemia (AML).

[0125] 50) An engineered cell according to any one of embodiments 41 to 49 wherein expression of TCR is suppressed in said immune cell.

[0126] 51) An engineered cell according to any one of embodiments 41 to 50, wherein expression of at least one MHC protein, preferably .beta.2m or HLA, is suppressed in said immune cell.

[0127] 52) An engineered cell according to any one of embodiments 41 to 51, wherein said cell is mutated to confer resistance to at least one immune suppressive or chemotherapy drug.

[0128] 53) A method of impairing a hematologic cancer cell comprising contacting said cell with an engineered cell according to any one of embodiments 41 to 52 in an amount effective to cause impairment of said cancer cell.

[0129] 54) A method of engineering an immune cell comprising:

[0130] (a) Providing an immune cell;

[0131] (b) Expressing at the surface of said cells at least one multi-chain Chimeric Antigen Receptor according to any one of the embodiments 1 to 38.

[0132] 55) The method of engineering an immune cell of embodiment 54 comprising:

[0133] (a) Providing an immune cell;

[0134] (b) Introducing into said cell at least one polynucleotide encoding polypeptides composing at least one multi-chain Chimeric Antigen Receptor according to any one of embodiments 1 to 38;

[0135] (c) Expressing said polynucleotides into said cell.

[0136] 56) The method of engineering an immune cell of embodiment 36 comprising:

[0137] (a) Providing an immune cell;

[0138] (b) Expressing at the surface of said cell a population of multi-chain Chimeric Antigen Receptors according to any one of the embodiments 1 to 38 each one comprising different extracellular ligand-binding domains.

[0139] 57) The method of engineering an immune cell of embodiment 56 comprising:

[0140] (a) Providing an immune cell;

[0141] (b) Introducing into said cell at least one polynucleotide encoding polypeptides composing a population of multi-chain Chimeric Antigen Receptors according to any one of embodiments 1 to 38 each one comprising different extracellular ligand binding domains.

[0142] (c) Expressing said polynucleotides into said cell.

[0143] 58) An isolated immune cell obtainable from the method according to any one of embodiments 54 to 57.

[0144] 59) An isolated immune cell comprising at least one multi-chain Chimeric Antigen Receptor according to any one of embodiments 1 to 38.

[0145] 60) An isolated immune cell according to embodiment 58 or 59 for its use as a medicament.

[0146] 61) An isolated cell according to any one of embodiments 58 to 60 derived from, NK cells, inflammatory T-lymphocytes, cytotoxic T-lymphocytes, regulatory T-lymphocytes or helper T-lymphocytes.

[0147] 62) A therapeutic composition comprising an isolated immune cell according to any one of embodiments 58 to 61.

[0148] 63) A method for treating a patient in need thereof comprising:

[0149] a) Providing a immune cell obtainable by a method according to any one of the embodiments 54 to 57;

[0150] b) Administrating said T-cells to said patient,

[0151] 64) The method for treating a patient of embodiment 63, wherein said immune cells are recovered from donors.

[0152] The method for treating a patient of embodiment 63, wherein said immune cells are recovered from patients.

Preliminary Definitions

[0153] The term "extracellular ligand-binding domain" as used herein is defined as an oligo- or polypeptide that is capable of binding a ligand. Preferably, the domain will be capable of interacting with a cell surface molecule. More preferably, said domain will be capable of interacting with a CLL1 cell surface molecule.

[0154] The term "derived from" means a polypeptide having an amino acid sequence which is equivalent to that an Fc.epsilon. receptor which include one or more amino acid modification(s) of the sequence of the Fc.epsilon. receptor. Such amino acid modification(s) may include amino acid substitution(s), deletion(s), addition(s) or a combination of any of those modifications, and may alter the biological activity of the Fc binding region relative to that of an Fc receptor. On the other hand, Fc binding regions derived from a particular Fc receptor may include one or more amino acid modification(s) which do not substantially alter the biological activity of the Fc binding region relative to that of an Fc receptor. Amino acid modification(s) of this kind will typically comprise conservative amino acid substitution(s).

[0155] "identity" refers to sequence identity between two nucleic acid molecules or polypeptides. Identity can be determined by comparing a position in each sequence which may be aligned for purposes of comparison. When a position in the compared sequence is occupied by the same base, then the molecules are identical at that position. A degree of similarity or identity between nucleic acid or amino acid sequences is a function of the number of identical or matching nucleotides at positions shared by the nucleic acid sequences. Various alignment algorithms and/or programs may be used to calculate the identity between two sequences, including FASTA, or BLAST which are available as a part of the GCG sequence analysis package (University of Wisconsin, Madison, Wis.), and can be used with, e.g., default setting. For example, polypeptides having at least 70%, 85%, 90%, 95%, 98% or 99% identity to specific polypeptides described herein and preferably exhibiting substantially the same functions, as well as polynucleotide encoding such polypeptides, are contemplated. Unless otherwise indicated a similarity score will be based on use of BLOSUM62. When BLASTP is used, the percent similarity is based on the BLASTP positives score and the percent sequence identity is based on the BLASTP identities score. BLASTP "Identities" shows the number and fraction of total residues in the high scoring sequence pairs which are identical; and BLASTP "Positives" shows the number and fraction of residues for which the alignment scores have positive values and which are similar to each other. Amino acid sequences having these degrees of identity or similarity or any intermediate degree of identity of similarity to the amino acid sequences disclosed herein are contemplated and encompassed by this disclosure. The polynucleotide sequences of similar polypeptides are deduced using the genetic code and may be obtained by conventional means, in particular by reverse translating its amino acid sequence using the genetic code.

[0156] Anti-CLL1 Multi-Chain CARs of the Invention

[0157] The present invention relates to a multi-chain chimeric antigen receptor (CAR) particularly adapted to immune cells used in immunotherapy.

[0158] In particular, the present invention provides a CLL1 specific multi-chain Chimeric Antigen Receptor (mc CAR) comprising at least:

[0159] a first transmembrane polypeptide comprising at least one extracellular ligand-binding domain, wherein the at least one extracellular ligand-binding domain binds to the cell surface CLL1 antigen; and;

[0160] a second polypeptide comprising at least one signal-transducing domain;

[0161] wherein the signal transducing domain(s) of the multi-chain Chimeric Antigen Receptor is present on a polypeptide distinct from that carrying the extracellular ligand-binding domain(s).

[0162] By "a polypeptide distinct from that carrying the extracellular ligand-binding domain(s)", it is meant that there is no peptidic binding between the two polypeptides.

[0163] The present invention provides an anti-CLL1 multi-chain chimeric antigen receptor (CAR) (CLL1 mcCAR anti-CLL1 mc) having a structure as illustrated in FIG. 2, FIG. 3, or FIG. 4, and according to claim 1, 2 and/or 3 said structure comprising an extra cellular ligand binding-domain VH and V.sub.L from a monoclonal anti-CLL1 antibody or CDR sequences.

[0164] In a preferred embodiment, said second polypeptide comprising at least one signal-transducing domain containing polypeptide is a transmembrane polypeptide.

[0165] In another preferred embodiment, said least one transmembrane polypeptide comprises a part of Fc receptor. More preferably, said part of Fc receptor is selected from the group consisting of: (a) Fc.epsilon.RI alpha chain, (b) Fc.epsilon.RI beta chain and (c) Fc.epsilon.RI gamma chain.

[0166] According to an embodiment, said first transmembrane polypeptide from the alpha chain of high-affinity IgE receptor (Fc.epsilon.RI) which is fused to an extracellular CLL1 ligand binding domain.

[0167] According to an embodiment, the present invention provides a CLL1 specific multi-chain Chimeric Antigen Receptor (mc CAR) as above further comprising:

[0168] said second transmembrane polypeptide from the gamma or beta chain of Fc.epsilon.RI which is fused to a signal transducing domain;

[0169] According to another embodiment, the present invention provides a CLL1 specific multi-chain Chimeric Antigen Receptor (mc CAR) according as above, further comprising:

[0170] A third transmembrane polypeptide from the gamma or beta chain of Fc.epsilon.RI comprising a co-stimulatory domain.

[0171] The present invention preferably provides a CLL1 specific multi-chain Chimeric Antigen Receptor (mc CAR) comprising:

[0172] a first transmembrane polypeptide from the alpha chain of high-affinity IgE receptor (Fc.epsilon.RI) fused to an extracellular ligand binding domain specifically binding to CLL1 comprising a single-chain variable fragment (scFv) comprising a heavy (V.sub.H) and a light (V.sub.L) chain conferring specificity to CLL1,

[0173] a second transmembrane polypeptide from the gamma or beta chain of Fc.epsilon.RI fused to a signal transducing domain; and

[0174] a third transmembrane polypeptide from the gamma or beta chain of Fc.epsilon.RI comprising a co-stimulatory domain.

[0175] In a more preferred embodiment said anti-CLL1 CARs are constructed with these sequences and correspond to the constructions illustrated in FIG. 4.

[0176] In more particular embodiment, said multi-chain CAR can comprise a part of Fc.epsilon.RI alpha chain and a part of Fc.epsilon.RI beta chain or variant thereof such that said Fc.epsilon.RI chains spontaneously dimerize together to form a dimeric Chimeric Antigen Receptor. In another embodiment, the multi-chain Chimeric Antigen can comprise a part of Fc.epsilon.RI alpha chain and a part of a Fc.epsilon.RI gamma chain or variant thereof such that said Fc.epsilon.RI chains spontaneously trimerize together to form a trimeric Chimeric Antigen Receptor, and in another embodiment the multi-chain Chimeric Antigen Receptor can comprise a part of Fc.epsilon.RI alpha chain, a part of Fc.epsilon.RI beta chain and a part of Fc.epsilon.RI gamma chain or variants thereof such that said Fc.epsilon.RI chains spontaneously tetramerize together to form a tetrameric Chimeric Antigen Receptor.

[0177] As non-limiting example, different versions (architectures) of multi-chain CAR are illustrated in FIG. 3. In a preferred embodiment, two versions (architectures) of multi-chain CAR are illustrated in FIG. 4. In a more preferred embodiment, the multi-chain CARs of the present invention comprises a polypeptide comprising amino acid sequences as set forth in Table 6. In another preferred embodiment the multi-chain CAR comprise a polypeptide with amino acid sequence that has at least 70%, preferably at least 80%, more preferably at least 90%, 95% 97% or 99% sequence identity with such amino acid sequences or with the polynucleotide sequence encoding one two or three of the polypeptides constitutive of the multi-chain polypeptide structure.

[0178] The present invention provides a polypeptide encoding a CLL1 specific multi-chain Chimeric Antigen Receptor as above, comprising a polypeptide sequence displaying at least 80% identity to the full amino acid sequence of anti-CLL1 SC02-357, SC02-378, SC02-161, M26, M31, G4, M22, M29, M2, M5, G12, 21.26 and 1075.7 as referred to in Table 6.

[0179] Extracellular Binding Domains, Hinges and Transmembrane Domains

[0180] The distinguishing features of appropriate transmembrane polypeptides comprise the ability to be expressed at the surface of an immune cell, in particular lymphocyte cells or Natural killer (NK) cells, and to interact together for directing cellular response of immune cell against a predefined target cell. The different transmembrane polypeptides of the multi-chain CAR of the present invention comprising an extracellular ligand-binding domain and/or a signal transducing domain interact together to take part in signal transduction following the binding with a target ligand and induce an immune response. The transmembrane domain can be derived either from a natural or from a synthetic source. The transmembrane domain can be derived from any membrane-bound or transmembrane protein. As non limiting examples, the transmembrane polypeptide can be a subunit of the T cell receptor such as .alpha., .beta., .gamma. or , polypeptide constituting CD3 complex, IL2 receptor p55 (.alpha. chain), p75 (.beta. chain) or .gamma. chain, subunit chain of Fc receptors, in particular Fc.gamma. receptor III or CD proteins. Alternatively the transmembrane domain can be synthetic and can comprise predominantly hydrophobic residues such as leucine and valine.

[0181] The present invention provides a CLL1 specific multi-chain Chimeric Antigen Receptor according to any one of the above, wherein said CLL1 ligand binding domain fused to said alpha chain of Fc.epsilon.RI is a single-chain variable fragment (scFv) comprising heavy (V.sub.H) and light (V.sub.L) chains conferring specificity to CLL1.

[0182] In a preferred embodiment, said extracellular ligand-binding domain is a single chain antibody fragment (scFv) comprising the light (V.sub.L) and the heavy (V.sub.H) variable fragment of a target antigen specific monoclonal antibody specific to CLL1 joined by a flexible linker. In a preferred embodiment, said scFv is an anti-CLL1 scFV, preferably provided in Table 5 as SEQ ID NO. 13 to 36. Binding domain specific to CLL1 other than scFv can also be used for predefined targeting of lymphocytes, such as camelid or shark (VNAR) single-domain antibody fragments or receptor ligands like a vascular endothelial growth factor polypeptide, an integrin-binding peptide, heregulin or an IL-13 mutein, antibody binding domains, antibody hypervariable loops or CDRs as non-limiting examples.

[0183] The present invention provides a CLL1 specific multi-chain Chimeric Antigen Receptor as above, wherein said V.sub.H comprises a polypeptide sequence having at least 80% to at least 90% identity with one of the polypeptide sequences selected from SEQ ID NO. 13, 14, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33 and 35.

[0184] The present invention provides a CLL1 specific multi-chain Chimeric Antigen Receptor as above wherein said V.sub.L comprises a polypeptide having at least 80% to at least 90% identity with one of the polypeptide sequences selected from SEQ ID NO. 16, 18, 20, 22, 24, 26, 28, 30, 32, 34 and 36.

[0185] In a more preferred embodiment, the present invention provides a CLL1 specific multi-chain Chimeric Antigen Receptor (mcAR) wherein said extra cellular ligand binding-domain comprises a VH from a monoclonal anti-CLL1 antibody containing at least one of the following CDR sequences: GSISSSNWWS (SEQ ID NO 37), WIGEIYHSGSPDY (SEQ ID NO 38), KVSTGGFFDY (SEQ ID NO 39), and GSISSSNWWS (SEQ ID NO 40), WIGEIYHSGSPNY (SEQ ID NO 41), RSSSGGFFDY (SEQ ID NO 42), and GSISSSNWWS (SEQ ID NO 43), WIGEIYHSGSPNY (SEQ ID NO 44), RQTTAGSFDY (SEQ ID NO 45), and GYTFTSYFIH (SEQ ID NO 49), WIGFINPYNDGSKY (SEQ ID NO 50), TRDDGYYGYAMDY (SEQ ID NO 51), and GYTFTSYVMH (SEQ ID NO 55), WIGYINPYNDGTKY (SEQ ID NO 56), ARPIYFDNDY (SEQ ID NO 57), and QQNNYDPW (SEQ ID NO 61), WIGPINPYNDGTI (SEQ ID NO 62), ARTDDYDDYTMDY (SEQ ID NO 63), and GYTFTRYWMH (SEQ ID NO 67), WIGNIDPSDTETHY (SEQ ID NO 68), AIYYGNPSYYAMDY (SEQ ID NO 69), and GYIFTSYVMY (SEQ ID NO 73), WIGYINPY (SEQ ID NO 74), ARYYDYDYYFDY (SEQ ID NO 75), and GYTFTSYFMH (SEQ ID NO 79), WIGFINPYNDGTKY (SEQ ID NO 80), TRDDGYYDYAMDY (SEQ ID NO 81), and GFNIKDDYIH (SEQ ID NO 85), WIGWIDPEKGDTAYA (SEQ ID NO 86), TLTGRFDY (SEQ ID NO 87), and GYTFPSSNIH (SEQ ID NO 91), WIGVIYPGNGDTSY (SEQ ID NO 92), AIYFVYNWHFDV (SEQ ID NO 93), and GYTFTRYWMH (SEQ ID NO 97), MIHPSSGSTSYNEKVK (SEQ ID NO 98), RDGDYYYGTGDY (SEQ ID NO 99), and GYSITSAYYWN (SEQ ID NO 103), YISYDGRNNYNPSLKN (SEQ ID NO 104) and AKEGDYDVGNYYAMDY (SEQ ID NO 105);

[0186] and comprises a VL from a monoclonal anti-CLL1 antibody containing at least one of the following CDR sequences: QSISSYLN (SEQ ID NO 46), LLIYAASSLQS (SEQ ID NO 47), QQSYSTPP (SEQ ID NO 48), and QELSGYLS (SEQ ID NO 52), RLIYAASTLDS (SEQ ID NO 53), LQYAIYPY (SEQ ID NO 54), and ESVDSYGNSFMH (SEQ ID NO 58), LLIYLASNLES (SEQ ID NO 59), QQNNYDPW (SEQ ID NO 60), HDISNYLN (SEQ ID NO 64), LLIYYTSRLHS (SEQ ID NO 65), QQGKTLLW (SEQ ID NO 66), and QNLLNSGNQKKYLN (SEQ ID NO 70), LLIYWASTRES (SEQ ID NO 71), QNDYSYPF (SEQ ID NO 72), and QDINKYIA (SEQ ID NO 76), LLIHYTSTLQP (SEQ ID NO 77), LQYDYLW (SEQ ID NO 78), and QEISVYLS (SEQ ID NO 82), RLIYAASTLDS (SEQ ID NO 83), LQYASYPY (SEQ ID NO 84), and QSLLYSSNQKNNLA (SEQ ID NO 88), LLIYWASTRES (SEQ ID NO 89), QQYYSYR (SEQ ID NO 90), and ESVDGYGDIFML (SEQ ID NO 94), LLIYFASNLES (SEQ ID NO 95), QQNNEDPY (SEQ ID NO 96), and RASSSINYMH (SEQ ID NO 100), PWIFATSNLAS (SEQ ID NO 101), QQWRSDRALT (SEQ ID NO 102), and RASSNVISSYVH (SEQ ID NO 106), LWIYSTSNLAS (SEQ ID NO 107) and QQYSGYPLT (SEQ ID NO 108).

[0187] The present invention provides a CLL1 specific multi-chain Chimeric Antigen Receptor as above, wherein said alpha chain of Fc.epsilon.RI is fused to said extracellular ligand-binding domain by a hinge from CD8.alpha., IgG1 or FcRIII.alpha. proteins.

[0188] The present invention provides a CLL1 specific multi-chain Chimeric Antigen Receptor as above, wherein said hinge comprises a polypeptide sequence displaying at least 90% identity with SEQ ID NO. 2. In one preferred embodiment, said hinge comprises a polypeptide of SEQ ID NO. 2.

[0189] In a preferred embodiment said first transmembrane polypeptide further comprises a stalk region between said extracellular ligand-binding domain and said transmembrane domain. The term "stalk region" used herein generally means any oligo- or polypeptide that functions to link the transmembrane domain to the extracellular ligand-binding domain. In particular, stalk region are used to provide more flexibility and accessibility for the extracellular ligand-binding domain. A stalk region may comprise up to 300 amino acids, preferably 10 to 100 amino acids and most preferably 25 to 50 amino acids. Stalk region may be derived from all or part of naturally occurring molecules, such as from all or part of the extracellular region of CD8, CD4 or CD28, or from all or part of an antibody constant region. Alternatively the stalk region may be a synthetic sequence that corresponds to a naturally occurring stalk sequence, or may be an entirely synthetic stalk sequence. In a preferred embodiment said stalk region is a part of human CD8 alpha chain (e.g. NP_001139345.1) (SEQ ID NO: 2). Thus, the expression of multi-chain CAR in immune cells results in modified cells that selectively and eliminate defined targets, including but not limited to malignant cells carrying a respective tumor-associated surface antigen or virus infected cells carrying a virus-specific surface antigen, or target cells carrying a lineage-specific or tissue-specific surface antigen.

[0190] The present invention provides a CLL1 specific multi-chain Chimeric Antigen Receptor as above, wherein said alpha chain of Fc.epsilon.RI is fused to said extracellular ligand-binding domain by a hinge from CD8.alpha., IgG1 or FcRIII.alpha. proteins.

[0191] The present invention provides a CLL1 specific multi-chain Chimeric Antigen Receptor as above, wherein said hinge comprises a polypeptide sequence displaying at least 90% identity to SEQ ID NO. 2.

[0192] Downregulation or mutation of target antigens is commonly observed in cancer cells, creating antigen-loss escape variants. Thus, to offset tumor escape and render immune cell more specific to target, the multi-chain CAR can comprise several extracellular ligand-binding domains, to simultaneously bind different elements in target thereby augmenting immune cell activation and function. In one embodiment, the extracellular ligand-binding domains can be placed in tandem on the same transmembrane polypeptide, and optionally can be separated by a linker.

[0193] In another embodiment, said different extracellular ligand-binding domains can be placed on different transmembrane polypeptides composing the multi-chain CAR.

[0194] In another embodiment, the present invention relates to a population of multi-chain CARs comprising each one different extracellular ligand binding domains. In a particular one, the present invention relates to a method of engineering immune cells comprising providing an immune cell and expressing at the surface of said cell a population of multi-chain CAR each one comprising different extracellular ligand binding domains. In another particular embodiment, the present invention relates to a method of engineering an immune cell comprising providing an immune cell and introducing into said cell polynucleotides encoding polypeptides composing a population of multi-chain CAR each one comprising different extracellular ligand binding domains. In a particular embodiment the method of engineering an immune cell comprises expressing at the surface of the cell at least a part of Fc.epsilon.RI beta and/or gamma chain fused to a signal-transducing domain and several part of Fc.epsilon.RI alpha chains fused to different extracellular ligand binding domains. In a more particular embodiment, said method comprises introducing into said cell at least one polynucleotide which encodes a part of Fc.epsilon.RI beta and/or gamma chain fused to a signal-transducing domain and several Fc.epsilon.RI alpha chains fused to different extracellular ligand binding domains. By population of multi-chain CARs, it is meant at least two, three, four, five, six or more multi-chain CARs each one comprising different extracellular ligand binding domains. The different extracellular ligand binding domains according to the present invention can preferably simultaneously bind different elements in target thereby augmenting immune cell activation and function.

[0195] Transduction Signalling Domains

[0196] The signal transducing domain or intracellular signaling domain of the multi-chain CAR of the invention is responsible for intracellular signaling following the binding of extracellular ligand binding domain to the target resulting in the activation of the immune cell and immune response. In other words, the signal transducing domain is responsible for the activation of at least one of the normal effector functions of the immune cell in which the multi-chain CAR is expressed. For example, the effector function of a T cell can be a cytolytic activity or helper activity including the secretion of cytokines. Thus, the term "signal transducing domain" refers to the portion of a protein which transduces the effector signal function signal and directs the cell to perform a specialized function.

[0197] The present invention provides a CLL1 specific multi-chain Chimeric Antigen Receptor according to any one of the above embodiments, wherein said signal transducing domain fused to the gamma or beta chain of Fc.epsilon.RI is from the TCR zeta chain, the Fc.epsilon. R.beta. chain, the Fc.epsilon.RI.gamma. chain, or includes an immunoreceptor tyrosine-based activation motif (ITAM), preferably said signal transducing domain is from CD3zeta, more preferably comprising a polypeptide sequence of SEQ ID NO. 10.

[0198] The present invention provides a CLL1 specific multi-chain Chimeric Antigen Receptor according to any one of the above embodiments, wherein said signal transducing domain fused to the gamma or beta chain of Fc.epsilon.RI is from the TCR zeta chain, the Fc.epsilon.R.beta. chain, the Fc.epsilon.RI.gamma. chain, or includes an immunoreceptor tyrosine-based activation motif (ITAM).

[0199] The present invention provides a CLL1 specific multi-chain Chimeric Antigen Receptor according to any one of the above embodiments, wherein said signal transducing domain fused to the gamma or beta chain of Fc.epsilon.RI is from the TCR zeta chain.

[0200] The present invention provides a CLL1 specific multi-chain Chimeric Antigen Receptor according to any one of the above embodiments, wherein said signal transducing domain fused to the gamma or beta chain of Fc.epsilon.RI is from the Fc.epsilon.R.beta. chain.

[0201] The present invention provides a CLL1 specific multi-chain Chimeric Antigen Receptor according to any one of the above embodiments, wherein said signal transducing domain fused to the gamma or beta chain of Fc.epsilon.RI is from the Fc.epsilon.RI.gamma. chain.

[0202] The present invention provides a CLL1 specific multi-chain Chimeric Antigen Receptor according to any one of the above embodiments, wherein said signal transducing domain fused to the gamma or beta chain of Fc.epsilon.RI comprises an immunoreceptor tyrosine-based activation motif (ITAM).

[0203] The present invention provides a CLL1 specific multi-chain Chimeric Antigen Receptor as above, wherein said signal transducing domain is from CD3zeta, preferably the present invention provides a CLL1 specific multi-chain Chimeric Antigen Receptor as above, wherein said signal transducing domain comprises a polypeptide sequence displaying at least 90% identity to SEQ ID NO. 10. In one embodiment, said signal transducing domain comprises a polypeptide sequence of SEQ ID NO. 10.

[0204] Preferred examples of signal transducing domain for use in multi-chain CAR can be the cytoplasmic sequences of the Fc receptor or T cell receptor and co-receptors that act in concert to initiate signal transduction following antigen receptor engagement, as well as any derivate or variant of these sequences and any synthetic sequence that as the same functional capability. Signal transduction domain comprises two distinct classes of cytoplasmic signaling sequence, those that initiate antigen-dependent primary activation, and those that act in an antigen-independent manner to provide a secondary or co-stimulatory signal. Primary cytoplasmic signaling sequence can comprise signaling motifs which are known as immunoreceptor tyrosine-based activation motifs of ITAMs. ITAMs are well defined signaling motifs found in the intracytoplasmic tail of a variety of receptors that serve as binding sites for syk/zap70 class tyrosine kinases. Examples of ITAM used in the invention can include as non limiting examples those derived from TCRzeta, FcRgamma, FcRbeta, FcRepsilon, CD3gamma, CD3delta, CD3epsilon, CD5, CD22, CD79a, CD79b and CD66d. In a preferred embodiment, the signaling transducing domain of the multi-chain CAR can comprise the CD3zeta signaling domain, or the intracytoplasmic domain of the Fc.epsilon.RI beta or gamma chains.

[0205] The present invention provides a CLL1 specific multi-chain Chimeric Antigen Receptor according to any one of the above, wherein said signal transducing domain fused to the gamma or beta chain of Fc.epsilon.RI is from the TCR zeta chain, the Fc.epsilon.R.beta. chain, the Fc.epsilon.RI.gamma. chain, or includes an immunoreceptor tyrosine-based activation motif (ITAM).

