Patents - stay tuned to the technology

Inventors list

Assignees list

Classification tree browser

Top 100 Inventors

Top 100 Assignees

Patent application title: METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES

Inventors:
IPC8 Class: AC12P502FI
USPC Class: 1 1
Class name:
Publication date: 2017-02-23
Patent application number: 20170051315



Abstract:

The present disclosure identifies methods and compositions for modifying photoautotrophic organisms as hosts, such that the organisms efficiently convert carbon dioxide and light into n-alkanes, and in particular the use of such organisms for the commercial production of n-alkanes and related molecules.

Claims:

1. A method for producing hydrocarbons, comprising: (i) culturing an engineered cyanobacterium in a culture medium, wherein said engineered cyanobacterium comprises a recombinant AAR enzyme and a recombinant ADM enzyme; and (ii) exposing said engineered cyanobacterium to light and carbon dioxide, wherein said exposure results in the conversion of said carbon dioxide by said engineered cynanobacterium into n-alkanes, wherein at least one of said n-alkanes is selected from the group consisting of n-tridecane, n-tetradecane, n-pentadecane, n-hexadecane, and n-heptadecane, and wherein the amount of said n-alkanes produced is between 0.1% and 5% dry cell weight and at least two times the amount produced by an otherwise identical cyanobacterium, cultured under identical conditions, but lacking said recombinant AAR and ADM enzymes.

2. The method of claim 1, wherein at least one of said recombinant enzymes is heterologous with respect to said engineered cyanobacterium.

3. The method of claim 1, wherein said engineered cyanobacterium further produces at least one n-alkene or n-alkanol.

4. The method of claim 3, wherein said engineered cyanobacterium produces at least one n-alkene or n-alkanol selected from the group consisting of n-pentadecene, n-heptadecene, and 1-octadecanol.

5. The method of claim 3, wherein said n-alkanes comprise predominantly n-heptadecane, n-pentadecane or a combination thereof.

6. The method of claim 3, further comprising isolating at least one n-alkane, n-alkene or n-alkanol from said engineered cyanobacterium or said culture medium.

7. The method of claim 1, wherein said enzymes are encoded by a plasmid.

8. The method of claim 1 wherein said enzymes are encoded by recombinant genes incorporated into the genome of said engineered cyanobacterium.

9. The method of claim 1 wherein said enzymes are encoded by genes which are present in multiple copies in said engineered cyanobacterium.

10. The method of claim 1 wherein said enzymes are encoded by genes which are part of an operon, and wherein the expression of said genes is controlled by a single promoter.

11. A composition comprising an n-alkane produced by the method of claim 1.

12. A composition comprising an n-alkene or n-alkanal produced by the method of claim 3.

13. An engineered cyanobacterium, wherein said engineered cyanobacterium comprises a recombinant AAR enzyme and a recombinant ADM enzyme.

14. The engineered cyanobacterium of claim 13, wherein exposure of the engineered cyanobacterium to light and inorganic carbon results in the conversion of said carbon by said engineered cynanobacterium into n-alkanes, wherein at least one of said n-alkanes is selected from the group consisting of n-tridecane, n-tetradecane, n-pentadecane, n-hexadecane, and n-heptadecane, and wherein the amount of said n-alkanes produced is between 0.1% and 5% dry cell weight and at least two times the amount produced by an otherwise identical cyanobacterium, cultured under identical conditions, but lacking said recombinant AAR and ADM enzymes.

Description:

CROSS-REFERENCE TO RELATED APPLICATIONS

[0001] This application is a continuation of U.S. patent application Ser. No. 13/913,795, filed on Jun. 10, 2013, which is a continuation of U.S. patent application Ser. No. 13/335,886, filed on Dec. 22, 2011, now U.S. Pat. No. 8,481,285, which is a continuation application of U.S. patent application Ser. No. 13/051,807, filed on Mar. 18, 2011, now U.S. Pat. No. 8,101,397, which is a continuation application of U.S. patent application Ser. No. 12/879,862, filed on Sep. 10, 2010, now U.S. Pat. No. 7,919,303, which is a continuation application of U.S. patent application Ser. No. 12/759,657, filed on Apr. 13, 2010, now U.S. Pat. No. 7,794,969, which claims the benefit of U.S. Provisional Patent Application No. 61/224,463, filed Jul. 9, 2009 and U.S. Provisional Patent Application No. 61/228,937, filed Jul. 27, 2009, the disclosures of each of which are incorporated herein by reference.

REFERENCE TO SEQUENCE LISTING

[0002] The instant application contains a Sequence Listing which has been submitted via EFS-Web and is hereby incorporated by reference in its entirety. Said ASCII copy, created on Aug. 26, 2016, is named 34734_US_Sequence_Listing.txt, lists 128 sequences, and is 337 kb in size.

FIELD OF THE INVENTION

[0003] The present disclosure relates to methods for conferring alkane-producing properties to a heterotrophic or photoautotrophic host, such that the modified host can be used in the commercial production of bioalkanes.

BACKGROUND OF THE INVENTION

[0004] Many existing photoautotrophic organisms (i.e., plants, algae, and photosynthetic bacteria) are poorly suited for industrial bioprocessing and have therefore not demonstrated commercial viability. Such organisms typically have slow doubling times (3-72 hrs) compared to industrialized heterotrophic organisms such as Escherichia coli (20 minutes), reflective of low total productivities. While a desire for the efficient biosynthetic production of fuels has led to the development of photosynthetic microorganisms which produce alkyl esters of fatty acids, a need still exists for methods of producing hydrocarbons, e.g., alkanes, using photosynthetic organisms.

SUMMARY OF THE INVENTION

[0005] The present invention provides, in certain embodiments, isolated polynucleotides comprising or consisting of nucleic acid sequences selected from the group consisting of the coding sequences for AAR and ADM enzymes, nucleic acid sequences that are codon-optimized variants of these sequences, and related nucleic acid sequences and fragments.

[0006] An AAR enzyme refers to an enzyme with the amino acid sequence of the SYNPCC7942_1594 protein (SEQ ID NO: 6) or a homolog thereof, wherein a SYNPCC7942_1594 homolog is a protein whose BLAST alignment (i) covers >90% length of SYNPCC7942_1594, (ii) covers >90% of the length of the matching protein, and (iii) has >50% identity with SYNPCC7942_1594 (when optimally aligned using the parameters provided herein), and retains the functional activity of SYNPCC7942_1594, i.e., the conversion of an acyl-ACP (ACP--acyl carrier protein) to an alkanal. An ADM enzyme refers to an enzyme with the amino acid sequence of the SYNPCC7942_1593 protein (SEQ ID NO: 8) or a homolog thereof, wherein a SYNPCC7942_1593 homolog is defined as a protein whose amino acid sequence alignment (i) covers >90% length of SYNPCC7942_1593, (ii) covers >90% of the length of the matching protein, and (iii) has >50% identity with SYNPCC7942_1593 (when aligned using the preferred parameters provided herein), and retains the functional activity of SYNPCC7942_1593, i.e., the conversion of an n-alkanal to an (n-1)-alkane. Exemplary AAR and ADM enzymes are listed in Table 1 and Table 2, respectively. Genes encoding AAR or ADM enzymes are referred to herein as AAR genes (aar) or ADM genes (adm), respectively.

[0007] Preferred parameters for BLASTp are: Expectation value: 10 (default); Filter: seg (default); Cost to open a gap: 11 (default); Cost to extend a gap: 1 (default); Maximum alignments: 100 (default); Word size: 11 (default); No. of descriptions: 100 (default); Penalty Matrix: BLOWSUM62.

[0008] While Applicants refer herein to a putative alkanal decarboxylative monooxygenase activity, Applicants do so without intending to be bound to any particular reaction mechanism unless expressly set forth. For example, whether the enzyme encoded by SYNPCC7942_1594 or any other ADM gene carries out a decarbonylase or a decarboxylase reaction does not affect the utility of Applicants' invention, unless expressly set forth herein to the contrary.

[0009] The present invention further provides isolated polypeptides comprising or consisting of polypeptide sequences selected from the group consisting of the sequences listed in Table 1 and Table 2, and related polypeptide sequences, fragments and fusions. Antibodies that specifically bind to the isolated polypeptides of the present invention are also contemplated.

[0010] The present invention also provides methods for expressing a heterologous nucleic acid sequence encoding AAR and ADM in a host cell lacking catalytic activity for AAR and ADM (thereby conferring n-alkane producing capability in the host cell), or for expressing a nucleic acid encoding AAR and ADM in a host cell which comprises native AAR and/or ADM activity (thereby enhancing n-alkane producing capability in the host cell).

[0011] In addition, the present invention provides methods for producing carbon-based products of interest using the AAR and ADM genes, proteins and host cells described herein. For example, in one embodiment the invention provides a method for producing hydrocarbons, comprising: (i) culturing an engineered cyanobacterium in a culture medium, wherein said engineered cyanobacterium comprises a recombinant AAR enzyme and a recombinant ADM enzyme; and (ii) exposing said engineered cyanobacterium to light and carbon dioxide, wherein said exposure results in the conversion of said carbon dioxide by said engineered cynanobacterium into n-alkanes, wherein at least one of said n-alkanes is selected from the group consisting of n-tridecane, n-tetradecane, n-pentadecane, n-hexadecane, and n-heptadecane, and wherein the amount of said n-alkanes produced is between 0.1% and 5% dry cell weight and at least two times the amount produced by an otherwise identical cyanobacterium, cultured under identical conditions, but lacking said recombinant AAR and ADM enzymes.

[0012] In a related embodiment, the amount on n-alkanes produced by the engineered cyanobacterium is at least 0.1%, 0.2%, 0.3%, 0.4%, 0.5%, 0.6%, 0.7%, 0.8%, 0.9%, or 1%, and at least two times the amount produced by an otherwise identical cyanobacterium, cultured under identical conditions, but lacking said recombinant AAR and ADM enzymes.

[0013] In a related embodiment, at least one of said recombinant enzymes is heterologous with respect to said engineered cyanobacterium. In another embodiment, said cyanobacterium does not synthesize alkanes in the absence of the expression of one or both of the recombinant enzymes. In another embodiment, at least one of said recombinant AAR or ADM enzymes is not heterologous to said engineered cyanobacterium.

[0014] In another related embodiment of the method, said engineered cyanobacterium further produces at least one n-alkene or n-alkanol. In yet another embodiment, the engineered cyanobacterium produces at least one n-alkene or n-alkanol selected from the group consisting of n-pentadecene, n-heptadecene, and 1-octadecanol. In a related embodiment, said n-alkanes comprise predominantly n-heptadecane, n-pentadecane or a combination thereof. In a related embodiment, more n-heptadecane and/or n-pentadecane are produced than all other n-alkane products combined. In yet another related embodiment, more n-heptadecane and/or n-pentadecane are produced by the engineered cyanobacterium than any other n-alkane or n-alkene produced by the engineered cyanobacterium. In yet another related embodiment, at least one n-pentadecene produced by said engineered cyanobacterium is selected from the group consisting of cis-3-heptadecene and cis-4-pentadecene. In yet another related embodiment, at least one n-heptadecene produced by said engineered cyanobacterium is selected from the group consisting of cis-4-pentadecene, cis-6-heptadecene, cis-8-heptadecene, cis-9-heptadecene, and cis, cis-heptadec-di-ene.

[0015] In yet another related embodiment, the invention further provides a step of isolating at least one n-alkane, n-alkene or n-alkanol from said engineered cyanobacterium or said culture medium. In yet another related embodiment, the engineered cyanobacterium is cultured in a liquid medium. In yet another related embodiment, the engineered cyanobacterium is cultured in a photobioreactor.

[0016] In another related embodiment, the AAR and/or ADM enzymes are encoded by a plasmid. In yet another related embodiment, the AAR and/or ADM enzymes are encoded by recombinant genes incorporated into the genome of the engineered cyanobacterium. In yet another related embodiment, the AAR and/or ADM enzymes are encoded by genes which are present in multiple copies in said engineered cyanobacterium. In yet another related embodiment, the recombinant AAR and/or ADM enzymes are encoded by genes which are part of an operon, wherein the expression of said genes is controlled by a single promoter. In yet another related embodiment, the recombinant AAR and/or ADM enzymes are encoded by genes which are expressed independently under the control of separate promoters. In yet another related embodiment, expression of the recombinant AAR and/or ADM enzymes in an engineered cyanobacterium is controlled by a promoter selected from the group consisting of a cI promoter, a cpcB promoter, a lacI-trc promoter, an EM7 promoter, and a aphII promoter.

[0017] In yet another related embodiment, the cyanobacterium species that is engineered to express recombinant AAR and/or ADM enzymes produces less than 0.1% DCW n-heptadecane or n-pentadecane in the absence of said recombinant AAR and/or ADM enzymes. In another related embodiment, the engineered cyanobacterium of the method is a thermophile. In yet another related embodiment, the engineered cyanobacterium of the method is selected from the group consisting of an engineered Synechococcus sp. PCC7002 and an engineered Thermosynechococcus elongatus BP-1.

[0018] In yet another related embodiment, the recombinant AAR and/or ADM enzymes are selected from the group of enzymes listed in Table 1 and Table 2, respectively. In yet another related embodiment, the recombinant AAR enzymes are selected from the group consisting of SYNPCC7942_1594, tll11312, and PMT9312_0533. In yet another related embodiment, the recombinant ADM enzymes are selected from the group consisting of SYNPCC7942_1593, tll1313, and PMT9312_0532. In yet another related embodiment, the recombinant AAR enzymes have the amino acid sequences of SEQ ID NO:10 and SEQ ID NO:12, respectively. In certain embodiments, the recombinant AAR and ADM enzymes are encoded by SEQ ID NOs: 9 and 11, respectively.

[0019] In yet another related embodiment, the method comprising culturing the engineered cyanobacterium in the presence of an antibiotic, wherein said antibiotic selects for the presence of a recombinant gene encoding an AAR and/or ADM enzyme. In certain embodiments, the antibiotic is spectinomycin or kanamycin. In related embodiments, the amount of spectinomycin in the culture media is between 100 and 700 .mu.g/ml, e.g., 100, 200, 300, 400, 500, 600, or 700 .mu.g/ml of spectinomycin can be added to the culture media. In certain embodiments, the amount of spectinomycin added is about 600 .mu.g/ml, and the amount of n-alkanes produced by the engineered cyanobacterium is at least about 3%, 4% or 5% DCW.

[0020] In another embodiment, the method for producing hydrocarbons comprises culturing a cyanobacterium expressing recombinant AAR and/or ADM enzymes in the presence of an exogenous substrate for one or both enzymes. In a related embodiment, the substrate is selected from the group consisting of an acyl-ACP, an acyl-CoA, a fatty aldehyde, a fatty alcohol, and a fatty ester.

[0021] In yet another embodiment, the invention provides a composition comprising an n-alkane produced by any of the recombinant biosynthetic methods described herein. In yet another embodiment, the invention provides a composition comprising an n-alkene or n-alkanol produced by any of the recombinant biosynthetic methods described herein.

[0022] In certain embodiments, the invention provides an engineered host cell for producing an n-alkane, wherein said cell comprises one or more recombinant protein activities selected from the group consisting of an acyl-CoA reductase activity, an acyl-ACP reductase activity, an alkanal decarboxylative monooxygenase activity, and an electron donor activity. In related embodiments, the host cell comprises a recombinant acyl-ACP reductase activity, a recombinant alkanal decarboxylative monooxygenase activity, and a recombinant electron donor activity. In other embodiments, the host cell comprises a recombinant acyl-ACP reductase activity and a recombinant alkanal decarboxylative monooxygenase activity. In certain embodiments, the electron donor activity is a ferredoxin. In certain related embodiments, the host cell is capable of photosynthesis. In still other related embodiments, the host cell is a cyanobacterium. In still other embodiments, the host cell is a gram-negative, a gram-positive bacterium, or a yeast cell.

[0023] In other embodiments, the invention provides an isolated or recombinant polynucleotide comprising or consisting of a nucleic acid sequence selected from the group consisting of: (a) SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13 or 14; (b) a nucleic acid sequence that is a degenerate variant of SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13 or 14; (c) a nucleic acid sequence at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8% or at least 99.9% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 14; (d) a nucleic acid sequence that encodes a polypeptide having the amino acid sequence of SEQ ID NO:2, 4, 6, 8, 10 or 12; (e) a nucleic acid sequence that encodes a polypeptide at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8% or at least 99.9% identical to SEQ ID NO:2, 4, 6, 8, 10, or 12; and (f) a nucleic acid sequence that hybridizes under stringent conditions to SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13 or 14. In related embodiments, the nucleic acid sequence encodes a polypeptide having acyl-ACP reductase activity or alkanal decarboxylative monooxygenase activity.

[0024] In yet another embodiment, the invention provides an isolated, soluble polypeptide with alkanal decarboxylative monooxygenase activity wherein, in certain related embodiments, the polypeptide has an amino acid sequence of one of the proteins listed in Table 2. In related embodiments, the polypeptide has the amino acid sequence of SEQ ID NO: 4, 8 or 12.

[0025] In yet another embodiment, the invention provides a method for synthesizing an n-alkane from an acyl-ACP in vitro, comprising: contacting an acyl-ACP with a recombinant acyl-ACP reductase, wherein said acyl-ACP reductase converts said acyl-ACP to an n-alkanal; then contacting said n-alkanal with a recombinant, soluble alkanal decarboxylative monooxygenase in the presence of an electron donor, wherein said alkanal decarboxylative monooxygenase converts said acyl-ACP to an n-alkane. In a related embodiment, the invention provides a method for synthesizing an n-alkane from an n-alkanal in vitro, comprising: contacting said n-alkanal with a recombinant, soluble alkanal decarboxylative monooxygenase in the presence of an electron donor, wherein said alkanal decarboxylative monooxygenase converts said acyl-ACP to an n-alkane. In certain related embodiments, the electron donor is a ferredoxin protein.

[0026] In another embodiment, the invention provides engineered cyanobacterial cells comprising recombinant AAR and ADM enzymes, wherein said cells comprise between 0.1% and 5%, between 1% and 5%, or between 2% and 5% dry cell weight n-alkanes, wherein said n-alkanes are predominantly n-pentadecane, n-heptadecane, or a combination thereof.

BRIEF DESCRIPTION OF THE FIGURES

[0027] FIG. 1A depicts A, an enzymatic pathway for the production of n-alkanes based on the sequential activity of (1) an AAR enzyme (e.g., tll1312); and (2) an ADM enzyme (e.g., tll1313).

[0028] FIG. 1B depicts baiosynthesis of n-alkanal via acyl-CoA. Acyl-CoAs are typically intermediates of fatty acid degradation.

[0029] FIG. 1C depicts baiosynthesis of n-alkanal via acyl-ACP. Acyl-ACP's are typically intermediates of fatty acid biosynthesis. Note the three different types of ACP reductase: (i) 0-ketoacyl-ACP reductase, (ii) enoyl-ACP reductase, and (iii) acyl-ACP reductase. Acyl-ACP reductase, a new enzyme, generates the substrate for alkanal decarboxylative monooxygenase. CoA, coenzyme A; ACP, acyl carrier protein.

[0030] FIG. 1D depicts an alternative acyl-CoA-mediated alkane biosynthetic pathway. See additional discussion in Example 1, herein.

[0031] FIG. 2 represents 0-to-2700000-count total ion chromatograms of JCC9a and JCC1076 BHT (butylated hydroxytoluene)-acetone cell pellet extracts, as well as n-alkane and 1-alkanol authentic standards. Peaks assigned by Method 1 are identified in regular font, those by Method 2 in italic font.

[0032] FIG. 3A depicts MS fragmentation spectra of JCC1076 peaks for n-pentadecane assigned by Method 1 (top mass spectrum of each panel), plotted against their respective NIST library hits (bottom mass spectrum of each panel).

[0033] FIG. 3B Depicts MS fragmentation spectra of JCC1076 peaks for 1-tetradecanol assigned by Method 1 (top mass spectrum of each panel), plotted against their respective NIST library hits (bottom mass spectrum of each panel).

[0034] FIG. 3C Depicts MS fragmentation spectra of JCC1076 peaks for n-heptadecane assigned by Method 1 (top mass spectrum of each panel), plotted against their respective NIST library hits (bottom mass spectrum of each panel).

[0035] FIG. 3D Depicts MS fragmentation spectra of JCC1076 peaks for 1-hexadecanol assigned by Method 1 (top mass spectrum of each panel), plotted against their respective NIST library hits (bottom mass spectrum of each panel).

[0036] FIG. 4A represents 0-to-7500000-count total ion chromatograms for the BHT-acetone extracts of JCC1113 and JCC1114 cell pellets, as well as C.sub.13-C.sub.20 n-alkane and C.sub.14, C.sub.16, and C.sub.18 n-alkanol authentic standards.

[0037] FIG. 4B represents 0-to-720000-count total ion chromatograms for BHT-acetone extracts of JCC1113 and JCC1114 cell pellets, as well as the n-alkane and n-alkanol authentic standards mentioned in 4A.

[0038] FIG. 5A depicts MS fragmentation spectra of JCC1113 peaks for n-tridecane assigned by Method 1 (top mass spectrum of each panel), plotted against their respective NIST library hits (bottom mass spectrum of each panel).

[0039] FIG. 5B depicts MS fragmentation spectra of JCC1113 peaks for n-tetradecane assigned by Method 1 (top mass spectrum of each panel), plotted against their respective NIST library hits (bottom mass spectrum of each panel).

[0040] FIG. 5C depicts MS fragmentation spectra of JCC1113 peaks for n-pentadecane assigned by Method 1 (top mass spectrum of each panel), plotted against their respective NIST library hits (bottom mass spectrum of each panel).

[0041] FIG. 5D depicts MS fragmentation spectra of JCC1113 peaks for n-hexadecane assigned by Method 1 (top mass spectrum of each panel), plotted against their respective NIST library hits (bottom mass spectrum of each panel).

[0042] FIG. 5E depicts MS fragmentation spectra of JCC1113 peaks for n-heptadecane assigned by Method 1 (top mass spectrum of each panel), plotted against their respective NIST library hits (bottom mass spectrum of each panel).

[0043] FIG. 5F depicts MS fragmentation spectra of JCC1113 peaks for 1-hexadecanol assigned by Method 1 (top mass spectrum of each panel), plotted against their respective NIST library hits (bottom mass spectrum of each panel).

[0044] FIG. 6 represents 0-to-6100000-count total ion chromatograms of JCC1170 and JCC1169 BHT-acetone cell pellet extracts versus those of the control strains JCC1113 and JCC1114. No hydrocarbon products were observed in JCC1169. The unidentified peak in JCC1170 is likely cis-11-octadecenal.

[0045] FIG. 7A depicts MS fragmentation spectra of JCC1170 peaks for 1-tetradecanol assigned by Method 1 (top mass spectrum of each panel), plotted against their respective NIST library hits (bottom mass spectrum of each panel).

[0046] FIG. 7B depicts MS fragmentation spectra of JCC1170 peaks for 1-hexadecanol assigned by Method 1 (top mass spectrum of each panel), plotted against their respective NIST library hits (bottom mass spectrum of each panel).

[0047] FIG. 8A represents 0-to-75000000-count total ion chromatograms for BHT-acetone extracts of JCC1221, JCC1220, JCC1160b, JCC1160a, JCC1160 and JCC879 cell pellets, as well as C.sub.13-C.sub.20 n-alkane and C.sub.14, C.sub.16, and C.sub.18 n-alkanol authentic standards. The doublet around 18.0 minutes corresponds to nonadec-di-ene and 1-nonadecene, respectively (data not shown), n-alkenes that are naturally produced by JCC138.

[0048] FIG. 8B represents 0-to-2250000-count total ion chromatograms for BHT-acetone extracts of JCC1221 and JCC879 cell pellets, as well as the n-alkane and n-alkanol authentic standards mentioned in 8A.

[0049] FIG. 9A depicts MS fragmentation spectra of JCC1221 peaks for n-tridecane assigned by Method 1 (top mass spectrum of each panel), plotted against their respective NIST library hits (bottom mass spectrum of each panel).

[0050] FIG. 9B depicts MS fragmentation spectra of JCC1221 peaks for n-tetradecane assigned by Method 1 (top mass spectrum of each panel), plotted against their respective NIST library hits (bottom mass spectrum of each panel).

[0051] FIG. 9C depicts MS fragmentation spectra of JCC1221 peaks for n-pentadecane assigned by Method 1 (top mass spectrum of each panel), plotted against their respective NIST library hits (bottom mass spectrum of each panel).

[0052] FIG. 9D depicts MS fragmentation spectra of JCC1221 peaks for n-hexadecane assigned by Method 1 (top mass spectrum of each panel), plotted against their respective NIST library hits (bottom mass spectrum of each panel).

[0053] FIG. 9E depicts MS fragmentation spectra of JCC1221 peaks for n-heptadecane assigned by Method 1 (top mass spectrum of each panel), plotted against their respective NIST library hits (bottom mass spectrum of each panel).

[0054] FIG. 9F depicts MS fragmentation spectra of JCC1221 peaks for 1-octadecanol assigned by Method 1 (top mass spectrum of each panel), plotted against their respective NIST library hits (bottom mass spectrum of each panel).

[0055] FIG. 10 depicts intracellular n-alkane production as a function of spectinomycin concentration in JCC1221.

[0056] FIG. 11 represents 0-to-1080000-count total ion chromatograms of the JCC1281 BHT-acetone cell pellet extractant versus that of the control strain JCC138, as well as of authentic standard n-alkanes.

[0057] FIG. 12A depicts MS fragmentation spectra of JCC1281 peaks for n-pentadecane assigned by Method 1 (top mass spectrum of each panel), plotted against their respective NIST library hits (bottom mass spectrum of each panel).

[0058] FIG. 12B depicts MS fragmentation spectra of JCC1281 peaks for n-heptadecane assigned by Method 1 (top mass spectrum of each panel), plotted against their respective NIST library hits (bottom mass spectrum of each panel).

[0059] FIG. 13A depicts MS fragmentation spectra of JCC3 peaks for n-pentadecane assigned by Method 1 (top mass spectrum of each panel), plotted against their respective NIST library hits (bottom mass spectrum of each panel).

[0060] FIG. 13B depicts MS fragmentation spectra of JCC3 peaks for n-hexadecane assigned by Method 1 (top mass spectrum of each panel), plotted against their respective NIST library hits (bottom mass spectrum of each panel).

[0061] FIG. 13C depicts MS fragmentation spectra of JCC3 peaks for n-heptadecane assigned by Method 1 (top mass spectrum of each panel), plotted against their respective NIST library hits (bottom mass spectrum of each panel).

[0062] FIG. 14 depicts enhanced intracellular production of n-alkanes in JCC1084t compared to the control strain JCC1084. Error bars represent standard deviation of three independent observations.

[0063] FIG. 15 represents 0-to-31500000-count total ion chromatograms of JCC1113 and JCC1221 BHT-acetone cell pellet extracts, as well as authentic n-alkane standards.

DETAILED DESCRIPTION OF THE INVENTION

[0064] Unless otherwise defined herein, scientific and technical terms used in connection with the present invention shall have the meanings that are commonly understood by those of ordinary skill in the art. Further, unless otherwise required by context, singular terms shall include the plural and plural terms shall include the singular. Generally, nomenclatures used in connection with, and techniques of, biochemistry, enzymology, molecular and cellular biology, microbiology, genetics and protein and nucleic acid chemistry and hybridization described herein are those well known and commonly used in the art.

[0065] The methods and techniques of the present invention are generally performed according to conventional methods well known in the art and as described in various general and more specific references that are cited and discussed throughout the present specification unless otherwise indicated. See, e.g., Sambrook et al., Molecular Cloning: A Laboratory Manual, 2d ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989); Ausubel et al., Current Protocols in Molecular Biology, Greene Publishing Associates (1992, and Supplements to 2002); Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1990); Taylor and Drickamer, Introduction to Glycobiology, Oxford Univ. Press (2003); Worthington Enzyme Manual, Worthington Biochemical Corp., Freehold, N.J.; Handbook of Biochemistry: Section A Proteins, Vol I, CRC Press (1976); Handbook of Biochemistry: Section A Proteins, Vol II, CRC Press (1976); Essentials of Glycobiology, Cold Spring Harbor Laboratory Press (1999).

[0066] All publications, patents and other references mentioned herein are hereby incorporated by reference in their entireties.

[0067] The following terms, unless otherwise indicated, shall be understood to have the following meanings:

[0068] The term "polynucleotide" or "nucleic acid molecule" refers to a polymeric form of nucleotides of at least 10 bases in length. The term includes DNA molecules (e.g., cDNA or genomic or synthetic DNA) and RNA molecules (e.g., mRNA or synthetic RNA), as well as analogs of DNA or RNA containing non-natural nucleotide analogs, non-native internucleoside bonds, or both. The nucleic acid can be in any topological conformation. For instance, the nucleic acid can be single-stranded, double-stranded, triple-stranded, quadruplexed, partially double-stranded, branched, hairpinned, circular, or in a padlocked conformation.

[0069] Unless otherwise indicated, and as an example for all sequences described herein under the general format "SEQ ID NO:", "nucleic acid comprising SEQ ID NO:1" refers to a nucleic acid, at least a portion of which has either (i) the sequence of SEQ ID NO:1, or (ii) a sequence complementary to SEQ ID NO: 1. The choice between the two is dictated by the context. For instance, if the nucleic acid is used as a probe, the choice between the two is dictated by the requirement that the probe be complementary to the desired target.

[0070] An "isolated" RNA, DNA or a mixed polymer is one which is substantially separated from other cellular components that naturally accompany the native polynucleotide in its natural host cell, e.g., ribosomes, polymerases and genomic sequences with which it is naturally associated.

[0071] As used herein, an "isolated" organic molecule (e.g., an alkane, alkene, or alkanal) is one which is substantially separated from the cellular components (membrane lipids, chromosomes, proteins) of the host cell from which it originated, or from the medium in which the host cell was cultured. The term does not require that the biomolecule has been separated from all other chemicals, although certain isolated biomolecules may be purified to near homogeneity.

[0072] The term "recombinant" refers to a biomolecule, e.g., a gene or protein, that (1) has been removed from its naturally occurring environment, (2) is not associated with all or a portion of a polynucleotide in which the gene is found in nature, (3) is operatively linked to a polynucleotide which it is not linked to in nature, or (4) does not occur in nature. The term "recombinant" can be used in reference to cloned DNA isolates, chemically synthesized polynucleotide analogs, or polynucleotide analogs that are biologically synthesized by heterologous systems, as well as proteins and/or mRNAs encoded by such nucleic acids.

[0073] As used herein, an endogenous nucleic acid sequence in the genome of an organism (or the encoded protein product of that sequence) is deemed "recombinant" herein if a heterologous sequence is placed adjacent to the endogenous nucleic acid sequence, such that the expression of this endogenous nucleic acid sequence is altered. In this context, a heterologous sequence is a sequence that is not naturally adjacent to the endogenous nucleic acid sequence, whether or not the heterologous sequence is itself endogenous (originating from the same host cell or progeny thereof) or exogenous (originating from a different host cell or progeny thereof). By way of example, a promoter sequence can be substituted (e.g., by homologous recombination) for the native promoter of a gene in the genome of a host cell, such that this gene has an altered expression pattern. This gene would now become "recombinant" because it is separated from at least some of the sequences that naturally flank it.

[0074] A nucleic acid is also considered "recombinant" if it contains any modifications that do not naturally occur to the corresponding nucleic acid in a genome. For instance, an endogenous coding sequence is considered "recombinant" if it contains an insertion, deletion or a point mutation introduced artificially, e.g., by human intervention. A "recombinant nucleic acid" also includes a nucleic acid integrated into a host cell chromosome at a heterologous site and a nucleic acid construct present as an episome.

[0075] As used herein, the phrase "degenerate variant" of a reference nucleic acid sequence encompasses nucleic acid sequences that can be translated, according to the standard genetic code, to provide an amino acid sequence identical to that translated from the reference nucleic acid sequence. The term "degenerate oligonucleotide" or "degenerate primer" is used to signify an oligonucleotide capable of hybridizing with target nucleic acid sequences that are not necessarily identical in sequence but that are homologous to one another within one or more particular segments.

[0076] The term "percent sequence identity" or "identical" in the context of nucleic acid sequences refers to the residues in the two sequences which are the same when aligned for maximum correspondence. The length of sequence identity comparison may be over a stretch of at least about nine nucleotides, usually at least about 20 nucleotides, more usually at least about 24 nucleotides, typically at least about 28 nucleotides, more typically at least about 32 nucleotides, and preferably at least about 36 or more nucleotides. There are a number of different algorithms known in the art which can be used to measure nucleotide sequence identity. For instance, polynucleotide sequences can be compared using FASTA, Gap or Bestfit, which are programs in Wisconsin Package Version 10.0, Genetics Computer Group (GCG), Madison, Wis. FASTA provides alignments and percent sequence identity of the regions of the best overlap between the query and search sequences. Pearson, Methods Enzymol. 183:63-98 (1990) (hereby incorporated by reference in its entirety). For instance, percent sequence identity between nucleic acid sequences can be determined using FASTA with its default parameters (a word size of 6 and the NOPAM factor for the scoring matrix) or using Gap with its default parameters as provided in GCG Version 6.1, herein incorporated by reference. Alternatively, sequences can be compared using the computer program, BLAST (Altschul et al., J. Mol. Biol. 215:403-410 (1990); Gish and States, Nature Genet. 3:266-272 (1993); Madden et al., Meth. Enzymol. 266:131-141 (1996); Altschul et al., Nucleic Acids Res. 25:3389-3402 (1997); Zhang and Madden, Genome Res. 7:649-656 (1997)), especially blastp or tblastn (Altschul et al., Nucleic Acids Res. 25:3389-3402 (1997)).

[0077] The term "substantial homology" or "substantial similarity," when referring to a nucleic acid or fragment thereof, indicates that, when optimally aligned with appropriate nucleotide insertions or deletions with another nucleic acid (or its complementary strand), there is nucleotide sequence identity in at least about 76%, 80%, 85%, preferably at least about 90%, and more preferably at least about 95%, 96%, 97%, 98% or 99% of the nucleotide bases, as measured by any well-known algorithm of sequence identity, such as FASTA, BLAST or Gap, as discussed above.

[0078] Alternatively, substantial homology or similarity exists when a nucleic acid or fragment thereof hybridizes to another nucleic acid, to a strand of another nucleic acid, or to the complementary strand thereof, under stringent hybridization conditions. "Stringent hybridization conditions" and "stringent wash conditions" in the context of nucleic acid hybridization experiments depend upon a number of different physical parameters. Nucleic acid hybridization will be affected by such conditions as salt concentration, temperature, solvents, the base composition of the hybridizing species, length of the complementary regions, and the number of nucleotide base mismatches between the hybridizing nucleic acids, as will be readily appreciated by those skilled in the art. One having ordinary skill in the art knows how to vary these parameters to achieve a particular stringency of hybridization.

[0079] In general, "stringent hybridization" is performed at about 25.degree. C. below the thermal melting point (T.sub.m) for the specific DNA hybrid under a particular set of conditions. "Stringent washing" is performed at temperatures about 5.degree. C. lower than the T.sub.m for the specific DNA hybrid under a particular set of conditions. The T.sub.m is the temperature at which 50% of the target sequence hybridizes to a perfectly matched probe. See Sambrook et al., Molecular Cloning: A Laboratory Manual, 2d ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989), page 9.51, hereby incorporated by reference. For purposes herein, "stringent conditions" are defined for solution phase hybridization as aqueous hybridization (i.e., free of formamide) in 6.times.SSC (where 20.times.SSC contains 3.0 M NaCl and 0.3 M sodium citrate), 1% SDS at 65.degree. C. for 8-12 hours, followed by two washes in 0.2.times.SSC, 0.1% SDS at 65.degree. C. for 20 minutes. It will be appreciated by the skilled worker that hybridization at 65.degree. C. will occur at different rates depending on a number of factors including the length and percent identity of the sequences which are hybridizing.

[0080] The nucleic acids (also referred to as polynucleotides) of this present invention may include both sense and antisense strands of RNA, cDNA, genomic DNA, and synthetic forms and mixed polymers of the above. They may be modified chemically or biochemically or may contain non-natural or derivatized nucleotide bases, as will be readily appreciated by those of skill in the art. Such modifications include, for example, labels, methylation, substitution of one or more of the naturally occurring nucleotides with an analog, internucleotide modifications such as uncharged linkages (e.g., methyl phosphonates, phosphotriesters, phosphoramidates, carbamates, etc.), charged linkages (e.g., phosphorothioates, phosphorodithioates, etc.), pendent moieties (e.g., polypeptides), intercalators (e.g., acridine, psoralen, etc.), chelators, alkylators, and modified linkages (e.g., alpha anomeric nucleic acids, etc.) Also included are synthetic molecules that mimic polynucleotides in their ability to bind to a designated sequence via hydrogen bonding and other chemical interactions. Such molecules are known in the art and include, for example, those in which peptide linkages substitute for phosphate linkages in the backbone of the molecule. Other modifications can include, for example, analogs in which the ribose ring contains a bridging moiety or other structure such as the modifications found in "locked" nucleic acids.

[0081] The term "mutated" when applied to nucleic acid sequences means that nucleotides in a nucleic acid sequence may be inserted, deleted or changed compared to a reference nucleic acid sequence. A single alteration may be made at a locus (a point mutation) or multiple nucleotides may be inserted, deleted or changed at a single locus. In addition, one or more alterations may be made at any number of loci within a nucleic acid sequence. A nucleic acid sequence may be mutated by any method known in the art including but not limited to mutagenesis techniques such as "error-prone PCR" (a process for performing PCR under conditions where the copying fidelity of the DNA polymerase is low, such that a high rate of point mutations is obtained along the entire length of the PCR product; see, e.g., Leung et al., Technique, 1:11-15 (1989) and Caldwell and Joyce, PCR Methods Applic. 2:28-33 (1992)); and "oligonucleotide-directed mutagenesis" (a process which enables the generation of site-specific mutations in any cloned DNA segment of interest; see, e.g., Reidhaar-Olson and Sauer, Science 241:53-57 (1988)).

[0082] The term "attenuate" as used herein generally refers to a functional deletion, including a mutation, partial or complete deletion, insertion, or other variation made to a gene sequence or a sequence controlling the transcription of a gene sequence, which reduces or inhibits production of the gene product, or renders the gene product non-functional. In some instances a functional deletion is described as a knockout mutation. Attenuation also includes amino acid sequence changes by altering the nucleic acid sequence, placing the gene under the control of a less active promoter, down-regulation, expressing interfering RNA, ribozymes or antisense sequences that target the gene of interest, or through any other technique known in the art. In one example, the sensitivity of a particular enzyme to feedback inhibition or inhibition caused by a composition that is not a product or a reactant (non-pathway specific feedback) is lessened such that the enzyme activity is not impacted by the presence of a compound. In other instances, an enzyme that has been altered to be less active can be referred to as attenuated.

[0083] Deletion: The removal of one or more nucleotides from a nucleic acid molecule or one or more amino acids from a protein, the regions on either side being joined together.

[0084] Knock-out: A gene whose level of expression or activity has been reduced to zero. In some examples, a gene is knocked-out via deletion of some or all of its coding sequence. In other examples, a gene is knocked-out via introduction of one or more nucleotides into its open reading frame, which results in translation of a non-sense or otherwise non-functional protein product.

[0085] The term "vector" as used herein is intended to refer to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. One type of vector is a "plasmid," which generally refers to a circular double stranded DNA loop into which additional DNA segments may be ligated, but also includes linear double-stranded molecules such as those resulting from amplification by the polymerase chain reaction (PCR) or from treatment of a circular plasmid with a restriction enzyme. Other vectors include cosmids, bacterial artificial chromosomes (BAC) and yeast artificial chromosomes (YAC). Another type of vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome (discussed in more detail below). Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., vectors having an origin of replication which functions in the host cell). Other vectors can be integrated into the genome of a host cell upon introduction into the host cell, and are thereby replicated along with the host genome. Moreover, certain preferred vectors are capable of directing the expression of genes to which they are operatively linked. Such vectors are referred to herein as "recombinant expression vectors" (or simply "expression vectors").

[0086] "Operatively linked" or "operably linked" expression control sequences refers to a linkage in which the expression control sequence is contiguous with the gene of interest to control the gene of interest, as well as expression control sequences that act in trans or at a distance to control the gene of interest.

[0087] The term "expression control sequence" as used herein refers to polynucleotide sequences which are necessary to affect the expression of coding sequences to which they are operatively linked. Expression control sequences are sequences which control the transcription, post-transcriptional events and translation of nucleic acid sequences. Expression control sequences include appropriate transcription initiation, termination, promoter and enhancer sequences; efficient RNA processing signals such as splicing and polyadenylation signals; sequences that stabilize cytoplasmic mRNA; sequences that enhance translation efficiency (e.g., ribosome binding sites); sequences that enhance protein stability; and when desired, sequences that enhance protein secretion. The nature of such control sequences differs depending upon the host organism; in prokaryotes, such control sequences generally include promoter, ribosomal binding site, and transcription termination sequence. The term "control sequences" is intended to include, at a minimum, all components whose presence is essential for expression, and can also include additional components whose presence is advantageous, for example, leader sequences and fusion partner sequences.

[0088] The term "recombinant host cell" (or simply "host cell"), as used herein, is intended to refer to a cell into which a recombinant vector has been introduced. It should be understood that such terms are intended to refer not only to the particular subject cell but to the progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term "host cell" as used herein. A recombinant host cell may be an isolated cell or cell line grown in culture or may be a cell which resides in a living tissue or organism.

[0089] The term "peptide" as used herein refers to a short polypeptide, e.g., one that is typically less than about 50 amino acids long and more typically less than about 30 amino acids long. The term as used herein encompasses analogs and mimetics that mimic structural and thus biological function.

[0090] The term "polypeptide" encompasses both naturally-occurring and non-naturally-occurring proteins, and fragments, mutants, derivatives and analogs thereof. A polypeptide may be monomeric or polymeric. Further, a polypeptide may comprise a number of different domains each of which has one or more distinct activities.

[0091] The term "isolated protein" or "isolated polypeptide" is a protein or polypeptide that by virtue of its origin or source of derivation (1) is not associated with naturally associated components that accompany it in its native state, (2) exists in a purity not found in nature, where purity can be adjudged with respect to the presence of other cellular material (e.g., is free of other proteins from the same species) (3) is expressed by a cell from a different species, or (4) does not occur in nature (e.g., it is a fragment of a polypeptide found in nature or it includes amino acid analogs or derivatives not found in nature or linkages other than standard peptide bonds). Thus, a polypeptide that is chemically synthesized or synthesized in a cellular system different from the cell from which it naturally originates will be "isolated" from its naturally associated components. A polypeptide or protein may also be rendered substantially free of naturally associated components by isolation, using protein purification techniques well known in the art. As thus defined, "isolated" does not necessarily require that the protein, polypeptide, peptide or oligopeptide so described has been physically removed from its native environment.

[0092] The term "polypeptide fragment" as used herein refers to a polypeptide that has a deletion, e.g., an amino-terminal and/or carboxy-terminal deletion compared to a full-length polypeptide. In a preferred embodiment, the polypeptide fragment is a contiguous sequence in which the amino acid sequence of the fragment is identical to the corresponding positions in the naturally-occurring sequence. Fragments typically are at least 5, 6, 7, 8, 9 or 10 amino acids long, preferably at least 12, 14, 16 or 18 amino acids long, more preferably at least 20 amino acids long, more preferably at least 25, 30, 35, 40 or 45, amino acids, even more preferably at least 50 or 60 amino acids long, and even more preferably at least 70 amino acids long.

[0093] A "modified derivative" refers to polypeptides or fragments thereof that are substantially homologous in primary structural sequence but which include, e.g., in vivo or in vitro chemical and biochemical modifications or which incorporate amino acids that are not found in the native polypeptide. Such modifications include, for example, acetylation, carboxylation, phosphorylation, glycosylation, ubiquitination, labeling, e.g., with radionuclides, and various enzymatic modifications, as will be readily appreciated by those skilled in the art. A variety of methods for labeling polypeptides and of substituents or labels useful for such purposes are well known in the art, and include radioactive isotopes such as .sup.125I, .sup.32P, .sup.35S, and .sup.3H, ligands which bind to labeled antiligands (e.g., antibodies), fluorophores, chemiluminescent agents, enzymes, and antiligands which can serve as specific binding pair members for a labeled ligand. The choice of label depends on the sensitivity required, ease of conjugation with the primer, stability requirements, and available instrumentation. Methods for labeling polypeptides are well known in the art. See, e.g., Ausubel et al., Current Protocols in Molecular Biology, Greene Publishing Associates (1992, and Supplements to 2002) (hereby incorporated by reference).

[0094] The term "fusion protein" refers to a polypeptide comprising a polypeptide or fragment coupled to heterologous amino acid sequences. Fusion proteins are useful because they can be constructed to contain two or more desired functional elements from two or more different proteins. A fusion protein comprises at least 10 contiguous amino acids from a polypeptide of interest, more preferably at least 20 or 30 amino acids, even more preferably at least 40, 50 or 60 amino acids, yet more preferably at least 75, 100 or 125 amino acids. Fusions that include the entirety of the proteins of the present invention have particular utility. The heterologous polypeptide included within the fusion protein of the present invention is at least 6 amino acids in length, often at least 8 amino acids in length, and usefully at least 15, 20, and 25 amino acids in length. Fusions that include larger polypeptides, such as an IgG Fc region, and even entire proteins, such as the green fluorescent protein ("GFP") chromophore-containing proteins, have particular utility. Fusion proteins can be produced recombinantly by constructing a nucleic acid sequence which encodes the polypeptide or a fragment thereof in frame with a nucleic acid sequence encoding a different protein or peptide and then expressing the fusion protein. Alternatively, a fusion protein can be produced chemically by crosslinking the polypeptide or a fragment thereof to another protein.

[0095] As used herein, the term "antibody" refers to a polypeptide, at least a portion of which is encoded by at least one immunoglobulin gene, or fragment thereof, and that can bind specifically to a desired target molecule. The term includes naturally-occurring forms, as well as fragments and derivatives.

[0096] Fragments within the scope of the term "antibody" include those produced by digestion with various proteases, those produced by chemical cleavage and/or chemical dissociation and those produced recombinantly, so long as the fragment remains capable of specific binding to a target molecule. Among such fragments are Fab, Fab', Fv, F(ab').sub.2, and single chain Fv (scFv) fragments.

[0097] Derivatives within the scope of the term include antibodies (or fragments thereof) that have been modified in sequence, but remain capable of specific binding to a target molecule, including: interspecies chimeric and humanized antibodies; antibody fusions; heteromeric antibody complexes and antibody fusions, such as diabodies (bispecific antibodies), single-chain diabodies, and intrabodies (see, e.g., Intracellular Antibodies: Research and Disease Applications, (Marasco, ed., Springer-Verlag New York, Inc., 1998), the disclosure of which is incorporated herein by reference in its entirety).

[0098] As used herein, antibodies can be produced by any known technique, including harvest from cell culture of native B lymphocytes, harvest from culture of hybridomas, recombinant expression systems and phage display.

[0099] The term "non-peptide analog" refers to a compound with properties that are analogous to those of a reference polypeptide. A non-peptide compound may also be termed a "peptide mimetic" or a "peptidomimetic." See, e.g., Jones, Amino Acid and Peptide Synthesis, Oxford University Press (1992); Jung, Combinatorial Peptide and Nonpeptide Libraries: A Handbook, John Wiley (1997); Bodanszky et al., Peptide Chemistry--A Practical Textbook, Springer Verlag (1993); Synthetic Peptides: A Users Guide, (Grant, ed., W. H. Freeman and Co., 1992); Evans et al., J. Med. Chem. 30:1229 (1987); Fauchere, J. Adv. Drug Res. 15:29 (1986); Veber and Freidinger, Trends Neurosci., 8:392-396 (1985); and references sited in each of the above, which are incorporated herein by reference. Such compounds are often developed with the aid of computerized molecular modeling. Peptide mimetics that are structurally similar to useful peptides of the present invention may be used to produce an equivalent effect and are therefore envisioned to be part of the present invention.

[0100] A "polypeptide mutant" or "mutein" refers to a polypeptide whose sequence contains an insertion, duplication, deletion, rearrangement or substitution of one or more amino acids compared to the amino acid sequence of a native or wild-type protein. A mutein may have one or more amino acid point substitutions, in which a single amino acid at a position has been changed to another amino acid, one or more insertions and/or deletions, in which one or more amino acids are inserted or deleted, respectively, in the sequence of the naturally-occurring protein, and/or truncations of the amino acid sequence at either or both the amino or carboxy termini. A mutein may have the same but preferably has a different biological activity compared to the naturally-occurring protein.

[0101] A mutein has at least 85% overall sequence homology to its wild-type counterpart. Even more preferred are muteins having at least 90% overall sequence homology to the wild-type protein.

[0102] In an even more preferred embodiment, a mutein exhibits at least 95% sequence identity, even more preferably 98%, even more preferably 99% and even more preferably 99.9% overall sequence identity.

[0103] Sequence homology may be measured by any common sequence analysis algorithm, such as Gap or Bestfit.

[0104] Amino acid substitutions can include those which: (1) reduce susceptibility to proteolysis, (2) reduce susceptibility to oxidation, (3) alter binding affinity for forming protein complexes, (4) alter binding affinity or enzymatic activity, and (5) confer or modify other physicochemical or functional properties of such analogs.

[0105] As used herein, the twenty conventional amino acids and their abbreviations follow conventional usage. See Immunology--A Synthesis (Golub and Gren eds., Sinauer Associates, Sunderland, Mass., 2.sup.nd ed. 1991), which is incorporated herein by reference. Stereoisomers (e.g., D-amino acids) of the twenty conventional amino acids, unnatural amino acids such as .alpha.-, .alpha.-disubstituted amino acids, N-alkyl amino acids, and other unconventional amino acids may also be suitable components for polypeptides of the present invention. Examples of unconventional amino acids include: 4-hydroxyproline, .gamma.-carboxyglutamate, .epsilon.-N,N,N-trimethyllysine, .epsilon.-N-acetyllysine, O-phosphoserine, N-acetylserine, N-formylmethionine, 3-methylhistidine, 5-hydroxylysine, N-methylarginine, and other similar amino acids and imino acids (e.g., 4-hydroxyproline). In the polypeptide notation used herein, the left-hand end corresponds to the amino terminal end and the right-hand end corresponds to the carboxy-terminal end, in accordance with standard usage and convention.

[0106] A protein has "homology" or is "homologous" to a second protein if the nucleic acid sequence that encodes the protein has a similar sequence to the nucleic acid sequence that encodes the second protein. Alternatively, a protein has homology to a second protein if the two proteins have "similar" amino acid sequences. (Thus, the term "homologous proteins" is defined to mean that the two proteins have similar amino acid sequences.) As used herein, homology between two regions of amino acid sequence (especially with respect to predicted structural similarities) is interpreted as implying similarity in function.

[0107] When "homologous" is used in reference to proteins or peptides, it is recognized that residue positions that are not identical often differ by conservative amino acid substitutions. A "conservative amino acid substitution" is one in which an amino acid residue is substituted by another amino acid residue having a side chain (R group) with similar chemical properties (e.g., charge or hydrophobicity). In general, a conservative amino acid substitution will not substantially change the functional properties of a protein. In cases where two or more amino acid sequences differ from each other by conservative substitutions, the percent sequence identity or degree of homology may be adjusted upwards to correct for the conservative nature of the substitution. Means for making this adjustment are well known to those of skill in the art. See, e.g., Pearson, 1994, Methods Mol. Blot. 24:307-31 and 25:365-89 (herein incorporated by reference).

[0108] The following six groups each contain amino acids that are conservative substitutions for one another: 1) Serine (S), Threonine (T); 2) Aspartic Acid (D), Glutamic Acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K); 5) Isoleucine (I), Leucine (L), Methionine (M), Alanine (A), Valine (V), and 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W).

[0109] Sequence homology for polypeptides, which is also referred to as percent sequence identity, is typically measured using sequence analysis software. See, e.g., the Sequence Analysis Software Package of the Genetics Computer Group (GCG), University of Wisconsin Biotechnology Center, 910 University Avenue, Madison, Wis. 53705. Protein analysis software matches similar sequences using a measure of homology assigned to various substitutions, deletions and other modifications, including conservative amino acid substitutions. For instance, GCG contains programs such as "Gap" and "Bestfit" which can be used with default parameters to determine sequence homology or sequence identity between closely related polypeptides, such as homologous polypeptides from different species of organisms or between a wild-type protein and a mutein thereof. See, e.g., GCG Version 6.1.

[0110] A preferred algorithm when comparing a particular polypeptide sequence to a database containing a large number of sequences from different organisms is the computer program BLAST (Altschul et al., J. Mol. Biol. 215:403-410 (1990); Gish and States, Nature Genet. 3:266-272 (1993); Madden et al., Meth. Enzymol. 266:131-141 (1996); Altschul et al., Nucleic Acids Res. 25:3389-3402 (1997); Zhang and Madden, Genome Res. 7:649-656 (1997)), especially blastp or tblastn (Altschul et al., Nucleic Acids Res. 25:3389-3402 (1997)).

[0111] Preferred parameters for BLASTp are: Expectation value: 10 (default); Filter: seg (default); Cost to open a gap: 11 (default); Cost to extend a gap: 1 (default); Max. alignments: 100 (default); Word size: 11 (default); No. of descriptions: 100 (default); Penalty Matrix: BLOWSUM62.

[0112] The length of polypeptide sequences compared for homology will generally be at least about 16 amino acid residues, usually at least about 20 residues, more usually at least about 24 residues, typically at least about 28 residues, and preferably more than about 35 residues. When searching a database containing sequences from a large number of different organisms, it is preferable to compare amino acid sequences. Database searching using amino acid sequences can be measured by algorithms other than blastp known in the art. For instance, polypeptide sequences can be compared using FASTA, a program in GCG Version 6.1. FASTA provides alignments and percent sequence identity of the regions of the best overlap between the query and search sequences. Pearson, Methods Enzymol. 183:63-98 (1990) (incorporated by reference herein). For example, percent sequence identity between amino acid sequences can be determined using FASTA with its default parameters (a word size of 2 and the PAM250 scoring matrix), as provided in GCG Version 6.1, herein incorporated by reference.

[0113] "Specific binding" refers to the ability of two molecules to bind to each other in preference to binding to other molecules in the environment. Typically, "specific binding" discriminates over adventitious binding in a reaction by at least two-fold, more typically by at least 10-fold, often at least 100-fold. Typically, the affinity or avidity of a specific binding reaction, as quantified by a dissociation constant, is about 10.sup.-7 M or stronger (e.g., about 10.sup.-8 M, 10.sup.-9M or even stronger).

[0114] "Percent dry cell weight" refers to a measurement of hydrocarbon production obtained as follows: a defined volume of culture is centrifuged to pellet the cells. Cells are washed then dewetted by at least one cycle of microcentrifugation and aspiration. Cell pellets are lyophilized overnight, and the tube containing the dry cell mass is weighed again such that the mass of the cell pellet can be calculated within .+-.0.1 mg. At the same time cells are processed for dry cell weight determination, a second sample of the culture in question is harvested, washed, and dewetted. The resulting cell pellet, corresponding to 1-3 mg of dry cell weight, is then extracted by vortexing in approximately 1 ml acetone plus butylated hydroxytolune (BHT) as antioxidant and an internal standard, e.g., n-heptacosane. Cell debris is then pelleted by centrifugation and the supernatant (extractant) is taken for analysis by GC. For accurate quantitation of n-alkanes, flame ionization detection (FID) was used as opposed to MS total ion count. n-Alkane concentrations in the biological extracts were calculated using calibration relationships between GC-FID peak area and known concentrations of authentic n-alkane standards. Knowing the volume of the extractant, the resulting concentrations of the n-alkane species in the extracant, and the dry cell weight of the cell pellet extracted, the percentage of dry cell weight that comprised n-alkanes can be determined.

[0115] The term "region" as used herein refers to a physically contiguous portion of the primary structure of a biomolecule. In the case of proteins, a region is defined by a contiguous portion of the amino acid sequence of that protein.

[0116] The term "domain" as used herein refers to a structure of a biomolecule that contributes to a known or suspected function of the biomolecule. Domains may be co-extensive with regions or portions thereof; domains may also include distinct, non-contiguous regions of a biomolecule. Examples of protein domains include, but are not limited to, an Ig domain, an extracellular domain, a transmembrane domain, and a cytoplasmic domain.

[0117] As used herein, the term "molecule" means any compound, including, but not limited to, a small molecule, peptide, protein, sugar, nucleotide, nucleic acid, lipid, etc., and such a compound can be natural or synthetic.

[0118] "Carbon-based Products of Interest" include alcohols such as ethanol, propanol, isopropanol, butanol, fatty alcohols, fatty acid esters, wax esters; hydrocarbons and alkanes such as propane, octane, diesel, Jet Propellant 8 (JP8); polymers such as terephthalate, 1,3-propanediol, 1,4-butanediol, polyols, Polyhydroxyalkanoates (PHA), poly-beta-hydroxybutyrate (PHB), acrylate, adipic acid, .epsilon.-caprolactone, isoprene, caprolactam, rubber; commodity chemicals such as lactate, Docosahexaenoic acid (DHA), 3-hydroxypropionate, .gamma.-valerolactone, lysine, serine, aspartate, aspartic acid, sorbitol, ascorbate, ascorbic acid, isopentenol, lanosterol, omega-3 DHA, lycopene, itaconate, 1,3-butadiene, ethylene, propylene, succinate, citrate, citric acid, glutamate, malate, 3-hydroxypropionic acid (HPA), lactic acid, THF, gamma butyrolactone, pyrrolidones, hydroxybutyrate, glutamic acid, levulinic acid, acrylic acid, malonic acid; specialty chemicals such as carotenoids, isoprenoids, itaconic acid; pharmaceuticals and pharmaceutical intermediates such as 7-aminodeacetoxycephalosporanic acid (7-ADCA)/cephalosporin, erythromycin, polyketides, statins, paclitaxel, docetaxel, terpenes, peptides, steroids, omega fatty acids and other such suitable products of interest. Such products are useful in the context of biofuels, industrial and specialty chemicals, as intermediates used to make additional products, such as nutritional supplements, neutraceuticals, polymers, paraffin replacements, personal care products and pharmaceuticals.

[0119] Biofuel: A biofuel refers to any fuel that derives from a biological source. Biofuel can refer to one or more hydrocarbons, one or more alcohols, one or more fatty esters or a mixture thereof.

[0120] Hydrocarbon: The term generally refers to a chemical compound that consists of the elements carbon (C), hydrogen (H) and optionally oxygen (O). There are essentially three types of hydrocarbons, e.g., aromatic hydrocarbons, saturated hydrocarbons and unsaturated hydrocarbons such as alkenes, alkynes, and dienes. The term also includes fuels, biofuels, plastics, waxes, solvents and oils. Hydrocarbons encompass biofuels, as well as plastics, waxes, solvents and oils.

[0121] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this present invention pertains. Exemplary methods and materials are described below, although methods and materials similar or equivalent to those described herein can also be used in the practice of the present invention and will be apparent to those of skill in the art. All publications and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including definitions, will control. The materials, methods, and examples are illustrative only and not intended to be limiting.

[0122] Throughout this specification and claims, the word "comprise" or variations such as "comprises" or "comprising", will be understood to imply the inclusion of a stated integer or group of integers but not the exclusion of any other integer or group of integers.

Nucleic Acid Sequences

[0123] Alkanes, also known as paraffins, are chemical compounds that consist only of the elements carbon (C) and hydrogen (H) (i.e., hydrocarbons), wherein these atoms are linked together exclusively by single bonds (i.e., they are saturated compounds) without any cyclic structure. n-Alkanes are linear, i.e., unbranched, alkanes. Together, AAR and ADM enzymes function to synthesize n-alkanes from acyl-ACP molecules.

[0124] Accordingly, the present invention provides isolated nucleic acid molecules for genes encoding AAR and ADM enzymes, and variants thereof. Exemplary full-length nucleic acid sequences for genes encoding AAR are presented as SEQ ID NOs: 1, 5, and 13, and the corresponding amino acid sequences are presented as SEQ ID NOs: 2, 6, and 10, respectively. Exemplary full-length nucleic acid sequences for genes encoding ADM are presented as SEQ ID NOs: 3, 7, 14, and the corresponding amino acid sequences are presented as SEQ ID NOs: 4, 8, and 12, respectively. Additional nucleic acids provided by the invention include any of the genes encoding the AAR and ADM enzymes in Table 1 and Table 2, respectively.