[0206] The present invention provides a CLL1 specific multi-chain Chimeric Antigen Receptor as above, wherein said signal transducing domain is from CD3zeta.

[0207] The present invention provides a CLL1 specific multi-chain Chimeric Antigen Receptor as above, wherein said signal transducing domain comprises a polypeptide sequence displaying at least 90% identity to SEQ ID NO. 10.

[0208] In another particular embodiment, said signal transducing domain is a TNFR-associated Factor 2 (TRAF2) binding motifs, intracytoplasmic tail of costimulatory TNFR member family. Cytoplasmic tail of costimulatory TNFR family member contains TRAF2 binding motifs consisting of the major conserved motif (P/S/A)X(Q/E)E) or the minor motif (PXQXXD), wherein X is any amino acid. TRAF proteins are recruited to the intracellular tails of many TN FRs in response to receptor trimerization.

[0209] In a preferred embodiment, the signal transduction domain of the multi-chain CAR of the present invention comprises a part of co-stimulatory signal molecule selected from the group consisting of 4-1BB (GenBank: AAA53133.) and CD28 (NP_006130.1).

[0210] Co-Stimulatory Domains

[0211] In particular embodiment the signal transduction domain of the multi-chain CAR of the present invention comprises a co-stimulatory signal molecule. A co-stimulatory molecule is a cell surface molecule other than an antigen receptor or their ligands that is required for an efficient immune response.

[0212] A "co-stimulatory molecule" refers to the cognate binding partner on a T-cell that specifically binds with a co-stimulatory ligand, thereby mediating a co-stimulatory response by the cell, such as, but not limited to proliferation. Co-stimulatory molecules include, but are not limited to an MHC class I molecule, BTLA and Toll ligand receptor.

[0213] The present invention is related to a CLL1 specific multi-chain Chimeric Antigen Receptor as any of the above embodiment, wherein said second or third polypeptide comprises a co-stimulatory domain from the cytoplasmic domain of a costimulatory molecule selected from CD7, B7-1 (CD80), B7-2 (CD86), PD-L1, PD-L2, 4-1BBL, OX40L, inducible costimulatory ligand (ICOS-L), intercellular adhesion molecule (ICAM, CD30L, CD40, CD70, CD83, HLA-G, MICA, M1CB, HVEM, lymphotoxin beta receptor, 3/TR6, ILT3, ILT4, an agonist or antibody that binds Toll ligand receptor and a ligand that specifically binds with B7-H3. A co-stimulatory ligand also encompasses, inter alia, an antibody that specifically binds with a co-stimulatory molecule present on a T cell, such as but not limited to, CD27, CD28, 4-IBB, OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LTGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83.

[0214] In a preferred embodiment, the present invention is related to a CLL1 specific multi-chain Chimeric Antigen Receptor as any of the above embodiment, wherein said second or third polypeptide comprises a co-stimulatory domain from the cytoplasmic domain of a costimulatory molecule from CD28.

[0215] In a preferred embodiment, the present invention is related to a CLL1 specific multi-chain Chimeric Antigen Receptor as any of the above embodiment, wherein said second or third polypeptide comprises a co-stimulatory domain from the cytoplasmic domain of a costimulatory molecule from 4-1BB.

[0216] The present invention provides a CLL1 specific multi-chain Chimeric Antigen Receptor as above, wherein said co-stimulatory domain is from 4-1BB and comprises a polypeptide sequence displaying at least 90% identity with SEQ ID NO. 6. In one embodiment, said co-stimulatory domain is from 4-1BB and comprises a polypeptide sequence of SEQ ID NO. 6.

[0217] The present invention provides a CLL1 specific multi-chain Chimeric Antigen Receptor as above, wherein said co-stimulatory domain is from CD28 and comprises a polypeptide sequence displaying at least 90% identity to SEQ ID NO. 7.

[0218] Exemplary CLL1 Multi Chain CARs

[0219] In one embodiment, the present invention provides a CLL1 specific multi-chain Chimeric Antigen Receptor (mc CAR) comprising:

[0220] a transmembrane polypeptide from the alpha chain of high-affinity IgE receptor (Fc.epsilon.RI) fused to an extracellular CLL1 ligand binding domain,

[0221] a second transmembrane polypeptide from the gamma or beta chain of Fc.epsilon.RI fused to a signal transducing domain; and

[0222] a third transmembrane polypeptide from the gamma or beta chain of Fc.epsilon.RI comprising a co-stimulatory domain.

[0223] wherein said extra cellular ligand binding-domain comprising a VH from a monoclonal anti-CLL1 antibody containing at least one of the following CDR sequences: GSISSSNWWS (SEQ ID NO 37), WIGEIYHSGSPDY (SEQ ID NO 38), KVSTGGFFDY (SEQ ID NO 39), and GSISSSNWWS (SEQ ID NO 40), WIGEIYHSGSPNY (SEQ ID NO 41), RSSSGGFFDY (SEQ ID NO 42), and GSISSSNWWS (SEQ ID NO 43), WIGEIYHSGSPNY (SEQ ID NO 44), RQTTAGSFDY (SEQ ID NO 45), and GYTFTSYFIH (SEQ ID NO 49), WIGFINPYNDGSKY (SEQ ID NO 50), TRDDGYYGYAMDY (SEQ ID NO 51), and GYTFTSYVMH (SEQ ID NO 55), WIGYINPYNDGTKY (SEQ ID NO 56), ARPIYFDNDY (SEQ ID NO 57), and QQNNYDPW (SEQ ID NO 61), WIGPINPYNDGTI (SEQ ID NO 62), ARTDDYDDYTMDY (SEQ ID NO 63), and GYTFTRYWMH (SEQ ID NO 67), WIGNIDPSDTETHY (SEQ ID NO 68), AIYYGNPSYYAMDY (SEQ ID NO 69), and GYIFTSYVMY (SEQ ID NO 73), WIGYINPY (SEQ ID NO 74), ARYYDYDYYFDY (SEQ ID NO 75), and GYTFTSYFMH (SEQ ID NO 79), WIGFINPYNDGTKY (SEQ ID NO 80), TRDDGYYDYAMDY (SEQ ID NO 81), and GFNIKDDYIH (SEQ ID NO 85), WIGWIDPEKGDTAYA (SEQ ID NO 86), TLTGRFDY (SEQ ID NO 87), and GYTFPSSNIH (SEQ ID NO 91), WIGVIYPGNGDTSY (SEQ ID NO 92), AIYFVYNWHFDV (SEQ ID NO 93), and GYTFTRYWMH (SEQ ID NO 97), MIHPSSGSTSYNEKVK (SEQ ID NO 98), RDGDYYYGTGDY (SEQ ID NO 99), and GYSITSAYYWN (SEQ ID NO 103), YISYDGRNNYNPSLKN (SEQ ID NO 104) and AKEGDYDVGNYYAMDY (SEQ ID NO 105);

[0224] and comprising a V.sub.L from a monoclonal anti-CLL1 antibody containing at least one of the following CDR sequences: QSISSYLN (SEQ ID NO 46), LLIYAASSLQS (SEQ ID NO 47), QQSYSTPP (SEQ ID NO 48), and QELSGYLS (SEQ ID NO 52), RLIYAASTLDS (SEQ ID NO 53), LQYAIYPY (SEQ ID NO 54), and ESVDSYGNSFMH (SEQ ID NO 58), LLIYLASNLES (SEQ ID NO 59), QQNNYDPW (SEQ ID NO 60), HDISNYLN (SEQ ID NO 64), LLIYYTSRLHS (SEQ ID NO 65), QQGKTLLW (SEQ ID NO 66), and QNLLNSGNQKKYLN (SEQ ID NO 70), LLIYWASTRES (SEQ ID NO 71), QNDYSYPF (SEQ ID NO 72), and QDINKYIA (SEQ ID NO 76), LLIHYTSTLQP (SEQ ID NO 77), LQYDYLW (SEQ ID NO 78), and QEISVYLS (SEQ ID NO 82), RLIYAASTLDS (SEQ ID NO 83), LQYASYPY (SEQ ID NO 84), and QSLLYSSNQKNNLA (SEQ ID NO 88), LLIYWASTRES (SEQ ID NO 89), QQYYSYR (SEQ ID NO 90), and ESVDGYGDIFML (SEQ ID NO 94), LLIYFASNLES (SEQ ID NO 95), QQNNEDPY (SEQ ID NO 96), and RASSSINYMH (SEQ ID NO 100), PWIFATSNLAS (SEQ ID NO 101), QQWRSDRALT (SEQ ID NO 102), and RASSNVISSYVH (SEQ ID NO 106), LWIYSTSNLAS (SEQ ID NO 107) and QQYSGYPLT (SEQ ID NO 108).

[0225] In one embodiment, the present invention provides a CLL1 specific multi-chain Chimeric Antigen Receptor (CLL1 mc CAR) comprising:

[0226] a first transmembrane polypeptide from the alpha chain of high-affinity IgE receptor (Fc.epsilon.RI) fused to an extracellular CLL1 ligand binding domain,

[0227] a second transmembrane polypeptide from the gamma or beta chain of Fc.epsilon.RI fused to a signal transducing domain; and

[0228] a third transmembrane polypeptide from the gamma or beta chain of Fc.epsilon.RI comprising a co-stimulatory domain.

[0229] wherein said extra cellular ligand binding-domain comprising a VH from a monoclonal anti-CLL1 antibody containing at least one of the following CDR sequences: GSISSSNWWS (SEQ ID NO 37), WIGEIYHSGSPDY (SEQ ID NO 38), KVSTGGFFDY (SEQ ID NO 39), and GSISSSNWWS (SEQ ID NO 40), WIGEIYHSGSPNY (SEQ ID NO 41), RSSSGGFFDY (SEQ ID NO 42), and GSISSSNWWS (SEQ ID NO 43), WIGEIYHSGSPNY (SEQ ID NO 44), RQTTAGSFDY (SEQ ID NO 45), and GYTFTSYFIH (SEQ ID NO 49), WIGFINPYNDGSKY (SEQ ID NO 50), TRDDGYYGYAMDY (SEQ ID NO 51), and GYTFTSYVMH (SEQ ID NO 55), WIGYINPYNDGTKY (SEQ ID NO 56), ARPIYFDNDY (SEQ ID NO 57), and QQNNYDPW (SEQ ID NO 61), WIGPINPYNDGTI (SEQ ID NO 62), ARTDDYDDYTMDY (SEQ ID NO 63), and GYTFTRYWMH (SEQ ID NO 67), WIGNIDPSDTETHY (SEQ ID NO 68), AIYYGNPSYYAMDY (SEQ ID NO 69), and GYIFTSYVMY (SEQ ID NO 73), WIGYINPY (SEQ ID NO 74), ARYYDYDYYFDY (SEQ ID NO 75), and GYTFTSYFMH (SEQ ID NO 79), WIGFINPYNDGTKY (SEQ ID NO 80), TRDDGYYDYAMDY (SEQ ID NO 81), and GFNIKDDYIH (SEQ ID NO 85), WIGWIDPEKGDTAYA (SEQ ID NO 86), TLTGRFDY (SEQ ID NO 87), and GYTFPSSNIH (SEQ ID NO 91), WIGVIYPGNGDTSY (SEQ ID NO 92), AIYFVYNWHFDV (SEQ ID NO 93), and GYTFTRYWMH (SEQ ID NO 97), MIHPSSGSTSYNEKVK (SEQ ID NO 98), RDGDYYYGTGDY (SEQ ID NO 99), and GYSITSAYYWN (SEQ ID NO 103), YISYDGRNNYNPSLKN (SEQ ID NO 104) and AKEGDYDVGNYYAMDY (SEQ ID NO 105);

[0230] and comprising a VL from a monoclonal anti-CLL1 antibody containing at least one of the following CDR sequences: QSISSYLN (SEQ ID NO 46), LLIYAASSLQS (SEQ ID NO 47), QQSYSTPP (SEQ ID NO 48), and QELSGYLS (SEQ ID NO 52), RLIYAASTLDS (SEQ ID NO 53), LQYAIYPY (SEQ ID NO 54), and ESVDSYGNSFMH (SEQ ID NO 58), LLIYLASNLES (SEQ ID NO 59), QQNNYDPW (SEQ ID NO 60), HDISNYLN (SEQ ID NO 64), LLIYYTSRLHS (SEQ ID NO 65), QQGKTLLW (SEQ ID NO 66), and QNLLNSGNQKKYLN (SEQ ID NO 70), LLIYWASTRES (SEQ ID NO 71), QNDYSYPF (SEQ ID NO 72), and QDINKYIA (SEQ ID NO 76), LLIHYTSTLQP (SEQ ID NO 77), LQYDYLW (SEQ ID NO 78), and QEISVYLS (SEQ ID NO 82), RLIYAASTLDS (SEQ ID NO 83), LQYASYPY (SEQ ID NO 84), and QSLLYSSNQKNNLA (SEQ ID NO 88), LLIYWASTRES (SEQ ID NO 89), QQYYSYR (SEQ ID NO 90), and ESVDGYGDIFML (SEQ ID NO 94), LLIYFASNLES (SEQ ID NO 95), QQNNEDPY (SEQ ID NO 96), and RASSSINYMH (SEQ ID NO 100), PWIFATSNLAS (SEQ ID NO 101), QQWRSDRALT (SEQ ID NO 102), and RASSNVISSYVH (SEQ ID NO 106), LWIYSTSNLAS (SEQ ID NO 107) and QQYSGYPLT (SEQ ID NO 108).

[0231] and a hinge between VH and V.sub.L (alpha chain),

[0232] wherein said signal transducing domain (or cytoplasmic transmembrane domain) comprises a CD3 zeta signaling domain (gamma chain), and

[0233] wherein said co-stimulatory domain comprises a co-stimulatory transmembrane domain from 4-1BB or CD28 (beta chain).

[0234] The present invention provides CLL1 specific multi-chain Chimeric Antigen Receptors (CLL1 mc CARs) as any of the above embodiments, comprising the peptide sequences according to Table 6 as follows, and wherein the polypeptide sequences has at least 80% identity with the following peptide sequences:

[0235] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 13, SEQ ID NO. 3, SEQ ID NO. 16, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0236] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 13, SEQ ID NO. 3, SEQ ID NO. 16, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0237] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 14, SEQ ID NO. 3, SEQ ID NO. 16, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0238] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 15, SEQ ID NO. 3, SEQ ID NO. 16, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0239] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 15, SEQ ID NO. 3, SEQ ID NO. 16, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0240] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 15, SEQ ID NO. 3, SEQ ID NO. 16, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0241] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 17, SEQ ID NO. 3, SEQ ID NO. 18, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0242] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 17, SEQ ID NO. 3, SEQ ID NO. 18, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0243] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 19, SEQ ID NO. 3, SEQ ID NO. 20, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0244] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 19, SEQ ID NO. 3, SEQ ID NO. 20, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0245] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 21, SEQ ID NO. 3, SEQ ID NO. 22, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0246] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 21, SEQ ID NO. 3, SEQ ID NO. 22 SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0247] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 23, SEQ ID NO. 3, SEQ ID NO. 24, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0248] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 23, SEQ ID NO. 3, SEQ ID NO. 24, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0249] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 25, SEQ ID NO. 3, SEQ ID NO. 26, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0250] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 25, SEQ ID NO. 3, SEQ ID NO. 26, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0251] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 27, SEQ ID NO. 3, SEQ ID NO. 28, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0252] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 27, SEQ ID NO. 3, SEQ ID NO. 28, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0253] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 29, SEQ ID NO. 3, SEQ ID NO. 30, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0254] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 29, SEQ ID NO. 3, SEQ ID NO. 30, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0255] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 31, SEQ ID NO. 3, SEQ ID NO. 32, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0256] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 31, SEQ ID NO. 3, SEQ ID NO. 32, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0257] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 33, SEQ ID NO. 3, SEQ ID NO. 34, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0258] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 33, SEQ ID NO. 3, SEQ ID NO. 34, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0259] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 33, SEQ ID NO. 3, SEQ ID NO. 36, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0260] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 35, SEQ ID NO. 3, SEQ ID NO. 36, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7.

[0261] In a preferred embodiment, the present invention provides CLL1 specific multi-chain Chimeric Antigen Receptors (CLL1 mc CARs), wherein the polypeptide sequences has at least 90% identity with the preceeding peptide sequences.

[0262] In a more preferred embodiment, the present invention provides CLL1 specific multi-chain Chimeric Antigen Receptors (CLL1 mc CARs), wherein the polypeptide sequences has at least 95% identity with the preceeding peptide sequences.

[0263] In the most preferred embodiment, the present invention provides CLL1 specific multi-chain Chimeric Antigen Receptors (CLL1 mc CARs), wherein the polypeptide sequences has at least 99% identity with the preceeding peptide sequences.

[0264] In all the above embodiments, said CLL1 specific multi-chain Chimeric Antigen Receptor (CLL1 mc CAR), retains, continuously or temporarily, their properties of binding to CLL1 expressing cells and/or to affect the survival of said CLL1 expressing cancer cells.

[0265] Insertion of at Least One Epitope in the Extracellular Domain of the Anti-CLL1 Multi-Chain CAR

[0266] An anti-CLL1 mcCAR of the invention may include at least the insertion of at least one epitope in one extracellular domain of said CAR, preferably the extracellular domain binding CLL1 as illustrated in Figure, This is intended to deplete the immune cells endowed with the CAR in the event these later would cause adverse effects in vivo such as a cytokine storm. Moreover, such insertion of epitope or "epitope-tagging" may be useful to sort in vitro engineered immune cells for sake of purification. For instance, this can be obtained, for instance, by inserting at least one, and preferably two copies of a CD20 mimotope, preferably of sequence CPYSNPSLCS (SEQ ID NO. 110), into the CAR polypeptide sequence. Different positions of the at least one CD20 mimotope are schematized in FIG. 5.

[0267] For purpose of simplification hereafter, the order of the scFvs from the N terminal end to the C terminal end is presented as follows: the VH chain and then the VL chain. However, it can be envisioned in the scope of the present invention that this order is inversed: VL chain and then the VL chain.

[0268] In one embodiment, said at least one epitope iss inserted between the VH and VL chains of the anti-CLL1.1 CAR, optionally linked to said VH and VL chains by one linker.

[0269] In another embodiment, said at least one epitope is inserted at the N terminal end of the CAR--so upfront of the scFvs--, optionally linked to the VH chain and to the N terminal end of the CAR by one linker.

[0270] In another embodiment, said at least one epitope is inserted between the scFvs and the hinge of the CAR, optionally linked to the VL chain and to the hinge by one linker.

[0271] In a preferred embodiment, at least two epitopes are inserted in the extracellular domain of the anti-CLL1 CAR.

[0272] According to one embodiment, two epitopes are inserted in such a way that the VH is located between them, all these components being optionally interspaced by at least one linker.

[0273] According to another embodiment, two epitopes are inserted in such a way that the VLs located between them, all these components being optionally interspaced by at least one linker.

[0274] According to another embodiment, two epitopes are inserted in such a way that the VH and VL chains are located between them, all these components being optionally interspaced by at least one linker.

[0275] According to another embodiment, three epitopes are inserted in such a way that the VH and VL chains are located between them, all these components being optionally interspaced by at least one linker.

[0276] Said linker may be the GS linker of SEQ ID NO. 10 or the like.

[0277] Said at least one epitope may be any antigenic peptide which is enough immunogenic to be bound by a specific antibody recognizing such peptide.

[0278] In a preferred embodiment, the epitope introduced within the chimeric scFv is the CD20 antigen (SEQ ID NO. 110) and the infused mAb which is being used to target it--for sorting and/or depletion purpose(s) is rixutimab.

[0279] According to another embodiment, the epitope is a mimotope. As a macromolecule, often a peptide, which mimics the structure of an epitope, the mimotope has the advantage to be smaller than conventional epitope, and therefore may be beneficial for a non-conformational sequence and easier to reproduce in a long polypeptide such a CAR. Mimotopes are known for several pharmaceutically-approved mAb such as two 10 amino acid peptides for cetuximab (Riemer et al., 2005), or a 24 aa for palivizumab (Arbiza et al, 1992). As these mimotopes can be identified by phage display, it is possible to try several of them in order to obtain a sequence which does not perturb the scFv for the same mAb. Furthermore, their use can enhance a complement-dependentcytotoxicity (CDC).

[0280] Several examples of such epitopes and mimotopes with their corresponding binding mAb are presented in the following Table 7.

TABLE-US-00007 TABLE 7 Mimotopes and epitope with their corresponding mAb Rituximab Mimotope SEQ ID NO 109 CPYSNPSLC Palivizumab Epitope C SEQ ID NO 110 NSELLSLINDMPITNDQKKLMSNN Cetuximab Mimotope 1 SEQ ID NO 111 CQFDLSTRRLKC Mimotope 2 SEQ ID NO 112 CQYNLSSRALKC Mimotope 3 SEQ ID NO 113 CVWQRWQKSYVC Mimotope 4 SEQ ID NO 114 CMWDRFSRWYKC Nivolumab Epitope A SEQ ID NO 115 SFVLNWYRMSPSNQTDKLAAFPE DR Epitope B SEQ ID NO 116 SGTYLCGAISLAPKAQIKE

[0281] Said two copies of a CD20 mimotope can be linked to each other and also to the V.sub.L by a linker. They can also be inserted between the anti-CLL1 scFv and the hinge (such as CD8alpha), by using an optional linker. The CD20 mimotopes can be bound by anti-CD20 antibodies, such as Rituximab (McLaughlin P, et al. 1998). The anti-CLL1 CAR of the present invention may thus comprise VH and a VL chains which are able to bind to CLL1 cell surface antigen, optionally humanized, a linker L, a suicide domain, a hinge or part of it, a transmembrane domain, a co-stimulatory domain and a stimulatory domain. According to a preferred embodiment of the invention, the epitope introduced within the chimeric scFv is the CD20 mimotope of SEQ ID NO. 109 and the corresponding antibody used for depleting the CAR positive cells into the patient is rituximab.

[0282] In general, the term "linker" as used in the context of a scFv refers to a peptide linker that consists of amino acids such as glycine and/or serine residues, used alone or in combination, to link variable heavy and variable light chain regions together. In one embodiment, the flexible polypeptide linker is a Glycine/Serine linker and comprises the amino acid sequence (Gly-Gly-Gly-Ser).sub.n or (Gly-Gly-Gly-Gly-Ser).sub.n, where n is a positive integer equal to or greater than 1. For example, n=1, n=2, n=3, n=4, n=5, n=6, n=7, n=8, n=9 and n=10. In one embodiment, the flexible polypeptide linkers include, but are not limited to, (Gly.sub.4Ser).sub.4 or (Gly.sub.4Ser).sub.3. In another embodiment, the linkers include multiple repeats of (Gly.sub.xSer).sub.n, where x=1, 2, 3, 4 or 5 and n is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10, such as multiple repeat of (GlySer), (Gly.sub.2Ser) or (Gly.sub.5Ser). Also included within the scope of the invention are linkers described in WO2012/138475, incorporated herein by reference.

[0283] According to one embodiment, the present invention relates to a CLL1 specific multi-chain Chimeric Antigen Receptor (mc CAR) comprising at least:

[0284] a first transmembrane polypeptide comprising at least one extracellular ligand-binding domain, wherein the at least one extracellular ligand-binding domain binds to the cell surface CLL1 antigen and comprises at least one epitope; and;

[0285] a second polypeptide comprising at least one signal-transducing domain;

[0286] wherein the signal transducing domain(s) of the multi-chain Chimeric Antigen Receptor is present on a polypeptide distinct from that carrying the extracellular ligand-binding domain(s).

[0287] In a preferred embodiment, said anti-CLL1 mcCAR contains said signal-transducing domain containing polypeptide is a transmembrane polypeptide, and at least one transmembrane polypeptide comprises a part of Fc receptor.

[0288] In a preferred embodiment, the present invention relates to a CLL1 specific multi-chain Chimeric Antigen Receptor (mc CAR) comprising at least: (a) Fc.epsilon.RI alpha chain, (b) Fc.epsilon.RI beta chain and (c) Fc.epsilon.RI gamma chain,

[0289] the transmembrane polypeptide from the alpha chain of high-affinity IgE receptor (Fc.epsilon.RI) is fused to an extracellular CLL1 ligand binding domain, and,

[0290] said extracellular CLL1 ligand binding domain contains at least one epitope.

[0291] In another preferred embodiment, the present invention relates to a CLL1 specific multi-chain Chimeric Antigen Receptor (mc CAR) comprising at least: (a) Fc.epsilon.RI alpha chain, (b) Fc.epsilon.RI beta chain and (c) Fc.epsilon.RI gamma chain,

[0292] the transmembrane polypeptide from the alpha chain of high-affinity IgE receptor (Fc.epsilon.RI) is fused to an extracellular CLL1 ligand binding domain,

[0293] second transmembrane polypeptide from the gamma or beta chain of Fc.epsilon.RI fused to a signal transducing domain, preferably CD3 ITAM;

[0294] third transmembrane polypeptide from the gamma or beta chain of Fc.epsilon.RI comprising a co-stimulatory domain, preferably 4-1 BB costimulatory domain,

[0295] said CLL1 ligand binding domain fused to said alpha chain of Fc.epsilon.RI is a single-chain variable fragment (scFv) comprising heavy (V.sub.H) and light (V.sub.L) chains conferring specificity to CLL1. and,

[0296] said extracellular CLL1 ligand binding domain contains at least one epitope.

[0297] In one embodiment, said previous CLL1 specific multi-chain Chimeric Antigen Receptor (mc CAR) comprises said Fc.epsilon.RI alpha chain in which one epitope is inserted between the 2 scFvs in its extracellular domain, said epitope being optionally bordered by one linker.

[0298] In another preferred embodiment, the present invention relates to a CLL1 specific multi-chain Chimeric Antigen Receptor (mc CAR) comprising at least: (a) Fc.epsilon.RI alpha chain, (b) Fc.epsilon.RI beta chain and (c) Fc.epsilon.RI gamma chain,

[0299] the transmembrane polypeptide from the alpha chain of high-affinity IgE receptor (Fc.epsilon.RI) is fused to an extracellular CLL1 ligand binding domain,

[0300] second transmembrane polypeptide from the gamma or beta chain of Fc.epsilon.RI fused to a signal transducing domain;

[0301] third transmembrane polypeptide from the gamma or beta chain of Fc.epsilon.RI comprising a co-stimulatory domain,

[0302] said CLL1 ligand binding domain fused to said alpha chain of Fc.epsilon.RI is a single-chain variable fragment (scFv) comprising heavy (V.sub.H) and light (V.sub.L) chains conferring specificity to CLL1. and,

[0303] said scFvs being linked to the transmembrane (TM) domain of said Fc.epsilon.RI alpha chain by a hinge, preferably IgG1, CD8alpha or Fc.gamma.RIII .alpha. hinge, and

[0304] said extracellular CLL1 ligand binding domain contains two epitopes.

[0305] In one embodiment, said previous CLL1 specific multi-chain Chimeric Antigen Receptor (mc CAR) comprises said Fc.epsilon.RI alpha chain in which two epitopes are inserted in the extracellular domain of the CAR, one being inserted between the N-terminal end of the CAR and the VH chain, said epitope being optionally bordered by 2 linkers; the second epitope is inserted between the 2 scFvs, said 2.sup.nd epitope being optionally bordered by 2 linkers.

[0306] In another embodiment, said CLL1 specific multi-chain Chimeric Antigen Receptor (mc CAR) comprises said Fc.epsilon.RI alpha chain in which two epitopes are inserted in the extracellular domain of the CAR, one being inserted between the two scFvs; the other epitope being inserted between the VL chain and the hinge, each said epitope being optionally bordered by 2 linkers.

[0307] In another embodiment, said CLL1 specific multi-chain Chimeric Antigen Receptor (mc CAR) comprises said Fc.epsilon.RI alpha chain in which two epitopes are inserted in the extracellular domain of the CAR, one being inserted between the N-terminal end of the CAR and the VH chain, said epitope being optionally bordered by 2 linkers; the second epitope being inserted between the VL chain and the hinge, said 2.sup.nd epitope being optionally bordered by 2 linkers.

[0308] In another preferred embodiment, the present invention relates to a CLL1 specific multi-chain Chimeric Antigen Receptor (mc CAR) comprising at least: (a) Fc.epsilon.RI alpha chain, (b) Fc.epsilon.RI beta chain and (c) Fc.epsilon.RI gamma chain,

[0309] the transmembrane polypeptide from the alpha chain of high-affinity IgE receptor (Fc.epsilon.RI) is fused to an extracellular CLL1 ligand binding domain,

[0310] second transmembrane polypeptide from the gamma or beta chain of Fc.epsilon.RI fused to a signal transducing domain;

[0311] third transmembrane polypeptide from the gamma or beta chain of Fc.epsilon.RI comprising a co-stimulatory domain,

[0312] said CLL1 ligand binding domain fused to said alpha chain of Fc.epsilon.RI is a single-chain variable fragment (scFv) comprising heavy (V.sub.H) and light (V.sub.L) chains conferring specificity to CLL1. and,

[0313] said extracellular CLL1 ligand binding domain contains three epitopes.

[0314] In another embodiment, said previous CLL1 specific multi-chain Chimeric Antigen Receptor (mc CAR) comprises said Fc.epsilon.RI alpha chain in which three epitopes are inserted in the extracellular domain of the CAR, the first one being inserted between the N-terminal end of the CAR and the VH chain, said epitope being optionally bordered by 2 linkers; the second epitope being inserted between the 2 scFvs, said epitope being optionally bordered by 2 linkers, and the third epitope being inserted between the VL chain et the hinge.

[0315] Said at least one epitope may be chosen preferably among those for which a corresponding monoclonal antibody exists and is approved by the National Health Organization (such as FDA). For instance, said epitope may be chosen among SEQ ID NO. 109 to SEQ ID NO. 116. Another epitope which may be selected is a CD34 epitope such as those of SEQ ID NO. 117 or 118.

[0316] In a particular embodiment, said above anti-CLL1 mcCARs comprising at least an extra cellular ligand binding-domain including VH and VL domains of monoclonal anti-CLL1 antibodies.

[0317] The present invention relates also to a method for depleting in a patient engineered lymphoid immune cell expressing a CLL1 specific mcCAR and at least one epitope such as disclosed in this application, by administering in said patient an antibody--preferably monoclonal--specific to said epitope in case of need, i.e. to avoid adverse effects such as cytokine storm.

[0318] In a preferred embodiment, the monoclonal antibody rituximab specific to the at least one CD20 antigen inserted in the extracellular domain of the CLL1 specific mcCAR is administered to the patient in order to deplete said engineered immune cells.

[0319] More specifically, the epitopes can be included into the extracellular domain of the CAR according to the present invention as follows:

[0320] In some embodiments, the extracellular binding domain comprises at least 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 mAb-specific epitopes.

[0321] In some embodiments, the extracellular binding domain comprises at least 1, 2 or 3 mAb-specific epitopes.

[0322] In some embodiments, when the extracellular binding domain comprises several mAb-specific epitopes, all the mAb-specific epitopes are identical.

[0323] In some embodiments, when the extracellular binding domain comprises several mAb-specific epitopes, the mAb-specific epitopes are not identical. For example, the extracellular binding domain can comprises three mAb-specific epitopes, two of them being identical and the third one being different.

[0324] In some embodiments, the extracellular binding domain comprises a VH, a VL, one or more mAb-specific epitopes, preferably 1, 2 or 3, more preferably 2 or 3 mAb-specific epitopes.

[0325] In some embodiments, the extracellular binding domain comprises the following sequence (Nterm is located on the left hand side):

[0326] V.sub.1-L.sub.1-V.sub.2-(L).sub.x-Epitope1-(L).sub.x;

[0327] V.sub.1-L.sub.1-V.sub.2-(L).sub.x-Epitope1-(L).sub.x-Epitope2-(L).s- ub.x;

[0328] V.sub.1-L.sub.1-V.sub.2-(L).sub.x-Epitope1-(L).sub.x-Epitope2-(L).s- ub.x-Epitope3-(L).sub.x;

[0329] (L).sub.x-Epitope1-(L).sub.x-V.sub.1-L.sub.1-V.sub.2;

[0330] (L).sub.x-Epitope1-(L).sub.x-Epitope2-(L).sub.x-V.sub.1-L.sub.1-V.s- ub.2;

[0331] Epitope1-(L).sub.x-Epitope2-(L).sub.x-Epitope3-(L).sub.x-V.sub.1-L.- sub.1-V.sub.2;

[0332] (L).sub.x-Epitope1-(L).sub.x-V.sub.1-L.sub.1-V.sub.2-(L).sub.x-Epit- ope2-(L).sub.x;

[0333] (L).sub.x-Epitope1-(L).sub.x-V.sub.1-L.sub.1-V.sub.2-(L).sub.x-Epit- ope2-(L).sub.x-Epitope3-(L).sub.x;

[0334] (L).sub.x-Epitope1-(L).sub.x-V.sub.1-L.sub.1-V.sub.2-(L).sub.x-Epit- ope2-(L).sub.x-Epitope3-(L).sub.x-Epitope4-(L).sub.x;

[0335] (L).sub.x-Epitope1-(L).sub.x-Epitope2-(L).sub.x-V.sub.1-L.sub.1-V.s- ub.2-(L).sub.x-Epitope3-(L).sub.x;

[0336] (L).sub.x-Epitope1-(L).sub.x-Epitope2-(L).sub.x-V.sub.1-L.sub.1-V.s- ub.2-(L).sub.x-Epitope3-(L).sub.x-Epitope4-(L).sub.x;

[0337] V.sub.1-(L).sub.x-Epitope1-(L).sub.x-V.sub.2;

[0338] V.sub.1-(L).sub.x-Epitope1-(L).sub.x-V.sub.2-(L).sub.x-Epitope2-(L)- .sub.x;

[0339] V.sub.1-(L).sub.x-Epitope1-(L).sub.x-V.sub.2-(L).sub.x-Epitope2-(L)- .sub.x-Epitope3-(L).sub.x;

[0340] V.sub.1-(L).sub.x-Epitope1-(L).sub.x-V.sub.2-(L).sub.x-Epitope2-(L)- .sub.x-Epitope3-(L).sub.x-Epitope4-(L).sub.x;

[0341] (L).sub.x-Epitope1-(L).sub.x-V.sub.1-(L).sub.x-Epitope2-(L).sub.x-V- .sub.2;

[0342] (L).sub.x-Epitope1-(L).sub.x-V.sub.1-(L).sub.x-Epitope2-(L).sub.x-V- .sub.2-(L).sub.x-Epitope3-(L).sub.x;

[0343] V.sub.1-L.sub.1-V.sub.2-L-Epitope1;

[0344] V.sub.1-L.sub.1-V.sub.2-L-Epitope1-L;

[0345] V.sub.1-L.sub.1-V.sub.2-L-Epitope1-L-Epitope2;

[0346] V.sub.1-L.sub.1-V.sub.2-L-Epitope1-L-Epitope2-L;

[0347] V.sub.1-L.sub.1-V.sub.2-L-Epitope1-L-Epitope2-L-Epitope3;

[0348] V.sub.1-L.sub.1-V.sub.2-L-Epitope1-L-Epitope2-L-Epitope3-L;

[0349] V.sub.1-L.sub.1-V.sub.2-Epitope1;

[0350] V.sub.1-L.sub.1-V.sub.2-Epitope1-L;

[0351] V.sub.1-L.sub.1-V.sub.2-Epitope1-L-Epitope2;

[0352] V.sub.1-L.sub.1-V.sub.2-Epitope1-L-Epitope2-L;

[0353] V.sub.1-L.sub.1-V.sub.2-Epitope1-L-Epitope2-L-Epitope3;

[0354] V.sub.1-L.sub.1-V.sub.2-Epitope1-L-Epitope2-L-Epitope3-L;

[0355] Epitope1-V.sub.1-L.sub.1-V.sub.2;

[0356] Epitope1-L-V.sub.1-L.sub.1-V.sub.2;

[0357] L-Epitope1-V.sub.1-L.sub.1-V.sub.2;

[0358] L-Epitope1-L-V.sub.1-L.sub.1-V.sub.2;

[0359] Epitope1-L-Epitope2-V.sub.1-L.sub.1-V.sub.2;

[0360] Epitope1-L-Epitope2-L-V.sub.1-L.sub.1-V.sub.2;

[0361] L-Epitope1-L-Epitope2-V.sub.1-L.sub.1-V.sub.2;

[0362] L-Epitope1-L-Epitope2-L-V.sub.1-L.sub.1-V.sub.2;

[0363] Epitope1-L-Epitope2-L-Epitope3-V.sub.1-L.sub.1-V.sub.2;

[0364] Epitope1-L-Epitope2-L-Epitope3-L-V.sub.1-L.sub.1-V.sub.2;

[0365] L-Epitope1-L-Epitope2-L-Epitope3-V.sub.1-L.sub.1-V.sub.2;

[0366] L-Epitope1-L-Epitope2-L-Epitope3-L-V.sub.1-L.sub.1-V.sub.2;

[0367] V.sub.1-L-Epitope1-L-V.sub.2;

[0368] L-Epitope1-L-V.sub.1-L-Epitope2-L-V.sub.2;

[0369] V.sub.1-L-Epitope1-L-V.sub.2-L-Epitope2-L;

[0370] V.sub.1-L-Epitope1-L-V.sub.2-L-Epitope2-L-Epitope3;

[0371] V.sub.1-L-Epitope1-L-V.sub.2-L-Epitope2-Epitope3;

[0372] V.sub.1-L-Epitope1-L-V.sub.2-L-Epitope2-L-Epitope3-Epitope4;

[0373] L-Epitope1-L-V.sub.1-L-Epitope2-L-V.sub.2-L-Epitope3-L;

[0374] Epitope1-L-V.sub.1-L-Epitope2-L-V.sub.2-L-Epitope3-L;

[0375] L-Epitope1-L-V.sub.1-L-Epitope2-L-V.sub.2-L-Epitope3;

[0376] L-Epitope1-L-V.sub.1-L.sub.1-V.sub.2-L-Epitope2-L;

[0377] L-Epitope1-L-V.sub.1-L.sub.1-V.sub.2-L-Epitope2-L-Epitope3;

[0378] L-Epitope1-L-V.sub.1-L.sub.1-V.sub.2-L-Epitope2-Epitope3, or,

[0379] Epitope1-L-V.sub.1-L.sub.1-V.sub.2-L-Epitope2-L-Epitope3-Epitope 4.

wherein, V.sub.1 and V.sub.2 are V.sub.H and V.sub.L of an ScFv (i.e, V.sub.1 is V.sub.L and V.sub.2 is V.sub.H or V.sub.1 is V.sub.H and V.sub.2 is V.sub.L); L.sub.1 is any linker suitable to link the VH chain to the VL chain in an ScFv;

[0380] L is a linker, preferably comprising glycine and serine residues, and each occurrence of L in the extracellular binding domain can be identical or different to other occurrence of L in the same extracellular binding domain, and,

[0381] x is 0 or 1 and each occurrence of x is independently from the others; and,

[0382] epitope 1, epitope 2 and epitope 3 are mAb-specific epitopes and can be identical or different.

[0383] In some embodiments, the extracellular binding domain comprises the following sequence (Nterm is located on the left hand side):

[0384] V.sub.H-L.sub.1-V.sub.L-L-Epitope1-L-Epitope2-L;

[0385] L-Epitope1-L-V.sub.H-L-Epitope2-L-V.sub.L-L-Epitope3-L;

[0386] V.sub.L-L.sup.1-V.sub.H-L-Epitope1-L-Epitope2-L; or,

[0387] L-Epitope1-L-V.sub.L-L-Epitope2-L-V.sub.H-L-Epitope3-L.

[0388] wherein L, L1, epitope 1, epitope 2 and epitope 3 are as defined above.

[0389] In some embodiments, L.sub.1 is a linker comprising Glycine and/or Serine. In some embodiment, L.sub.1 is a linker comprising the amino acid sequence (Gly-Gly-Gly-Ser).sub.n or (Gly-Gly-Gly-Gly-Ser).sub.n, where n is 1, 2, 3, 4 or 5. In some embodiments L.sub.1 is (Gly.sub.4Ser).sub.4 or (Gly.sub.4Ser).sub.3.

[0390] In some embodiment, L is a flexible linker, preferably comprising Glycine and/or Serine. In some embodiments, L has an amino acid sequence selected from SGG, GGS, SGGS, SSGGS, GGGG, SGGGG, GGGGS, SGGGGS, GGGGGS, SGGGGGS, SGGGGG, GSGGGGS, GGGGGGGS, SGGGGGGG, SGGGGGGGS, or SGGGGSGGGGS preferably SGG, SGGS, SSGGS, GGGG, SGGGGS, SGGGGGS, SGGGGG, GSGGGGS or SGGGGSGGGGS. In some embodiment, when the extracellular binding domain comprises several occurrences of L, all the Ls are identical. In some embodiments, when the extracellular binding domain comprises several occurrences of L, the Ls are not all identical. In some embodiments, L is SGGGGS. In some embodiments, the extracellular binding domain comprises several occurrences of L and all the Ls are SGGGGS.

[0391] In some embodiments, Epitope 1, Epitope 2 and Epitope 3 are identical or different and are selected from mAb-specific epitopes having an amino acid sequence of SEQ ID NO 109, SEQ ID NO 110, SEQ ID NO 111, SEQ ID NO 112, SEQ ID NO 113, SEQ ID NO 114, SEQ ID NO 115 or SEQ ID NO 116.

[0392] In some embodiments, Epitope 1, Epitope 2 and Epitope 3 are identical or different and are selected from mAb-specific epitopes specifically recognized by ibritumomab, tiuxetan, muromonab-CD3, tositumomab, abciximab, basiliximab, brentuximab vedotin, cetuximab, infliximab, rituximab, alemtuzumab, bevacizumab, certolizumab pegol, daclizumab, eculizumab, efalizumab, gemtuzumab, natalizumab, omalizumab, palivizumab, ranibizumab, tocilizumab, trastuzumab, vedolizumab, adalimumab, belimumab, canakinumab, denosumab, golimumab, ipilimumab, ofatumumab, panitumumab, QBEND-10, alemtuzumab or ustekinumab.

[0393] In some embodiment, Epitope 1 is an mAb-specific epitope having an amino acid sequence of SEQ ID NO 109.

[0394] In some embodiment, Epitope 2 is an mAb-specific epitope having an amino acid sequence of SEQ ID NO 109.

[0395] In some embodiment, Epitope 3 is an mAb-specific epitope having an amino acid sequence of SEQ ID NO 109.

[0396] In some embodiment, Epitope 4 is an mAb-specific epitope having an amino acid sequence of SEQ ID NO 109.

[0397] In some embodiment, Epitope 2 is an mAb-specific epitope having an amino acid sequence of SEQ ID NO 109 and Epitope 3 is an mAb-specific epitope having an amino acid sequence of SEQ ID NO 117.

[0398] In some embodiment, one of Epitope 1, Epitope 2, Epitope 3 and Epitope 4 is a CD34 epitope, preferably an epitope of SEQ ID NO 117 or SEQ ID NO 118. In some embodiment, one of Epitope1, Epitope 2, Epitope 3 and Epitope 4 is a CD34 epitope, preferably an epitope of SEQ ID NO 117 or SEQ ID NO. 118 and the other mAb specific epitopes are CD20 mimotopes, preferably mimotope of SEQ ID NO 109.

[0399] Method for Depleting CAR-Expressing Immune Cells

[0400] The immune cells expressing the CLL1 specific CAR according to the present invention may comprise epitope(s) in their extracellular domain such as described above, so that they can be depleted in a patient in the event of adverse or too acute immune response (e.g. cytokine storm) by administering to said patient an antibody--preferably monoclonal--specific to said epitope (s).

[0401] By "in vivo depletion" is meant in the present invention the administration of a treatment to a mammalian organism aiming to stop the proliferation of CAR-expressing immune cells by inhibition or elimination.

[0402] One aspect of the invention is related to a method for in vivo depleting an engineered immune cell expressing a CAR comprising an m-Ab specific epitope as previously described, comprising contacting said engineered immune cell or said CAR-expressing immune cell with at least one epitope-specific mAbs. Another aspect of the invention relates to a method for in vivo depleting immune CAR-expressing immune cell which comprises the above chimeric scFv (formed by insertion of a mAb-specific epitope) by contacting said engineered immune cell with epitope-specific antibodies.

[0403] Preferably, said immune cells are T-cells and/or the antibodies are monoclonal.

[0404] According to one embodiment, the in vivo depletion of immune engineered cell is performed on engineered immune cell which has been previously sorted using the in vitro method of the present invention. In this case, this will be the same infused mAb used.

[0405] According to a preferred embodiment, the mAb-specific antigen is CD20 antigen and the epitope-specific mAb is rituximab.

[0406] In some embodiments, the invention relates to a method for in vivo depleting an engineered immune cell expressing a CAR comprising an mAb-specific epitope (CAR-expressing immune cell) as previously described, in a patient comprising contacting said CAR-expressing immune cell with at least one epitope-specific mAbs.

[0407] In some embodiment, said mAb-specific epitope is a CD20 epitope or mimotope, preferably SEQ ID NO 35 and the epitope-specific mAbs is rituximab.

[0408] In some embodiments, the step of contacting said engineered immune cell or said CAR-expressing immune cell with at least one epitope-specific mAb comprises infusing the patient with epitope-specific mAb, preferably rituximab.

[0409] In some embodiment, when immune cells expressing a CAR comprising an mAb-specific epitope (CAR-expressing immune cells) are depleted in a CDC assay using epitope specific mAb, the amount of viable CAR-expressing immune cells decreases, preferably by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80% or 90%. Preferably the CDC assay is the assay disclosed in Example 3, Example 4 or Example 7.4. In some embodiment, said mAb-specific epitope is a CD20 epitope or mimotope, preferably SEQ ID NO 35 and the epitope-specific mAbs is rituximab.

[0410] Besides the possibility of in-vivo depleting the immune cells according to the invention, the epitopes inserted into the extracellular domain of the CARs may be useful to the steps of sorting or purifying the immune cells expressing said CARs, as part of the method for producing them.

[0411] Anti-CLL1 CAR Encoding Polynucleotides and Vectors

[0412] The present invention also relates to polynucleotides, vectors encoding the above described multi-chain CAR according to the invention. The present invention provides polynucleotides, including DNA and RNA molecules that encode the transmembrane polypeptides disclosed herein that can be included in the multi-chain CAR. In particular, the invention relates to a polynucleotide comprising a nucleic acid sequence encoding at least one transmembrane polypeptide composing the multi-chain CAR as described above. More particularly the invention relates to a polynucleotide comprising two or more nucleic acid sequences encoding transmembrane polypeptides composing the multi-chain CAR as described above.

[0413] The polynucleotide may consist in an expression cassette or expression vector (e.g. a plasmid for introduction into a bacterial host cell, or a viral vector such as a baculovirus vector for transfection of an insect host cell, or a plasmid or viral vector such as a lentivirus for transfection of a mammalian host cell).

[0414] In a particular embodiment, the different nucleic acid sequences can be included in one polynucleotide or vector which comprises a nucleic acid sequence encoding ribosomal skip sequence such as a sequence encoding a 2A peptide. 2A peptides, which were identified in the Aphthovirus subgroup of picornaviruses, causes a ribosomal "skip" from one codon to the next without the formation of a peptide bond between the two amino acids encoded by the codons (see Donnelly et al., J. of General Virology 82: 1013-1025 (2001); Donnelly et al., J. of Gen. Virology 78: 13-21 (1997); Doronina et al., Mol. And. Cell. Biology 28(13): 4227-4239 (2008); Atkins et al., RNA 13: 803-810 (2007)). By "codon" is meant three nucleotides on an mRNA (or on the sense strand of a DNA molecule) that are translated by a ribosome into one amino acid residue. Thus, two polypeptides can be synthesized from a single, contiguous open reading frame within an mRNA when the polypeptides are separated by a 2A oligopeptide sequence that is in frame. Such ribosomal skip mechanisms are well known in the art and are known to be used by several vectors for the expression of several proteins encoded by a single messenger RNA. As non-limiting example, in the present invention, 2A peptides have been used to express into the cell the different polypeptides of the multi-chain CAR.

[0415] To direct, transmembrane polypeptide such as Fc.epsilon.R into the secretory pathway of a host cell, a secretory signal sequence (also known as a leader sequence, prepro sequence or pre sequence) is provided in polynucleotide sequence or vector sequence. The secretory signal sequence may be that of Fc.epsilon.R, or may be derived from another secreted protein (e.g., t-PA) or synthesized de novo. The secretory signal sequence is operably linked to the transmembrane nucleic acid sequence, i.e., the two sequences are joined in the correct reading frame and positioned to direct the newly synthesized polypeptide into the secretory pathway of the host cell. Secretory signal sequences are commonly positioned 5' to the nucleic acid sequence encoding the polypeptide of interest, although certain secretory signal sequences may be positioned elsewhere in the nucleic acid sequence of interest (see, e.g., Welch et al., U.S. Pat. No. 5,037,743; Holland et al., U.S. Pat. No. 5,143,830). In a preferred embodiment the signal peptide comprises the residues 1 to 25 of the Fc.epsilon.RI alpha chain (NP_001992.1) and has the amino acid sequence SEQ ID NO: 5.

[0416] Those skilled in the art will recognize that, in view of the degeneracy of the genetic code, considerable sequence variation is possible among these polynucleotide molecules. Preferably, the nucleic acid sequences of the present invention are codon-optimized for expression in mammalian cells, preferably for expression in human cells. Codon-optimization refers to the exchange in a sequence of interest of codons that are generally rare in highly expressed genes of a given species by codons that are generally frequent in highly expressed genes of such species, such codons encoding the amino acids as the codons that are being exchanged.

[0417] The present invention provides a polynucleotide comprising a nucleic acid sequence encoding a CLL1 specific multi-chain Chimeric Antigen Receptor according to any one of the above embodiments.

[0418] The present invention provides a polynucleotide comprising a nucleic acid sequence encoding a CLL1 specific multi-chain Chimeric Antigen Receptor comprising the following peptide sequences:

[0419] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 13, SEQ ID NO. 3, SEQ ID NO. 16, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0420] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 13, SEQ ID NO. 3, SEQ ID NO. 16, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0421] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 14, SEQ ID NO. 3, SEQ ID NO. 16, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0422] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 15, SEQ ID NO. 3, SEQ ID NO. 16, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0423] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 15, SEQ ID NO. 3, SEQ ID NO. 16, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0424] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 15, SEQ ID NO. 3, SEQ ID NO. 16, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0425] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 17, SEQ ID NO. 3, SEQ ID NO. 18, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0426] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 17, SEQ ID NO. 3, SEQ ID NO. 18, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0427] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 19, SEQ ID NO. 3, SEQ ID NO. 20, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0428] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 19, SEQ ID NO. 3, SEQ ID NO. 20, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0429] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 21, SEQ ID NO. 3, SEQ ID NO. 22, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0430] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 21, SEQ ID NO. 3, SEQ ID NO. 22 SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0431] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 23, SEQ ID NO. 3, SEQ ID NO. 24, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0432] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 23, SEQ ID NO. 3, SEQ ID NO. 24, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0433] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 25, SEQ ID NO. 3, SEQ ID NO. 26, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0434] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 25, SEQ ID NO. 3, SEQ ID NO. 26, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0435] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 27, SEQ ID NO. 3, SEQ ID NO. 28, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0436] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 27, SEQ ID NO. 3, SEQ ID NO. 28, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0437] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 29, SEQ ID NO. 3, SEQ ID NO. 30, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0438] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 29, SEQ ID NO. 3, SEQ ID NO. 30, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0439] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 31, SEQ ID NO. 3, SEQ ID NO. 32, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0440] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 31, SEQ ID NO. 3, SEQ ID NO. 32, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0441] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 33, SEQ ID NO. 3, SEQ ID NO. 34, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0442] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 33, SEQ ID NO. 3, SEQ ID NO. 34, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0443] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 33, SEQ ID NO. 3, SEQ ID NO. 36, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0444] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 35, SEQ ID NO. 3, SEQ ID NO. 36, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7.