[0125] In one embodiment, the present invention provides an isolated nucleic acid molecule having a nucleic acid sequence comprising or consisting of a gene coding for AAR and ADM, and homologs, variants and derivatives thereof expressed in a host cell of interest. The present invention also provides a nucleic acid molecule comprising or consisting of a sequence which is a codon-optimized version of the AAR and ADM genes described herein (e.g., SEQ ID NO: 9 and SEQ ID NO: 11, which are optimized for the expression of the AAR and ADM genes of Prochlorococcus marinus MIT 9312 in Synechoccocus sp. PCC 7002). In a further embodiment, the present invention provides a nucleic acid molecule and homologs, variants and derivatives of the molecule comprising or consisting of a sequence which is a variant of the AAR or ADM gene having at least 76% identity to the wild-type gene. The nucleic acid sequence can be preferably 80%, 85%, 90%, 95%, 98%, 99%, 99.9% or even higher identity to the wild-type gene.

[0126] In another embodiment, the nucleic acid molecule of the present invention encodes a polypeptide having the amino acid sequence of SEQ ID NO:2, 4, 6, 8, 10 or 12. Preferably, the nucleic acid molecule of the present invention encodes a polypeptide sequence of at least 50%, 60, 70%, 80%, 85%, 90% or 95% identity to SEQ ID NO:2, 4, 6, 8, 10 or 12 and the identity can even more preferably be 96%, 97%, 98%, 99%, 99.9% or even higher.

[0127] The present invention also provides nucleic acid molecules that hybridize under stringent conditions to the above-described nucleic acid molecules. As defined above, and as is well known in the art, stringent hybridizations are performed at about 25.degree. C. below the thermal melting point (T.sub.m) for the specific DNA hybrid under a particular set of conditions, where the T.sub.m is the temperature at which 50% of the target sequence hybridizes to a perfectly matched probe. Stringent washing is performed at temperatures about 5.degree. C. lower than the T.sub.m for the specific DNA hybrid under a particular set of conditions.

[0128] Nucleic acid molecules comprising a fragment of any one of the above-described nucleic acid sequences are also provided. These fragments preferably contain at least 20 contiguous nucleotides. More preferably the fragments of the nucleic acid sequences contain at least 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100 or even more contiguous nucleotides.

[0129] The nucleic acid sequence fragments of the present invention display utility in a variety of systems and methods. For example, the fragments may be used as probes in various hybridization techniques. Depending on the method, the target nucleic acid sequences may be either DNA or RNA. The target nucleic acid sequences may be fractionated (e.g., by gel electrophoresis) prior to the hybridization, or the hybridization may be performed on samples in situ. One of skill in the art will appreciate that nucleic acid probes of known sequence find utility in determining chromosomal structure (e.g., by Southern blotting) and in measuring gene expression (e.g., by Northern blotting). In such experiments, the sequence fragments are preferably detectably labeled, so that their specific hydridization to target sequences can be detected and optionally quantified. One of skill in the art will appreciate that the nucleic acid fragments of the present invention may be used in a wide variety of blotting techniques not specifically described herein.

[0130] It should also be appreciated that the nucleic acid sequence fragments disclosed herein also find utility as probes when immobilized on microarrays. Methods for creating microarrays by deposition and fixation of nucleic acids onto support substrates are well known in the art. Reviewed in DNA Microarrays: A Practical Approach (Practical Approach Series), Schena (ed.), Oxford University Press (1999) (ISBN: 0199637768); Nature Genet. 21(1)(suppl):1-60 (1999); Microarray Biochip: Tools and Technology, Schena (ed.), Eaton Publishing Company/BioTechniques Books Division (2000) (ISBN: 1881299376), the disclosures of which are incorporated herein by reference in their entireties. Analysis of, for example, gene expression using microarrays comprising nucleic acid sequence fragments, such as the nucleic acid sequence fragments disclosed herein, is a well-established utility for sequence fragments in the field of cell and molecular biology. Other uses for sequence fragments immobilized on microarrays are described in Gerhold et al., Trends Biochem. Sci. 24:168-173 (1999) and Zweiger, Trends Biotechnol. 17:429-436 (1999); DNA Microarrays: A Practical Approach (Practical Approach Series), Schena (ed.), Oxford University Press (1999) (ISBN: 0199637768); Nature Genet. 21(1)(suppl):1-60 (1999); Microarray Biochip: Tools and Technology, Schena (ed.), Eaton Publishing Company/BioTechniques Books Division (2000) (ISBN: 1881299376), the disclosure of each of which is incorporated herein by reference in its entirety.

[0131] As is well known in the art, enzyme activities can be measured in various ways. For example, the pyrophosphorolysis of OMP may be followed spectroscopically (Grubmeyer et al., (1993) J. Biol. Chem. 268:20299-20304). Alternatively, the activity of the enzyme can be followed using chromatographic techniques, such as by high performance liquid chromatography (Chung and Sloan, (1986) J. Chromatogr. 371:71-81). As another alternative the activity can be indirectly measured by determining the levels of product made from the enzyme activity. These levels can be measured with techniques including aqueous chloroform/methanol extraction as known and described in the art (Cf. M. Kates (1986) Techniques of Lipidology; Isolation, analysis and identification of Lipids. Elsevier Science Publishers, New York (ISBN: 0444807322)). More modern techniques include using gas chromatography linked to mass spectrometry (Niessen, W. M. A. (2001). Current practice of gas chromatography--mass spectrometry. New York, N.Y.: Marcel Dekker. (ISBN: 0824704738)). Additional modern techniques for identification of recombinant protein activity and products including liquid chromatography-mass spectrometry (LCMS), high performance liquid chromatography (HPLC), capillary electrophoresis, Matrix-Assisted Laser Desorption Ionization time of flight-mass spectrometry (MALDI-TOF MS), nuclear magnetic resonance (NMR), near-infrared (NIR) spectroscopy, viscometry (Knothe, G (1997) Am. Chem. Soc. Symp. Series, 666: 172-208), titration for determining free fatty acids (Komers (1997) Fett/Lipid, 99(2): 52-54), enzymatic methods (Bailer (1991) Fresenius J. Anal. Chem. 340(3): 186), physical property-based methods, wet chemical methods, etc. can be used to analyze the levels and the identity of the product produced by the organisms of the present invention. Other methods and techniques may also be suitable for the measurement of enzyme activity, as would be known by one of skill in the art.

Vectors

[0132] Also provided are vectors, including expression vectors, which comprise the above nucleic acid molecules of the present invention, as described further herein. In a first embodiment, the vectors include the isolated nucleic acid molecules described above. In an alternative embodiment, the vectors of the present invention include the above-described nucleic acid molecules operably linked to one or more expression control sequences. The vectors of the instant invention may thus be used to express an AAR and/or ADM polypeptide contributing to n-alkane producing activity by a host cell.

[0133] Vectors useful for expression of nucleic acids in prokaryotes are well known in the art.

Isolated Polypeptides

[0134] According to another aspect of the present invention, isolated polypeptides (including muteins, allelic variants, fragments, derivatives, and analogs) encoded by the nucleic acid molecules of the present invention are provided. In one embodiment, the isolated polypeptide comprises the polypeptide sequence corresponding to SEQ ID NO:2, 4, 6, 8 10 or 12. In an alternative embodiment of the present invention, the isolated polypeptide comprises a polypeptide sequence at least 85% identical to SEQ ID NO:2, 4, 6, 8, 10 or 12. Preferably the isolated polypeptide of the present invention has at least 50%, 60, 70%, 80%, 85%, 90%, 95%, 98%, 98.1%, 98.2%, 98.3%, 98.4%, 98.5%, 98.6%, 98.7%, 98.8%, 98.9%, 99%, 99.1%, 99.2%, 99.3%, 99.4%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9% or even higher identity to SEQ ID NO:2, 4, 6, 8, 10 or 12.

[0135] According to other embodiments of the present invention, isolated polypeptides comprising a fragment of the above-described polypeptide sequences are provided. These fragments preferably include at least 20 contiguous amino acids, more preferably at least 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100 or even more contiguous amino acids.

[0136] The polypeptides of the present invention also include fusions between the above-described polypeptide sequences and heterologous polypeptides. The heterologous sequences can, for example, include sequences designed to facilitate purification, e.g. histidine tags, and/or visualization of recombinantly-expressed proteins. Other non-limiting examples of protein fusions include those that permit display of the encoded protein on the surface of a phage or a cell, fusions to intrinsically fluorescent proteins, such as green fluorescent protein (GFP), and fusions to the IgG Fc region.

Host Cell Transformants

[0137] In another aspect of the present invention, host cells transformed with the nucleic acid molecules or vectors of the present invention, and descendants thereof, are provided. In some embodiments of the present invention, these cells carry the nucleic acid sequences of the present invention on vectors, which may but need not be freely replicating vectors. In other embodiments of the present invention, the nucleic acids have been integrated into the genome of the host cells.

[0138] In a preferred embodiment, the host cell comprises one or more AAR or ADM encoding nucleic acids which express AAR or ADM in the host cell.

[0139] In an alternative embodiment, the host cells of the present invention can be mutated by recombination with a disruption, deletion or mutation of the isolated nucleic acid of the present invention so that the activity of the AAR and/or ADM protein(s) in the host cell is reduced or eliminated compared to a host cell lacking the mutation.

Selected or Engineered Microorganisms for the Production of Carbon-Based Products of Interest

[0140] Microorganism: Includes prokaryotic and eukaryotic microbial species from the Domains Archaea, Bacteria and Eucarya, the latter including yeast and filamentous fungi, protozoa, algae, or higher Protista. The terms "microbial cells" and "microbes" are used interchangeably with the term microorganism.

[0141] A variety of host organisms can be transformed to produce a product of interest. Photoautotrophic organisms include eukaryotic plants and algae, as well as prokaryotic cyanobacteria, green-sulfur bacteria, green non-sulfur bacteria, purple sulfur bacteria, and purple non-sulfur bacteria.

[0142] Extremophiles are also contemplated as suitable organisms. Such organisms withstand various environmental parameters such as temperature, radiation, pressure, gravity, vacuum, desiccation, salinity, pH, oxygen tension, and chemicals. They include hyperthermophiles, which grow at or above 80.degree. C. such as Pyrolobus fumarii; thermophiles, which grow between 60-80.degree. C. such as Synechococcus lividis; mesophiles, which grow between 15-60.degree. C. and psychrophiles, which grow at or below 15.degree. C. such as Psychrobacter and some insects. Radiation tolerant organisms include Deinococcus radiodurans. Pressure-tolerant organisms include piezophiles, which tolerate pressure of 130 MPa. Weight-tolerant organisms include barophiles. Hypergravity (e.g., >1 g) hypogravity (e.g., <1 g) tolerant organisms are also contemplated. Vacuum tolerant organisms include tardigrades, insects, microbes and seeds. Dessicant tolerant and anhydrobiotic organisms include xerophiles such as Artemia salina; nematodes, microbes, fungi and lichens. Salt-tolerant organisms include halophiles (e.g., 2-5 M NaCl) Halobacteriacea and Dunaliella salina, pH-tolerant organisms include alkaliphiles such as Natronobacterium, Bacillus firmus OF4, Spirulina spp. (e.g., pH >9) and acidophiles such as Cyanidium caldarium, Ferroplasma sp. (e.g., low pH). Anaerobes, which cannot tolerate O.sub.2 such as Methanococcus jannaschii; microaerophils, which tolerate some O.sub.2 such as Clostridium and aerobes, which require O.sub.2 are also contemplated. Gas-tolerant organisms, which tolerate pure CO.sub.2 include Cyanidium caldarium and metal tolerant organisms include metalotolerants such as Ferroplasma acidarmanus (e.g., Cu, As, Cd, Zn), Ralstonia sp. CH34 (e.g., Zn, Co, Cd, Hg, Pb). Gross, Michael. Life on the Edge: Amazing Creatures Thriving in Extreme Environments. New YorK: Plenum (1998) and Seckbach, J. "Search for Life in the Universe with Terrestrial Microbes Which Thrive Under Extreme Conditions." In Cristiano Batalli Cosmovici, Stuart Bowyer, and Dan Wertheimer, eds., Astronomical and Biochemical Origins and the Search for Life in the Universe, p. 511. Milan: Editrice Compositori (1997).

[0143] Plants include but are not limited to the following genera: Arabidopsis, Beta, Glycine, Jatropha, Miscanthus, Panicum, Phalaris, Populus, Saccharum, Salix, Simmondsia and Zea.

[0144] Algae and cyanobacteria include but are not limited to the following genera: Acanthoceras, Acanthococcus, Acaryochloris, Achnanthes, Achnanthidium, Actinastrum, Actinochloris, Actinocyclus, Actinotaenium, Amphichrysis, Amphidinium, Amphikrikos, Amphipleura, Amphiprora, Amphithrix, Amphora, Anabaena, Anabaenopsis, Aneumastus, Ankistrodesmus, Ankyra, Anomoeoneis, Apatococcus, Aphanizomenon, Aphanocapsa, Aphanochaete, Aphanothece, Apiocystis, Apistonema, Arthrodesmus, Artherospira, Ascochloris, Asterionella, Asterococcus, Audouinella, Aulacoseira, Bacillaria, Balbiania, Bambusina, Bangia, Basichlamys, Batrachospermum, Binuclearia, Bitrichia, Blidingia, Botrdiopsis, Botrydium, Botryococcus, Botryosphaerella, Brachiomonas, Brachysira, Brachytrichia, Brebissonia, Bulbochaete, Bumilleria, Bumilleriopsis, Caloneis, Calothrix, Campylodiscus, Capsosiphon, Carteria, Catena, Cavinula, Centritractus, Centronella, Ceratium, Chaetoceros, Chaetochloris, Chaetomorpha, Chaetonella, Chaetonema, Chaetopeltis, Chaetophora, Chaetosphaeridium, Chamaesiphon, Chara, Characiochloris, Characiopsis, Characium, Charales, Chilomonas, Chlainomonas, Chlamydoblepharis, Chlamydocapsa, Chlamydomonas, Chlamydomonopsis, Chlamydomyxa, Chlamydonephris, Chlorangiella, Chlorangiopsis, Chlorella, Chlorobotrys, Chlorobrachis, Chlorochytrium, Chlorococcum, Chlorogloea, Chlorogloeopsis, Chlorogonium, Chlorolobion, Chloromonas, Chlorophysema, Chlorophyta, Chlorosaccus, Chlorosarcina, Choricystis, Chromophyton, Chromulina, Chroococcidiopsis, Chroococcus, Chroodactylon, Chroomonas, Chroothece, Chrysamoeba, Chrysapsis, Chrysidiastrum, Chrysocapsa, Chrysocapsella, Chrysochaete, Chrysochromulina, Chrysococcus, Chrysocrinus, Chrysolepidomonas, Chrysolykos, Chrysonebula, Chrysophyta, Chrysopyxis, Chrysosaccus, Chrysophaerella, Chrysostephanosphaera, Clodophora, Clastidium, Closteriopsis, Closterium, Coccomyxa, Cocconeis, Coelastrella, Coelastrum, Coelosphaerium, Coenochloris, Coenococcus, Coenocystis, Colacium, Coleochaete, Collodictyon, Compsogonopsis, Compsopogon, Conjugatophyta, Conochaete, Coronastrum, Cosmarium, Cosmioneis, Cosmocladium, Crateriportula, Craticula, Crinalium, Crucigenia, Crucigeniella, Cryptoaulax, Cryptomonas, Cryptophyta, Ctenophora, Cyanodictyon, Cyanonephron, Cyanophora, Cyanophyta, Cyanothece, Cyanothomonas, Cyclonexis, Cyclostephanos, Cyclotella, Cylindrocapsa, Cylindrocystis, Cylindrospermum, Cylindrotheca, Cymatopleura, Cymbella, Cymbellonitzschia, Cystodinium Dactylococcopsis, Debarya, Denticula, Dermatochrysis, Dermocarpa, Dermocarpella, Desmatractum, Desmidium, Desmococcus, Desmonema, Desmosiphon, Diacanthos, Diacronema, Diadesmis, Diatoma, Diatomella, Dicellula, Dichothrix, Dichotomococcus, Dicranochaete, Dictyochloris, Dictyococcus, Dictyosphaerium, Didymocystis, Didymogenes, Didymosphenia, Dilabifilum, Dimorphococcus, Dinobryon, Dinococcus, Diplochloris, Diploneis, Diplostauron, Distrionella, Docidium, Draparnaldia, Dunaliella, Dysmorphococcus, Ecballocystis, Elakatothrix, Ellerbeckia, Encyonema, Enteromorpha, Entocladia, Entomoneis, Entophysalis, Epichrysis, Epipyxis, Epithemia, Eremosphaera, Euastropsis, Euastrum, Eucapsis, Eucocconeis, Eudorina, Euglena, Euglenophyta, Eunotia, Eustigmatophyta, Eutreptia, Fallacia, Fischerella, Fragilaria, Fragilariforma, Franceia, Frustulia, Curcilla, Geminella, Genicularia, Glaucocystis, Glaucophyta, Glenodiniopsis, Glenodinium, Gloeocapsa, Gloeochaete, Gloeochrysis, Gloeococcus, Gloeocystis, Gloeodendron, Gloeomonas, Gloeoplax, Gloeothece, Gloeotila, Gloeotrichia, Gloiodictyon, Golenkinia, Golenkiniopsis, Gomontia, Gomphocymbella, Gomphonema, Gomphosphaeria, Gonatozygon, Gongrosia, Gongrosira, Goniochloris, Gonium, Gonyostomum, Granulochloris, Granulocystopsis, Groenbladia, Gymnodinium, Gymnozyga, Gyrosigma, Haematococcus, Hafniomonas, Hallassia, Hammatoidea, Hannaea, Hantzschia, Hapalosiphon, Haplotaenium, Haptophyta, Haslea, Hemidinium, Hemitoma, Heribaudiella, Heteromastix, Heterothrix, Hibberdia, Hildenbrandia, Hillea, Holopedium, Homoeothrix, Hormanthonema, Hormotila, Hyalobrachion, Hyalocardium, Hyalodiscus, Hyalogonium, Hyalotheca, Hydrianum, Hydrococcus, Hydrocoleum, Hydrocoryne, Hydrodictyon, Hydrosera, Hydrurus, Hyella, Hymenomonas, Isthmochloron, Johannesbaptistia, Juranyiella, Karayevia, Kathablepharis, Katodinium, Kephyrion, Keratococcus, Kirchneriella, Klebsormidium, Kolbesia, Koliella, Komarekia, Korshikoviella, Kraskella, Lagerheimia, Lagynion, Lamprothamnium, Lemanea, Lepocinclis, Leptosira, Lobococcus, Lobocystis, Lobomonas, Luticola, Lyngbya, Malleochloris, Mallomonas, Mantoniella, Marssoniella, Martyana, Mastigocoleus, Gastogloia, Melosira, Merismopedia, Mesostigma, Mesotaenium, Micractinium, Micrasterias, Microchaete, Microcoleus, Microcystis, Microglena, Micromonas, Microspora, Microthamnion, Mischococcus, Monochrysis, Monodus, Monomastix, Monoraphidium, Monostroma, Mougeotia, Mougeotiopsis, Myochloris, Myromecia, Myxosarcina, Naegeliella, Nannochloris, Nautococcus, Navicula, Neglectella, Neidium, Nephroclamys, Nephrocytium, Nephrodiella, Nephroselmis, Netrium, Nitella, Nitellopsis, Nitzschia, Nodularia, Nostoc, Ochromonas, Oedogonium, Oligochaetophora, Onychonema, Oocardium, Oocystis, Opephora, Ophiocytium, Orthoseira, Oscillatoria, Oxyneis, Pachycladella, Palmella, Palmodictyon, Pnadorina, Pannus, Paralia, Pascherina, Paulschulzia, Pediastrum, Pedinella, Pedinomonas, Pedinopera, Pelagodictyon, Penium, Peranema, Peridiniopsis, Peridinium, Peronia, Petroneis, Phacotus, Phacus, Phaeaster, Phaeodermatium, Phaeophyta, Phaeosphaera, Phaeothamnion, Phormidium, Phycopeltis, Phyllariochloris, Phyllocardium, Phyllomitas, Pinnularia, Pitophora, Placoneis, Planctonema, Planktosphaeria, Planothidium, Plectonema, Pleodorina, Pleurastrum, Pleurocapsa, Pleurocladia, Pleurodiscus, Pleurosigma, Pleurosira, Pleurotaenium, Pocillomonas, Podohedra, Polyblepharides, Polychaetophora, Polyedriella, Polyedriopsis, Polygoniochloris, Polyepidomonas, Polytaenia, Polytoma, Polytomella, Porphyridium, Posteriochromonas, Prasinochloris, Prasinocladus, Prasinophyta, Prasiola, Prochlorphyta, Prochlorothrix, Protoderma, Protosiphon, Provasoliella, Prymnesium, Psammodictyon, Psammothidium, Pseudanabaena, Pseudenoclonium, Psuedocarteria, Pseudochate, Pseudocharacium, Pseudococcomyxa, Pseudodictyosphaerium, Pseudokephyrion, Pseudoncobyrsa, Pseudoquadrigula, Pseudosphaerocystis, Pseudostaurastrum, Pseudostaurosira, Pseudotetrastrum, Pteromonas, Punctastruata, Pyramichlamys, Pyramimonas, Pyrrophyta, Quadrichloris, Quadricoccus, Quadrigula, Radiococcus, Radiofilum, Raphidiopsis, Raphidocelis, Raphidonema, Raphidophyta, Peimeria, Rhabdoderma, Rhabdomonas, Rhizoclonium, Rhodomonas, Rhodophyta, Rhoicosphenia, Rhopalodia, Rivularia, Rosenvingiella, Rossithidium, Roya, Scenedesmus, Scherffelia, Schizochlamydella, Schizochlamys, Schizomeris, Schizothrix, Schroederia, Scolioneis, Scotiella, Scotiellopsis, Scourfieldia, Scytonema, Selenastrum, Selenochloris, Sellaphora, Semiorbis, Siderocelis, Diderocystopsis, Dimonsenia, Siphononema, Sirocladium, Sirogonium, Skeletonema, Sorastrum, Spermatozopsis, Sphaerellocystis, Sphaerellopsis, Sphaerodinium, Sphaeroplea, Sphaerozosma, Spiniferomonas, Spirogyra, Spirotaenia, Spirulina, Spondylomorum, Spondylosium, Sporotetras, Spumella, Staurastrum, Stauerodesmus, Stauroneis, Staurosira, Staurosirella, Stenopterobia, Stephanocostis, Stephanodiscus, Stephanoporos, Stephanosphaera, Stichococcus, Stichogloea, Stigeoclonium, Stigonema, Stipitococcus, Stokesiella, Strombomonas, Stylochrysalis, Stylodinium, Styloyxis, Stylosphaeridium, Surirella, Sykidion, Symploca, Synechococcus, Synechocystis, Synedra, Synochromonas, Synura, Tabellaria, Tabularia, Tellingia, Temnogametum, Tetmemorus, Tetrachlorella, Tetracyclus, Tetradesmus, Tetraedriella, Tetraedron, Tetraselmis, Tetraspora, Tetrastrum, Thalassiosira, Thamniochaete, Thorakochloris, Thorea, Tolypella, Tolypothrix, Trachelomonas, Trachydiscus, Trebouxia, Trentepholia, Treubaria, Tribonema, Trichodesmium, Trichodiscus, Trochiscia, Tryblionella, Ulothrix, Uroglena, Uronema, Urosolenia, Urospora, Uva, Vacuolaria, Vaucheria, Volvox, Volvulina, Westella, Woloszynskia, Xanthidium, Xanthophyta, Xenococcus, Zygnema, Zygnemopsis, and Zygonium. A partial list of cyanobacteria that can be engineered to express recombinant AAR and ADM enzymes is also provided in Table 1 and Table 2, herein. Additional cyanobacteria include members of the genus Chamaesiphon, Chroococcus, Cyanobacterium, Cyanobium, Cyanothece, Dactylococcopsis, Gloeobacter, Gloeocapsa, Gloeothece, Microcystis, Prochlorococcus, Prochloron, Synechococcus, Synechocystis, Cyanocystis, Dermocarpella, Stanieria, Xenococcus, Chroococcidiopsis, Myxosarcina, Arthrospira, Borzia, Crinalium, Geitlerinemia, Leptolyngbya, Limnothrix, Lyngbya, Microcoleus, Oscillatoria, Planktothrix, Prochiorothrix, Pseudanabaena, Spirulina, Starria, Symploca, Trichodesmium, Tychonema, Anabaena, Anabaenopsis, Aphanizomenon, Cyanospira, Cylindrospermopsis, Cylindrospermum, Nodularia, Nostoc, Scylonema, Calothrix, Rivularia, Tolypothrix, Chlorogloeopsis, Fischerella, Geitieria, lyengariella, Nostochopsis, Stigonema and Thermosynechococcus.

[0145] Green non-sulfur bacteria include but are not limited to the following genera: Chloroflexus, Chloronema, Oscillochloris, Heliothrix, Herpetosiphon, Roseiflexus, and Thermomicrobium.

[0146] Green sulfur bacteria include but are not limited to the following genera: Chlorobium, Clathrochloris, and Prosthecochloris.

[0147] Purple sulfur bacteria include but are not limited to the following genera: Allochromatium, Chromatium, Halochromatium, Isochromatium, Marichromatium, Rhodovulum, Thermochromatium, Thiocapsa, Thiorhodococcus, and Thiocystis,

[0148] Purple non-sulfur bacteria include but are not limited to the following genera: Phaeospirillum, Rhodobaca, Rhodobacter, Rhodomicrobium, Rhodopila, Rhodopseudomonas, Rhodothalassium, Rhodospirillum, Rodovibrio, and Roseospira.

[0149] Aerobic chemolithotrophic bacteria include but are not limited to nitrifying bacteria such as Nitrobacteraceae sp., Nitrobacter sp., Nitrospina sp., Nitrococcus sp., Nitrospira sp., Nitrosomonas sp., Nitrosococcus sp., Nitrosospira sp., Nitrosolobus sp., Nitrosovibrio sp.; colorless sulfur bacteria such as, Thiovulum sp., Thiobacillus sp., Thiomicrospira sp., Thiosphaera sp., Thermothrix sp.; obligately chemolithotrophic hydrogen bacteria such as Hydrogenobacter sp., iron and manganese-oxidizing and/or depositing bacteria such as Siderococcus sp., and magnetotactic bacteria such as Aquaspirillum sp.

[0150] Archaeobacteria include but are not limited to methanogenic archaeobacteria such as Methanobacterium sp., Methanobrevibacter sp., Methanothermus sp., Methanococcus sp., Methanomicrobium sp., Methanospirillum sp., Methanogenium sp., Methanosarcina sp., Methanolobus sp., Methanothrix sp., Methanococcoides sp., Methanoplanus sp.; extremely thermophilic S-Metabolizers such as Thermoproteus sp., Pyrodictium sp., Sulfolobus sp., Acidianus sp. and other microorganisms such as, Bacillus subtilis, Saccharomyces cerevisiae, Streptomyces sp., Ralstonia sp., Rhodococcus sp., Corynebacteria sp., Brevibacteria sp., Mycobacteria sp., and oleaginous yeast.

[0151] Preferred organisms for the manufacture of n-alkanes according to the methods disclosed herein include: Arabidopsis thaliana, Panicum virgatum, Miscanthus giganteus, and Zea mays (plants); Botryococcus braunii, Chlamydomonas reinhardtii and Dunaliela salina (algae); Synechococcus sp PCC 7002, Synechococcus sp. PCC 7942, Synechocystis sp. PCC 6803, Thermosynechococcus elongatus BP-1 (cyanobacteria); Chlorobium tepidum (green sulfur bacteria), Chloroflexus auranticus (green non-sulfur bacteria); Chromatium tepidum and Chromatium vinosum (purple sulfur bacteria); Rhodospirillum rubrum, Rhodobacter capsulatus, and Rhodopseudomonas palusris (purple non-sulfur bacteria).

[0152] Yet other suitable organisms include synthetic cells or cells produced by synthetic genomes as described in Venter et al. US Pat. Pub. No. 2007/0264688, and cell-like systems or synthetic cells as described in Glass et al. US Pat. Pub. No. 2007/0269862.

[0153] Still, other suitable organisms include microorganisms that can be engineered to fix carbon dioxide bacteria such as Escherichia coli, Acetobacter aceti, Bacillus subtilis, yeast and fungi such as Clostridium ljungdahlii, Clostridium thermocellum, Penicillium chrysogenum, Pichia pastoris, Saccharomyces cerevisiae, Schizosaccharomyces pombe, Pseudomonas fluorescens, or Zymomonas mobilis.

[0154] A suitable organism for selecting or engineering is autotrophic fixation of CO.sub.2 to products. This would cover photosynthesis and methanogenesis. Acetogenesis, encompassing the three types of CO.sub.2 fixation; Calvin cycle, acetyl-CoA pathway and reductive TCA pathway is also covered. The capability to use carbon dioxide as the sole source of cell carbon (autotrophy) is found in almost all major groups of prokaryotes. The CO.sub.2 fixation pathways differ between groups, and there is no clear distribution pattern of the four presently-known autotrophic pathways. See, e.g., Fuchs, G. 1989. Alternative pathways of autotrophic CO.sub.2 fixation, p. 365-382. In H. G. Schlegel, and B. Bowien (ed.), Autotrophic bacteria. Springer-Verlag, Berlin, Germany. The reductive pentose phosphate cycle (Calvin-Bassham-Benson cycle) represents the CO.sub.2 fixation pathway in almost all aerobic autotrophic bacteria, for example, the cyanobacteria.

[0155] For producing n-alkanes via the recombinant expression of AAR and/or ADM enzymes, an engineered cyanobacteria, e.g., a Synechococcus or Thermosynechococcus species, is preferred. Other preferred organisms include Synechocystis, Klebsiella oxytoca, Escherichia coli or Saccharomyces cerevisiae. Other prokaryotic, archaea and eukaryotic host cells are also encompassed within the scope of the present invention.

Carbon-Based Products of Interest: Hydrocarbons & Alcohols

[0156] In various embodiments of the invention, desired hydrocarbons and/or alcohols of certain chain length or a mixture thereof can be produced. In certain aspects, the host cell produces at least one of the following carbon-based products of interest: 1-dodecanol, 1-tetradecanol, 1-pentadecanol, n-tridecane, n-tetradecane, 15:1 n-pentadecane, n-pentadecane, 16:1 n-hexadecene, n-hexadecane, 17:1 n-heptadecene, n-heptadecane, 16:1 n-hexadecen-ol, n-hexadecan-1-ol and n-octadecen-1-ol, as shown in the Examples herein. In other aspects, the carbon chain length ranges from C.sub.10 to C.sub.20. Accordingly, the invention provides production of various chain lengths of alkanes, alkenes and alkanols suitable for use as fuels & chemicals.

[0157] In preferred aspects, the methods provide culturing host cells for direct product secretion for easy recovery without the need to extract biomass. These carbon-based products of interest are secreted directly into the medium. Since the invention enables production of various defined chain length of hydrocarbons and alcohols, the secreted products are easily recovered or separated. The products of the invention, therefore, can be used directly or used with minimal processing.

Fuel Compositions

[0158] In various embodiments, compositions produced by the methods of the invention are used as fuels. Such fuels comply with ASTM standards, for instance, standard specifications for diesel fuel oils D 975-09b, and Jet A, Jet A-1 and Jet B as specified in ASTM Specification D. 1655-68. Fuel compositions may require blending of several products to produce a uniform product. The blending process is relatively straightforward, but the determination of the amount of each component to include in a blend is much more difficult. Fuel compositions may, therefore, include aromatic and/or branched hydrocarbons, for instance, 75% saturated and 25% aromatic, wherein some of the saturated hydrocarbons are branched and some are cyclic. Preferably, the methods of the invention produce an array of hydrocarbons, such as C.sub.13-C.sub.17 or C.sub.10-C.sub.15 to alter cloud point. Furthermore, the compositions may comprise fuel additives, which are used to enhance the performance of a fuel or engine. For example, fuel additives can be used to alter the freezing/gelling point, cloud point, lubricity, viscosity, oxidative stability, ignition quality, octane level, and flash point. Fuels compositions may also comprise, among others, antioxidants, static dissipater, corrosion inhibitor, icing inhibitor, biocide, metal deactivator and thermal stability improver.

[0159] In addition to many environmental advantages of the invention such as CO.sub.2 conversion and renewable source, other advantages of the fuel compositions disclosed herein include low sulfur content, low emissions, being free or substantially free of alcohol and having high cetane number.

Carbon Fingerprinting

[0160] Biologically-produced carbon-based products, e.g., ethanol, fatty acids, alkanes, isoprenoids, represent a new commodity for fuels, such as alcohols, diesel and gasoline. Such biofuels have not been produced using biomass but use CO2 as its carbon source. These new fuels may be distinguishable from fuels derived form petrochemical carbon on the basis of dual carbon-isotopic fingerprinting. Such products, derivatives, and mixtures thereof may be completely distinguished from their petrochemical derived counterparts on the basis of .sup.14C (fM) and dual carbon-isotopic fingerprinting, indicating new compositions of matter.

[0161] There are three naturally occurring isotopes of carbon: .sup.12C, .sup.13C, and .sup.14C. These isotopes occur in above-ground total carbon at fractions of 0.989, 0.011, and 10.sup.-12, respectively. The isotopes .sup.12C and .sup.13C are stable, while .sup.14C decays naturally to .sup.14N, a beta particle, and an anti-neutrino in a process with a half-life of 5730 years. The isotope .sup.14C originates in the atmosphere, due primarily to neutron bombardment of .sup.14N caused ultimately by cosmic radiation. Because of its relatively short half-life (in geologic terms), .sup.14C occurs at extremely low levels in fossil carbon. Over the course of 1 million years without exposure to the atmosphere, just 1 part in 10.sup.50 will remain .sup.14C.

[0162] The .sup.13C:.sup.12C ratio varies slightly but measurably among natural carbon sources. Generally these differences are expressed as deviations from the .sup.13C:.sup.12C ratio in a standard material. The international standard for carbon is Pee Dee Belemnite, a form of limestone found in South Carolina, with a .sup.13C fraction of 0.0112372. For a carbon source a, the deviation of the .sup.13C:.sup.12C ratio from that of Pee Dee Belemnite is expressed as: .delta..sub.a=(R.sub.a/R.sub.s)-1, where R.sub.a=.sup.13C:.sup.12C ratio in the natural source, and R.sub.s=.sup.13C:.sup.12C ratio in Pee Dee Belemnite, the standard. For convenience, .delta..sub.a is expressed in parts per thousand, or .Salinity.. A negative value of .delta..sub.a shows a bias toward .sup.12C over .sup.13C as compared to Pee Dee Belemnite. Table A shows 6, and .sup.14C fraction for several natural sources of carbon.

TABLE-US-00001 TABLE A 13C:12C variations in natural carbon sources Source -.delta..sub.a (.Salinity.) References Underground coal 32.5 Farquhar et al. (1989) Plant Mol. Biol., 40: 503-37 Fossil fuels 26 Farquhar et al. (1989) Plant Mol. Biol., 40: 503-37 Ocean DIC* 0-1.5 Goericke et al. (1994) Chapter 9 in Stable Isotopes in Ecology and Environmental Science, by K. Lajtha and R. H. Michener, Blackwell Publishing; Ivlev (2010) Separation Sci. Technol. 36: 1819-1914 Atmospheric 6-8 Ivlev (2010) Separation Sci. CO2 Technol. 36: 1819-1914; Farquhar et al. (1989) Plant Mol. Biol., 40: 503-37 Freshwater DIC* 6-14 Dettman et al. (1999) Geochim. Cosmochim. Acta 63: 1049-1057 Pee Dee 0 Ivlev (2010) Separation Sci. Belemnite Technol. 36: 1819-1914 *DIC = dissolved inorganic carbon

[0163] Biological processes often discriminate among carbon isotopes. The natural abundance of .sup.14C is very small, and hence discrimination for or against .sup.14C is difficult to measure. Biological discrimination between .sup.13C and .sup.12C, however, is well-documented. For a biological product p, we can define similar quantities to those above: .delta..sub.p=(R.sub.p/R.sub.s)-1, where R.sub.p=.sup.13C:.sup.12C ratio in the biological product, and R.sub.s=.sup.13C:.sup.12C ratio in Pee Dee Belemnite, the standard. Table B shows measured deviations in the .sup.13C:.sup.12C ratio for some biological products.

TABLE-US-00002 TABLE B .sup.13C:.sup.12C variations in selected biological products Product -.delta..sub.p(.Salinity.) -D(.Salinity.)* References Plant 18-28 .sup. 10-20 Ivlev (2010) Separation sugar/starch from Sci. Technol. 36: 1819- atmospheric CO.sub.2 1914 Cyanobacterial 18-31 16.5-31 Goericke et al. (1994) biomass from Chapter 9 in Stable marine DIC Isotopes in Ecology and Environmental Science, by K. Lajtha and R. H. Michener, Blackwell Publishing; Sakata et al. (1997) Geochim. Cosmochim. Acta, 61: 5379-89 Cyanobacterial 39-40 37.5-40 Sakata et al. (1997) lipid from Geochim. Cosmochim. marine DIC Acta, 61: 5379-89 Algal lipid 17-28 15.5-28 Goericke et al. (1994) from marine Chapter 9 in Stable DIC Isotopes in Ecology and Environmental Science, by K. Lajtha and R. H. Michener, Blackwell Publishing; Abelseon et al. (1961) Proc. Natl. Acad. Sci., 47: 623-32 Algal biomass 17-36 3-30 Marty et al. (2008) Limnol. from freshwater Oceanogr.: Methods 6: 51- DIC 63 E. coli lipid 15-27 near 0 Monson et al. (1980) J. from plant Biol. Chem., 255: 11435- sugar 41 Cyanobacterial 63.5-66.sup. 37.5-40 -- lipid from fossil carbon Cyanobacterial 42.5-57.sup. 16.5-31 -- biomass from fossil carbon *D = discrimination by a biological process in its utilization of .sup.12C vs. .sup.13C (see text)

[0164] Table B introduces a new quantity, D. This is the discrimination by a biological process in its utilization of .sup.12C vs. .sup.13C. We define D as follows: D=(R.sub.p/R.sub.a)-1. This quantity is very similar to .delta..sub.a and .delta..sub.p, except we now compare the biological product directly to the carbon source rather than to a standard. Using D, we can combine the bias effects of a carbon source and a biological process to obtain the bias of the biological product as compared to the standard. Solving for .delta..sub.p, we obtain: .delta..sub.p=(D)(.delta..sub.a)+D+.delta..sub.a, and, because (D)(.delta..sub.a) is generally very small compared to the other terms, .delta..sub.p.apprxeq..delta..sub.a+D.

[0165] For a biological product having a production process with a known D, we may therefore estimate .delta..sub.p by summing .delta..sub.and D. We assume that D operates irrespective of the carbon source. This has been done in Table B for cyanobacterial lipid and biomass produced from fossil carbon. As shown in the Table A and Table B, above, cyanobacterial products made from fossil carbon (in the form of, for example, flue gas or other emissions) will have a higher .delta..sub.1) than those of comparable biological products made from other sources, distinguishing them on the basis of composition of matter from these other biological products. In addition, any product derived solely from fossil carbon will have a negligible fraction of .sup.14C, while products made from above-ground carbon will have a .sup.14C fraction of approximately 10.sup.-12.

[0166] Accordingly, in certain aspects, the invention provides various carbon-based products of interest characterized as -.delta..sub.p(.Salinity.) of about 63.5 to about 66 and -D(.Salinity.) of about 37.5 to about 40.

Antibodies

[0167] In another aspect, the present invention provides isolated antibodies, including fragments and derivatives thereof that bind specifically to the isolated polypeptides and polypeptide fragments of the present invention or to one or more of the polypeptides encoded by the isolated nucleic acids of the present invention. The antibodies of the present invention may be specific for linear epitopes, discontinuous epitopes or conformational epitopes of such polypeptides or polypeptide fragments, either as present on the polypeptide in its native conformation or, in some cases, as present on the polypeptides as denatured, as, e.g., by solubilization in SDS. Among the useful antibody fragments provided by the instant invention are Fab, Fab', Fv, F(ab').sub.2, and single chain Fv fragments.

[0168] By "bind specifically" and "specific binding" is here intended the ability of the antibody to bind to a first molecular species in preference to binding to other molecular species with which the antibody and first molecular species are admixed. An antibody is said specifically to "recognize" a first molecular species when it can bind specifically to that first molecular species.

[0169] As is well known in the art, the degree to which an antibody can discriminate as among molecular species in a mixture will depend, in part, upon the conformational relatedness of the species in the mixture; typically, the antibodies of the present invention will discriminate over adventitious binding to unrelated polypeptides by at least two-fold, more typically by at least 5-fold, typically by more than 10-fold, 25-fold, 50-fold, 75-fold, and often by more than 100-fold, and on occasion by more than 500-fold or 1000-fold.

[0170] Typically, the affinity or avidity of an antibody (or antibody multimer, as in the case of an IgM pentamer) of the present invention for a polypeptide or polypeptide fragment of the present invention will be at least about 1.times.10.sup.6 M, typically at least about 5.times.10.sup.7 M, usefully at least about 1.times.10.sup.7 M, with affinities and avidities of 1.times.10.sup.8 M, 5.times.10.sup.9 M, 1.times.10.sup.-1.degree. M and even stronger proving especially useful.

[0171] The isolated antibodies of the present invention may be naturally-occurring forms, such as IgG, IgM, IgD, IgE, and IgA, from any mammalian species. For example, antibodies are usefully obtained from species including rodents-typically mouse, but also rat, guinea pig, and hamster-lagomorphs, typically rabbits, and also larger mammals, such as sheep, goats, cows, and horses. The animal is typically affirmatively immunized, according to standard immunization protocols, with the polypeptide or polypeptide fragment of the present invention.

[0172] Virtually all fragments of 8 or more contiguous amino acids of the polypeptides of the present invention may be used effectively as immunogens when conjugated to a carrier, typically a protein such as bovine thyroglobulin, keyhole limpet hemocyanin, or bovine serum albumin, conveniently using a bifunctional linker. Immunogenicity may also be conferred by fusion of the polypeptide and polypeptide fragments of the present invention to other moieties. For example, peptides of the present invention can be produced by solid phase synthesis on a branched polylysine core matrix; these multiple antigenic peptides (MAPs) provide high purity, increased avidity, accurate chemical definition and improved safety in vaccine development. See, e.g., Tam et al., Proc. Natl. Acad. Sci. USA 85:5409-5413 (1988); Posnett et al., J. Biol. Chem. 263, 1719-1725 (1988).

[0173] Protocols for immunization are well-established in the art. Such protocols often include multiple immunizations, either with or without adjuvants such as Freund's complete adjuvant and Freund's incomplete adjuvant. Antibodies of the present invention may be polyclonal or monoclonal, with polyclonal antibodies having certain advantages in immuno-histochemical detection of the proteins of the present invention and monoclonal antibodies having advantages in identifying and distinguishing particular epitopes of the proteins of the present invention. Following immunization, the antibodies of the present invention may be produced using any art-accepted technique. Host cells for recombinant antibody production--either whole antibodies, antibody fragments, or antibody derivatives--can be prokaryotic or eukaryotic. Prokaryotic hosts are particularly useful for producing phage displayed antibodies, as is well known in the art. Eukaryotic cells, including mammalian, insect, plant and fungal cells are also useful for expression of the antibodies, antibody fragments, and antibody derivatives of the present invention. Antibodies of the present invention can also be prepared by cell free translation.

[0174] The isolated antibodies of the present invention, including fragments and derivatives thereof, can usefully be labeled. It is, therefore, another aspect of the present invention to provide labeled antibodies that bind specifically to one or more of the polypeptides and polypeptide fragments of the present invention. The choice of label depends, in part, upon the desired use. In some cases, the antibodies of the present invention may usefully be labeled with an enzyme. Alternatively, the antibodies may be labeled with colloidal gold or with a fluorophore. For secondary detection using labeled avidin, streptavidin, captavidin or neutravidin, the antibodies of the present invention may usefully be labeled with biotin. When the antibodies of the present invention are used, e.g., for Western blotting applications, they may usefully be labeled with radioisotopes, such as .sup.33P, .sup.32P, .sup.35S, .sup.3H and .sup.125I. As would be understood, use of the labels described above is not restricted to any particular application.

[0175] The following examples are for illustrative purposes and are not intended to limit the scope of the present invention.

Example 1

[0176] A pathway for the enzymatic synthesis of n-alkanes. An enzymatic process for the production of n-alkanes in, e.g., cyanobacteria is shown in FIG. 1A based on the sequential activity of (1) an AAR enzyme, e.g., tll1312, an acyl-ACP reductase; and (2) an ADM enzyme, e.g., tll1313, a putative alkanal decarboxylative monooxygenase, that uses reduced ferredoxin as electron donor. The AAR activity is distinct from the relatively well characterized acyl-CoA reductase activity exhibited by proteins such as Acr1 from Acinetobacter calcoaceticus (Reiser S and Somerville C (1997) J. Bacteriol. 179:2969-2975). A membranous ADM activity has previously been identified in insect microsomal preparations (Reed J R et al. (1994) Proc. Natl. Acad. Sci. USA 91:10000-10004; Reed J R et al. (1995) Musca domestica. Biochemistry 34:16221-16227).

[0177] FIGS. 1B and 1C summarize the names and activities of the enzymes involved in the biosynthesis of n-alkanals. FIG. 1B depicts the relatively well characterized acyl-CoA reductase activity (EC 1.2.1.50) exhibited by proteins such as Acr1 from Acinetobacter calcoaceticus. In FIG. 1C, the two well-known ACP-related reductases that are involved in fatty acid biosynthesis, .beta.-ketoacyl-ACP reductase (EC 1.1.1.100) and enoyl-ACP reductase (EC 1.3.1.9, 1.3.1.10), are contrasted with the acyl-ACP reductase (AAR) (no EC number yet assigned) believed to be involved in the biosynthetic pathway for n-alkanes in cyanobacteria. The key difference between AAR and acyl-CoA reductase (EC 1.2.1.50) is that ACP is the acyl carrier rather than coenzyme A. Supporting this distinction, it has been shown that acyl-CoA reductase Acr1 from Acinetobacter calcoaceticus can only generate alkanals from acyl-CoA and not acyl-ACP (Resier S and Somerville C (1997) J Bacteriol. 179: 2969-2975).

[0178] ADM also lacks a presently assigned EC number. An alkanal monooxygenase (EC 1.14.14.3), often referred to as luciferase, is known to catalyze the conversion of n-alkanal to n-alkanoic acid. This activity is distinct from the ADM activity (n-alkanal to (n-1)-alkane) proposed herein, although both use n-alkanal and molecular oxygen as substrates.

[0179] Cyanobacterial AAR and ADM homologs for production of n-alkanes. In this example, homologs of cyanobacterial AAR and ADM genes (e.g., homologs of Synechococcus elongatus PCC 7942 SYNPCC7942_1594 and/or SYNPCC7942_1593 protein, respectively) are identified using a BLAST search. These proteins can be expressed in a variety of organisms (bacteria, yeast, plant, etc.) for the purpose of generating and isolating n-alkanes and other desired carbon-based products of interest from the organisms. A search of the non-redundant BLAST protein database revealed counterparts for each protein in other cyanobacteria.

[0180] To determine the degree of similarity among homologs of the Synechococcus elongatus PCC 7942 SYNPCC7942_1594 protein, the 341-amino acid protein sequence was queried using BLAST (http://blast.ncbi.nlm.nih.gov/) against the "nr" non-redundant protein database. Homologs were taken as matching proteins whose alignments (i) covered >90% length of SYNPCC7942_1594, (ii) covered >90% of the length of the matching protein, and (iii) had >50% identity with SYNPCC7942_1594 (Table 1).

TABLE-US-00003 TABLE 1 Protein homologs of SYNPCC7942_1594 (AAR) SEQ ID BLAST Score, Organism NO: Homolog accession # E-value Synechococcus elongatus 6 (SYNPCC7942_1594) n/a PCC 7942 Synechococcus elongatus 23 YP_400611.1 706, 0.0 PCC 7942 [cyanobacteria] taxid 1140 Synechococcus elongatus 24 YP_170761.1 706, 0.0 PCC 6301 [cyanobacteria] taxid 269084 Anabaena variabilis ATCC 25 YP_323044.1 538, 4e-151 29413 [cyanobacteria] taxid 240292 Nostoc sp. PCC 7120 26 NP_489324.1 535, 3e-150 [cyanobacteria] taxid 103690 `Nostoc azollae` 0708 27 ZP_03763674.1 533, 1e-149 [cyanobacteria] taxid 551115 Cyanothece sp. PCC 7425 28 YP_002481152.1 526, 9e-148 [cyanobacteria] taxid 395961 Nodularia spumigena CCY 29 ZP_01628095.1 521, 3e-146 9414 [cyanobacteria] taxid 313624 Lyngbya sp. PCC 8106 30 ZP_01619574.1 520, 6e-146 [cyanobacteria] taxid 313612 Nostoc punctiforme PCC 31 YP_001865324.1 520, 7e-146 73102 [cyanobacteria] taxid 63737 Trichodesmium erythraeum 32 YP_721978.1 517, 6e-145 IMS101 [cyanobacteria] taxid 203124 Thermosynechococcus 2 NP_682102.1 516, 2e-144 elongatus BP-1 [cyanobacteria] taxid 197221 Acaryochloris marina 33 YP_001518341.1 512, 2e-143 MBIC11017 [cyanobacteria] taxid 329726 Cyanothece sp. PCC 8802 34 ZP_03142196.1 510, 8e-143 [cyanobacteria] taxid 395962 Cyanothece sp. PCC 8801 35 YP_002371106.1 510, 8e-143 [cyanobacteria] taxid 41431 Microcoleus chthonoplastes 36 YP_002619867.1 509, 2e-142 PCC 7420 [cyanobacteria] taxid 118168 Arthrospira maxima CS-328 37 ZP_03273554.1 507, 7e-142 [cyanobacteria] taxid 513049 Synechocystis sp. PCC 6803 38 NP_442146.1 504, 5e-141 [cyanobacteria] taxid 1148 Cyanothece sp. CCY 0110 39 ZP_01728620.1 501, 4e-140 [cyanobacteria] taxid 391612 Synechococcus sp. PCC 7335 40 YP_002711557.1 500, 1e-139 [cyanobacteria] taxid 91464 Cyanothece sp. ATCC 51142 41 YP_001802846.1 489, 2e-136 [cyanobacteria] taxid 43989 Gloeobacter violaceus PCC 42 NP_926091.1 487, 7e-136 7421 [cyanobacteria] taxid 251221 Microcystis aeruginosa 43 YP_001660322.1 486, 1e-135 NIES-843 [cyanobacteria] taxid 449447 Crocosphaera watsonii WH 44 ZP_00516920.1 486, 1e-135 8501 [cyanobacteria] taxid 165597 Microcystis aeruginosa PCC 45 emb|CAO90781.1 484, 8e-135 7806 [cyanobacteria] taxid 267872 Synechococcus sp. WH 5701 46 ZP_01085337.1 471, 4e-131 [cyanobacteria] taxid 69042 Synechococcus sp. RCC307 47 YP_001227841.1 464, 8e-129 [cyanobacteria] taxid 316278 uncultured marine type-A 48 gb|ABD96327.1 462, 2e-128 Synechococcus GOM 3O6 [cyanobacteria] taxid 364150 Synechococcus sp. WH 8102 49 NP_897828.1 462, 2e-128 [cyanobacteria] taxid 84588 Synechococcus sp. WH 7803 50 YP_001224378.1 459, 2e-127 [cyanobacteria] taxid 32051 uncultured marine type-A 51 gb|ABD96480.1 458, 3e-127 Synechococcus GOM 5D20 [cyanobacteria] taxid 364154 Synechococcus sp. WH 7805 52 ZP_01123215.1 457, 5e-127 [cyanobacteria] taxid 59931 uncultured marine type-A 53 gb|ABB92249.1 457, 8e-127 Synechococcus 5B2 [cyanobacteria] taxid 359140 Synechococcus sp. RS9917 54 ZP_01079773.1 456, 2e-126 [cyanobacteria] taxid 221360 Synechococcus sp. CC9902 55 YP_377636.1 454, 6e-126 [cyanobacteria] taxid 316279 Prochlorococcus marinus 56 NP_874926.1 453, 9e-126 subsp. marinus str. CCMP1375 [cyanobacteria] taxid 167539 Prochlorococcus marinus str. 57 NP_895058.1 453, 1e-125 MIT 9313 [cyanobacteria] taxid 74547 uncultured marine type-A 58 gb|ABD96274.1 452, 2e-125 Synechococcus GOM 3M9 [cyanobacteria] taxid 364149 uncultured marine type-A 59 gb|ABD96442.1 452, 2e-125 Synechococcus GOM 4P21 [cyanobacteria] taxid 364153 Synechococcus sp. BL107 60 ZP_01469469.1 452, 2e-125 [cyanobacteria] taxid 313625 Cyanobium sp. PCC 7001 61 YP_002597253.1 451, 4e-125 [cyanobacteria] taxid 180281 Prochlorococcus marinus str. 62 YP_001014416.1 449, 2e-124 NATL1A [cyanobacteria] taxid 167555 Prochlorococcus marinus str. 63 YP_001010913.1 447, 6e-124 MIT 9515 [cyanobacteria] taxid 167542 Synechococcus sp. CC9605 64 YP_381056.1 447, 8e-124 [cyanobacteria] taxid 110662 Prochlorococcus marinus str. 65 YP_001550421.1 446, 2e-123 MIT 9211 [cyanobacteria] taxid 93059 Prochlorococcus marinus 66 NP_892651.1 446, 2e-123 subsp. pastoris str. CCMP1986 [cyanobacteria] taxid 59919 Prochlorococcus marinus str. 67 YP_001090783.1 445, 3e-123 MIT 9301 [cyanobacteria] taxid 167546 Synechococcus sp. RS9916 68 ZP_01472595.1 445, 3e-123 [cyanobacteria] taxid 221359 Prochlorococcus marinus str. 69 YP_293055.1 445, 4e-123 NATL2A [cyanobacteria] taxid 59920 Prochlorococcus marinus str. 70 YP_002673377.1 444, 7e-123 MIT 9202 [cyanobacteria] taxid 93058 Synechococcus sp. CC9311 71 YP_731192.1 443, 1e-122 [cyanobacteria] taxid 64471 Prochlorococcus marinus str. 72 YP_001483815.1 442, 2e-122 MIT 9215 [cyanobacteria] taxid 93060 Prochlorococcus marinus str. 73 YP_001008982.1 442, 3e-122 AS9601 [cyanobacteria] taxid 146891 Synechococcus sp. JA-3-3Ab 74 YP_473896.1 441, 5e-122 [cyanobacteria] taxid 321327 Synechococcus sp. JA-2- 75 YP_478638.1 440, 8e-122 3B'a(2-13) [cyanobacteria] taxid 321332 Prochlorococcus marinus str. 76 YP_397030.1 436, 1e-120 MIT 9312 [cyanobacteria] taxid 74546

[0181] To determine the degree of similarity among homologs of the Synechococcus elongatus PCC 7942 SYNPCC7942_1593 protein, the 231 amino acid protein sequence was queried using BLAST (http://blast.ncbi.nlm.nih.gov/) against the "nr" non-redundant protein database. Homologs were taken as matching proteins whose alignments (i) covered >90% length of SYNPCC7942_1593, (ii) covered >90% of the length of the matching protein, (iii) and had >50% identity with SYNPCC7942_1593 (Table 2).

TABLE-US-00004 TABLE 2 Protein homologs of SYNPCC7942_1593 (ADM) SEQ ID BLAST Score, Organism NO: Homolog accession # E-value Synechococcus elongatus PCC 8 (SYNPCC7942_1593) n/a 7942 [cyanobacteria] Synechococcus elongatus PCC 77 YP_400610.1 475, 1e-132 7942 [cyanobacteria] taxid 1140 Synechococcus elongatus PCC 78 YP_170760.1 475, 2e-132 6301 [cyanobacteria] taxid 269084 Arthrospira maxima CS-328 79 ZP_03273549.1 378, 3e-103 [cyanobacteria] taxid 513049 Microcoleus chthonoplastes PCC 80 YP_002619869.1 376, 1e-102 7420 [cyanobacteria] taxid 118168 Lyngbya sp. PCC 8106 81 ZP_01619575.1 374, 5e-102 [cyanobacteria] taxid 313612 Nodularia spumigena CCY 9414 82 ZP_01628096.1 369, 1e-100 [cyanobacteria] taxid 313624 Microcystis aeruginosa NIES-843 83 YP_001660323.1 367, 5e-100 [cyanobacteria] taxid 449447 Microcystis aeruginosa PCC 7806 84 emb|CAO90780.1 364, 3e-99 [cyanobacteria] taxid 267872 Nostoc sp. PCC 7120 85 NP_489323.1 363, 1e-98 [cyanobacteria] taxid 103690 Anabaena variabilis ATCC 29413 86 YP_323043.1 362, 2e-98 [cyanobacteria] taxid 240292 Crocosphaera watsonii WH 8501 87 ZP_00514700.1 359, 1e-97 [cyanobacteria] taxid 165597 Trichodesmium erythraeum 88 YP_721979.1 358, 2e-97 IMS101 [cyanobacteria] taxid 203124 Synechococcus sp. PCC 7335 89 YP_002711558.1 357, 6e-97 [cyanobacteria] taxid 91464 `Nostoc azollae` 0708 90 ZP_03763673.1 355, 3e-96 [cyanobacteria] taxid 551115 Synechocystis sp. PCC 6803 91 NP_442147.1 353, 5e-96 [cyanobacteria] taxid 1148 Cyanothece sp. ATCC 51142 92 YP_001802195.1 352, 2e-95 [cyanobacteria] taxid 43989 Cyanothece sp. CCY 0110 93 ZP_01728578.1 352, 2e-95 [cyanobacteria] taxid 391612 Cyanothece sp. PCC 7425 94 YP_002481151.1 350, 7e-95 [cyanobacteria] taxid 395961 Nostoc punctiforme PCC 73102 95 YP_001865325.1 349, 1e-94 [cyanobacteria] taxid 63737 Acaryochloris marina 96 YP_001518340.1 344, 4e-93 MBIC11017 [cyanobacteria] taxid 329726 Cyanothece sp. PCC 8802 97 ZP_03142957.1 342, 1e-92 [cyanobacteria] taxid 395962 Cyanothece sp. PCC 8801 98 YP_002370707.1 342, 1e-92 [cyanobacteria] taxid 41431 Thermosynechococcus elongatus 4 NP_682103.1 332, 2e-89 BP-1 [cyanobacteria] taxid 197221 Synechococcus sp. JA-2-3B'a(2- 99 YP_478639.1 319, 1e-85 13) [cyanobacteria] taxid 321332 Synechococcus sp. RCC307 100 YP_001227842.1 319, 1e-85 [cyanobacteria] taxid 316278 Synechococcus sp. WH 7803 101 YP_001224377.1 313, 8e-84 [cyanobacteria] taxid 32051 Synechococcus sp. WH 8102 102 NP_897829.1 311, 3e-83 [cyanobacteria] taxid 84588 Synechococcus sp. WH 7805 103 ZP_01123214.1 310, 6e-83 [cyanobacteria] taxid 59931 uncultured marine type-A 104 gb|ABD96376.1 309, 1e-82 Synechococcus GOM 3O12 [cyanobacteria] taxid 364151 Synechococcus sp. JA-3-3Ab 105 YP_473897.1 309, 1e-82 [cyanobacteria] taxid 321327 uncultured marine type-A 106 gb|ABD96328.1 309, 1e-82 Synechococcus GOM 3O6 [cyanobacteria] taxid 364150 uncultured marine type-A 107 gb|ABD96275.1 308, 2e-82 Synechococcus GOM 3M9 [cyanobacteria] taxid 364149 Synechococcus sp. CC9311 108 YP_731193.1 306, 7e-82 [cyanobacteria] taxid 64471 uncultured marine type-A 109 gb|ABB92250.1 306, 9e-82 Synechococcus 5B2 [cyanobacteria] taxid 359140 Synechococcus sp. WH 5701 110 ZP_01085338.1 305, 3e-81 [cyanobacteria] taxid 69042 Gloeobacter violaceus PCC 7421 111 NP_926092.1 303, 8e-81 [cyanobacteria] taxid 251221 Synechococcus sp. RS9916 112 ZP_01472594.1 303, 9e-81 [cyanobacteria] taxid 221359 Synechococcus sp. RS9917 113 ZP_01079772.1 300, 6e-80 [cyanobacteria] taxid 221360 Synechococcus sp. CC9605 114 YP_381055.1 300, 7e-80 [cyanobacteria] taxid 110662 Prochlorococcus marinus str. MIT 115 YP_001016795.1 294, 4e-78 9303 [cyanobacteria] taxid 59922 Cyanobium sp. PCC 7001 116 YP_002597252.1 294, 6e-78 [cyanobacteria] taxid 180281 Prochlorococcus marinus str. MIT 117 NP_895059.1 291, 3e-77 9313 [cyanobacteria] taxid 74547 Synechococcus sp. CC9902 118 YP_377637.1 289, 1e-76 [cyanobacteria] taxid 316279 Prochlorococcus marinus str. MIT 119 YP_001090782.1 287, 5e-76 9301 [cyanobacteria] taxid 167546 Synechococcus sp. BL107 120 ZP_01469468.1 287, 6e-76 [cyanobacteria] taxid 313625 Prochlorococcus marinus str. 121 YP_001008981.1 286, 2e-75 AS9601 [cyanobacteria] taxid 146891 Prochlorococcus marinus str. MIT 12 YP_397029.1 282, 1e-74 9312 [cyanobacteria] taxid 74546 Prochlorococcus marinus subsp. 122 NP_892650.1 280, 9e-74 pastoris str. CCMP1986 [cyanobacteria] taxid 59919 Prochlorococcus marinus str. MIT 123 YP_001550420.1 279, 2e-73 9211 [cyanobacteria] taxid 93059 Prochlorococcus marinus str. 124 YP_293054.1 276, 9e-73 NATL2A [cyanobacteria] taxid 59920 Prochlorococcus marinus str. 125 YP_001014415.1 276, 9e-73 NATL1A [cyanobacteria] taxid 167555 Prochlorococcus marinus subsp. 126 NP_874925.1 276, 1e-72 marinus str. CCMP1375 [cyanobacteria] taxid 167539 Prochlorococcus marinus str. MIT 127 YP_001010912.1 273, 6e-72 9515 [cyanobacteria] taxid 167542 Prochlorococcus marinus str. MIT 128 YP_001483814.1 273, 9e-72 9215 [cyanobacteria] taxid 93060

[0182] The amino acid sequences referred to in the Table, as those sequences appeared in the NCBI database on Jul. 9, 2009, by accession number are incorporated by reference herein.

[0183] An AAR enzyme from Table 1, and/or an ADM enzyme from Table 2, or both can be expressed in a host cell of interest, wherein the host may be a heterologous host or the native host, i.e., the species from which the genes were originally derived. In one embodiment, the invention provides a method of imparting n-alkane synthesis capability in a heterologous organism, lacking native homologs of AAR and/or ADM, by engineering the organism to express a gene encoding one of the enzymes listed in Table 1 or Table 2. Also provided are methods of modulating n-alkane synthesis in an organism which already expresses one or both of the AAR and ADM enzymes by increasing the expression of the native enzymes, or by augmenting native gene expression by the recombinant expression of heterologous AAR and/or ADM enzymes. In addition, the invention provides methods of modulating the degree of alkane synthesis by varying certain parameters, including the identity and/or compatibility of electron donors, culture conditions, promoters for expressing AAR and/or ADM enzymes, and the like.

[0184] If the host lacks a suitable electron donor or lacks sufficient levels of a suitable electron donor to achieve production of the desired amount of n-alkane, such electron donor may also be introduced recombinantly. Guidelines for optimizing electron donors for the reaction catalyzed by the recombinant ADM proteins described herein may be summarized as follows:

[0185] 1. In cyanobacteria, electrons are shuttled from photosystem I to ferredoxin and from ferredoxin to the ADM enzyme.

[0186] 2. In bacteria that lack photosystem I, electrons can be shuttled from NADPH to ferredoxin via the action of ferredoxin-NADP+ reductase (EC 1.18.1.2) and from ferredoxin to the ADM enzyme.

[0187] 3. In bacteria that lack photosystem I, electrons can be shuttled from NADPH to flavodoxin via the action of ferredoxin-NADP+ reductase (EC 1.18.1.2) and from flavodoxin to the ADM enzyme.

[0188] 4. In bacteria that lack photosystem I, electrons can be shuttled from NADH to ferredoxin via the action of Trichomonas vaginalis NADH dehydrogenase and from ferredoxin to the ADM enzyme.

[0189] 5. In all bacteria, electrons can be shuttled from pyruvate to ferredoxin by the action of pyruvate:ferredoxin oxidoreductase (EC 1.2.7.1), and from ferredoxin to the ADM enzyme.

[0190] In addition to the in vivo production of n-alkanes discussed above, AAR and ADM proteins encoded by the genes listed in Tables 1 and 2 can be purified. When incubated in vitro with an appropriate electron donor (e.g., a ferredoxin, as discussed above), the proteins will catalyze the enzymatic synthesis of n-alkanes in vitro from appropriate starting materials (e.g., an acyl-ACP or n-alkanal).

[0191] In addition to the pathways for n-alkane synthesis described above, the invention also provides an alternative pathway, namely, acyl-CoA n-alkanal (n-1)-alkane, via the successive activities of acyl-CoA reductase (ACR) and ADM. Normally, acyl-CoA is the first intermediate in metabolic pathways of fatty acid oxidation; thus, upon import into the cell, exogenously added free fatty acids are converted to acyl-CoAs by acyl-CoA synthetase (FIG. 1B). Acyl-CoA can also be derived purely biosynthetically as follows: acyl-ACP free fatty acid acyl-CoA, via the activities of cytoplasmic acyl-ACP thioesterase (EC 3.1.2.14; an example is leader-signal-less E. coli TesA) and the endogenous and/or heterologous acyl-CoA synthetase. Thus, in one embodiment, the invention provides a method for the biosynthesis of n-alkanes via the pathway: acyl-ACP intracellular free fatty acid acyl-CoA n-alkanal (n-1)-alkane (FIG. 1D), catalyzed by the successive activities of acyl-ACP thioesterase, acyl-CoA synthetase, acyl-CoA reductase, and ADM. For example, the acyl-CoA reductase Acr1 from Acinetobacter calcoaceticus and the ADM from Synechococcus sp. PCC7942 (SYNPCC7942_1593) can be used to transform E. coli, which is cultured in the presence of exogenous free fatty acids. The free fatty acids are taken up by the cells as acyl-CoA, which are then converted to n-alkanal by Acr1, and thence to (n-1)-alkane by ADM.

Example 2

Production of n-Alkanes, n-Alkenes, and Fatty Alcohols in Escherichia coli K-12 Through Heterologous Expression of Synechococcus elongatus PCC7942 SYNPCC7942_1593 (adm) and SYNPCC7942_1594 (aar)

[0192] The natural SYNPCC7942_1593-SYNPCC7942_1594 operonic sequence was PCR-amplified from the genomic DNA of Synechococcus elongatus PCC7942 and cloned into the pAQ1 homologous recombination vector pJB5 via NdeI and EcoRI. The resulting plasmid was denoted pJB823. This construct placed the SYNPCC7942_1593-SYNPCC7942_1594 operon under the transcriptional control of the constitutive aphII promoter. The sequence of pJB823 is provided as SEQ ID NO: 15. The intracellular hydrocarbon products of E. coli K-12 EPI400.TM. (Epicentre) harboring pJB823, JCC1076, were compared to those of EPI400.TM. harboring pJB5, the control strain JCC9a, by gas chromatography-mass spectrometry (GC-MS). Clonal cultures of JCC9a and JCC1076 were grown overnight at 37.degree. C. in Luria Broth (LB) containing 2% glucose, 100 .mu.g/ml carbenicillin, 50 .mu.g/ml spectinomycin, 50 .mu.g/ml streptomycin, and 1.times. CopyCutter Induction Solution (Epicentre). For each strain, 15 ml of saturated culture was collected by centrifugation. Cell pellets were washed thoroughly by three cycles of resuspension in Milli-Q water and microcentrifugation, and then dewetted as much as possible by three cycles of microcentrifugation and aspiration. Cell pellets were then extracted by vortexing for five minutes in 0.8 ml acetone containing 100 .mu.g/ml butylated hydroxytoluene (BHT; a general antioxidant) and 100 .mu.g/ml ethyl arachidate (EA; an internal reporter of extraction efficiency). Cell debris was pelleted by centrifugation, and 700 .mu.l extractant was pipetted into a GC vial. These JCC9a and JCC1067 acetone samples, along with authentic standards, were then analyzed by GC-MS.

[0193] The gas chromatograph was an Agilent 7890A GC equipped with a 5975C electron-impact mass spectrometer. Liquid samples (1.0 .mu.l) were injected into the GC with a 7683 automatic liquid sampler equipped with a 10 .mu.l syringe. The GC inlet temperature was 290.degree. C. and split-less injection was used. The capillary column was an Agilent HP-5MS (30 m.times.0.25 mm.times.0.25 .mu.m). The carrier gas was helium at a flow rate of 1.0 ml/min. The GC oven temperature program was 50.degree. C., hold 1 min/10.degree. C. per min to 290.degree. C./hold 9 min. The GC-MS interface temperature was 290.degree. C. The MS source temperature was 230.degree. C., and the quadrapole temperature was 150.degree. C. The mass range was 25-600 amu. MS fragmentation spectra were matched against the NIST MS database, 2008 version.

[0194] Peaks present in the total-ion GC-MS chromatograms were chemically assigned in one of two ways. In the first, assignment was done by ensuring that both the retention time and the fragmentation mass spectrum corresponded to the retention time and fragmentation mass spectrum, respectively, of an authentic standard--this is referred to as "Method 1", and is essentially unambiguous. In the absence of authentic standards, only a tentative chemical assignment can be reached; this was done by collectively integrating the following data for the peak in question: (i) the structure of the fragmentation spectrum, especially with regard to the weight of the molecular ion, and to the degree to which it resembled a hydrocarbon-characteristic "envelope" mass spectrum, (ii) the retention time, especially with regard to its qualitative compatibility with the assigned compound, e.g., cis-unsaturated n-alkenes elute slightly before their saturated n-alkane counterparts, and (iii) the likelihood that the assigned compound is chemically compatible with the operation of the AAR-ADM and related pathways in the host organism in question, e.g., fatty aldehydes generated by AAR are expected to be converted to the corresponding fatty alcohols by host dehydrogenases in E. coli if they are not acted upon sufficiently quickly by ADM. This second approach to peak assignment is referred to as "Method 2". In the total-ion GC-MS chromatogram in FIG. 2, as well as in all such chromatograms in subsequent figures, peaks chemically assigned by Method 1 are labeled in regular font, whereas those assigned by Method 2 are labeled in italic font.

[0195] Total ion chromatograms (TICs) of JCC9a and JCC1076 acetone cell pellet extractants are shown in FIG. 2. The TICs of C.sub.8-C.sub.20 n-alkane authentic standards (Sigma 04070), as well as 1-tetradecanol (Sigma 185388) plus 1-hexadecanol (Sigma 258741) plus 1-octadecanol (Sigma 258768), are also shown. Hydrocarbons identified in JCC1076, but not in control strain JCC9a, are detailed in Table 3. These hydrocarbons are n-pentadecane (1), 1-tetradecanol (1), n-heptadecene (2), n-heptadecane (1), and 1-hexadecanol (1), where the number in parentheses indicates the GC-MS peak assignment method. MS fragmentation spectra of the Method 1 peaks are shown in FIG. 3, plotted against their respective library hits.

TABLE-US-00005 TABLE 3 Hydrocarbons detected by GC-MS in acetone cell pellet extractants of JCC1076 but not JCC9a, in increasing order of retention time. GC-MS Peak Candidate Compound JCC9a JCC1076 Assigment isomer n-pentadecane - + Method 1 1-tetradecanol - + Method 1 n-heptadecene - + Method 2 cis-7- (envelope- heptadecene type MS with molecular ion mass 238) n-pentadecane - + Method 1 1-hexadecanol - + Method 1 "-" not detected; "+" detected.

[0196] The formation of these five products is consistent with both the expected incomplete operation, i.e., acyl-ACP.fwdarw.fatty aldehyde.fwdarw.fatty alcohol, and expected complete operation, i.e., acyl-ACP.fwdarw.fatty aldehyde.fwdarw.alkane/alkene, of the AAR-ADM pathway in E. coli, whose major straight-chain acyl-ACPs include 12:0, 14:0, 16:0, 18:0, 16:1.DELTA.9cis, and 18:1.DELTA.11cis acyl groups (Heipieper H J (2005); Appl Environ Microbiol 71:3388). Assuming that n-heptadecene (2) is derived 18:1.DELTA.11cis-ACP, it would correspond to cis-7-heptadecene. Indeed, an n-heptadecene isomer was identified as the highest-confidence MS fragmentation library hit at that retention time, with the expected molecular ion of molecular weight 238; also, as expected, it elutes slightly before n-heptadecane.

Example 3

Production of n-Alkanes, n-Alkenes, and Fatty Alcohols in Escherichia coli B Through Heterologous Expression of Synechococcus elongatus PCC7942 SYNPCC7942_1593 (adm) and SYNPCC7942_1594 (aar)

[0197] The natural SYNPCC7942_1593-SYNPCC7942_1594 operonic sequence was excised from pJB823 using NdeI and EcoRI, and cloned into the commercial expression vector pCDFDuet.TM.-1 (Novagen) cut with via NdeI and MfeI. The resulting plasmid was denoted pJB855 (SEQ ID NO: 16). This construct placed the SYNPCC7942_1593-SYNPCC7942_1594 operon under the transcriptional control of the inducible T7lacO promoter.

[0198] The intracellular hydrocarbon products of E. coli BL21(DE3) (Novagen) harboring pJB855, JCC1113, were compared to those of E. coli BL21(DE3) harboring pCDFDuet.TM.-1, the control strain JCC114, by gas chromatography-mass spectrometry (GC-MS). Starter clonal cultures of JCC1114 and JCC1113 were grown overnight at 37.degree. C. in M9 minimal medium supplemented with 6 mg/l FeSO.sub.4.7H.sub.2O, 50 .mu.g/ml spectinomycin, and 2% glucose as carbon source; this medium is referred to M9fs. Each starter culture was used to inoculate a 32 ml culture of M9fs at an initial OD.sub.600 of 0.1. Inoculated cultures were grown at 37.degree. C. at 300 rpm until an OD.sub.600 of 0.4 has been reached, at which point IPTG was added to a final concentration of 1 mM. After addition of inducer, cultures were grown under the same conditions for an additional 17 hours. For each strain, 12 ml of saturated culture was then collected by centrifugation. Cell pellets were washed thoroughly by 3 cycles of resuspension in Milli-Q water and microcentrifugation, and then dewetted as much as possible by 3 cycles of microcentrifugation and aspiration. Cell pellets were then extracted by vortexing for 5 minutes in 0.7 ml acetone containing 20 .mu.g/ml BHT and 20 .mu.g/ml EA. Cell debris was pelleted by centrifugation, and 600 .mu.l supernatant was pipetted into a GC vial. These JCC1114 and JCC1113 samples, along with authentic standards, were then analyzed by GC-MS as described in Example 2. The TICs of JCC1114 and JCC1113 acetone cell pellet extractants are shown in FIG. 4; n-alkane and 1-alkanol standards are as in Example 2. Hydrocarbons identified in JCC1113, but not in control strain JCC1114, are detailed in Table 4.

TABLE-US-00006 TABLE 4 Hydrocarbons detected by GC-MS in acetone cell pellet extractants of JCC1113 but not JCC1114 in increasing order of retention time. GC-MS Peak Candidate Compound JCC1114 JCC1113 Assigment isomer n-tridecane - + Method 1 n-tetradecane - + Method 1 n-pentadecene - + Method 2 cis-7- (envelope- pentadecene type MS with molecular ion mass 210) 1-dodecanol - + Method 2 n-pentadecane - + Method 1 n-hexadecene - + Method 2 cis-8- (envelope- hexadecene type MS with molecular ion mass 224) n-hexadecane - + Method 1 1-tetradecanol - + Method 1 n-heptadecene - + Method 2 cis-7- (envelope- heptadecene type MS with molecular ion mass 238) n-heptadecane - + Method 1 1-pentadecanol - + Method 2 1-hexadecenol - + Method 2 cis-9- hexadecen-1-ol 1-hexadecanol - + Method 1 1-octadecenol - + Method 2 cis-11- (envelope- octadecen-1-ol type MS with molecular ion mass 250) "-" not detected; "+" detected.

[0199] These hydrocarbons are n-tridecane (1), n-tetradecane (1), n-pentadecene (2), 1-dodecanol (2), n-pentadecane (1), n-hexadecene (2), n-hexadecane (1), 1-tetradecanol (1), n-heptadecene (2), n-heptadecane (1), 1-pentadecanol (2), 1-hexadecenol (2), 1-hexadecanol (1), and 1-octadecenol (2), where the number in parentheses indicates the GC-MS peak assignment method. MS fragmentation spectra of Method 1 peaks are shown in FIG. 5, plotted against their respective library hits. The major products were n-pentadecane and n-heptadecene.

[0200] The formation of these fourteen products is consistent with both the expected incomplete operation, i.e., acyl-ACP.fwdarw.fatty aldehyde.fwdarw.fatty alcohol, and expected complete operation, i.e., acyl-ACP.fwdarw.fatty aldehyde.fwdarw.alkane/alkene, of the Aar-Adm pathway in E. coli, whose major straight-chain acyl-ACPs include 12:0, 14:0, 16:0, 18:0, 16:1.DELTA.9cis, and 18:1.DELTA.11cis acyl groups (Heipieper H J (2005). Adaptation of Escherichia coli to Ethanol on the Level of Membrane Fatty Acid Composition. Appl Environ Microbiol 71:3388). Assuming that n-pentadecene (2) is derived 16:1.DELTA.9cis-ACP, it would correspond to cis-7-pentadecene. Indeed, an n-pentadecene isomer was identified as the highest-confidence MS fragmentation library hit at that retention time, with the expected molecular ion of molecular weight 210; also, as expected, it elutes slightly before n-pentadecane. With respect to 1-dodecanol (2), a sufficiently clean fragmentation spectrum could not be obtained for that peak due to the overlapping, much larger n-pentadecane (1) peak. Its presence, however, is consistent with the existence of 12:0-ACP in E. coli, and its retention time is exactly that extrapolated from the relationship between 1-alkanol carbon number and observed retention time, for the 1-tetradecanol, 1-hexadecanol, and 1-octadecanol authentic standards that were run. Assuming that n-hexadecene (2) is derived from the trace-level unsaturated 17:1.DELTA.9cis acyl group expected in the E. coli acyl-ACP population due to rare acyl chain initiation with propionyl-CoA as opposed to malonyl-CoA, it would correspond to cis-8-hexadecene. Indeed, an n-hexadecene isomer was identified as the highest-confidence MS fragmentation library hit at that retention time, with the expected molecular ion of molecular weight 224; also, as expected, it elutes slightly before n-hexadecane. Assuming that n-heptadecene (2) is derived 18:1.DELTA.11cis-ACP, it would correspond to cis-7-heptadecene. Indeed, an n-heptadecene isomer was identified as the highest-confidence MS fragmentation library hit at that retention time, with the expected molecular ion of molecular weight 238; also, as expected, it elutes slightly before n-heptadecane. With respect to 1-pentadecanol (2), a sufficiently clean fragmentation spectrum could not be obtained for that peak due to its low abundance. Its presence, however, is consistent with the existence of trace-level 15:0 acyl group expected in the E. coli acyl-ACP population due to rare acyl chain initiation with propionyl-CoA as opposed to malonyl-CoA, and its retention time is exactly that interpolated from the relationship between 1-alkanol carbon number and observed retention time, for the 1-tetradecanol, 1-hexadecanol, and 1-octadecanol authentic standards that were run. In addition, 1-pentadecanol was identified as the highest-confidence MS fragmentation library hit at that retention time in acetone extracts of JCC1170, a BL21(DE3) derivative that expresses Aar without Adm (see Example 4). With respect to 1-hexadecenol (2), a sufficiently clean fragmentation spectrum could not be obtained for that peak due to its low abundance; however, assuming that it is derived 16:1.DELTA.9cis-ACP, it would correspond to cis-9-hexadecen-1-ol. Also, as expected, it elutes slightly before 1-hexadecanol. Finally, assuming that n-octadecenol (2) is derived 18:1149cis-ACP, it would correspond to cis-11-octadecen-1-ol. Indeed, an n-octadecen-1-ol isomer was identified as the highest-confidence MS fragmentation library hit at that retention time, with the expected molecular ion of molecular weight 250; also, as expected, it elutes slightly before 1-octadecanol.

Example 4

Production of Fatty Alcohols in Escherichia coli B Through Heterologous Expression of Synechococcus elongatus SYNPCC7942_1594 (aar) without Co-Expression of SYNPCC7942_1593 (adm)

[0201] In order to test the hypothesis that both AAR and ADM are required for alkane biosynthesis, as well as the prediction that expression of AAR alone should result in the production of fatty alcohols only in E. coli (due to non-specific dehydrogenation of the fatty aldehydes generated), expression constructs containing just SYNPCC7942_1593 (ADM) and just SYNPCC7942_1594 (AAR), were created. Accordingly, the SYNPCC7942_1593 and SYNPCC7942_1594 coding sequences were individually PCR-amplified and cloned via NdeI and MfeI into the commercial expression vector pCDFDuet.TM.-1 (Novagen). The resulting plasmids were denoted pJB881 (SYNPCC7942_1593 only) and pJB882 (SYNPCC7942_1594 only); in each construct, the coding sequence was placed under the transcriptional control of the inducible T7lacO promoter.

[0202] The intracellular hydrocarbon products of E. coli BL21(DE3) (Novagen) harboring pJB881, JCC1169, and of E. coli BL21(DE3) (Novagen) harboring pJB882, JCC1170, were compared to those of E. coli BL21(DE3) harboring pCDFDuet.TM.-1, the negative control strain JCC114, as well as to the positive control SYNPCC7942_1593-SYNPCC7942_1594 strain JCC1113 (Example 3), by gas chromatography-mass spectrometry (GC-MS). Clonal cultures of JCC1169, JCC1170, JCC1114, and JCC1113 were grown, extracted, and analyzed by GC-MS as described in Example 3, with the following exception: the JCC1170 culture was grown overnight in M9fs medium without IPTG, because the culture did not grow if IPTG was added. Presumably, this was due to the toxic over-accumulation of fatty alcohols that occurred even in the absence of inducer.

[0203] The TICs of JCC1169, JCC1170, JCC1114, and JCC1113 acetone cell pellet extractants are shown in FIG. 6; n-alkane and 1-alkanol standard traces have been omitted. Hydrocarbons identified in JCC1170, but not in control strain JCC1114, are detailed in Table 5.

TABLE-US-00007 TABLE 5 Hydrocarbons detected by GC-MS in acetone cell pellet extractants of JCC1170 but not JCC1114 in increasing order of retention time. GC-MS Peak Candidate Compound JCC1114 JCC1170 Assigment isomer 1-tetradecanol - + Method 1 1-pentadecanol - + Method 2 (envelope- type MS with molecular ion mass 182) 1-hexadecenol - + Method 2 cis-9- (envelope- hexadecen-1-ol type MS with molecular ion mass 222) 1-hexadecanol - + Method 1 1-octadecenol - + Method 2 cis-11- (envelope- octadecen-1-ol type MS with molecular ion mass 250) "-" not detected; "+" detected.

[0204] These hydrocarbons are 1-tetradecanol (1), 1-pentadecanol (2), 1-hexadecenol (2), 1-hexadecanol (1), and 1-ocadecenol (2), where the number in parentheses indicates the GC-MS peak assignment method. MS fragmentation spectra of Method 1 peaks are shown in FIG. 7, plotted against their respective library hits. No hydrocarbons were identified in JCC1169, whose trace was indistinguishable from that of JCC1114, as expected owing to absence of fatty aldehyde substrate generation by AAR.

[0205] The lack of production of alkanes, alkenes, and fatty alkanols in JCC1169, the production of only fatty alcohols in JCC1170, and the production of alkanes, alkenes, and fatty alkanols in JCC1113 (as discussed in Example 3) are all consistent with the proposed mechanism of alkane biosynthesis by AAR and ADM in E. coli. Thus, the formation of the five fatty alcohols in JCC1170 is consistent with only AAR being active, and active on the known straight-chain acyl-ACPs (see Example 3). With respect to 1-pentadecanol (2), its presence is consistent with the existence of trace-level 15:0 acyl group expected in the E. coli acyl-ACP population due to rare acyl chain initiation with propionyl-CoA as opposed to malonyl-CoA and its retention time is exactly that interpolated from the relationship between 1-alkanol carbon number and observed retention time, for the 1-tetradecanol, 1-hexadecanol, and 1-octadecanol authentic standards that were run. Most importantly, the 1-pentadecanol (2) peak exhibits an envelope-type fragmentation mass spectrum, with the expected molecular ion of molecular weight 182. Unlike in the case of JCC1113, a clean fragmentation spectrum from the candidate 1-hexadecenol peak could now be obtained due to increased abundance. The top library hit was a 1-hexadecenol with the expected molecular ion of molecular weight 222. Assuming that it is derived from 16:1.DELTA.9cis hexadecenyl-ACP, the isomeric assignment would be cis-9-hexadecen-1-ol; also, as expected, it elutes slightly before 1-hexadecanol. Assuming that n-octadecenol (2) is derived 18:1149cis-ACP, it would correspond to cis-11-octadecen-1-ol. Indeed, an n-octadecen-1-ol isomer was identified as the highest-confidence MS fragmentation library hit at that retention time, with the expected molecular ion of molecular weight 250; also, as expected, it elutes slightly before 1-octadecanol. There is also an unidentified side peak in JCC1170 that elutes in the tail of 1-hexadecenol and whose fragmentation mass spectrum was not sufficiently clean to enable possible identification. It is hypothesized that this could be the primary C.sub.18 aldehyde product expected of AAR-only activity in E. coli, i.e., cis-11-octadecenal.

Example 5

Production of n-Alkanes, n-Alkenes, and Fatty Alcohol in Synechococcus sp. PCC 7002 Through Heterologous Expression of Synechococcus elongatus PCC7942 SYNPCC7942_1593 (adm) and SYNPCC7942_1594 (aar)

[0206] In order to test whether heterologous expression of AAR and ADM would lead to the desired alkane biosynthesis in a cyanobacterial host, the SYNPCC7942_1593-SYNPCC7942_1594 operon was expressed in Synechococcus sp. PCC 7002 (JCC138). Accordingly, plasmid pJB823 was transformed into JCC138, generating strain JCC1160. The sequence and annotation of this plasmid is provided as SEQ ID NO: 15, and described in Example 2. In this construct, the SYNPCC7942_1593-SYNPCC7942_1594 operon is placed under the transcriptional control of the constitutive aphII promoter. 500 base pair upstream and downstream homology regions direct homologous recombinational integration into the native high-copy pAQ1 plasmid of JCC138, and an aadA gene permits selection of transformants by virtue of their resistance to spectinomycin.

[0207] To test the effect of potentially stronger promoters, constructs directly analogous to pJB823 were also generated that substituted the aphII promoter with the following: the promoter of cro from lambda phage (PcI), the promoter of cpcB from Synechocystis sp. PCC 6803 (PcpcB), the trc promoter along with an upstream copy of a promoter-lacI cassette (PlacI-trc), the synthetic EM7 promoter (PEM7). Promoters were exchanged via the NotI and NdeI sites flanking the promoter upstream of the SYNPCC7942_1593-SYNPCC7942_1594 operon in the pJB823 vector. The corresponding final plasmids were as follows: pJB886 (PcI), pJB887 (PcpcB), pJB889 (PlacI-trc), pJB888 (PEM7), and pJB823 (PaphII). These sequences of pJB886, pJB887, pJB889, and pJB888 are identical to the sequence of pJB823 except in the region between the NotI and NdeI sites, where they differ according to the promoter used. The sequences of the different promoter regions are provided as SEQ ID NO: 19 (PcI), SEQ ID NO: 20 (PcpcB), SEQ ID NO: 21 (PlacI-trc), and SEQ ID NO: 22 (PEM7). The sequence of the PaphII promoter is presented in SEQ ID NO: 15.

[0208] pJB886, pJB887, pJB889, pJB888, pJB823, as well as pJB5 (the empty pAQ1 targeting vector that entirely lacked the SYNPCC7942_1593-SYNPCC7942_1594 operonic sequence) were naturally transformed into JCC138 using a standard cyanobacterial transformation protocol, generating strains JCC1221 (PcI), JCC1220 (PcpcB), JCC1160b (PlacI-trc), JCC1160a (PEM7), JCC1160 (PaphII), and JCC879 (pJB5), respectively. Briefly, 5-10 .mu.g of plasmid DNA was added to 1 ml of neat JCC138 culture that had been grown to an OD.sub.730 of approximately 1.0. The cell-DNA mixture was incubated at 37.degree. C. for 4 hours in the dark with gentle mixing, plated onto A+ plates, and incubated in a photoincubator (Percival) for 24 hours, at which point spectinomycin was underlaid to a final concentration of 50 .mu.g/ml. Spectinomycin-resistant colonies appeared after 5-8 days of further incubation under 24 hr-light conditions (.about.100 .mu.mol photons m.sup.-2s.sup.-1). Following one round of colony purification on A+ plates supplemented with 100 .mu.g/ml spectinomycin, single colonies of each of the six transformed strains were grown in test-tubes for 4-8 days at 37.degree. C. at 150 rpm in 3% CO.sub.2-enriched air at .about.100 .mu.mol photons m.sup.-2s.sup.-1 in a Multitron II (Infors) shaking photoincubator. The growth medium used for liquid culture was A+ with 200 .mu.g/ml spectinomycin.

[0209] In order to compare the intracellular hydrocarbon products of strains JCC1221, JCC1220, JCC1160b, JCC1160a, JCC1160, and JCC879, 24 OD.sub.730-ml worth of cells (.about.2.4.times.10.sup.9 cells) of each strain was collected from the aforementioned test-tube cultures by centrifugation. Cell pellets were washed thoroughly by 3 cycles of resuspension in Milli-Q water and microcentrifugation, and then dewetted as much as possible by 3 cycles of microcentrifugation and aspiration. Cell pellets were then extracted by vortexing for 5 minutes in 0.7 ml acetone containing 20 .mu.g/ml BHT and 20 .mu.g/ml EA. Cell debris was pelleted by centrifugation, and 600 .mu.l supernatant was pipetted into a GC vial. The six extractants, along with authentic standards, were then analyzed by GC-MS as described in Example 2.

[0210] The TICs of JCC1221, JCC1220, JCC1160b, JCC1160a, JCC1160, and JCC879 acetone cell pellet extractants are shown in FIG. 8; n-alkane and 1-alkanol standards are as in Example 2. Consistent with a range of promoter strengths, and with function of the AAR-ADM pathway, there was a range of hydrocarbon accumulation, the order of accumulation being PcI>PcpcB>PlacI-trc>PEM7>PaphII (FIG. 8A).

[0211] In JCC1160, approximately 0.2% of dry cell weight was found as n-alkanes and n-alkan-1-ol (excluding n-nonadec-1-ene). Of this 0.2%, approximately three-quarters corresponded to n-alkanes, primary products being n-heptadecane and n-pentadecane. These hydrocarbons were not detected in JCC879. The data are summarized in Table 6A.

TABLE-US-00008 TABLE 6A Hydrocarbons detected in acetone extracts of JCC1160 and JCC879. Approximate % of dry cell weight Compound JCC879 JCC1160 n-pentadecane not detected 0.024% n-hexadecane nd 0.004% n-heptadecane nd 0.110% n-octadecan-1-ol nd 0.043% Total 0.181% % of products that are n-alkanes 76%

[0212] The highest accumulator was JCC1221 (PO. Hydrocarbons identified in JCC1221, but not in control strain JCC879, are detailed in Table 6B, Table 6C and FIG. 8B. These hydrocarbons are n-tridecane (1), n-tetradecane (1), n-pentadecene (2), n-pentadecane (1), n-hexadecane (1), n-heptadec-di-ene (2), three isomers of n-heptadecene (2), n-heptadecane (1), and 1-ocadecanol (1), where the number in parentheses indicates the GC-MS peak assignment method.

TABLE-US-00009 TABLE 6B n-Alkanes quantitated in acetone extract of JCC1221 Compound % of JCC1221 dry cell weight n-tridecane <0.001% n-tetradecane 0.0064% n-pentadecane 0.40% n-hexadecane 0.040% n-heptadecane 1.2% Total 1.67%

[0213] MS fragmentation spectra of Method 1 peaks are shown in FIG. 9, plotted against their respective library hits. The only alkanes/alkenes observed in JCC879 were 1-nonadecene and a smaller amount of nonadec-di-ene, alkenes that are known to be naturally synthesized by JCC138 (Winters K et al. (1969) Science 163:467-468). The major products observed in JCC1221 were n-pentadecane (.about.25%) and n-heptadecane (.about.75%); all others were in relatively trace levels.

[0214] The formation of n-pentadecane and n-heptadecane in JCC1221, as well as the nine other trace hydrocarbon products, is consistent with the virtually complete operation of the ADM-AAR pathway in JCC138, i.e., 16:0 hexadecyl-ACP.fwdarw.n-hexadecanal.fwdarw.n-pentadecane and 18:0 octadecyl-ACP.fwdarw.n-octadecanal.fwdarw.n-heptadecane. Indeed it is known that the major acyl-ACP species in this organism are C.sub.16:0 and C.sub.18:0 (Murata N et al. (1992) Plant Cell Physiol 33:933-941). Relatively much less fatty alcohol is produced relative to AAR-ADM expression in E. coli (Example 3), as expected given the presence in JCC138 of a cyanobacterial ferredoxin/ferredoxin-NADPH reductase system that can regenerate the di-iron active site of ADM, thereby preventing the accumulation of hexadecanal and octadecanal that could in turn be non-specifically dehydrogenated to the corresponding 1-alkanols. Thus, in JCC1221, only a very small 1-octadecanol (1) peak is observed (FIG. 8).

[0215] The other trace hydrocarbons seen in JCC1221 are believed to be unsaturated isomers of n-pentadecane and n-heptadecane (Table 6C). It is hypothesized that all these alkenes are generated by desaturation events following the production of the corresponding alkanes by the SYNPCC7942_1593 Adm. This contrasts with the situation in E. coli, where double bonds are introduced into the growing acyl chain while it is linked to the acyl carrier protein (Example 3). JCC138 is known to have a variety of position-specific acyl-lipid desaturases that, while nominally active only on fatty acids esterified to glycerolipids, could potentially act on otherwise unreactive alkanes produced nonphysiologically by the action of AAR and ADM. JCC138 desaturases, i.e., DesA, DesB, and DesC, introduce cis double bonds at the 49, 412, and 415 positions of C.sub.18 acyl chains, and at the 49 and 412 positions of C.sub.16 acyl chains (Murata N and Wada H (1995) Biochem J. 308:1-8). The candidate n-pentadecene peak is believed to be cis-4-pentadecene (Table 6C).

[0216] Assuming also that heptadecane could also serve as a substrate for JCC138 desaturases, and that it would be desaturated at positions analogous to the 49, 412, and 415 of the C.sub.18 acyl moiety, there are four theoretically possible mono-unsaturated isomers: cis-3-heptadecene, cis-6-heptadecene, cis-8-heptadecene, and cis-9-heptadecene. These isomers do not include the single n-heptadecene species nominally observed in E. coli, cis-7-heptadecene (Example 2). It is believed that the three peaks closest to the n-heptadecane peak--denoted by subscripts 1, 2, and 3 in Table 6C and FIG. 8B--encompass at least three of these four mono-unsaturated heptadecane isomers. Consistent with this, n-heptadecene.sub.2 and n-heptadecene.sub.3 peaks have the expected molecular ions of mass 238 in their envelope-type fragmentation spectra. There are many isomeric possibilities, accordingly, for the putative cis,cis-heptadec-di-ene peak, which has an envelope-type fragmentation spectrum with the expected molecular ions of mass 236. As expected, all putative heptadecene species elute slightly before n-heptadecane.

TABLE-US-00010 TABLE 6C Alkane and alkenes detected by GC-MS in acetone cell pellet extractants of JCC1221 but not JCC879 in increasing order of retention time. GC-MS Peak Candidate Compound JCC879 JCC1221 Assigment isomer n-tridecane - + Method 1 n-tetradecane - + Method 1 n-pentadecene - + Method 2 cis-4- pentadecene n-pentadecane - + Method 1 n-hexadecane - + Method 1 n-heptadec-di-ene - + Method 2 cis,cis- (envelope- heptadec-di-ene type MS with molecular ion mass 236) n-heptadecene.sub.3 - + Method 2 cis-[3/6/8/9]- (envelope- heptadecene type MS with molecular ion mass 238) n-heptadecene.sub.2 - + Method 2 cis-[3/6/8/9]- (envelope- heptadecene type MS with molecular ion mass 238) n-heptadecene.sub.1 - + Method 2 cis-[3/6/8/9]- heptadecene n-heptadecane - + Method 1 1-octadecanol - + Method 1 "-", not detected; "+", detected.

Example 6

Intracellular Accumulation of n-Alkanes to Up to 5% of Dry Cell Weight in Synechococcus sp. PCC 7002 Through Heterologous Expression of Synechococcus elongatus PCC7942 SYNPCC7942_1593 (adm) and SYNPCC7942_1594 (aar)

[0217] In order to quantitate more accurately the level of intracellular accumulation of n-alkane products in the alkanogen JCC1221 (Example 5), the levels of n-pentadecane and n-heptadecane, as well as the relatively trace products n-tetradecane and n-hexadecane, were quantified with respect to dry cell weight (DCW). Based on the hypothesis that the extent of n-alkane production could correlate positively with the level of SYNPCC7942_1593-SYNPCC7942_1594 operon expression, the DCW-normalized n-alkane levels of JCC1221 were determined as a function of the spectinomycin concentration of the growth medium. The rationale was that the higher the spectinomycin selective pressure, the higher the relative copy number of pAQ1, and the more copies of the aadA-linked SYNPCC7942_1593-SYNPCC7942_1594 operon.

[0218] A clonal starter culture of JCC1221 was grown up in A+ medium supplemented with 100 .mu.g/ml spectinomycin in for 7 days at 37.degree. C. at 150 rpm in 3% CO.sub.2-enriched air at .about.100 .mu.mol photons m.sup.-2s.sup.-1 in a Multitron II (Infors) shaking photoincubator. At this point, this culture was used to inoculate triplicate 30 ml JB2.1 medium (PCT/US2009/006516) flask cultures supplemented with 100, 200, 300, 400, or 600 .mu.g/ml spectinomycin. JB2.1 medium consists of 18.0 g/l sodium chloride, 5.0 g/l magnesium sulfate heptahydrate, 4.0 g/l sodium nitrate, 1.0 g/l Tris, 0.6 g/l potassium chloride, 0.3 g/l calcium chloride (anhydrous), 0.2 g/l potassium phosphate monobasic, 34.3 mg/l boric acid, 29.4 mg/l EDTA (disodium salt dihydrate), 14.1 mg/l iron (III) citrate hydrate, 4.3 mg/l manganese chloride tetrahydrate, 315.0 .mu.g/l zinc chloride, 30.0 .mu.g/1 molybdenum (VI) oxide, 12.2 .mu.g/1 cobalt (II) chloride hexahydrate, 10.0 .mu.g/1 vitamin B.sub.12, and 3.0 .mu.g/l copper (II) sulfate pentahydrate. The 15 cultures were grown for 10 days at 37.degree. C. at 150 rpm in 3% CO.sub.2-enriched air at .about.100 .mu.mol photons m.sup.-2s.sup.-1 in a Multitron II (Infors) shaking photoincubator.

[0219] For each culture, 5-10 ml was used for dry cell weight determination. To do so, a defined volume of culture--corresponding to approximately 20 mg DCW--was centrifuged to pellet the cells. Cells were transferred to a pre-weighed eppendorf tube, and then washed by 2 cycles of resuspension in Milli-Q water and microcentrifugation, and dewetted by 3 cycles of microcentrifugation and aspiration. Wet cell pellets were frozen at -80.degree. C. for two hours and then lyophilized overnight, at which point the tube containing the dry cell mass was weighed again such that the mass of the cell pellet could be calculated within .+-.0.1 mg. In addition, for each culture, 0.3-0.8 ml was used for acetone extraction of the cell pellet for GC analysis. To do so, a defined volume of culture--corresponding to approximately 1.4 mg DCW--was microcentrifuged to pellet the cells. Cells were then washed by 2 cycles of resuspension in Milli-Q water and microcentrifugation, and then dewetted by 4 cycles of microcentrifugation and aspiration. Dewetted cell pellets were then extracted by vortexing for 1 minute in 1.0 ml acetone containing 50 .mu.g/ml BHT and 160 .mu.g/ml n-heptacosane internal standard (Sigma 51559). Cell debris was pelleted by centrifugation, and 700 .mu.l supernatant was pipetted into a GC vial.

[0220] Concentrations of n-tetradecane, n-pentadecane, n-hexadecane, and n-heptadecane in the fifteen extractants were quantitated by gas chromatography/flame ionization detection (GC/FID). Unknown n-alkane peak areas in biological samples were converted to concentrations via linear calibration relationships determined between known n-tetradecane, n-pentadecane, n-hexadecane, and n-heptadecane authentic standard concentrations and their corresponding GC-FID peak areas. Standards were obtained from Sigma. GC-FID conditions were as follows. An Agilent 7890A GC/FID equipped with a 7683 series autosampler was used. 1 .mu.l of each sample was injected into the GC inlet (split 5:1, pressure: 20 psi, pulse time: 0.3 min, purge time: 0.2 min, purge flow: 15 ml/min) and an inlet temperature of 280.degree. C. The column was a HP-5M5 (Agilent, 30 m.times.0.25 mm.times.0.25 .mu.m) and the carrier gas was helium at a flow of 1.0 ml/min. The GC oven temperature program was 50.degree. C., hold one minute; 10.degree. C./min increase to 280.degree. C.; hold ten minutes. n-Alkane production was calculated as a percentage of the DCW extracted in acetone.

[0221] Consistent with scaling between pAQ1 selective pressure and the extent of intracellular n-alkane production in JCC1221, there was a roughly positive relationship between the % n-alkanes with respect to DCW and spectinomycin concentration (FIG. 10). For all JCC1221 cultures, n-alkanes were .about.25% n-pentadecane and .about.75% n-heptadecane. The minimum n-alkane production was .about.1.8% of DCW at 100 .mu.g/ml spectinomycin and 5.0% in one of the 600 .mu.g/ml spectinomycin cultures.

Example 7

Production of n-Alkanes in Synechococcus sp. PCC 7002 Through Heterologous Expression of Prochlorococcus marinus MIT 9312 PMT9312_0532 (adm) and PMT9312_0533 (aar)

[0222] This candidate Adm/Aar pair from Prochlorococcus marinus MIT9312 was selected for functional testing by heterologous expression in JCC138 because of the relatively low amino acid homology (62%) of these proteins to their Synechococcus elongatus PCC7942 counterparts, SYNPCC7942_1593 and SYNPCC7942_1594. Specifically, the 252-amino acid protein PMT9312_0532 exhibits only 62% amino acid identity with the 232 amino acid protein SYNPCC7942_1593, wherein amino acids 33-246 of the former are aligned with amino acids 11-224 of the latter. The 347 amino acid protein PMT9312_0533 exhibits only 61% amino acid identity with the 342 amino acid protein SYNPCC7942_1594, wherein amino acids 1-337 of the former are aligned with amino acids 1-339 of the latter.

[0223] A codon- and restriction-site-optimized version of the PMT9312_0532-PMT9312_0533 operon was synthesized by DNA2.0 (Menlo Park, Calif.), flanked by NdeI and EcoRI sites. The operon was cloned into the pAQ1 homologous recombination vector pJB5 via NdeI and EcoRI, such that the PMT9312_0532-PMT9312_0533 operon was placed under transcriptional control of the aphII promoter. The sequence of the pJB947 vector is provided as SEQ ID NO: 17.

[0224] pJB947 was transformed into JCC138 as described in Example 5, generating strain JCC1281. The hydrocarbon products of this strain were compared to those of the negative control strain JCC879, corresponding to JCC138 transformed with empty pJB5 (see Example 5). Eight OD.sub.730-ml worth of cells (.about.8.times.10.sup.8 cells) of each strain was collected by centrifugation, having been grown in A+ medium supplemented with 200 .mu.g/ml spectinomycin as described in Example 5. Cell pellets were washed thoroughly by 3 cycles of resuspension in Milli-Q water and microcentrifugation, and then dewetted as much as possible by 3 cycles of microcentrifugation and aspiration. Cell pellets were then extracted by vortexing for 5 minutes in 0.7 ml acetone containing 20 .mu.g/ml BHT and 20 .mu.g/ml EA. Cell debris was pelleted by centrifugation, and 600 .mu.l supernatant was pipetted into a GC vial. Samples were analyzed by GC-MS as described in Example 5.

[0225] The TICs of JCC1281 and JCC879 acetone cell pellet extractants are shown in FIG. 11; n-alkane standards are as in Example 6. Hydrocarbons identified in JCC1281, but not in control strain JCC879, were n-pentadecane (1) and n-heptadecane (1), where the number in parentheses indicates the GC-MS peak assignment method. MS fragmentation spectra of Method 1 peaks are shown in FIG. 12, plotted against their respective library hits (as noted in Example 5, the only alkanes/alkenes observed in JCC879 were 1-nonadecene and a smaller amount of nonadec-di-ene, alkenes that are known to be naturally synthesized by JCC138). The amount of n-alkanes produced in JCC1281 is at least 0.1% dry cell weight, and at least 2-two times higher than the amount produced by JCC879. The ratio of n-pentadecane:n-heptadecane (.about.40%:.about.60%) in JCC1281 was higher than that observed in JCC1221 (.about.25%:.about.75%), suggesting that the PMT9312_0532 (ADM) and/or the PMT9312_0533 (AAR) exhibit higher activity towards the C.sub.16 substrates relative to C.sub.18 substrates, compared to SYNPCC7942_1593 (ADM) and/or SYNPCC7942_1594 (AAR).

Example 8

Augmentation of Native n-Alkane Production in Thermosynechococcus elongatus BP-1 by Overexpression of the Native Tll1313 (adm)-Tll1312 (aar) Operon

[0226] Genes encoding Thermosynechococcus elongatus BP-1 tll1312 (AAR) and tll1313 (ADM) are incorporated into one or more plasmids (e.g., pJB5 derivatives), comprising promoters of differing strength. The plasmids are used to transform Thermosynechococcus elongatus BP-1. Overexpression of the genes in the transformed cells are measured as will the amount of n-alkanes, particularly heptadecane, produced by the transformed cells, in a manner similar to that described in Example 3. The n-alkanes and other carbon-based products of interest can also be isolated from the cell or cell culture, as needed.

[0227] Wild-type Thermosynechococcus elongatus BP-1, referred to as JCC3, naturally produces n-heptadecane as the major intracellular hydrocarbon product, with traces of n-hexadecane and n-pentadecane. These n-alkanes were identified by GC-MS using Method 1; fragmentation spectra are shown in FIG. 13. Briefly, a colony of JCC3 was grown in B-HEPES medium to a final OD.sub.730 of .about.4, at which point 5 OD.sub.730-ml worth of cells was harvested, extracted in acetone, and analyzed by GC-MS as detailed in Example 5.

[0228] In an effort to augment this n-alkane production, the native 11113134111312 operonic sequence from this organism was PCR-amplified and cloned into the Thermosynechococcus elongatus BP-1 chromosomal integration vector pJB825. This construct places the 1111313-1111312 operon under the transcriptional control of the constitutive cI promoter. The sequence of the resulting plasmid, pJB825t, is shown in SEQ ID NO:18.

[0229] pJB825 and pJB825t were naturally transformed into JCC3 using a standard cyanobacterial transformation protocol, generating strains JCC1084 and JCC1084t, respectively. Briefly, 25 .mu.g of plasmid DNA was added to 0.5 ml of concentrated JCC3 culture (OD.sub.730.about.100) that had originally been grown to an OD.sub.730 of approximately 1.0 in B-HEPES at 45.degree. C. in 3% CO.sub.2-enriched air at .about.100 .mu.mol photons m.sup.-2s.sup.-1 in a Multitron II (Infors) shaking photoincubator. The cell-DNA mixture was incubated at 37.degree. C. for 4 hours in the dark with gentle mixing, made up to 7 ml with fresh B-HEPES medium, and then incubated under continuous light conditions (.about.100 .mu.mol photons m.sup.-2s.sup.-1) for 20 hours at 45.degree. C. at 150 rpm in 3% CO.sub.2-enriched air at .about.100 .mu.mol photons m.sup.-2s.sup.-1 in a Multitron II (Infors) shaking photoincubator. At this point, cells were collected by centrifugation and serial dilutions were mixed with molten top agar and plated on the surface of B-HEPES plates supplemented with 60 .mu.g/ml kanamycin. Transformant colonies appeared in the top agar layer within around 7 days upon incubation in a photoincubator (Percival) in 1% CO.sub.2-enriched air at continuous .about.100 .mu.mol photons m.sup.-2s.sup.-1 irradiance. Single colonies of JCC1084 and JCC1084t were then grown up in triplicate to an OD.sub.730 of .about.6 in B-HEPES/60 .mu.g/ml kanamycin liquid culture, and their intracellular hydrocarbon products quantitated by GC-FID.

[0230] 3.5 OD.sub.730-ml worth of cells (.about.3.5.times.10.sup.8 cells) of each replicate culture of each strain was collected by centrifugation. Cell pellets were washed thoroughly by 3 cycles of resuspension in Milli-Q water and microcentrifugation, and then dewetted as much as possible by 3 cycles of microcentrifugation and aspiration. Cell pellets were then extracted by vortexing for 1 minutes in 0.7 ml acetone containing 20 .mu.g/ml BHT and 20 .mu.g/ml n-heptacosane. Cell debris was pelleted by centrifugation, and 600 .mu.l supernatant was pipetted into a GC vial. The two extractants, along with authentic C.sub.8-C.sub.20n-alkane authentic standards (Sigma 04070), were then analyzed by GC coupled with flame ionization detection (FID) as described in Example 6. Quantitation of n-pentadecane, n-hexadecane, and n-heptadecane by GC-FID, and dry cell weights were taken as described in Example 6.

[0231] Consistent with increased expression of tll1313-tll1312 in JCC1084t relative to the control strain JCC1084, n-pentadecane, n-hexadecane, and n-heptadecane were .about.500%, .about.100%, and .about.100% higher, respectively, in JCC1084t relative to their % DCW levels in JCC1084 (FIG. 14). The total n-alkane concentration in both strains was less than 1%. The n-alkane concentration in JCC1084t was at least 0.62% and at least twice as much n-alkane was produced relative to JCC1084.

Example 9

Comparison of Intracellular Hydrocarbon Products of JCC1113 (a Derivative of E. coli) and JCC1221 (a Derivative of Synechococcus sp. PCC 7002), Both Strains Heterologously Expressing Synechococcus elongatus SYNPCC7942_1593 (adm) and SYNPCC7942_1594 (aar)

[0232] GC-MS TICs of JCC1113 and JCC1221 acetone cell pellet extractants are shown in FIG. 15, along with the TIC of C.sub.8-C.sub.20 n-alkane authentic standards (Sigma 04070). These two strains are derived from E. coli BL21(DE3) and Synechococcus sp. PCC7002, respectively, and are described in detail in Examples 3 and 5, respectively. JCC1113 synthesizes predominantly n-heptadecene and n-pentadecane, whereas JCC1221 synthesizes predominantly n-heptadecane and n-pentadecane. This figure visually emphasizes the different retention times of the n-heptadecene isomer produced in JCC1113 and n-heptadecane produced in JCC1221.

Example 10

Production of Hydrocarbons in Yeast

[0233] The methods of the invention can be performed in a number of lower eukaryotes such as Saccharomyces cerevisiae, Trichoderma reesei, Aspergillus nidulans and Pichia pastoris. Engineering such organisms may include optimization of genes for efficient transcription and/or translation of the encoded protein. For instance, because the ADM and AAR genes introduced into a fungal host are of cyanobacterial origin, it may be necessary to optimize the base pair composition. This includes codon optimization to ensure that the cellular pools of tRNA are sufficient. The foreign genes (ORFs) may contain motifs detrimental to complete transcription/translation in the fungal host and, thus, may require substitution to more amenable sequences. The expression of each introduced protein can be followed both at the transcriptional and translational stages by well known Northern and Western blotting techniques, respectively.

[0234] Use of various yeast expression vectors including genes encoding activities which promote the ADM or AAR pathways, a promoter, a terminator, a selectable marker and targeting flanking regions. Such promoters, terminators, selectable markers and flanking regions are readily available in the art. In a preferred embodiment, the promoter in each case is selected to provide optimal expression of the protein encoded by that particular ORF to allow sufficient catalysis of the desired enzymatic reaction. This step requires choosing a promoter that is either constitutive or inducible, and provides regulated levels of transcription. In another embodiment, the terminator selected enables sufficient termination of transcription. In yet another embodiment, the selectable/counterselectable markers used are unique to each ORF to enable the subsequent selection of a fungal strain that contains a specific combination of the ORFs to be introduced. In a further embodiment, the locus to which relevant plasmid construct (encoding promoter, ORF and terminator) is localized, is determined by the choice of flanking region.

[0235] The engineered strains can be transformed with a range of different genes for production of carbon-based products of interest, and these genes are stably integrated to ensure that the desired activity is maintained throughout the fermentation process. Various combinations of enzyme activities can be engineered into the fungal host such as the ADM, ADR pathways while undesired pathways are attenuated or knocked out.

[0236] A number of embodiments of the invention have been described. Nevertheless, it will be understood that various modifications may be made without departing from the spirit and scope of the invention. All publications, patents and other references mentioned herein are hereby incorporated by reference in their entirety.