[0445] The present invention provides a vector comprising a polynucleotide as above, preferably a vector encoding a CLL1 specific multi-chain Chimeric Antigen Receptor comprising the following peptide sequences:

[0446] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 13, SEQ ID NO. 3, SEQ ID NO. 16, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0447] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 13, SEQ ID NO. 3, SEQ ID NO. 16, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0448] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 14, SEQ ID NO. 3, SEQ ID NO. 16, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0449] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 15, SEQ ID NO. 3, SEQ ID NO. 16, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0450] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 15, SEQ ID NO. 3, SEQ ID NO. 16, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0451] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 15, SEQ ID NO. 3, SEQ ID NO. 16, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0452] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 17, SEQ ID NO. 3, SEQ ID NO. 18, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0453] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 17, SEQ ID NO. 3, SEQ ID NO. 18, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0454] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 19, SEQ ID NO. 3, SEQ ID NO. 20, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0455] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 19, SEQ ID NO. 3, SEQ ID NO. 20, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0456] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 21, SEQ ID NO. 3, SEQ ID NO. 22, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0457] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 21, SEQ ID NO. 3, SEQ ID NO. 22 SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0458] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 23, SEQ ID NO. 3, SEQ ID NO. 24, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0459] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 23, SEQ ID NO. 3, SEQ ID NO. 24, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0460] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 25, SEQ ID NO. 3, SEQ ID NO. 26, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0461] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 25, SEQ ID NO. 3, SEQ ID NO. 26, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0462] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 27, SEQ ID NO. 3, SEQ ID NO. 28, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0463] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 27, SEQ ID NO. 3, SEQ ID NO. 28, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0464] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 29, SEQ ID NO. 3, SEQ ID NO. 30, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0465] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 29, SEQ ID NO. 3, SEQ ID NO. 30, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0466] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 31, SEQ ID NO. 3, SEQ ID NO. 32, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0467] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 31, SEQ ID NO. 3, SEQ ID NO. 32, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0468] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 33, SEQ ID NO. 3, SEQ ID NO. 34, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0469] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 33, SEQ ID NO. 3, SEQ ID NO. 34, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0470] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 33, SEQ ID NO. 3, SEQ ID NO. 36, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0471] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 35, SEQ ID NO. 3, SEQ ID NO. 36, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7.

[0472] Methods for Engineering Immune Cell

[0473] The present invention also provides with a method of engineering an immune cell as above comprising the following steps of:

[0474] (a) Providing an immune cell;

[0475] (b) Expressing at the surface of said cell a population of multi-chain Chimeric Antigen Receptors as above each one comprising different extracellular ligand-binding domains.

[0476] The present invention provides a method of engineering an immune cell as above comprising:

[0477] (a) Providing an immune cell;

[0478] (b) Introducing into said cell at least one polynucleotide encoding polypeptides composing a population of multi-chain Chimeric Antigen Receptors as above each one comprising different extracellular ligand binding domains.

[0479] (c) Expressing said polynucleotides into said cell.

[0480] A method of engineering an immune cell endowing a CLL1 specific multi-chain Chimeric Antigen Receptor according to any one of the above embodiments is part of the present invention, said method of engineering an immune cell is comprising the following steps:

[0481] (a) Providing an immune cell;

[0482] (b) Expressing at the surface of said cells at least one CLL1 multi-chain Chimeric Antigen Receptor according to any one of the above embodiments.

[0483] In one embodiment, the present invention provides method of engineering an immune cell endowing a CLL1 specific multi-chain Chimeric Antigen Receptor according to any one of the above embodiments comprising:

[0484] (a) Providing an immune cell;

[0485] (b) Introducing into said cell at least one polynucleotide encoding polypeptides composing a CLL1 multi-chain Chimeric Antigen Receptor according to any one of the above; preferably encoding the following peptide sequences:

[0486] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 13, SEQ ID NO. 3, SEQ ID NO. 16, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0487] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 13, SEQ ID NO. 3, SEQ ID NO. 16, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0488] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 14, SEQ ID NO. 3, SEQ ID NO. 16, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0489] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 15, SEQ ID NO. 3, SEQ ID NO. 16, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0490] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 15, SEQ ID NO. 3, SEQ ID NO. 16, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0491] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 15, SEQ ID NO. 3, SEQ ID NO. 16, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0492] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 17, SEQ ID NO. 3, SEQ ID NO. 18, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0493] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 17, SEQ ID NO. 3, SEQ ID NO. 18, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0494] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 19, SEQ ID NO. 3, SEQ ID NO. 20, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0495] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 19, SEQ ID NO. 3, SEQ ID NO. 20, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0496] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 21, SEQ ID NO. 3, SEQ ID NO. 22, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0497] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 21, SEQ ID NO. 3, SEQ ID NO. 22 SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0498] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 23, SEQ ID NO. 3, SEQ ID NO. 24, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0499] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 23, SEQ ID NO. 3, SEQ ID NO. 24, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0500] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 25, SEQ ID NO. 3, SEQ ID NO. 26, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0501] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 25, SEQ ID NO. 3, SEQ ID NO. 26, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0502] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 27, SEQ ID NO. 3, SEQ ID NO. 28, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0503] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 27, SEQ ID NO. 3, SEQ ID NO. 28, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0504] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 29, SEQ ID NO. 3, SEQ ID NO. 30, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0505] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 29, SEQ ID NO. 3, SEQ ID NO. 30, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0506] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 31, SEQ ID NO. 3, SEQ ID NO. 32, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0507] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 31, SEQ ID NO. 3, SEQ ID NO. 32, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0508] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 33, SEQ ID NO. 3, SEQ ID NO. 34, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0509] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 33, SEQ ID NO. 3, SEQ ID NO. 34, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0510] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 33, SEQ ID NO. 3, SEQ ID NO. 36, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0511] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 35, SEQ ID NO. 3, SEQ ID NO. 36, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7.

[0512] (c) Expressing said polynucleotides into said cell.

[0513] In a preferred embodiment, said method of engineering an immune cell is comprising:

[0514] (a) Providing an immune cell;

[0515] (b) Expressing at the surface of said cell a population of CLL1 multi-chain Chimeric Antigen Receptors according to any one of the above embodiments each one comprising different extracellular ligand-binding domains.

[0516] In a preferred embodiment, the method of engineering an immune cell is further comprising:

[0517] (a) Providing an immune cell;

[0518] (b) Introducing into said cell at least one polynucleotide encoding polypeptides composing a population of CLL1 multi-chain Chimeric Antigen Receptors according to any one of the above embodiments each one comprising different extracellular ligand binding domains.

[0519] (c) Expressing said polynucleotides into said cell.

[0520] Isolated Immune Cells

[0521] According to another aspect, the present invention provides an isolated immune cell obtainable from the method according to any one of the above embodiments, preferably an isolated immune cell expressing a CLL1 multi-chain Chimeric Antigen Receptors comprising the following peptide sequences:

[0522] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 13, SEQ ID NO. 3, SEQ ID NO. 16, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0523] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 13, SEQ ID NO. 3, SEQ ID NO. 16, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0524] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 14, SEQ ID NO. 3, SEQ ID NO. 16, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0525] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 15, SEQ ID NO. 3, SEQ ID NO. 16, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0526] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 15, SEQ ID NO. 3, SEQ ID NO. 16, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0527] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 15, SEQ ID NO. 3, SEQ ID NO. 16, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0528] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 17, SEQ ID NO. 3, SEQ ID NO. 18, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0529] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 17, SEQ ID NO. 3, SEQ ID NO. 18, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0530] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 19, SEQ ID NO. 3, SEQ ID NO. 20, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0531] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 19, SEQ ID NO. 3, SEQ ID NO. 20, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0532] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 21, SEQ ID NO. 3, SEQ ID NO. 22, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0533] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 21, SEQ ID NO. 3, SEQ ID NO. 22 SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0534] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 23, SEQ ID NO. 3, SEQ ID NO. 24, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0535] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 23, SEQ ID NO. 3, SEQ ID NO. 24, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0536] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 25, SEQ ID NO. 3, SEQ ID NO. 26, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0537] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 25, SEQ ID NO. 3, SEQ ID NO. 26, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0538] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 27, SEQ ID NO. 3, SEQ ID NO. 28, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0539] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 27, SEQ ID NO. 3, SEQ ID NO. 28, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0540] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 29, SEQ ID NO. 3, SEQ ID NO. 30, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0541] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 29, SEQ ID NO. 3, SEQ ID NO. 30, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0542] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 31, SEQ ID NO. 3, SEQ ID NO. 32, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0543] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 31, SEQ ID NO. 3, SEQ ID NO. 32, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0544] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 33, SEQ ID NO. 3, SEQ ID NO. 34, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0545] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 33, SEQ ID NO. 3, SEQ ID NO. 34, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7 or;

[0546] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 33, SEQ ID NO. 3, SEQ ID NO. 36, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 6 or;

[0547] SEQ ID NO. 8, SEQ ID NO. 9, SEQ ID NO. 10, SEQ ID NO. 11, SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 35, SEQ ID NO. 3, SEQ ID NO. 36, SEQ ID NO. 4, SEQ ID NO. 12, SEQ ID NO. 5, and SEQ ID NO. 7.

[0548] The present invention provides an isolated cell said isolated cell is selected from the group consisting of inflammatory T-lymphocytes, cytotoxic T-lymphocytes, regulatory T-lymphocytes or helper T-lymphocytes, said isolated cell further comprises at least one anti-CLL1 multi-chain (CAR) of the invention.

[0549] In a preferred embodiment, said isolated cell provided in the present invention is an isolated immune T cell and said isolated immune T cell expresses at least one anti-CLL1 multi-chain (CAR) of the invention.

[0550] In another preferred embodiment, said isolated immune cell is an isolated immune T cell and said isolated immune T cell expresses at least one anti-CLL1 multi-chain (CAR) of the invention.

[0551] In one embodiment, said isolated immune cell is further engineered and is an engineered primary isolated immune cell comprising at least one anti-CLL1 multi-chain (CAR) of the invention.

[0552] In a preferred embodiment, said engineered primary isolated immune cell comprises at least one anti-CLL1 multi-chain (CAR) of the invention.

[0553] In another preferred embodiment, said engineered primary isolated immune cell comprises at least one anti-CLL1 multi-chain (CAR) comprising at least one anti-CLL1 multi-chain (CAR) of the invention.

[0554] Pharmaceutical Composition

[0555] In one aspect, the present invention provides a pharmaceutical composition as described above.

[0556] The present invention provides pharmaceutical composition comprising at least one pharmaceutically acceptable vehicle and at least one primary cell endowed with at least one anti-CLL1 multi-chain (CAR).

[0557] In one embodiment said pharmaceutical composition comprises at least one pharmaceutically acceptable vehicle and at least one primary cell endowed with at least one anti-CLL1 multi-chain (CAR) of the invention.

[0558] In one embodiment said pharmaceutical composition comprises at least one pharmaceutically acceptable vehicle and at least one anti-CLL1 multi-chain (CAR) of the invention.

[0559] Methods of Engineering an Immune Cell

[0560] In encompassed particular embodiment, the invention relates to a method of preparing immune cells for immunotherapy comprising introducing into said immune cells the polypeptides composing said multi-chain CAR and expanding said cells. In particular embodiment, the invention relates to a method of engineering an immune cell comprising providing a cell and expressing at the surface of said cell at least one multi-chain CAR as described above. In particular embodiment, the method comprises transforming the cell with at least one polynucleotide encoding polypeptides composing at least one multi-chain CAR as described above, and expressing said polynucleotides into said cell.

[0561] In another embodiment, the present invention relates to a method of preparing cells for immunotherapy comprising introducing into said cells the different polypeptides composing said multi-chain CAR and expanding said cells.

[0562] In a preferred embodiment, said polynucleotides are included in lentiviral vectors in view of being stably expressed in the cells.

[0563] The invention relates to a method of preparing primary immune cells for immunotherapy comprising introducing into said primary immune cells the polypeptides composing at least one anti-CLL1 multi-chain (CAR) of the invention.

[0564] In another embodiment, the present invention provides a method of preparing primary immune cells for immunotherapy comprising introducing into said immune cells a polynucleotide encoding at least one anti-CLL1 multi-chain (CAR) of the invention.

[0565] Delivery Methods

[0566] The different methods described above involve introducing multi-chain CAR, pTalpha or functional variants thereof, rare cutting endonuclease, TALE-nuclease, CAR optionally with DNA-end processing enzyme or exogenous nucleic acid into a cell.

[0567] As non-limiting example, said multi-chain CAR can be introduced as transgenes encoded by one or as different plasmidic vectors. Different transgenes can be included in one vector which comprises a nucleic acid sequence encoding ribosomal skip sequence such as a sequence encoding a 2A peptide. 2A peptides, which were identified in the Aphthovirus subgroup of picornaviruses, causes a ribosomal "skip" from one codon to the next without the formation of a peptide bond between the two amino acids encoded by the codons (see Donnelly et al., J. of General Virology 82: 1013-1025 (2001); Donnelly et al., J. of Gen. Virology 78: 13-21 (1997); Doronina et al., Mol. And. Cell. Biology 28(13): 4227-4239 (2008); Atkins et al., RNA 13: 803-810 (2007)). By "codon" is meant three nucleotides on an mRNA (or on the sense strand of a DNA molecule) that are translated by a ribosome into one amino acid residue. Thus, two polypeptides can be synthesized from a single, contiguous open reading frame within an mRNA when the polypeptides are separated by a 2A oligopeptide sequence that is in frame. Such ribosomal skip mechanisms are well known in the art and are known to be used by several vectors for the expression of several proteins encoded by a single messenger RNA. As non-limiting example, in the present invention, 2A peptides have been used to express into the cell the rare-cutting endonuclease and a DNA end-processing enzyme or the different polypeptides of the multi-chain CAR.

[0568] Said plasmid vector can also contain a selection marker which provides for identification and/or selection of cells which received said vector.

[0569] Polypeptides may be synthesized in situ in the cell as a result of the introduction of polynucleotides encoding said polypeptides into the cell. Alternatively, said polypeptides could be produced outside the cell and then introduced thereto. Methods for introducing a polynucleotide construct into animal cells are known in the art and including as non-limiting examples stable transformation methods wherein the polynucleotide construct is integrated into the genome of the cell, transient transformation methods wherein the polynucleotide construct is not integrated into the genome of the cell and virus mediated methods. Said polynucleotides may be introduced into a cell by for example, recombinant viral vectors (e.g. retroviruses, adenoviruses), liposome and the like. For example, transient transformation methods include for example microinjection, electroporation or particle bombardment. Said polynucleotides may be included in vectors, more particularly plasmids or virus, in view of being expressed in cells.

[0570] Electroporation

[0571] In particular embodiment of the invention, polynucleotides encoding polypeptides according to the present invention can be mRNA which is introduced directly into the cells, for example by electroporation. The inventors determined the optimal condition for mRNA electroporation in T-cell.

[0572] The inventor used the cytoPulse technology which allows, by the use of pulsed electric fields, to transiently permeabilize living cells for delivery of material into the cells. The technology, based on the use of PulseAgile (Cellectis property) electroporation waveforms grants the precise control of pulse duration, intensity as well as the interval between pulses (U.S. Pat. No. 6,010,613 and International PCT application WO2004083379). All these parameters can be modified in order to reach the best conditions for high transfection efficiency with minimal mortality. Basically, the first high electric field pulses allow pore formation, while subsequent lower electric field pulses allow moving the polynucleotide into the cell. In one aspect of the present invention, the inventor describe the steps that led to achievement of >95% transfection efficiency of mRNA in T cells, and the use of the electroporation protocol to transiently express different kind of proteins in T cells. In particular the invention relates to a method of transforming T cell comprising contacting said T cell with RNA and applying to T cell an agile pulse sequence consisting of:

[0573] (a) one electrical pulse with a voltage range from 2250 to 3000 V per centimeter, a pulse width of 0.1 ms and a pulse interval of 0.2 to 10 ms between the electrical pulses of step (a) and (b);

[0574] (b) one electrical pulse with a voltage range from 2250 to 3000 V with a pulse width of 100 ms and a pulse interval of 100 ms between the electrical pulse of step (b) and the first electrical pulse of step (c); and

[0575] (c) 4 electrical pulses with a voltage of 325 V with a pulse width of 0.2 ms and a pulse interval of 2 ms between each of 4 electrical pulses.

[0576] In particular embodiment, the method of transforming T cell comprising contacting said T cell with RNA and applying to T cell an agile pulse sequence consisting of:

[0577] (a) one electrical pulse with a voltage of 2250, 2300, 2350, 2400, 2450, 2500, 2550, 2400, 2450, 2500, 2600, 2700, 2800, 2900 or 3000V per centimeter, a pulse width of 0.1 ms and a pulse interval of 0.2, 0.5, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 ms between the electrical pulses of step (a) and (b);

[0578] (b) one electrical pulse with a voltage range from 2250, of 2250, 2300, 2350, 2400, 2450, 2500, 2550, 2400, 2450, 2500, 2600, 2700, 2800, 2900 or 3000V with a pulse width of 100 ms and a pulse interval of 100 ms between the electrical pulse of step (b) and the first electrical pulse of step (c); and

[0579] (c) 4 electrical pulses with a voltage of 325 V with a pulse width of 0.2 ms and a pulse interval of 2 ms between each of 4 electrical pulses.

[0580] Any values included in the value range described above are disclosed in the present application. Electroporation medium can be any suitable medium known in the art. Preferably, the electroporation medium has conductivity in a range spanning 0.01 to 1.0 milliSiemens.

[0581] In particular embodiments, as non-limiting examples, said RNA encodes a rare-cutting endonuclease, one monomer of the rare-cutting endonuclease such as Half-TALE-nuclease, a Chimeric Antigen Receptor, at least one component of the multi-chain chimeric antigen receptor, a pTalpha or functional variant thereof, an exogenous nucleic acid, one additional catalytic domain.

[0582] Engineered Immune Cells

[0583] The present invention also relates to isolated cells or cell lines susceptible to be obtained by said method to engineer cells. In particular said isolated cell comprises at least one multi-chain CAR as described above. In another embodiment, said isolated cell comprises a population of multi-chain CARs each one comprising different extracellular ligand binding domains. In particular, said isolated cell comprises exogenous polynucleotide sequences encoding polypeptides composing at least one multi-chain CAR.

[0584] In the scope of the present invention is also encompassed an isolated immune cell, preferably a T-cell obtained according to any one of the methods previously described.

[0585] Said immune cell refers to a cell of hematopoietic origin functionally involved in the initiation and/or execution of innate and/or adaptative immune response. Said immune cell according to the present invention can be derived from a stem cell. The stem cells can be adult stem cells, embryonic stem cells, more particularly non-human stem cells, cord blood stem cells, progenitor cells, bone marrow stem cells, induced pluripotent stem cells, totipotent stem cells or hematopoietic stem cells. Representative human cells are CD34+ cells.

[0586] In a preferred embodiment, said isolated cell is an isolated stem CD34+ cell, said isolated stem CD34+ cell comprises at least one anti-CLL1 multi-chain (CAR) of the present invention.

[0587] In another preferred embodiment, said isolated cell is an isolated stem CD34+ cell, said isolated stem CD34+ cell comprises at least one anti-CLL1 multi-chain (CAR) comprising comprises at least one anti-CLL1 multi-chain (CAR) of the present invention.

[0588] Said isolated cell can also be a dendritic cell, killer dendritic cell, a mast cell, a NK-cell, a B-cell or a T-cell selected from the group consisting of inflammatory T-lymphocytes, cytotoxic T-lymphocytes, regulatory T-lymphocytes or helper T-lymphocytes.

[0589] In another embodiment, said cell can be derived from the group consisting of CD4+ T-lymphocytes and CD8+ T-lymphocytes.

[0590] Prior to expansion and genetic modification of the cells of the invention, a source of cells can be obtained from a subject through a variety of non-limiting methods. Cells can be obtained from a number of non-limiting sources, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors. In certain embodiments of the present invention, any number of T cell lines available and known to those skilled in the art, may be used. In another embodiment, said cell can be derived from a healthy donor, from a patient diagnosed with cancer or from a patient diagnosed with an infection. In another embodiment, said cell is part of a mixed population of cells which present different phenotypic characteristics. In the scope of the present invention is also encompassed a cell line obtained from a transformed T-cell according to the method previously described. Modified cells resistant to an immunosuppressive treatment and susceptible to be obtained by the previous method are encompassed in the scope of the present invention. As mentioned previously, such cells can be also genetically engineered to inactivate one or several genes selected, for instance, from the group consisting of CD52, GR, TCR alpha, TCR beta, HLA gene, immune check point genes such as PD1 and CTLA-4, or can express a pTalpha transgene.

[0591] In another embodiment, TCR is rendered not functional in the cells according to the invention by inactivating TCR alpha gene and/or TCR beta gene(s). The above strategies are used more particularly to avoid GvHD. In a particular aspect of the present invention is a method to obtain modified cells derived from an individual, wherein said cells can proliferate independently of the Major Histocompatibility Complex signaling pathway. Said method comprises the following steps:

[0592] (a) Recovering cells from said individual;

[0593] (b) Genetically modifying said cells ex-vivo by inactivating TCR alpha and/or TCR beta genes;

[0594] (c) Cultivating genetically modified T-cells in vitro in appropriate conditions to amplify said cells.

[0595] The present invention provides primary engineered T cell comprising at least one anti-CLL1 multi-chain (CAR) of the present invention.

[0596] The present invention provides primary engineered T cell comprising at least one anti-CLL1 multi-chain (CAR) of the present invention.

[0597] Modified cells, which can proliferate independently of the Major Histocompatibility Complex signaling pathway, susceptible to be obtained by this method are encompassed in the scope of the present invention. Said modified cells can be used in a particular aspect of the invention for treating patients in need thereof against Host versus Graft (HvG) rejection and Graft versus Host Disease (GvHD); therefore in the scope of the present invention is a method of treating patients in need thereof against Host versus Graft (HvG) rejection and Graft versus Host Disease (GvHD) comprising treating said patient by administering to said patient an effective amount of modified cells comprising inactivated TCR alpha and/or TCR beta genes.

[0598] In a more preferred embodiment, said method comprises:

[0599] (a) Providing a T-cell, preferably from a cell culture or from a blood sample;

[0600] (b) Transforming said T cell with nucleic acid encoding a rare-cutting endonuclease able to selectively inactivate by DNA cleavage, preferably by double-strand break at least one gene encoding a component of the T-cell receptor (TCR);

[0601] (c) Expressing said rare-cutting endonucleases into said T-cells;

[0602] (d) Sorting the transformed T-cells, which do not express TCR on their cell surface;

[0603] (e) Expanding said cells.

[0604] In another embodiment, said rare-cutting endonuclease can be a meganuclease, a Zinc finger nuclease or a TALE-nuclease. In a preferred embodiment, said rare-cutting endonuclease is a TALE-nuclease. Preferred methods and relevant TALE-nucleases have been described in WO2013176915.

[0605] The present invention provides primary engineered T cell comprising at least one anti-CLL1 multi-chain (CAR) of the present invention inducing from 50% to 100% less Host versus Graft (HvG) rejection than primary non engineered T cell.

[0606] The present invention provides primary engineered T cell comprising at least one anti-CLL1 multi-chain (CAR) of the present invention inducing from 50% to 100% less Host versus Graft (HvG) rejection than primary non engineered T cell.

[0607] Anti-CLL1 Immune Cells Made Resistant to Chemotherapy

[0608] According to a preferred embodiment of the invention, the immune cells endowed with an anti CLL1 multi-chain CAR are engineered to be resistant to chemotherapy drugs, in particular to purine nucleotide analogues (PNAs), making them suitable for cancer treatments in order to combine adoptive immunotherapy and chemotherapy. Purine nucleotide analogues enter chemotherapy compositions for many cancer treatments, especially leukemia. It is particularly used as a standard of care in AML. The most widely used PNAs are clofarabine, fludarabine, cytarabine and decitabine (Dacogen), alone or in combination. PNAs are metabolized by enzymes having deoxycytidine kinase (dCK) activity [EC 2.7.1.74] into mono, -di and tri-phosphate PNA. Their tri-phosphate forms and particularly clorofarabine triphosphate compete with ATP for DNA synthesis, acts as pro-apotptotic agent and are potent inhibitors of ribonucleotide reductase (RNR), which is involved in trinucleotide production.

[0609] The present invention thus includes a method of producing ex-vivo immune cells, preferably T-cells, which are resistant to a purine analogue drug and that can target CLL1 positive malignant cells. Said method comprises one or several of the following steps of:

[0610] (a) Providing an immune cell from a patient (autologous treatment) or from a donor;

[0611] (b) transfecting said immune cell with a nucleic acid sequence encoding a rare-cutting endonuclease specifically targeting a gene expressing an enzyme having deoxycytidine kinase activity (dcK--EC 2.7.1.74), in particular the human deoxycytidine kinase gene (NCBI Gene ID: 1633).

[0612] (c) expressing said endonuclease into said immune cells to obtain targeted inactivation of said dck gene;

[0613] (d) Expanding the engineered immune cells obtained in step c), optionally in the presence of said purine analogue drug; and

[0614] (e) Introducing into said immune cell an anti-CLL1 multi chain CAR as previously described.

[0615] The present inventors have successfully created anti-CLL1 T-cells resistant to purine nucleotide analogues, more particularly clorofarabine and/or fludarabine, by mediating the inactivation of dcK gene expression into said cells particularly by using TAL-nucleases. Transfection of the T-cells using mRNA encoding specific TAL-nuclease directed against cdk genes, preferably by using electroporation as described in WO2013176915, induced a significant resistance to the drugs, while maintaining T-cells cytotoxic activity towards CLL1 bearing cells.

[0616] The present application thus provides with anti-CLL1 T-cells, which expression of deoxycytidine kinase has been repressed or inactivated for the treatment of leukemia.

[0617] The present invention provides primary engineered T cell comprising at least one anti-CLL1 multi-chain (CAR) of the present invention, in which expression of deoxycytidine kinase has been repressed or inactivated for the treatment of leukemia, preferably AML

[0618] The present invention provides primary engineered T cell comprising at least one anti-CLL1 multi-chain (CAR) of the present invention, in which expression of deoxycytidine kinase has been repressed or inactivated for the treatment of leukemia, preferably AML.

[0619] Activation and Expansion of T Cells

[0620] Whether prior to or after genetic modification of the T cells, the T cells can be activated and expanded generally using methods as described, for example, in U.S. Pat. Nos. 6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358; 6,887,466; 6,905,681; 7,144,575; 7,067,318; 7,172,869; 7,232,566; 7,175,843; 5,883,223; 6,905,874; 6,797,514; 6,867,041; and U.S. Patent Application Publication No. 20060121005. T cells can be expanded in vitro or in vivo.

[0621] Generally, the T cells of the invention are expanded by contact with an agent that stimulates a CD3 TCR complex and a co-stimulatory molecule on the surface of the T cells to create an activation signal for the T-cell.

[0622] For example, chemicals such as calcium ionophore A23187, phorbol 12-myristate 13-acetate (PMA), or mitogenic lectins like phytohaemagglutinin (PHA) can be used to create an activation signal for the T-cell.