Informal Sequence Listing

TABLE-US-00011

[0237] SEQ ID NO: 1 ThermoSynechococcus elongatus BP-1; tll1312 (AAR) nucleic acid sequence (SEQ ID NO: 1) ATGTTTGGATTAATTGGTCATCTGACGAGTCTGGAGCACGCCCAAGCCGTTGCCCATCAGTTGGG TTACCCCGAATATGCCGATCAAGGCTTGGAATTTTGGTGTATGGCACCGCCGCAGATCGTCGATG AGATTACGGTGACGAGCGTAACGGGCAAAACTATCTATGGCAAATACGTTGAGTCCTGCTTTTTA CCAGAGATGCTGGCCAACCAGCGGGTGAAGGCAGCGACTCGCAAAGTTATTAACGCCATGGCCCA TGCCCAAAAGCACAACATTGACATTACGGCCTTGGGGGGCTTCTCCTCGATCATCTTTGAGAACT TTGATCTGGAGAAAATGTCCCACATTCGCAACATTGAACTGGACTTTCGCCGCTTTACAACGGGG AATACCCATACCGCCTATATCATCTGCCAACAAATTGAGCAGGCGGCGCCCCAAGTGGGGATTGA TTTGCGGCAGGCAACCGTGGCTGTTTGTGGGGCTACGGGGGATATTGGTAGTGCCGTCTGCCGTT GGTTGAATACCTGTTTAGATGTGCAAGATCTCTTACTCGTAGCACGGAATCGCGATCGCCTGCTG GAGCTACAGGCGGAATTGGGACGGGGGAAAATCCTCGACTTGATGGAGGCGCTGCCCCTTGCCGA TATTGTGGTTTGGGTGGCCAGTATGCCCAAGGGAGTTGAGCTGAGCATTGAGCAGTTAAAACGCC CCTCCCTGATGATTGATGGTGGTTATCCCAAAAATATGGCCACCAAAATTCAGCACCCCCAGATT CATGTTCTCAATGGTGGCATTGTCGAGCATGCCCTCGACATTGACTGGAAAATTATGGAAATTGT GAATATGGATGTGCCCTCGCGGCAGATGTTTGCCTGTTTTGCAGAGGCTATGCTTTTAGAGTTCG AGGGCTGGCACACCAATTTCTCTTGGGGACGCAATCAAATCACTGTGGAAAAGATGCAGCAAATT GGTGAGGTCTCCCGTAAACATGGATTTCAGCCACTACTGTTGAATCCTCAGTAA SEQ ID NO:2 ThermoSynechococcus elongatus BP-1 tll1312(AAR) amino acid sequence (SEQ ID NO: 2) MFGLIGHLTSLEHAQAVAHQLGYPEYADQGLEFWCMAPPQIVDEITVTSVTGKTIYGKYVESCFL PEMLANQRVKAATRKVINAMAHAQKHNIDITALGGFSSIIFENFDLEKMSHIRNIELDFRRFTTG NTHTAYIICQQIEQAAPQVGIDLRQATVAVCGATGDIGSAVCRWLNTCLDVQDLLLVARNRDRLL ELQAELGRGKILDLMEALPLADIVVWVASMPKGVELSIEQLKRPSLMIDGGYPKNMATKIQHPQI HVLNGGIVEHALDIDWKIMEIVNMDVPSRQMFACFAEAMLLEFEGWHTNFSWGRNQITVEKMQQI GEVSRKHGFQPLLLNPQ SEQ ID NO: 3 ThermoSynechococcus elongatus BP-1 tll1313 (ADM) nucleic acid sequence (SEQ ID NO: 3) ATGACAACGGCTACCGCTACACCTGTTTTGGACTACCATAGCGATCGCTACAAGGATGCCTACAG CCGCATTAACGCCATTGTCATTGAAGGTGAACAGGAAGCTCACGATAACTATATCGATTTAGCCA AGCTGCTGCCACAACACCAAGAGGAACTCACCCGCCTTGCCAAGATGGAAGCTCGCCACAAAAAG GGGTTTGAGGCCTGTGGTCGCAACCTGAGCGTAACGCCAGATATGGAATTTGCCAAAGCCTTCTT TGAAAAACTGCGCGCTAACTTTCAGAGGGCTCTGGCGGAGGGAAAAACTGCGACTTGTCTTCTGA TTCAAGCTTTGATCATCGAATCCTTTGCGATCGCGGCCTACAACATCTACATCCCAATGGCGGAT CCTTTCGCCCGTAAAATTACTGAGAGTGTTGTTAAGGACGAATACAGCCACCTCAACTTTGGCGA AATCTGGCTCAAGGAACACTTTGAAAGCGTCAAAGGAGAGCTCGAAGAAGCCAATCGCGCCAATT TACCCTTGGTCTGGAAAATGCTCAACCAAGTGGAAGCAGATGCCAAAGTGCTCGGCATGGAAAAA GATGCCCTTGTGGAAGACTTCATGATTCAGTACAGTGGTGCCCTAGAAAATATCGGCTTTACCAC CCGCGAAATTATGAAGATGTCAGTTTATGGCCTCACTGGGGCATAA SEQ ID NO: 4 ThermoSynechococcus elongatus BP-1 tll1313 (ADM) amino acid sequence (SEQ ID NO: 4) MTTATATPVLDYHSDRYKDAYSRINAIVIEGEQEAHDNYIDLAKLLPQHQEELTRLAKMEARHKK GFEACGRNLSVTPDMEFAKAFFEKLRANFQRALAEGKTATCLLIQALIIESFAIAAYNIYIPMAD PFARKITESVVKDEYSHLNFGEIWLKEHFESVKGELEEANRANLPLVWKMLNQVEADAKVLGMEK DALVEDFMIQYSGALENIGFTTREIMKMSVYGLTGA SEQ ID NO: 5 Synechococcus elongatus PCC 7942; SYNPCC7942_1594 (AAR) nucleic acid sequence (SEQ ID NO: 5) ATGTTCGGTCTTATCGGTCATCTCACCAGTTTGGAGCAGGCCCGCGACGTTTCTCGCAGGATGGG CTACGACGAATACGCCGATCAAGGATTGGAGTTTTGGAGTAGCGCTCCTCCTCAAATCGTTGATG AAATCACAGTCACCAGTGCCACAGGCAAGGTGATTCACGGTCGCTACATCGAATCGTGTTTCTTG CCGGAAATGCTGGCGGCGCGCCGCTTCAAAACAGCCACGCGCAAAGTTCTCAATGCCATGTCCCA TGCCCAAAAACACGGCATCGACATCTCGGCCTTGGGGGGCTTTACCTCGATTATTTTCGAGAATT TCGATTTGGCCAGTTTGCGGCAAGTGCGCGACACTACCTTGGAGTTTGAACGGTTCACCACCGGC AATACTCACACGGCCTACGTAATCTGTAGACAGGTGGAAGCCGCTGCTAAAACGCTGGGCATCGA CATTACCCAAGCGACAGTAGCGGTTGTCGGCGCGACTGGCGATATCGGTAGCGCTGTCTGCCGCT GGCTCGACCTCAAACTGGGTGTCGGTGATTTGATCCTGACGGCGCGCAATCAGGAGCGTTTGGAT AACCTGCAGGCTGAACTCGGCCGGGGCAAGATTCTGCCCTTGGAAGCCGCTCTGCCGGAAGCTGA CTTTATCGTGTGGGTCGCCAGTATGCCTCAGGGCGTAGTGATCGACCCAGCAACCCTGAAGCAAC CCTGCGTCCTAATCGACGGGGGCTACCCCAAAAACTTGGGCAGCAAAGTCCAAGGTGAGGGCATC TATGTCCTCAATGGCGGGGTAGTTGAACATTGCTTCGACATCGACTGGCAGATCATGTCCGCTGC AGAGATGGCGCGGCCCGAGCGCCAGATGTTTGCCTGCTTTGCCGAGGCGATGCTCTTGGAATTTG AAGGCTGGCATACTAACTTCTCCTGGGGCCGCAACCAAATCACGATCGAGAAGATGGAAGCGATC GGTGAGGCATCGGTGCGCCACGGCTTCCAACCCTTGGCATTGGCAATTTGA SEQ ID NO: 6 Synechococcus elongatus PCC 7942; SYNPCC7942_1594 (AAR) amino acid sequence (SEQ ID NO: 6) MFGLIGHLTSLEQARDVSRRMGYDEYADQGLEFWSSAPPQIVDEITVTSATGKVIHGRYIESCFL PEMLAARRFKTATRKVLNAMSHAQKHGIDISALGGFTSIIFENFDLASLRQVRDTTLEFERFTTG NTHTAYVICRQVEAAAKTLGIDITQATVAVVGATGDIGSAVCRWLDLKLGVGDLILTARNQERLD NLQAELGRGKILPLEAALPEADFIVWVASMPQGVVIDPATLKQPCVLIDGGYPKNLGSKVQGEGI YVLNGGVVEHCFDIDWQIMSAAEMARPERQMFACFAEAMLLEFEGWHTNFSWGRNQITIEKMEAI GEASVRHGFQPLALAI SEQ ID NO: 7 Synechococcus elongatus PCC 7942; SYNPCC7942_1593 (ADM) nucleic acid sequence (SEQ ID NO: 7) ATGCCGCAGCTTGAAGCCAGCCTTGAACTGGACTTTCAAAGCGAGTCCTACAAAGACGCTTACAG CCGCATCAACGCGATCGTGATTGAAGGCGAACAAGAGGCGTTCGACAACTACAATCGCCTTGCTG AGATGCTGCCCGACCAGCGGGATGAGCTTCACAAGCTAGCCAAGATGGAACAGCGCCACATGAAA GGCTTTATGGCCTGTGGCAAAAATCTCTCCGTCACTCCTGACATGGGTTTTGCCCAGAAATTTTT CGAGCGCTTGCACGAGAACTTCAAAGCGGCGGCTGCGGAAGGCAAGGTCGTCACCTGCCTACTGA TTCAATCGCTAATCATCGAGTGCTTTGCGATCGCGGCTTACAACATCTACATCCCAGTGGCGGAT GCTTTTGCCCGCAAAATCACGGAGGGGGTCGTGCGCGACGAATACCTGCACCGCAACTTCGGTGA AGAGTGGCTGAAGGCGAATTTTGATGCTTCCAAAGCCGAACTGGAAGAAGCCAATCGTCAGAACC TGCCCTTGGTTTGGCTAATGCTCAACGAAGTGGCCGATGATGCTCGCGAACTCGGGATGGAGCGT GAGTCGCTCGTCGAGGACTTTATGATTGCCTACGGTGAAGCTCTGGAAAACATCGGCTTCACAAC GCGCGAAATCATGCGTATGTCCGCCTATGGCCTTGCGGCCGTTTGA SEQ ID NO: 8 Synechococcus elongatus PCC 7942; SYNPCC7942_1593 (ADM) amino acid sequence (SEQ ID NO: 8) MPQLEASLELDFQSESYKDAYSRINAIVIEGEQEAFDNYNRLAEMLPDQRDELHKLAKMEQRHMK GFMACGKNLSVTPDMGFAQKFFERLHENFKAAAAEGKVVTCLLIQSLIIECFAIAAYNIYIPVAD AFARKITEGVVRDEYLHRNFGEEWLKANFDASKAELEEANRQNLPLVWLMLNEVADDARELGMER ESLVEDFMIAYGEALENIGFTTREIMRMSAYGLAAV SEQ ID NO: 9 Prochlorococcus marimus MIT9312 PMT9312_0533 (AAR) optimized nucleic acid sequence (SEQ ID NO: 9) ATGTTTGGTCTGATTGGTCATAGCACCAGCTTTGAGGACGCAAAGCGCAAGGCGAGCCTGCTGGG TTTCGACCACATCGCGGATGGCGATCTGGATGTGTGGTGTACCGCACCGCCGCAACTGGTTGAAA ACGTGGAAGTCAAAAGCGCGACGGGTATCAGCATTGAAGGTAGCTATATCGATAGCTGCTTCGTG CCGGAGATGCTGAGCCGCTTCAAGACCGCGCGTCGTAAAGTTCTGAATGCAATGGAGCTGGCGCA GAAAAAGGGTATCAATATCACTGCCCTGGGTGGCTTTACCTCCATTATCTTTGAGAACTTCAACC TGTTGCAGCACAAGCAAATCCGTAATACCAGCCTGGAGTGGGAGCGTTTCACCACGGGTAACACG CACACGGCATGGGTGATTTGTCGTCAGCTGGAGATCAACGCACCGCGCATTGGCATCGACCTGAA AACTGCAACGGTCGCTGTTATCGGCGCGACCGGCGATATTGGTAGCGCGGTGTGTCGCTGGCTGG TCAATAAGACCGGCATTAGCGAACTGCTGATGGTCGCTCGCCAACAACAGCCACTGACCCTGCTG CAAAAAGAACTGGACGGTGGCACCATCAAGAGCCTGGATGAAGCCCTGCCGCAGGCGGATATTGT CGTGTGGGTTGCTTCGATGCCTAAGACGATCGAAATTGAGATTGAAAACCTGAAAAAGCCGTGCC TGATGATCGACGGTGGCTACCCGAAGAATCTGGACGAGAAATTCAAAGGCAAAAACATTCACGTG TTGAAGGGTGGTATCGTCGAGTTTTTCAACGACATTGGCTGGAACATGATGGAGTTGGCGGAGAT GCAAAACCCGCAGCGTGAGATGTTTGCGTGCTTCGCCGAAGCTATGATTCTGGAGTTTGAGAAAT GCCATACCAACTTTAGCTGGGGCCGTAACAATATCAGCTTGGAGAAGATGGAGTTCATCGGTGCT GCATCTCTGAAGCACGGTTTCAGCGCGATCGGTCTGGATAAACAGCCGAAAGTCTTGACCGTTTG A SEQ ID NO: 10 Prochlorococcus marimus MIT9312 PMT9312_0533 (AAR) protein sequence (SEQ ID NO: 10) MFGLIGHSTSFEDAKRKASLLGFDHIADGDLDVWCTAPPQLVENVEVKSATGISIEGSYIDSCFV PEMLSRFKTARRKVLNAMELAQKKGINITALGGFTSIIFENFNLLQHKQIRNTSLEWERFTTGNT HTAWVICRQLEINAPRIGIDLKTATVAVIGATGDIGSAVCRWLVNKTGISELLMVARQQQPLTLL QKELDGGTIKSLDEALPQADIVVWVASMPKTIEIEIENLKKPCLMIDGGYPKNLDEKFKGKNIHV LKGGIVEFFNDIGWNMMELAEMQNPQREMFACFAEAMILEEKCHTNFSWGRNNISLEKMEFIGAA SLKHGFSAIGLDKQPKVLTV SEQ ID NO: 11 Prochlorococcus marimus MIT9312 PMT9312_0532 (ADM) optimized nucleic acid sequence (SEQ ID NO: 11) ATGCACAATGAATTGAAAATCACGGATATGCAAACGCTGGAAACCAACACCAAGACGACCGAAGA GTCTATTGACACCAATAGCCTGAACCTGCCGGACTTTACTACCGACAGCTACAAGGATGCCTATT CTCGCATTAACGCCATCGTTATTGAGGGCGAACAGGAAGCTCATGACAATTACATCTCCATCGCA ACGCTGATCCCGAATGAGCTGGAAGAGCTGACGAAGCTGGCACGTATGGAGCTGAAACACAAGAA AGGTTTTACTGCGTGCGGTCGTAATCTGGGTGTGGACGCAGACATGGTTTTCGCGAAAAAGTTCT TCAGCAAACTGCACGGCAATTTCCAAATCGCGCTGGAAAAAGGTAACCTGACCACCTGCTTGCTG

ATCCAAGCGATTCTGATCGAAGCATTTGCGATTTCCGCGTACAATGTTTACATCCGTGTGGCCGA CCCATTTGCCAAAAAGATTACCGAGGGTGTTGTCAAAGACGAGTATCTGCATCTGAACTATGGTC AGGAGTGGCTGAAAAAGAATCTGTCCACGTGTAAAGAAGAGCTGATGGAGGCCAACAAGGTCAAT CTGCCGCTGATTAAGAAAATGCTGGACGAAGTGGCAGAAGATGCGAGCGTTTTGGCGATGGATCG TGAAGAGTTGATGGAAGAGTTCATGATTGCGTACCAGGATACCCTGTTGGAGATTGGCCTGGATA ATCGCGAAATTGCCCGTATGGCGATGGCGGCCATTGTTTAG SEQ ID NO: 12 Prochlorococcus marimus MIT9312 PMT9312_0532 (ADM) protein sequence (SEQ ID NO: 12) MHNELKITDMQTLETNTKTTEESIDTNSLNLPDFTTDSYKDAYSRINAIVIEGEQEAHDNYISIA TLIPNELEELTKLARMELKHKKGFTACGRNLGVDADMVFAKKFFSKLHGNFQIALEKGNLTTCLL IQAILIEAFAISAYNVYIRVADPFAKKITEGVVKDEYLHLNYGQEWLKKNLSTCKEELMEANKVN LPLIKKMLDEVAEDASVLAMDREELMEEFMIAYQDTLLEIGLDNREIARMAMAAIV SEQ ID NO: 13 Prochlorococcus marimus MIT9312 PMT9312_0533 (AAR) nucleic acid sequence (SEQ ID NO: 13) ATGTTTGGGTTAATAGGCCACTCAACTAGTTTTGAAGATGCAAAAAGAAAAGCTTCATTACTAGG CTTTGATCATATTGCTGATGGTGATCTAGATGTTTGGTGTACAGCCCCTCCTCAATTGGTTGAAA ATGTAGAAGTTAAGAGTGCTACTGGAATATCTATTGAAGGTTCTTATATAGATTCTTGCTTTGTT CCTGAAATGCTTTCTAGGTTTAAAACCGCAAGAAGAAAAGTATTAAATGCTATGGAATTAGCTCA GAAAAAAGGGATTAACATTACGGCTTTAGGAGGATTTACTTCTATTATTTTCGAAAATTTTAATC TTCTTCAACATAAACAAATTAGAAATACTTCATTAGAGTGGGAAAGGTTTACTACAGGTAATACA CACACTGCCTGGGTTATTTGTAGGCAACTAGAAATAAATGCTCCTCGCATAGGGATAGATCTTAA AACTGCAACTGTTGCTGTTATTGGTGCTACAGGTGATATAGGAAGTGCTGTTTGTAGGTGGCTTG TCAATAAAACTGGTATTTCAGAACTTCTTATGGTGGCTAGACAACAACAACCATTAACTCTATTA CAGAAAGAATTAGATGGTGGCACTATAAAAAGTTTAGATGAAGCATTGCCTCAAGCGGATATTGT TGTATGGGTTGCAAGTATGCCTAAAACGATTGAAATTGAAATTGAAAACTTAAAAAAACCATGTT TAATGATTGATGGTGGATACCCTAAAAATCTTGATGAGAAATTTAAAGGTAAAAATATTCATGTT TTAAAAGGAGGTATAGTAGAGTTTTTCAATGATATTGGCTGGAATATGATGGAACTTGCAGAAAT GCAGAACCCTCAGAGAGAGATGTTTGCTTGCTTTGCAGAAGCTATGATTTTAGAATTTGAAAAGT GTCATACCAACTTTAGTTGGGGAAGGAATAACATTTCTCTTGAAAAAATGGAATTTATTGGAGCA GCTTCTTTGAAACATGGTTTTTCTGCGATTGGACTTGATAAACAGCCTAAAGTATTGACTGTTTG A SEQ ID NO: 14 Prochlorococcus marimus MIT9312 PMT9312_0532 (ADM) nucleic acid sequence (SEQ ID NO: 14) ATGCATAATGAGCTAAAGATTACTGACATGCAAACTCTAGAAACAAATACAAAAACTACTGAAGA ATCCATAGACACGAATTCTTTGAATCTTCCCGACTTTACAACAGATTCCTATAAGGATGCATATA GCAGAATAAATGCAATTGTTATAGAGGGAGAGCAAGAGGCTCATGATAATTACATTTCAATAGCA ACGTTAATACCAAATGAGTTAGAAGAATTAACTAAGTTGGCGAGAATGGAACTCAAGCATAAAAA AGGATTTACTGCTTGTGGAAGAAATTTAGGAGTAGATGCTGATATGGTATTCGCAAAAAAATTCT TTTCTAAATTGCATGGTAATTTTCAAATTGCTTTAGAAAAAGGAAATTTAACAACTTGTCTTCTG ATACAAGCTATTTTAATTGAAGCTTTTGCTATATCTGCTTATAACGTTTACATAAGAGTTGCTGA TCCTTTTGCAAAAAAAATAACAGAGGGAGTGGTTAAAGATGAATATCTCCATCTAAATTACGGCC AAGAGTGGCTTAAAAAGAATTTATCTACTTGTAAAGAAGAATTAATGGAAGCCAATAAGGTTAAC CTTCCCTTAATTAAAAAGATGTTAGATGAAGTAGCAGAAGATGCATCAGTTTTGGCTATGGATAG AGAAGAGTTAATGGAAGAATTTATGATTGCTTACCAAGACACTCTTCTAGAAATAGGTCTTGATA ATAGAGAAATTGCAAGAATGGCTATGGCAGCGATTGTTTAA SEQ ID NO: 15 plasmid JB823 1.sup.st underlined sequence Upstream homology region for pAQ1 1.sup.st double-underlined lowercase sequence NotI site for promoter swapping 1.sup.st italic sequence aphII promoter 2.sup.nd double-underlined lowercase sequence NdeI site for promoter swapping 1.sup.st bold sequence SYNPCC7942_1593 (adm) coding sequence 1.sup.st lower case sequence Intergenic sequence 2.sup.nd bold sequence SYNPCC7942_1594 (aar) coding sequence 2.sup.nd italic sequence aadA coding sequence; spec.sup.R selection marker 2.sup.nd underlined sequence Downstream homology region for pAQ1 2.sup.nd lowercase sequence Vector backbone (SEQ ID NO: 15) GTCAGCAAGCTCTGGAATTTCCCGATTCTCTGATGGGAGATCCAAAAATTCTCGCAGTCCCTCAA TCACGATATCGGTCTTGGATCGCCCTGTAGCTTCCGACAACTGCTCAATTTTTTCGAGCATCTCT ACCGGGCATCGGAATGAAATTAACGGTGTTTTAGCCATGTGTTATACAGTGTTTACAACTTGACT AACAAATACCTGCTAGTGTATACATATTGTATTGCAATGTATACGCTATTTTCACTGCTGTCTTT AATGGGGATTATCGCAAGCAAGTAAAAAAGCCTGAAAACCCCAATAGGTAAGGGATTCCGAGCTT ACTCGATAATTATCACCTTTGAGCGCCCCTAGGAGGAGGCGSSSSGCTATGTCTGACAAGGGGTT TGACCCCTGAAGTCGTTGCGCGAGCATTAAGGTCTGCGGATAGCCCATAACATACTTTTGTTGAA ##STR00001## GAAAGCCACGTTGTGTCTCAAAATCTCTGATGTTACATTGCACAAGATAAAAATATATCATCATG ##STR00002## GCCTTGAACTGGACTTTCAAAGCGAGTCCTACAAAGACGCTTACAGCCGCATCAACGCGATCGTG ATTGAAGGCGAACAAGAGGCGTTCGACAACTACAATCGCCTTGCTGAGATGCTGCCCGACCAGCG GGATGAGCTTCACAAGCTAGCCAAGATGGAACAGCGCCACATGAAAGGCTTTATGGCCTGTGGCA AAAATCTCTCCGTCACTCCTGACATGGGTTTTGCCCAGAAATTTTTCGAGCGCTTGCACGAGAAC TTCAAAGCGGCGGCTGCGGAAGGCAAGGTCGTCACCTGCCTACTGATTCAATCGCTAATCATCGA GTGCTTTGCGATCGCGGCTTACAACATCTACATCCCAGTGGCGGATGCTTTTGCCCGCAAAATCA CGGAGGGGGTCGTGCGCGACGAATACCTGCACCGCAACTTCGGTGAAGAGTGGCTGAAGGCGAAT TTTGATGCTTCCAAAGCCGAACTGGAAGAAGCCAATCGTCAGAACCTGCCCTTGGTTTGGCTAAT GCTCAACGAAGTGGCCGATGATGCTCGCGAACTCGGGATGGAGCGTGAGTCGCTCGTCGAGGACT TTATGATTGCCTACGGTGAAGCTCTGGAAAACATCGGCTTCACAACGCGCGAAATCATGCGTATG TCCGCCTATGGCCTTGCGGCCGTTTGAtccaggaaatctgaATGTTCGGTCTTATCGGTCATCTC ACCAGTTTGGAGCAGGCCCGCGACGTTTCTCGCAGGATGGGCTACGACGAATACGCCGATCAAGG ATTGGAGTTTTGGAGTAGCGCTCCTCCTCAAATCGTTGATGAAATCACAGTCACCAGTGCCACAG GCAAGGTGATTCACGGTCGCTACATCGAATCGTGTTTCTTGCCGGAAATGCTGGCGGCGCGCCGC TTCAAAACAGCCACGCGCAAAGTTCTCAATGCCATGTCCCATGCCCAAAAACACGGCATCGACAT CTCGGCCTTGGGGGGCTTTACCTCGATTATTTTCGAGAATTTCGATTTGGCCAGTTTGCGGCAAG TGCGCGACACTACCTTGGAGTTTGAACGGTTCACCACCGGCAATACTCACACGGCCTACGTAATC TGTAGACAGGTGGAAGCCGCTGCTAAAACGCTGGGCATCGACATTACCCAAGCGACAGTAGCGGT TGTCGGCGCGACTGGCGATATCGGTAGCGCTGTCTGCCGCTGGCTCGACCTCAAACTGGGTGTCG GTGATTTGATCCTGACGGCGCGCAATCAGGAGCGTTTGGATAACCTGCAGGCTGAACTCGGCCGG GGCAAGATTCTGCCCTTGGAAGCCGCTCTGCCGGAAGCTGACTTTATCGTGTGGGTCGCCAGTAT GCCTCAGGGCGTAGTGATCGACCCAGCAACCCTGAAGCAACCCTGCGTCCTAATCGACGGGGGCT ACCCCAAAAACTTGGGCAGCAAAGTCCAAGGTGAGGGCATCTATGTCCTCAATGGCGGGGTAGTT GAACATTGCTTCGACATCGACTGGCAGATCATGTCCGCTGCAGAGATGGCGCGGCCCGAGCGCCA GATGTTTGCCTGCTTTGCCGAGGCGATGCTCTTGGAATTTGAAGGCTGGCATACTAACTTCTCCT GGGGCCGCAACCAAATCACGATCGAGAAGATGGAAGCGATCGGTGAGGCATCGGTGCGCCACGGC TTCCAACCCTTGGCATTGGCAATTTGAGGTCTGTGAATTCGGTTTTCCGTCCTGTCTTGATTTTC AAGCAAACAATGCCTCCGATTTCTAATCGGAGGCATTTGTTTTTGTTTATTGCAAAAACAAAAAA TATTGTTACAAATTTTTACAGGCTATTAAGCCTACCGTCATAAATAATTTGCCATTTACTAGTTT TTAATTAACCAGAACCTTGACCGAACGCAGCGGTGGTAACGGCGCAGTGGCGGTTTTCATGGCTT GTTATGACTGTTTTTTTGGGGTACAGTCTATGCCTCGGGCATCCAAGCAGCAAGCGCGTTACGCC GTGGGTCGATGTTTGATGTTATGGAGCAGCAACGATGTTACGCAGCAGGGCAGTCGCCCTAAAAC AAAGTTAAACATCATGAGGGAAGCGGTGATCGCCGAAGTATCGACTCAACTATGAGAGGTAGTTG GCGTCATCGAGCGCCATCTCGAACCGACGTTGCTGGCCGTACATTTGTACGGCTCCGCAGTGGAT GGCGGCCTGAAGCCACACAGTGATATTGATTTGCTGGTTACGGTGACCGTAAGGCTTGATGAAAC AACGCGGCGAGCTTTGATCAACGACCTTTTGGAAACTTCGGCTTCCCCTGGAGAGAGCGAGATTC TCCGCGCTGTAGAAGTCACCATTGTTGTGCACGACGACATCATTCCGTGGCGTTATCCAGCTAAG CGCGAACTGCAATTTGGAGAATGGCAGCGCAATGACATTCTTGCAGGTATCTTCGAGCCAGCCAC GATCGACATTGATCTGGCTATCTTGCTGACAAAAGCAAGAGAACATAGCGTTGCCTTGGTAGGTC CAGCGGCGGAGGAACTCTTTGATCCGGTTCCTGAACAGGATCTATTTGAGGCGCTAAATGAAACC TTAACGCTATGGAACTCGCCGCCCGACTGGGCTGGCGATGAGCGAAATGTAGTGCTTACGTTGTC CCGCATTTGGTACAGCGCAGTAACCGGCAAAATCGCGCCGAAGGATGTCGCTGCCGACTGGGCAA TGGAGCGCCTGCCGGCCCAGTATCAGCCCGTCATACTTGAAGCTAGACAGGCTTATCTTGGACAA GAAGAAGATCGCTTGGCCTCGCGCGCAGATCAGTTGGAAGAATTTGTCCACTACGTGAAAGGCGA GATCACCAAGGTAGTCGGCAAATAATGTGTAACAATTCGTTCAAGCCGAGCCGCTTCGCGGCGC GGCTTAACTCAAGCGTTAGATGCACTAAGCACATAATTGCTCACAGCCAAACTATCAGGTCAAGT CTGCTTTTATTATTTTTAAGCGTGCATAATAAGCGCTACACAAATTGGGAGATATATCATGAGGC GCGCCACGAGTGCGGGGAAATTTCGGGGGCGATCGCCCCTATATCGCAAAAAGGAGTTACCCCAT CAGAGCTATAGTCGAGAAGAAAACCATCATTCACTCAACAAGGCTATGTCAGAAGAGAAACTAGA CCGGATCGAAGCAGCCCTAGAGCAATTGGATAAGGATGTGCAAACGCTCCAAACAGAGCTTCAGC AATCCCAAAAATGGCAGGACAGGACATGGGATGTTGTGAAGTGGGTAGGCGGAATCTCAGCGGGC CTAGCGGTGAGCGCTTCCATTGCCCTGTTCGGGTTGGTCTTTAGATTTTCTGTTTCCCTGCCATA AAAGCACATTCTTATAAGTCATACTTGTTTACATCAAGGAACAAAAACGGCATTGTGCCTTGCAA GGCACAATGTCTTTCTCTTATGCACAGATGGGGACTGGAAACCACACGCACAATTCCCTTAAAAA GCAACCGCAAAAAATAACCATCAAAATAAAACTGGACAAATTCTCATGTGggccggccaaaatga agtgaagttcctatactttctagagaataggaacttctatagtgagtcgaataagggcgacacaa aatttattctaaatgcataataaatactgataacatattatagtttgtattatattttgtattat cgttgacatgtataattttgatataaaaaactgattttccctttattattttcgagatttatttt cttcattctctttaacaaactagaaatattgtatatacaaaaaatcataaatcatagatgaatag tttaattataggtgttcatcaatcgaaaaagcaacgtatcttatttaaagtgcgttgcttttttc tcatttataaggttaaataattctcatatatcaagcaaagtgacaggcgcccttaaatattctga caaatgctctttccctaaactccccccataaaaaaacccgccgaagcgggtttttacgttatttg cggattaacgattactcgttatcagaaccgcccagggggcccgagcttaagactggccgtcgttt

tacaacacagaaagagtttgtagaaacgcaaaaaggccatccgtcaggggccttctgcttagttt gatgcctggcagttccctactctcgccttccgcttcctcgctcactgactcgctgcgctcggtcg ttcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttatccacagaatcaggg gataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccaggaaccgtaaaaaggccgc gttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaaatcgacgctcaagtc agaggtggcgaaacccgacaggactataaagataccaggcgtttccccctggaagctccctcgtg cgctctcctgttccgaccctgccgcttaccggatacctgtccgcctttctcccttcgggaagcgt ggcgctttctcatagctcacgctgtaggtatctcagttcggtgtaggtcgttcgctccaagctgg gctgtgtgcacgaaccccccgttcagcccgaccgctgcgccttatccggtaactatcgtcttgag tccaacccggtaagacacgacttatcgccactggcagcagccactggtaacaggattagcagagc gaggtatgtaggcggtgctacagagttcttgaagtggtgggctaactacggctacactagaagaa cagtatttggtatctgcgctctgctgaagccagttaccttcggaaaaagagttggtagctcttca tccggcaaacaaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgcag aaaaaaaggatctcaagaagatcctttgatcttttctacggggtctgacgctcagtggaacgacg cgcgcgtaactcacgttaagggattttggtcatgagcttgcgccgtcccgtcaagtcagcgtaat gctctgcttttaccaatgcttaatcagtgaggcacctatctcagcgatctgtctatttcgttcat ccatagttgcctgactccccgtcgtgtagataactacgatacgggagggcttaccatctggcccc agcgctgcgatgataccgcgagaaccacgctcaccggctccggatttatcagcaataaaccagcc agccggaagggccgagcgcagaagtggtcctgcaactttatccgcctccatccagtctattaatt gttgccgggaagctagagtaagtagttcgccagttaatagtttgcgcaacgttgttgccatcgct acaggcatcgtggtgtcacgctcgtcgtttggtatggcttcattcagctccggttcccaacgatc aaggcgagttacatgatcccccatgttgtgcaaaaaagcggttagctccttcggtcctccgatcg ttgtcagaagtaagttggccgcagtgttatcactcatggttatggcagcactgcataattctctt actgtcatgccatccgtaagatgcttttctgtgactggtgagtactcaaccaagtcattctgaga atagtgtatgcggcgaccgagttgctcttgcccggcgtcaatacgggataataccgcgccacata gcagaactttaaaagtgctcatcattggaaaacgttcttcggggcgaaaactctcaaggatctta ccgctgttgagatccagttcgatgtaacccactcgtgcacccaactgatcttcagcatcttttac tttcaccagcgtttctgggtgagcaaaaacaggaaggcaaaatgccgcaaaaaagggaataaggg cgacacggaaatgttgaatactcatattcttcctttttcaatattattgaagcatttatcagggt tattgtctcatgagcggatacatatttgaatgtatttagaaaaataaacaaataggggtcagtgt tacaaccaattaaccaattctgaacattatcgcgagcccatttatacctgaatatggctcataac accccttgtttgcctggcggcagtagcgcggtggtcccacctgaccccatgccgaactcagaagt gaaacgccgtagcgccgatggtagtgtggggactccccatgcgagagtagggaactgccaggcat caaataaaacgaaaggctcagtcgaaagactgggcctttcgcccgggctaattatggggtgtcgc ccttattcgactctatagtgaagttcctattctctagaaagtataggaacttctgaagtggggcc tgcagg SEQ ID NO: 16 plasmid pJB855 1.sup.st bold sequence SYNPCC7942_1593 coding sequence 2.sup.nd bold sequence SYNPCC7942_1594 coding sequence Italic sequence aadA spectinomycin selection marker (reverse complement) (SEQ ID NO: 16) GGGGAATTGTGAGCGGATAACAATTCCCCTGTAGAAATAATTTTGTTTAACTTTAATAAGGAGAT ATACCATGGGCAGCAGCCATCACCATCATCACCACAGCCAGGATCCGAATTCGAGCTCGGCGCGC CTGCAGGTCGACAAGCTTGCGGCCGCATAATGCTTAAGTCGAACAGAAAGTAATCGTATTGTACA CGGCCGCATAATCGAAATTAATACGACTCACTATAGGGGAATTGTGAGCGGATAACAATTCCCCA TCTTAGTATATTAGTTAAGTATAAGAAGGAGATATACATATGCCGCAGCTTGAAGCCAGCCTTGA ACTGGACTTTCAAAGCGAGTCCTACAAAGACGCTTACAGCCGCATCAACGCGATCGTGATTGAAG GCGAACAAGAGGCGTTCGACAACTACAATCGCCTTGCTGAGATGCTGCCCGACCAGCGGGATGAG CTTCACAAGCTAGCCAAGATGGAACAGCGCCACATGAAAGGCTTTATGGCCTGTGGCAAAAATCT CTCCGTCACTCCTGACATGGGTTTTGCCCAGAAATTTTTCGAGCGCTTGCACGAGAACTTCAAAG CGGCGGCTGCGGAAGGCAAGGTCGTCACCTGCCTACTGATTCAATCGCTAATCATCGAGTGCTTT GCGATCGCGGCTTACAACATCTACATCCCAGTGGCGGATGCTTTTGCCCGCAAAATCACGGAGGG GGTCGTGCGCGACGAATACCTGCACCGCAACTTCGGTGAAGAGTGGCTGAAGGCGAATTTTGATG CTTCCAAAGCCGAACTGGAAGAAGCCAATCGTCAGAACCTGCCCTTGGTTTGGCTAATGCTCAAC GAAGTGGCCGATGATGCTCGCGAACTCGGGATGGAGCGTGAGTCGCTCGTCGAGGACTTTATGAT TGCCTACGGTGAAGCTCTGGAAAACATCGGCTTCACAACGCGCGAAATCATGCGTATGTCCGCCT ATGGCCTTGCGGCCGTTTGATCCAGGAAATCTGAATGTTCGGTCTTATCGGTCATCTCACCAGTT TGGAGCAGGCCCGCGACGTTTCTCGCAGGATGGGCTACGACGAATACGCCGATCAAGGATTGGAG TTTTGGAGTAGCGCTCCTCCTCAAATCGTTGATGAAATCACAGTCACCAGTGCCACAGGCAAGGT GATTCACGGTCGCTACATCGAATCGTGTTTCTTGCCGGAAATGCTGGCGGCGCGCCGCTTCAAAA CAGCCACGCGCAAAGTTCTCAATGCCATGTCCCATGCCCAAAAACACGGCATCGACATCTCGGCC TTGGGGGGCTTTACCTCGATTATTTTCGAGAATTTCGATTTGGCCAGTTTGCGGCAAGTGCGCGA CACTACCTTGGAGTTTGAACGGTTCACCACCGGCAATACTCACACGGCCTACGTAATCTGTAGAC AGGTGGAAGCCGCTGCTAAAACGCTGGGCATCGACATTACCCAAGCGACAGTAGCGGTTGTCGGC GCGACTGGCGATATCGGTAGCGCTGTCTGCCGCTGGCTCGACCTCAAACTGGGTGTCGGTGATTT GATCCTGACGGCGCGCAATCAGGAGCGTTTGGATAACCTGCAGGCTGAACTCGGCCGGGGCAAGA TTCTGCCCTTGGAAGCCGCTCTGCCGGAAGCTGACTTTATCGTGTGGGTCGCCAGTATGCCTCAG GGCGTAGTGATCGACCCAGCAACCCTGAAGCAACCCTGCGTCCTAATCGACGGGGGCTACCCCAA AAACTTGGGCAGCAAAGTCCAAGGTGAGGGCATCTATGTCCTCAATGGCGGGGTAGTTGAACATT GCTTCGACATCGACTGGCAGATCATGTCCGCTGCAGAGATGGCGCGGCCCGAGCGCCAGATGTTT GCCTGCTTTGCCGAGGCGATGCTCTTGGAATTTGAAGGCTGGCATACTAACTTCTCCTGGGGCCG CAACCAAATCACGATCGAGAAGATGGAAGCGATCGGTGAGGCATCGGTGCGCCACGGCTTCCAAC CCTTGGCATTGGCAATTTGAGGTCTGTGAATTGGATATCGGCCGGCCACGCGATCGCTGACGTCG GTACCCTCGAGTCTGGTAAAGAAACCGCTGCTGCGAAATTTGAACGCCAGCACATGGACTCGTCT ACTAGCGCAGCTTAATTAACCTAGGCTGCTGCCACCGCTGAGCAATAACTAGCATAACCCCTTGG GGCCTCTAAACGGGTCTTGAGGGGTTTTTTGCTGAAACCTCAGGCATTTGAGAAGCACACGGTCA CACTGCTTCCGGTAGTCAATAAACCGGTAAACCAGCAATAGACATAAGCGGCTATTTAACGACCC TGCCCTGAACCGACGACCGGGTCATCGTGGCCGGATCTTGCGGCCCCTCGGCTTGAACGAATTGT TAGACATTATTTGCCGACTACCTTGGTGATCTCGCCTTTCACGTAGTGGACAAATTCTTCCAACT GATCTGCGCGCGAGGCCAAGCGATCTTCTTCTTGTCCAAGATAAGCCTGTCTAGCTTCAAGTATG ACGGGCTGATACTGGGCCGGCAGGCGCTCCATTGCCCAGTCGGCAGCGACATCCTTCGGCGCGAT TTTGCCGGTTACTGCGCTGTACCAAATGCGGGACAACGTAAGCACTACATTTCGCTCATCGCCAG CCCAGTCGGGCGGCGAGTTCCATAGCGTTAAGGTTTCATTTAGCGCCTCAAATAGATCCTGTTCA GGAACCGGATCAAAGAGTTCCTCCGCCGCTGGACCTACCAAGGCAACGCTATGTTCTCTTGCTTT TGTCAGCAAGATAGCCAGATCAATGTCGATCGTGGCTGGCTCGAAGATACCTGCAAGAATGTCAT TGCGCTGCCATTCTCCAAATTGCAGTTCGCGCTTAGCTGGATAACGCCACGGAATGATGTCGTCG TGCACAACAATGGTGACTTCTACAGCGCGGAGAATCTCGCTCTCTCCAGGGGAAGCCGAAGTTTC CAAAAGGTCGTTGATCAAAGCTCGCCGCGTTGTTTCATCAAGCCTTACGGTCACCGTAACCAGCA AATCAATATCACTGTGTGGCTTCAGGCCGCCATCCACTGCGGAGCCGTACAAATGTACGGCCAGC AACGTCGGTTCGAGATGGCGCTCGATGACGCCAACTACCTCTGATAGTTGAGTCGATACTTCGGC GATCACCGCTTCCCTCATACTCTTCCTTTTTCAATATTATTGAAGCATTTATCAGGGTTATTGTC TCATGAGCGGATACATATTTGAATGTATTTAGAAAAATAAACAAATAGCTAGCTCACTCGGTCGC TACGCTCCGGGCGTGAGACTGCGGCGGGCGCTGCGGACACATACAAAGTTACCCACAGATTCCGT GGATAAGCAGGGGACTAACATGTGAGGCAAAACAGCAGGGCCGCGCCGGTGGCGTTTTTCCATAG GCTCCGCCCTCCTGCCAGAGTTCACATAAACAGACGCTTTTCCGGTGCATCTGTGGGAGCCGTGA GGCTCAACCATGAATCTGACAGTACGGGCGAAACCCGACAGGACTTAAAGATCCCCACCGTTTCC GGCGGGTCGCTCCCTCTTGCGCTCTCCTGTTCCGACCCTGCCGTTTACCGGATACCTGTTCCGCC TTTCTCCCTTACGGGAAGTGTGGCGCTTTCTCATAGCTCACACACTGGTATCTCGGCTCGGTGTA GGTCGTTCGCTCCAAGCTGGGCTGTAAGCAAGAACTCCCCGTTCAGCCCGACTGCTGCGCCTTAT CCGGTAACTGTTCACTTGAGTCCAACCCGGAAAAGCACGGTAAAACGCCACTGGCAGCAGCCATT GGTAACTGGGAGTTCGCAGAGGATTTGTTTAGCTAAACACGCGGTTGCTCTTGAAGTGTGCGCCA AAGTCCGGCTACACTGGAAGGACAGATTTGGTTGCTGTGCTCTGCGAAAGCCAGTTACCACGGTT AAGCAGTTCCCCAACTGACTTAACCTTCGATCAAACCACCTCCCCAGGTGGTTTTTTCGTTTACA GGGCAAAAGATTACGCGCAGAAAAAAAGGATCTCAAGAAGATCCTTTGATCTTTTCTACTGAACC GCTCTAGATTTCAGTGCAATTTATCTCTTCAAATGTAGCACCTGAAGTCAGCCCCATACGATATA AGTTGTAATTCTCATGTTAGTCATGCCCCGCGCCCACCGGAAGGAGCTGACTGGGTTGAAGGCTC TCAAGGGCATCGGTCGAGATCCCGGTGCCTAATGAGTGAGCTAACTTACATTAATTGCGTTGCGC TCACTGCCCGCTTTCCAGTCGGGAAACCTGTCGTGCCAGCTGCATTAATGAATCGGCCAACGCGC GGGGAGAGGCGGTTTGCGTATTGGGCGCCAGGGTGGTTTTTCTTTTCACCAGTGAGACGGGCAAC AGCTGATTGCCCTTCACCGCCTGGCCCTGAGAGAGTTGCAGCAAGCGGTCCACGCTGGTTTGCCC CAGCAGGCGAAAATCCTGTTTGATGGTGGTTAACGGCGGGATATAACATGAGCTGTCTTCGGTAT CGTCGTATCCCACTACCGAGATGTCCGCACCAACGCGCAGCCCGGACTCGGTAATGGCGCGCATT GCGCCCAGCGCCATCTGATCGTTGGCAACCAGCATCGCAGTGGGAACGATGCCCTCATTCAGCAT TTGCATGGTTTGTTGAAAACCGGACATGGCACTCCAGTCGCCTTCCCGTTCCGCTATCGGCTGAA TTTGATTGCGAGTGAGATATTTATGCCAGCCAGCCAGACGCAGACGCGCCGAGACAGAACTTAAT GGGCCCGCTAACAGCGCGATTTGCTGGTGACCCAATGCGACCAGATGCTCCACGCCCAGTCGCGT ACCGTCTTCATGGGAGAAAATAATACTGTTGATGGGTGTCTGGTCAGAGACATCAAGAAATAACG CCGGAACATTAGTGCAGGCAGCTTCCACAGCAATGGCATCCTGGTCATCCAGCGGATAGTTAATG ATCAGCCCACTGACGCGTTGCGCGAGAAGATTGTGCACCGCCGCTTTACAGGCTTCGACGCCGCT TCGTTCTACCATCGACACCACCACGCTGGCACCCAGTTGATCGGCGCGAGATTTAATCGCCGCGA CAATTTGCGACGGCGCGTGCAGGGCCAGACTGGAGGTGGCAACGCCAATCAGCAACGACTGTTTG CCCGCCAGTTGTTGTGCCACGCGGTTGGGAATGTAATTCAGCTCCGCCATCGCCGCTTCCACTTT TTCCCGCGTTTTCGCAGAAACGTGGCTGGCCTGGTTCACCACGCGGGAAACGGTCTGATAAGAGA CACCGGCATACTCTGCGACATCGTATAACGTTACTGGTTTCACATTCACCACCCTGAATTGACTC TCTTCCGGGCGCTATCATGCCATACCGCGAAAGGTTTTGCGCCATTCGATGGTGTCCGGGATCTC GACGCTCTCCCTTATGCGACTCCTGCATTAGGAAATTAATACGACTCACTATA SEQ ID NO: 17

plasmid pJB947 1.sup.st underlined sequence Upstream homology region for pAQ1 1.sup.st italic sequence aphII promoter 1.sup.st bold sequence PMT9312_0532 (adm) coding sequence 1.sup.st lower case sequence Intergenic sequence 2.sup.nd bold sequence PMT9312_0533 (aar) 2.sup.nd italic sequence aadA coding sequence; spectinomycin selection marker 2.sup.nd underlined sequence Downstream homology region for pAQ1 2.sup.nd lower case sequence Vector backbone (SEQ ID NO: 17) GTCAGCAAGCTCTGGAATTTCCCGATTCTCTGATGGGAGATCCAAAAATTCTCGCAGTCCCTCAAT CACGATATCGGTCTTGGATCGCCCTGTAGCTTCCGACAACTGCTCAATTTTTTCGAGCATCTCTAC CGGGCATCGGAATGAAATTAACGGTGTTTTAGCCATGTGTTATACAGTGTTTACAACTTGACTAAC AAATACCTGCTAGTGTATACATATTGTATTGCAATGTATACGCTATTTTCACTGCTGTCTTTAATG GGGATTATCGCAAGCAAGTAAAAAAGCCTGAAAACCCCAATAGGTAAGGGATTCCGAGCTTACTCG ATAATTATCACCTTTGAGCGCCCCTAGGAGGAGGCGAAAAGCTATGTCTGACAAGGGGTTTGACCC CTGAAGTCGTTGCGCGAGCATTAAGGTCTGCGGATAGCCCATAACATACTTTTGTTGAACTTGTGC GCTTTTATCAACCCCTTAAGGGCTTGGGAGCGTTTTATGCGGCCGCGGGGGGGGGGGGGAAAGCCA CGTTGTGTCTCAAAATCTCTGATGTTACATTGCACAAGATAAAAATATATCATCATGAACAATAAA ACTGTCTGCTTACATAAACAGTAATACAAGGGGTCATATGCACAATGAATTGAAAATCACGGATAT GCAAACGCTGGAAACCAACACCAAGACGACCGAAGAGTCTATTGACACCAATAGCCTGAACCTGCC GGACTTTACTACCGACAGCTACAAGGATGCCTATTCTCGCATTAACGCCATCGTTATTGAGGGCGA ACAGGAAGCTCATGACAATTACATCTCCATCGCAACGCTGATCCCGAATGAGCTGGAAGAGCTGAC GAAGCTGGCACGTATGGAGCTGAAACACAAGAAAGGTTTTACTGCGTGCGGTCGTAATCTGGGTGT GGACGCAGACATGGTTTTCGCGAAAAAGTTCTTCAGCAAACTGCACGGCAATTTCCAAATCGCGCT GGAAAAAGGTAACCTGACCACCTGCTTGCTGATCCAAGCGATTCTGATCGAAGCATTTGCGATTTC CGCGTACAATGTTTACATCCGTGTGGCCGACCCATTTGCCAAAAAGATTACCGAGGGTGTTGTCAA AGACGAGTATCTGCATCTGAACTATGGTCAGGAGTGGCTGAAAAAGAATCTGTCCACGTGTAAAGA AGAGCTGATGGAGGCCAACAAGGTCAATCTGCCGCTGATTAAGAAAATGCTGGACGAAGTGGCAGA AGATGCGAGCGTTTTGGCGATGGATCGTGAAGAGTTGATGGAAGAGTTCATGATTGCGTACCAGGA TACCCTGTTGGAGATTGGCCTGGATAATCGCGAAATTGCCCGTATGGCGATGGCGGCCATTGTTTA GtaatatttctaattaactaataaaggaagtctgaATGTTTGGTCTGATTGGTCATAGCACCAGCT TTGAGGACGCAAAGCGCAAGGCGAGCCTGCTGGGTTTCGACCACATCGCGGATGGCGATCTGGATG TGTGGTGTACCGCACCGCCGCAACTGGTTGAAAACGTGGAAGTCAAAAGCGCGACGGGTATCAGCA TTGAAGGTAGCTATATCGATAGCTGCTTCGTGCCGGAGATGCTGAGCCGCTTCAAGACCGCGCGTC GTAAAGTTCTGAATGCAATGGAGCTGGCGCAGAAAAAGGGTATCAATATCACTGCCCTGGGTGGCT TTACCTCCATTATCTTTGAGAACTTCAACCTGTTGCAGCACAAGCAAATCCGTAATACCAGCCTGG AGTGGGAGCGTTTCACCACGGGTAACACGCACACGGCATGGGTGATTTGTCGTCAGCTGGAGATCA ACGCACCGCGCATTGGCATCGACCTGAAAACTGCAACGGTCGCTGTTATCGGCGCGACCGGCGATA TTGGTAGCGCGGTGTGTCGCTGGCTGGTCAATAAGACCGGCATTAGCGAACTGCTGATGGTCGCTC GCCAACAACAGCCACTGACCCTGCTGCAAAAAGAACTGGACGGTGGCACCATCAAGAGCCTGGATG AAGCCCTGCCGCAGGCGGATATTGTCGTGTGGGTTGCTTCGATGCCTAAGACGATCGAAATTGAGA TTGAAAACCTGAAAAAGCCGTGCCTGATGATCGACGGTGGCTACCCGAAGAATCTGGACGAGAAAT TCAAAGGCAAAAACATTCACGTGTTGAAGGGTGGTATCGTCGAGTTTTTCAACGACATTGGCTGGA ACATGATGGAGTTGGCGGAGATGCAAAACCCGCAGCGTGAGATGTTTGCGTGCTTCGCCGAAGCTA TGATTCTGGAGTTTGAGAAATGCCATACCAACTTTAGCTGGGGCCGTAACAATATCAGCTTGGAGA AGATGGAGTTCATCGGTGCTGCATCTCTGAAGCACGGTTTCAGCGCGATCGGTCTGGATAAACAGC CGAAAGTCTTGACCGTTTGAaattGAATTCGGTTTTCCGTCCTGTCTTGATTTTCAAGCAAACAAT GCCTCCGATTTCTAATCGGAGGCATTTGTTTTTGTTTATTGCAAAAACAAAAAATATTGTTACAAA TTTTTACAGGCTATTAAGCCTACCGTCATAAATAATTTGCCATTTACTAGTTTTTAATTAACCAGA ACCTTGACCGAACGCAGCGGTGGTAACGGCGCAGTGGCGGTTTTCATGGCTTGTTATGACTGTTTT TTTGGGGTACAGTCTATGCCTCGGGCATCCAAGCAGCAAGCGCGTTACGCCGTGGGTCGATGTTTG ATGTTATGGAGCAGCAACGATGTTACGCAGCAGGGCAGTCGCCCTAAAACAAAGTTAAACATCATG AGGGAAGCGGTGATCGCCGAAGTATCGACTCAACTATCAGAGGTAGTTGGCGTCATCGAGCGCCAT CTCGAACCGACGTTGCTGGCCGTACATTTGTACGGCTCCGCAGTGGATGGCGGCCTGAAGCCACAC AGTGATATTGATTTGCTGGTTACGGTGACCGTAAGGCTTGATGAAACAACGCGGCGAGCTTTGATC AACGACCTTTTGGAAACTTCGGCTTCCCCTGGAGAGAGCGAGATTCTCCGCGCTGTAGAAGTCACC ATTGTTGTGCACGACGACATCATTCCGTGGCGTTATCCAGCTAAGCGCGAACTGCAATTTGGAGAA TGGCAGCGCAATGACATTCTTGCAGGTATCTTCGAGCCAGCCACGATCGACATTGATCTGGCTATC TTGCTGACAAAAGCAAGAGAACATAGCGTTGCCTTGGTAGGTCCAGCGGCGGAGGAACTCTTTGAT CCGGTTCCTGAACAGGATCTATTTGAGGCGCTAAATGAAACCTTAACGCTATGGAACTCGCCGCCC GACTGGGCTGGCGATGAGCGAAATGTAGTGCTTACGTTGTCCCGCATTTGGTACAGCGCAGTAACC GGCAAAATCGCGCCGAAGGATGTCGCTGCCGACTGGGCAATGGAGCGCCTGCCGGCCCAGTATCAG CCCGTCATACTTGAAGCTAGACAGGCTTATCTTGGACAAGAAGAAGATCGCTTGGCCTCGCGCGCA GATCAGTTGGAAGAATTTGTCCACTACGTGAAAGGCGAGATCACCAAGGTAGTCGGCAAATAATGT CTAACAATTCGTTCAAGCCGACGCCGCTTCGCGGCGCGGCTTAACTCAAGCGTTAGATGCACTAAG CACATAATTGCTCACAGCCAAACTATCAGGTCAAGTCTGCTTTTATTATTTTTAAGCGTGCATAAT AAGCCCTACACAAATTGGGAGATATATCATGAGGCGCGCCACGAGTGCGGGGAAATTTCGGGGGCG ATCGCCCCTATATCGCAAAAAGGAGTTACCCCATCAGAGCTATAGTCGAGAAGAAAACCATCATTC ACTCAACAAGGCTATGTCAGAAGAGAAACTAGACCGGATCGAAGCAGCCCTAGAGCAATTGGATAA GGATGTGCAAACGCTCCAAACAGAGCTTCAGCAATCCCAAAAATGGCAGGACAGGACATGGGATGT TGTGAAGTGGGTAGGCGGAATCTCAGCGGGCCTAGCGGTGAGCGCTTCCATTGCCCTGTTCGGGTT GGTCTTTAGATTTTCTGTTTCCCTGCCATAAAAGCACATTCTTATAAGTCATACTTGTTTACATCA AGGAACAAAAACGGCATTGTGCCTTGCAAGGCACAATGTCTTTCTCTTATGCACAGATGGGGACTG GAAACCACACGCACAATTCCCTTAAAAAGCAACCGCAAAAAATAACCATCAAAATAAAACTGGACA AATTCTCATGTGggccggccaaaatgaagtgaagttcctatactttctagagaataggaacttcta tagtgagtcgaataagggcgacacaaaatttattctaaatgcataataaatactgataacatctta tagtttgtattatattttgtattatcgttgacatgtataattttgatatcaaaaactgattttccc tttattattttcgagatttattttcttaattctctttaacaaactagaaatattgtatatacaaaa aatcataaataatagatgaatagtttaattataggtgttcatcaatcgaaaaagcaacgtatctta tttaaagtgcgttgcttttttctcatttataaggttaaataattctcatatatcaagcaaagtgac aggcgcccttaaatattctgacaaatgctctttccctaaactccccccataaaaaaacccgccgaa gcgggtttttacgttatttgcggattaacgattactcgttatcagaaccgcccagggggcccgagc ttaagactggccgtcgttttacaacacagaaagagtttgtagaaacgcaaaaaggccatccgtcag gggccttctgcttagtttgatgcctggcagttccctactctcgccttccgcttcctcgctcactga ctcgctgcgctcggtcgttcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggtt atccacagaatcaggggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccaggaa ccgtaaaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaaa tcgacgctcaagtcagaggtggcgaaacccgacaggactataaagataccaggcgtttcccvctgg aagctccctcgtgcgctctcctgttccgaccctgccgcttaccggatacctgtccgcctttctccc ttcgggaagcgtggcgctttctcatagctcacgctgtaggtatctcagttcggtgtaggtcgttcg ctccaagctgggctgtgtgcacgaaccccccgttcagcccgaccgctgcgccttatccggtaacta tcgtcttgagtccaacccggtaagacacgacttatcgccactggcagcagccactggtaacaggat tagcagagcgaggtatgtaggcggtgctacagagttcttgaagtggtgggctaactacggctacac tagaagaacagtatttggtatctgcgctctgctgaagccagttaccttcggaaaaagagttggtag ctcttgatccggcaaacaaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattac gcgcagaaaaaaaggatctcaagaagatcctttgatcttttctacggggtctgacgctcagtggaa cgacgcgcgcgtaactcacgttaagggattttggtcatgagcttgcgccgtcccgtcaagtcagcg taatgctctgcttttaccaatgcttaatcagtgaggcacctatctcagcgatctgtctatttcgtt catccatagttgcctgactccccgtcgtgtagataactacgatacgggagggcttaccatctggcc ccagcgctgcgatgataccgcgagaaccacgctcaccggctccggatttatcagcaataaaccagc cagccggaagggccgagcgcagaagtggtcctgcaactttatccgcctccatccagtctattaatt gttgccgggaagctagagtaagtagttcgccagttaatagtttgcgcaacgttgttgccatcgcta caggcatcgtggtgtcacgctcgtcgtttggtatggcttcattcagctccggttcccaacgatcaa ggcgagttacatgatcccccatgttgtgcaaaaaagcggttagctccttcggtcctccgatcgttg tcagaagtaagttggccgcagtgttatcactcatggttatggcagcactgcataattctcttactg tcatgccatccgtaagatgcttttctgtgactggtgagtactcaaccaagtcattctgagaatagt gtatgcggcgaccgagttgctcttgcccggcgtcaatacgggataataccgcgccacatagcagaa ctttaaaagtgctcatcattggaaaacgttcttcggggcgaaaactctcaaggatcttaccgctgt tgagatccagttcgatgtaacccactcgtgcacccaactgatcttcagcatcttttactttcacca gcgtttctgggtgagcaaaaacaggaaggcaaaatgccgcaaaaaagggaataagggcgacacgga aatgttgaatactcatattcttcctttttcaatattattgaagcatttatcagggttattgtctca tgagcggatacatatttgaatgtatttagaaaaataaacaaataggggtcagtgttacaaccaatt aaccaattctgaacattatcgcgagcccatttatacctgaatatggctcataacaccccttgtttg cctggcggcagtagcgcggtggtcccacctgaccccatgccgaactcagaagtgaaacgccgtagc gccgatggtagtgtggggactccccatgcgagagtagggaactgccaggcatcaaataaaacgaaa ggctcagtcgaaagactgggcctttcgcccgggctaattatggggtgtcgcccttattcgactcta tagtgaagttcctattctctagaaagtataggaacttctgaagtggggcctgcagg SEQ ID NO: 18 plasmid pJB825t 1.sup.st underlined sequence Upstream homology region for TS1 chromosomal integration site 1.sup.st italic sequence cI promoter with JCC138 rbcL ribosome- binding sequence 1.sup.st bold sequence tll1313 (adm) coding sequence 1.sup.st lower case sequence Native intergenic sequence 2.sup.nd bold sequence tll1312 (aar) coding sequence 2.sup.nd italic sequence kan.sup.HTK coding sequence; thermostable kanamycin selection marker 2.sup.nd underlined sequence Downstream homology region for TS1 chromosomal integration site 2.sup.nd lower case sequence Vector backbone (SEQ ID NO: 18) TGGGAGTCAATAAACCCGATGTGCGTTGGATTTGCCACTACCAGCCGCCCCTGCAACTCAGTGAA TATCTCCAAGAGGTGGGACGCGCTGGGCGAGATGGCGAAGCGGCACAGGCCCTGGTTTTGGTGAG CGATCGCTGGGGCTTGGATCGCGAAGATCAACAGCGTTGGTCTTTTTTTCAGCACCAAAGTCAAG ACACCTACAATCGCGCCATGGCACTTCAGACGCAGCTGCCCCTCCAGGGTAATCTGCAGCAACTG CGGCAACACTTTCCTGAAGTGGAATTGACCCTGGCATTACTGCATCAACAGGGGGCCCTCCGCTG

GCAAGATCCCTTTCACTATTGCCGTCAACCCTTGGCACAGGTGCCACCCCCACCCAAAGACCCTC AAGAACAGTTGATGCAAAAGTTCCTCTATCACCGGGGCTGCCGCTGGCAGTTTCTCCTCCAAGCC TTTGGTTTTGCCACTGAGGCAAGGGGATTCCACTGTGGCCATTGCGATCGCTGTCGGCCGCCGCA CCGCTCCCGCAAAATACCGTAAATTGCCAGCGCTGTATCACTGGAATATTGGGTACACTGGCACA TAGAACGGTCGCTTTACCATTGGTAGGCAAAAGTTTCTCAGCAGTCATTCTGTTGCCGCAAGGTA GGGGTTGCAGGCATGGGGCTACTACAAGTTGAGGAAATTCGCGAAGCACTTCAAGATGTGCTTTC AGAACACGCCCTTGTTGTGCAAGTTAATCAGTTTCGCAACCAATTAAACATTATTTTGAACAAGC CCCCCGGCACCGTTGCCCATTATTCTGCCCTAGCGGATTTTCTCAAGTCGCGCTTGGGACAGTTT CATCTCAATGATATTGACCGCATTAAAATAATTGGCCGCATACAGGGTTCGCCTAAACCCGATTG GGAAGAGGTCATTGATCTACGTCCCCCCAACCCAGCCCTAGCTGCCCCTGTGTATGCTTCTTCTG CCCCGTGGGTGGTGGCGATCGCTGCTGGCTTTGTCAGTTTACTGGTGATCTTTAGCTATCACCTT GGTCAGTAGCAGCAACAGCAACGGCTGTAGCCGTTGATCGAAGGTTCCTTTGGTCAAAAGGGCGT CGTGATGACGGACTTTAAGTGGCACATTGAGGGTGGTACAGGGTTTATTGTCGGGGTTCTTAAAA ACTACAGTAAAGGGTATTTTCGCTTAGTTCAGGCGGACTTTGAACTCTTTGACCAAGGCGGTCAG CAAGTTGGGACAGTGGCGGTACAGGTTTATGGTCTTGGCCCTGAGGAAACATGGCAATTCCGTGA ACTGATAGCCAATCATCAGGCAGTGCGAGCACGGCTGGTAAAATTACAGTCATTCAATTAAGGTT TTTCTAATGTTTAGGTTTCCCCAGCAGGGAGCGACACCGCTTGCTATGGCACACCTTAAAGCCCT GATCTTTGATGTCGATGGCACCTTAGCAGATACGGAGCGGGATGGCCATCGTATCGCCTTCAACA AGGCCTTTGCCGCCGCTGGTCTAGATTGGGAATGGGACATTCCCCTCTATGGTCAACTCCTGGCG GTGGCTGGGGGCAAGGAGCGGATCCGGTATTACCTTGAGTGCTTTCGTCCCGATTGGCCACGTCC CCAAAATTTGGATGCTCTGATTGCCGATTTACACAAGGCCAAGACCCGCTATTATACCGAGCTAT TGGCGGCAGGGGCTATTCCCCTGCGGCCGGGGGTGAAACGGCTCCTCACTGAAGCCCGGGAAGCA GGATTACGTTTGGCGATCGCCACCACGACCACCCCTGCCAATGTCACCGCACTCCTTGAAAATGC CCTCGCTCCTGATGGCGTCAGTTGGTTTGAGATAATTGCTGCCGGGGATGTAGTTCCAGCCAAGA AACCCGCGCCCGACATTTACTTCTACACGCTTGAAAAGATGCGCCTCTCACCCCAAGAGTGCCTT GCCTTTGAGGATTCCGCCAATGGGATTCAGGCGGCCACTGCCAGTCACCTAGCGACCATTATCAC GATTACCGACTACACCAAGGATCATGATTTTCGTGATGCAGCGCTGGTCTTGGATTGCTTAGGGG AACCGGACTACCCCTTTCAGGTTCTGCGCGGTGAGGTGGGTTGGACAACCTATGTGGATGTCCCC CTATTGCGATCGCTGCACCAGCAGTGGACAAGCACGTTGAGTCAGGGATAATTTTCTGGCCGCAG CGTTTTACATTGAATATGACCCCCTTAGTCTGAGGATCAAGGAACATAATGTACACGATTGATTT AATTCTGCGTCATGTCCCCATGCCCGTCAGCATTGAACGCAAGGAAAGTGCAGCAGCGATGGCAG TCTATCAGCAAATTCAGCAGGCCATGGCCAGTGGTACTCCAACTTTCCTCGAACTGACGTGCGAT CGCCAAGTGGGCAAGAAGTTAACGGTGCTCACCTCAGAAATTGTCGCCGTGCAAATGGCGGATAA GGATGCCCCCTCCAGTACTATCAGTCGTGGGGGATTCTTTGCTCAATTAGTGCAGCAAACCAGCA ACTGAGGGAAAATGCCTCAATAAAGTTGAGTTTTTCTTGGCAATGCTGATTCTTTGCCGTTAGGA TACTAAGCAGACCGATCCGTAGGGGAACGTGAAGCAAATCCTCCCCGTCTGAAAGTCAGGTATCT CTGGTGTGTCGTAATAGGGTTGTCTATGGTGCAGCGTTTCCTGCCGGTTCTGATTTTGTTGGGGT GTAGTTTTGGTCTTGCGACCCCTGCCCTTGTGCGTGCCCAAGCCAATCAGGGCTTTACGTTTACT TGGGGTGAGGGGCCGAGTGGCCGACAGCAGTTGCAATACCACTTAGATAACGGCACCCCCGGTTT TATGGGCGATCGCTATTGGCTGCGGCTGGGTCAGCAGAAAGTGGCCATCAATCGCATTAACATTA CCTATCCCGACTACTACAACGGTATTATTGATCCCAAAGGCATTGAGGTGCGCATCGGTGGCGAT CGCGGCAATCGCTTCTTCCAATTTCGCCGTGACCCCGGCACCAAAATTCAATTGGCGGAAGTCTC CGTTGATCGCGATAACCGCGTGATTGATATTGTGCCGGCTGAGGTGATTCCCGCCGGAACACCGG TGCAAGTTATTCTCAATAATGTGCGCAACCCTAACAATGGCGGCATGTACTATTTCAATGCCCGC ATTGGCTCCCCTGGAGATATTCCCCTCATGCGCTACGTTGGCACCTGGATTCTCAGCATTGCCAA TAACTAAAACCCGTCAAACTCGAGCATTGGTGAGCGGGTTAGCCATTTCTAACTATTGCGGGGCG ATCGCCCTAGACTAGTTTTTTGTCTATTATTGCCGGTTCACTCTTTACACCAGATGCCAGATTCC GTTAGGTCTTCATTCCCCTCCATTTCTCCTCTGCTCACGCCTCTGATGTACCGCCTCGTGGGGGA CGTTGTCCTGCGGCGCTATTTTCGTACCCTTGAGGTGCAAGGGCAGGAGCGGGTGCCCCAAAGGG GTCCAGTGATCTTGGCCCCCACCCACCGTTCCCGCTGGGATGCGCTGATTATTCCCTATGTCACT GGGCGGCGGGTGAGTGGGCGCGACCTCTACTACATGGTGTCCCACGATGAGATGTTGGGACTACA GGGCTGGGTGATTGCTCAGTGTGGCGGTTTTCCCGTCAATACCCAAGCGCCTTCGGTGAGTGCGT TGCGTACGGGTGTGGAACTGCTCCGGCAGGGGCAAGCCTTGGTGGTGTTCCCTGAGGGGAATATC TTTCGCGATCGCCAGATTCATCCCCTCAAGCCGGGGTTGGCTCGCTTAGCCCTTCAGGCGGCCCA GCGCTGTGAACAAGCAATCCAGATTCTGCCAATTTTACTCGATTATGCCCAGCCCTACCCACAGT GGGGAAGTGCGGTCAAGGTAATCATTGGGGCTCCCTTGAGTACCGACAATTACGATGCCAGCCGG CCAAAAAGTGCTGCCCAACAACTGACCAGTGATCTCTTTAGAAGACTTCAGCAGCTCCAAGGGGG GCGATCGCCCCTGTGTTTTGCTTAGACCTCAAACTTCCATCCCCGCGGCCGCTCTTGATAACCCA AGAGGGCATTTTTTAGGCGCGCCTCGAGTAACACCGTGCGTGTTGACTATTTTACCTCTGGCGGT GATAATGGTTGCAGGATCCTTTTGCTGGAGGAAGAATTCATGACAACGGCTACCGCTACACCTGT TTTGGACTACCATAGCGATCGCTACAAGGATGCCTACAGCCGCATTAACGCCATTGTCATTGAAG GTGAACAGGAAGCTCACGATAACTATATCGATTTAGCCAAGCTGCTGCCACAACACCAAGAGGAA CTCACCCGCCTTGCCAAGATGGAAGCTCGCCACAAAAAGGGGTTTGAGGCCTGTGGTCGCAACCT GAGCGTAACGCCAGATATGGAATTTGCCAAAGCCTTCTTTGAAAAACTGCGCGCTAACTTTCAGA GGGCTCTGGCGGAGGGAAAAACTGCGACTTGTCTTCTGATTCAAGCTTTGATCATCGAATCCTTT GCGATCGCGGCCTACAACATCTACATCCCAATGGCGGATCCTTTCGCCCGTAAAATTACTGAGAG TGTTGTTAAGGACGAATACAGCCACCTCAACTTTGGCGAAATCTGGCTCAAGGAACACTTTGAAA GCGTCAAAGGAGAGCTCGAAGAAGCCAATCGCGCCAATTTACCCTTGGTCTGGAAAATGCTCAAC CAAGTGGAAGCAGATGCCAAAGTGCTCGGCATGGAAAAAGATGCCCTTGTGGAAGACTTCATGAT TCAGTACAGTGGTGCCCTAGAAAATATCGGCTTTACCACCCGCGAAATTATGAAGATGTCAGTTT ATGGCCTCACTGGGGCATAAtggtggcttaacgtatcgttacatttcagtcaccacacgcttgtA TGTTTGGATTAATTGGTCATCTGACGAGTCTGGAGCACGCCCAAGCCGTTGCCCATCAGTTGGGT TACCCCGAATATGCCGATCAAGGCTTGGAATTTTGGTGTATGGCACCGCCGCAGATCGTCGATGA GATTACGGTGACGAGCGTAACGGGCAAAACTATCTATGGCAAATACGTTGAGTCCTGCTTTTTAC CAGAGATGCTGGCCAACCAGCGGGTGAAGGCAGCGACTCGCAAAGTTATTAACGCCATGGCCCAT GCCCAAAAGCACAACATTGACATTACGGCCTTGGGGGGCTTCTCCTCGATCATCTTTGAGAACTT TGATCTGGAGAAAATGTCCCACATTCGCAACATTGAACTGGACTTTCGCCGCTTTACAACGGGGA ATACCCATACCGCCTATATCATCTGCCAACAAATTGAGCAGGCGGCGCCCCAAGTGGGGATTGAT TTGCGGCAGGCAACCGTGGCTGTTTGTGGGGCTACGGGGGATATTGGTAGTGCCGTCTGCCGTTG GTTGAATACCTGTTTAGATGTGCAAGATCTCTTACTCGTAGCACGGAATCGCGATCGCCTGCTGG AGCTACAGGCGGAATTGGGACGGGGGAAAATCCTCGACTTGATGGAGGCGCTGCCCCTTGCCGAT ATTGTGGTTTGGGTGGCCAGTATGCCCAAGGGAGTTGAGCTGAGCATTGAGCAGTTAAAACGCCC CTCCCTGATGATTGATGGTGGTTATCCCAAAAATATGGCCACCAAAATTCAGCACCCCCAGATTC ATGTTCTCAATGGTGGCATTGTCGAGCATGCCCTCGACATTGACTGGAAAATTATGGAAATTGTG AATATGGATGTGCCCTCGCGGCAGATGTTTGCCTGTTTTGCAGAGGCTATGCTTTTAGAGTTCGA GGGCTGGCACACCAATTTCTCTTGGGGACGCAATCAAATCACTGTGGAAAAGATGCAGCAAATTG GTGAGGTCTCCCGTAAACATGGATTTCAGCCACTACTGTTGAATCCTCAGTAAGCGGCCGCAAAA AAAACGGGCCGGCGTATTATCGCCGGCCCGAGTAACACCGTGCGTGTTGACTATTTTACCTCTGG CGGTGATAATGGTTGCAGGATCCTTTTGCTGGAGGAAAACCATATGAAAGGACCAATAATAATGA CTAGAGAAGAAAGAATGAAGATTGTTCATGAAATTAAGGAACGAATATTGGATAAATATGGGGAT GATGTTAAGGCAATTGGTGTTTATGGCTCTCTTGGTCGTCAGACTGATGGGCCCTATTCGGATAT TGAGATGATGTGTGTTCTGTCAACAGAGGGAGTAGAGTTCAGCTATGAATGGACAACCGGTGAGT GGAAGGCGGAAGTGAATTTTTATAGCGAAGAGATTCTACTAGATTATGCATCTCGGGTGGAACCG GATTGGCCGCTTACACATGGTCGATTTTTCTCTATTTTGCCGATTTATGATCCAGGTGGATACTT TGAGAAAGTGTACCAAACTGCTAAATCGGTAGAAGCCCAAAAGTTCCACGATGCGATCTGTGCCC TTATCGTAGAAGAGCTGTTTGAATATGCAGGCAAATGGCGTAATATTCGTGTGCAAGGACCGACA ACATTTCTACCATCCTTGACTGTACAGGTGGCAATGGCAGGTGCCATGTTGATTGGTCTGCATCA TCGCATCTGTTATACGACGAGCGCTTCGGTCTTAACTGAAGCAGTTAAGCAACCAGATCTTCCTC CAGGTTATGTCCAACTGTGCCAGCTCGTAATGTCTGGTCAACTTTCCGACCCTGAGAAACTTCTG GAATCGCTAGAGAATTTCTGGAATGGGGTTCAGGAGTGGGCGGAACGACACGGATATATAGTGGA TGTGTCAAAACGCATACCATTTTGATGTCTAACCCCCTTCCTTGCCCACAGCTTCGTCGATGGCG CGAAATTTCGGGTAAATATAATGACCCTCTTGATAACCCAAGAGGGCATTTTTTAGGCGCGCCCT AAGCGTCCGTAGGCACAATTAAGGCTTCAAATTGTTGGCGAAGCTGCTCAGTCACTTCCTTGACG GCTTGCCGTGCCCCTTGGCGATCGCGCCGGTACAGAGGCCAATAGCTCTCTAAATTGAGAGGGTC GCCGACACTGAGGCGCACCTGCCGCAAACCCACCAAACGATTGAGATTCGAGCTTTTTCCCTCTA GCCAATCAAATGTGCGCCAGAGAATCAGCGCGACATCTGCAAAGCGATGAATCGTGAATTTCTCA CGGATATAGCTACCCGTAATTGAGGTAAATCGCTCCGCAAGACGCATATGACGCAATCGCACATT GGCTTCCTCGGCCAACCAATCGGCTAGGCAGCGCTCTACGGCCGAAAGTTGTGCCAAATCACTGC GAAACATCCGTTCCCAAGCAGCCTGTTCAATGCGTCGGCAGCGACTCACAAAATCGGCACTGGGC TTCAGACCAAAGTAGGACTCTGCCACCACAAGGGCGCTGTTGAGGAGGCGCTGAATTCGCGCTGC CAATTTAGCATTGGCAGAGTCAAAGGGGGGCAGTTCGGGAAAATCTTGACCATAGGAGGTGGCAT AAAAAGCCTCCAGGCGATCCAAGAGGTGGATCGCTAAATTCAGCAGGCGGCGGTAGAGGTCGTCT GGCTGGGTACTGTGAGAATCTGTAGGGCACCCAAGGCGGTTCTCCAGTTGTGCCATCAGCCTTGC CATGCGCTCCCAAGAGGGCTGACTGAGGCTGTACTGAATGCCAATGGGAAGAATGACCACGGGGA GCGATCGCCCCGCCTTGGCTAAATCTTCTAGACACCAAAATCCCAGTTGGGCCACCCCCGGCTCC AAAGGTGCGACCAGTTCGTTGTGCTCATTCGTTGCTCCCTCCGGCGCTGCCGCTAGGGGAAATCG TCCTCCGAGAAGTAGCTCCCGCGCTGAGCGCAGGGCTTGGCTATCGAGCTTACCGCGCATGATGG AAATCCCCCCCAACCGTGAAAAGAGCCAACCAATCTGCGCCCCTGCCCAGAGGGGAATCCCGCGA TCGTAGAGAAAATAGCCATTTGTCGGCGGACGCAAGGGAATGCCCAGCCGCCGTGCTGTTTGCGG CAGTAAATGCCACATCAAATAGCCCATCACCAACGGATCATCCGTACAGGGATGGCGAAAGGCAA TGAGGAGCCGGACCTGTCCCTGCTGAAACTGCTGGTAATAACGGGCAAGGGTCTCCACATTCACC CCTTCAACCCGCTGTAGCCCAAGACCATAGCGAATGTAGAGGGGCAGGAGTCTTGCTACTGTCCA CCAGACGGGGTAGCTAAACCGCTGGGGGAGAAAATGCAACGGCGGTTGGGCAGTTGTCACTACAC TGGACATTAGGCAAGCTCCTCAGGGCAATGGCTAAACTGAGGCAGTGGCCAACTCCGCAATTAAC TGCTCTAACATCGGTTGATCGGCCCAATAGACAGCATTACAAAACTGACAGGTGGCTTCTGCCTT

TGCCTCTGTGGCTAGGATATCTCTTAATTCTGCCTCCCCTAGGAGCTTGAGTGCCGCTAACATCC GTTCATGGGAACAGCCACAGTGGAAGCGCACCATTTGCCGTTGGGGCAAGATTTGTAAATCCATA TCCCCTAAGAGTTCCTGAAAGATATCTGGCAGTGTCCGCCCTGCCTGTAGCAGTGGTGTAAAGCC CTTAAGATTGGCCACCCGTTGTTCAAGGGTCGCGATCAGGTGTTCATCATTGGCCGCTTTGGGTA GCACCTGTAACATCAACCCACCGGCGGCAGTCACCCCGGACTCTTCGACAAAAACACCCAACATC AGGGCGGAGGGGGTTTGCTCTGAGGTGGCGAGGTAGTAGGTGATGTCTTCTGCAATTTCGCCGGA GACTAGCTCCACCGTGCTGGAATAGGGGTAGCCGTAGCCAAGATCGTGGATGACGTAGAGATATC CCTGATGGCCCACCGCTGCCCCCACATCGAGTTTGCCCTTGGCATTGGGGGGCAGTTCAACACTG GGGTACTGCACATAGCCGCGAACTGTGCCATCGGCACCAGCATCGGCAAAAATGGTTCCTAGGGG ACCGTTGCCCTGAATGCGCACATTCACCCGTGCTTGGGGCTGTTTGAAACTGGAGGCAAGGATTA AGCCTGCGGCCATGGTTCGTCCCAAGGCCGCTGTGGCCACGTAGGACAGTTGGTGACGTTTGCGG GCTTCATCAGTGAGTTGAGTGGTAATCACACCTACGGCCCGGATGCCTTCGGCAGCGGCAGTTGC TCGCAACAGAAAATCGGCCATGTTCAACCTACGAAATGTTTTGTTACATTTAGTGTGACATACTC CCACCGCTGACCAGGGCACAATGGGGCAAAAAACCATCAATCCTGCCTTTGGTGACCGATCCAGT ACAGCCAGCCAGGGCTTAAGACTGGGAAGACCCCTAGCACTGGGGCTAGAAAATTGGCGATGATA GGCAAGCAATAGTCATTCAGCGTCCAGTCATTCCGCCTATGGCCATGCCCCTCACTGTCTTGCCT GCCACAACTGTTTTGACAGAAGCGACTCAATTGCCCCAGGGCGGCTTGATTACGGAGATTCCGAC GCTGGCGATCGCCCACCGTTTGGCCCAGCAGTTGCGCCGCCATTGGCCCCTAGAGACCCCCTTAA CGCTGATTGATGCGCAATACCAGAGTATCCCCCTGACCCTTGGGGAATTGGCCGAGCTCACCGAT GCCAACTGTCCTTTACAGCTCTATGTGCCGCCCCCCTTGCCAGAGGCCTTGACGCAATTTCAACG CCTGATGGATGTGGTTCGAGAGCTGCGCCATCCGGAGCGTGGCTGTCCTTGGGATTTGCAGCAAA CCCCAACCAGTCTCATTCCCTATGTCCTTGAGGAAGCCTATGAAGTGGTACATGCCCTGCAGGAG GGAGATGCGGGGGCGATCGCCGAAGAATTGGGAGACCTGTTGCTTCAAGTTGTTCTCCAGAGCCA ACTTGCCCAAGAAGCCGGCCAATTTACCCTTGCTCAAGTCATTCAAAGGATTACCGATAAACTCA TCCGCCGCCATCCCCACGTCTTTGGTGAAGTGGCACTCACCACTGCTCAAGAGGTGCGCGACCAA TGGGAGCAAATCAAAGCGGCTGAAAAAGGCACCGAACTCCCCCTGAGTCAAACGCTGCAACGTTA CGCACGCACCCTCCCACCCCTGATGGCCGGCATGAAAATTGGTGAGCGAGCCAGTCGCGCTGGCC TCGATTGGCCGACGATTAGTGGTGCATGGGAGAAATTTTACGAGGAACTGGCGGAGTTTCAGGAG GCCCTTCTGCAAGGGAATGCTGAGCAACAGGCAGCGGAATTAGGAGACCTGCTCTTCAGTGTGAT TAACCTTGCCCGCTGGTGCCAACTGGATCCTGTTAATGCCCTGCAACAAACCTACCAACGCTTTA TTCAACGCTTGGCCTGTATTGAGGCAGTCATCGATCGCCCCCTTGAGACGTACACCCTAGAAGAA CTAGAAGCCCTCTGGCAACAGGCCAAAGTACAGTTAGCCACCGACAGCGAGGCAACCCCTATGGA GACTGAGGAAGAGGCCTAGTCCGCTGCGGCCCTTGCCACCTTCAGTTCATCGAGATTCCACAGGG GGCCCCCCAGCGCCGTGGGCTTGGCGCCAATGACATGATTGCGAAAAGCTGTAAGGGAGAGGGGA TTCACGAGGTAAATAAAGGGGAGATATTCCTGAGCTAGTCGTTGGGCTTCCGCATAAATTTGCTG CCGTCGTTCCAGATTGAGCTCCTGGGCACCTTGGACATACAGGTCACTGATGCGCTGCTCCCAGT CAGCGACGACTCGACCCGTAATGGGTGGTTGATTCGGTGACGGTTGCTGATTGAATGTATGCAAA AGGCCATCCACACGCCAGATATTGGCACCGCTATTGGGTTCATTGCCCCCCCCAGTAAAGCCGAG GATATGGGCTTCCCACTCTAGGGAATTGGAGAGACGATCCACGAGGGTACCAAAGGCCAAAAATT GCAGATCCACCTGCATGCCGATCGCCCCTAGGTCCTGCTGAACTTGCGTCGggccggccaaaatg aagtgaagttcctatactttctagagaataggaacttctatagtgagtcgaataagggcgacaca aaatttattctaaatgcataataaatactgataacatcttatagtttgtattatattttgtatta tcgttgacatgtataattttgatatcaaaaactgattttccctttattattttcgagatttattt tcttaattctctttaacaaactagaaatattgtatatacaaaaaatcataaataatagatgaata gtttaattataggtgttcatcaatcgaaaaagcaacgtatcttatttaaagtgcgttgctttttt ctcatttataaggttaaataattctcatatatcaagcaaagtgacaggcgcccttaaatattctg acaaatgctctttccctaaactccccccataaaaaaacccgccgaagcgggtttttacgttattt gcggattaacgattactcgttatcagaaccgcccagggggcccgagcttaagactggccgtcgtt ttacaacacagaaagagtttgtagaaacgcaaaaaggccatccgtcaggggccttctgcttagtt tgatgcctggcagttccctactctcgccttccgcttcctcgctcactgactcgctgcgctcggtc gttcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttatccacagaatcagg ggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccaggaaccgtaaaaaggccg cgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaaatcgacgctcaagt cagaggtggcgaaacccgacaggactataaagataccaggcgtttccccctggaagctccctcgt gcgctctcctgttccgaccctgccgcttaccggatacctgtccgcctttctcccttcgggaagcg tggcgctttctcatagctcacgctgtaggtatctcagttcggtgtaggtcgttcgctccaagctg ggctgtgtgcacgaaccccccgttcagcccgaccgctgcgccttatccggtaactatcgtcttga gtccaacccggtaagacacgacttatcgccactggcagcagccactggtaacaggattagcagag cgaggtatgtaggcggtgctacagagttcttgaagtggtgggctaactacggctacactagaaga acagtatttggtatctgcgctctgctgaagccagttaccttcggaaaaagagttggtagctcttg atccggcaaacaaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgca gaaaaaaaggatctcaagaagatcctttgatcttttctacggggtctgacgctcagtggaacgac gcgcgcgtaactcacgttaagggattttggtcatgagcttgcgccgtcccgtcaagtcagcgtaa tgctctgcttttaccaatgcttaatcagtgaggcacctatctcagcgatctgtctatttcgttca tccatagttgcctgactccccgtcgtgtagataactacgatacgggagggcttaccatctggccc cagcgctgcgatgataccgcgagaaccacgctcaccggctccggatttatcagcaataaaccagc cagccggaagggccgagcgcagaagtggtcctgcaactttatccgcctccatccagtctattaat tgttgccgggaagctagagtaagtagttcgccagttaatagtttgcgcaacgttgttgccatcgc tacaggcatcgtggtgtcacgctcgtcgtttggtatggcttcattcagctccggttcccaacgat caaggcgagttacatgatcccccatgttgtgcaaaaaagcggttagctccttcggtcctccgatc gttgtcagaagtaagttggccgcagtgttatcactcatggttatggcagcactgcataattctct tactgtcatgccatccgtaagatgcttttctgtgactggtgagtactcaaccaagtcattctgag aatagtgtatgcggcgaccgagttgctcttgcccggcgtcaatacgggataataccgcgccacat agcagaactttaaaagtgctcatcattggaaaacgttcttcggggcgaaaactctcaaggatctt accgctgttgagatccagttcgatgtaacccactcgtgcacccaactgatcttcagcatctttta ctttcaccagcgtttctgggtgagcaaaaacaggaaggcaaaatgccgcaaaaaagggaataagg gcgacacggaaatgttgaatactcatattcttcctttttcaatattattgaagcatttatcaggg ttattgtctcatgagcggatacatatttgaatgtatttagaaaaataaacaaataggggtcagtg ttacaaccaattaaccaattctgaacattatcgcgagcccatttatacctgaatatggctcataa caccccttgtttgcctggcggcagtagcgcggtggtcccacctgaccccatgccgaactcagaag tgaaacgccgtagcgccgatggtagtgtggggactccccatgcgagagtagggaactgccaggca tcaaataaaacgaaaggctcagtcgaaagactgggcctttcgcccgggctaattatggggtgtcg cccttattcgactctatagtgaagttcctattctctagaaagtataggaacttctgaagtggggc ctgcagg SEQ ID NO: 19 cI promoter used for transcription in pJB886. Terminal NotI and NdeI sites used for promoter exchanges are capitalized. (SEQ ID NO: 19) GCGGCCGCtcgagtaacaccgtgcgtgttgactattttacctctggcggtgataatggt tgcaggatccttttgctggaggaaaacCATATG SEQ ID NO: 20 cpcB promoter used for transcription in pJB887. (SEQ ID NO: 20) GCGGCCGCttcgttataaaataaacttaacaaatctatacccacctgtagagaagagtc cctgaatatcaaaatggtgggataaaaagctcaaaaaggaaagtaggctgtggttccct aggcaacagtcttccctaccccactggaaactaaaaaaacgagaaaagttcgcaccgaa catcaattgcataattttagccctaaaacataagctgaacgaaactggttgtcttccct tcccaatccaggacaatctgagaatcccctgcaacattacttaacaaaaaagcaggaat aaaattaacaagatgtaacagacataagtcccatcaccgttgtataaagttaactgtgg gattgcaaaagcattcaagcctaggcgctgagctgtttgagcatcccggtggcccttgt cgctgcctccgtgtttctccctggatttatttaggtaatatctctcataaatccccggg tagttaacgaaagttaatggagatcagtaacaataactctagggtcattactttggact ccctcagtttatccgggggaattgtgtttaagaaaatcccaactcataaagtcaagtag gagattaatCATATG SEQ ID NO: 21 lacI-trc promoter used for transcription in pJB889. Terminal NotI and NdeI sites used for promoter exchanges are capitalized. (SEQ ID NO: 21) GCGGCCGCgaaggcgaagcggcatgcatttacgttgacaccatcgaatggtgcaaaacc tttcgcggtatggcatgatagcgcccggaagagagtcaattcagggtggtgaatatgaa accagtaacgttatacgatgtcgcagagtatgccggtgtctcttatcagaccgtttccc gcgtggtgaaccaggccagccacgtttctgcgaaaacgcgggaaaaagtggaagcggcg atggcggagctgaattacattcccaaccgcgtggcacaacaactggcgggcaaacagtc gttgctgattggcgttgccacctccagtctggccctgcacgcgccgtcgcaaattgtcg cggcgattaaatctcgcgccgatcaactgggtgccagcgtggtggtgtcgatggtagaa cgaagcggcgtcgaagcctgtaaagcggcggtgcacaatcttctcgcgcaacgcgtcag tgggctgatcattaactatccgctggatgaccaggatgccattgctgtggaagctgcct gcactaatgttccggcgttatttcttgatgtctctgaccagacacccatcaacagtatt attttctcccatgaagacggtacgcgactgggcgtggagcatctggtcgcattgggtca ccagcaaatcgcgctgttagcgggcccattaagttctgtctcggcgcgtctgcgtctgg ctggctggcataaatatctcactcgcaatcaaattcagccgatagcggaacgggaaggc gactggagtgccatgtccggttttcaacaaaccatgcaaatgctgaatgagggcatcgt tcccactgcgatgctggttgccaacgatcagatggcgctgggcgcaatgcgcgccatta ccgagtccgggctgcgcgttggtgcggatatctcggtagtgggatacgacgataccgaa gacagctcatgttatatcccgccgtcaaccaccatcaaacaggattttcgcctgctggg gcaaaccagcgtggaccgcttgctgcaactctctcagggccaggcggtgaagggcaatc agctgttgcccgtctcactggtgaaaagaaaaaccaccctggcgcccaatacgcaaacc gcctctccccgcgcgttggccgattcattaatgcagctggcacgacaggtttcccgact ggaaagcgggcagtgagcgcaacgcaattaatgtgagttagcgcgaattgatctccttt gacagcttatcatcgagctcgactgcacggtgcaccaatgcttctggcgtcaggcagcc

atcggaagctgtggtatggctgtgcaggtcgtaaatcactgcataattcgtgtcgctca aggcgcactcccgttctggataatgttttttgcgccgacatcataacggttctggcaaa tattctgaaatgagctgttgacaattaatcatccggctcgtataatgtgtggaattgtg agcggataacaatttcacacaggaaacagCATATG SEQ ID NO: 22 EM7 promoter used for transcription in pJB888. Terminal NotI and NdeI sites used for promoter exchanges are capitalized. (SEQ ID NO: 22) GCGGCCGCtgttgacaattaatcatcggcatagtatatcggcatagtataatacgacaa ggtgaggaactaaCATATG

Sequence CWU 1

1

12811029DNAThermosynechococcus elongatus 1atgtttggat taattggtca tctgacgagt ctggagcacg cccaagccgt tgcccatcag 60ttgggttacc ccgaatatgc cgatcaaggc ttggaatttt ggtgtatggc accgccgcag 120atcgtcgatg agattacggt gacgagcgta acgggcaaaa ctatctatgg caaatacgtt 180gagtcctgct ttttaccaga gatgctggcc aaccagcggg tgaaggcagc gactcgcaaa 240gttattaacg ccatggccca tgcccaaaag cacaacattg acattacggc cttggggggc 300ttctcctcga tcatctttga gaactttgat ctggagaaaa tgtcccacat tcgcaacatt 360gaactggact ttcgccgctt tacaacgggg aatacccata ccgcctatat catctgccaa 420caaattgagc aggcggcgcc ccaagtgggg attgatttgc ggcaggcaac cgtggctgtt 480tgtggggcta cgggggatat tggtagtgcc gtctgccgtt ggttgaatac ctgtttagat 540gtgcaagatc tcttactcgt agcacggaat cgcgatcgcc tgctggagct acaggcggaa 600ttgggacggg ggaaaatcct cgacttgatg gaggcgctgc cccttgccga tattgtggtt 660tgggtggcca gtatgcccaa gggagttgag ctgagcattg agcagttaaa acgcccctcc 720ctgatgattg atggtggtta tcccaaaaat atggccacca aaattcagca cccccagatt 780catgttctca atggtggcat tgtcgagcat gccctcgaca ttgactggaa aattatggaa 840attgtgaata tggatgtgcc ctcgcggcag atgtttgcct gttttgcaga ggctatgctt 900ttagagttcg agggctggca caccaatttc tcttggggac gcaatcaaat cactgtggaa 960aagatgcagc aaattggtga ggtctcccgt aaacatggat ttcagccact actgttgaat 1020cctcagtaa 10292342PRTThermosynechococcus elongatus 2Met Phe Gly Leu Ile Gly His Leu Thr Ser Leu Glu His Ala Gln Ala 1 5 10 15 Val Ala His Gln Leu Gly Tyr Pro Glu Tyr Ala Asp Gln Gly Leu Glu 20 25 30 Phe Trp Cys Met Ala Pro Pro Gln Ile Val Asp Glu Ile Thr Val Thr 35 40 45 Ser Val Thr Gly Lys Thr Ile Tyr Gly Lys Tyr Val Glu Ser Cys Phe 50 55 60 Leu Pro Glu Met Leu Ala Asn Gln Arg Val Lys Ala Ala Thr Arg Lys 65 70 75 80 Val Ile Asn Ala Met Ala His Ala Gln Lys His Asn Ile Asp Ile Thr 85 90 95 Ala Leu Gly Gly Phe Ser Ser Ile Ile Phe Glu Asn Phe Asp Leu Glu 100 105 110 Lys Met Ser His Ile Arg Asn Ile Glu Leu Asp Phe Arg Arg Phe Thr 115 120 125 Thr Gly Asn Thr His Thr Ala Tyr Ile Ile Cys Gln Gln Ile Glu Gln 130 135 140 Ala Ala Pro Gln Val Gly Ile Asp Leu Arg Gln Ala Thr Val Ala Val 145 150 155 160 Cys Gly Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Asn 165 170 175 Thr Cys Leu Asp Val Gln Asp Leu Leu Leu Val Ala Arg Asn Arg Asp 180 185 190 Arg Leu Leu Glu Leu Gln Ala Glu Leu Gly Arg Gly Lys Ile Leu Asp 195 200 205 Leu Met Glu Ala Leu Pro Leu Ala Asp Ile Val Val Trp Val Ala Ser 210 215 220 Met Pro Lys Gly Val Glu Leu Ser Ile Glu Gln Leu Lys Arg Pro Ser 225 230 235 240 Leu Met Ile Asp Gly Gly Tyr Pro Lys Asn Met Ala Thr Lys Ile Gln 245 250 255 His Pro Gln Ile His Val Leu Asn Gly Gly Ile Val Glu His Ala Leu 260 265 270 Asp Ile Asp Trp Lys Ile Met Glu Ile Val Asn Met Asp Val Pro Ser 275 280 285 Arg Gln Met Phe Ala Cys Phe Ala Glu Ala Met Leu Leu Glu Phe Glu 290 295 300 Gly Trp His Thr Asn Phe Ser Trp Gly Arg Asn Gln Ile Thr Val Glu 305 310 315 320 Lys Met Gln Gln Ile Gly Glu Val Ser Arg Lys His Gly Phe Gln Pro 325 330 335 Leu Leu Leu Asn Pro Gln 340 3696DNAThermosynechococcus elongatus 3atgacaacgg ctaccgctac acctgttttg gactaccata gcgatcgcta caaggatgcc 60tacagccgca ttaacgccat tgtcattgaa ggtgaacagg aagctcacga taactatatc 120gatttagcca agctgctgcc acaacaccaa gaggaactca cccgccttgc caagatggaa 180gctcgccaca aaaaggggtt tgaggcctgt ggtcgcaacc tgagcgtaac gccagatatg 240gaatttgcca aagccttctt tgaaaaactg cgcgctaact ttcagagggc tctggcggag 300ggaaaaactg cgacttgtct tctgattcaa gctttgatca tcgaatcctt tgcgatcgcg 360gcctacaaca tctacatccc aatggcggat cctttcgccc gtaaaattac tgagagtgtt 420gttaaggacg aatacagcca cctcaacttt ggcgaaatct ggctcaagga acactttgaa 480agcgtcaaag gagagctcga agaagccaat cgcgccaatt tacccttggt ctggaaaatg 540ctcaaccaag tggaagcaga tgccaaagtg ctcggcatgg aaaaagatgc ccttgtggaa 600gacttcatga ttcagtacag tggtgcccta gaaaatatcg gctttaccac ccgcgaaatt 660atgaagatgt cagtttatgg cctcactggg gcataa 6964231PRTThermosynechococcus elongatus 4Met Thr Thr Ala Thr Ala Thr Pro Val Leu Asp Tyr His Ser Asp Arg 1 5 10 15 Tyr Lys Asp Ala Tyr Ser Arg Ile Asn Ala Ile Val Ile Glu Gly Glu 20 25 30 Gln Glu Ala His Asp Asn Tyr Ile Asp Leu Ala Lys Leu Leu Pro Gln 35 40 45 His Gln Glu Glu Leu Thr Arg Leu Ala Lys Met Glu Ala Arg His Lys 50 55 60 Lys Gly Phe Glu Ala Cys Gly Arg Asn Leu Ser Val Thr Pro Asp Met 65 70 75 80 Glu Phe Ala Lys Ala Phe Phe Glu Lys Leu Arg Ala Asn Phe Gln Arg 85 90 95 Ala Leu Ala Glu Gly Lys Thr Ala Thr Cys Leu Leu Ile Gln Ala Leu 100 105 110 Ile Ile Glu Ser Phe Ala Ile Ala Ala Tyr Asn Ile Tyr Ile Pro Met 115 120 125 Ala Asp Pro Phe Ala Arg Lys Ile Thr Glu Ser Val Val Lys Asp Glu 130 135 140 Tyr Ser His Leu Asn Phe Gly Glu Ile Trp Leu Lys Glu His Phe Glu 145 150 155 160 Ser Val Lys Gly Glu Leu Glu Glu Ala Asn Arg Ala Asn Leu Pro Leu 165 170 175 Val Trp Lys Met Leu Asn Gln Val Glu Ala Asp Ala Lys Val Leu Gly 180 185 190 Met Glu Lys Asp Ala Leu Val Glu Asp Phe Met Ile Gln Tyr Ser Gly 195 200 205 Ala Leu Glu Asn Ile Gly Phe Thr Thr Arg Glu Ile Met Lys Met Ser 210 215 220 Val Tyr Gly Leu Thr Gly Ala 225 230 51026DNASynechococcus elongatus 5atgttcggtc ttatcggtca tctcaccagt ttggagcagg cccgcgacgt ttctcgcagg 60atgggctacg acgaatacgc cgatcaagga ttggagtttt ggagtagcgc tcctcctcaa 120atcgttgatg aaatcacagt caccagtgcc acaggcaagg tgattcacgg tcgctacatc 180gaatcgtgtt tcttgccgga aatgctggcg gcgcgccgct tcaaaacagc cacgcgcaaa 240gttctcaatg ccatgtccca tgcccaaaaa cacggcatcg acatctcggc cttggggggc 300tttacctcga ttattttcga gaatttcgat ttggccagtt tgcggcaagt gcgcgacact 360accttggagt ttgaacggtt caccaccggc aatactcaca cggcctacgt aatctgtaga 420caggtggaag ccgctgctaa aacgctgggc atcgacatta cccaagcgac agtagcggtt 480gtcggcgcga ctggcgatat cggtagcgct gtctgccgct ggctcgacct caaactgggt 540gtcggtgatt tgatcctgac ggcgcgcaat caggagcgtt tggataacct gcaggctgaa 600ctcggccggg gcaagattct gcccttggaa gccgctctgc cggaagctga ctttatcgtg 660tgggtcgcca gtatgcctca gggcgtagtg atcgacccag caaccctgaa gcaaccctgc 720gtcctaatcg acgggggcta ccccaaaaac ttgggcagca aagtccaagg tgagggcatc 780tatgtcctca atggcggggt agttgaacat tgcttcgaca tcgactggca gatcatgtcc 840gctgcagaga tggcgcggcc cgagcgccag atgtttgcct gctttgccga ggcgatgctc 900ttggaatttg aaggctggca tactaacttc tcctggggcc gcaaccaaat cacgatcgag 960aagatggaag cgatcggtga ggcatcggtg cgccacggct tccaaccctt ggcattggca 1020atttga 10266341PRTSynechococcus elongatus 6Met Phe Gly Leu Ile Gly His Leu Thr Ser Leu Glu Gln Ala Arg Asp 1 5 10 15 Val Ser Arg Arg Met Gly Tyr Asp Glu Tyr Ala Asp Gln Gly Leu Glu 20 25 30 Phe Trp Ser Ser Ala Pro Pro Gln Ile Val Asp Glu Ile Thr Val Thr 35 40 45 Ser Ala Thr Gly Lys Val Ile His Gly Arg Tyr Ile Glu Ser Cys Phe 50 55 60 Leu Pro Glu Met Leu Ala Ala Arg Arg Phe Lys Thr Ala Thr Arg Lys 65 70 75 80 Val Leu Asn Ala Met Ser His Ala Gln Lys His Gly Ile Asp Ile Ser 85 90 95 Ala Leu Gly Gly Phe Thr Ser Ile Ile Phe Glu Asn Phe Asp Leu Ala 100 105 110 Ser Leu Arg Gln Val Arg Asp Thr Thr Leu Glu Phe Glu Arg Phe Thr 115 120 125 Thr Gly Asn Thr His Thr Ala Tyr Val Ile Cys Arg Gln Val Glu Ala 130 135 140 Ala Ala Lys Thr Leu Gly Ile Asp Ile Thr Gln Ala Thr Val Ala Val 145 150 155 160 Val Gly Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Asp 165 170 175 Leu Lys Leu Gly Val Gly Asp Leu Ile Leu Thr Ala Arg Asn Gln Glu 180 185 190 Arg Leu Asp Asn Leu Gln Ala Glu Leu Gly Arg Gly Lys Ile Leu Pro 195 200 205 Leu Glu Ala Ala Leu Pro Glu Ala Asp Phe Ile Val Trp Val Ala Ser 210 215 220 Met Pro Gln Gly Val Val Ile Asp Pro Ala Thr Leu Lys Gln Pro Cys 225 230 235 240 Val Leu Ile Asp Gly Gly Tyr Pro Lys Asn Leu Gly Ser Lys Val Gln 245 250 255 Gly Glu Gly Ile Tyr Val Leu Asn Gly Gly Val Val Glu His Cys Phe 260 265 270 Asp Ile Asp Trp Gln Ile Met Ser Ala Ala Glu Met Ala Arg Pro Glu 275 280 285 Arg Gln Met Phe Ala Cys Phe Ala Glu Ala Met Leu Leu Glu Phe Glu 290 295 300 Gly Trp His Thr Asn Phe Ser Trp Gly Arg Asn Gln Ile Thr Ile Glu 305 310 315 320 Lys Met Glu Ala Ile Gly Glu Ala Ser Val Arg His Gly Phe Gln Pro 325 330 335 Leu Ala Leu Ala Ile 340 7696DNASynechococcus elongatus 7atgccgcagc ttgaagccag ccttgaactg gactttcaaa gcgagtccta caaagacgct 60tacagccgca tcaacgcgat cgtgattgaa ggcgaacaag aggcgttcga caactacaat 120cgccttgctg agatgctgcc cgaccagcgg gatgagcttc acaagctagc caagatggaa 180cagcgccaca tgaaaggctt tatggcctgt ggcaaaaatc tctccgtcac tcctgacatg 240ggttttgccc agaaattttt cgagcgcttg cacgagaact tcaaagcggc ggctgcggaa 300ggcaaggtcg tcacctgcct actgattcaa tcgctaatca tcgagtgctt tgcgatcgcg 360gcttacaaca tctacatccc agtggcggat gcttttgccc gcaaaatcac ggagggggtc 420gtgcgcgacg aatacctgca ccgcaacttc ggtgaagagt ggctgaaggc gaattttgat 480gcttccaaag ccgaactgga agaagccaat cgtcagaacc tgcccttggt ttggctaatg 540ctcaacgaag tggccgatga tgctcgcgaa ctcgggatgg agcgtgagtc gctcgtcgag 600gactttatga ttgcctacgg tgaagctctg gaaaacatcg gcttcacaac gcgcgaaatc 660atgcgtatgt ccgcctatgg ccttgcggcc gtttga 6968231PRTSynechococcus elongatus 8Met Pro Gln Leu Glu Ala Ser Leu Glu Leu Asp Phe Gln Ser Glu Ser 1 5 10 15 Tyr Lys Asp Ala Tyr Ser Arg Ile Asn Ala Ile Val Ile Glu Gly Glu 20 25 30 Gln Glu Ala Phe Asp Asn Tyr Asn Arg Leu Ala Glu Met Leu Pro Asp 35 40 45 Gln Arg Asp Glu Leu His Lys Leu Ala Lys Met Glu Gln Arg His Met 50 55 60 Lys Gly Phe Met Ala Cys Gly Lys Asn Leu Ser Val Thr Pro Asp Met 65 70 75 80 Gly Phe Ala Gln Lys Phe Phe Glu Arg Leu His Glu Asn Phe Lys Ala 85 90 95 Ala Ala Ala Glu Gly Lys Val Val Thr Cys Leu Leu Ile Gln Ser Leu 100 105 110 Ile Ile Glu Cys Phe Ala Ile Ala Ala Tyr Asn Ile Tyr Ile Pro Val 115 120 125 Ala Asp Ala Phe Ala Arg Lys Ile Thr Glu Gly Val Val Arg Asp Glu 130 135 140 Tyr Leu His Arg Asn Phe Gly Glu Glu Trp Leu Lys Ala Asn Phe Asp 145 150 155 160 Ala Ser Lys Ala Glu Leu Glu Glu Ala Asn Arg Gln Asn Leu Pro Leu 165 170 175 Val Trp Leu Met Leu Asn Glu Val Ala Asp Asp Ala Arg Glu Leu Gly 180 185 190 Met Glu Arg Glu Ser Leu Val Glu Asp Phe Met Ile Ala Tyr Gly Glu 195 200 205 Ala Leu Glu Asn Ile Gly Phe Thr Thr Arg Glu Ile Met Arg Met Ser 210 215 220 Ala Tyr Gly Leu Ala Ala Val 225 230 91041DNAProchlorococcus marinus 9atgtttggtc tgattggtca tagcaccagc tttgaggacg caaagcgcaa ggcgagcctg 60ctgggtttcg accacatcgc ggatggcgat ctggatgtgt ggtgtaccgc accgccgcaa 120ctggttgaaa acgtggaagt caaaagcgcg acgggtatca gcattgaagg tagctatatc 180gatagctgct tcgtgccgga gatgctgagc cgcttcaaga ccgcgcgtcg taaagttctg 240aatgcaatgg agctggcgca gaaaaagggt atcaatatca ctgccctggg tggctttacc 300tccattatct ttgagaactt caacctgttg cagcacaagc aaatccgtaa taccagcctg 360gagtgggagc gtttcaccac gggtaacacg cacacggcat gggtgatttg tcgtcagctg 420gagatcaacg caccgcgcat tggcatcgac ctgaaaactg caacggtcgc tgttatcggc 480gcgaccggcg atattggtag cgcggtgtgt cgctggctgg tcaataagac cggcattagc 540gaactgctga tggtcgctcg ccaacaacag ccactgaccc tgctgcaaaa agaactggac 600ggtggcacca tcaagagcct ggatgaagcc ctgccgcagg cggatattgt cgtgtgggtt 660gcttcgatgc ctaagacgat cgaaattgag attgaaaacc tgaaaaagcc gtgcctgatg 720atcgacggtg gctacccgaa gaatctggac gagaaattca aaggcaaaaa cattcacgtg 780ttgaagggtg gtatcgtcga gtttttcaac gacattggct ggaacatgat ggagttggcg 840gagatgcaaa acccgcagcg tgagatgttt gcgtgcttcg ccgaagctat gattctggag 900tttgagaaat gccataccaa ctttagctgg ggccgtaaca atatcagctt ggagaagatg 960gagttcatcg gtgctgcatc tctgaagcac ggtttcagcg cgatcggtct ggataaacag 1020ccgaaagtct tgaccgtttg a 104110345PRTProchlorococcus marinus 10Met Phe Gly Leu Ile Gly His Ser Thr Ser Phe Glu Asp Ala Lys Arg 1 5 10 15 Lys Ala Ser Leu Leu Gly Phe Asp His Ile Ala Asp Gly Asp Leu Asp 20 25 30 Val Trp Cys Thr Ala Pro Pro Gln Leu Val Glu Asn Val Glu Val Lys 35 40 45 Ser Ala Thr Gly Ile Ser Ile Glu Gly Ser Tyr Ile Asp Ser Cys Phe 50 55 60 Val Pro Glu Met Leu Ser Arg Phe Lys Thr Ala Arg Arg Lys Val Leu 65 70 75 80 Asn Ala Met Glu Leu Ala Gln Lys Lys Gly Ile Asn Ile Thr Ala Leu 85 90 95 Gly Gly Phe Thr Ser Ile Ile Phe Glu Asn Phe Asn Leu Leu Gln His 100 105 110 Lys Gln Ile Arg Asn Thr Ser Leu Glu Trp Glu Arg Phe Thr Thr Gly 115 120 125 Asn Thr His Thr Ala Trp Val Ile Cys Arg Gln Leu Glu Ile Asn Ala 130 135 140 Pro Arg Ile Gly Ile Asp Leu Lys Thr Ala Thr Val Ala Val Ile Gly 145 150 155 160 Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Val Asn Lys 165 170 175 Thr Gly Ile Ser Glu Leu Leu Met Val Ala Arg Gln Gln Gln Pro Leu 180 185 190 Thr Leu Leu Gln Lys Glu Leu Asp Gly Gly Thr Ile Lys Ser Leu Asp 195 200 205 Glu Ala Leu Pro Gln Ala Asp Ile Val Val Trp Val Ala Ser Met Pro 210 215 220 Lys Thr Ile Glu Ile Glu Ile Glu Asn Leu Lys Lys Pro Cys Leu Met 225 230 235 240 Ile Asp Gly Gly Tyr Pro Lys Asn Leu Asp Glu Lys Phe Lys Gly Lys 245 250 255 Asn Ile His Val Leu Lys Gly Gly Ile Val Glu Phe Phe Asn Asp Ile 260 265 270 Gly Trp Asn Met Met Glu Leu Ala Glu Met Gln Asn Pro Gln Arg Glu 275 280 285 Met Phe Ala Cys Phe Ala Glu Ala Met Ile Leu Glu Glu Lys Cys His 290 295 300 Thr Asn Phe Ser Trp Gly Arg Asn Asn Ile Ser Leu Glu Lys Met Glu 305 310 315 320 Phe Ile Gly Ala Ala Ser Leu Lys His Gly Phe Ser Ala Ile Gly Leu 325 330 335 Asp Lys Gln Pro Lys Val Leu Thr Val 340 345 11756DNAProchlorococcus marinus 11atgcacaatg aattgaaaat cacggatatg caaacgctgg aaaccaacac caagacgacc 60gaagagtcta ttgacaccaa tagcctgaac ctgccggact ttactaccga cagctacaag 120gatgcctatt ctcgcattaa cgccatcgtt attgagggcg aacaggaagc tcatgacaat 180tacatctcca tcgcaacgct gatcccgaat gagctggaag agctgacgaa gctggcacgt 240atggagctga aacacaagaa aggttttact gcgtgcggtc gtaatctggg tgtggacgca

300gacatggttt tcgcgaaaaa gttcttcagc aaactgcacg gcaatttcca aatcgcgctg 360gaaaaaggta acctgaccac ctgcttgctg atccaagcga ttctgatcga agcatttgcg 420atttccgcgt acaatgttta catccgtgtg gccgacccat ttgccaaaaa gattaccgag 480ggtgttgtca aagacgagta tctgcatctg aactatggtc aggagtggct gaaaaagaat 540ctgtccacgt gtaaagaaga gctgatggag gccaacaagg tcaatctgcc gctgattaag 600aaaatgctgg acgaagtggc agaagatgcg agcgttttgg cgatggatcg tgaagagttg 660atggaagagt tcatgattgc gtaccaggat accctgttgg agattggcct ggataatcgc 720gaaattgccc gtatggcgat ggcggccatt gtttag 75612251PRTProchlorococcus marinus 12Met His Asn Glu Leu Lys Ile Thr Asp Met Gln Thr Leu Glu Thr Asn 1 5 10 15 Thr Lys Thr Thr Glu Glu Ser Ile Asp Thr Asn Ser Leu Asn Leu Pro 20 25 30 Asp Phe Thr Thr Asp Ser Tyr Lys Asp Ala Tyr Ser Arg Ile Asn Ala 35 40 45 Ile Val Ile Glu Gly Glu Gln Glu Ala His Asp Asn Tyr Ile Ser Ile 50 55 60 Ala Thr Leu Ile Pro Asn Glu Leu Glu Glu Leu Thr Lys Leu Ala Arg 65 70 75 80 Met Glu Leu Lys His Lys Lys Gly Phe Thr Ala Cys Gly Arg Asn Leu 85 90 95 Gly Val Asp Ala Asp Met Val Phe Ala Lys Lys Phe Phe Ser Lys Leu 100 105 110 His Gly Asn Phe Gln Ile Ala Leu Glu Lys Gly Asn Leu Thr Thr Cys 115 120 125 Leu Leu Ile Gln Ala Ile Leu Ile Glu Ala Phe Ala Ile Ser Ala Tyr 130 135 140 Asn Val Tyr Ile Arg Val Ala Asp Pro Phe Ala Lys Lys Ile Thr Glu 145 150 155 160 Gly Val Val Lys Asp Glu Tyr Leu His Leu Asn Tyr Gly Gln Glu Trp 165 170 175 Leu Lys Lys Asn Leu Ser Thr Cys Lys Glu Glu Leu Met Glu Ala Asn 180 185 190 Lys Val Asn Leu Pro Leu Ile Lys Lys Met Leu Asp Glu Val Ala Glu 195 200 205 Asp Ala Ser Val Leu Ala Met Asp Arg Glu Glu Leu Met Glu Glu Phe 210 215 220 Met Ile Ala Tyr Gln Asp Thr Leu Leu Glu Ile Gly Leu Asp Asn Arg 225 230 235 240 Glu Ile Ala Arg Met Ala Met Ala Ala Ile Val 245 250 131041DNAProchlorococcus marinus 13atgtttgggt taataggcca ctcaactagt tttgaagatg caaaaagaaa agcttcatta 60ctaggctttg atcatattgc tgatggtgat ctagatgttt ggtgtacagc ccctcctcaa 120ttggttgaaa atgtagaagt taagagtgct actggaatat ctattgaagg ttcttatata 180gattcttgct ttgttcctga aatgctttct aggtttaaaa ccgcaagaag aaaagtatta 240aatgctatgg aattagctca gaaaaaaggg attaacatta cggctttagg aggatttact 300tctattattt tcgaaaattt taatcttctt caacataaac aaattagaaa tacttcatta 360gagtgggaaa ggtttactac aggtaataca cacactgcct gggttatttg taggcaacta 420gaaataaatg ctcctcgcat agggatagat cttaaaactg caactgttgc tgttattggt 480gctacaggtg atataggaag tgctgtttgt aggtggcttg tcaataaaac tggtatttca 540gaacttctta tggtggctag acaacaacaa ccattaactc tattacagaa agaattagat 600ggtggcacta taaaaagttt agatgaagca ttgcctcaag cggatattgt tgtatgggtt 660gcaagtatgc ctaaaacgat tgaaattgaa attgaaaact taaaaaaacc atgtttaatg 720attgatggtg gataccctaa aaatcttgat gagaaattta aaggtaaaaa tattcatgtt 780ttaaaaggag gtatagtaga gtttttcaat gatattggct ggaatatgat ggaacttgca 840gaaatgcaga accctcagag agagatgttt gcttgctttg cagaagctat gattttagaa 900tttgaaaagt gtcataccaa ctttagttgg ggaaggaata acatttctct tgaaaaaatg 960gaatttattg gagcagcttc tttgaaacat ggtttttctg cgattggact tgataaacag 1020cctaaagtat tgactgtttg a 104114756DNAProchlorococcus marinus 14atgcataatg agctaaagat tactgacatg caaactctag aaacaaatac aaaaactact 60gaagaatcca tagacacgaa ttctttgaat cttcccgact ttacaacaga ttcctataag 120gatgcatata gcagaataaa tgcaattgtt atagagggag agcaagaggc tcatgataat 180tacatttcaa tagcaacgtt aataccaaat gagttagaag aattaactaa gttggcgaga 240atggaactca agcataaaaa aggatttact gcttgtggaa gaaatttagg agtagatgct 300gatatggtat tcgcaaaaaa attcttttct aaattgcatg gtaattttca aattgcttta 360gaaaaaggaa atttaacaac ttgtcttctg atacaagcta ttttaattga agcttttgct 420atatctgctt ataacgttta cataagagtt gctgatcctt ttgcaaaaaa aataacagag 480ggagtggtta aagatgaata tctccatcta aattacggcc aagagtggct taaaaagaat 540ttatctactt gtaaagaaga attaatggaa gccaataagg ttaaccttcc cttaattaaa 600aagatgttag atgaagtagc agaagatgca tcagttttgg ctatggatag agaagagtta 660atggaagaat ttatgattgc ttaccaagac actcttctag aaataggtct tgataataga 720gaaattgcaa gaatggctat ggcagcgatt gtttaa 756157026DNAArtificial SequenceDescription of Artificial Sequence Synthetic plasmid JB823 15gtcagcaagc tctggaattt cccgattctc tgatgggaga tccaaaaatt ctcgcagtcc 60ctcaatcacg atatcggtct tggatcgccc tgtagcttcc gacaactgct caattttttc 120gagcatctct accgggcatc ggaatgaaat taacggtgtt ttagccatgt gttatacagt 180gtttacaact tgactaacaa atacctgcta gtgtatacat attgtattgc aatgtatacg 240ctattttcac tgctgtcttt aatggggatt atcgcaagca agtaaaaaag cctgaaaacc 300ccaataggta agggattccg agcttactcg ataattatca cctttgagcg cccctaggag 360gaggcgaaaa gctatgtctg acaaggggtt tgacccctga agtcgttgcg cgagcattaa 420ggtctgcgga tagcccataa catacttttg ttgaacttgt gcgcttttat caacccctta 480agggcttggg agcgttttat gcggccgcgg gggggggggg gaaagccacg ttgtgtctca 540aaatctctga tgttacattg cacaagataa aaatatatca tcatgaacaa taaaactgtc 600tgcttacata aacagtaata caaggggtca tatgccgcag cttgaagcca gccttgaact 660ggactttcaa agcgagtcct acaaagacgc ttacagccgc atcaacgcga tcgtgattga 720aggcgaacaa gaggcgttcg acaactacaa tcgccttgct gagatgctgc ccgaccagcg 780ggatgagctt cacaagctag ccaagatgga acagcgccac atgaaaggct ttatggcctg 840tggcaaaaat ctctccgtca ctcctgacat gggttttgcc cagaaatttt tcgagcgctt 900gcacgagaac ttcaaagcgg cggctgcgga aggcaaggtc gtcacctgcc tactgattca 960atcgctaatc atcgagtgct ttgcgatcgc ggcttacaac atctacatcc cagtggcgga 1020tgcttttgcc cgcaaaatca cggagggggt cgtgcgcgac gaatacctgc accgcaactt 1080cggtgaagag tggctgaagg cgaattttga tgcttccaaa gccgaactgg aagaagccaa 1140tcgtcagaac ctgcccttgg tttggctaat gctcaacgaa gtggccgatg atgctcgcga 1200actcgggatg gagcgtgagt cgctcgtcga ggactttatg attgcctacg gtgaagctct 1260ggaaaacatc ggcttcacaa cgcgcgaaat catgcgtatg tccgcctatg gccttgcggc 1320cgtttgatcc aggaaatctg aatgttcggt cttatcggtc atctcaccag tttggagcag 1380gcccgcgacg tttctcgcag gatgggctac gacgaatacg ccgatcaagg attggagttt 1440tggagtagcg ctcctcctca aatcgttgat gaaatcacag tcaccagtgc cacaggcaag 1500gtgattcacg gtcgctacat cgaatcgtgt ttcttgccgg aaatgctggc ggcgcgccgc 1560ttcaaaacag ccacgcgcaa agttctcaat gccatgtccc atgcccaaaa acacggcatc 1620gacatctcgg ccttgggggg ctttacctcg attattttcg agaatttcga tttggccagt 1680ttgcggcaag tgcgcgacac taccttggag tttgaacggt tcaccaccgg caatactcac 1740acggcctacg taatctgtag acaggtggaa gccgctgcta aaacgctggg catcgacatt 1800acccaagcga cagtagcggt tgtcggcgcg actggcgata tcggtagcgc tgtctgccgc 1860tggctcgacc tcaaactggg tgtcggtgat ttgatcctga cggcgcgcaa tcaggagcgt 1920ttggataacc tgcaggctga actcggccgg ggcaagattc tgcccttgga agccgctctg 1980ccggaagctg actttatcgt gtgggtcgcc agtatgcctc agggcgtagt gatcgaccca 2040gcaaccctga agcaaccctg cgtcctaatc gacgggggct accccaaaaa cttgggcagc 2100aaagtccaag gtgagggcat ctatgtcctc aatggcgggg tagttgaaca ttgcttcgac 2160atcgactggc agatcatgtc cgctgcagag atggcgcggc ccgagcgcca gatgtttgcc 2220tgctttgccg aggcgatgct cttggaattt gaaggctggc atactaactt ctcctggggc 2280cgcaaccaaa tcacgatcga gaagatggaa gcgatcggtg aggcatcggt gcgccacggc 2340ttccaaccct tggcattggc aatttgaggt ctgtgaattc ggttttccgt cctgtcttga 2400ttttcaagca aacaatgcct ccgatttcta atcggaggca tttgtttttg tttattgcaa 2460aaacaaaaaa tattgttaca aatttttaca ggctattaag cctaccgtca taaataattt 2520gccatttact agtttttaat taaccagaac cttgaccgaa cgcagcggtg gtaacggcgc 2580agtggcggtt ttcatggctt gttatgactg tttttttggg gtacagtcta tgcctcgggc 2640atccaagcag caagcgcgtt acgccgtggg tcgatgtttg atgttatgga gcagcaacga 2700tgttacgcag cagggcagtc gccctaaaac aaagttaaac atcatgaggg aagcggtgat 2760cgccgaagta tcgactcaac tatcagaggt agttggcgtc atcgagcgcc atctcgaacc 2820gacgttgctg gccgtacatt tgtacggctc cgcagtggat ggcggcctga agccacacag 2880tgatattgat ttgctggtta cggtgaccgt aaggcttgat gaaacaacgc ggcgagcttt 2940gatcaacgac cttttggaaa cttcggcttc ccctggagag agcgagattc tccgcgctgt 3000agaagtcacc attgttgtgc acgacgacat cattccgtgg cgttatccag ctaagcgcga 3060actgcaattt ggagaatggc agcgcaatga cattcttgca ggtatcttcg agccagccac 3120gatcgacatt gatctggcta tcttgctgac aaaagcaaga gaacatagcg ttgccttggt 3180aggtccagcg gcggaggaac tctttgatcc ggttcctgaa caggatctat ttgaggcgct 3240aaatgaaacc ttaacgctat ggaactcgcc gcccgactgg gctggcgatg agcgaaatgt 3300agtgcttacg ttgtcccgca tttggtacag cgcagtaacc ggcaaaatcg cgccgaagga 3360tgtcgctgcc gactgggcaa tggagcgcct gccggcccag tatcagcccg tcatacttga 3420agctagacag gcttatcttg gacaagaaga agatcgcttg gcctcgcgcg cagatcagtt 3480ggaagaattt gtccactacg tgaaaggcga gatcaccaag gtagtcggca aataatgtct 3540aacaattcgt tcaagccgac gccgcttcgc ggcgcggctt aactcaagcg ttagatgcac 3600taagcacata attgctcaca gccaaactat caggtcaagt ctgcttttat tatttttaag 3660cgtgcataat aagccctaca caaattggga gatatatcat gaggcgcgcc acgagtgcgg 3720ggaaatttcg ggggcgatcg cccctatatc gcaaaaagga gttaccccat cagagctata 3780gtcgagaaga aaaccatcat tcactcaaca aggctatgtc agaagagaaa ctagaccgga 3840tcgaagcagc cctagagcaa ttggataagg atgtgcaaac gctccaaaca gagcttcagc 3900aatcccaaaa atggcaggac aggacatggg atgttgtgaa gtgggtaggc ggaatctcag 3960cgggcctagc ggtgagcgct tccattgccc tgttcgggtt ggtctttaga ttttctgttt 4020ccctgccata aaagcacatt cttataagtc atacttgttt acatcaagga acaaaaacgg 4080cattgtgcct tgcaaggcac aatgtctttc tcttatgcac agatggggac tggaaaccac 4140acgcacaatt cccttaaaaa gcaaccgcaa aaaataacca tcaaaataaa actggacaaa 4200ttctcatgtg ggccggccaa aatgaagtga agttcctata ctttctagag aataggaact 4260tctatagtga gtcgaataag ggcgacacaa aatttattct aaatgcataa taaatactga 4320taacatctta tagtttgtat tatattttgt attatcgttg acatgtataa ttttgatatc 4380aaaaactgat tttcccttta ttattttcga gatttatttt cttaattctc tttaacaaac 4440tagaaatatt gtatatacaa aaaatcataa ataatagatg aatagtttaa ttataggtgt 4500tcatcaatcg aaaaagcaac gtatcttatt taaagtgcgt tgcttttttc tcatttataa 4560ggttaaataa ttctcatata tcaagcaaag tgacaggcgc ccttaaatat tctgacaaat 4620gctctttccc taaactcccc ccataaaaaa acccgccgaa gcgggttttt acgttatttg 4680cggattaacg attactcgtt atcagaaccg cccagggggc ccgagcttaa gactggccgt 4740cgttttacaa cacagaaaga gtttgtagaa acgcaaaaag gccatccgtc aggggccttc 4800tgcttagttt gatgcctggc agttccctac tctcgccttc cgcttcctcg ctcactgact 4860cgctgcgctc ggtcgttcgg ctgcggcgag cggtatcagc tcactcaaag gcggtaatac 4920ggttatccac agaatcaggg gataacgcag gaaagaacat gtgagcaaaa ggccagcaaa 4980aggccaggaa ccgtaaaaag gccgcgttgc tggcgttttt ccataggctc cgcccccctg 5040acgagcatca caaaaatcga cgctcaagtc agaggtggcg aaacccgaca ggactataaa 5100gataccaggc gtttccccct ggaagctccc tcgtgcgctc tcctgttccg accctgccgc 5160ttaccggata cctgtccgcc tttctccctt cgggaagcgt ggcgctttct catagctcac 5220gctgtaggta tctcagttcg gtgtaggtcg ttcgctccaa gctgggctgt gtgcacgaac 5280cccccgttca gcccgaccgc tgcgccttat ccggtaacta tcgtcttgag tccaacccgg 5340taagacacga cttatcgcca ctggcagcag ccactggtaa caggattagc agagcgaggt 5400atgtaggcgg tgctacagag ttcttgaagt ggtgggctaa ctacggctac actagaagaa 5460cagtatttgg tatctgcgct ctgctgaagc cagttacctt cggaaaaaga gttggtagct 5520cttgatccgg caaacaaacc accgctggta gcggtggttt ttttgtttgc aagcagcaga 5580ttacgcgcag aaaaaaagga tctcaagaag atcctttgat cttttctacg gggtctgacg 5640ctcagtggaa cgacgcgcgc gtaactcacg ttaagggatt ttggtcatga gcttgcgccg 5700tcccgtcaag tcagcgtaat gctctgcttt taccaatgct taatcagtga ggcacctatc 5760tcagcgatct gtctatttcg ttcatccata gttgcctgac tccccgtcgt gtagataact 5820acgatacggg agggcttacc atctggcccc agcgctgcga tgataccgcg agaaccacgc 5880tcaccggctc cggatttatc agcaataaac cagccagccg gaagggccga gcgcagaagt 5940ggtcctgcaa ctttatccgc ctccatccag tctattaatt gttgccggga agctagagta 6000agtagttcgc cagttaatag tttgcgcaac gttgttgcca tcgctacagg catcgtggtg 6060tcacgctcgt cgtttggtat ggcttcattc agctccggtt cccaacgatc aaggcgagtt 6120acatgatccc ccatgttgtg caaaaaagcg gttagctcct tcggtcctcc gatcgttgtc 6180agaagtaagt tggccgcagt gttatcactc atggttatgg cagcactgca taattctctt 6240actgtcatgc catccgtaag atgcttttct gtgactggtg agtactcaac caagtcattc 6300tgagaatagt gtatgcggcg accgagttgc tcttgcccgg cgtcaatacg ggataatacc 6360gcgccacata gcagaacttt aaaagtgctc atcattggaa aacgttcttc ggggcgaaaa 6420ctctcaagga tcttaccgct gttgagatcc agttcgatgt aacccactcg tgcacccaac 6480tgatcttcag catcttttac tttcaccagc gtttctgggt gagcaaaaac aggaaggcaa 6540aatgccgcaa aaaagggaat aagggcgaca cggaaatgtt gaatactcat attcttcctt 6600tttcaatatt attgaagcat ttatcagggt tattgtctca tgagcggata catatttgaa 6660tgtatttaga aaaataaaca aataggggtc agtgttacaa ccaattaacc aattctgaac 6720attatcgcga gcccatttat acctgaatat ggctcataac accccttgtt tgcctggcgg 6780cagtagcgcg gtggtcccac ctgaccccat gccgaactca gaagtgaaac gccgtagcgc 6840cgatggtagt gtggggactc cccatgcgag agtagggaac tgccaggcat caaataaaac 6900gaaaggctca gtcgaaagac tgggcctttc gcccgggcta attatggggt gtcgccctta 6960ttcgactcta tagtgaagtt cctattctct agaaagtata ggaacttctg aagtggggcc 7020tgcagg 7026165513DNAArtificial SequenceDescription of Artificial Sequence Synthetic plasmid pJB855 16ggggaattgt gagcggataa caattcccct gtagaaataa ttttgtttaa ctttaataag 60gagatatacc atgggcagca gccatcacca tcatcaccac agccaggatc cgaattcgag 120ctcggcgcgc ctgcaggtcg acaagcttgc ggccgcataa tgcttaagtc gaacagaaag 180taatcgtatt gtacacggcc gcataatcga aattaatacg actcactata ggggaattgt 240gagcggataa caattcccca tcttagtata ttagttaagt ataagaagga gatatacata 300tgccgcagct tgaagccagc cttgaactgg actttcaaag cgagtcctac aaagacgctt 360acagccgcat caacgcgatc gtgattgaag gcgaacaaga ggcgttcgac aactacaatc 420gccttgctga gatgctgccc gaccagcggg atgagcttca caagctagcc aagatggaac 480agcgccacat gaaaggcttt atggcctgtg gcaaaaatct ctccgtcact cctgacatgg 540gttttgccca gaaatttttc gagcgcttgc acgagaactt caaagcggcg gctgcggaag 600gcaaggtcgt cacctgccta ctgattcaat cgctaatcat cgagtgcttt gcgatcgcgg 660cttacaacat ctacatccca gtggcggatg cttttgcccg caaaatcacg gagggggtcg 720tgcgcgacga atacctgcac cgcaacttcg gtgaagagtg gctgaaggcg aattttgatg 780cttccaaagc cgaactggaa gaagccaatc gtcagaacct gcccttggtt tggctaatgc 840tcaacgaagt ggccgatgat gctcgcgaac tcgggatgga gcgtgagtcg ctcgtcgagg 900actttatgat tgcctacggt gaagctctgg aaaacatcgg cttcacaacg cgcgaaatca 960tgcgtatgtc cgcctatggc cttgcggccg tttgatccag gaaatctgaa tgttcggtct 1020tatcggtcat ctcaccagtt tggagcaggc ccgcgacgtt tctcgcagga tgggctacga 1080cgaatacgcc gatcaaggat tggagttttg gagtagcgct cctcctcaaa tcgttgatga 1140aatcacagtc accagtgcca caggcaaggt gattcacggt cgctacatcg aatcgtgttt 1200cttgccggaa atgctggcgg cgcgccgctt caaaacagcc acgcgcaaag ttctcaatgc 1260catgtcccat gcccaaaaac acggcatcga catctcggcc ttggggggct ttacctcgat 1320tattttcgag aatttcgatt tggccagttt gcggcaagtg cgcgacacta ccttggagtt 1380tgaacggttc accaccggca atactcacac ggcctacgta atctgtagac aggtggaagc 1440cgctgctaaa acgctgggca tcgacattac ccaagcgaca gtagcggttg tcggcgcgac 1500tggcgatatc ggtagcgctg tctgccgctg gctcgacctc aaactgggtg tcggtgattt 1560gatcctgacg gcgcgcaatc aggagcgttt ggataacctg caggctgaac tcggccgggg 1620caagattctg cccttggaag ccgctctgcc ggaagctgac tttatcgtgt gggtcgccag 1680tatgcctcag ggcgtagtga tcgacccagc aaccctgaag caaccctgcg tcctaatcga 1740cgggggctac cccaaaaact tgggcagcaa agtccaaggt gagggcatct atgtcctcaa 1800tggcggggta gttgaacatt gcttcgacat cgactggcag atcatgtccg ctgcagagat 1860ggcgcggccc gagcgccaga tgtttgcctg ctttgccgag gcgatgctct tggaatttga 1920aggctggcat actaacttct cctggggccg caaccaaatc acgatcgaga agatggaagc 1980gatcggtgag gcatcggtgc gccacggctt ccaacccttg gcattggcaa tttgaggtct 2040gtgaattgga tatcggccgg ccacgcgatc gctgacgtcg gtaccctcga gtctggtaaa 2100gaaaccgctg ctgcgaaatt tgaacgccag cacatggact cgtctactag cgcagcttaa 2160ttaacctagg ctgctgccac cgctgagcaa taactagcat aaccccttgg ggcctctaaa 2220cgggtcttga ggggtttttt gctgaaacct caggcatttg agaagcacac ggtcacactg 2280cttccggtag tcaataaacc ggtaaaccag caatagacat aagcggctat ttaacgaccc 2340tgccctgaac cgacgaccgg gtcatcgtgg ccggatcttg cggcccctcg gcttgaacga 2400attgttagac attatttgcc gactaccttg gtgatctcgc ctttcacgta gtggacaaat 2460tcttccaact gatctgcgcg cgaggccaag cgatcttctt cttgtccaag ataagcctgt 2520ctagcttcaa gtatgacggg ctgatactgg gccggcaggc gctccattgc ccagtcggca 2580gcgacatcct tcggcgcgat tttgccggtt actgcgctgt accaaatgcg ggacaacgta 2640agcactacat ttcgctcatc gccagcccag tcgggcggcg agttccatag cgttaaggtt 2700tcatttagcg cctcaaatag atcctgttca ggaaccggat caaagagttc ctccgccgct 2760ggacctacca aggcaacgct atgttctctt gcttttgtca gcaagatagc cagatcaatg 2820tcgatcgtgg ctggctcgaa gatacctgca agaatgtcat tgcgctgcca ttctccaaat 2880tgcagttcgc gcttagctgg ataacgccac ggaatgatgt cgtcgtgcac aacaatggtg 2940acttctacag cgcggagaat ctcgctctct ccaggggaag ccgaagtttc caaaaggtcg 3000ttgatcaaag ctcgccgcgt tgtttcatca agccttacgg tcaccgtaac cagcaaatca 3060atatcactgt gtggcttcag gccgccatcc actgcggagc cgtacaaatg tacggccagc 3120aacgtcggtt cgagatggcg ctcgatgacg ccaactacct ctgatagttg agtcgatact 3180tcggcgatca ccgcttccct catactcttc ctttttcaat attattgaag catttatcag 3240ggttattgtc tcatgagcgg atacatattt gaatgtattt agaaaaataa acaaatagct 3300agctcactcg gtcgctacgc tccgggcgtg agactgcggc gggcgctgcg gacacataca 3360aagttaccca cagattccgt ggataagcag gggactaaca tgtgaggcaa aacagcaggg 3420ccgcgccggt ggcgtttttc cataggctcc gccctcctgc cagagttcac ataaacagac 3480gcttttccgg tgcatctgtg ggagccgtga ggctcaacca tgaatctgac agtacgggcg 3540aaacccgaca ggacttaaag atccccaccg tttccggcgg gtcgctccct cttgcgctct 3600cctgttccga ccctgccgtt taccggatac ctgttccgcc tttctccctt acgggaagtg 3660tggcgctttc tcatagctca cacactggta tctcggctcg gtgtaggtcg ttcgctccaa