[0623] As non-limiting examples, T cell populations may be stimulated in vitro such as by contact with an anti-CD3 antibody, or antigen-binding fragment thereof, or an anti-CD2 antibody immobilized on a surface, or by contact with a protein kinase C activator (e.g., bryostatin) in conjunction with a calcium ionophore. For co-stimulation of an accessory molecule on the surface of the T cells, a ligand that binds the accessory molecule is used. For example, a population of T cells can be contacted with an anti-CD3 antibody and an anti-CD28 antibody, under conditions appropriate for stimulating proliferation of the T cells. To stimulate proliferation of either CD4+ T cells or CD8+ T cells, an anti-CD3 antibody and an anti-CD28 antibody. For example, the agents providing each signal may be in solution or coupled to a surface. As those of ordinary skill in the art can readily appreciate, the ratio of particles to cells may depend on particle size relative to the target cell. In further embodiments of the present invention, the cells, such as T cells, are combined with agent-coated beads, the beads and the cells are subsequently separated, and then the cells are cultured. In an alternative embodiment, prior to culture, the agent-coated beads and cells are not separated but are cultured together. Conditions appropriate for T cell culture include an appropriate media (e.g., Minimal Essential Media or RPMI Media 1640 or, X-vivo 5, (Lonza)) that may contain factors necessary for proliferation and viability, including serum (e.g., fetal bovine or human serum), interleukin-2 (IL-2), insulin, IFN-g, 1L-4, 1L-7, GM-CSF, -10, -2, 1L-15, TGFp, and TNF- or any other additives for the growth of cells known to the skilled artisan. Other additives for the growth of cells include, but are not limited to, surfactant, plasmanate, and reducing agents such as N-acetyl-cysteine and 2-mercaptoethanol. Media can include RPMI 1640, A1M-V, DMEM, MEM, a-MEM, F-12, X-Vivo 1, and X-Vivo 20, Optimizer, with added amino acids, sodium pyruvate, and vitamins, either serum-free or supplemented with an appropriate amount of serum (or plasma) or a defined set of hormones, and/or an amount of cytokine(s) sufficient for the growth and expansion of T cells. Antibiotics, e.g., penicillin and streptomycin, are included only in experimental cultures, not in cultures of cells that are to be infused into a subject. The target cells are maintained under conditions necessary to support growth; for example, an appropriate temperature (e.g., 37.degree. C.) and atmosphere (e.g., air plus 5% CO2). T cells that have been exposed to varied stimulation times may exhibit different characteristics

[0624] In another particular embodiment, said cells can be expanded by co-culturing with tissue or cells. Said cells can also be expanded in vivo, for example in the subject's blood after administrating said cell into the subject.

[0625] Medicament

[0626] The pharmaceutical composition of the invention for use as a medicament to prevent or treat AML comprises engineered primary immune cells, preferably primary immune T cells, comprising at least one anti-CLL1 multi-chain (CAR) of the invention, with at least one pharmaceutically acceptable vehicle.

[0627] The present invention provides an isolated immune cell according to above embodiments for its use as a medicament, preferably an isolated immune T cell endowed with a CLL1 mc CAR of the invention for its use as a medicament.

[0628] In one embodiment the present application provides an isolated immune T cells endowed with at least one anti-CLL1 multi-chain (CAR) of the invention for its use as a medicament to prevent or treat refractory/relapse AML.

[0629] The present invention provides an isolated inflammatory T-lymphocyte with at least one anti-CLL1 multi-chain (CAR) of the invention for its use as a medicament to prevent or treat AML.

[0630] The present invention provides an isolated cytotoxic T-lymphocyte endowed with at least one anti-CLL1 multi-chain (CAR) of the invention for its use as a medicament to prevent or treat AML.

[0631] The present invention provides an isolated regulatory T-lymphocyte endowed with at least one anti-CLL1 multi-chain (CAR) of the invention for its use as a medicament to prevent or treat AML.

[0632] The present invention provides an isolated helper T-lymphocyte endowed with at least one anti-CLL1 multi-chain (CAR) of the invention for its use as a medicament to prevent or treat AML.

[0633] The present invention provides an isolated immune NK cell endowed with at least one anti-CLL1 multi-chain (CAR) of the invention for its use as a medicament to prevent or treat AML

[0634] In another aspect the present invention provides a pharmaceutical composition for use as a medicament for the prevention or treatment of a pathological condition such as cancer, in particular a cancer of hematopoietic cells, more particularly AML.

[0635] Therapeutic Indications

[0636] Preferably, the present invention provides a method for treating a patient in need thereof comprising:

[0637] a) Providing an isolated immune T cell obtainable by a method according to any one of the above embodiments;

[0638] b) Administrating said T-cells to said patient,

[0639] wherein said patients is suffering from a cancer selected from AML, more preferably refractory/relapse AML.

[0640] The present invention provides a method for treating a patient as above wherein said immune cells are recovered from donors.

[0641] The present invention provides a method for treating a patient as above wherein said immune cells are recovered from a patient, preferably from the patient itself, the patient to be treated by said method.

[0642] In the present application a patient or a subject means non-human primates or humans.

[0643] A donor means a healthy individual or an individual suffering from a disease.

[0644] Leukemia/AML

[0645] The term "hematologic malignancy" or "hematologic cancer" refers to a cancer of the body's blood-bone marrow and/or lymphatic tissue. Examples of hematological malignancies include, in particular leukemia, such as acute myeloid leukemia (AML).

[0646] The term "leukemia" refers to malignant neoplasms of the blood-forming tissues, including, in particular, acute myelogenous leukemia (AML).

[0647] The term "relapsed" refers to a situation where a subject who has had a remission of cancer after therapy has a return of cancer cells.

[0648] The term "refractory or resistant" refers to a circumstance where a subject or a mammal, even after intensive treatment, has residual cancer cells in his body. T cells comprising an anti CLL1 multi-chain CAR of the invention are provided as a treatment in patients diagnosed with a pre-malignant or malignant cancer condition characterized by CLL1-expressing cells, especially by an overabundance of CLL1-expressing cells. Such conditions are found in hematologic cancers, such as leukemia and in particular acute myelogenous leukemia (AML).

[0649] AML Subtypes/Markers

[0650] AML or AML subtypes that may be treated using the anti CLL1 multi-chain CAR-expressing cells of the present invention may be in particular, acute myeloblastic leukemia, minimally differentiated acute myeloblastic leukemia, acute myeloblastic leukemia without maturation, acute myeloblastic leukemia with granulocytic maturation, promyelocytic or acute promyelocytic leukemia (APL), acute myelomonocytic leukemia, myelomonocytic together with bone marrow eosinophilia, acute monoblastic leukemia (M5a) or acute monocytic leukemia (M5b), acute erythroid leukemias, including erythroleukemia (M6a) and very rare pure erythroid leukemia (M6b), acute megakaryoblastic leukemia, acute basophilic leukemia, acute panmyelosis with myelofibrosis, whether involving CLL1-positive malignant cells.

[0651] Subtypes of AML also include, hairy cell leukemia, Philadelphia chromosome-positive acute lymphoblastic leukemia.

[0652] AML or AML subtypes that may be treated using the anti CLL1 multi-chain CAR-expressing cells of the present invention may be AML with specific genetic abnormalities. Classification is based on the ability of karyotype to predict response to induction therapy, relapse risk, survival.

[0653] Accordingly, AML that may be treated using the anti CLL1 multi-chain CAR-expressing cells of the present invention may be AML with a translocation between chromosomes 8 and 21, AML with a translocation or inversion in chromosome 16, AML with a translocation between chromosomes 9 and 11, APL (M3) with a translocation between chromosomes 15 and 17, AML with a translocation between chromosomes 6 and 9, AML with a translocation or inversion in chromosome 3, AML (megakaryoblastic) with a translocation between chromosomes 1 and 22.

[0654] The present invention is particularly useful for the treatment of AML associated with these particular cytogenetic markers.

[0655] The present invention also provides an anti CLL1 multi-chain CAR-expressing cells for the treatment of patients with specific cytogenetic subsets of AML, such as patients with t(15;17)(q22;q21) identified using all-trans retinoic acid (ATRA)16-19 and for the treatment of patients with t(8;21)(q22;q22) or inv(16)(p13q22)/t(16;16)(p13;q22) identified using repetitive doses of high-dose cytarabine.

[0656] Preferably, the present invention provides an anti CLL1 multi-chain CAR-expressing cells for the treatment of AML suffering patients with aberrations, such as -5/del(5q), -7, abnormalities of 3q, or a complex karyotype, who have been shown to have inferior complete remission rates and survival.

[0657] In another embodiment, isolated cell obtained by the different methods or cell line derived from said isolated cell as previously described can be used as a medicament.

[0658] In another embodiment, said medicament can be used for treating cancer or infections in a patient diagnosed with a pathology linked to CLL1 positive cells. In another embodiment, said isolated cell according to the invention or cell line derived from said isolated cell can be used in the manufacture of a medicament for treatment of a cancer, especially AML.

[0659] In another aspect, the present invention relies on methods for treating patients in need thereof, said method comprising at least one of the following steps:

[0660] (a) providing an immune-cell obtainable by any one of the methods previously described;

[0661] (b) Administrating said transformed immune cells to said patient,

[0662] On one embodiment, said T cells of the invention can undergo robust in vivo T cell expansion and can persist for an extended amount of time.

[0663] Said treatment can be ameliorating, curative or prophylactic. It may be either part of an autologous immunotherapy or part of an allogenic immunotherapy treatment. By autologous, it is meant that cells, cell line or population of cells used for treating patients are originating from said patient or from a Human Leucocyte Antigen (HLA) compatible donor. By allogeneic is meant that the cells or population of cells used for treating patients are not originating from said patient but from a donor.

[0664] The invention is particularly suited for allogenic immunotherapy, insofar as it enables the transformation of T-cells, typically obtained from donors, into non-alloreactive cells. This may be done under standard protocols and reproduced as many times as needed. The resulted modified T cells may be pooled and administrated to one or several patients, being made available as an "off the shelf" therapeutic product.

[0665] Cells that can be used with the disclosed methods are described in the previous section. Said treatment can be used to treat patients diagnosed with cancer, viral infection, autoimmune disorders or Graft versus Host Disease (GvHD). Cancers that may be treated include tumors that are not vascularized, or not yet substantially vascularized, as well as vascularized tumors. The cancers may comprise nonsolid tumors (such as hematological tumors, for example, leukemias and lymphomas) or may comprise solid tumors. Types of cancers to be treated with the multi-chain CARs of the invention include, but are not limited to, carcinoma, blastoma, and sarcoma, and certain leukemia or lymphoid malignancies, benign and malignant tumors, and malignancies e.g., sarcomas, carcinomas, and melanomas. Adult tumors/cancers and pediatric tumors/cancers are also included.

[0666] Administration: Routes/Posology

[0667] According to a preferred embodiment of the invention, said treatment can be administrated into patients undergoing an immunosuppressive treatment. Indeed, the present invention preferably relies on cells or population of cells, which have been made resistant to at least one immunosuppressive agent due to the inactivation of a gene encoding a receptor for such immunosuppressive agent. In this aspect, the immunosuppressive treatment should help the selection and expansion of the T-cells according to the invention within the patient. The administration of the cells or population of cells according to the present invention may be carried out in any convenient manner, including by aerosol inhalation, injection, ingestion, transfusion, implantation or transplantation. The compositions described herein may be administered to a patient subcutaneously, intradermally, intratumorally, intranodally, intramedullary, intramuscularly, by intravenous or intralymphatic injection, or intraperitoneally. In one embodiment, the cell compositions of the present invention are preferably administered by intravenous injection.

[0668] In another embodiment, said effective amount of cells or composition comprising those cells are administrated parenterally. Said administration can be an intravenous administration. Said administration can be directly done by injection within a tumor.

[0669] The administration of the cells or population of cells can consist of the administration of 10.sup.4-10.sup.9 cells per kg body weight, preferably 10.sup.5 to 10.sup.6 cells/kg body weight including all integer values of cell numbers within those ranges. The cells or population of cells can be administrated in one or more doses. In another embodiment, said effective amount of cells are administrated as a single dose. In another embodiment, said effective amount of cells are administrated as more than one dose over a period time. Timing of administration is within the judgment of managing physician and depends on the clinical condition of the patient. The cells or population of cells may be obtained from any source, such as a blood bank or a donor. While individual needs vary, determination of optimal ranges of effective amounts of a given cell type for a particular disease or conditions within the skill of the art. An effective amount means an amount which provides a therapeutic or prophylactic benefit. The dosage administrated will be dependent upon the age, health and weight of the recipient, kind of concurrent treatment, if any, frequency of treatment and the nature of the effect desired.

[0670] Combination with Other(s) Treatment(s)

[0671] It can be a treatment in combination with one or more therapies against cancer selected from the group of antibodies therapy, chemotherapy, cytokines therapy, dendritic cell therapy, gene therapy, hormone therapy, laser light therapy and radiation therapy.

[0672] In certain embodiments of the present invention, cells are administered to a patient in conjunction with (e.g., before, simultaneously or following) any number of relevant treatment modalities, including but not limited to treatment with agents such as antiviral therapy, cidofovir and interleukin-2, Cytarabine (also known as ARA-C) or natalizimab treatment for MS patients or efaliztimab treatment for psoriasis patients or other treatments for PML patients. In further embodiments, the T cells of the invention may be used in combination with chemotherapy, radiation, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunoablative agents such as CAM PATH, anti-CD3 antibodies or other antibody therapies, cytoxin, fludaribine, cyclosporin, FK506, rapamycin, mycoplienolic acid, steroids, FR901228, cytokines, and irradiation. These drugs inhibit either the calcium dependent phosphatase calcineurin (cyclosporine and FK506) or inhibit the p7056 kinase that is important for growth factor induced signaling (rapamycin) (Liu et al., Cell 66:807-815, 1 1; Henderson et al., Immun. 73:316-321, 1991; Bierer et al., Citrr. Opin. mm n. 5:763-773, 93). In a further embodiment, the cell compositions of the present invention are administered to a patient in conjunction with (e.g., before, simultaneously or following) bone marrow transplantation, T cell ablative therapy using either chemotherapy agents such as, fludarabine, external-beam radiation therapy (XRT), cyclophosphamide, or antibodies such as OKT3 or CAMPATH, In another embodiment, the cell compositions of the present invention are administered following B-cell ablative therapy such as agents that react with CD20, e.g., Rituxan. For example, in one embodiment, subjects may undergo standard treatment with high dose chemotherapy followed by peripheral blood stem cell transplantation. In certain embodiments, following the transplant, subjects receive an infusion of the expanded immune cells of the present invention. In an additional embodiment, expanded cells are administered before or following surgery. Said modified cells obtained by any one of the methods described here can be used in a particular aspect of the invention for treating patients in need thereof against Host versus Graft (HvG) rejection and Graft versus Host Disease (GvHD); therefore in the scope of the present invention is a method of treating patients in need thereof against Host versus Graft (HvG) rejection and Graft versus Host Disease (GvHD) comprising treating said patient by administering to said patient an effective amount of modified (engineered) cells comprising inactivated TCR alpha and/or TCR beta genes.

EXAMPLES

[0673] All methods disclosed in document PCT/EP2015/055848 are incorporated herein by references.

Example 1: Design of Multi-Chain CARs

[0674] Multi-chain CARs targeting the CLL1 antigen were designed based on the high affinity receptor for IgE (Fc.epsilon.RI) such as depicted in FIG. 2 to FIG. 4. The Fc.epsilon.RI expressed on mast cells and basophiles triggers allergic reactions. It is a tetrameric complex composed of a single a subunit, a single .beta. subunit and two disulfide-linked .gamma. subunits. The a subunit contains the IgE-binding domain. The .beta. and .gamma. subunits contain ITAMs that mediate signal transduction. In every multi-chain CAR, the extracellular domain of the FcR.alpha. chain was deleted and replaced by the respective scFv referred to .mu. ln Table 5 respectively and the CD8.alpha. hinge (SEQ ID NO: 2) and the ITAM of the FcR.beta. chain and/or the FcR.gamma. chain was deleted. The resulting constructions had the structure detailed in table 6.

Example 2: Expression of Anti-CLL1 mcCARs in Human T Cells

[0675] Primary T-Cell Cultures

[0676] T cells were purified from Buffy coat samples provided by EFS (Etablissement Francais du Sang, Paris, France) using Ficoll gradient density medium (Ficoll Paque PLUS/GE Healthcare Life Sciences). The PBMC layer was recovered and T cells were purified using a commercially available T-cell enrichment kit (Stem Cell Technologies). Purified T cells were activated in X-Vivo.TM.-15 medium (Lonza) supplemented with 20 ng/mL Human IL-2 (Miltenyi Biotech), 5% Human Serum (Sera Laboratories), and Dynabeads Human T activator CD3/CD28 at a bead:cell ratio 1:1 (Life Technologies). After activation cells were grown and maintained in X-Vivo.TM.-15 medium (Lonza) supplemented with 20 ng/mL Human IL-2 (Miltenyi Biotec) and 5% Human Serum (Sera Laboratories).

[0677] Models of AML and Clorofarabine, Fludarabine or Cytarabine Resistant AML

[0678] Originally, an AML-positive cell line, such as MOLM13 cell line, has been established from the peripheral blood of a 20-year-old man with acute myeloid leukemia AML FAB M5a at relapse in 1995 after initial myelodysplastic syndromes (MDS, refractory anemia with excess of blasts, RAEB).

[0679] To establish the MOLM13-Luc cell line and dck Knock out MOLM13-Luc cell line (clorofarabine, fludarabine or cytarabine resistant MOLM13-Luc cell line), MOLM13 cells (DSMZ ACC 554) were transfected with a nucleic acid sequence encoding a rare-cutting endonuclease specifically targeting a gene expressing an enzyme having deoxycytidine kinase activity (dcK-EC 2.7.1.74), namely the human deoxycytidine kinase gene (NCBI Gene ID: 1633), and with a lentivirus encoding the GFP and the firefly luciferase (amsbio LVP438-PBS).

[0680] The GFP-positive cells have been selected with Neomycin (ref 10131-027, Gibco, Life Technologies, Saint-Aubin, France). Resistance to clorofarabine, fludarabine or cytarabine of cdk KO MOLM13-Luc cells was tested in the presence of clorofarabine, fludarabine or cytarabine.

[0681] Transiently Expression in T Cells

[0682] The live T cells engineered using polycistronic mRNAs expressed the multi-chain CARs on their surface. Multi-chain CARs can be expressed in human T cells after electroporation of polycistronic mRNA. T cells were electroporated with capped and polyadenylated polycistronic mRNA that were produced using the mMESSAGE mMACHINE kit and linearized plasmids as template. The plasmids used as template contained the T7 RNA polymerase promoter followed by a polycistronic DNA sequence encoding the different CAR variants.

[0683] The electroporation of the polycistronic mRNAs into the human T cells was done using the CytoLVT-S device (Cellectis), according to the following protocol: 5.times.10.sup.6 T cells preactivated several days (3-5) with anti CD3/CD28 coated beads and IL2 were resuspended in cytoporation buffer T, and electroporated in 0.4 cm cuvettes with 45 .mu.g of mRNA.

[0684] 24 hours post electroporation, human T cells engineered using polycistronic mRNAs encoding the multi-chain CARs were labeled with a fixable viability dye eFluor-780 and a PE-conjugated goat anti mouse IgG F(ab')2 fragment specific, and analysed by flow cytometry.

[0685] The human T cells engineered using polycistronic mRNAs encoding the multi-chain CARs were co-cultured with target (Daudi) or AML cell line control cells for 24 hours. The supernatants were then harvested and analysed using the TH1/TH2 cytokine cytometric bead array kit to quantify the cytokines produced by the T cells. The assay aims to show that the human T cells expressing the multi-chain CARs produce IFN.gamma., IL8 and IL5 in coculture with CLL1 expressing target cells but not in coculture with control cells.

[0686] T-Cell Transduction and CAR Detection

[0687] Transduction of T-cells with recombinant lentiviral vectors along the expression of mcCAR was carried out three days after T-cell purification/activation. Lentiviral vectors were produced by Vectalys SA (Toulouse, France) by transfection of genomic and helper plasmids in HEK-293 cells. Transductions were carried out at a multiplicity of infection of 5, using 10.sup.6 cells per transduction. CAR detection at the surface of T-cells was done using a recombinant protein consisting on the fusion of the extracellular domain of the human CLL1 protein together with a murine IgG1 Fc fragment (produced by LakePharma). Binding of this protein to the CAR molecule was detected with a PE-conjugated secondary antibody (Jackson Immunoresearch) targeting the mouse Fc portion of the protein, and analyzed by flow cytometry.

Example 3: Degranulation of T Cells Transiently Expressing the Anti-CLL1 mcCARs Following Coculture with Target Cells

[0688] 24 hours post electroporation, human T cells engineered using polycistronic mRNAs encoding the multi-chain CARs were co-cultured with target (Daudi) or AML cell line control cells for 6 hours. The CD8+ T cells were then analyzed by flow cytometry to detect the expression of the degranulation marker CD107a at their surface. This experiment aims to check that the human CD8+ T cells expressing the CLL1 multi-chain CARs degranulate in coculture with CLL1 expressing target cells but not in coculture with control cells.

[0689] Degranulation Assay (CD107a Mobilization)

[0690] T-cells were incubated in 96-well plates (40,000 cells/well), together with an equal amount of cells expressing or not the CLL1 protein. Co-cultures were maintained in a final volume of 100 .mu.l of X-Vivo.TM.-15 medium (Lonza) for 6 hours at 37.degree. C. with 5% CO.sub.2. CD107a staining was done during cell stimulation, by the addition of a fluorescent anti-CD107a antibody (APC conjugated, from Miltenyi Biotec) at the beginning of the co-culture, together with 1 .mu.g/ml of anti-CD49d (BD Pharmingen), 1 .mu.g/ml of anti-CD28 (Miltenyi Biotec), and 1.times. Monensin solution (eBioscience). After the 6 h incubation period, cells were stained with a fixable viability dye (eFluor 780, from eBioscience) and fluorochrome-conjugated anti-CD8 (PE conjugated Miltenyi Biotec) and analyzed by flow cytometry.

[0691] The degranulation activity was determined as the % of CD8+/CD107a+ cells, and by determining the mean fluorescence intensity signal (MFI) for CD107a staining among CD8+ cells. Degranulation assays were carried out 8-10 days after T-cell transduction with mcCAR.

Example 4: Lyse of Target Cells by T Cells Transiently Expressing the Anti-CLL1 mcCARs

[0692] 24 hours post electroporation, human T cells engineered using polycistronic mRNAs encoding the multi-chain CARs were co-cultured with target (Daudi) or AML cell line control cells for 4 hours. The target cells were then analysed by flow cytometry to analyse their viability. This assay aims to show that the different cells expressing the CLL1 multi-chain CARs lyse the CLL1 expressing target cells but not the control cells.

[0693] Cytotoxicity Assay

[0694] T-cells were incubated in 96-well plates (100,000 cells/well), together with 10,000 target cells (expressing various levels of CLL1) and 10,000 control (CLL1neg) cells in the same well. Target and control cells were labelled with fluorescent intracellular dyes (CFSE or Cell Trace Violet, from Life Technologies) before co-culturing them with CAR+ T-cells (mcCAR+ T-cells or mcCAR+ T-cells). The co-cultures were incubated for 4 hours at 37.degree. C. with 5% CO.sub.2. After this incubation period, cells were labelled with a fixable viability dye (eFluor 780, from eBioscience) and analyzed by flow cytometry. Viability of each cellular population (target cells or CLL1neg control cells) was determined and the % of specific cell lysis was calculated. Cytotoxicity assays were carried out 48 h after mRNA transfection.

Example 5: Anti-Tumor Mouse Model

[0695] Animal housing and experimental procedures were carried out by Oncodesign (Dijon, France; http://www.oncodesign.com/), according to the French and European Regulations and NRC Guide for the Care and Use of Laboratory Animals. Immunodefficient female NOG (NOG) mice (NOD.Cg-Prkdcscidll2rgtm1Sug/JicTac) mice (NOD stands for non-obese diabetic), 6-8 weeks old, were obtained from Taconic (Ry, Danemark). In one arm of the experiment, mice received clorofarabine or fludarabine. Mice were intravenously (iv) injected with MOLM13-Luciferase cells or with clorofarabine resistant MOLM13-Luciferase cells as an AML and an clorofarabine resistant AML mouse model, respectively. Mice were then iv injected (7 days after injection of the tumor cell line) with different doses of mcCAR+ T-cells (from 10.sup.4 to 5.times.10.sup.6), or with T-cells that were not transduced with any CAR lentiviral vector.

[0696] Bioluminescent signals were determined the day before T-cell injection (D-1) and at D7 and 14 after T-cell injection, in order to follow tumoral progression on the different animals.

Example 6 Proliferation of TCRalpha Inactivated Cells Expressing a CLL1-mcCAR

[0697] Heterodimeric TALE-nuclease targeting two 17-bp long sequences (called half targets) separated by an 15-bp spacer within T-cell receptor alpha constant chain region (TRAC) gene were designed and produced. Each half target is recognized by repeats of the half TALE-nucleases listed in Table 8.

TABLE-US-00008 TABLE 8 TAL-nucleases targeting TCRalpha gene Target Target sequence Repeat sequence Half TALE-nuclease TRAC_T01 TTGTCCCACAGATATCC Repeat TRAC_T01-L TRAC_T01-L TALEN Agaaccctgaccctg (SEQ ID NO: 120) (SEQ ID NO: 122) CCGTGTACCAGCTGAGA Repeat TRAC_T01-R TRAC_T01-R TALEN (SEQ ID NO: 119) (SEQ ID NO: 121) (SEQ ID NO: 123)

[0698] Each TALE-nuclease construct was subcloned using restriction enzyme digestion in a mammalian expression vector under the control of the T7 promoter. mRNA encoding TALE-nuclease cleaving TRAC genomic sequence were synthesized from plasmid carrying the coding sequence downstream from the T7 promoter.

[0699] Purified T cells preactivated during 72 hours with antiCD3/CD28 coated beads were transfected with each of the 2 mRNAs encoding both half TRAC_T01 TALE-nucleases. 48 hours post-transfection, different groups of T cells from the same donor were respectively transduced with a lentiviral vector encoding one of the anti-CLL1 mcCAR previously described (SEQ ID NO: 18 to 37). 2 days post-transduction, CD3.sub.NEG cells were purified using anti-CD3 magnetic beads and 5 days post-transduction cells were reactivated with soluble anti-CD28 (5 .mu.g/ml).

[0700] 1. Cell proliferation was followed for up to 30 days after reactivation by counting cell 2 times per week. Increased proliferation in TCR alpha inactivated cells expressing the CLL1 mcCARs, especially when reactivated with anti-CD28, was observed compared to non-transduced cells.