3720gctgggctgt aagcaagaac tccccgttca gcccgactgc tgcgccttat ccggtaactg 3780ttcacttgag tccaacccgg aaaagcacgg taaaacgcca ctggcagcag ccattggtaa 3840ctgggagttc gcagaggatt tgtttagcta aacacgcggt tgctcttgaa gtgtgcgcca 3900aagtccggct acactggaag gacagatttg gttgctgtgc tctgcgaaag ccagttacca 3960cggttaagca gttccccaac tgacttaacc ttcgatcaaa ccacctcccc aggtggtttt 4020ttcgtttaca gggcaaaaga ttacgcgcag aaaaaaagga tctcaagaag atcctttgat 4080cttttctact gaaccgctct agatttcagt gcaatttatc tcttcaaatg tagcacctga 4140agtcagcccc atacgatata agttgtaatt ctcatgttag tcatgccccg cgcccaccgg 4200aaggagctga ctgggttgaa ggctctcaag ggcatcggtc gagatcccgg tgcctaatga 4260gtgagctaac ttacattaat tgcgttgcgc tcactgcccg ctttccagtc gggaaacctg 4320tcgtgccagc tgcattaatg aatcggccaa cgcgcgggga gaggcggttt gcgtattggg 4380cgccagggtg gtttttcttt tcaccagtga gacgggcaac agctgattgc ccttcaccgc 4440ctggccctga gagagttgca gcaagcggtc cacgctggtt tgccccagca ggcgaaaatc 4500ctgtttgatg gtggttaacg gcgggatata acatgagctg tcttcggtat cgtcgtatcc 4560cactaccgag atgtccgcac caacgcgcag cccggactcg gtaatggcgc gcattgcgcc 4620cagcgccatc tgatcgttgg caaccagcat cgcagtggga acgatgccct cattcagcat 4680ttgcatggtt tgttgaaaac cggacatggc actccagtcg ccttcccgtt ccgctatcgg 4740ctgaatttga ttgcgagtga gatatttatg ccagccagcc agacgcagac gcgccgagac 4800agaacttaat gggcccgcta acagcgcgat ttgctggtga cccaatgcga ccagatgctc 4860cacgcccagt cgcgtaccgt cttcatggga gaaaataata ctgttgatgg gtgtctggtc 4920agagacatca agaaataacg ccggaacatt agtgcaggca gcttccacag caatggcatc 4980ctggtcatcc agcggatagt taatgatcag cccactgacg cgttgcgcga gaagattgtg 5040caccgccgct ttacaggctt cgacgccgct tcgttctacc atcgacacca ccacgctggc 5100acccagttga tcggcgcgag atttaatcgc cgcgacaatt tgcgacggcg cgtgcagggc 5160cagactggag gtggcaacgc caatcagcaa cgactgtttg cccgccagtt gttgtgccac 5220gcggttggga atgtaattca gctccgccat cgccgcttcc actttttccc gcgttttcgc 5280agaaacgtgg ctggcctggt tcaccacgcg ggaaacggtc tgataagaga caccggcata 5340ctctgcgaca tcgtataacg ttactggttt cacattcacc accctgaatt gactctcttc 5400cgggcgctat catgccatac cgcgaaaggt tttgcgccat tcgatggtgt ccgggatctc 5460gacgctctcc cttatgcgac tcctgcatta ggaaattaat acgactcact ata 5513177118DNAArtificial SequenceDescription of Artificial Sequence Synthetic plasmid pJB947 17gtcagcaagc tctggaattt cccgattctc tgatgggaga tccaaaaatt ctcgcagtcc 60ctcaatcacg atatcggtct tggatcgccc tgtagcttcc gacaactgct caattttttc 120gagcatctct accgggcatc ggaatgaaat taacggtgtt ttagccatgt gttatacagt 180gtttacaact tgactaacaa atacctgcta gtgtatacat attgtattgc aatgtatacg 240ctattttcac tgctgtcttt aatggggatt atcgcaagca agtaaaaaag cctgaaaacc 300ccaataggta agggattccg agcttactcg ataattatca cctttgagcg cccctaggag 360gaggcgaaaa gctatgtctg acaaggggtt tgacccctga agtcgttgcg cgagcattaa 420ggtctgcgga tagcccataa catacttttg ttgaacttgt gcgcttttat caacccctta 480agggcttggg agcgttttat gcggccgcgg gggggggggg gaaagccacg ttgtgtctca 540aaatctctga tgttacattg cacaagataa aaatatatca tcatgaacaa taaaactgtc 600tgcttacata aacagtaata caaggggtca tatgcacaat gaattgaaaa tcacggatat 660gcaaacgctg gaaaccaaca ccaagacgac cgaagagtct attgacacca atagcctgaa 720cctgccggac tttactaccg acagctacaa ggatgcctat tctcgcatta acgccatcgt 780tattgagggc gaacaggaag ctcatgacaa ttacatctcc atcgcaacgc tgatcccgaa 840tgagctggaa gagctgacga agctggcacg tatggagctg aaacacaaga aaggttttac 900tgcgtgcggt cgtaatctgg gtgtggacgc agacatggtt ttcgcgaaaa agttcttcag 960caaactgcac ggcaatttcc aaatcgcgct ggaaaaaggt aacctgacca cctgcttgct 1020gatccaagcg attctgatcg aagcatttgc gatttccgcg tacaatgttt acatccgtgt 1080ggccgaccca tttgccaaaa agattaccga gggtgttgtc aaagacgagt atctgcatct 1140gaactatggt caggagtggc tgaaaaagaa tctgtccacg tgtaaagaag agctgatgga 1200ggccaacaag gtcaatctgc cgctgattaa gaaaatgctg gacgaagtgg cagaagatgc 1260gagcgttttg gcgatggatc gtgaagagtt gatggaagag ttcatgattg cgtaccagga 1320taccctgttg gagattggcc tggataatcg cgaaattgcc cgtatggcga tggcggccat 1380tgtttagtaa tatttctaat taactaataa aggaagtctg aatgtttggt ctgattggtc 1440atagcaccag ctttgaggac gcaaagcgca aggcgagcct gctgggtttc gaccacatcg 1500cggatggcga tctggatgtg tggtgtaccg caccgccgca actggttgaa aacgtggaag 1560tcaaaagcgc gacgggtatc agcattgaag gtagctatat cgatagctgc ttcgtgccgg 1620agatgctgag ccgcttcaag accgcgcgtc gtaaagttct gaatgcaatg gagctggcgc 1680agaaaaaggg tatcaatatc actgccctgg gtggctttac ctccattatc tttgagaact 1740tcaacctgtt gcagcacaag caaatccgta ataccagcct ggagtgggag cgtttcacca 1800cgggtaacac gcacacggca tgggtgattt gtcgtcagct ggagatcaac gcaccgcgca 1860ttggcatcga cctgaaaact gcaacggtcg ctgttatcgg cgcgaccggc gatattggta 1920gcgcggtgtg tcgctggctg gtcaataaga ccggcattag cgaactgctg atggtcgctc 1980gccaacaaca gccactgacc ctgctgcaaa aagaactgga cggtggcacc atcaagagcc 2040tggatgaagc cctgccgcag gcggatattg tcgtgtgggt tgcttcgatg cctaagacga 2100tcgaaattga gattgaaaac ctgaaaaagc cgtgcctgat gatcgacggt ggctacccga 2160agaatctgga cgagaaattc aaaggcaaaa acattcacgt gttgaagggt ggtatcgtcg 2220agtttttcaa cgacattggc tggaacatga tggagttggc ggagatgcaa aacccgcagc 2280gtgagatgtt tgcgtgcttc gccgaagcta tgattctgga gtttgagaaa tgccatacca 2340actttagctg gggccgtaac aatatcagct tggagaagat ggagttcatc ggtgctgcat 2400ctctgaagca cggtttcagc gcgatcggtc tggataaaca gccgaaagtc ttgaccgttt 2460gaaattgaat tcggttttcc gtcctgtctt gattttcaag caaacaatgc ctccgatttc 2520taatcggagg catttgtttt tgtttattgc aaaaacaaaa aatattgtta caaattttta 2580caggctatta agcctaccgt cataaataat ttgccattta ctagttttta attaaccaga 2640accttgaccg aacgcagcgg tggtaacggc gcagtggcgg ttttcatggc ttgttatgac 2700tgtttttttg gggtacagtc tatgcctcgg gcatccaagc agcaagcgcg ttacgccgtg 2760ggtcgatgtt tgatgttatg gagcagcaac gatgttacgc agcagggcag tcgccctaaa 2820acaaagttaa acatcatgag ggaagcggtg atcgccgaag tatcgactca actatcagag 2880gtagttggcg tcatcgagcg ccatctcgaa ccgacgttgc tggccgtaca tttgtacggc 2940tccgcagtgg atggcggcct gaagccacac agtgatattg atttgctggt tacggtgacc 3000gtaaggcttg atgaaacaac gcggcgagct ttgatcaacg accttttgga aacttcggct 3060tcccctggag agagcgagat tctccgcgct gtagaagtca ccattgttgt gcacgacgac 3120atcattccgt ggcgttatcc agctaagcgc gaactgcaat ttggagaatg gcagcgcaat 3180gacattcttg caggtatctt cgagccagcc acgatcgaca ttgatctggc tatcttgctg 3240acaaaagcaa gagaacatag cgttgccttg gtaggtccag cggcggagga actctttgat 3300ccggttcctg aacaggatct atttgaggcg ctaaatgaaa ccttaacgct atggaactcg 3360ccgcccgact gggctggcga tgagcgaaat gtagtgctta cgttgtcccg catttggtac 3420agcgcagtaa ccggcaaaat cgcgccgaag gatgtcgctg ccgactgggc aatggagcgc 3480ctgccggccc agtatcagcc cgtcatactt gaagctagac aggcttatct tggacaagaa 3540gaagatcgct tggcctcgcg cgcagatcag ttggaagaat ttgtccacta cgtgaaaggc 3600gagatcacca aggtagtcgg caaataatgt ctaacaattc gttcaagccg acgccgcttc 3660gcggcgcggc ttaactcaag cgttagatgc actaagcaca taattgctca cagccaaact 3720atcaggtcaa gtctgctttt attattttta agcgtgcata ataagcccta cacaaattgg 3780gagatatatc atgaggcgcg ccacgagtgc ggggaaattt cgggggcgat cgcccctata 3840tcgcaaaaag gagttacccc atcagagcta tagtcgagaa gaaaaccatc attcactcaa 3900caaggctatg tcagaagaga aactagaccg gatcgaagca gccctagagc aattggataa 3960ggatgtgcaa acgctccaaa cagagcttca gcaatcccaa aaatggcagg acaggacatg 4020ggatgttgtg aagtgggtag gcggaatctc agcgggccta gcggtgagcg cttccattgc 4080cctgttcggg ttggtcttta gattttctgt ttccctgcca taaaagcaca ttcttataag 4140tcatacttgt ttacatcaag gaacaaaaac ggcattgtgc cttgcaaggc acaatgtctt 4200tctcttatgc acagatgggg actggaaacc acacgcacaa ttcccttaaa aagcaaccgc 4260aaaaaataac catcaaaata aaactggaca aattctcatg tgggccggcc aaaatgaagt 4320gaagttccta tactttctag agaataggaa cttctatagt gagtcgaata agggcgacac 4380aaaatttatt ctaaatgcat aataaatact gataacatct tatagtttgt attatatttt 4440gtattatcgt tgacatgtat aattttgata tcaaaaactg attttccctt tattattttc 4500gagatttatt ttcttaattc tctttaacaa actagaaata ttgtatatac aaaaaatcat 4560aaataataga tgaatagttt aattataggt gttcatcaat cgaaaaagca acgtatctta 4620tttaaagtgc gttgcttttt tctcatttat aaggttaaat aattctcata tatcaagcaa 4680agtgacaggc gcccttaaat attctgacaa atgctctttc cctaaactcc ccccataaaa 4740aaacccgccg aagcgggttt ttacgttatt tgcggattaa cgattactcg ttatcagaac 4800cgcccagggg gcccgagctt aagactggcc gtcgttttac aacacagaaa gagtttgtag 4860aaacgcaaaa aggccatccg tcaggggcct tctgcttagt ttgatgcctg gcagttccct 4920actctcgcct tccgcttcct cgctcactga ctcgctgcgc tcggtcgttc ggctgcggcg 4980agcggtatca gctcactcaa aggcggtaat acggttatcc acagaatcag gggataacgc 5040aggaaagaac atgtgagcaa aaggccagca aaaggccagg aaccgtaaaa aggccgcgtt 5100gctggcgttt ttccataggc tccgcccccc tgacgagcat cacaaaaatc gacgctcaag 5160tcagaggtgg cgaaacccga caggactata aagataccag gcgtttcccc ctggaagctc 5220cctcgtgcgc tctcctgttc cgaccctgcc gcttaccgga tacctgtccg cctttctccc 5280ttcgggaagc gtggcgcttt ctcatagctc acgctgtagg tatctcagtt cggtgtaggt 5340cgttcgctcc aagctgggct gtgtgcacga accccccgtt cagcccgacc gctgcgcctt 5400atccggtaac tatcgtcttg agtccaaccc ggtaagacac gacttatcgc cactggcagc 5460agccactggt aacaggatta gcagagcgag gtatgtaggc ggtgctacag agttcttgaa 5520gtggtgggct aactacggct acactagaag aacagtattt ggtatctgcg ctctgctgaa 5580gccagttacc ttcggaaaaa gagttggtag ctcttgatcc ggcaaacaaa ccaccgctgg 5640tagcggtggt ttttttgttt gcaagcagca gattacgcgc agaaaaaaag gatctcaaga 5700agatcctttg atcttttcta cggggtctga cgctcagtgg aacgacgcgc gcgtaactca 5760cgttaaggga ttttggtcat gagcttgcgc cgtcccgtca agtcagcgta atgctctgct 5820tttaccaatg cttaatcagt gaggcaccta tctcagcgat ctgtctattt cgttcatcca 5880tagttgcctg actccccgtc gtgtagataa ctacgatacg ggagggctta ccatctggcc 5940ccagcgctgc gatgataccg cgagaaccac gctcaccggc tccggattta tcagcaataa 6000accagccagc cggaagggcc gagcgcagaa gtggtcctgc aactttatcc gcctccatcc 6060agtctattaa ttgttgccgg gaagctagag taagtagttc gccagttaat agtttgcgca 6120acgttgttgc catcgctaca ggcatcgtgg tgtcacgctc gtcgtttggt atggcttcat 6180tcagctccgg ttcccaacga tcaaggcgag ttacatgatc ccccatgttg tgcaaaaaag 6240cggttagctc cttcggtcct ccgatcgttg tcagaagtaa gttggccgca gtgttatcac 6300tcatggttat ggcagcactg cataattctc ttactgtcat gccatccgta agatgctttt 6360ctgtgactgg tgagtactca accaagtcat tctgagaata gtgtatgcgg cgaccgagtt 6420gctcttgccc ggcgtcaata cgggataata ccgcgccaca tagcagaact ttaaaagtgc 6480tcatcattgg aaaacgttct tcggggcgaa aactctcaag gatcttaccg ctgttgagat 6540ccagttcgat gtaacccact cgtgcaccca actgatcttc agcatctttt actttcacca 6600gcgtttctgg gtgagcaaaa acaggaaggc aaaatgccgc aaaaaaggga ataagggcga 6660cacggaaatg ttgaatactc atattcttcc tttttcaata ttattgaagc atttatcagg 6720gttattgtct catgagcgga tacatatttg aatgtattta gaaaaataaa caaatagggg 6780tcagtgttac aaccaattaa ccaattctga acattatcgc gagcccattt atacctgaat 6840atggctcata acaccccttg tttgcctggc ggcagtagcg cggtggtccc acctgacccc 6900atgccgaact cagaagtgaa acgccgtagc gccgatggta gtgtggggac tccccatgcg 6960agagtaggga actgccaggc atcaaataaa acgaaaggct cagtcgaaag actgggcctt 7020tcgcccgggc taattatggg gtgtcgccct tattcgactc tatagtgaag ttcctattct 7080ctagaaagta taggaacttc tgaagtgggg cctgcagg 71181813852DNAArtificial SequenceDescription of Artificial Sequence Synthetic plasmid pJB825t 18tgggagtcaa taaacccgat gtgcgttgga tttgccacta ccagccgccc ctgcaactca 60gtgaatatct ccaagaggtg ggacgcgctg ggcgagatgg cgaagcggca caggccctgg 120ttttggtgag cgatcgctgg ggcttggatc gcgaagatca acagcgttgg tctttttttc 180agcaccaaag tcaagacacc tacaatcgcg ccatggcact tcagacgcag ctgcccctcc 240agggtaatct gcagcaactg cggcaacact ttcctgaagt ggaattgacc ctggcattac 300tgcatcaaca gggggccctc cgctggcaag atccctttca ctattgccgt caacccttgg 360cacaggtgcc acccccaccc aaagaccctc aagaacagtt gatgcaaaag ttcctctatc 420accggggctg ccgctggcag tttctcctcc aagcctttgg ttttgccact gaggcaaggg 480gattccactg tggccattgc gatcgctgtc ggccgccgca ccgctcccgc aaaataccgt 540aaattgccag cgctgtatca ctggaatatt gggtacactg gcacatagaa cggtcgcttt 600accattggta ggcaaaagtt tctcagcagt cattctgttg ccgcaaggta ggggttgcag 660gcatggggct actacaagtt gaggaaattc gcgaagcact tcaagatgtg ctttcagaac 720acgcccttgt tgtgcaagtt aatcagtttc gcaaccaatt aaacattatt ttgaacaagc 780cccccggcac cgttgcccat tattctgccc tagcggattt tctcaagtcg cgcttgggac 840agtttcatct caatgatatt gaccgcatta aaataattgg ccgcatacag ggttcgccta 900aacccgattg ggaagaggtc attgatctac gtccccccaa cccagcccta gctgcccctg 960tgtatgcttc ttctgccccg tgggtggtgg cgatcgctgc tggctttgtc agtttactgg 1020tgatctttag ctatcacctt ggtcagtagc agcaacagca acggctgtag ccgttgatcg 1080aaggttcctt tggtcaaaag ggcgtcgtga tgacggactt taagtggcac attgagggtg 1140gtacagggtt tattgtcggg gttcttaaaa actacagtaa agggtatttt cgcttagttc 1200aggcggactt tgaactcttt gaccaaggcg gtcagcaagt tgggacagtg gcggtacagg 1260tttatggtct tggccctgag gaaacatggc aattccgtga actgatagcc aatcatcagg 1320cagtgcgagc acggctggta aaattacagt cattcaatta aggtttttct aatgtttagg 1380tttccccagc agggagcgac accgcttgct atggcacacc ttaaagccct gatctttgat 1440gtcgatggca ccttagcaga tacggagcgg gatggccatc gtatcgcctt caacaaggcc 1500tttgccgccg ctggtctaga ttgggaatgg gacattcccc tctatggtca actcctggcg 1560gtggctgggg gcaaggagcg gatccggtat taccttgagt gctttcgtcc cgattggcca 1620cgtccccaaa atttggatgc tctgattgcc gatttacaca aggccaagac ccgctattat 1680accgagctat tggcggcagg ggctattccc ctgcggccgg gggtgaaacg gctcctcact 1740gaagcccggg aagcaggatt acgtttggcg atcgccacca cgaccacccc tgccaatgtc 1800accgcactcc ttgaaaatgc cctcgctcct gatggcgtca gttggtttga gataattgct 1860gccggggatg tagttccagc caagaaaccc gcgcccgaca tttacttcta cacgcttgaa 1920aagatgcgcc tctcacccca agagtgcctt gcctttgagg attccgccaa tgggattcag 1980gcggccactg ccagtcacct agcgaccatt atcacgatta ccgactacac caaggatcat 2040gattttcgtg atgcagcgct ggtcttggat tgcttagggg aaccggacta cccctttcag 2100gttctgcgcg gtgaggtggg ttggacaacc tatgtggatg tccccctatt gcgatcgctg 2160caccagcagt ggacaagcac gttgagtcag ggataatttt ctggccgcag cgttttacat 2220tgaatatgac ccccttagtc tgaggatcaa ggaacataat gtacacgatt gatttaattc 2280tgcgtcatgt ccccatgccc gtcagcattg aacgcaagga aagtgcagca gcgatggcag 2340tctatcagca aattcagcag gccatggcca gtggtactcc aactttcctc gaactgacgt 2400gcgatcgcca agtgggcaag aagttaacgg tgctcacctc agaaattgtc gccgtgcaaa 2460tggcggataa ggatgccccc tccagtacta tcagtcgtgg gggattcttt gctcaattag 2520tgcagcaaac cagcaactga gggaaaatgc ctcaataaag ttgagttttt cttggcaatg 2580ctgattcttt gccgttagga tactaagcag accgatccgt aggggaacgt gaagcaaatc 2640ctccccgtct gaaagtcagg tatctctggt gtgtcgtaat agggttgtct atggtgcagc 2700gtttcctgcc ggttctgatt ttgttggggt gtagttttgg tcttgcgacc cctgcccttg 2760tgcgtgccca agccaatcag ggctttacgt ttacttgggg tgaggggccg agtggccgac 2820agcagttgca ataccactta gataacggca cccccggttt tatgggcgat cgctattggc 2880tgcggctggg tcagcagaaa gtggccatca atcgcattaa cattacctat cccgactact 2940acaacggtat tattgatccc aaaggcattg aggtgcgcat cggtggcgat cgcggcaatc 3000gcttcttcca atttcgccgt gaccccggca ccaaaattca attggcggaa gtctccgttg 3060atcgcgataa ccgcgtgatt gatattgtgc cggctgaggt gattcccgcc ggaacaccgg 3120tgcaagttat tctcaataat gtgcgcaacc ctaacaatgg cggcatgtac tatttcaatg 3180cccgcattgg ctcccctgga gatattcccc tcatgcgcta cgttggcacc tggattctca 3240gcattgccaa taactaaaac ccgtcaaact cgagcattgg tgagcgggtt agccatttct 3300aactattgcg gggcgatcgc cctagactag ttttttgtct attattgccg gttcactctt 3360tacaccagat gccagattcc gttaggtctt cattcccctc catttctcct ctgctcacgc 3420ctctgatgta ccgcctcgtg ggggacgttg tcctgcggcg ctattttcgt acccttgagg 3480tgcaagggca ggagcgggtg ccccaaaggg gtccagtgat cttggccccc acccaccgtt 3540cccgctggga tgcgctgatt attccctatg tcactgggcg gcgggtgagt gggcgcgacc 3600tctactacat ggtgtcccac gatgagatgt tgggactaca gggctgggtg attgctcagt 3660gtggcggttt tcccgtcaat acccaagcgc cttcggtgag tgcgttgcgt acgggtgtgg 3720aactgctccg gcaggggcaa gccttggtgg tgttccctga ggggaatatc tttcgcgatc 3780gccagattca tcccctcaag ccggggttgg ctcgcttagc ccttcaggcg gcccagcgct 3840gtgaacaagc aatccagatt ctgccaattt tactcgatta tgcccagccc tacccacagt 3900ggggaagtgc ggtcaaggta atcattgggg ctcccttgag taccgacaat tacgatgcca 3960gccggccaaa aagtgctgcc caacaactga ccagtgatct ctttagaaga cttcagcagc 4020tccaaggggg gcgatcgccc ctgtgttttg cttagacctc aaacttccat ccccgcggcc 4080gctcttgata acccaagagg gcatttttta ggcgcgcctc gagtaacacc gtgcgtgttg 4140actattttac ctctggcggt gataatggtt gcaggatcct tttgctggag gaagaattca 4200tgacaacggc taccgctaca cctgttttgg actaccatag cgatcgctac aaggatgcct 4260acagccgcat taacgccatt gtcattgaag gtgaacagga agctcacgat aactatatcg 4320atttagccaa gctgctgcca caacaccaag aggaactcac ccgccttgcc aagatggaag 4380ctcgccacaa aaaggggttt gaggcctgtg gtcgcaacct gagcgtaacg ccagatatgg 4440aatttgccaa agccttcttt gaaaaactgc gcgctaactt tcagagggct ctggcggagg 4500gaaaaactgc gacttgtctt ctgattcaag ctttgatcat cgaatccttt gcgatcgcgg 4560cctacaacat ctacatccca atggcggatc ctttcgcccg taaaattact gagagtgttg 4620ttaaggacga atacagccac ctcaactttg gcgaaatctg gctcaaggaa cactttgaaa 4680gcgtcaaagg agagctcgaa gaagccaatc gcgccaattt acccttggtc tggaaaatgc 4740tcaaccaagt ggaagcagat gccaaagtgc tcggcatgga aaaagatgcc cttgtggaag 4800acttcatgat tcagtacagt ggtgccctag aaaatatcgg ctttaccacc cgcgaaatta 4860tgaagatgtc agtttatggc ctcactgggg cataatggtg gcttaacgta tcgttacatt 4920tcagtcacca cacgcttgta tgtttggatt aattggtcat ctgacgagtc tggagcacgc 4980ccaagccgtt gcccatcagt tgggttaccc cgaatatgcc gatcaaggct tggaattttg 5040gtgtatggca ccgccgcaga tcgtcgatga gattacggtg acgagcgtaa cgggcaaaac 5100tatctatggc aaatacgttg agtcctgctt tttaccagag atgctggcca accagcgggt 5160gaaggcagcg actcgcaaag ttattaacgc catggcccat gcccaaaagc acaacattga 5220cattacggcc ttggggggct tctcctcgat catctttgag aactttgatc tggagaaaat 5280gtcccacatt cgcaacattg aactggactt tcgccgcttt acaacgggga atacccatac 5340cgcctatatc atctgccaac aaattgagca ggcggcgccc caagtgggga ttgatttgcg 5400gcaggcaacc gtggctgttt gtggggctac gggggatatt ggtagtgccg tctgccgttg 5460gttgaatacc tgtttagatg tgcaagatct cttactcgta gcacggaatc gcgatcgcct 5520gctggagcta caggcggaat tgggacgggg gaaaatcctc gacttgatgg aggcgctgcc 5580ccttgccgat attgtggttt gggtggccag tatgcccaag ggagttgagc tgagcattga 5640gcagttaaaa cgcccctccc tgatgattga tggtggttat cccaaaaata tggccaccaa 5700aattcagcac ccccagattc atgttctcaa tggtggcatt gtcgagcatg ccctcgacat 5760tgactggaaa attatggaaa ttgtgaatat ggatgtgccc tcgcggcaga tgtttgcctg 5820ttttgcagag gctatgcttt tagagttcga gggctggcac accaatttct cttggggacg 5880caatcaaatc actgtggaaa agatgcagca aattggtgag gtctcccgta aacatggatt

5940tcagccacta ctgttgaatc ctcagtaagc ggccgcaaaa aaaacgggcc ggcgtattat 6000cgccggcccg agtaacaccg tgcgtgttga ctattttacc tctggcggtg ataatggttg 6060caggatcctt ttgctggagg aaaaccatat gaaaggacca ataataatga ctagagaaga 6120aagaatgaag attgttcatg aaattaagga acgaatattg gataaatatg gggatgatgt 6180taaggcaatt ggtgtttatg gctctcttgg tcgtcagact gatgggccct attcggatat 6240tgagatgatg tgtgttctgt caacagaggg agtagagttc agctatgaat ggacaaccgg 6300tgagtggaag gcggaagtga atttttatag cgaagagatt ctactagatt atgcatctcg 6360ggtggaaccg gattggccgc ttacacatgg tcgatttttc tctattttgc cgatttatga 6420tccaggtgga tactttgaga aagtgtacca aactgctaaa tcggtagaag cccaaaagtt 6480ccacgatgcg atctgtgccc ttatcgtaga agagctgttt gaatatgcag gcaaatggcg 6540taatattcgt gtgcaaggac cgacaacatt tctaccatcc ttgactgtac aggtggcaat 6600ggcaggtgcc atgttgattg gtctgcatca tcgcatctgt tatacgacga gcgcttcggt 6660cttaactgaa gcagttaagc aaccagatct tcctccaggt tatgtccaac tgtgccagct 6720cgtaatgtct ggtcaacttt ccgaccctga gaaacttctg gaatcgctag agaatttctg 6780gaatggggtt caggagtggg cggaacgaca cggatatata gtggatgtgt caaaacgcat 6840accattttga tgtctaaccc ccttccttgc ccacagcttc gtcgatggcg cgaaatttcg 6900ggtaaatata atgaccctct tgataaccca agagggcatt ttttaggcgc gccctaagcg 6960tccgtaggca caattaaggc ttcaaattgt tggcgaagct gctcagtcac ttccttgacg 7020gcttgccgtg ccccttggcg atcgcgccgg tacagaggcc aatagctctc taaattgaga 7080gggtcgccga cactgaggcg cacctgccgc aaacccacca aacgattgag attcgagctt 7140tttccctcta gccaatcaaa tgtgcgccag agaatcagcg cgacatctgc aaagcgatga 7200atcgtgaatt tctcacggat atagctaccc gtaattgagg taaatcgctc cgcaagacgc 7260atatgacgca atcgcacatt ggcttcctcg gccaaccaat cggctaggca gcgctctacg 7320gccgaaagtt gtgccaaatc actgcgaaac atccgttccc aagcagcctg ttcaatgcgt 7380cggcagcgac tcacaaaatc ggcactgggc ttcagaccaa agtaggactc tgccaccaca 7440agggcgctgt tgaggaggcg ctgaattcgc gctgccaatt tagcattggc agagtcaaag 7500gggggcagtt cgggaaaatc ttgaccatag gaggtggcat aaaaagcctc caggcgatcc 7560aagaggtgga tcgctaaatt cagcaggcgg cggtagaggt cgtctggctg ggtactgtga 7620gaatctgtag ggcacccaag gcggttctcc agttgtgcca tcagccttgc catgcgctcc 7680caagagggct gactgaggct gtactgaatg ccaatgggaa gaatgaccac ggggagcgat 7740cgccccgcct tggctaaatc ttctagacac caaaatccca gttgggccac ccccggctcc 7800aaaggtgcga ccagttcgtt gtgctcattc gttgctccct ccggcgctgc cgctagggga 7860aatcgtcctc cgagaagtag ctcccgcgct gagcgcaggg cttggctatc gagcttaccg 7920cgcatgatgg aaatcccccc caaccgtgaa aagagccaac caatctgcgc ccctgcccag 7980aggggaatcc cgcgatcgta gagaaaatag ccatttgtcg gcggacgcaa gggaatgccc 8040agccgccgtg ctgtttgcgg cagtaaatgc cacatcaaat agcccatcac caacggatca 8100tccgtacagg gatggcgaaa ggcaatgagg agccggacct gtccctgctg aaactgctgg 8160taataacggg caagggtctc cacattcacc ccttcaaccc gctgtagccc aagaccatag 8220cgaatgtaga ggggcaggag tcttgctact gtccaccaga cggggtagct aaaccgctgg 8280gggagaaaat gcaacggcgg ttgggcagtt gtcactacac tggacattag gcaagctcct 8340cagggcaatg gctaaactga ggcagtggcc aactccgcaa ttaactgctc taacatcggt 8400tgatcggccc aatagacagc attacaaaac tgacaggtgg cttctgcctt tgcctctgtg 8460gctaggatat ctcttaattc tgcctcccct aggagcttga gtgccgctaa catccgttca 8520tgggaacagc cacagtggaa gcgcaccatt tgccgttggg gcaagatttg taaatccata 8580tcccctaaga gttcctgaaa gatatctggc agtgtccgcc ctgcctgtag cagtggtgta 8640aagcccttaa gattggccac ccgttgttca agggtcgcga tcaggtgttc atcattggcc 8700gctttgggta gcacctgtaa catcaaccca ccggcggcag tcaccccgga ctcttcgaca 8760aaaacaccca acatcagggc ggagggggtt tgctctgagg tggcgaggta gtaggtgatg 8820tcttctgcaa tttcgccgga gactagctcc accgtgctgg aataggggta gccgtagcca 8880agatcgtgga tgacgtagag atatccctga tggcccaccg ctgcccccac atcgagtttg 8940cccttggcat tggggggcag ttcaacactg gggtactgca catagccgcg aactgtgcca 9000tcggcaccag catcggcaaa aatggttcct aggggaccgt tgccctgaat gcgcacattc 9060acccgtgctt ggggctgttt gaaactggag gcaaggatta agcctgcggc catggttcgt 9120cccaaggccg ctgtggccac gtaggacagt tggtgacgtt tgcgggcttc atcagtgagt 9180tgagtggtaa tcacacctac ggcccggatg ccttcggcag cggcagttgc tcgcaacaga 9240aaatcggcca tgttcaacct acgaaatgtt ttgttacatt tagtgtgaca tactcccacc 9300gctgaccagg gcacaatggg gcaaaaaacc atcaatcctg cctttggtga ccgatccagt 9360acagccagcc agggcttaag actgggaaga cccctagcac tggggctaga aaattggcga 9420tgataggcaa gcaatagtca ttcagcgtcc agtcattccg cctatggcca tgcccctcac 9480tgtcttgcct gccacaactg ttttgacaga agcgactcaa ttgccccagg gcggcttgat 9540tacggagatt ccgacgctgg cgatcgccca ccgtttggcc cagcagttgc gccgccattg 9600gcccctagag acccccttaa cgctgattga tgcgcaatac cagagtatcc ccctgaccct 9660tggggaattg gccgagctca ccgatgccaa ctgtccttta cagctctatg tgccgccccc 9720cttgccagag gccttgacgc aatttcaacg cctgatggat gtggttcgag agctgcgcca 9780tccggagcgt ggctgtcctt gggatttgca gcaaacccca accagtctca ttccctatgt 9840ccttgaggaa gcctatgaag tggtacatgc cctgcaggag ggagatgcgg gggcgatcgc 9900cgaagaattg ggagacctgt tgcttcaagt tgttctccag agccaacttg cccaagaagc 9960cggccaattt acccttgctc aagtcattca aaggattacc gataaactca tccgccgcca 10020tccccacgtc tttggtgaag tggcactcac cactgctcaa gaggtgcgcg accaatggga 10080gcaaatcaaa gcggctgaaa aaggcaccga actccccctg agtcaaacgc tgcaacgtta 10140cgcacgcacc ctcccacccc tgatggccgg catgaaaatt ggtgagcgag ccagtcgcgc 10200tggcctcgat tggccgacga ttagtggtgc atgggagaaa ttttacgagg aactggcgga 10260gtttcaggag gcccttctgc aagggaatgc tgagcaacag gcagcggaat taggagacct 10320gctcttcagt gtgattaacc ttgcccgctg gtgccaactg gatcctgtta atgccctgca 10380acaaacctac caacgcttta ttcaacgctt ggcctgtatt gaggcagtca tcgatcgccc 10440ccttgagacg tacaccctag aagaactaga agccctctgg caacaggcca aagtacagtt 10500agccaccgac agcgaggcaa cccctatgga gactgaggaa gaggcctagt ccgctgcggc 10560ccttgccacc ttcagttcat cgagattcca cagggggccc cccagcgccg tgggcttggc 10620gccaatgaca tgattgcgaa aagctgtaag ggagagggga ttcacgaggt aaataaaggg 10680gagatattcc tgagctagtc gttgggcttc cgcataaatt tgctgccgtc gttccagatt 10740gagctcctgg gcaccttgga catacaggtc actgatgcgc tgctcccagt cagcgacgac 10800tcgacccgta atgggtggtt gattcggtga cggttgctga ttgaatgtat gcaaaaggcc 10860atccacacgc cagatattgg caccgctatt gggttcattg ccccccccag taaagccgag 10920gatatgggct tcccactcta gggaattgga gagacgatcc acgagggtac caaaggccaa 10980aaattgcaga tccacctgca tgccgatcgc ccctaggtcc tgctgaactt gcgtcgggcc 11040ggccaaaatg aagtgaagtt cctatacttt ctagagaata ggaacttcta tagtgagtcg 11100aataagggcg acacaaaatt tattctaaat gcataataaa tactgataac atcttatagt 11160ttgtattata ttttgtatta tcgttgacat gtataatttt gatatcaaaa actgattttc 11220cctttattat tttcgagatt tattttctta attctcttta acaaactaga aatattgtat 11280atacaaaaaa tcataaataa tagatgaata gtttaattat aggtgttcat caatcgaaaa 11340agcaacgtat cttatttaaa gtgcgttgct tttttctcat ttataaggtt aaataattct 11400catatatcaa gcaaagtgac aggcgccctt aaatattctg acaaatgctc tttccctaaa 11460ctccccccat aaaaaaaccc gccgaagcgg gtttttacgt tatttgcgga ttaacgatta 11520ctcgttatca gaaccgccca gggggcccga gcttaagact ggccgtcgtt ttacaacaca 11580gaaagagttt gtagaaacgc aaaaaggcca tccgtcaggg gccttctgct tagtttgatg 11640cctggcagtt ccctactctc gccttccgct tcctcgctca ctgactcgct gcgctcggtc 11700gttcggctgc ggcgagcggt atcagctcac tcaaaggcgg taatacggtt atccacagaa 11760tcaggggata acgcaggaaa gaacatgtga gcaaaaggcc agcaaaaggc caggaaccgt 11820aaaaaggccg cgttgctggc gtttttccat aggctccgcc cccctgacga gcatcacaaa 11880aatcgacgct caagtcagag gtggcgaaac ccgacaggac tataaagata ccaggcgttt 11940ccccctggaa gctccctcgt gcgctctcct gttccgaccc tgccgcttac cggatacctg 12000tccgcctttc tcccttcggg aagcgtggcg ctttctcata gctcacgctg taggtatctc 12060agttcggtgt aggtcgttcg ctccaagctg ggctgtgtgc acgaaccccc cgttcagccc 12120gaccgctgcg ccttatccgg taactatcgt cttgagtcca acccggtaag acacgactta 12180tcgccactgg cagcagccac tggtaacagg attagcagag cgaggtatgt aggcggtgct 12240acagagttct tgaagtggtg ggctaactac ggctacacta gaagaacagt atttggtatc 12300tgcgctctgc tgaagccagt taccttcgga aaaagagttg gtagctcttg atccggcaaa 12360caaaccaccg ctggtagcgg tggttttttt gtttgcaagc agcagattac gcgcagaaaa 12420aaaggatctc aagaagatcc tttgatcttt tctacggggt ctgacgctca gtggaacgac 12480gcgcgcgtaa ctcacgttaa gggattttgg tcatgagctt gcgccgtccc gtcaagtcag 12540cgtaatgctc tgcttttacc aatgcttaat cagtgaggca cctatctcag cgatctgtct 12600atttcgttca tccatagttg cctgactccc cgtcgtgtag ataactacga tacgggaggg 12660cttaccatct ggccccagcg ctgcgatgat accgcgagaa ccacgctcac cggctccgga 12720tttatcagca ataaaccagc cagccggaag ggccgagcgc agaagtggtc ctgcaacttt 12780atccgcctcc atccagtcta ttaattgttg ccgggaagct agagtaagta gttcgccagt 12840taatagtttg cgcaacgttg ttgccatcgc tacaggcatc gtggtgtcac gctcgtcgtt 12900tggtatggct tcattcagct ccggttccca acgatcaagg cgagttacat gatcccccat 12960gttgtgcaaa aaagcggtta gctccttcgg tcctccgatc gttgtcagaa gtaagttggc 13020cgcagtgtta tcactcatgg ttatggcagc actgcataat tctcttactg tcatgccatc 13080cgtaagatgc ttttctgtga ctggtgagta ctcaaccaag tcattctgag aatagtgtat 13140gcggcgaccg agttgctctt gcccggcgtc aatacgggat aataccgcgc cacatagcag 13200aactttaaaa gtgctcatca ttggaaaacg ttcttcgggg cgaaaactct caaggatctt 13260accgctgttg agatccagtt cgatgtaacc cactcgtgca cccaactgat cttcagcatc 13320ttttactttc accagcgttt ctgggtgagc aaaaacagga aggcaaaatg ccgcaaaaaa 13380gggaataagg gcgacacgga aatgttgaat actcatattc ttcctttttc aatattattg 13440aagcatttat cagggttatt gtctcatgag cggatacata tttgaatgta tttagaaaaa 13500taaacaaata ggggtcagtg ttacaaccaa ttaaccaatt ctgaacatta tcgcgagccc 13560atttatacct gaatatggct cataacaccc cttgtttgcc tggcggcagt agcgcggtgg 13620tcccacctga ccccatgccg aactcagaag tgaaacgccg tagcgccgat ggtagtgtgg 13680ggactcccca tgcgagagta gggaactgcc aggcatcaaa taaaacgaaa ggctcagtcg 13740aaagactggg cctttcgccc gggctaatta tggggtgtcg cccttattcg actctatagt 13800gaagttccta ttctctagaa agtataggaa cttctgaagt ggggcctgca gg 138521992DNAArtificial SequenceDescription of Artificial Sequence Synthetic PcI promoter 19gcggccgctc gagtaacacc gtgcgtgttg actattttac ctctggcggt gataatggtt 60gcaggatcct tttgctggag gaaaaccata tg 9220605DNAArtificial SequenceDescription of Artificial Sequence Synthetic PcpcB promoter 20gcggccgctt cgttataaaa taaacttaac aaatctatac ccacctgtag agaagagtcc 60ctgaatatca aaatggtggg ataaaaagct caaaaaggaa agtaggctgt ggttccctag 120gcaacagtct tccctacccc actggaaact aaaaaaacga gaaaagttcg caccgaacat 180caattgcata attttagccc taaaacataa gctgaacgaa actggttgtc ttcccttccc 240aatccaggac aatctgagaa tcccctgcaa cattacttaa caaaaaagca ggaataaaat 300taacaagatg taacagacat aagtcccatc accgttgtat aaagttaact gtgggattgc 360aaaagcattc aagcctaggc gctgagctgt ttgagcatcc cggtggccct tgtcgctgcc 420tccgtgtttc tccctggatt tatttaggta atatctctca taaatccccg ggtagttaac 480gaaagttaat ggagatcagt aacaataact ctagggtcat tactttggac tccctcagtt 540tatccggggg aattgtgttt aagaaaatcc caactcataa agtcaagtag gagattaatc 600atatg 605211510DNAArtificial SequenceDescription of Artificial Sequence Synthetic PlacI-trc promoter 21gcggccgcga aggcgaagcg gcatgcattt acgttgacac catcgaatgg tgcaaaacct 60ttcgcggtat ggcatgatag cgcccggaag agagtcaatt cagggtggtg aatatgaaac 120cagtaacgtt atacgatgtc gcagagtatg ccggtgtctc ttatcagacc gtttcccgcg 180tggtgaacca ggccagccac gtttctgcga aaacgcggga aaaagtggaa gcggcgatgg 240cggagctgaa ttacattccc aaccgcgtgg cacaacaact ggcgggcaaa cagtcgttgc 300tgattggcgt tgccacctcc agtctggccc tgcacgcgcc gtcgcaaatt gtcgcggcga 360ttaaatctcg cgccgatcaa ctgggtgcca gcgtggtggt gtcgatggta gaacgaagcg 420gcgtcgaagc ctgtaaagcg gcggtgcaca atcttctcgc gcaacgcgtc agtgggctga 480tcattaacta tccgctggat gaccaggatg ccattgctgt ggaagctgcc tgcactaatg 540ttccggcgtt atttcttgat gtctctgacc agacacccat caacagtatt attttctccc 600atgaagacgg tacgcgactg ggcgtggagc atctggtcgc attgggtcac cagcaaatcg 660cgctgttagc gggcccatta agttctgtct cggcgcgtct gcgtctggct ggctggcata 720aatatctcac tcgcaatcaa attcagccga tagcggaacg ggaaggcgac tggagtgcca 780tgtccggttt tcaacaaacc atgcaaatgc tgaatgaggg catcgttccc actgcgatgc 840tggttgccaa cgatcagatg gcgctgggcg caatgcgcgc cattaccgag tccgggctgc 900gcgttggtgc ggatatctcg gtagtgggat acgacgatac cgaagacagc tcatgttata 960tcccgccgtc aaccaccatc aaacaggatt ttcgcctgct ggggcaaacc agcgtggacc 1020gcttgctgca actctctcag ggccaggcgg tgaagggcaa tcagctgttg cccgtctcac 1080tggtgaaaag aaaaaccacc ctggcgccca atacgcaaac cgcctctccc cgcgcgttgg 1140ccgattcatt aatgcagctg gcacgacagg tttcccgact ggaaagcggg cagtgagcgc 1200aacgcaatta atgtgagtta gcgcgaattg atctggtttg acagcttatc atcgagctcg 1260actgcacggt gcaccaatgc ttctggcgtc aggcagccat cggaagctgt ggtatggctg 1320tgcaggtcgt aaatcactgc ataattcgtg tcgctcaagg cgcactcccg ttctggataa 1380tgttttttgc gccgacatca taacggttct ggcaaatatt ctgaaatgag ctgttgacaa 1440ttaatcatcc ggctcgtata atgtgtggaa ttgtgagcgg ataacaattt cacacaggaa 1500acagcatatg 15102278DNAArtificial SequenceDescription of Artificial Sequence Synthetic EM7 promoter 22gcggccgctg ttgacaatta atcatcggca tagtatatcg gcatagtata atacgacaag 60gtgaggaact aacatatg 7823341PRTSynechococcus elongatus 23Met Phe Gly Leu Ile Gly His Leu Thr Ser Leu Glu Gln Ala Arg Asp 1 5 10 15 Val Ser Arg Arg Met Gly Tyr Asp Glu Tyr Ala Asp Gln Gly Leu Glu 20 25 30 Phe Trp Ser Ser Ala Pro Pro Gln Ile Val Asp Glu Ile Thr Val Thr 35 40 45 Ser Ala Thr Gly Lys Val Ile His Gly Arg Tyr Ile Glu Ser Cys Phe 50 55 60 Leu Pro Glu Met Leu Ala Ala Arg Arg Phe Lys Thr Ala Thr Arg Lys 65 70 75 80 Val Leu Asn Ala Met Ser His Ala Gln Lys His Gly Ile Asp Ile Ser 85 90 95 Ala Leu Gly Gly Phe Thr Ser Ile Ile Phe Glu Asn Phe Asp Leu Ala 100 105 110 Ser Leu Arg Gln Val Arg Asp Thr Thr Leu Glu Phe Glu Arg Phe Thr 115 120 125 Thr Gly Asn Thr His Thr Ala Tyr Val Ile Cys Arg Gln Val Glu Ala 130 135 140 Ala Ala Lys Thr Leu Gly Ile Asp Ile Thr Gln Ala Thr Val Ala Val 145 150 155 160 Val Gly Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Asp 165 170 175 Leu Lys Leu Gly Val Gly Asp Leu Ile Leu Thr Ala Arg Asn Gln Glu 180 185 190 Arg Leu Asp Asn Leu Gln Ala Glu Leu Gly Arg Gly Lys Ile Leu Pro 195 200 205 Leu Glu Ala Ala Leu Pro Glu Ala Asp Phe Ile Val Trp Val Ala Ser 210 215 220 Met Pro Gln Gly Val Val Ile Asp Pro Ala Thr Leu Lys Gln Pro Cys 225 230 235 240 Val Leu Ile Asp Gly Gly Tyr Pro Lys Asn Leu Gly Ser Lys Val Gln 245 250 255 Gly Glu Gly Ile Tyr Val Leu Asn Gly Gly Val Val Glu His Cys Phe 260 265 270 Asp Ile Asp Trp Gln Ile Met Ser Ala Ala Glu Met Ala Arg Pro Glu 275 280 285 Arg Gln Met Phe Ala Cys Phe Ala Glu Ala Met Leu Leu Glu Phe Glu 290 295 300 Gly Trp His Thr Asn Phe Ser Trp Gly Arg Asn Gln Ile Thr Ile Glu 305 310 315 320 Lys Met Glu Ala Ile Gly Glu Ala Ser Val Arg His Gly Phe Gln Pro 325 330 335 Leu Ala Leu Ala Ile 340 24341PRTSynechococcus elongatus 24Met Phe Gly Leu Ile Gly His Leu Thr Ser Leu Glu Gln Ala Arg Asp 1 5 10 15 Val Ser Arg Arg Met Gly Tyr Asp Glu Tyr Ala Asp Gln Gly Leu Glu 20 25 30 Phe Trp Ser Ser Ala Pro Pro Gln Ile Val Asp Glu Ile Thr Val Thr 35 40 45 Ser Ala Thr Gly Lys Val Ile His Gly Arg Tyr Ile Glu Ser Cys Phe 50 55 60 Leu Pro Glu Met Leu Ala Ala Arg Arg Phe Lys Thr Ala Thr Arg Lys 65 70 75 80 Val Leu Asn Ala Met Ser His Ala Gln Lys His Gly Ile Asp Ile Ser 85 90 95 Ala Leu Gly Gly Phe Thr Ser Ile Ile Phe Glu Asn Phe Asp Leu Ala 100 105 110 Ser Leu Arg Gln Val Arg Asp Thr Thr Leu Glu Phe Glu Arg Phe Thr 115 120 125 Thr Gly Asn Thr His Thr Ala Tyr Val Ile Cys Arg Gln Val Glu Ala 130 135 140 Ala Ala Lys Thr Leu Gly Ile Asp Ile Thr Gln Ala Thr Val Ala Val 145 150 155 160 Val Gly Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Asp 165 170 175 Leu Lys Leu Gly Val Gly Asp Leu Ile Leu Thr Ala Arg Asn Gln Glu 180 185 190 Arg Leu Asp Asn Leu Gln Ala Glu Leu Gly Arg Gly Lys Ile Leu Pro 195 200 205 Leu Glu Ala Ala Leu Pro Glu Ala Asp Phe Ile Val Trp Val Ala Ser 210 215 220 Met Pro Gln Gly Val Val Ile Asp Pro Ala Thr Leu Lys Gln Pro Cys 225 230 235 240 Val Leu Ile Asp Gly Gly Tyr Pro Lys Asn Leu Gly Ser Lys Val Gln 245 250 255 Gly Glu Gly Ile Tyr Val Leu Asn Gly Gly Val Val Glu His Cys Phe 260 265 270 Asp Ile Asp Trp Gln Ile Met Ser Ala Ala Glu Met Ala Arg Pro Glu 275 280 285 Arg Gln Met Phe Ala Cys Phe Ala Glu Ala Met Leu Leu Glu Phe Glu 290 295 300 Gly Trp His Thr Asn Phe Ser Trp Gly Arg Asn Gln Ile Thr Ile Glu 305 310

315 320 Lys Met Glu Ala Ile Gly Glu Ala Ser Val Arg His Gly Phe Gln Pro 325 330 335 Leu Ala Leu Ala Ile 340 25339PRTAnabaena variabilis 25Met Phe Gly Leu Ile Gly His Leu Thr Ser Leu Glu His Ala Gln Ala 1 5 10 15 Val Ala Gln Glu Leu Gly Tyr Pro Glu Tyr Ala Asp Gln Gly Leu Asp 20 25 30 Phe Trp Cys Ser Ala Pro Pro Gln Ile Val Asp His Ile Lys Val Thr 35 40 45 Ser Ile Thr Gly Glu Ile Ile Glu Gly Arg Tyr Val Glu Ser Cys Phe 50 55 60 Leu Pro Glu Met Leu Ala Ser Arg Arg Ile Lys Ala Ala Thr Arg Lys 65 70 75 80 Val Leu Asn Ala Met Ala His Ala Gln Lys His Gly Ile Asp Ile Thr 85 90 95 Ala Leu Gly Gly Phe Ser Ser Ile Ile Phe Glu Asn Phe Lys Leu Glu 100 105 110 Gln Phe Ser Gln Val Arg Asn Val Thr Leu Glu Phe Glu Arg Phe Thr 115 120 125 Thr Gly Asn Thr His Thr Ala Tyr Ile Ile Cys Arg Gln Val Glu Gln 130 135 140 Ala Ser Gln Gln Leu Gly Ile Glu Leu Ser Gln Ala Thr Val Ala Ile 145 150 155 160 Cys Gly Ala Thr Gly Asp Ile Gly Ser Ala Val Thr Arg Trp Leu Asp 165 170 175 Ala Lys Thr Asp Val Lys Glu Leu Leu Leu Ile Ala Arg Asn Gln Glu 180 185 190 Arg Leu Gln Glu Leu Gln Ser Glu Leu Gly Arg Gly Lys Ile Met Ser 195 200 205 Leu Asp Glu Ala Leu Pro Gln Ala Asp Ile Val Val Trp Val Ala Ser 210 215 220 Met Pro Lys Gly Val Glu Ile Asn Pro Gln Val Leu Lys Gln Pro Cys 225 230 235 240 Leu Leu Ile Asp Gly Gly Tyr Pro Lys Asn Leu Gly Thr Lys Val Gln 245 250 255 Tyr Pro Gly Val Tyr Val Leu Asn Gly Gly Ile Val Glu His Ser Leu 260 265 270 Asp Ile Asp Trp Lys Ile Met Lys Ile Val Asn Met Asp Val Pro Ala 275 280 285 Arg Gln Leu Phe Ala Cys Phe Ala Glu Ser Met Leu Leu Glu Phe Glu 290 295 300 Lys Leu Tyr Thr Asn Phe Ser Trp Gly Arg Asn Gln Ile Thr Val Asp 305 310 315 320 Lys Met Glu Gln Ile Gly Gln Ala Ser Val Lys His Gly Phe Arg Pro 325 330 335 Leu Leu Val 26339PRTNostoc sp. 26Met Phe Gly Leu Ile Gly His Leu Thr Ser Leu Glu His Ala Gln Ala 1 5 10 15 Val Ala Gln Glu Leu Gly Tyr Pro Glu Tyr Ala Asp Gln Gly Leu Asp 20 25 30 Phe Trp Cys Ser Ala Pro Pro Gln Ile Val Asp His Ile Lys Val Thr 35 40 45 Ser Ile Thr Gly Glu Ile Ile Glu Gly Arg Tyr Val Glu Ser Cys Phe 50 55 60 Leu Pro Glu Met Leu Ala Ser Arg Arg Ile Lys Ala Ala Thr Arg Lys 65 70 75 80 Val Leu Asn Ala Met Ala His Ala Gln Lys Asn Gly Ile Asp Ile Thr 85 90 95 Ala Leu Gly Gly Phe Ser Ser Ile Ile Phe Glu Asn Phe Lys Leu Glu 100 105 110 Gln Phe Ser Gln Val Arg Asn Val Thr Leu Glu Phe Glu Arg Phe Thr 115 120 125 Thr Gly Asn Thr His Thr Ala Tyr Ile Ile Cys Arg Gln Val Glu Gln 130 135 140 Ala Ser Gln Gln Leu Gly Ile Glu Leu Ser Gln Ala Thr Val Ala Ile 145 150 155 160 Cys Gly Ala Thr Gly Asp Ile Gly Ser Ala Val Thr Arg Trp Leu Asp 165 170 175 Ala Lys Thr Asp Val Lys Glu Leu Leu Leu Ile Ala Arg Asn Gln Glu 180 185 190 Arg Leu Gln Glu Leu Gln Ser Glu Leu Gly Arg Gly Lys Ile Met Ser 195 200 205 Leu Asp Glu Ala Leu Pro Gln Ala Asp Ile Val Val Trp Val Ala Ser 210 215 220 Met Pro Lys Gly Val Glu Ile Asn Pro Gln Val Leu Lys Gln Pro Cys 225 230 235 240 Leu Leu Ile Asp Gly Gly Tyr Pro Lys Asn Leu Gly Thr Lys Val Gln 245 250 255 Tyr Pro Gly Val Tyr Val Leu Asn Gly Gly Ile Val Glu His Ser Leu 260 265 270 Asp Ile Asp Trp Lys Ile Met Lys Ile Val Asn Met Asp Val Pro Ala 275 280 285 Arg Gln Leu Phe Ala Cys Phe Ala Glu Ser Met Leu Leu Glu Phe Glu 290 295 300 Lys Leu Tyr Thr Asn Phe Ser Trp Gly Arg Asn Gln Ile Thr Val Asp 305 310 315 320 Lys Met Glu Gln Ile Gly Gln Ala Ser Val Lys His Gly Phe Arg Pro 325 330 335 Leu Leu Val 27339PRTNostoc azollae 27Met Phe Gly Leu Ile Gly His Leu Thr Ser Leu Glu His Ala Gln Ser 1 5 10 15 Val Ala Gln Glu Leu Gly Tyr Pro Glu Tyr Ala Asp Gln Gly Leu Asp 20 25 30 Phe Trp Cys Ser Ala Pro Pro Gln Ile Val Asp His Ile Thr Val Thr 35 40 45 Ser Ile Thr Gly Gln Lys Ile Glu Gly Arg Tyr Val Glu Ser Cys Phe 50 55 60 Leu Pro Glu Met Leu Ala Asn Arg Arg Ile Lys Ala Ala Thr Arg Lys 65 70 75 80 Ile Leu Asn Ala Met Ala His Ala Gln Lys His Gly Ile Asp Ile Thr 85 90 95 Ala Leu Gly Gly Phe Ser Ser Ile Ile Phe Glu Asn Phe Asn Leu Glu 100 105 110 Gln Phe Ser Gln Val Arg Asn Val Thr Leu Glu Phe Glu Arg Phe Thr 115 120 125 Thr Gly Asn Thr His Thr Ala Tyr Ile Ile Cys Arg Gln Val Glu Glu 130 135 140 Ala Ser Lys Gln Leu Gly Ile Glu Leu Ser Lys Ala Thr Val Ala Val 145 150 155 160 Cys Gly Ala Thr Gly Asp Ile Gly Ser Ala Val Thr Arg Trp Leu Asp 165 170 175 Lys Lys Thr Asp Val Gln Glu Leu Leu Leu Ile Ala Arg Asn Gln Glu 180 185 190 Arg Leu Gln Glu Leu Gln Ala Glu Leu Gly Arg Gly Lys Ile Thr Asp 195 200 205 Leu His Glu Ala Leu Pro Gln Ser Asp Ile Val Val Trp Val Ala Ser 210 215 220 Met Pro Lys Gly Val Glu Ile Asp Pro Ile Val Leu Lys Gln Pro Cys 225 230 235 240 Leu Leu Ile Asp Gly Gly Tyr Pro Lys Asn Leu Gly Thr Lys Ile Gln 245 250 255 His Pro Gly Val Tyr Val Leu Asn Gly Gly Ile Val Glu His Ser Leu 260 265 270 Asp Ile Asp Trp Lys Ile Met Lys Ile Val Ser Met Glu Val Pro Gly 275 280 285 Arg Gln Leu Phe Ala Cys Phe Ala Glu Ser Met Leu Leu Glu Phe Glu 290 295 300 Lys Leu Tyr Thr Asn Phe Ser Trp Gly Arg Asn Gln Ile Thr Val Asp 305 310 315 320 Lys Met Asp His Ile Gly Gln Val Ser Val Lys His Gly Phe Lys Pro 325 330 335 Leu Leu Val 28340PRTCyanothece sp. 28Met Phe Gly Leu Ile Gly His Leu Thr Ser Leu Glu His Ala Gln Ser 1 5 10 15 Val Ala Glu Ala Leu Gly Tyr Pro Glu Tyr Ala Asn Gln Gly Leu Glu 20 25 30 Phe Trp Cys Met Ala Pro Pro Gln Ile Val Asp Ser Ile Thr Val Thr 35 40 45 Ser Ile Thr Gly Gln Lys Ile Tyr Gly Lys Tyr Val Glu Ser Cys Phe 50 55 60 Leu Pro Glu Met Leu Ala Thr Gln Arg Ile Lys Ala Ala Thr Arg Lys 65 70 75 80 Ile Leu Asn Ala Met Ala His Ala Gln Lys His Gly Ile Asp Ile Thr 85 90 95 Ala Leu Gly Gly Phe Ser Ser Ile Ile Phe Glu Asn Phe Asn Leu His 100 105 110 Thr Ile Thr Gln Ile His Asn Ile Lys Leu Glu Leu Gln Arg Phe Thr 115 120 125 Thr Gly Asn Thr His Thr Ala Tyr Ile Ile Cys Arg Gln Val Glu Gln 130 135 140 Ala Ser Ala Gln Ile Gly Ile Asp Leu Ser Lys Ala Thr Val Ala Val 145 150 155 160 Cys Gly Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Asn 165 170 175 Ser Arg Leu Asp Val Ala Glu Leu Leu Leu Val Ala Arg Asn Gln Glu 180 185 190 Arg Leu Gln Glu Leu Gln Glu Glu Leu Gly Arg Gly Lys Ile Leu Ser 195 200 205 Leu Glu Ala Ala Leu Pro Leu Ala Asp Ile Val Val Trp Val Ala Ser 210 215 220 Met Pro Arg Gly Val Glu Ile Asp Pro Thr Ser Leu Arg Thr Pro Cys 225 230 235 240 Leu Met Ile Asp Gly Gly Tyr Pro Lys Asn Leu Ala Thr Gln Ile Gln 245 250 255 His Pro Gly Val His Val Leu Asn Gly Gly Ile Val Glu His Ser Leu 260 265 270 Asp Ile Asp Trp Arg Ile Met Glu Ile Val Asn Met Ser Ile Pro Ser 275 280 285 Arg Gln Leu Phe Ala Cys Phe Ala Glu Ser Met Leu Leu Glu Phe Glu 290 295 300 Gln Trp Tyr Thr Asn Phe Ser Trp Gly Arg Asn Gln Ile Ser Val Glu 305 310 315 320 Lys Met Glu Lys Ile Gly Gln Ile Ser Val Lys His Gly Phe Gln Pro 325 330 335 Leu Leu Phe Gln 340 29346PRTNodularia spumigena 29Met Phe Gly Leu Ile Gly His Leu Thr Ser Leu Glu His Ala Gln Ser 1 5 10 15 Val Ala Lys Glu Leu Gly Tyr Pro Glu Tyr Ala Asp Gln Gly Leu Asp 20 25 30 Phe Trp Cys Ser Ala Pro Pro Gln Ile Val Asp Glu Ile Thr Val Thr 35 40 45 Ser Val Thr Gly Gln Thr Ile Glu Gly Arg Tyr Val Glu Ser Cys Phe 50 55 60 Leu Pro Glu Met Leu Ala Asn Arg Arg Ile Lys Ala Ala Thr Arg Lys 65 70 75 80 Ile Leu Asn Ala Met Ala His Ala Gln Lys His Gly Ile Asn Ile Thr 85 90 95 Ala Leu Gly Gly Phe Ser Ser Ile Ile Phe Glu Asn Phe Lys Leu Glu 100 105 110 Gln Phe Ser Gln Val Arg Asn Ile Lys Leu Glu Phe Glu Arg Phe Thr 115 120 125 Thr Gly Asn Thr His Thr Ala Tyr Ile Ile Cys Arg Gln Val Glu Gln 130 135 140 Ala Ser Lys Gln Ile Gly Ile Asp Leu Ser Lys Ala Thr Val Ala Ile 145 150 155 160 Cys Gly Ala Thr Gly Asp Ile Gly Ser Ala Val Thr Arg Trp Leu Asp 165 170 175 Ala Arg Thr Asp Val Lys Glu Leu Leu Leu Ile Ala Arg Asn His Glu 180 185 190 Arg Leu Lys Asp Leu Gln Asp Glu Leu Gly Arg Gly Lys Ile Met Ala 195 200 205 Leu Asn Glu Ala Leu Pro Glu Ala Asp Ile Val Val Trp Val Ala Ser 210 215 220 Met Pro Lys Ser Met Glu Ile Asp Phe Gln Val Leu Lys Arg Pro Cys 225 230 235 240 Leu Leu Ile Asp Gly Gly Tyr Pro Lys Asn Leu Ala Thr Lys Ile Gln 245 250 255 Tyr Pro Gly Val His Val Leu Asn Gly Gly Ile Val Glu His Ser Leu 260 265 270 Asp Ile Asp Trp Lys Ile Met Lys Ile Val Asn Met Asp Val Pro Ala 275 280 285 Arg Gln Leu Phe Ala Cys Phe Ala Glu Ser Met Leu Leu Glu Phe Glu 290 295 300 Lys Leu Tyr Thr Asn Phe Ser Trp Gly Arg Asn Gln Ile Thr Val Asp 305 310 315 320 Lys Met Glu Gln Ile Gly Gln Ala Ser Ile Lys His Gly Phe Arg Pro 325 330 335 Leu Leu Val Glu Ser Leu Val Val Asn Ser 340 345 30341PRTLyngbya sp. 30Met Phe Gly Leu Ile Gly His Leu Thr Ser Leu Glu His Ala Gln Leu 1 5 10 15 Val Ala Lys Asp Leu Gly Tyr Pro Glu Tyr Ala Asp Gln Gly Leu Asp 20 25 30 Phe Trp Cys Ser Ala Pro Pro Gln Ile Val Asp Glu Ile Lys Val Thr 35 40 45 Ser Val Thr Gly Gln Val Ile Glu Gly Arg Tyr Val Glu Ser Cys Phe 50 55 60 Leu Pro Glu Met Leu Ala Ser Arg Arg Ile Lys Ala Ala Thr Arg Lys 65 70 75 80 Ile Ile Asn Ala Met Ala His Ala Gln Lys His Gly Ile Asn Ile Thr 85 90 95 Ala Leu Gly Gly Phe Ser Ser Ile Ile Phe Glu Asn Phe Asn Leu Glu 100 105 110 Lys Ile Lys Gln Val Arg Asn Ile Lys Leu Glu Phe Glu Arg Phe Thr 115 120 125 Thr Gly Asn Thr His Thr Ala Tyr Ile Ile Cys Ser Gln Val Glu Gln 130 135 140 Met Ala Pro Lys Leu Gly Ile Asp Leu Ser Asn Ala Thr Val Ala Val 145 150 155 160 Cys Gly Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Asn 165 170 175 Gln Arg Thr Gln Val Gly Glu Leu Leu Leu Ile Ala Arg Asp Arg Glu 180 185 190 Arg Leu Gln Asn Leu Gln Gly Glu Leu Gly Arg Gly Lys Ile Leu Gly 195 200 205 Leu Glu Glu Ala Leu Pro Gln Ala Asn Val Val Val Trp Val Ala Ser 210 215 220 Met Ala Lys Gly Val Asp Ile Asp Pro Ser Arg Leu Gln Gln Pro Cys 225 230 235 240 Leu Leu Ile Asp Gly Gly Tyr Pro Lys Asn Met Ala Thr Lys Leu Gln 245 250 255 His Pro Gly Val His Ile Leu Glu Gly Gly Ile Val Glu His Ser Leu 260 265 270 Asp Ile Asp Trp Lys Ile Met Lys Ile Val Asn Met Gln Phe Pro Ala 275 280 285 Arg Gln Leu Phe Ala Cys Phe Ala Glu Ala Met Leu Leu Glu Phe Glu 290 295 300 Lys Ile Tyr Thr Asn Phe Ser Trp Gly Arg Asn Gln Ile Thr Val Asp 305 310 315 320 Lys Met Asp Met Ile Gly Arg Val Ser Ile Lys His Gly Phe Lys Pro 325 330 335 Leu Leu Leu Ser Leu 340 31339PRTNostoc punctiforme 31Met Phe Gly Leu Ile Gly His Leu Thr Ser Leu Glu His Ala Gln Ala 1 5 10 15 Val Ala Gln Glu Leu Gly Tyr Pro Glu Tyr Ala Asp Gln Gly Leu Asp 20 25 30 Phe Trp Cys Ser Ala Pro Pro Gln Ile Val Asp Ser Ile Ile Val Thr 35 40 45 Ser Val Thr Gly Gln Gln Ile Glu Gly Arg Tyr Val Glu Ser Cys Phe 50 55 60 Leu Pro Glu Met Leu Ala Ser Arg Arg Ile Lys Ala Ala Thr Arg Lys 65 70 75 80 Ile Leu Asn Ala Met Ala His Ala Gln Lys His Gly Ile Asn Ile Thr 85 90 95 Ala Leu Gly Gly Phe Ser Ser Ile Ile Phe Glu Asn Phe Lys Leu Glu 100 105 110 Gln Phe Ser Gln Val Arg Asn Ile Lys Leu Glu Phe Glu Arg Phe Thr 115 120 125 Thr Gly Asn Thr His Thr Ala Tyr Ile Ile Cys Lys Gln Val Glu Glu 130 135 140 Ala Ser Lys Gln Leu Gly Ile Asn Leu Ser Asn Ala Thr Val Ala Val 145 150 155 160 Cys Gly Ala Thr Gly Asp Ile Gly Ser Ala Val Thr Arg Trp Leu Asp 165 170 175 Ala Arg Thr Asp Val Gln Glu Leu Leu Leu Ile Ala Arg Asp Gln Glu 180 185 190 Arg Leu Lys Glu Leu Gln Gly Glu Leu Gly Arg Gly Lys Ile Met Gly 195 200 205 Leu Thr Glu Ala Leu Pro Gln Ala Asp Val Val Val Trp Val Ala Ser 210

215 220 Met Pro Arg Gly Val Glu Ile Asp Pro Thr Thr Leu Lys Gln Pro Cys 225 230 235 240 Leu Leu Ile Asp Gly Gly Tyr Pro Lys Asn Leu Ala Thr Lys Ile Gln 245 250 255 Tyr Pro Gly Val His Val Leu Asn Gly Gly Ile Val Glu His Ser Leu 260 265 270 Asp Ile Asp Trp Lys Ile Met Lys Ile Val Asn Met Asp Val Pro Ala 275 280 285 Arg Gln Leu Phe Ala Cys Phe Ala Glu Ser Met Leu Leu Glu Phe Glu 290 295 300 Lys Leu Tyr Thr Asn Phe Ser Trp Gly Arg Asn Gln Ile Thr Val Asp 305 310 315 320 Lys Met Glu Gln Ile Gly Arg Val Ser Val Lys His Gly Phe Arg Pro 325 330 335 Leu Leu Val 32339PRTTrichodesmium erythraeum 32Met Phe Gly Leu Ile Gly His Leu Thr Asn Leu Glu His Ala Gln Ser 1 5 10 15 Val Ala Arg Asp Leu Gly Tyr Pro Glu Tyr Ala Asp Gln Gly Leu Asp 20 25 30 Phe Trp Cys Ser Ala Pro Pro Gln Ile Val Asp Thr Ile Lys Val Thr 35 40 45 Ser Ile Thr Gly Gln Lys Ile Glu Gly Lys Tyr Val Glu Ser Cys Phe 50 55 60 Leu Pro Glu Met Leu Ala Ser Ser Arg Ile Lys Ala Ala Thr Arg Lys 65 70 75 80 Ile Met Asn Ala Met Ala His Ala Gln Lys His Gly Ile Asp Ile Thr 85 90 95 Ala Leu Gly Gly Phe Ser Ser Ile Val Phe Glu Asn Phe Asn Leu Gln 100 105 110 Lys Phe Lys Gln Ile Arg Asn Ile Thr Leu Glu Phe Lys Arg Phe Thr 115 120 125 Thr Gly Asn Thr His Thr Ala Tyr Ile Val Cys Gln Gln Val Glu Gln 130 135 140 Gly Ala Gln Lys Leu Gly Ile Asp Leu Ser Lys Ala Thr Val Ala Val 145 150 155 160 Cys Gly Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Asn 165 170 175 Thr Lys Thr Glu Val Glu Glu Leu Leu Leu Ile Ala Arg Lys Gln Glu 180 185 190 Arg Leu Asn Ala Leu Gln Lys Glu Leu Lys Arg Gly Lys Ile Leu Glu 195 200 205 Leu Asn Ser Ala Leu Pro Met Ala Asp Ile Ile Val Trp Val Ala Ser 210 215 220 Ile Pro Glu Ala Leu Glu Ile Asn Pro Asn Val Leu Lys Lys Pro Cys 225 230 235 240 Leu Leu Ile Asp Gly Gly Tyr Pro Lys Asn Met Ala Thr Lys Val Gln 245 250 255 Gln Glu Gly Ile Tyr Val Leu Asn Gly Gly Ile Val Glu His Ser Leu 260 265 270 Asp Ile Asp Trp Lys Ile Met Lys Ile Val Asn Met Glu Val Pro Gly 275 280 285 Arg Gln Leu Phe Ala Cys Phe Ala Glu Ser Met Leu Leu Glu Phe Glu 290 295 300 Lys Leu Tyr Thr Asn Phe Ser Trp Gly Arg Asn Leu Ile Thr Val Glu 305 310 315 320 Lys Met Glu Leu Ile Gly Lys Leu Ser Val Lys His Gly Phe Lys Pro 325 330 335 Leu Met Leu 33341PRTAcaryochloris marina 33Met Phe Gly Leu Ile Gly His Leu Thr Ser Leu Gln His Ala Gln Ser 1 5 10 15 Val Ala Arg Glu Leu Gly Tyr Pro Glu Tyr Ala Asp Gln Gly Leu Asp 20 25 30 Phe Trp Cys Met Ala Pro Pro Gln Ile Val Asp Asp Ile Thr Val Thr 35 40 45 Ser Ile Thr Gly Gln Thr Ile Tyr Gly Lys Tyr Val Glu Ser Cys Phe 50 55 60 Leu Pro Glu Met Leu Ala Ser Gln Arg Ile Lys Ala Ala Thr Arg Lys 65 70 75 80 Ile Val Asn Ala Met Ala His Ala Gln Lys Asn Gly Ile Asn Ile Thr 85 90 95 Ala Leu Gly Gly Phe Ser Ser Ile Ile Phe Glu Asn Phe Asn Leu Gln 100 105 110 Arg Ile Thr Arg Ile Arg Asn Ile Gln Leu Asp Leu Gln Arg Phe Thr 115 120 125 Thr Gly Asn Thr His Thr Ala Tyr Ile Ile Cys Arg Gln Val Glu Gln 130 135 140 Gly Ala Gln Lys Leu Gly Ile Asp Leu Asn Lys Ala Thr Val Ala Val 145 150 155 160 Cys Gly Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Asp 165 170 175 Ala Arg Thr Asp Thr Ala Glu Leu Leu Leu Val Ala Arg His Gln Gly 180 185 190 Arg Leu Glu Thr Leu Gln Ser Glu Leu Gly Arg Gly Lys Ile Met Ser 195 200 205 Ile Glu Glu Ala Leu Pro Gln Ala Asp Ile Val Val Trp Val Ala Ser 210 215 220 Met Pro Lys Gly Ile Glu Ile Asp Ala Glu Asn Leu Lys His Pro Cys 225 230 235 240 Leu Met Ile Asp Gly Gly Tyr Pro Lys Asn Leu Gly Thr Lys Ile Gln 245 250 255 His Pro Asp Val His Ile Leu Asn Gly Gly Ile Val Glu His Ser Leu 260 265 270 Asp Ile Asp Trp Lys Ile Met His Ile Val Asn Met Asn Ile Pro Asn 275 280 285 Arg Gln Leu Phe Ala Cys Phe Ala Glu Ser Met Leu Leu Glu Phe Glu 290 295 300 Gln Leu His Thr Asn Phe Ser Trp Gly Arg Asn Glu Ile Thr Val Ala 305 310 315 320 Lys Met Glu Lys Ile Gly Glu Ile Ser Leu Lys His Gly Phe Lys Pro 325 330 335 Leu Ala Leu Ala Val 340 34340PRTCyanothece sp. 34Met Phe Gly Leu Ile Gly His Leu Thr Ser Leu Glu His Ala Gln Gln 1 5 10 15 Val Ala Glu Ala Leu Gly Tyr Pro Glu Tyr Ala Asn Gln Gly Leu Asp 20 25 30 Phe Trp Cys Ala Ala Pro Pro Gln Ile Val Asp His Phe His Val Thr 35 40 45 Ser Val Thr Gly Gln Ile Ile Glu Gly Lys Tyr Val Glu Ser Cys Phe 50 55 60 Leu Pro Glu Met Leu Val Asn Arg Arg Ile Lys Ala Ala Ile Arg Lys 65 70 75 80 Ile Leu Asn Ala Met Ala Leu Ala Gln Lys Ala Asp Leu Asn Ile Thr 85 90 95 Ala Leu Gly Gly Phe Ser Ser Ile Ile Phe Glu Glu Phe Asn Leu Lys 100 105 110 Glu Asn Lys Gln Val Arg Asn Val Glu Leu Glu Phe Glu Arg Phe Thr 115 120 125 Thr Gly Asn Thr His Thr Ala Tyr Ile Ile Cys Arg Gln Leu Glu Gln 130 135 140 Val Ser Ala Gln Leu Gly Leu Asp Leu Ser Gln Ala Thr Val Ala Val 145 150 155 160 Cys Gly Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Asp 165 170 175 Gln Lys Thr Asp Val Ala Glu Leu Leu Leu Ile Ala Arg Asn Gln Glu 180 185 190 Arg Leu Gln Gly Leu Gln Ala Glu Leu Gly Arg Gly Lys Ile Met Glu 195 200 205 Leu Glu Glu Ala Leu Pro Gln Ala Asp Ile Ile Val Trp Val Ala Ser 210 215 220 Met Pro Lys Gly Val Glu Ile Asn Pro Glu Thr Leu Lys Lys Pro Cys 225 230 235 240 Leu Ile Ile Asp Gly Gly Tyr Pro Lys Asn Leu Gly Thr Gln Val Gln 245 250 255 His Pro Asp Val Tyr Val Leu Lys Gly Gly Ile Val Glu His Ser Leu 260 265 270 Asp Ile Asp Trp Lys Ile Met Glu Ile Val Ser Met Asp Ile Pro Ser 275 280 285 Arg Gln Met Phe Ala Cys Phe Ala Glu Gly Ile Leu Leu Glu Phe Glu 290 295 300 Gly Trp His Thr Asn Phe Ser Trp Gly Arg Asn Gln Ile Ser Val Pro 305 310 315 320 Lys Met Glu Gln Ile Gly Glu Ala Ser Leu Lys His Gly Phe Arg Pro 325 330 335 Leu Leu Ser Trp 340 35340PRTCyanothece sp. 35Met Phe Gly Leu Ile Gly His Leu Thr Ser Leu Glu His Ala Gln Gln 1 5 10 15 Val Ala Glu Ala Leu Gly Tyr Pro Glu Tyr Ala Asn Gln Gly Leu Asp 20 25 30 Phe Trp Cys Ala Ala Pro Pro Gln Ile Val Asp His Phe His Val Thr 35 40 45 Ser Val Thr Gly Gln Ile Ile Glu Gly Lys Tyr Val Glu Ser Cys Phe 50 55 60 Leu Pro Glu Met Leu Val Asn Arg Arg Ile Lys Ala Ala Ile Arg Lys 65 70 75 80 Ile Leu Asn Ala Met Ala Leu Ala Gln Lys Ala Asp Leu Asn Ile Thr 85 90 95 Ala Leu Gly Gly Phe Ser Ser Ile Ile Phe Glu Glu Phe Asn Leu Lys 100 105 110 Glu Asn Lys Gln Val Arg Asn Val Glu Leu Glu Phe Glu Arg Phe Thr 115 120 125 Thr Gly Asn Thr His Thr Ala Tyr Ile Ile Cys Arg Gln Leu Glu Gln 130 135 140 Val Ser Ala Gln Leu Gly Leu Asp Leu Ser Gln Ala Thr Val Ala Val 145 150 155 160 Cys Gly Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Asp 165 170 175 Gln Lys Thr Asp Val Ala Glu Leu Leu Leu Ile Ala Arg Asn Gln Glu 180 185 190 Arg Leu Gln Gly Leu Gln Ala Glu Leu Gly Arg Gly Lys Ile Met Glu 195 200 205 Leu Glu Glu Ala Leu Pro Gln Ala Asp Ile Ile Val Trp Val Ala Ser 210 215 220 Met Pro Lys Gly Val Glu Ile Asn Pro Glu Thr Leu Lys Lys Pro Cys 225 230 235 240 Leu Ile Ile Asp Gly Gly Tyr Pro Lys Asn Leu Gly Thr Gln Val Gln 245 250 255 His Pro Asp Val Tyr Val Leu Lys Gly Gly Ile Val Glu His Ser Leu 260 265 270 Asp Ile Asp Trp Lys Ile Met Glu Ile Val Ser Met Asp Ile Pro Ser 275 280 285 Arg Gln Met Phe Ala Cys Phe Ala Glu Gly Ile Leu Leu Glu Phe Glu 290 295 300 Gly Trp His Thr Asn Phe Ser Trp Gly Arg Asn Gln Ile Ser Val Pro 305 310 315 320 Lys Met Glu Gln Ile Gly Glu Ala Ser Leu Lys His Gly Phe Arg Pro 325 330 335 Leu Leu Ser Trp 340 36340PRTMicrocoleus chthonoplastes 36Met Phe Gly Leu Ile Gly His Leu Thr Ser Leu Gln His Ala Gln Ala 1 5 10 15 Val Ala Arg Asp Leu Gly Tyr Pro Glu Tyr Ala Asp Gln Gly Leu Asp 20 25 30 Phe Trp Cys Ser Ala Pro Pro Gln Ile Val Asp Thr Ile Lys Val Thr 35 40 45 Ser Leu Thr Gly Glu Thr Ile Glu Gly Arg Tyr Val Glu Ser Cys Phe 50 55 60 Leu Pro Glu Met Leu Ala Thr Arg Arg Ile Lys Ala Ala Ile Arg Lys 65 70 75 80 Val Leu Asn Ala Met Ala His Ala Gln Lys Asn Gly Ile Glu Ile Thr 85 90 95 Ala Leu Gly Gly Phe Ser Ser Ile Ile Phe Glu Glu Phe His Leu Tyr 100 105 110 Glu Lys Ser Gln Val Arg Asn Ile Lys Leu Glu Phe Glu Arg Phe Thr 115 120 125 Thr Gly Asn Thr His Thr Ala Tyr Ile Ile Ser Ala Gln Val Glu Gln 130 135 140 Gly Ala Gln Lys Leu Gly Ile Asp Leu Ser Lys Ala Thr Val Ala Val 145 150 155 160 Cys Gly Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Asn 165 170 175 Thr Arg Thr Asp Val Ala Glu Ile Leu Leu Thr Ala Arg Asn Gln Glu 180 185 190 Arg Leu Gln Ala Leu Gln Asp Gln Leu Gly Arg Gly Lys Ile Met Gly 195 200 205 Leu Glu Glu Ala Leu Pro Gln Ala Asp Ile Ile Val Trp Val Ala Ser 210 215 220 Met Ser Lys Gly Ile Asp Ile Asp Ala Ser Leu Leu Lys Lys Pro Cys 225 230 235 240 Leu Leu Ile Asp Gly Gly Tyr Pro Lys Asn Leu Ala Thr Lys Leu Gln 245 250 255 His Pro Asp Ile Tyr Val Leu Asn Gly Gly Ile Val Glu His Ser Leu 260 265 270 Asp Ile Asp Trp Lys Ile Met Gln Ile Val Glu Met Lys Asp Pro Gly 275 280 285 Arg Gln Leu Phe Ala Cys Phe Ala Glu Ser Met Leu Leu Glu Phe Glu 290 295 300 Lys Trp Tyr Thr Asn Phe Ser Trp Gly Arg Asn Gln Ile Thr Val Glu 305 310 315 320 Lys Met Asp Lys Ile Gly Gln Val Ser Ile Lys His Gly Phe Arg Pro 325 330 335 Leu Leu Asn Val 340 37339PRTArthrospira maxima 37Met Phe Gly Leu Ile Gly His Leu Thr Ser Leu Glu His Ala Gln Val 1 5 10 15 Val Ala Arg Asp Leu Gly Tyr Ala Glu Tyr Ala Asp Gln Gly Leu Asp 20 25 30 Phe Trp Cys Ser Ala Pro Pro Val Ile Val Glu Asp Leu Lys Val Thr 35 40 45 Ser Ile Thr Gly Gln Val Ile Glu Gly Arg Tyr Val Glu Ser Cys Phe 50 55 60 Leu Pro Glu Met Leu Ala Thr Asn Arg Met Lys Ala Ala Thr Arg Lys 65 70 75 80 Ile Ile Asn Ala Met Ala His Ala Gln Lys Asn Gly Ile Asn Ile Thr 85 90 95 Ala Leu Gly Gly Phe Ser Ser Ile Ile Leu Glu Arg Phe Asn Leu Asp 100 105 110 Gln Leu Gly Arg Ile Arg Asn Ile Lys Leu Glu Phe Glu Arg Phe Thr 115 120 125 Thr Gly Asn Thr His Thr Ala Tyr Ile Ile Cys Arg Gln Val Glu Gln 130 135 140 Ala Ala Pro Lys Leu Gly Ile Asp Leu Ser Lys Ala Thr Val Ala Val 145 150 155 160 Cys Gly Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Asn 165 170 175 Gly Arg Leu Asp Val Ala Glu Ile Leu Leu Ile Ala Arg Asp Arg Gln 180 185 190 Arg Leu Gln Asn Leu Gln Ala Glu Leu Gly Arg Gly Lys Ile Met Ala 195 200 205 Leu Asp Glu Ala Leu Pro Gln Ala Asp Ile Val Val Trp Val Ala Ser 210 215 220 Met Pro Gln Gly Val Glu Ile Asp Pro Glu Val Leu Lys Lys Pro Cys 225 230 235 240 Leu Leu Ile Asp Gly Gly Tyr Pro Lys Asn Met Ala Thr Lys Phe Gln 245 250 255 Ser Pro Gly Val His Val Leu Ser Gly Gly Ile Val Glu His Ala Leu 260 265 270 Asp Ile Asp Trp Lys Ile Met Lys Ile Val Asn Met Asn Val Pro Gly 275 280 285 Arg Gln Leu Phe Ala Cys Phe Ala Glu Ser Met Leu Leu Glu Phe Glu 290 295 300 Ser Ile Tyr Thr Asn Phe Ser Trp Gly Arg Asn Gln Ile Thr Leu Asp 305 310 315 320 Lys Met Asp Met Ile Gly Arg Met Ser Ile Lys His Gly Phe Lys Pro 325 330 335 Leu Met Leu 38340PRTSynechocystis sp. 38Met Phe Gly Leu Ile Gly His Leu Thr Ser Leu Glu His Ala Gln Ala 1 5 10 15 Val Ala Glu Asp Leu Gly Tyr Pro Glu Tyr Ala Asn Gln Gly Leu Asp 20 25 30 Phe Trp Cys Ser Ala Pro Pro Gln Val Val Asp Asn Phe Gln Val Lys 35 40 45 Ser Val Thr Gly Gln Val Ile Glu Gly Lys Tyr Val Glu Ser Cys Phe 50 55 60 Leu Pro Glu Met Leu Thr Gln Arg Arg Ile Lys Ala Ala Ile Arg Lys 65 70 75 80 Ile Leu Asn Ala Met Ala Leu Ala Gln Lys Val Gly Leu Asp Ile Thr 85 90 95 Ala Leu Gly Gly Phe Ser Ser Ile Val Phe Glu Glu Phe Asn Leu Lys 100 105 110 Gln Asn Asn Gln Val Arg Asn Val Glu Leu Asp Phe Gln Arg Phe Thr 115 120

125 Thr Gly Asn Thr His Thr Ala Tyr Val Ile Cys Arg Gln Val Glu Ser 130 135 140 Gly Ala Lys Gln Leu Gly Ile Asp Leu Ser Gln Ala Thr Val Ala Val 145 150 155 160 Cys Gly Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Asp 165 170 175 Ser Lys His Gln Val Lys Glu Leu Leu Leu Ile Ala Arg Asn Arg Gln 180 185 190 Arg Leu Glu Asn Leu Gln Glu Glu Leu Gly Arg Gly Lys Ile Met Asp 195 200 205 Leu Glu Thr Ala Leu Pro Gln Ala Asp Ile Ile Val Trp Val Ala Ser 210 215 220 Met Pro Lys Gly Val Glu Ile Ala Gly Glu Met Leu Lys Lys Pro Cys 225 230 235 240 Leu Ile Val Asp Gly Gly Tyr Pro Lys Asn Leu Asp Thr Arg Val Lys 245 250 255 Ala Asp Gly Val His Ile Leu Lys Gly Gly Ile Val Glu His Ser Leu 260 265 270 Asp Ile Thr Trp Glu Ile Met Lys Ile Val Glu Met Asp Ile Pro Ser 275 280 285 Arg Gln Met Phe Ala Cys Phe Ala Glu Ala Ile Leu Leu Glu Phe Glu 290 295 300 Gly Trp Arg Thr Asn Phe Ser Trp Gly Arg Asn Gln Ile Ser Val Asn 305 310 315 320 Lys Met Glu Ala Ile Gly Glu Ala Ser Val Lys His Gly Phe Cys Pro 325 330 335 Leu Val Ala Leu 340 39340PRTCyanothece sp. 39Met Phe Gly Leu Ile Gly His Leu Thr Ser Leu Glu His Ala Gln Ser 1 5 10 15 Val Ala Asp Ala Leu Gly Tyr Pro Glu Tyr Ala Asn Gln Gly Leu Asp 20 25 30 Phe Trp Cys Ser Ala Pro Pro Gln Ile Val Asp His Phe His Val Thr 35 40 45 Ser Val Thr Gly Gln Thr Ile Glu Gly Lys Tyr Val Glu Ser Cys Phe 50 55 60 Leu Pro Glu Met Leu Met Asn Arg Arg Ile Lys Ala Ala Ile Arg Lys 65 70 75 80 Ile Leu Asn Ala Met Ala Leu Ala Gln Lys Asn Ser Ile Asn Ile Thr 85 90 95 Ala Leu Gly Gly Phe Ser Ser Ile Ile Phe Glu Glu Phe Asn Leu Lys 100 105 110 Asp Asn Lys Gln Val Arg Asn Val Ser Leu Glu Phe Asp Arg Phe Thr 115 120 125 Thr Gly Asn Thr His Thr Ala Tyr Val Ile Cys Arg Gln Val Glu Gln 130 135 140 Gly Ser Ala Lys Leu Gly Ile Asp Leu Ser Lys Ala Thr Ile Ala Val 145 150 155 160 Cys Gly Ala Thr Gly Asp Ile Gly Ser Gly Val Cys Arg Trp Leu Asp 165 170 175 Arg Asn Thr Asn Thr Gln Glu Leu Leu Leu Ile Ala Arg Asn Gln Glu 180 185 190 Arg Leu Lys Arg Leu Gln Asp Glu Leu Gly Arg Gly Lys Ile Met Gly 195 200 205 Leu Glu Glu Ala Leu Pro Glu Ala Asp Val Ile Val Trp Val Ala Ser 210 215 220 Met Pro Lys Gly Val Glu Ile Asn Pro Glu Thr Leu Lys Lys Pro Cys 225 230 235 240 Leu Ile Ile Asp Gly Gly Tyr Pro Lys Asn Leu Asp Thr Lys Ile Lys 245 250 255 His Ser Asp Val His Ile Leu Lys Gly Gly Ile Val Glu His Ser Leu 260 265 270 Asp Ile Asp Trp Lys Ile Met Glu Ile Val Ser Met Asp Ile Pro Ser 275 280 285 Arg Gln Met Phe Ala Cys Phe Ala Glu Ala Ile Leu Leu Glu Phe Glu 290 295 300 Gln Trp His Thr Asn Phe Ser Trp Gly Arg Asn Gln Ile Thr Val Thr 305 310 315 320 Lys Met Glu Gln Ile Gly Thr Ala Ser Val Lys His Gly Phe Gln Pro 325 330 335 Leu Leu Asn Trp 340 40339PRTSynechococcus sp. 40Met Phe Gly Leu Ile Gly His Leu Thr Ser Leu Glu His Ala Lys Ser 1 5 10 15 Val Ala His Lys Leu Gly Tyr Pro Glu Tyr Ala Glu Gln Gly Leu Asp 20 25 30 Phe Trp Cys Ser Ala Pro Pro Gln Val Val Asp His Phe Lys Val Val 35 40 45 Ser Ala Thr Gly Gln Thr Ile Glu Gly Lys Tyr Val Glu Ser Cys Phe 50 55 60 Leu Pro Glu Met Leu Ala Asn Arg Arg Ile Lys Ala Ala Thr Arg Lys 65 70 75 80 Ile Leu Asn Ala Met Ala His Ala Gln Lys Glu Gly Ile Asn Ile Thr 85 90 95 Ala Leu Gly Gly Phe Ser Ser Ile Ile Phe Glu Asn Phe Lys Leu Glu 100 105 110 Gln Ile Lys Arg Val Arg Asn Leu Asp Leu Asp Phe Ser Lys Phe Thr 115 120 125 Thr Gly Asn Thr His Thr Ala Tyr Val Ile Cys Lys Gln Val Glu Glu 130 135 140 Ala Ala Pro Ser Leu Gly Ile Asp Leu Ser Gln Ala Thr Val Ala Val 145 150 155 160 Cys Gly Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Thr 165 170 175 Ala Arg Thr Gly Val Lys Asn Leu Leu Leu Val Ala Arg Asn Gln Glu 180 185 190 Arg Leu Glu Asn Leu Gln Ala Asp Leu Lys Phe Gly Gln Val Gln Thr 195 200 205 Leu Asp Glu Ala Leu Pro Gln Ala Asp Val Val Val Trp Val Ala Ser 210 215 220 Met Pro Lys Gly Val Glu Val Asp Leu Glu Thr Leu Lys Gln Pro Cys 225 230 235 240 Leu Met Val Asp Gly Gly Tyr Pro Lys Asn Met Asp Val Thr Phe Ser 245 250 255 His Pro Gly Ile Thr Val Leu Lys Gly Gly Ile Val Glu His Met Leu 260 265 270 Asp Ile Asp Trp His Ile Met Asn Ile Val Asn Met Asp Val Pro Gly 275 280 285 Arg Gln Leu Phe Ala Cys Phe Ala Glu Ser Met Leu Leu Glu Phe Glu 290 295 300 Lys Leu His Thr Asn Phe Ser Trp Gly Arg Asn Gln Ile Thr Leu Glu 305 310 315 320 Lys Met Asp Leu Ile Gly Glu Ala Ser Arg Arg His Gly Phe Lys Pro 325 330 335 Leu Leu Thr 41340PRTCyanothece sp. 41Met Phe Gly Leu Ile Gly His Leu Thr Ser Leu Glu His Ala His Ser 1 5 10 15 Val Ala Asp Ala Phe Gly Tyr Gly Pro Tyr Ala Thr Gln Gly Leu Asp 20 25 30 Leu Trp Cys Ser Ala Pro Pro Gln Phe Val Glu His Phe His Val Thr 35 40 45 Ser Ile Thr Gly Gln Thr Ile Glu Gly Lys Tyr Ile Glu Ser Ala Phe 50 55 60 Leu Pro Glu Met Leu Ile Lys Arg Arg Ile Lys Ala Ala Ile Arg Lys 65 70 75 80 Ile Leu Asn Ala Met Ala Phe Ala Gln Lys Asn Asn Leu Asn Ile Thr 85 90 95 Ala Leu Gly Gly Phe Ser Ser Ile Ile Phe Glu Glu Phe Asn Leu Lys 100 105 110 Glu Asn Arg Gln Val Arg Asn Val Ser Leu Glu Phe Asp Arg Phe Thr 115 120 125 Thr Gly Asn Thr His Thr Ala Tyr Ile Ile Cys Arg Gln Val Glu Gln 130 135 140 Ala Ser Ala Lys Leu Gly Ile Asp Leu Ser Gln Ala Thr Val Ala Ile 145 150 155 160 Cys Gly Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Asp 165 170 175 Arg Lys Thr Asp Thr Gln Glu Leu Phe Leu Ile Ala Arg Asn Lys Glu 180 185 190 Arg Leu Gln Arg Leu Gln Asp Glu Leu Gly Arg Gly Lys Ile Met Gly 195 200 205 Leu Glu Glu Ala Leu Pro Glu Ala Asp Ile Ile Val Trp Val Ala Ser 210 215 220 Met Pro Lys Gly Val Glu Ile Asn Ala Glu Thr Leu Lys Lys Pro Cys 225 230 235 240 Leu Ile Ile Asp Gly Gly Tyr Pro Lys Asn Leu Asp Thr Lys Ile Lys 245 250 255 His Pro Asp Val His Ile Leu Lys Gly Gly Ile Val Glu His Ser Leu 260 265 270 Asp Ile Asp Trp Lys Ile Met Glu Thr Val Asn Met Asp Val Pro Ser 275 280 285 Arg Gln Met Phe Ala Cys Phe Ala Glu Ala Ile Leu Leu Glu Phe Glu 290 295 300 Gln Trp His Thr Asn Phe Ser Trp Gly Arg Asn Gln Ile Thr Val Thr 305 310 315 320 Lys Met Glu Gln Ile Gly Glu Ala Ser Val Lys His Gly Leu Gln Pro 325 330 335 Leu Leu Ser Trp 340 42350PRTGloeobacter violaceus 42Met Phe Gly Leu Ile Gly His Leu Thr Asn Leu Ser His Ala Gln Arg 1 5 10 15 Val Ala Arg Asp Leu Gly Tyr Asp Glu Tyr Ala Ser His Asp Leu Glu 20 25 30 Phe Trp Cys Met Ala Pro Pro Gln Ala Val Asp Glu Ile Thr Ile Thr 35 40 45 Ser Val Thr Gly Gln Val Ile His Gly Gln Tyr Val Glu Ser Cys Phe 50 55 60 Leu Pro Glu Met Leu Ala Gln Gly Arg Phe Lys Thr Ala Met Arg Lys 65 70 75 80 Ile Leu Asn Ala Met Ala Leu Val Gln Lys Arg Gly Ile Asp Ile Thr 85 90 95 Ala Leu Gly Gly Phe Ser Ser Ile Ile Phe Glu Asn Phe Ser Leu Asp 100 105 110 Lys Leu Leu Asn Val Arg Asp Ile Thr Leu Asp Ile Gln Arg Phe Thr 115 120 125 Thr Gly Asn Thr His Thr Ala Tyr Ile Leu Cys Gln Gln Val Glu Gln 130 135 140 Gly Ala Val Arg Tyr Gly Ile Asp Pro Ala Lys Ala Thr Val Ala Val 145 150 155 160 Val Gly Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Thr 165 170 175 Asp Arg Ala Gly Ile His Glu Leu Leu Leu Val Ala Arg Asp Ala Glu 180 185 190 Arg Leu Asp Arg Leu Gln Gln Glu Leu Gly Thr Gly Arg Ile Leu Pro 195 200 205 Val Glu Glu Ala Leu Pro Lys Ala Asp Ile Val Val Trp Val Ala Ser 210 215 220 Met Asn Gln Gly Met Ala Ile Asp Pro Ala Gly Leu Arg Thr Pro Cys 225 230 235 240 Leu Leu Ile Asp Gly Gly Tyr Pro Lys Asn Met Ala Gly Thr Leu Gln 245 250 255 Arg Pro Gly Ile His Ile Leu Asp Gly Gly Met Val Glu His Ser Leu 260 265 270 Asp Ile Asp Trp Gln Ile Met Ser Phe Leu Asn Val Pro Asn Pro Ala 275 280 285 Arg Gln Phe Phe Ala Cys Phe Ala Glu Ser Met Leu Leu Glu Phe Glu 290 295 300 Gly Leu His Phe Asn Phe Ser Trp Gly Arg Asn His Ile Thr Val Glu 305 310 315 320 Lys Met Ala Gln Ile Gly Ser Leu Ser Lys Lys His Gly Phe Arg Pro 325 330 335 Leu Leu Glu Pro Ser Gln Arg Ser Gly Glu Leu Val His Gly 340 345 350 43339PRTMicrocystis aeruginosa 43Met Phe Gly Leu Ile Gly His Leu Thr Ser Leu Glu His Ala Gln Ser 1 5 10 15 Val Ala Asp Asp Leu Gly Tyr Pro Glu Tyr Ala Asn Gln Gly Leu Asp 20 25 30 Phe Trp Cys Ala Ala Pro Pro Gln Ile Val Asp Asp Phe His Val Thr 35 40 45 Ser Ile Thr Gly Gln Thr Ile Arg Gly Lys Tyr Ile Glu Ser Cys Phe 50 55 60 Leu Pro Glu Met Leu Ser Asn Arg Trp Val Lys Ser Ala Ile Arg Lys 65 70 75 80 Val Leu Asn Ala Met Ala Leu Ala Gln Lys Ser Asp Ile Asn Ile Thr 85 90 95 Ala Leu Gly Gly Phe Ser Ser Ile Ile Phe Glu Glu Phe Asn Leu Lys 100 105 110 Asp Asn Arg Gln Val Arg Asn Ile Glu Leu Asp Phe Gly Arg Phe Thr 115 120 125 Thr Gly Asn Thr His Thr Ala Tyr Val Ile Cys Thr Gln Val Glu Thr 130 135 140 Leu Ala Glu Lys Met Gly Ile Asp Leu Ala Gln Ser Thr Val Val Val 145 150 155 160 Cys Gly Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Asn 165 170 175 Glu Lys Thr Asp Thr Lys Glu Leu Ile Cys Val Ala Arg Asn Gln Glu 180 185 190 Arg Leu Gln Ser Leu Gln Glu Glu Leu Gly Arg Gly Lys Ile Leu Pro 195 200 205 Leu Glu Glu Ala Leu Pro Leu Ala Asp Ile Ile Val Trp Val Ala Ser 210 215 220 Leu Pro Lys Gly Val Glu Ile Asp Pro Asp Lys Leu Lys Arg Pro Cys 225 230 235 240 Ile Ile Ile Asp Gly Gly Tyr Pro Lys Asn Leu Gly Thr Val Leu Asn 245 250 255 Ala Pro Asp Ile Ser Val Ile Lys Gly Gly Ile Val Glu His Ser Leu 260 265 270 Asp Ile Asp Trp Lys Ile Met Lys Ile Val Asn Met Asp Ile Pro Ser 275 280 285 Arg Gln Met Phe Ala Cys Phe Ala Glu Ala Ile Leu Leu Glu Leu Glu 290 295 300 Gly Trp Gln Thr Asn Phe Ser Trp Gly Arg Asn Gln Ile Thr Val Pro 305 310 315 320 Lys Met Glu Gln Ile Gly Ala Ala Ser Arg Lys His Gly Phe Gln Pro 325 330 335 Leu Leu Phe 44340PRTCrocosphaera watsonii 44Met Phe Gly Leu Ile Gly His Leu Thr Ser Leu Glu His Ala His Ser 1 5 10 15 Val Ala Asp Ala Phe Gly Tyr Gly Pro Tyr Ala Thr Gln Gly Leu Asp 20 25 30 Leu Trp Cys Ser Ala Pro Pro Gln Phe Val Glu Gln Phe His Val Thr 35 40 45 Ser Ile Thr Gly Gln Thr Ile Glu Gly Lys Tyr Ile Glu Ser Ala Phe 50 55 60 Leu Pro Glu Met Leu Met Lys Arg Arg Ile Lys Ala Ala Ile Arg Lys 65 70 75 80 Ile Leu Asn Ala Met Ala Phe Ala Gln Lys Asn Asp Leu Asn Ile Thr 85 90 95 Ala Leu Gly Gly Phe Ser Ser Ile Ile Phe Glu Glu Phe Asn Leu Lys 100 105 110 Gly Asn Arg Gln Val Arg Asn Val Ser Leu Glu Phe Asp Arg Phe Thr 115 120 125 Thr Gly Asn Thr His Thr Ala Tyr Ile Ile Ala Arg Gln Val Glu Gln 130 135 140 Ala Ser Ala Lys Leu Gly Ile Asp Leu Ser Arg Ala Thr Val Ala Val 145 150 155 160 Cys Gly Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Asp 165 170 175 Arg Lys Thr Asp Thr Gln Glu Leu Leu Leu Ile Ala Arg Asn Gln Glu 180 185 190 Arg Leu Gln Arg Leu Gln Asp Glu Leu Gly Arg Gly Lys Ile Met Gly 195 200 205 Leu Glu Glu Ala Leu Pro Glu Ala Asp Val Ile Val Trp Val Ala Ser 210 215 220 Met Pro Lys Gly Val Glu Ile Asn Pro Glu Thr Leu Lys Lys Pro Cys 225 230 235 240 Leu Ile Val Asp Gly Gly Tyr Pro Lys Asn Leu Asp Thr Lys Ile Lys 245 250 255 His Pro Asp Val His Ile Leu Lys Gly Gly Val Val Glu His Ser Leu 260 265 270 Asp Ile Asp Trp Lys Ile Met Glu Thr Val Asn Met Asp Val Pro Ser 275 280 285 Arg Gln Met Phe Ala Cys Phe Ala Glu Ala Ile Leu Leu Glu Phe Glu 290 295 300 Gln Trp His Thr Asn Phe Ser Trp Gly Arg Asn Gln Ile Thr Val Thr 305 310 315 320 Lys Met Glu Gln Ile Gly Gly Ala Ser Val Lys His Gly Leu Gln Pro 325 330 335 Leu Leu Ser Trp 340 45339PRTMicrocystis aeruginosa 45Met Phe Gly Leu Ile Gly His Leu Thr Ser Leu Glu His Ala Gln Ser 1 5 10 15 Val Ala Asp Asp