[0701] To investigate whether the human T cells expressing the CLL1-mcCAR display activated state, the expression of the activation marker CD25 are analyzed by FACS 7 days post transduction. The purified cells transduced with the lentiviral vector encoding CLL1 mcCAR assayed for CD25 expression at their surface in order to assess their activation in comparison with the non-transduced cells. Increased CD25 expression is expected both in CD28 reactivation or no reactivation conditions.

Sequence CWU 1

1

137125PRThomo sapiensFc Receptor for IgE, alpha chain, signal peptide 1Met Ala Pro Ala Met Glu Ser Pro Thr Leu Leu Cys Val Ala Leu Leu 1 5 10 15 Phe Phe Ala Pro Asp Gly Val Leu Ala 20 25 245PRThomo sapiensCD8a-hinge 2Thr Thr Thr Pro Ala Pro Arg Pro Pro Thr Pro Ala Pro Thr Ile Ala 1 5 10 15 Ser Gln Pro Leu Ser Leu Arg Pro Glu Ala Cys Arg Pro Ala Ala Gly 20 25 30 Gly Ala Val His Thr Arg Gly Leu Asp Phe Ala Cys Asp 35 40 45 315PRTartificial sequencelinker for VH and VL fragments of the scFv 3Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser 1 5 10 15 452PRThomo sapiensFc Receptor for IgE, alpha chain, transmembrane and intracellular domain 4Phe Phe Ile Pro Leu Leu Val Val Ile Leu Phe Ala Val Asp Thr Gly 1 5 10 15 Leu Phe Ile Ser Thr Gln Gln Gln Val Thr Phe Leu Leu Lys Ile Lys 20 25 30 Arg Thr Arg Lys Gly Phe Arg Leu Leu Asn Pro His Pro Lys Pro Asn 35 40 45 Pro Lys Asn Asn 50 5215PRThomo sapiensFc Receptor for IgE, beta chain, without ITAM 5Met Asp Thr Glu Ser Asn Arg Arg Ala Asn Leu Ala Leu Pro Gln Glu 1 5 10 15 Pro Ser Ser Val Pro Ala Phe Glu Val Leu Glu Ile Ser Pro Gln Glu 20 25 30 Val Ser Ser Gly Arg Leu Leu Lys Ser Ala Ser Ser Pro Pro Leu His 35 40 45 Thr Trp Leu Thr Val Leu Lys Lys Glu Gln Glu Phe Leu Gly Val Thr 50 55 60 Gln Ile Leu Thr Ala Met Ile Cys Leu Cys Phe Gly Thr Val Val Cys 65 70 75 80 Ser Val Leu Asp Ile Ser His Ile Glu Gly Asp Ile Phe Ser Ser Phe 85 90 95 Lys Ala Gly Tyr Pro Phe Trp Gly Ala Ile Phe Phe Ser Ile Ser Gly 100 105 110 Met Leu Ser Ile Ile Ser Glu Arg Arg Asn Ala Thr Tyr Leu Val Arg 115 120 125 Gly Ser Leu Gly Ala Asn Thr Ala Ser Ser Ile Ala Gly Gly Thr Gly 130 135 140 Ile Thr Ile Leu Ile Ile Asn Leu Lys Lys Ser Leu Ala Tyr Ile His 145 150 155 160 Ile His Ser Cys Gln Lys Phe Phe Glu Thr Lys Cys Phe Met Ala Ser 165 170 175 Phe Ser Thr Glu Ile Val Val Met Met Leu Phe Leu Thr Ile Leu Gly 180 185 190 Leu Gly Ser Ala Val Ser Leu Thr Ile Cys Gly Ala Gly Glu Glu Leu 195 200 205 Lys Gly Asn Lys Val Pro Glu 210 215 642PRThomo sapiens41BB Intracellular domain 6Lys Arg Gly Arg Lys Lys Leu Leu Tyr Ile Phe Lys Gln Pro Phe Met 1 5 10 15 Arg Pro Val Gln Thr Thr Gln Glu Glu Asp Gly Cys Ser Cys Arg Phe 20 25 30 Pro Glu Glu Glu Glu Gly Gly Cys Glu Leu 35 40 741PRThomo sapiensCD28 Intracellular domain 7Arg Ser Lys Arg Ser Arg Gly Gly His Ser Asp Tyr Met Asn Met Thr 1 5 10 15 Pro Arg Arg Pro Gly Pro Thr Arg Lys His Tyr Gln Pro Tyr Ala Pro 20 25 30 Pro Arg Asp Phe Ala Ala Tyr Arg Ser 35 40 818PRThomo sapiensFc Receptor for IgE, gamma chain, signal peptide 8Met Ile Pro Ala Val Val Leu Leu Leu Leu Leu Leu Val Glu Gln Ala 1 5 10 15 Ala Ala 943PRThomo sapiensFc Receptor for IgE, gamma chain, without ITAM 9Leu Gly Glu Pro Gln Leu Cys Tyr Ile Leu Asp Ala Ile Leu Phe Leu 1 5 10 15 Tyr Gly Ile Val Leu Thr Leu Leu Tyr Cys Arg Leu Lys Ile Gln Val 20 25 30 Arg Lys Ala Ala Ile Thr Ser Tyr Glu Lys Ser 35 40 10112PRThomo sapiensCD3z intracellular domain 10Arg Val Lys Phe Ser Arg Ser Ala Asp Ala Pro Ala Tyr Gln Gln Gly 1 5 10 15 Gln Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu Glu Tyr 20 25 30 Asp Val Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu Met Gly Gly Lys 35 40 45 Pro Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu Leu Gln Lys 50 55 60 Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys Gly Glu Arg 65 70 75 80 Arg Arg Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu Ser Thr Ala 85 90 95 Thr Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala Leu Pro Pro Arg 100 105 110 1122PRTartificial sequenceGSG-P2A ribosomal skip peptide 11Gly Ser Gly Ala Thr Asn Phe Ser Leu Leu Lys Gln Ala Gly Asp Val 1 5 10 15 Glu Glu Asn Pro Gly Pro 20 1221PRTartificial sequenceGSG-T2A ribosomal skip peptide 12Gly Ser Gly Glu Gly Arg Gly Ser Leu Leu Thr Cys Gly Asp Val Glu 1 5 10 15 Glu Asn Pro Gly Pro 20 13115PRTartificial sequenceSC02-357 heavy chain variable region 13Gln Val Gln Leu Gln Glu Ser Gly Pro Gly Leu Val Lys Pro Ser Glu 1 5 10 15 Thr Leu Ser Leu Thr Cys Val Val Ser Gly Gly Ser Ile Ser Ser Ser 20 25 30 Asn Trp Trp Ser Trp Val Arg Gln Pro Pro Gly Lys Gly Leu Glu Trp 35 40 45 Ile Gly Glu Ile Tyr His Ser Gly Ser Pro Asn Tyr Asn Pro Ser Leu 50 55 60 Lys Ser Arg Val Thr Ile Ser Val Asp Lys Ser Lys Asn Gln Phe Ser 65 70 75 80 Leu Lys Leu Ser Ser Val Thr Ala Ala Asp Thr Ala Val Tyr Tyr Ser 85 90 95 Ser Ser Gly Gly Phe Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr 100 105 110 Val Ser Ser 115 14118PRTartificial sequenceSC02-378 heavy chain variable region 14Gln Val Gln Leu Gln Glu Ser Gly Pro Gly Leu Val Lys Pro Ser Glu 1 5 10 15 Thr Leu Ser Leu Thr Cys Val Val Ser Gly Gly Ser Ile Ser Ser Ser 20 25 30 Asn Trp Trp Ser Trp Val Arg Gln Pro Pro Gly Lys Gly Leu Glu Trp 35 40 45 Ile Gly Glu Ile Tyr His Ser Gly Ser Pro Asn Tyr Asn Pro Ser Leu 50 55 60 Lys Ser Arg Val Thr Ile Ser Val Asp Lys Ser Lys Asn Gln Phe Ser 65 70 75 80 Leu Lys Leu Ser Ser Val Thr Ala Ala Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Arg Ser Ser Ser Gly Gly Phe Phe Asp Tyr Trp Gly Gln Gly Thr 100 105 110 Leu Val Thr Val Ser Ser 115 15118PRTartificial sequenceSC02-161 heavy chain variable region 15Gln Val Gln Leu Gln Glu Ser Gly Pro Gly Leu Val Lys Pro Ser Glu 1 5 10 15 Thr Leu Ser Leu Thr Cys Val Val Ser Gly Gly Ser Ile Ser Ser Ser 20 25 30 Asn Trp Trp Ser Trp Val Arg Gln Pro Pro Gly Lys Gly Leu Glu Trp 35 40 45 Ile Gly Glu Ile Tyr His Ser Gly Ser Pro Asn Tyr Asn Pro Ser Leu 50 55 60 Lys Ser Arg Val Thr Ile Ser Val Asp Lys Ser Lys Asn Gln Phe Ser 65 70 75 80 Leu Lys Leu Ser Ser Val Thr Ala Ala Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Arg Gln Thr Thr Ala Gly Ser Phe Asp Tyr Trp Gly Gln Gly Thr 100 105 110 Leu Val Thr Val Ser Ser 115 16107PRTartificial sequenceSC02-357 & SC02-378 & SC02-161 light chain variable region 16Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Ser Tyr 20 25 30 Leu Asn Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45 Tyr Ala Ala Ser Ser Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60 Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro 65 70 75 80 Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Ser Tyr Ser Thr Pro Pro 85 90 95 Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys 100 105 17120PRTartificial sequenceM26 heavy chain variable region 17Glu Val Gln Leu Gln Gln Ser Gly Pro Glu Leu Val Lys Pro Gly Ala 1 5 10 15 Ser Val Lys Met Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr 20 25 30 Phe Ile His Trp Val Lys Gln Lys Pro Gly Gln Gly Leu Glu Trp Ile 35 40 45 Gly Phe Ile Asn Pro Tyr Asn Asp Gly Ser Lys Tyr Asn Glu Lys Phe 50 55 60 Lys Gly Lys Ala Thr Leu Thr Ser Asp Lys Ser Ser Ser Thr Ala Tyr 65 70 75 80 Met Glu Leu Ser Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95 Thr Arg Asp Asp Gly Tyr Tyr Gly Tyr Ala Met Asp Tyr Trp Gly Gln 100 105 110 Gly Thr Ser Val Thr Val Ser Ser 115 120 18108PRTartificial sequenceM26 light chain variable region 18Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Leu Gly 1 5 10 15 Glu Arg Val Ser Leu Thr Cys Arg Ala Thr Gln Glu Leu Ser Gly Tyr 20 25 30 Leu Ser Trp Leu Gln Gln Lys Pro Asp Gly Thr Ile Lys Arg Leu Ile 35 40 45 Tyr Ala Ala Ser Thr Leu Asp Ser Gly Val Pro Lys Arg Phe Ser Gly 50 55 60 Asn Arg Ser Gly Ser Asp Tyr Ser Leu Thr Ile Ser Ser Leu Glu Ser 65 70 75 80 Glu Asp Phe Ala Asp Tyr Tyr Cys Leu Gln Tyr Ala Ile Tyr Pro Tyr 85 90 95 Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg 100 105 19120PRTartificial sequenceM31 heavy chain variable region 19Glu Val Gln Leu Gln Gln Ser Gly Pro Glu Leu Val Lys Pro Gly Ala 1 5 10 15 Ser Val Lys Met Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr 20 25 30 Val Met His Trp Val Lys Gln Lys Pro Gly Gln Gly Leu Glu Trp Ile 35 40 45 Gly Tyr Ile Asn Pro Tyr Asn Asp Gly Thr Lys Tyr Asn Glu Lys Phe 50 55 60 Lys Gly Lys Ala Thr Leu Thr Ser Asp Thr Ser Ser Ser Thr Ala Tyr 65 70 75 80 Met Glu Leu Asn Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Phe Cys 85 90 95 Ala Arg Pro Ile Tyr Phe Asp Asn Asp Tyr Phe Asp Tyr Trp Gly Gln 100 105 110 Gly Thr Thr Leu Lys Val Ser Ser 115 120 20111PRTartificial sequenceM31 light chain variable region 20Thr Ile Val Leu Thr Gln Ser Pro Ala Ser Leu Ala Val Ser Leu Gly 1 5 10 15 Gln Arg Ala Thr Ile Ser Cys Arg Ala Ser Glu Ser Val Asp Ser Tyr 20 25 30 Gly Asn Ser Phe Met His Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro 35 40 45 Lys Leu Leu Ile Tyr Leu Ala Ser Asn Leu Glu Ser Gly Val Pro Ala 50 55 60 Arg Phe Ser Gly Ser Gly Ser Arg Thr Asp Phe Thr Leu Thr Ile Asp 65 70 75 80 Pro Val Glu Ala Asp Asp Ala Ala Thr Tyr Tyr Cys Gln Gln Asn Asn 85 90 95 Tyr Asp Pro Trp Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys 100 105 110 21120PRTartificial sequenceG4 heavy chain variable region 21Glu Val Gln Leu Gln Gln Ser Gly Pro Glu Leu Val Lys Pro Gly Ala 1 5 10 15 Ser Met Lys Ile Ser Cys Lys Ala Ser Gly Tyr Ser Phe Thr Gly Tyr 20 25 30 Thr Met Asn Trp Val Lys Gln Ser His Glu Lys Asn Leu Glu Trp Ile 35 40 45 Gly Pro Ile Asn Pro Tyr Asn Asp Gly Thr Ile Tyr Asn Pro Asn Phe 50 55 60 Lys Gly Lys Ala Thr Leu Thr Val Asp Lys Ala Ser Ser Thr Ala Tyr 65 70 75 80 Met Glu Leu Leu Ser Leu Thr Ser Asp Asp Pro Ala Val Tyr Tyr Cys 85 90 95 Ala Arg Thr Asp Asp Tyr Asp Asp Tyr Thr Met Asp Tyr Trp Gly Gln 100 105 110 Gly Thr Ser Val Thr Val Ser Ser 115 120 22107PRTartificial sequenceG4 light chain variable region 22Glu Ile Gln Met Thr Gln Thr Pro Ser Ser Leu Ser Ala Ser Leu Gly 1 5 10 15 Asp Arg Val Thr Ile Ser Cys Arg Ala Ser His Asp Ile Ser Asn Tyr 20 25 30 Leu Asn Trp Tyr Gln Gln Lys Pro Asp Gly Thr Leu Lys Leu Leu Ile 35 40 45 Tyr Tyr Thr Ser Arg Leu His Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60 Ser Gly Ser Gly Thr Asp Tyr Ser Leu Thr Ile Ser Asn Leu Glu Gln 65 70 75 80 Glu Asp Ile Ala Thr Tyr Phe Cys Gln Gln Gly Lys Thr Leu Leu Trp 85 90 95 Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys 100 105 23121PRTartificial sequenceM22 heavy chain variable region 23Gln Val Gln Leu Gln Gln Pro Gly Ala Glu Leu Val Lys Pro Gly Ala 1 5 10 15 Ser Val Lys Leu Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Arg Tyr 20 25 30 Trp Met His Trp Val Lys Gln Arg Pro Gly Gln Gly Leu Glu Trp Ile 35 40 45 Gly Asn Ile Asp Pro Ser Asp Thr Glu Thr His Tyr Asn Gln Gln Phe 50 55 60 Lys Asp Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser Thr Ala Tyr 65 70 75 80 Met Gln Leu Ser Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95 Ala Ile Tyr Tyr Gly Asn Pro Ser Tyr Tyr Ala Met Asp Tyr Trp Gly 100 105 110 Gln Gly Thr Ser Val Thr Val Ser Ser 115 120 24113PRTartificial sequenceM22 light chain variable region 24Asp Ile Val Met Thr Gln Ser Pro Ser Ser Leu Thr Val Thr Ala Gly 1 5 10 15 Glu Lys Val Thr Met Ser Cys Lys Ser Ser Gln Asn Leu Leu Asn Ser 20 25 30 Gly Asn Gln Lys Lys Tyr Leu Asn Trp Tyr Gln Gln Lys Pro Gly Gln 35 40 45 Pro Pro Lys Leu Leu Ile Tyr Trp Ala Ser Thr Arg Glu Ser Gly Val 50 55 60 Pro Asp Arg Phe Thr Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr 65 70 75 80 Ile Ser Ser Val Gln Ala Glu Asp Leu Ala Val Tyr Phe Cys Gln Asn 85 90 95 Asp Tyr Ser Tyr Pro Phe Thr Phe Gly Ala Gly Thr Lys Leu Glu Leu 100 105 110 Lys 25119PRTartificial sequenceM29 heavy chain variable region 25Glu Val Gln Leu Gln Gln Ser Gly Pro Glu Leu Val Lys Pro Gly Ala 1 5 10 15 Ser Val Lys Met Ser Cys Lys Ala Ser Gly Tyr Ile Phe Thr Ser Tyr 20 25 30 Val Met Tyr Trp Val Lys Gln Lys Pro Gly Gln Gly Leu Glu Trp Ile 35 40 45 Gly Tyr Ile Asn Pro Tyr Asn Asp Gly Thr Lys Tyr Asn Glu Lys Phe 50 55 60 Lys Gly Lys

Ala Thr Leu Thr Ser Asp Lys Ser Ser Ser Thr Ala Tyr 65 70 75 80 Met Glu Leu Ser Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95 Ala Arg Tyr Tyr Asp Tyr Asp Tyr Tyr Phe Asp Tyr Trp Gly Gln Gly 100 105 110 Thr Thr Leu Thr Val Ser Ser 115 26106PRTartificial sequenceM29 light chain variable region 26Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Leu Gly 1 5 10 15 Gly Lys Val Thr Ile Thr Cys Lys Ala Ser Gln Asp Ile Asn Lys Tyr 20 25 30 Ile Ala Trp Tyr Gln His Lys Pro Gly Lys Gly Pro Arg Leu Leu Ile 35 40 45 His Tyr Thr Ser Thr Leu Gln Pro Gly Ile Pro Ser Arg Phe Ser Gly 50 55 60 Ser Gly Ser Gly Arg Asp Tyr Ser Phe Ser Ile Ser Asn Leu Glu Pro 65 70 75 80 Glu Asp Ile Ala Thr Tyr Tyr Cys Leu Gln Tyr Asp Tyr Leu Trp Thr 85 90 95 Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys 100 105 27120PRTartificial sequenceM2 heavy chain variable region 27Glu Val Gln Leu Arg Gln Ser Gly Pro Glu Leu Val Lys Pro Gly Ala 1 5 10 15 Ser Val Lys Met Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr 20 25 30 Phe Met His Trp Val Lys Gln Lys Pro Gly Gln Gly Leu Glu Trp Ile 35 40 45 Gly Phe Ile Asn Pro Tyr Asn Asp Gly Thr Lys Tyr Asn Glu Lys Phe 50 55 60 Lys Gly Lys Ala Thr Leu Thr Ser Asp Lys Ser Ser Ser Thr Ala Tyr 65 70 75 80 Met Glu Leu Asn Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95 Thr Arg Asp Asp Gly Tyr Tyr Asp Tyr Ala Met Asp Tyr Trp Gly Gln 100 105 110 Gly Thr Ser Val Thr Val Ser Ser 115 120 28108PRTartificial sequenceM2 light chain variable region 28Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Leu Gly 1 5 10 15 Glu Arg Val Ser Leu Thr Cys Arg Ala Ser Gln Glu Ile Ser Val Tyr 20 25 30 Leu Ser Trp Leu Gln Gln Lys Pro Asp Gly Thr Ile Lys Arg Leu Ile 35 40 45 Tyr Ala Ala Ser Thr Leu Asp Ser Gly Val Pro Glu Arg Phe Ser Gly 50 55 60 Ser Arg Ser Gly Ser Asp Tyr Ser Leu Thr Ile Ser Ser Leu Glu Ser 65 70 75 80 Glu Asp Phe Ala Asp Tyr Tyr Cys Leu Gln Tyr Ala Ser Tyr Pro Tyr 85 90 95 Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg 100 105 29115PRTartificial sequenceM5 heavy chain variable region 29Glu Val Gln Leu Gln Gln Ser Gly Ala Glu Leu Val Arg Pro Gly Ala 1 5 10 15 Ser Val Lys Leu Ser Cys Thr Ala Ser Gly Phe Asn Ile Lys Asp Asp 20 25 30 Tyr Ile His Trp Val Lys Gln Arg Pro Glu Gln Gly Leu Glu Trp Ile 35 40 45 Gly Trp Ile Asp Pro Glu Lys Gly Asp Thr Ala Tyr Ala Ser Lys Phe 50 55 60 Gln Asp Lys Ala Thr Ile Thr Ser Asp Thr Ser Ser Asn Thr Ala Tyr 65 70 75 80 Leu Gln Leu Ser Ser Leu Thr Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Thr Leu Thr Gly Arg Phe Asp Tyr Trp Gly Gln Gly Thr Thr Leu Thr 100 105 110 Val Ser Ser 115 30112PRTartificial sequenceM5 light chain variable region 30Asp Ile Val Met Ser Gln Ser Pro Ser Ser Leu Ala Val Ser Val Gly 1 5 10 15 Glu Lys Val Thr Met Ser Cys Lys Ser Ser Gln Ser Leu Leu Tyr Ser 20 25 30 Ser Asn Gln Lys Asn Asn Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln 35 40 45 Ser Pro Lys Leu Leu Ile Tyr Trp Ala Ser Thr Arg Glu Ser Gly Val 50 55 60 Pro Asp Arg Phe Thr Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr 65 70 75 80 Ile Ser Ser Val Gln Ala Glu Asp Leu Ala Val Tyr Tyr Cys Gln Gln 85 90 95 Tyr Tyr Ser Tyr Arg Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys 100 105 110 31117PRTartificial sequenceG12 heavy chain variable region 31Gln Val Gln Leu Gln Gln Pro Gly Ala Glu Leu Val Lys Pro Gly Ala 1 5 10 15 Ser Met Lys Met Ser Cys Lys Ala Ser Gly Tyr Thr Phe Pro Ser Ser 20 25 30 Asn Ile His Trp Leu Lys Gln Thr Pro Gly Gln Gly Leu Glu Trp Ile 35 40 45 Gly Val Ile Tyr Pro Gly Asn Gly Asp Thr Ser Tyr Asn Gln Lys Phe 50 55 60 Lys Asp Lys Ala Thr Leu Thr Thr Asp Lys Ser Ser Ser Thr Ala Tyr 65 70 75 80 Met Gln Leu Ser Ser Leu Thr Ser Glu Asp Ser Ala Ile Tyr Phe Cys 85 90 95 Ala Arg Val Tyr Asn Trp His Phe Asp Val Trp Gly Ala Gly Thr Thr 100 105 110 Val Thr Val Ser Ser 115 32112PRTartificial sequenceG12 light chain variable region 32Asn Ile Val Leu Thr Gln Ser Pro Ala Ser Leu Ala Val Ser Leu Gly 1 5 10 15 Gln Arg Ala Thr Ile Ser Cys Arg Ala Ser Glu Ser Val Asp Gly Tyr 20 25 30 Gly Asp Ile Phe Met Leu Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro 35 40 45 Lys Leu Leu Ile Tyr Phe Ala Ser Asn Leu Glu Ser Gly Val Pro Ala 50 55 60 Arg Phe Ser Gly Ser Gly Ser Arg Thr Asp Phe Thr Leu Thr Ile Asp 65 70 75 80 Pro Val Glu Ala Asp Asp Ala Ala Thr Tyr Tyr Cys Gln Gln Asn Asn 85 90 95 Glu Asp Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg 100 105 110 33120PRTartificial sequence21.26 heavy chain variable region 33Gln Val Gln Leu Gln Gln Pro Gly Ala Glu Leu Val Lys Pro Gly Thr 1 5 10 15 Ser Val Lys Leu Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Arg Tyr 20 25 30 Trp Met His Trp Val Lys Gln Arg Pro Gly Gln Gly Leu Glu Trp Ile 35 40 45 Gly Met Ile His Pro Ser Ser Gly Ser Thr Ser Tyr Asn Glu Lys Val 50 55 60 Lys Asn Lys Ala Thr Leu Thr Val Asp Arg Ser Ser Thr Thr Ala Tyr 65 70 75 80 Met Gln Leu Ser Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95 Ala Arg Asp Gly Asp Tyr Tyr Tyr Gly Thr Gly Asp Tyr Trp Gly Gln 100 105 110 Gly Thr Thr Leu Thr Val Ser Ser 115 120 34106PRTartificial sequence21.26 light chain variable region 34Gln Ile Val Leu Ser Gln Ser Pro Ala Ile Leu Ser Ala Ser Pro Gly 1 5 10 15 Glu Lys Val Thr Met Thr Cys Arg Ala Ser Ser Ser Ile Asn Tyr Met 20 25 30 His Trp Tyr Gln Gln Lys Pro Gly Ser Ser Pro Lys Pro Trp Ile Phe 35 40 45 Ala Thr Ser Asn Leu Ala Ser Gly Val Pro Ser Arg Phe Ser Gly Ser 50 55 60 Gly Ser Gly Thr Ser Tyr Ser Leu Thr Ile Ser Arg Val Glu Ala Glu 65 70 75 80 Asp Ala Ala Thr Tyr Tyr Cys Gln Gln Trp Arg Ser Asp Arg Ala Leu 85 90 95 Thr Phe Gly Ala Gly Thr Lys Leu Glu Leu 100 105 35123PRTartificial sequence1075.7 heavy chain variable region 35Asp Ile Gln Leu Gln Glu Ser Gly Pro Gly Leu Val Lys Pro Ser Gln 1 5 10 15 Ser Leu Ser Leu Thr Cys Ser Val Thr Gly Tyr Ser Ile Thr Ser Ala 20 25 30 Tyr Tyr Trp Asn Trp Ile Arg Gln Phe Pro Gly Asn Lys Leu Glu Trp 35 40 45 Met Gly Tyr Ile Ser Tyr Asp Gly Arg Asn Asn Tyr Asn Pro Ser Leu 50 55 60 Lys Asn Arg Ile Ser Ile Thr Arg Asp Thr Ser Lys Asn Gln Phe Phe 65 70 75 80 Leu Lys Leu Asn Ser Val Thr Thr Glu Asp Thr Ala Thr Tyr Tyr Cys 85 90 95 Ala Lys Glu Gly Asp Tyr Asp Val Gly Asn Tyr Tyr Ala Met Asp Tyr 100 105 110 Trp Gly Gln Gly Thr Ser Val Thr Val Ser Ser 115 120 36107PRTartificial sequence1075.7 light chain variable region 36Glu Asn Val Leu Thr Gln Ser Pro Ala Ile Met Ser Ala Ser Pro Gly 1 5 10 15 Glu Lys Val Thr Met Thr Cys Arg Ala Ser Ser Asn Val Ile Ser Ser 20 25 30 Tyr Val His Trp Tyr Gln Gln Arg Ser Gly Ala Ser Pro Lys Leu Trp 35 40 45 Ile Tyr Ser Thr Ser Asn Leu Ala Ser Gly Val Pro Ala Arg Phe Ser 50 55 60 Gly Ser Gly Ser Gly Thr Ser Tyr Ser Leu Thr Ile Ser Ser Val Glu 65 70 75 80 Ala Glu Asp Ala Ala Thr Tyr Tyr Cys Gln Gln Tyr Ser Gly Tyr Pro 85 90 95 Leu Thr Phe Gly Ala Gly Thr Lys Leu Glu Leu 100 105 3710PRTartificial sequenceCDR1 of SC02-357 heavy chain variable region 37Gly Ser Ile Ser Ser Ser Asn Trp Trp Ser 1 5 10 3813PRTartificial sequenceCDR2 of SC02-357 heavy chain variable region 38Trp Ile Gly Glu Ile Tyr His Ser Gly Ser Pro Asp Tyr 1 5 10 3910PRTartificial sequenceCDR3 of SC02-357 heavy chain variable region 39Lys Val Ser Thr Gly Gly Phe Phe Asp Tyr 1 5 10 4010PRTartificial sequenceCDR1 of SC02-378 heavy chain variable region 40Gly Ser Ile Ser Ser Ser Asn Trp Trp Ser 1 5 10 4113PRTartificial sequenceCDR2 of SC02-378 heavy chain variable region 41Trp Ile Gly Glu Ile Tyr His Ser Gly Ser Pro Asn Tyr 1 5 10 4210PRTartificial sequenceCDR3 of SC02-378 heavy chain variable region 42Arg Ser Ser Ser Gly Gly Phe Phe Asp Tyr 1 5 10 4310PRTartificial sequenceCDR1 of SC02-161 heavy chain variable region 43Gly Ser Ile Ser Ser Ser Asn Trp Trp Ser 1 5 10 4413PRTartificial sequenceCDR2 of SC02-161 heavy chain variable region 44Trp Ile Gly Glu Ile Tyr His Ser Gly Ser Pro Asn Tyr 1 5 10 4510PRTartificial sequenceCDR3 of SC02-161 heavy chain variable region 45Arg Gln Thr Thr Ala Gly Ser Phe Asp Tyr 1 5 10 468PRTartificial sequenceCDR1 of SC02-357 & SC02-378 & SC02-161 light chain variable region 46Gln Ser Ile Ser Ser Tyr Leu Asn 1 5 4711PRTartificial sequenceCDR2 of SC02-357 & SC02-378 & SC02-161 light chain variable region 47Leu Leu Ile Tyr Ala Ala Ser Ser Leu Gln Ser 1 5 10 488PRTartificial sequenceCDR3 of SC02-357 & SC02-378 & SC02-161 light chain variable region 48Gln Gln Ser Tyr Ser Thr Pro Pro 1 5 4910PRTartificial sequenceCDR1 of M26 heavy chain variable region 49Gly Tyr Thr Phe Thr Ser Tyr Phe Ile His 1 5 10 5014PRTartificial sequenceCDR2 of M26 heavy chain variable region 50Trp Ile Gly Phe Ile Asn Pro Tyr Asn Asp Gly Ser Lys Tyr 1 5 10 5113PRTartificial sequenceCDR3 of M26 heavy chain variable region 51Thr Arg Asp Asp Gly Tyr Tyr Gly Tyr Ala Met Asp Tyr 1 5 10 528PRTartificial sequenceCDR1 of M26 light chain variable region 52Gln Glu Leu Ser Gly Tyr Leu Ser 1 5 5311PRTartificial sequenceCDR2 of M26 light chain variable region 53Arg Leu Ile Tyr Ala Ala Ser Thr Leu Asp Ser 1 5 10 548PRTartificial sequenceCDR3 of M26 light chain variable region 54Leu Gln Tyr Ala Ile Tyr Pro Tyr 1 5 5510PRTartificial sequenceCDR1 of M31 heavy chain variable region 55Gly Tyr Thr Phe Thr Ser Tyr Val Met His 1 5 10 5614PRTartificial sequenceCDR2 of M31 heavy chain variable region 56Trp Ile Gly Tyr Ile Asn Pro Tyr Asn Asp Gly Thr Lys Tyr 1 5 10 5710PRTartificial sequenceCDR3 of M31 heavy chain variable region 57Ala Arg Pro Ile Tyr Phe Asp Asn Asp Tyr 1 5 10 5812PRTartificial sequenceCDR1 of M31 light chain variable region 58Glu Ser Val Asp Ser Tyr Gly Asn Ser Phe Met His 1 5 10 5911PRTartificial sequenceCDR2 of M31 light chain variable region 59Leu Leu Ile Tyr Leu Ala Ser Asn Leu Glu Ser 1 5 10 608PRTartificial sequenceCDR3 of M31 light chain variable region 60Gln Gln Asn Asn Tyr Asp Pro Trp 1 5 618PRTartificial sequenceCDR1 of G4 heavy chain variable region 61Gln Gln Asn Asn Tyr Asp Pro Trp 1 5 6214PRTartificial sequenceCDR2 of G4 heavy chain variable region 62Trp Ile Gly Pro Ile Asn Pro Tyr Asn Asp Gly Thr Ile Tyr 1 5 10 6313PRTartificial sequenceCDR3 of G4 heavy chain variable region 63Ala Arg Thr Asp Asp Tyr Asp Asp Tyr Thr Met Asp Tyr 1 5 10 648PRTartificial sequenceCDR1 of G4 light chain variable region 64His Asp Ile Ser Asn Tyr Leu Asn 1 5 6511PRTartificial sequenceCDR2 of G4 light chain variable region 65Leu Leu Ile Tyr Tyr Thr Ser Arg Leu His Ser 1 5 10 668PRTartificial sequenceCDR3 of G4 light chain variable region 66Gln Gln Gly Lys Thr Leu Leu Trp 1 5 6710PRTartificial sequenceCDR1 of M22 heavy chain variable region 67Gly Tyr Thr Phe Thr Arg Tyr Trp Met His 1 5 10 6814PRTartificial sequenceCDR2 of M22 heavy chain variable region 68Trp Ile Gly Asn Ile Asp Pro Ser Asp Thr Glu Thr His Tyr 1 5 10 6914PRTartificial sequenceCDR3 of M22 heavy chain variable region 69Ala Ile Tyr Tyr Gly Asn Pro Ser Tyr Tyr Ala Met Asp Tyr 1 5 10 7014PRTartificial sequenceCDR1 of M22 light chain variable region 70Gln Asn Leu Leu Asn Ser Gly Asn Gln Lys Lys Tyr Leu Asn 1 5 10 7111PRTartificial sequenceCDR2 of M22 light chain variable region 71Leu Leu Ile Tyr Trp Ala Ser Thr Arg Glu Ser 1 5 10 728PRTartificial sequenceCDR3 of M22 light chain variable region 72Gln Asn Asp Tyr Ser Tyr Pro Phe 1 5 7310PRTartificial sequenceCDR1 of M29 heavy chain variable region 73Gly Tyr Ile Phe Thr Ser Tyr Val Met Tyr 1 5 10 748PRTartificial sequenceCDR2 of M29 heavy chain variable region 74Trp Ile Gly Tyr Ile Asn Pro Tyr 1 5 7512PRTartificial sequenceCDR3 of M29 heavy chain variable region 75Ala Arg Tyr Tyr Asp Tyr Asp Tyr Tyr Phe Asp Tyr 1 5 10 768PRTartificial sequenceCDR1 of M29 light chain variable region 76Gln Asp Ile Asn Lys Tyr Ile Ala 1 5 7711PRTartificial sequenceCDR2 of M29 light chain variable region 77Leu Leu Ile His Tyr Thr Ser Thr Leu Gln Pro 1 5 10 787PRTartificial sequenceCDR3 of M29 light chain variable region 78Leu Gln Tyr Asp Tyr Leu Trp 1 5 7910PRTartificial sequenceCDR1 of M2 heavy chain variable region 79Gly Tyr Thr Phe Thr Ser Tyr Phe Met His 1 5 10 8014PRTartificial sequenceCDR2 of M2 heavy chain variable region 80Trp Ile Gly Phe Ile Asn Pro Tyr Asn Asp Gly Thr Lys Tyr 1 5 10 8113PRTartificial sequenceCDR3 of M2 heavy chain variable region 81Thr Arg Asp Asp Gly Tyr Tyr Asp Tyr Ala Met Asp Tyr 1 5 10 828PRTartificial sequenceCDR1 of M2 light chain variable region 82Gln Glu

Ile Ser Val Tyr Leu Ser 1 5 8311PRTartificial sequenceCDR2 of M2 light chain variable region 83Arg Leu Ile Tyr Ala Ala Ser Thr Leu Asp Ser 1 5 10 848PRTartificial sequenceCDR3 of M2 light chain variable region 84Leu Gln Tyr Ala Ser Tyr Pro Tyr 1 5 8510PRTartificial sequenceCDR1 of M5 heavy chain variable region 85Gly Phe Asn Ile Lys Asp Asp Tyr Ile His 1 5 10 8616PRTartificial sequenceCDR2 of M5 heavy chain variable region 86Trp Ile Gly Trp Ile Asp Pro Glu Lys Gly Asp Thr Ala Tyr Ala Ser 1 5 10 15 878PRTartificial sequenceCDR3 of M5 heavy chain variable region 87Thr Leu Thr Gly Arg Phe Asp Tyr 1 5 8814PRTartificial sequenceCDR1 of M5 light chain variable region 88Gln Ser Leu Leu Tyr Ser Ser Asn Gln Lys Asn Asn Leu Ala 1 5 10 8911PRTartificial sequenceCDR2 of M5 light chain variable region 89Leu Leu Ile Tyr Trp Ala Ser Thr Arg Glu Ser 1 5 10 907PRTartificial sequenceCDR3 of M5 light chain variable region 90Gln Gln Tyr Tyr Ser Tyr Arg 1 5 9110PRTartificial sequenceCDR1 of G12 heavy chain variable region 91Gly Tyr Thr Phe Pro Ser Ser Asn Ile His 1 5 10 9214PRTartificial sequenceCDR2 of G12 heavy chain variable region 92Trp Ile Gly Val Ile Tyr Pro Gly Asn Gly Asp Thr Ser Tyr 1 5 10 9312PRTartificial sequenceCDR3 of G12 heavy chain variable region 93Ala Ile Tyr Phe Val Tyr Asn Trp His Phe Asp Val 1 5 10 9412PRTartificial sequenceCDR1 of G12 light chain variable region 94Glu Ser Val Asp Gly Tyr Gly Asp Ile Phe Met Leu 1 5 10 9511PRTartificial sequenceCDR2 of G12 light chain variable region 95Leu Leu Ile Tyr Phe Ala Ser Asn Leu Glu Ser 1 5 10 968PRTartificial sequenceCDR3 of G12 light chain variable region 96Gln Gln Asn Asn Glu Asp Pro Tyr 1 5 9710PRTartificial sequenceCDR1 of 21.26 heavy chain variable region 97Gly Tyr Thr Phe Thr Arg Tyr Trp Met His 1 5 10 9816PRTartificial sequenceCDR2 of 21.26 heavy chain variable region 98Met Ile His Pro Ser Ser Gly Ser Thr Ser Tyr Asn Glu Lys Val Lys 1 5 10 15 9912PRTartificial sequenceCDR3 of 21.26 heavy chain variable region 99Arg Asp Gly Asp Tyr Tyr Tyr Gly Thr Gly Asp Tyr 1 5 10 10010PRTartificial sequenceCDR1 of 21.26 light chain variable region 100Arg Ala Ser Ser Ser Ile Asn Tyr Met His 1 5 10 10111PRTartificial sequenceCDR2 of 21.26 light chain variable region 101Pro Trp Ile Phe Ala Thr Ser Asn Leu Ala Ser 1 5 10 10210PRTartificial sequenceCDR3 of 21.26 light chain variable region 102Gln Gln Trp Arg Ser Asp Arg Ala Leu Thr 1 5 10 10311PRTartificial sequenceCDR1 of 1075.7 heavy chain variable region 103Gly Tyr Ser Ile Thr Ser Ala Tyr Tyr Trp Asn 1 5 10 10416PRTartificial sequenceCDR2 of 1075.7 heavy chain variable region 104Tyr Ile Ser Tyr Asp Gly Arg Asn Asn Tyr Asn Pro Ser Leu Lys Asn 1 5 10 15 10516PRTartificial sequenceCDR3 of 1075.7 heavy chain variable region 105Ala Lys Glu Gly Asp Tyr Asp Val Gly Asn Tyr Tyr Ala Met Asp Tyr 1 5 10 15 10612PRTartificial sequenceCDR1 of 1075.7 light chain variable region 106Arg Ala Ser Ser Asn Val Ile Ser Ser Tyr Val His 1 5 10 10711PRTartificial sequenceCDR2 of 1075.7 light chain variable region 107Leu Trp Ile Tyr Ser Thr Ser Asn Leu Ala Ser 1 5 10 1089PRTartificial sequenceCDR3 of 1075.7 light chain variable region 108Gln Gln Tyr Ser Gly Tyr Pro Leu Thr 1 5 10910PRTartificial sequenceCD20 mimotope 109Cys Pro Tyr Ser Asn Pro Ser Leu Cys Ser 1 5 10 11024PRTartificial sequenceEpitope for palivizumab 110Asn Ser Glu Leu Leu Ser Leu Ile Asn Asp Met Pro Ile Thr Asn Asp 1 5 10 15 Gln Lys Lys Leu Met Ser Asn Asn 20 11112PRTartificial sequenceMimotope 1 for cetuximab 111Cys Gln Phe Asp Leu Ser Thr Arg Arg Leu Lys Cys 1 5 10 11212PRTartificial sequenceMimotope 2 for cetuximab 112Cys Gln Tyr Asn Leu Ser Ser Arg Ala Leu Lys Cys 1 5 10 11312PRTartificial sequenceMimotope 3 for cetuximab 113Cys Val Trp Gln Arg Trp Gln Lys Ser Tyr Val Cys 1 5 10 11412PRTartificial sequenceMimotope 4 for cetuximab 114Cys Met Trp Asp Arg Phe Ser Arg Trp Tyr Lys Cys 1 5 10 11525PRTartificial sequenceEpitope 1 for nivolumab 115Ser Phe Val Leu Asn Trp Tyr Arg Met Ser Pro Ser Asn Gln Thr Asp 1 5 10 15 Lys Leu Ala Ala Phe Pro Glu Asp Arg 20 25 11619PRTartificial sequenceEpitope 2 for nivolumab 116Ser Gly Thr Tyr Leu Cys Gly Ala Ile Ser Leu Ala Pro Lys Ala Gln 1 5 10 15 Ile Lys Glu 11714PRTartificial sequenceEpitope 1 for CD34 117Thr Phe Ser Asn Val Ser Thr Asn Val Ser Tyr Gln Glu Thr 1 5 10 11814PRTartificial sequenceEpitope 2 for CD34 118Asn Thr Asn Ser Ser Val Gln Ser Gln Thr Ser Val Ile Ser 1 5 10 11949DNAartificial sequenceTarget TALEN TRAC_T01 119ttgtcccaca gatatccaga accctgaccc tgccgtgtac cagctgaga 49120530PRTartificial sequenceTAL binding domain TRAC_T01-L 120Leu Thr Pro Gln Gln Val Val Ala Ile Ala Ser Asn Gly Gly Gly Lys 1 5 10 15 Gln Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln Ala 20 25 30 His Gly Leu Thr Pro Gln Gln Val Val Ala Ile Ala Ser Asn Asn Gly 35 40 45 Gly Lys Gln Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys 50 55 60 Gln Ala His Gly Leu Thr Pro Gln Gln Val Val Ala Ile Ala Ser Asn 65 70 75 80 Gly Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val 85 90 95 Leu Cys Gln Ala His Gly Leu Thr Pro Glu Gln Val Val Ala Ile Ala 100 105 110 Ser His Asp Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Arg Leu Leu 115 120 125 Pro Val Leu Cys Gln Ala His Gly Leu Thr Pro Glu Gln Val Val Ala 130 135 140 Ile Ala Ser His Asp Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Arg 145 150 155 160 Leu Leu Pro Val Leu Cys Gln Ala His Gly Leu Thr Pro Glu Gln Val 165 170 175 Val Ala Ile Ala Ser His Asp Gly Gly Lys Gln Ala Leu Glu Thr Val 180 185 190 Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly Leu Thr Pro Glu 195 200 205 Gln Val Val Ala Ile Ala Ser Asn Ile Gly Gly Lys Gln Ala Leu Glu 210 215 220 Thr Val Gln Ala Leu Leu Pro Val Leu Cys Gln Ala His Gly Leu Thr 225 230 235 240 Pro Glu Gln Val Val Ala Ile Ala Ser His Asp Gly Gly Lys Gln Ala 245 250 255 Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 260 265 270 Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser Asn Ile Gly Gly Lys 275 280 285 Gln Ala Leu Glu Thr Val Gln Ala Leu Leu Pro Val Leu Cys Gln Ala 290 295 300 His Gly Leu Thr Pro Gln Gln Val Val Ala Ile Ala Ser Asn Asn Gly 305 310 315 320 Gly Lys Gln Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys 325 330 335 Gln Ala His Gly Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser Asn 340 345 350 Ile Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Ala Leu Leu Pro Val 355 360 365 Leu Cys Gln Ala His Gly Leu Thr Pro Gln Gln Val Val Ala Ile Ala 370 375 380 Ser Asn Gly Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Arg Leu Leu 385 390 395 400 Pro Val Leu Cys Gln Ala His Gly Leu Thr Pro Glu Gln Val Val Ala 405 410 415 Ile Ala Ser Asn Ile Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Ala 420 425 430 Leu Leu Pro Val Leu Cys Gln Ala His Gly Leu Thr Pro Gln Gln Val 435 440 445 Val Ala Ile Ala Ser Asn Gly Gly Gly Lys Gln Ala Leu Glu Thr Val 450 455 460 Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly Leu Thr Pro Glu 465 470 475 480 Gln Val Val Ala Ile Ala Ser His Asp Gly Gly Lys Gln Ala Leu Glu 485 490 495 Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly Leu Thr 500 505 510 Pro Gln Gln Val Val Ala Ile Ala Ser Asn Gly Gly Gly Arg Pro Ala 515 520 525 Leu Glu 530 121530PRTartificial sequenceTAL binding domain TRAC_T01-R 121Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser His Asp Gly Gly Lys 1 5 10 15 Gln Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln Ala 20 25 30 His Gly Leu Thr Pro Gln Gln Val Val Ala Ile Ala Ser Asn Gly Gly 35 40 45 Gly Lys Gln Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys 50 55 60 Gln Ala His Gly Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser His 65 70 75 80 Asp Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val 85 90 95 Leu Cys Gln Ala His Gly Leu Thr Pro Glu Gln Val Val Ala Ile Ala 100 105 110 Ser Asn Ile Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Ala Leu Leu 115 120 125 Pro Val Leu Cys Gln Ala His Gly Leu Thr Pro Gln Gln Val Val Ala 130 135 140 Ile Ala Ser Asn Asn Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Arg 145 150 155 160 Leu Leu Pro Val Leu Cys Gln Ala His Gly Leu Thr Pro Glu Gln Val 165 170 175 Val Ala Ile Ala Ser His Asp Gly Gly Lys Gln Ala Leu Glu Thr Val 180 185 190 Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly Leu Thr Pro Gln 195 200 205 Gln Val Val Ala Ile Ala Ser Asn Gly Gly Gly Lys Gln Ala Leu Glu 210 215 220 Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly Leu Thr 225 230 235 240 Pro Gln Gln Val Val Ala Ile Ala Ser Asn Asn Gly Gly Lys Gln Ala 245 250 255 Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly 260 265 270 Leu Thr Pro Gln Gln Val Val Ala Ile Ala Ser Asn Asn Gly Gly Lys 275 280 285 Gln Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln Ala 290 295 300 His Gly Leu Thr Pro Gln Gln Val Val Ala Ile Ala Ser Asn Gly Gly 305 310 315 320 Gly Lys Gln Ala Leu Glu Thr Val Gln Arg Leu Leu Pro Val Leu Cys 325 330 335 Gln Ala His Gly Leu Thr Pro Glu Gln Val Val Ala Ile Ala Ser Asn 340 345 350 Ile Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Ala Leu Leu Pro Val 355 360 365 Leu Cys Gln Ala His Gly Leu Thr Pro Glu Gln Val Val Ala Ile Ala 370 375 380 Ser His Asp Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Arg Leu Leu 385 390 395 400 Pro Val Leu Cys Gln Ala His Gly Leu Thr Pro Glu Gln Val Val Ala 405 410 415 Ile Ala Ser Asn Ile Gly Gly Lys Gln Ala Leu Glu Thr Val Gln Ala 420 425 430 Leu Leu Pro Val Leu Cys Gln Ala His Gly Leu Thr Pro Glu Gln Val 435 440 445 Val Ala Ile Ala Ser His Asp Gly Gly Lys Gln Ala Leu Glu Thr Val 450 455 460 Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly Leu Thr Pro Gln 465 470 475 480 Gln Val Val Ala Ile Ala Ser Asn Asn Gly Gly Lys Gln Ala Leu Glu 485 490 495 Thr Val Gln Arg Leu Leu Pro Val Leu Cys Gln Ala His Gly Leu Thr 500 505 510 Pro Gln Gln Val Val Ala Ile Ala Ser Asn Gly Gly Gly Arg Pro Ala 515 520 525 Leu Glu 530 1222814DNAartificial sequencepolynucleotide encoding TRAC_T01-L TALEN 122atgggcgatc ctaaaaagaa acgtaaggtc atcgattacc catacgatgt tccagattac 60gctatcgata tcgccgatct acgcacgctc ggctacagcc agcagcaaca ggagaagatc 120aaaccgaagg ttcgttcgac agtggcgcag caccacgagg cactggtcgg ccacgggttt 180acacacgcgc acatcgttgc gttaagccaa cacccggcag cgttagggac cgtcgctgtc 240aagtatcagg acatgatcgc agcgttgcca gaggcgacac acgaagcgat cgttggcgtc 300ggcaaacagt ggtccggcgc acgcgctctg gaggccttgc tcacggtggc gggagagttg 360agaggtccac cgttacagtt ggacacaggc caacttctca agattgcaaa acgtggcggc 420gtgaccgcag tggaggcagt gcatgcatgg cgcaatgcac tgacgggtgc cccgctcaac 480ttgacccccc agcaggtggt ggccatcgcc agcaatggcg gtggcaagca ggcgctggag 540acggtccagc ggctgttgcc ggtgctgtgc caggcccacg gcttgacccc ccagcaggtg 600gtggccatcg ccagcaataa tggtggcaag caggcgctgg agacggtcca gcggctgttg 660ccggtgctgt gccaggccca cggcttgacc ccccagcagg tggtggccat cgccagcaat 720ggcggtggca agcaggcgct ggagacggtc cagcggctgt tgccggtgct gtgccaggcc 780cacggcttga ccccggagca ggtggtggcc atcgccagcc acgatggcgg caagcaggcg 840ctggagacgg tccagcggct gttgccggtg ctgtgccagg cccacggctt gaccccggag 900caggtggtgg ccatcgccag ccacgatggc ggcaagcagg cgctggagac ggtccagcgg 960ctgttgccgg tgctgtgcca ggcccacggc ttgaccccgg agcaggtggt ggccatcgcc 1020agccacgatg gcggcaagca ggcgctggag acggtccagc ggctgttgcc ggtgctgtgc 1080caggcccacg gcttgacccc ggagcaggtg gtggccatcg ccagcaatat tggtggcaag 1140caggcgctgg agacggtgca ggcgctgttg ccggtgctgt gccaggccca cggcttgacc 1200ccggagcagg tggtggccat cgccagccac gatggcggca agcaggcgct ggagacggtc 1260cagcggctgt tgccggtgct gtgccaggcc cacggcttga ccccggagca ggtggtggcc 1320atcgccagca atattggtgg caagcaggcg ctggagacgg tgcaggcgct gttgccggtg 1380ctgtgccagg cccacggctt gaccccccag caggtggtgg ccatcgccag caataatggt 1440ggcaagcagg cgctggagac ggtccagcgg ctgttgccgg tgctgtgcca ggcccacggc 1500ttgaccccgg agcaggtggt ggccatcgcc agcaatattg gtggcaagca ggcgctggag 1560acggtgcagg cgctgttgcc ggtgctgtgc caggcccacg gcttgacccc ccagcaggtg 1620gtggccatcg ccagcaatgg cggtggcaag caggcgctgg agacggtcca gcggctgttg 1680ccggtgctgt gccaggccca cggcttgacc ccggagcagg tggtggccat cgccagcaat 1740attggtggca agcaggcgct ggagacggtg caggcgctgt tgccggtgct gtgccaggcc 1800cacggcttga ccccccagca ggtggtggcc atcgccagca atggcggtgg caagcaggcg 1860ctggagacgg tccagcggct gttgccggtg ctgtgccagg cccacggctt gaccccggag 1920caggtggtgg ccatcgccag ccacgatggc ggcaagcagg cgctggagac ggtccagcgg 1980ctgttgccgg tgctgtgcca ggcccacggc ttgacccctc agcaggtggt ggccatcgcc 2040agcaatggcg gcggcaggcc ggcgctggag agcattgttg cccagttatc tcgccctgat 2100ccggcgttgg ccgcgttgac caacgaccac ctcgtcgcct tggcctgcct cggcgggcgt 2160cctgcgctgg atgcagtgaa aaagggattg ggggatccta tcagccgttc ccagctggtg 2220aagtccgagc tggaggagaa gaaatccgag ttgaggcaca agctgaagta cgtgccccac 2280gagtacatcg agctgatcga gatcgcccgg aacagcaccc aggaccgtat cctggagatg 2340aaggtgatgg agttcttcat gaaggtgtac ggctacaggg gcaagcacct gggcggctcc 2400aggaagcccg acggcgccat ctacaccgtg ggctccccca tcgactacgg cgtgatcgtg 2460gacaccaagg cctactccgg cggctacaac ctgcccatcg gccaggccga cgaaatgcag 2520aggtacgtgg aggagaacca gaccaggaac aagcacatca accccaacga gtggtggaag 2580gtgtacccct ccagcgtgac cgagttcaag ttcctgttcg tgtccggcca cttcaagggc 2640aactacaagg cccagctgac caggctgaac cacatcacca actgcaacgg cgccgtgctg 2700tccgtggagg agctcctgat cggcggcgag atgatcaagg ccggcaccct gaccctggag 2760gaggtgagga ggaagttcaa caacggcgag atcaacttcg cggccgactg ataa 28141232832DNAartificial sequencepolynucleotide encoding TRAC_T01-R TALEN

123atgggcgatc ctaaaaagaa acgtaaggtc atcgataagg agaccgccgc tgccaagttc 60gagagacagc acatggacag catcgatatc gccgatctac gcacgctcgg ctacagccag 120cagcaacagg agaagatcaa accgaaggtt cgttcgacag tggcgcagca ccacgaggca 180ctggtcggcc acgggtttac acacgcgcac atcgttgcgt taagccaaca cccggcagcg 240ttagggaccg tcgctgtcaa gtatcaggac atgatcgcag cgttgccaga ggcgacacac 300gaagcgatcg ttggcgtcgg caaacagtgg tccggcgcac gcgctctgga ggccttgctc 360acggtggcgg gagagttgag aggtccaccg ttacagttgg acacaggcca acttctcaag 420attgcaaaac gtggcggcgt gaccgcagtg gaggcagtgc atgcatggcg caatgcactg 480acgggtgccc cgctcaactt gaccccggag caggtggtgg ccatcgccag ccacgatggc 540ggcaagcagg cgctggagac ggtccagcgg ctgttgccgg tgctgtgcca ggcccacggc 600ttgacccccc agcaggtggt ggccatcgcc agcaatggcg gtggcaagca ggcgctggag 660acggtccagc ggctgttgcc ggtgctgtgc caggcccacg gcttgacccc ggagcaggtg 720gtggccatcg ccagccacga tggcggcaag caggcgctgg agacggtcca gcggctgttg 780ccggtgctgt gccaggccca cggcttgacc ccggagcagg tggtggccat cgccagcaat 840attggtggca agcaggcgct ggagacggtg caggcgctgt tgccggtgct gtgccaggcc 900cacggcttga ccccccagca ggtggtggcc atcgccagca ataatggtgg caagcaggcg 960ctggagacgg tccagcggct gttgccggtg ctgtgccagg cccacggctt gaccccggag 1020caggtggtgg ccatcgccag ccacgatggc ggcaagcagg cgctggagac ggtccagcgg 1080ctgttgccgg tgctgtgcca ggcccacggc ttgacccccc agcaggtggt ggccatcgcc 1140agcaatggcg gtggcaagca ggcgctggag acggtccagc ggctgttgcc ggtgctgtgc 1200caggcccacg gcttgacccc ccagcaggtg gtggccatcg ccagcaataa tggtggcaag 1260caggcgctgg agacggtcca gcggctgttg ccggtgctgt gccaggccca cggcttgacc 1320ccccagcagg tggtggccat cgccagcaat aatggtggca agcaggcgct ggagacggtc 1380cagcggctgt tgccggtgct gtgccaggcc cacggcttga ccccccagca ggtggtggcc 1440atcgccagca atggcggtgg caagcaggcg ctggagacgg tccagcggct gttgccggtg 1500ctgtgccagg cccacggctt gaccccggag caggtggtgg ccatcgccag caatattggt 1560ggcaagcagg cgctggagac ggtgcaggcg ctgttgccgg tgctgtgcca ggcccacggc 1620ttgaccccgg agcaggtggt ggccatcgcc agccacgatg gcggcaagca ggcgctggag 1680acggtccagc ggctgttgcc ggtgctgtgc caggcccacg gcttgacccc ggagcaggtg 1740gtggccatcg ccagcaatat tggtggcaag caggcgctgg agacggtgca ggcgctgttg 1800ccggtgctgt gccaggccca cggcttgacc ccggagcagg tggtggccat cgccagccac 1860gatggcggca agcaggcgct ggagacggtc cagcggctgt tgccggtgct gtgccaggcc 1920cacggcttga ccccccagca ggtggtggcc atcgccagca ataatggtgg caagcaggcg 1980ctggagacgg tccagcggct gttgccggtg ctgtgccagg cccacggctt gacccctcag 2040caggtggtgg ccatcgccag caatggcggc ggcaggccgg cgctggagag cattgttgcc 2100cagttatctc gccctgatcc ggcgttggcc gcgttgacca acgaccacct cgtcgccttg 2160gcctgcctcg gcgggcgtcc tgcgctggat gcagtgaaaa agggattggg ggatcctatc 2220agccgttccc agctggtgaa gtccgagctg gaggagaaga aatccgagtt gaggcacaag 2280ctgaagtacg tgccccacga gtacatcgag ctgatcgaga tcgcccggaa cagcacccag 2340gaccgtatcc tggagatgaa ggtgatggag ttcttcatga aggtgtacgg ctacaggggc 2400aagcacctgg gcggctccag gaagcccgac ggcgccatct acaccgtggg ctcccccatc 2460gactacggcg tgatcgtgga caccaaggcc tactccggcg gctacaacct gcccatcggc 2520caggccgacg aaatgcagag gtacgtggag gagaaccaga ccaggaacaa gcacatcaac 2580cccaacgagt ggtggaaggt gtacccctcc agcgtgaccg agttcaagtt cctgttcgtg 2640tccggccact tcaagggcaa ctacaaggcc cagctgacca ggctgaacca catcaccaac 2700tgcaacggcg ccgtgctgtc cgtggaggag ctcctgatcg gcggcgagat gatcaaggcc 2760ggcaccctga ccctggagga ggtgaggagg aagttcaaca acggcgagat caacttcgcg 2820gccgactgat aa 28321244PRTartificial sequencelinker for VH and VL fragments of the scFv 124Ser Gly Gly Ser 1 1255PRTartificial sequencelinker for VH and VL fragments of the scFv 125Ser Ser Gly Gly Ser 1 5 1264PRTartificial sequencelinker for VH and VL fragments of the scFv 126Gly Gly Gly Gly 1 1275PRTartificial sequencelinker for VH and VL fragments of the scFv 127Ser Gly Gly Gly Gly 1 5 1285PRTartificial sequencelinker for VH and VL fragments of the scFv 128Gly Gly Gly Gly Ser1 5 1296PRTartificial sequencelinker for VH and VL fragments of the scFv 129Ser Gly Gly Gly Gly Ser1 5 1306PRTartificial sequencelinker for VH and VL fragments of the scFv 130Gly Gly Gly Gly Gly Ser1 5 1317PRTartificial sequencelinker for VH and VL fragments of the scFv 131Ser Gly Gly Gly Gly Gly Ser1 5 1326PRTartificial sequencelinker for VH and VL fragments of the scFv 132Ser Gly Gly Gly Gly Gly1 5 1337PRTartificial sequencelinker for VH and VL fragments of the scFv 133Gly Ser Gly Gly Gly Gly Ser1 5 1348PRTartificial sequencelinker for VH and VL fragments of the scFv 134Gly Gly Gly Gly Gly Gly Gly Ser1 5 1358PRTartificial sequencelinker for VH and VL fragments of the scFv 135Ser Gly Gly Gly Gly Gly Gly Gly1 5 1369PRTartificial sequencelinker for VH and VL fragments of the scFv 136Ser Gly Gly Gly Gly Gly Gly Gly Ser1 5 13711PRTartificial sequencelinker for VH and VL fragments of the scFv 137Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser1 5 10

Claims

1. A CLL1 specific multi-chain Chimeric Antigen Receptor (mcCAR) comprising at least: a first transmembrane polypeptide comprising at least one extracellular ligand-binding domain, wherein the at least one extracellular ligand-binding domain binds to the cell surface CLL1 antigen; and; a second polypeptide comprising at least one signal-transducing domain; wherein the signal transducing domain(s) of the mcCAR is present on a polypeptide distinct from that carrying the extracellular ligand-binding domain(s).

2. The CLL1 specific mcCAR of claim 1, wherein said signal-transducing domain is a transmembrane polypeptide.

3. The CLL1 specific mcCAR of claim 1, wherein the mcCAR comprises at least one transmembrane polypeptide and comprises a part of an Fc receptor.

4. The CLL1 specific mcCAR of claim 3, wherein said part of the Fc receptor is selected from: (a) Fc.epsilon.RI alpha chain, (b) Fc.epsilon.RI beta chain or (c) Fc.epsilon.RI gamma chain.

5. The CLL1 specific mcCAR of claim 3, wherein a transmembrane polypeptide from the alpha chain of Fc.epsilon.RI is fused to an extracellular CLL1 ligand binding domain.

6. The CLL1 specific mcCAR according to claim 3 further comprising: a second transmembrane polypeptide from a gamma or beta chain of Fc.epsilon.RI fused to a signal transducing domain;

7. The CLL1 specific mcCAR according to claim 3, further comprising: a third transmembrane polypeptide from a gamma or beta chain of Fc.epsilon.RI comprising a co-stimulatory domain.

8. The CLL1 specific mcCAR according to claim 1, wherein said CLL1 ligand binding domain is fused to an alpha chain of a Fc.epsilon.RI and is a single-chain variable fragment (scFv) comprising heavy (V.sub.H) and light (V.sub.L) chains conferring specificity to CLL1.

9. The CLL1 specific mcCAR of claim 8, wherein said V.sub.H comprises a polypeptide sequence having at least 90% sequence identity to SEQ ID NOs. 13, 14, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33 or 35.

10. The CLL1 specific mcCAR of claim 8, wherein said V.sub.L comprises a polypeptide having at least 90% sequence identity to SEQ ID NOs. 16, 18, 20, 22, 24, 26, 28, 30, 32, 34 or 36.

11. The CLL1 specific mcCAR of claim 4, wherein said Fc.epsilon.RI alpha chain is fused to said extracellular ligand-binding domain by a hinge from CD8.alpha., IgG1 or FcRIII.alpha. proteins.

12. The CLL1 specific mcCAR of claim 11, wherein said hinge comprises a polypeptide sequence displaying at least 90% sequence identity to SEQ ID NO. 2.

13. The CLL1 specific mcCAR according to claim 6, wherein said signal transducing domain fused to the gamma or beta chain of Fc.epsilon.RI is from a T-cell receptor (TCR) zeta chain, a FC.epsilon.R.beta. chain, a Fc.epsilon.RI.gamma. chain, or includes an immunoreceptor tyrosine-based activation motif (ITAM).

14. The CLL1 specific mcCAR according to claim 13, wherein said signal transducing domain is from CD3zeta.

15. The CLL1 specific mcCAR according to claim 14, wherein said signal transducing domain comprises a polypeptide sequence having at least 90% identity to SEQ ID NO. 10.

16. The CLL1 specific mcCAR according to claim 1, further comprising a third polypeptide, wherein the second and third polypeptides comprises a co-stimulatory domain from the cytoplasmic domain of a costimulatory molecule of CD27, CD28, 4-1BB, OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, CD8, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83, or any combination thereof.

17. The CLL1 specific mcCAR according to claim 16, wherein said co-stimulatory domain is from 4-1BB and comprises a polypeptide sequence having at least 90% sequence identity to SEQ ID NO. 6.

18. The CLL1 specific mcCAR according to claim 16, wherein said co-stimulatory domain is from CD28 and comprises a polypeptide sequence having at least 90% sequence identity to SEQ ID NO. 7.

19. The CLL1 specific mcCAR according to claim 1, wherein at least one epitope is inserted in at least one of the extracellular domain(s) of said CAR.

20. The CLL1 specific mcCAR according to claim 19, wherein said extracellular domain(s) is an extracellular ligand binding domain of said CAR.

21. The CLL1 specific mcCAR according to claim 20, wherein said extracellular ligand binding domain of said CAR binds CLL1.

22. The CLL1 specific mcCAR according to claim 21, wherein the extracellular ligand binding domain comprises 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 mAb-specific epitopes.

23. The CLL1 specific mcCAR according to claim 22, wherein the extracellular ligand binding domain comprises 1, 2, 3 or, 4 mAb-specific epitopes.

24. The CLL1 specific mcCAR according to claim 23, wherein the extracellular ligand binding domain comprises 2, 3 or, 4 mAb-specific epitopes.

25. The CLL1 specific mcCAR according to claim 23, wherein the extracellular ligand binding domain comprises one of the following sequences: V.sub.1-L.sub.1-V.sub.2-(L).sub.x-Epitope1-(L).sub.x-; V.sub.1-L.sub.1-V.sub.2-(L).sub.x-Epitope1-(L).sub.x-Epitope2-(L).sub.x-; V.sub.1-L.sub.1-V.sub.2-(L).sub.x-Epitope1-(L).sub.x-Epitope2-(L).sub.x-E- pitope3-(L).sub.x-; (L).sub.x-Epitope1-(L).sub.x-V.sub.1-L.sub.1-V.sub.2; (L).sub.x-Epitope1-(L).sub.x-Epitope2-(L).sub.x-V.sub.1-L.sub.1-V.sub.2; Epitope1-(L).sub.x-Epitope2-(L).sub.x-Epitope3-(L).sub.x-V.sub.1-L.sub.1-- V.sub.2; (L).sub.x-Epitope1-(L).sub.x-V.sub.1-L.sub.1-V.sub.2-(L).sub.x-Ep- itope2-(L).sub.x; (L).sub.x-Epitope1-(L).sub.x-V.sub.1-L.sub.1-V.sub.2-(L).sub.x-Epitope2-(- L).sub.x-Epitope3-(L).sub.x-; (L).sub.x-Epitope1-(L).sub.x-V.sub.1-L.sub.1-V.sub.2-(L).sub.x-Epitope2-(- L).sub.x-Epitope3-(L).sub.x-Epitope4-(L).sub.x-; (L).sub.x-Epitope1-(L).sub.x-Epitope2-(L).sub.x-V.sub.1-L.sub.1-V.sub.2-(- L).sub.x-Epitope3-(L).sub.x-; (L).sub.x-Epitope1-(L).sub.x-Epitope2-(L).sub.x-V.sub.1-L.sub.1-V.sub.2-(- L).sub.x-Epitope3-(L).sub.x-Epitope4-(L).sub.x-; V.sub.1-(L).sub.x-Epitope1-(L).sub.x-V.sub.2; V.sub.1-(L).sub.x-Epitope1-(L).sub.x-V.sub.2-(L).sub.x-Epitope2-(L).sub.x- ; V.sub.1-(L).sub.x-Epitope1-(L).sub.x-V.sub.2-(L).sub.x-Epitope2-(L).sub.- x-Epitope3-(L).sub.x; V.sub.1-(L).sub.x-Epitope1-(L).sub.x-V.sub.2-(L).sub.x-Epitope2-(L).sub.x- -Epitope3-(L).sub.x-Epitope4-(L).sub.x; (L).sub.x-Epitope1-(L).sub.x-V.sub.1-(L).sub.x-Epitope2-(L).sub.x-V.sub.2- ; or, (L).sub.x-Epitope1-(L).sub.x-V.sub.1-(L).sub.x-Epitope2-(L).sub.x-V.- sub.2-(L).sub.x-Epitope3-(L).sub.x; wherein, V.sub.1 is V.sub.L and V.sub.2 is V.sub.H or V.sub.1 is V.sub.H and V.sub.2 is V.sub.L; L.sub.1 is a linker suitable to link the V.sub.H chain to the V.sub.L chain; L is a linker comprising glycine and serine residues, and each occurrence of L in the extracellular binding domain can be identical or different to other occurrence of L in the same extracellular binding domain, and, x is 0 or 1 and each occurrence of x is selected independently from the others; and, Epitope 1, Epitope 2 or Epitope 3 are mAb-specific epitopes and can be identical or different.

26. The CLL1 specific mcCAR according to claim 22, wherein the ligand binding domain comprises the following sequence: V.sub.1-L.sub.1-V.sub.2-L-Epitope1; V.sub.1-L.sub.1-V.sub.2-L-Epitope1-L; V.sub.1-L.sub.1-V.sub.2-L-Epitope1-L-Epitope2; V.sub.1-L.sub.1-V.sub.2-L-Epitope1-L-Epitope2-L; V.sub.1-L.sub.1-V.sub.2-L-Epitope1-L-Epitope2-L-Epitope3; V.sub.1-L.sub.1-V.sub.2-L-Epitope1-L-Epitope2-L-Epitope3-L; V.sub.1-L.sub.1-V.sub.2-Epitope1; V.sub.1-L.sub.1-V.sub.2-Epitope1-L; V.sub.1-L.sub.1-V.sub.2-Epitope1-L-Epitope2; V.sub.1-L.sub.1-V.sub.2-Epitope1-L-Epitope2-L; V.sub.1-L.sub.1-V.sub.2-Epitope1-L-Epitope2-L-Epitope3; V.sub.1-L.sub.1-V.sub.2-Epitope1-L-Epitope2-L-Epitope3-L; Epitope1-V.sub.1-L.sub.1-V.sub.2; Epitope1-L-V.sub.1-L.sub.1-V.sub.2; L-Epitope1-V.sub.1-L.sub.1-V.sub.2; L-Epitope1-L-V.sub.1-L.sub.1-V.sub.2; Epitope1-L-Epitope2-V.sub.1-L.sub.1-V.sub.2; Epitope1-L-Epitope2-L-V.sub.1-L.sub.1-V.sub.2; L-Epitope1-L-Epitope2-V.sub.1-L.sub.1-V.sub.2; L-Epitope1-L-Epitope2-L-V.sub.1-L.sub.1-V.sub.2; Epitope1-L-Epitope2-L-Epitope3-V.sub.1-L.sub.1-V.sub.2; Epitope1-L-Epitope2-L-Epitope3-L-V.sub.1-L.sub.1-V.sub.2; L-Epitope1-L-Epitope2-L-Epitope3-V.sub.1-L.sub.1-V.sub.2; L-Epitope1-L-Epitope2-L-Epitope3-L-V.sub.1-L.sub.1-V.sub.2; V.sub.1-L-Epitope1-L-V.sub.2; L-Epitope1-L-V.sub.1-L-Epitope2-L-V.sub.2; V.sub.1-L-Epitope1-L-V.sub.2-L-Epitope2-L; V.sub.1-L-Epitope1-L-V.sub.2-L-Epitope2-L-Epitope3; V.sub.1-L-Epitope1-L-V.sub.2-L-Epitope2-Epitope3; V.sub.1-L-Epitope1-L-V.sub.2-L-Epitope2-L-Epitope3-Epitope4; L-Epitope1-L-V.sub.1-L-Epitope2-L-V.sub.2-L-Epitope3-L; Epitope1-L-V.sub.1-L-Epitope2-L-V.sub.2-L-Epitope3-L; L-Epitope1-L-V.sub.1-L-Epitope2-L-V.sub.2-L-Epitope3; L-Epitope1-L-V.sub.1-L.sub.1-V.sub.2-L-Epitope2-L; L-Epitope1-L-V.sub.1-L.sub.1-V.sub.2-L-Epitope2-L-Epitope3; L-Epitope1-L-V.sub.1-L.sub.1-V.sub.2-L-Epitope2-Epitope3, or Epitope1-L-V.sub.1-L.sub.1-V.sub.2-L-Epitope2-L-Epitope3-Epitope4 wherein V.sub.1 is V.sub.L and V.sub.2 is V.sub.H or V.sub.1 is V.sub.H and V.sub.2 is V.sub.L; L.sub.1 is any linker suitable to link the V.sub.H chain to the V.sub.L chain; L is a linker comprising glycine and serine residues, and each occurrence of L in the extracellular binding domain can be identical or different to other occurrence of L in the same extracellular binding domain, and, epitope 1, epitope 2 or epitope 3 are mAb-specific epitopes and can be identical or different.

27. The CLL1 specific mcCAR according to claim 25, wherein L.sub.1 is a linker comprising Glycine and/or Serine.

28. The CLL1 specific mcCAR according to claim 27, wherein L.sub.1 is a linker comprising an amino acid sequence (Gly-Gly-Gly-Ser).sub.n or (Gly-Gly-Gly-Gly-Ser).sub.n, where n is 1, 2, 3, 4 or 5.

29. The CLL1 specific mcCAR according to claim 27, wherein L.sub.1 is a linker comprising the amino acid sequence (Gly.sub.4Ser).sub.4 or (Gly.sub.4Ser).sub.3.

30. The CLL1 specific mcCAR according to claim 27, wherein L.sub.1 is a linker having an amino acid sequence of SGG, GGS, SGGS (SEQ ID NO. 124), SSGGS (SEQ ID NO. 125), GGGG (SEQ ID NO. 126), SGGGG (SEQ ID NO. 127), GGGGS (SEQ ID NO. 128), SGGGGS (SEQ ID NO. 129), GGGGGS (SEQ ID NO. 130), SGGGGGS (SEQ ID NO. 131), SGGGGG (SEQ ID NO. 132), GSGGGGS (SEQ ID NO. 133), GGGGGGGS (SEQ ID NO. 134), SGGGGGGG (SEQ ID NO. 135), SGGGGGGGS (SEQ ID NO. 136), or SGGGGSGGGGS (SEQ ID NO. 137).

31. The CLL1 specific mcCAR according to claim 30, wherein L.sub.1 is a SGGGG (SEQ ID NO. 127), GGGGS (SEQ ID NO. 128), or SGGGGS (SEQ ID NO. 129).

32. The CLL1 specific mcCAR according to claim 22, wherein said mAb-specific epitope(s) is(are) specifically recognized by ibritumomab, tiuxetan, muromonab-CD3, tositumomab, abciximab, basiliximab, brentuximab vedotin, cetuximab, infliximab, rituximab, alemtuzumab, bevacizumab, certolizumab pegol, daclizumab, eculizumab, efalizumab, gemtuzumab, natalizumab, omalizumab, palivizumab, ranibizumab, tocilizumab, trastuzumab, vedolizumab, adalimumab, belimumab, canakinumab, denosumab, golimumab, ipilimumab, ofatumumab, panitumumab, QBEND-10, alemtuzumab or ustekinumab.

33. The CLL1 specific mcCAR according to claim 22, wherein mAb-specific epitope is one comprising an amino acid sequence of SEQ ID NO 109, SEQ ID NO 110, SEQ ID NO 111, SEQ ID NO 112, SEQ ID NO 113, SEQ ID NO 114, SEQ ID NO 115 or SEQ ID NO 116.

34. The CLL1 specific mcCAR according to claim 25, wherein Epitope 1 is an mAb-specific epitope having an amino acid sequence of SEQ ID NO 109.

35. The CLL1 specific mcCAR according to claim 25, wherein Epitope 2 is an mAb-specific epitope having an amino acid sequence of SEQ ID NO 109.

36. The CLL1 specific mcCAR according to claim 25, wherein Epitope 3 is an mAb-specific epitope having an amino acid sequence of SEQ ID NO 109 or SEQ ID NO 117 or SEQ ID NO 118.

37. The CLL1 specific mcCAR according to claim 25, wherein Epitope 4 is an mAb-specific epitope having an amino acid sequence of SEQ ID NO 109.

38. The CLL1 specific mcCAR according to claim 1, wherein the mcCAR comprises a polypeptide sequence having at least 80% sequence identity to the full amino acid sequence of anti-CLL1 SC02-357, anti-CLL1 SC02-378, anti-CLL1 SC02-161, anti-CLL1 M26, anti-CLL1 M31, anti-CLL1 G4, anti-CLL1 M22, anti-CLL1 M29, anti-CLL1 M2, anti-CLL1 M5, anti-CLL1 G12, anti-CLL1 21.26 or anti-CLL1 1075.7 as referred to in Table 6.

39. A polynucleotide comprising a nucleic acid sequence encoding a CLL1 specific mcCAR according to claim 1.

40. A vector comprising the polynucleotide of claim 39.

41. An engineered immune cell comprising an anti-CLL1 mcCAR according to claim 1, wherein the anti-CLL1 mcCAR is expressed at the surface of the cell.

42. The engineered immune cell according to claim 41, wherein the cell is derived from inflammatory T-lymphocytes, cytotoxic T-lymphocytes, regulatory T-lymphocytes or helper T-lymphocytes.

43. The engineered immune cell according to claim 41 formulated as a medicament.

44. A method of treating a pre-malignant or malignant cancer condition comprising administering to a patient the engineered immune cell according to claim 41.

45. The method according to claim 44, wherein the patient is a human patient.

46. The method of treating according to claim 44, wherein the pre-malignant or malignant condition is characterized by an overabundance of CLL1-expressing cells.

47. The method according to claim 44, wherein the pre-malignant or malignant condition is a hematological cancer.

48. The method according to claim 47, wherein the hematological cancer is leukemia.

49. The method according to claim 48, wherein the leukemia is acute myelogenous leukemia (AML).

50. The engineered immune cell according to claim 41, wherein the engineered immune cell suppresses expression of a TCR in said immune cell.

51. The engineered immune cell according to claim 41, wherein the engineered immune cell suppresses expression of at least one MHC protein.

52. The engineered immune cell according to claim 41, wherein said cell is mutated to confer resistance to at least one immune suppressive or chemotherapy drug.

53. A method of impairing a hematologic cancer cell comprising contacting said cell with an engineered cell according to claim 41 in an amount effective to cause impairment of said cancer cell.

54. A method of engineering an immune cell comprising expressing at a surface of an immune cell at least one mcCAR according to claim 1.

55. The method of engineering an immune cell of claim 54, wherein the method comprises: introducing into said immune cell at least one polynucleotide encoding the at least one mcCAR.

56. The method of engineering an immune cell of claim 55, wherein the immune cell expresses: (b) at the surface of said cell a population of mcCAR each one comprising different extracellular ligand-binding domains.

57. The method of engineering an immune cell of claim 56, wherein the population of mcCARs: is expressed by introducing into said cell at least one polynucleotide encoding polypeptides composing a population of mcCARs. Expressing said polynucleotides into said cell.

58. An isolated immune cell obtainable from the method according to claim 54.

59. An isolated immune cell comprising at least one mcCAR according to claim 1.

60. An isolated immune cell according to claim 58 for its use as a medicament.

61. The isolated cell according to claim 58, wherein the cell is derived from NK cells, inflammatory T-lymphocytes, cytotoxic T-lymphocytes, regulatory T-lymphocytes or helper T-lymphocytes.

62. A therapeutic composition comprising an isolated immune cell according to claim 58.

63. A method for treating a patient in need thereof comprising administering the cell according to claim 54 to said patient.

64. The method of claim 63, wherein said immune cells are recovered from donors.

65. The method of claim 63, wherein said immune cells are recovered from patients.

66. The engineered immune cell according to claim 51, wherein the at least one MHC protein is .beta.2m or HLA.