Leu Gly Tyr Pro Glu Tyr Ala Asn Gln Gly Leu Asp 20 25 30 Phe Trp Cys Ala Ala Pro Pro Gln Ile Val Asp Asp Phe His Val Thr 35 40 45 Ser Ile Thr Gly Gln Thr Ile Thr Gly Lys Tyr Ile Glu Ser Cys Phe 50 55 60 Leu Pro Glu Met Leu Ser Asn Arg Trp Val Lys Ser Ala Ile Arg Lys 65 70 75 80 Val Leu Asn Ala Met Ala Leu Ala Gln Lys Ser Asp Ile Asn Ile Thr 85 90 95 Ala Leu Gly Gly Phe Ser Ser Ile Ile Phe Glu Glu Phe Asn Leu Lys 100 105 110 Asp Asn Arg Gln Val Arg Asn Ile Glu Leu Asp Phe Gly Arg Phe Thr 115 120 125 Thr Gly Asn Thr His Thr Ala Tyr Val Ile Cys Thr Gln Val Gln Thr 130 135 140 Leu Ala Asp Lys Met Gly Ile Asp Leu Ala Gln Ser Thr Val Val Val 145 150 155 160 Cys Gly Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Asn 165 170 175 Glu Lys Thr Asp Thr Lys Glu Leu Ile Cys Val Ala Arg Asn Gln Glu 180 185 190 Arg Leu Gln Ser Leu Gln Glu Glu Leu Gly Arg Gly Lys Ile Leu Pro 195 200 205 Leu Glu Glu Ala Leu Pro Leu Ala Asp Ile Ile Val Trp Val Ala Ser 210 215 220 Met Pro Lys Gly Val Glu Ile Asp Pro Asp Lys Leu Lys Arg Pro Cys 225 230 235 240 Leu Ile Ile Asp Gly Gly Tyr Pro Lys Asn Leu Gly Thr Val Leu Asn 245 250 255 Ala Pro Asp Val Ser Val Ile Lys Gly Gly Ile Val Glu His Ser Leu 260 265 270 Asp Ile Asp Trp Lys Ile Met Lys Ile Val Asn Met Asp Ile Pro Ser 275 280 285 Arg Gln Met Phe Ala Cys Phe Ala Glu Ala Ile Leu Leu Glu Leu Glu 290 295 300 Gly Trp Gln Thr Asn Phe Ser Trp Gly Arg Asn Gln Ile Ser Val Ser 305 310 315 320 Lys Met Glu Gln Ile Gly Ala Ala Ser Arg Lys His Gly Phe Gln Pro 325 330 335 Leu Leu Phe 46348PRTSynechococcus sp. 46Met Phe Gly Leu Ile Gly His Ser Thr Ser Leu Glu Gln Ala Arg Ser 1 5 10 15 Lys Ala Leu Glu Leu Gly Phe Pro Glu Tyr Ala Asp Gly Asp Leu Asp 20 25 30 Leu Trp Cys Val Ala Pro Pro Gln Leu Val Glu Asn Val Ser Ile Thr 35 40 45 Ser Pro Thr Gly Lys Thr Ile Glu Gly Ala Tyr Ile Asp Ser Val Phe 50 55 60 Val Pro Glu Met Leu Ser Arg Phe Lys Thr Ala Arg Arg Lys Val Leu 65 70 75 80 Asn Ala Met Glu Leu Ala Gln Lys Ser Gly Ile Asp Ile Thr Ala Leu 85 90 95 Gly Gly Phe Thr Ser Ile Ile Phe Glu Asn Phe Asn Leu Leu Lys Asn 100 105 110 Gln Gln Ile Arg Ser Thr Ala Leu Glu Trp Glu Arg Phe Thr Thr Gly 115 120 125 Asn Thr His Thr Ala Trp Val Ile Ala Gln Gln Val Glu Thr Asn Ala 130 135 140 Pro Ala Leu Gly Ile Asp Leu Ser Arg Ala Lys Val Ala Val Val Gly 145 150 155 160 Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Ser Gln Asn 165 170 175 Thr Gly Val Gly Glu Leu Leu Leu Val Ala Arg Gln Pro Gln Pro Leu 180 185 190 Leu Asp Leu Gln Ala Glu Leu Gly Ser Gly Arg Ile Leu Ser Leu Glu 195 200 205 Glu Ala Leu Pro Glu Ala Asp Val Val Val Trp Val Ala Ser Leu Pro 210 215 220 Gln Gly Leu Ser Ile Asp Pro Ala Ser Leu Lys Ser Pro Cys Leu Met 225 230 235 240 Ile Asp Gly Gly Tyr Pro Lys Asn Leu Asp Ser Lys Val Thr Gly Ala 245 250 255 Gly Val His Val Ile Lys Gly Gly Ile Val Glu Phe Trp Gln Asp Ile 260 265 270 Gly Trp Gln Met Met Gln Val Ala Glu Met Glu Asn Pro Arg Arg Gln 275 280 285 Leu Phe Ala Cys Phe Ala Glu Ala Met Leu Leu Glu Phe Glu Gly Leu 290 295 300 His Thr Asn Phe Ser Trp Gly Arg Asn Asn Ile Thr Leu Ala Asn Met 305 310 315 320 Glu Leu Ile Gly Ala Ala Ser Leu Arg His Gly Phe Arg Ser Ile Gly 325 330 335 Leu Asn Gln Val Pro Arg Pro Gln Leu Ala Ala Val 340 345 47349PRTSynechococcus sp. 47Met Phe Gly Leu Ile Gly His Ser Ser Ser Phe Arg Asp Ala Arg Asn 1 5 10 15 Thr Ala Arg Asp Leu Gly Phe Glu Asp Leu Ala Asp Gly Glu Leu Asp 20 25 30 Leu Trp Cys Ser Ala Pro Pro Gln Leu Val Glu Ser Phe Glu Val Thr 35 40 45 Ser Ser Thr Gly Lys Thr Ile Glu Gly Thr Tyr Ile Asp Ser Cys Phe 50 55 60 Val Pro Glu Met Leu Ser Arg Phe Lys Thr Ala Thr Arg Lys Val Gln 65 70 75 80 Asn Ala Met Glu Leu Ala Gln Lys Arg Gly Ile Asn Ile Thr Ala Leu 85 90 95 Gly Gly Phe Thr Ser Ile Ile Phe Glu Asn Phe Asn Leu Ala Lys Phe 100 105 110 Gln Gln Ile Arg Ser Thr Leu Leu Gln Trp Asp Arg Phe Thr Thr Gly 115 120 125 Asn Thr His Thr Ala Trp Val Ile Cys Arg Gln Val Glu Gln Asn Ala 130 135 140 Pro Arg Leu Gly Ile Asp Leu Lys Ala Ala Lys Val Ala Val Val Gly 145 150 155 160 Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Met Ala Asn Lys 165 170 175 Thr Gly Val Ala Glu Leu Leu Leu Val Ala Arg Gln Gln Gln Arg Leu 180 185 190 Glu Asp Leu Arg Glu Glu Leu Gly Gly Gly Arg Ile Leu Thr Leu Glu 195 200 205 Gln Ala Leu Pro Glu Ala Asp Val Val Val Trp Val Ala Ser Leu Pro 210 215 220 Gln Thr Leu Glu Ile Asp Ser Asn Ser Leu Arg Lys Pro Cys Leu Met 225 230 235 240 Ile Asp Gly Gly Tyr Pro Lys Asn Leu Asp Ser Lys Val Met Ser Glu 245 250 255 His Val Thr Val Leu Lys Gly Gly Ile Val Glu Phe Ala Arg Asp Ile 260 265 270 Gly Trp Gln Met Met Thr Val Ala Asp Met Ala Asn Pro Arg Arg Gln 275 280 285 Leu Phe Ala Cys Phe Ala Glu Ala Met Leu Leu Glu Phe Glu Gly Ile 290 295 300 His Thr Asn Phe Ser Trp Gly Arg Asn Asn Ile Thr Leu Glu Ala Met 305 310 315 320 Glu Gln Ile Gly Met Ala Ser Ile Arg His Gly Phe Ser Ala Leu Gly 325 330 335 Ile Asp Pro Asn Thr Leu Asn Pro Gln Pro Leu Ala Ala 340 345 48346PRTSynechococcus sp. 48Met Phe Gly Leu Ile Gly His Ser Thr Ser Phe Asp Ala Ala Arg Arg 1 5 10 15 Lys Ala Met Glu Leu Gly Phe Asp His Ile Ala Asp Gly Asp Leu Asp 20 25 30 Val Trp Cys Ser Ala Pro Pro Gln Leu Val Glu His Val Glu Ile Ser 35 40 45 Ser Pro Thr Gly Thr Thr Ile Lys Gly Ala Tyr Ile Asp Ser Cys Phe 50 55 60 Val Pro Glu Met Leu Ser Arg Phe Lys Thr Ala Arg Arg Lys Val Leu 65 70 75 80 Asn Ala Met Glu Leu Ala Gln Lys Lys Gly Ile Asn Ile Thr Ala Leu 85 90 95 Gly Gly Phe Thr Ser Ile Ile Phe Glu Asn Phe Asn Leu Leu Gln His 100 105 110 Gln Thr Val Arg Ser Thr Thr Leu Glu Trp Gln Arg Phe Thr Thr Gly 115 120 125 Asn Thr His Thr Ala Trp Val Ile Cys Arg Gln Val Glu Asn Asn Ala 130 135 140 Pro Thr Leu Gly Ile Asp Leu Lys Thr Ala Lys Val Ala Val Val Gly 145 150 155 160 Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Ser Ala Arg 165 170 175 Thr Gly Val Gly Glu Leu Leu Leu Val Ala Arg Gln Gln Gln Pro Leu 180 185 190 Val Asp Leu Gln Ala Gln Ile Gly Gly Gly Arg Ile Leu Thr Leu Asp 195 200 205 Glu Ala Leu Pro Glu Ala Asp Val Val Val Trp Val Ala Ser Met Pro 210 215 220 Arg Thr Leu Glu Ile Asp Gln Ala Ser Leu Arg Lys Pro Cys Leu Met 225 230 235 240 Ile Asp Gly Gly Tyr Pro Lys Asn Leu Asp Thr Lys Val Ala Gly Gly 245 250 255 Gly Ile His Val Leu Lys Gly Gly Ile Val Glu Phe Cys Lys Asp Ile 260 265 270 Gly Trp Thr Met Met Gln Ile Ala Glu Met Glu Lys Pro Gln Arg Gln 275 280 285 Met Phe Ala Cys Phe Ala Glu Ala Met Leu Leu Glu Phe Glu Arg Cys 290 295 300 His Thr Asn Phe Ser Trp Gly Arg Asn Asn Ile Thr Leu Glu Lys Met 305 310 315 320 Asp Phe Ile Gly Ala Ala Ser Val Arg His Gly Phe Ser Thr Leu Asn 325 330 335 Leu Asn Pro Ser Ala Gln Ala Ala Ala Ala 340 345 49346PRTSynechococcus sp. 49Met Phe Gly Leu Ile Gly His Ser Thr Ser Phe Asp Ala Ala Arg Arg 1 5 10 15 Lys Ala Met Glu Leu Gly Phe Asp His Ile Ala Asp Gly Asp Leu Asp 20 25 30 Val Trp Cys Ser Ala Pro Pro Gln Leu Val Glu His Val Glu Ile Ser 35 40 45 Ser Pro Thr Gly Thr Thr Ile Lys Gly Ala Tyr Ile Asp Ser Cys Phe 50 55 60 Val Pro Glu Met Leu Ser Arg Phe Lys Thr Ala Arg Arg Lys Val Leu 65 70 75 80 Asn Ala Met Glu Leu Ala Gln Lys Lys Gly Ile Asn Ile Thr Ala Leu 85 90 95 Gly Gly Phe Thr Ser Ile Ile Phe Glu Asn Phe Asn Leu Leu Gln His 100 105 110 Gln Thr Val Arg Ser Thr Thr Leu Glu Trp Gln Arg Phe Thr Thr Gly 115 120 125 Asn Thr His Thr Ala Trp Val Ile Cys Arg Gln Val Glu Asn Asn Ala 130 135 140 Pro Thr Leu Gly Ile Asp Leu Lys Thr Ala Lys Val Ala Val Val Gly 145 150 155 160 Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Ser Ala Arg 165 170 175 Thr Gly Val Gly Glu Leu Leu Leu Val Ala Arg Gln Gln Gln Pro Leu 180 185 190 Leu Asp Leu Gln Ala Gln Ile Gly Gly Gly Arg Ile Leu Thr Leu Asp 195 200 205 Glu Ala Leu Pro Glu Ala Asp Val Val Val Trp Val Ala Ser Met Pro 210 215 220 Arg Thr Leu Glu Ile Asp Gln Ala Ser Leu Arg Lys Pro Cys Leu Met 225 230 235 240 Ile Asp Gly Gly Tyr Pro Lys Asn Leu Asp Thr Lys Val Ala Gly Gly 245 250 255 Gly Ile His Val Leu Lys Gly Gly Ile Val Glu Phe Cys Lys Asp Ile 260 265 270 Gly Trp Thr Met Met Gln Ile Ala Glu Met Glu Lys Pro Gln Arg Gln 275 280 285 Met Phe Ala Cys Phe Ala Glu Ala Met Leu Leu Glu Phe Glu Arg Cys 290 295 300 His Thr Asn Phe Ser Trp Gly Arg Asn Asn Ile Thr Leu Glu Lys Met 305 310 315 320 Asp Phe Ile Gly Ala Ala Ser Val Arg His Gly Phe Ser Thr Leu Asn 325 330 335 Leu Asn Pro Ser Ala Gln Ala Ala Ala Ala 340 345 50346PRTSynechococcus sp. 50Met Phe Gly Leu Ile Gly His Ser Thr Ser Phe Glu Ala Ala Arg Arg 1 5 10 15 Lys Ala Ser Glu Leu Gly Phe Asp His Ile Ala Glu Gly Asp Leu Asp 20 25 30 Val Trp Cys Ser Ala Pro Pro Gln Leu Val Glu His Val Glu Val Thr 35 40 45 Ser Ala Thr Gly Arg Thr Ile Gln Gly Ala Tyr Ile Asp Ser Cys Phe 50 55 60 Val Pro Glu Met Leu Ser Arg Phe Lys Thr Ala Arg Arg Lys Val Leu 65 70 75 80 Asn Ala Met Glu Leu Ala Gln Lys Lys Gly Ile Asp Ile Thr Ala Leu 85 90 95 Gly Gly Phe Thr Ser Ile Ile Phe Glu Asn Phe Asn Leu Leu Gln His 100 105 110 Gln His Val Arg Ser Thr Thr Leu Ala Trp Glu Arg Phe Thr Thr Gly 115 120 125 Asn Thr His Thr Ala Trp Val Ile Cys Arg Gln Val Glu Asn Asn Ala 130 135 140 Pro Ala Leu Gly Ile Asp Leu Lys Lys Ala Ser Val Ala Val Val Gly 145 150 155 160 Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Ser Ser Arg 165 170 175 Thr Gly Val Ala Glu Leu Leu Leu Val Ala Arg Gln Gln Lys Pro Leu 180 185 190 Glu Glu Leu Arg Glu Glu Leu Gly Gly Gly Arg Ile Leu Ser Leu Glu 195 200 205 Asp Ala Leu Pro Glu Ala Asp Val Val Val Trp Val Ala Ser Met Pro 210 215 220 Arg Thr Leu Glu Ile Asp Thr Ser Arg Leu Lys Thr Pro Cys Leu Met 225 230 235 240 Ile Asp Gly Gly Tyr Pro Lys Asn Leu Asp Ala Arg Val Ala Ala Lys 245 250 255 Gly Ile His Val Leu Lys Gly Gly Ile Val Glu Phe Phe Thr Asp Ile 260 265 270 Gly Trp Ser Met Met Glu Ile Ala Glu Met Glu Lys Pro Gln Arg Gln 275 280 285 Met Phe Ala Cys Phe Ala Glu Ala Met Leu Leu Glu Phe Glu Ser His 290 295 300 His Thr Asn Phe Ser Trp Gly Arg Asn Asn Ile Thr Leu Glu Lys Met 305 310 315 320 Asp Phe Ile Gly Gly Ala Ser Val Arg His Gly Phe Thr Thr Leu Asn 325 330 335 Leu Gln Gly Leu Pro Gln Ala Ala Val Ala 340 345 51346PRTSynechococcus sp. 51Met Phe Gly Leu Ile Gly His Ser Thr Ser Phe Asp Ala Ala Arg Arg 1 5 10 15 Lys Ala Met Glu Leu Gly Phe Asp His Ile Ala Asp Gly Asp Leu Asp 20 25 30 Val Trp Cys Ser Ala Pro Pro Gln Leu Val Glu His Val Glu Ile Ser 35 40 45 Ser Pro Thr Gly Thr Thr Ile Lys Gly Ala Tyr Ile Asp Ser Cys Phe 50 55 60 Val Pro Glu Met Leu Ser Arg Phe Lys Thr Ala Arg Arg Lys Val Leu 65 70 75 80 Asn Ala Met Glu Leu Ala Gln Lys Lys Gly Ile Asn Ile Thr Ala Leu 85 90 95 Gly Gly Phe Thr Ser Ile Ile Phe Glu Asn Phe Asn Leu Leu Gln His 100 105 110 Gln Thr Val Arg Ser Thr Thr Leu Glu Trp Gln Arg Phe Thr Thr Gly 115 120 125 Asn Thr His Thr Ala Trp Val Ile Cys Arg Gln Val Glu Asn Asn Ala 130 135 140 Pro Ser Leu Gly Ile Asp Leu Lys Thr Ala Lys Val Ala Val Val Gly 145 150 155 160 Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Ser Ala Arg 165 170 175 Thr Gly Val Gly Glu Leu Leu Leu Val Ala Arg Gln Gln Gln Pro Leu 180 185 190 Leu Asp Leu Gln Ala Gln Ile Gly Gly Gly Arg Ile Leu Thr Leu Asp 195 200 205 Glu Ala Leu Pro Glu Ala Asp Val Val Val Trp Val Ala Ser Met Pro 210 215 220 Arg Thr Leu Glu Ile Asp Gln Ser Ser Leu Pro Lys Pro Cys Leu Met 225

230 235 240 Ile Asp Gly Gly Tyr Pro Lys Asn Leu Asp Ser Lys Val Ala Gly Gly 245 250 255 Gly Ile His Val Leu Lys Gly Gly Ile Val Glu Phe Cys Lys Asp Ile 260 265 270 Gly Trp Thr Met Met Gln Ile Ala Glu Met Asp Asn Pro Gln Arg Gln 275 280 285 Met Phe Ala Cys Phe Ala Glu Ala Met Leu Leu Glu Phe Glu Arg Cys 290 295 300 His Thr Asn Phe Ser Trp Gly Arg Asn Asn Ile Thr Leu Glu Lys Met 305 310 315 320 Asp Phe Ile Gly Ala Ala Ser Val Arg His Gly Phe Ser Thr Leu Asn 325 330 335 Leu Asn Pro Ser Val Gln Ala Ala Ala Ala 340 345 52346PRTSynechococcus sp. 52Met Phe Gly Leu Ile Gly His Ser Thr Ser Phe Glu Ala Ala Arg Arg 1 5 10 15 Lys Ala Ser Asp Leu Gly Phe Asp His Ile Ala Glu Gly Asp Leu Asp 20 25 30 Val Trp Cys Ser Ala Pro Pro Gln Leu Val Glu His Val Glu Val Thr 35 40 45 Ser Pro Thr Gly Lys Ser Ile Gln Gly Ala Tyr Ile Asp Ser Cys Phe 50 55 60 Val Pro Glu Met Leu Ser Arg Phe Lys Thr Ala Arg Arg Lys Val Leu 65 70 75 80 Asn Ala Met Glu Leu Ala Gln Lys Lys Gly Ile Asp Ile Thr Ala Leu 85 90 95 Gly Gly Phe Thr Ser Ile Ile Phe Glu Asn Phe Asn Leu Leu Gln His 100 105 110 Gln His Val Arg Ser Thr Thr Leu Ala Trp Glu Arg Phe Thr Thr Gly 115 120 125 Asn Thr His Thr Ala Trp Val Ile Cys Arg Gln Val Glu Asn Asn Ala 130 135 140 Pro Ser Leu Gly Ile Asp Leu Lys Lys Ala Ser Val Ala Val Val Gly 145 150 155 160 Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Ser Ser Arg 165 170 175 Thr Gly Val Ala Glu Leu Leu Leu Val Ala Arg Gln Gln Lys Pro Leu 180 185 190 Glu Asp Leu Arg Asp Glu Leu Gly Gly Gly Arg Ile Leu Ser Leu Glu 195 200 205 Asp Ala Leu Pro Glu Ala Asp Val Val Val Trp Val Ala Ser Met Pro 210 215 220 Arg Thr Leu Glu Ile Asp Ala Ser Arg Leu Lys Thr Pro Cys Leu Met 225 230 235 240 Ile Asp Gly Gly Tyr Pro Lys Asn Leu Asp Ala Arg Val Ala Ala Lys 245 250 255 Gly Ile His Val Leu Lys Gly Gly Ile Val Glu Phe Phe Thr Asp Ile 260 265 270 Gly Trp Ser Met Met Glu Ile Ala Glu Met Glu Lys Pro Gln Arg Gln 275 280 285 Met Phe Ala Cys Phe Ala Glu Ala Met Leu Leu Glu Phe Glu Ser His 290 295 300 His Thr Asn Phe Ser Trp Gly Arg Asn Asn Ile Thr Leu Glu Lys Met 305 310 315 320 Asp Phe Ile Gly Gly Ala Ser Val Arg His Gly Phe Ser Thr Leu Asn 325 330 335 Leu Gln Gly Leu Pro Gln Ala Ala Ala Ala 340 345 53346PRTSynechococcus sp. 53Met Phe Gly Leu Ile Gly His Ser Thr Ser Phe Asp Ala Ala Arg Arg 1 5 10 15 Lys Ala Leu Glu Leu Gly Phe Asp His Ile Ala Asp Gly Asp Leu Asp 20 25 30 Val Trp Cys Ser Ala Pro Pro Gln Leu Val Glu His Val Glu Ile Thr 35 40 45 Ser Pro Val Gly Thr Thr Ile Lys Gly Ala Tyr Ile Asp Ser Cys Phe 50 55 60 Val Pro Glu Met Leu Ser Arg Phe Lys Thr Ala Arg Arg Lys Val Leu 65 70 75 80 Asn Ala Met Glu Leu Ala Gln Lys Lys Gly Ile Asn Ile Thr Ala Leu 85 90 95 Gly Gly Phe Thr Ser Ile Ile Phe Glu Asn Phe Asn Leu Leu Gln His 100 105 110 Gln Thr Ile Arg Ser Thr Thr Leu Glu Trp Gln Arg Phe Thr Thr Gly 115 120 125 Asn Thr His Thr Ala Trp Val Ile Cys Arg Gln Val Glu Asn Asn Ala 130 135 140 Pro Ala Leu Gly Ile Asp Leu Lys Thr Ala Lys Val Ala Val Val Gly 145 150 155 160 Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Thr Ala Arg 165 170 175 Thr Gly Val Gly Glu Leu Leu Leu Val Ala Arg Gln Gln Gln Pro Leu 180 185 190 Leu Asp Leu Gln Gly Glu Leu Gly Gly Gly Arg Ile Leu Ser Leu Asp 195 200 205 Glu Ala Met Pro Glu Ala Asp Val Val Val Trp Val Ala Ser Met Pro 210 215 220 Arg Thr Leu Gln Ile Asp Gln Glu Ser Leu Arg Lys Pro Cys Leu Met 225 230 235 240 Ile Asp Gly Gly Tyr Pro Lys Asn Leu Asp Ala Lys Val Ala Gly Gly 245 250 255 Gly Ile His Val Leu Lys Gly Gly Ile Val Glu Phe Cys Lys Asp Ile 260 265 270 Gly Trp Thr Met Met Gln Ile Ala Glu Met Glu Lys Pro Gln Arg Gln 275 280 285 Met Phe Ala Cys Phe Ala Glu Ala Met Leu Leu Glu Phe Glu Arg Cys 290 295 300 His Thr Asn Phe Ser Trp Gly Arg Asn Asn Ile Thr Leu Glu Lys Met 305 310 315 320 Asp Phe Ile Gly Gln Ala Ser Val Arg His Gly Phe Ser Thr Leu Asn 325 330 335 Leu Asn Pro Ser Leu Gln Val Ala Ala Ala 340 345 54346PRTSynechococcus sp. 54Met Phe Gly Leu Ile Gly His Ser Thr Ser Phe Glu Ala Ala Arg Gln 1 5 10 15 Lys Ala Phe Glu Leu Gly Phe Asp His Ile Ala Asp Gly Asp Leu Asp 20 25 30 Val Trp Cys Ser Ala Pro Pro Gln Leu Val Glu Thr Phe Asp Val Thr 35 40 45 Ser Pro Thr Gly Arg Thr Ile Thr Gly Ala Tyr Ile Asp Ser Cys Phe 50 55 60 Val Pro Glu Met Leu Ser Arg Phe Lys Thr Ala Arg Arg Lys Val Leu 65 70 75 80 Asn Ala Met Glu Leu Ala Gln Lys Lys Gly Ile Asn Ile Thr Ala Leu 85 90 95 Gly Gly Phe Thr Ser Ile Ile Phe Glu Asn Phe Asn Leu Leu Gln His 100 105 110 Gln His Val Arg Ser Thr Thr Leu Glu Trp Glu Arg Phe Thr Thr Gly 115 120 125 Asn Thr His Thr Ala Trp Val Ile Ser Arg Gln Val Glu Ile Asn Ala 130 135 140 Pro Arg Leu Gly Ile Asp Leu Ser Lys Ala Arg Val Ala Val Val Gly 145 150 155 160 Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Ser Gln Arg 165 170 175 Thr Gly Val Ala Glu Leu Leu Leu Val Ala Arg Gln Gln Gln Pro Leu 180 185 190 Leu Asp Leu Gln Lys Glu Leu Gly Gly Gly Arg Ile Leu Ser Leu Asp 195 200 205 Glu Ala Val Pro Glu Ala Asp Val Val Val Trp Val Ala Ser Met Pro 210 215 220 Arg Thr Leu Glu Ile Asp Ala Ala Ser Leu Arg Gln Pro Cys Leu Met 225 230 235 240 Ile Asp Gly Gly Tyr Pro Lys Asn Leu Asn Ala Arg Ile Ala Gly Ser 245 250 255 Gly Val His Val Leu Lys Gly Gly Ile Val Glu Phe Gly Ser Asp Ile 260 265 270 Gly Trp Asn Met Met Glu Leu Ala Glu Met Glu Lys Pro Gln Arg Gln 275 280 285 Met Phe Ala Cys Phe Ala Glu Ala Met Leu Leu Glu Phe Glu Ser Cys 290 295 300 His Thr Asn Phe Ser Trp Gly Arg Asn Asn Ile Thr Leu Glu Lys Met 305 310 315 320 Asp Phe Ile Gly Glu Ala Ser Arg Arg His Gly Phe Ser Thr Leu Asn 325 330 335 Leu Ser Ala Pro Val Gln Val Ala Ala Ala 340 345 55346PRTSynechococcus sp. 55Met Phe Gly Leu Ile Gly His Ser Thr Ser Phe Glu Ala Ala Arg Arg 1 5 10 15 Lys Ala Leu Glu Leu Gly Phe Asp His Ile Ala Asp Gly Asp Leu Asp 20 25 30 Val Trp Cys Ser Ala Pro Pro Gln Leu Val Glu His Val Glu Val Thr 35 40 45 Ser Pro Ala Gly Ile Thr Ile Glu Gly Ala Tyr Ile Asp Ser Cys Phe 50 55 60 Val Pro Glu Met Leu Ser Arg Phe Lys Thr Ala Arg Arg Lys Val Leu 65 70 75 80 Asn Ala Met Glu Leu Ala Gln Lys Lys Gly Ile Asn Ile Thr Ala Leu 85 90 95 Gly Gly Phe Thr Ser Ile Ile Phe Glu Asn Phe Asn Leu Leu Gln His 100 105 110 Gln Thr Val Arg Ser Thr Thr Leu Asp Trp Gln Arg Phe Thr Thr Gly 115 120 125 Asn Thr His Thr Ala Trp Val Ile Cys Arg Gln Val Glu Asn Asn Ala 130 135 140 Pro Ser Leu Gly Ile Asp Leu Lys Thr Ala Lys Val Ala Val Val Gly 145 150 155 160 Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Thr Ala Arg 165 170 175 Thr Asn Val Gly Glu Leu Leu Leu Val Ala Arg Gln Pro Gln Pro Leu 180 185 190 Ala Asp Leu Gln Ala Glu Leu Gly Gly Gly Arg Ile Leu Ala Leu Ser 195 200 205 Asp Ala Leu Ser Glu Ala Asp Val Val Val Trp Val Ala Ser Met Pro 210 215 220 Arg Thr Leu Glu Ile Asp Asn Asn Ser Leu Lys Lys Pro Cys Leu Met 225 230 235 240 Ile Asp Gly Gly Tyr Pro Lys Asn Leu Asp Ser Lys Val Ala Gly Gly 245 250 255 Gly Ile His Val Leu Lys Gly Gly Ile Val Glu Phe Cys Arg Asp Ile 260 265 270 Gly Trp Ser Met Met Glu Ile Ala Glu Met Glu Lys Pro Gln Arg Gln 275 280 285 Met Phe Ala Cys Phe Ala Glu Ala Met Leu Leu Glu Phe Glu Arg Cys 290 295 300 His Thr Asn Phe Ser Trp Gly Arg Asn Asn Ile Thr Leu Glu Lys Met 305 310 315 320 Asp Phe Ile Gly Ala Ala Ser Val Arg His Gly Phe Ser Thr Leu Asn 325 330 335 Leu Lys Thr Asn Leu Gln Ala Ala Val Ala 340 345 56347PRTProchlorococcus marinus 56Met Phe Gly Leu Ile Gly His Ser Thr Ser Phe Lys Asp Ala Arg Gln 1 5 10 15 Lys Ala Met Asp Leu Gly Tyr Asp His Ile Ala Glu Gly Asp Leu Asp 20 25 30 Val Trp Cys Ser Ala Pro Pro Gln Leu Val Glu His Val Lys Val Val 35 40 45 Ser Ala Ile Gly Lys Thr Ile Glu Gly Ala Tyr Ile Asp Ser Cys Phe 50 55 60 Val Pro Glu Met Leu Ser Arg Phe Lys Thr Ala Arg Arg Lys Val Leu 65 70 75 80 Asn Ala Met Glu Leu Ala Gln Lys Lys Gly Ile Asn Ile Thr Ala Leu 85 90 95 Gly Gly Phe Thr Ser Ile Ile Phe Glu Asn Phe Asn Leu Leu Glu Asn 100 105 110 Lys Gln Val Arg Asn Thr Thr Leu Asp Trp Glu Arg Phe Thr Thr Gly 115 120 125 Asn Thr His Thr Ala Trp Val Ile Cys Arg Gln Leu Glu Ile Asn Ala 130 135 140 Pro Leu Leu Gly Ile Asp Leu Gln Lys Ala Arg Val Ala Val Val Gly 145 150 155 160 Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Ser Gln Arg 165 170 175 Thr Gly Val Ser Glu Leu Leu Leu Val Ala Arg Gln Gln Gln Pro Leu 180 185 190 Lys Asp Leu Gln Lys Asp Leu Gly Gly Gly Arg Val Leu Arg Leu Glu 195 200 205 Glu Ala Leu Pro Glu Ala Asp Ala Val Ile Trp Val Ala Ser Leu Pro 210 215 220 Lys Asn Leu Gln Ile Asp Lys Ser Lys Leu Arg Lys Pro Cys Leu Met 225 230 235 240 Ile Asp Gly Gly Tyr Pro Lys Asn Leu Asp Glu Lys Phe Ser Gly Ser 245 250 255 Gly Ile His Val Leu Lys Gly Gly Ile Val Glu Phe Phe Glu Asp Ile 260 265 270 Gly Trp Asn Met Met Glu Ile Ala Glu Met Asp Val Pro Gln Arg Gln 275 280 285 Met Phe Ala Cys Phe Ala Glu Ala Met Leu Leu Glu Phe Glu Asn Cys 290 295 300 His Thr Asn Phe Ser Trp Gly Arg Asn Asn Ile Thr Leu Glu Lys Met 305 310 315 320 Asp Phe Ile Gly Glu Ala Ser Leu Arg His Gly Phe Ser Val Leu Arg 325 330 335 Leu Gln Pro Asn Asn Leu Gln Ala Ala Phe Ala 340 345 57345PRTProchlorococcus marinus 57Met Phe Gly Leu Ile Gly His Ser Thr Ser Phe Glu Asp Ala Arg Lys 1 5 10 15 Thr Ala Leu Gln Ile Gly Tyr Asp His Leu Asp Gly Asp Leu Asp Val 20 25 30 Trp Cys Ser Ala Pro Pro Gln Phe Leu Glu Gln Ile Glu Val Glu Ser 35 40 45 Leu Thr Gly Lys Lys Ile Glu Gly Ala Tyr Ile Asp Ser Cys Phe Val 50 55 60 Pro Glu Met Leu Ser Arg Phe Lys Thr Ala Arg Arg Lys Val Leu Asn 65 70 75 80 Ala Met Glu Met Ala Gln Lys Arg Gly Ile Gln Ile Ser Ala Leu Gly 85 90 95 Gly Phe Thr Ser Ile Ile Phe Glu Asn Phe Asn Leu Leu Lys His Gln 100 105 110 His Val Arg Asn Thr Thr Leu Glu Trp Glu Arg Phe Thr Thr Gly Asn 115 120 125 Thr His Thr Ala Trp Val Ile Cys Arg Gln Leu Glu Asn Asn Ala Pro 130 135 140 Leu Leu Gly Ile Asp Leu Ser Lys Ala Arg Val Ala Val Val Gly Ala 145 150 155 160 Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Ser Ala Arg Thr 165 170 175 Gly Val Ala Glu Leu Leu Leu Val Ala Arg Gln Gln Gln Pro Leu Ile 180 185 190 Asp Leu Gln Thr Glu Leu Ala Gly Gly Arg Ile Leu Ser Leu Glu Glu 195 200 205 Ala Leu Pro Glu Ala Asp Val Val Val Trp Val Ala Ser Met Pro Arg 210 215 220 Thr Leu Glu Ile Asp Met Glu Ser Leu Arg Lys Pro Cys Leu Met Ile 225 230 235 240 Asp Gly Gly Tyr Pro Lys Asn Leu Asp Ala Lys Phe Ala Gly Ser Gly 245 250 255 Val His Val Leu Lys Gly Gly Ile Val Glu Phe Cys Asn Asp Ile Ser 260 265 270 Trp Asp Val Gly Trp Ile Ala Glu Met Asp Lys Pro Ala Arg Gln Met 275 280 285 Phe Ala Cys Phe Ala Glu Ala Met Leu Leu Glu Phe Glu Asn Cys His 290 295 300 Thr Asn Phe Ser Trp Gly Arg Asn Gln Ile Thr Leu Glu Lys Met Asp 305 310 315 320 Phe Ile Gly Met Ala Ser Leu Arg His Gly Phe Ser Ser Leu Asn Leu 325 330 335 Asn His Gln Leu Gln Ala Ala Ala Ala 340 345 58346PRTSynechococcus sp. 58Met Phe Gly Leu Ile Gly His Ser Thr Ser Phe Asp Ala Ala Arg Arg 1 5 10 15 Lys Ala Met Glu Leu Gly Phe Asp His Ile Ala Glu Gly Asp Leu Asp 20 25 30 Val Trp Cys Ser Ala Pro Pro Gln Leu Val Glu His Val Gln Val Thr 35 40 45 Ser Pro Val Gly Thr Thr Ile Glu Gly Ala Tyr Ile Asp Ser Cys Phe 50 55 60 Val Pro Glu Met Leu Ser Arg Phe Lys Thr Ala Arg Arg Lys Val Leu 65 70 75 80 Asn Ala Met Glu Leu Ala Gln Lys Lys Asp Ile Ala Ile Thr Ala Leu 85 90

95 Gly Gly Phe Thr Ser Ile Ile Phe Glu Asn Phe Asn Leu Leu Gln Asn 100 105 110 Gln Thr Val Arg Ser Thr Thr Leu Asp Trp Arg Arg Phe Thr Thr Gly 115 120 125 Asn Thr His Thr Ala Trp Val Ile Cys Arg Gln Val Glu Asn Asn Ala 130 135 140 Pro Ser Leu Gly Ile Asp Leu Ser Thr Ala Lys Val Ala Val Val Gly 145 150 155 160 Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Ser Ala Arg 165 170 175 Thr Gly Val Gly Glu Leu Leu Leu Val Ala Arg Gln Gln Gln Pro Leu 180 185 190 Met Asp Leu Gln Lys Glu Leu Gly Gly Gly Arg Ile Leu Thr Leu Glu 195 200 205 Glu Ala Leu Pro Glu Ala Asp Val Val Val Trp Val Ala Ser Met Pro 210 215 220 Arg Thr Leu Gln Ile Asp Gln Asp Ser Leu Arg Ser Pro Cys Leu Met 225 230 235 240 Ile Asp Gly Gly Tyr Pro Lys Asn Leu Asp Ala Lys Val Ala Gly Gly 245 250 255 Gly Ile His Val Leu Lys Gly Gly Ile Val Glu Phe Cys Arg Asp Ile 260 265 270 Gly Trp Thr Met Met Glu Ile Ala Glu Met Glu Lys Pro Gln Arg Gln 275 280 285 Met Phe Ala Cys Phe Ala Glu Ala Met Leu Leu Glu Phe Glu Arg Cys 290 295 300 His Thr Asn Phe Ser Trp Gly Arg Asn Asn Ile Thr Leu Glu Lys Met 305 310 315 320 Asp Phe Ile Gly Ala Ala Ser Val Arg His Gly Phe Ser Thr Leu Asn 325 330 335 Leu Gln Ser Arg Leu Gln Ala Ala Ala Ala 340 345 59346PRTSynechococcus sp. 59Met Phe Gly Leu Ile Gly His Ser Thr Ser Phe Asp Ala Ala Arg Arg 1 5 10 15 Lys Ala Met Glu Leu Gly Phe Asp His Ile Ala Glu Gly Asp Leu Asp 20 25 30 Val Trp Cys Ser Ala Pro Pro Gln Leu Val Glu His Val Gln Val Thr 35 40 45 Ser Pro Val Gly Thr Thr Ile Glu Gly Ala Tyr Ile Asp Ser Cys Phe 50 55 60 Val Pro Glu Met Leu Ser Arg Phe Lys Thr Ala Arg Arg Lys Val Leu 65 70 75 80 Asn Ala Met Glu Leu Ala Gln Lys Lys Asp Ile Ala Ile Thr Ala Leu 85 90 95 Gly Gly Phe Thr Ser Ile Ile Phe Glu Asn Phe Asn Leu Leu Gln Asn 100 105 110 Gln Thr Val Arg Ser Thr Thr Leu Asp Trp Arg Arg Phe Thr Thr Gly 115 120 125 Asn Thr His Thr Ala Trp Val Ile Cys Arg Gln Val Glu Asn Asn Ala 130 135 140 Pro Ser Leu Gly Ile Asp Leu Ser Thr Ala Lys Val Ala Val Val Gly 145 150 155 160 Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Ser Ala Arg 165 170 175 Thr Gly Val Gly Glu Leu Leu Leu Val Ala Arg Gln Gln Gln Pro Leu 180 185 190 Met Asp Leu Gln Lys Glu Leu Gly Gly Gly Arg Ile Leu Thr Leu Glu 195 200 205 Glu Ala Leu Pro Glu Ala Asp Val Val Val Trp Val Ala Ser Met Pro 210 215 220 Arg Thr Leu Gln Ile Asp Gln Asp Ser Leu Arg Ser Pro Cys Leu Met 225 230 235 240 Ile Asp Gly Gly Tyr Pro Lys Asn Leu Asp Ala Lys Val Ala Gly Gly 245 250 255 Gly Ile His Val Leu Lys Gly Gly Ile Val Glu Phe Cys Arg Asp Ile 260 265 270 Gly Trp Thr Met Met Glu Ile Ala Glu Met Glu Lys Pro Gln Arg Gln 275 280 285 Met Phe Ala Cys Phe Ala Glu Ala Met Leu Leu Glu Phe Glu Arg Cys 290 295 300 His Thr Asn Phe Ser Trp Gly Arg Asn Asn Ile Thr Leu Glu Lys Met 305 310 315 320 Asp Phe Ile Gly Ala Ala Ser Val Arg His Gly Phe Ser Thr Leu Asn 325 330 335 Leu Gln Ser Arg Leu Gln Ala Ala Ala Ala 340 345 60346PRTSynechococcus sp. 60Met Phe Gly Leu Ile Gly His Ser Thr Ser Phe Glu Ala Ala Arg Arg 1 5 10 15 Lys Ala Leu Glu Leu Gly Phe Asp His Ile Ala Asp Gly Asp Leu Asp 20 25 30 Val Trp Cys Ser Ala Pro Pro Gln Leu Val Glu His Val Glu Val Thr 35 40 45 Ser Pro Ala Gly Ile Thr Ile Glu Gly Ala Tyr Ile Asp Ser Cys Phe 50 55 60 Val Pro Glu Met Leu Ser Arg Phe Lys Thr Ala Arg Arg Lys Val Leu 65 70 75 80 Asn Ala Met Glu Leu Ala Gln Lys Lys Gly Ile Asn Ile Thr Ala Leu 85 90 95 Gly Gly Phe Thr Ser Ile Ile Phe Glu Asn Phe Asn Leu Leu Gln His 100 105 110 Gln Thr Ile Arg Ser Thr Thr Leu Asp Trp Gln Arg Phe Thr Thr Gly 115 120 125 Asn Thr His Thr Ala Trp Val Ile Cys Arg Gln Val Glu Asn Asn Ala 130 135 140 Pro Ser Leu Gly Ile Asp Leu Lys Thr Ala Lys Val Ala Val Val Gly 145 150 155 160 Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Ser Ala Arg 165 170 175 Thr Asn Val Gly Glu Leu Leu Leu Val Ala Arg Gln Pro Gln Pro Leu 180 185 190 Ala Asp Leu Gln Ser Glu Leu Gly Gly Gly Arg Ile Leu Ala Leu Ser 195 200 205 Asp Ala Leu Ser Glu Ala Asp Val Val Val Trp Val Ala Ser Met Pro 210 215 220 Arg Thr Leu Glu Ile Asp Asn Asn Ser Leu Lys Lys Pro Cys Leu Met 225 230 235 240 Ile Asp Gly Gly Tyr Pro Lys Asn Leu Asp Ser Lys Val Ala Gly Gly 245 250 255 Gly Ile His Val Leu Lys Gly Gly Ile Val Glu Phe Cys Arg Asp Ile 260 265 270 Gly Trp Ser Met Met Glu Ile Ala Glu Met Glu Asn Pro Gln Arg Gln 275 280 285 Met Phe Ala Cys Phe Ala Glu Ala Met Leu Leu Glu Phe Glu Arg Cys 290 295 300 His Thr Asn Phe Ser Trp Gly Arg Asn Asn Ile Thr Leu Glu Lys Met 305 310 315 320 Asp Phe Ile Gly Ala Ala Ser Val Arg His Gly Phe Ser Thr Leu Asn 325 330 335 Leu Lys Thr Asn Leu Gln Ala Ala Ala Ala 340 345 61349PRTCyanobium sp. 61Met Phe Gly Leu Ile Gly His Ser Thr Ser Phe Glu Glu Ala Arg Ala 1 5 10 15 Lys Ala Arg Ser Leu Gly Phe Asp Glu Tyr Ala Asp Gly Asp Leu Asp 20 25 30 Met Trp Cys Ala Ala Pro Pro Gln Leu Val Glu Lys Val Thr Val Thr 35 40 45 Ser Arg Thr Gly Lys Thr Ile Glu Gly Ala Tyr Ile Asp Ser Val Phe 50 55 60 Val Pro Glu Met Leu Arg Arg Phe Lys Thr Ala Lys Arg Lys Val Leu 65 70 75 80 Lys Ala Met Glu Leu Ala Gln Arg Ser Gly Ile Asp Ile Thr Ala Leu 85 90 95 Gly Gly Phe Thr Ser Ile Ile Phe Glu Asp Met Asn Leu Leu Arg Glu 100 105 110 Glu Arg Val Ser Ala Val Gln Leu Asn Trp Glu Arg Phe Thr Thr Gly 115 120 125 Asn Thr His Thr Ala Trp Val Ile Cys Gln Gln Val Glu Arg Asn Ala 130 135 140 Ser Ser Leu Gly Ile Asp Leu Ala Ser Ala Lys Val Ala Val Val Gly 145 150 155 160 Ala Ser Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Gln Arg Arg 165 170 175 Gly Val Gly Glu Leu Leu Leu Val Ala Arg Arg Pro Gln Pro Leu Val 180 185 190 Asp Leu Gln Glu Ser Leu Gly Glu Gly Arg Ile Leu Asp Leu Glu Ala 195 200 205 Ala Leu Pro Glu Ala Asp Val Val Val Trp Val Ala Ser Leu Pro Gln 210 215 220 Ser Leu Gln Ile Asp Thr Ala Ser Leu Lys Arg Pro Cys Leu Met Ile 225 230 235 240 Asp Gly Gly Tyr Pro Lys Asn Leu Asp Ala Lys Ala Ala Ala Glu Gly 245 250 255 Val His Val Leu Lys Gly Gly Ile Val Glu Phe Trp Gln Asp Ile Gly 260 265 270 Trp Gln Met Met Glu Val Ala Glu Met Ala Val Pro Gln Arg Gln Met 275 280 285 Phe Ala Cys Phe Ala Glu Ala Met Leu Leu Asp Phe Glu Asp Leu His 290 295 300 Thr Asn Phe Ser Trp Gly Arg Asn Asn Ile Thr Leu Ala Ala Met Asp 305 310 315 320 Arg Ile Gly Glu Ala Ser Leu Arg His Gly Phe Glu Ala Leu Gly Leu 325 330 335 Gln His Ala Gly Ala Val Ser Pro Ala Leu Ala Ala Ala 340 345 62346PRTProchlorococcus marinus 62Met Phe Gly Leu Ile Gly His Ser Thr Ser Phe Glu Asp Ala Lys Arg 1 5 10 15 Lys Ala Leu Gly Leu Gly Tyr Asp His Ile Ala Glu Gly Asp Leu Asp 20 25 30 Val Trp Cys Thr Ala Pro Pro Gln Leu Val Glu Asn Val Lys Val Val 35 40 45 Ser Ala Ile Gly Lys Thr Ile Glu Gly Ala Tyr Ile Asp Ser Cys Phe 50 55 60 Val Pro Glu Met Leu Ser Arg Phe Lys Thr Ala Arg Arg Lys Val Leu 65 70 75 80 Asn Ala Met Glu Leu Ala Gln Lys Lys Gly Ile Ser Ile Thr Ala Leu 85 90 95 Gly Gly Phe Thr Ser Ile Ile Phe Glu Asn Phe Asn Leu Leu Gln Asn 100 105 110 Gln Gln Val Arg Asn Thr Thr Leu Asp Trp Gln Arg Phe Thr Thr Gly 115 120 125 Asn Thr His Thr Ala Trp Val Ile Cys Arg Gln Leu Glu Gln Asn Ala 130 135 140 Pro Arg Ile Gly Ile Asp Leu Ser Lys Ser Lys Val Ala Val Val Gly 145 150 155 160 Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Ser Asn Arg 165 170 175 Thr Gly Val Ser Glu Leu Leu Leu Val Ala Arg Gln Gln Lys Pro Leu 180 185 190 Leu Glu Leu Gln Ser Gln Leu Gly Gly Gly Arg Ile Leu Ser Leu Asp 195 200 205 Asp Ala Leu Pro Glu Ala Asp Ile Val Ile Trp Val Ala Ser Met Pro 210 215 220 Lys Thr Leu Glu Ile Asp Pro Ser Lys Ile Lys Arg Pro Cys Leu Met 225 230 235 240 Ile Asp Gly Gly Tyr Pro Lys Asn Leu Gly Glu Lys Phe Ser Gly Pro 245 250 255 Gly Ile His Val Leu Lys Gly Gly Ile Val Gln Phe Phe Lys Asp Ile 260 265 270 Gly Trp Ser Met Met Glu Leu Ala Glu Met Glu Asn Pro Lys Arg Glu 275 280 285 Met Phe Ala Cys Phe Ala Glu Ala Met Leu Leu Glu Phe Glu Asn Cys 290 295 300 His Thr Asn Phe Ser Trp Gly Arg Asn Asn Ile Thr Leu Glu Lys Met 305 310 315 320 Asp Phe Ile Gly Lys Ala Ser Glu Arg His Gly Phe Ser Ala Val Gly 325 330 335 Leu Lys Ser Asn Ile Gln Thr Leu Thr Val 340 345 63346PRTProchlorococcus marinus 63Met Phe Gly Leu Ile Gly His Ser Thr Ser Phe Glu Asp Ala Lys Arg 1 5 10 15 Lys Ala Ser Leu Leu Gly Phe Asp His Ile Ala Asp Gly Asp Leu Asp 20 25 30 Val Trp Cys Thr Ala Pro Pro Gln Leu Val Glu Asn Val Glu Val Lys 35 40 45 Ser Ala Thr Gly Ile Ser Ile Glu Gly Ser Tyr Ile Asp Ser Cys Phe 50 55 60 Val Pro Glu Met Leu Ser Arg Phe Lys Thr Ala Arg Arg Lys Val Leu 65 70 75 80 Asn Ala Met Glu Leu Ala Gln Lys Lys Gly Ile Asn Ile Thr Ala Leu 85 90 95 Gly Gly Phe Thr Ser Ile Ile Phe Glu Asn Phe Asn Leu Leu Gln His 100 105 110 Lys Gln Ile Arg Asn Thr Ser Leu Glu Trp Glu Arg Phe Thr Thr Gly 115 120 125 Asn Thr His Thr Ala Trp Val Ile Cys Arg Gln Leu Glu Ile Asn Ala 130 135 140 Pro Lys Val Gly Ile Glu Leu Lys Lys Ala Thr Val Ala Val Val Gly 145 150 155 160 Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Ile Asn Lys 165 170 175 Thr Gly Ile Gly Glu Leu Leu Leu Val Ala Arg Gln Lys Glu Pro Leu 180 185 190 Asp Asn Leu Gln Lys Glu Leu Asp Gly Gly Thr Ile Lys Ser Leu Asp 195 200 205 Glu Ala Leu Pro Glu Ala Asp Ile Val Val Trp Val Ala Ser Met Pro 210 215 220 Lys Thr Met Glu Ile Asn Thr Asn Asn Leu Lys Gln Pro Cys Leu Met 225 230 235 240 Ile Asp Gly Gly Tyr Pro Lys Asn Leu Asp Glu Lys Phe Gln Gly Asn 245 250 255 Asn Ile His Val Val Lys Gly Gly Ile Val Lys Phe Phe Asn Asp Ile 260 265 270 Gly Trp Asn Met Met Glu Leu Ala Glu Met Gln Asn Pro Gln Arg Glu 275 280 285 Met Phe Ala Cys Phe Ala Glu Ala Met Ile Leu Glu Phe Glu Lys Cys 290 295 300 His Thr Asn Phe Ser Trp Gly Arg Asn Asn Ile Ser Leu Glu Lys Met 305 310 315 320 Glu Phe Ile Gly Ala Ala Ser Val Lys His Gly Phe Ser Ala Ile Gly 325 330 335 Leu Asp Lys His Pro Lys Val Leu Ala Val 340 345 64346PRTSynechococcus sp. 64Met Phe Gly Leu Ile Gly His Ser Thr Ser Phe Glu Ala Ala Arg Arg 1 5 10 15 Lys Ala Met Glu Leu Gly Phe Asp His Ile Ala Asp Gly Asp Leu Asp 20 25 30 Val Trp Cys Ser Ala Pro Pro Gln Leu Val Glu His Val Glu Val Thr 35 40 45 Ser Pro Val Gly Thr Thr Ile Glu Gly Ala Tyr Ile Asp Ser Cys Phe 50 55 60 Val Pro Glu Met Leu Ser Arg Phe Lys Thr Ala Arg Arg Lys Val Leu 65 70 75 80 Asn Ala Met Glu Leu Ala Gln Lys Lys Gly Ile Asn Ile Thr Ala Leu 85 90 95 Gly Gly Phe Thr Ser Ile Ile Phe Glu Asn Phe Asn Leu Leu Gln His 100 105 110 Gln Thr Val Arg Ser Thr Thr Leu Asp Trp Gln Arg Phe Thr Thr Gly 115 120 125 Asn Thr His Thr Ala Trp Val Ile Cys Arg Gln Val Glu Asn Asn Ala 130 135 140 Pro Thr Leu Gly Ile Asp Leu Ser Lys Ala Lys Val Ala Val Val Gly 145 150 155 160 Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Gln Ala Arg 165 170 175 Thr Arg Val Gly Glu Leu Leu Leu Val Ala Arg Gln Gln Gln Pro Leu 180 185 190 Leu Asp Leu Gln Gln Glu Leu Gly Gly Gly Arg Ile Leu Ser Leu Asp 195 200 205 Glu Ala Leu Pro Glu Ala Asp Val Val Val Trp Val Ala Ser Met Pro 210 215 220 Arg Thr Leu Glu Ile Asp Gln Asp Ser Leu Lys Lys Pro Cys Leu Met 225 230 235 240 Ile Asp Gly Gly Tyr Pro Lys Asn Leu Asp Thr Lys Val Ala Gly Gly 245 250 255 Gly Ile His Val Leu Lys Gly Gly Ile Val Glu Phe Cys Arg Asp Ile 260 265 270 Gly Trp Ser Met Met Ala Ile Ala Glu Met Glu Arg Pro Gln Arg Gln 275 280 285 Met Phe Ala Cys Phe Ala Glu Ala Met Leu Leu Glu Phe Glu Arg Cys 290

295 300 His Thr Asn Phe Ser Trp Gly Arg Asn Asn Ile Thr Leu Glu Lys Met 305 310 315 320 Asp Phe Ile Gly Ala Ala Ser Val Arg His Gly Phe Ser Thr Leu Asn 325 330 335 Leu His Pro Asn Leu Gln Ala Thr Ala Ala 340 345 65346PRTProchlorococcus marinus 65Met Phe Gly Leu Ile Gly His Ser Thr Ser Phe Asp Asp Ala Lys Lys 1 5 10 15 Lys Ala Met Asp Leu Gly Tyr Asp His Ile Ala Gln Gly Asp Leu Asp 20 25 30 Val Trp Cys Ser Ala Pro Pro Gln Leu Val Glu His Val Asn Ile Val 35 40 45 Ser Ala Ile Gly Lys Asn Ile Glu Gly Ala Tyr Ile Asp Ser Cys Phe 50 55 60 Val Pro Glu Met Leu Gly Arg Phe Lys Thr Ala Arg Arg Lys Val Leu 65 70 75 80 Asn Ala Met Glu Leu Ala Gln Lys Lys Gly Ile Asn Ile Thr Ala Leu 85 90 95 Gly Gly Phe Thr Ser Ile Ile Phe Glu Asn Phe Asn Leu Leu Gln Asn 100 105 110 Lys Gln Val Arg Asn Thr Thr Leu Glu Trp Glu Arg Phe Thr Thr Gly 115 120 125 Asn Thr His Thr Ala Trp Val Ile Cys Arg Gln Leu Glu Leu Asn Ala 130 135 140 Pro Leu Leu Gly Ile Asp Leu Lys Lys Ala Arg Val Ala Val Val Gly 145 150 155 160 Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Ser Glu Arg 165 170 175 Thr Gly Val Gln Glu Leu Leu Leu Val Ala Arg Gln Gln Gln Pro Leu 180 185 190 Ile Glu Leu Gln Lys Ser Leu Gly Gly Gly Lys Ile Leu Gly Leu Glu 195 200 205 Asp Ala Leu Pro Glu Ala Asp Val Val Ile Trp Val Ala Ser Leu Pro 210 215 220 Lys Thr Leu Glu Ile Asp Lys Ala Lys Leu Arg Lys Pro Cys Leu Met 225 230 235 240 Ile Asp Gly Gly Tyr Pro Lys Asn Leu Asp Glu Lys Phe Asn Gly Ser 245 250 255 Gly Val His Val Leu Lys Gly Gly Ile Val Glu Phe Phe Thr Asp Ile 260 265 270 Gly Trp Ser Met Met Glu Leu Ala Ala Met Glu Lys Pro Arg Arg Glu 275 280 285 Met Phe Ala Cys Phe Ala Glu Ala Met Leu Leu Glu Phe Glu Gly Cys 290 295 300 His Thr Asn Phe Ser Trp Gly Arg Asn Asn Ile Thr Leu Glu Lys Met 305 310 315 320 Asp Phe Ile Gly Gln Ala Ser Glu Lys His Gly Phe Ser Val Ile Gly 325 330 335 Leu Asn Pro Lys Leu Gln Ala Ala Ile Ala 340 345 66346PRTProchlorococcus marinus 66Met Phe Gly Leu Ile Gly His Ser Thr Ser Phe Glu Asp Ala Lys Arg 1 5 10 15 Lys Ala Ser Leu Leu Gly Phe Asp His Ile Ala Asp Gly Asp Leu Asp 20 25 30 Val Trp Cys Thr Ala Pro Pro Gln Leu Val Glu Asn Val Glu Val Lys 35 40 45 Ser Ala Ile Gly Ile Ser Ile Glu Gly Ser Tyr Ile Asp Ser Cys Phe 50 55 60 Val Pro Glu Met Leu Ser Arg Phe Lys Thr Ala Arg Arg Lys Val Leu 65 70 75 80 Asn Ala Met Glu Leu Ala Gln Lys Lys Gly Ile Asn Ile Thr Ala Leu 85 90 95 Gly Gly Phe Thr Ser Ile Ile Phe Glu Asn Phe Asn Leu Leu Gln His 100 105 110 Lys Gln Ile Arg Asn Thr Ser Leu Glu Trp Glu Arg Phe Thr Thr Gly 115 120 125 Asn Thr His Thr Ala Trp Val Ile Cys Arg Gln Leu Glu Met Asn Ala 130 135 140 Pro Lys Ile Gly Ile Asp Leu Lys Ser Ala Thr Val Ala Val Val Gly 145 150 155 160 Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Ile Asn Lys 165 170 175 Thr Gly Ile Gly Glu Leu Leu Leu Val Ala Arg Gln Lys Glu Pro Leu 180 185 190 Asp Ser Leu Gln Lys Glu Leu Asp Gly Gly Thr Ile Lys Asn Leu Asp 195 200 205 Glu Ala Leu Pro Glu Ala Asp Ile Val Val Trp Val Ala Ser Met Pro 210 215 220 Lys Thr Met Glu Ile Asp Ala Asn Asn Leu Lys Gln Pro Cys Leu Met 225 230 235 240 Ile Asp Gly Gly Tyr Pro Lys Asn Leu Asp Glu Lys Phe Gln Gly Asn 245 250 255 Asn Ile His Val Val Lys Gly Gly Ile Val Arg Phe Phe Asn Asp Ile 260 265 270 Gly Trp Asn Met Met Glu Leu Ala Glu Met Gln Asn Pro Gln Arg Glu 275 280 285 Met Phe Ala Cys Phe Ala Glu Ala Met Ile Leu Glu Phe Glu Lys Cys 290 295 300 His Thr Asn Phe Ser Trp Gly Arg Asn Asn Ile Ser Leu Glu Lys Met 305 310 315 320 Glu Phe Ile Gly Ala Ala Ser Val Lys His Gly Phe Ser Ala Ile Gly 325 330 335 Leu Asp Lys His Pro Lys Val Leu Ala Val 340 345 67346PRTProchlorococcus marinus 67Met Phe Gly Leu Ile Gly His Ser Thr Ser Phe Glu Asp Ala Lys Arg 1 5 10 15 Lys Ala Ser Met Leu Gly Phe Asp His Ile Ala Asp Gly Asp Leu Asp 20 25 30 Val Trp Cys Thr Ala Pro Pro Gln Leu Val Glu Asn Val Glu Val Lys 35 40 45 Ser Ala Thr Gly Ile Ser Ile Glu Gly Ser Tyr Ile Asp Ser Cys Phe 50 55 60 Val Pro Glu Met Leu Ser Arg Phe Lys Thr Ala Arg Arg Lys Val Leu 65 70 75 80 Asn Ala Met Glu Leu Ala Gln Lys Lys Gly Ile Asn Ile Thr Ala Leu 85 90 95 Gly Gly Phe Thr Ser Ile Ile Phe Glu Asn Phe Asn Leu Leu Gln His 100 105 110 Lys Gln Ile Arg Asn Thr Ser Leu Glu Trp Glu Arg Phe Thr Thr Gly 115 120 125 Asn Thr His Thr Ala Trp Val Ile Cys Lys Gln Leu Glu Ile Asn Ala 130 135 140 Pro Arg Ile Gly Ile Asp Leu Lys Lys Ala Thr Val Ala Val Ile Gly 145 150 155 160 Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Ile Asn Lys 165 170 175 Thr Gly Ile Ser Glu Leu Leu Met Val Ala Arg Gln Gln Glu Pro Leu 180 185 190 Ala Leu Leu Gln Lys Glu Leu Asp Gly Gly Thr Ile Thr Ser Leu Asp 195 200 205 Glu Ala Leu Pro Gln Ala Asp Ile Val Val Trp Val Ala Ser Met Pro 210 215 220 Lys Thr Ile Glu Ile Asp Thr Asp Asn Leu Lys Lys Pro Cys Leu Met 225 230 235 240 Ile Asp Gly Gly Tyr Pro Lys Asn Leu Asp Glu Lys Phe Gln Gly Glu 245 250 255 Asn Ile Tyr Val Leu Lys Gly Gly Ile Val Glu Phe Phe Asn Asp Ile 260 265 270 Gly Trp Asn Met Met Glu Leu Ala Glu Met Gln Asn Pro Gln Arg Glu 275 280 285 Met Phe Ala Cys Phe Ala Glu Ala Met Ile Leu Glu Phe Glu Lys Cys 290 295 300 His Thr Asn Phe Ser Trp Gly Arg Asn Asn Ile Ser Leu Glu Lys Met 305 310 315 320 Glu Phe Ile Gly Ala Ala Ser Leu Lys His Gly Phe Ser Ala Ile Gly 325 330 335 Leu Asp Lys Gln Pro Lys Val Leu Thr Val 340 345 68346PRTSynechococcus sp. 68Met Phe Gly Leu Ile Gly His Ser Thr Ser Phe Glu Ala Ala Arg Arg 1 5 10 15 Lys Ala Ser Glu Leu Gly Phe Asp His Ile Ala Glu Gly Asp Leu Asp 20 25 30 Val Trp Cys Ser Ala Pro Pro Gln Leu Val Glu His Val Glu Val Thr 35 40 45 Ser Ala Thr Gly Lys Thr Ile Thr Gly Ala Tyr Ile Asp Ser Cys Phe 50 55 60 Val Pro Glu Met Leu Ser Arg Phe Lys Thr Ala Arg Arg Lys Val Leu 65 70 75 80 Asn Ala Met Glu Leu Ala Gln Lys Lys Gly Ile Asn Ile Thr Ala Leu 85 90 95 Gly Gly Phe Thr Ser Ile Ile Phe Glu Asn Phe Asn Leu Leu Gln His 100 105 110 Gln His Val Arg Ser Thr Thr Leu Glu Trp Glu Arg Phe Thr Thr Gly 115 120 125 Asn Thr His Thr Ala Trp Val Ile Ser Arg Gln Val Glu Asn Asn Ala 130 135 140 Pro Leu Leu Gly Ile Asp Leu Ser Ser Ala Lys Val Ala Val Val Gly 145 150 155 160 Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Ser Gln Arg 165 170 175 Thr Gly Val Gly Glu Leu Leu Leu Val Ala Arg Gln Gln Gln Pro Leu 180 185 190 Leu Asp Leu Gln Gln Glu Leu Gly Gly Gly Arg Ile Leu Ser Leu Asp 195 200 205 Glu Ala Leu Pro Glu Ala Asp Val Val Val Trp Val Ala Ser Met Pro 210 215 220 Arg Thr Leu Glu Ile Asp Ala Ala Ser Leu Arg Lys Pro Cys Leu Met 225 230 235 240 Ile Asp Gly Gly Tyr Pro Lys Asn Leu Asp Ala Lys Val Ala Ser Ala 245 250 255 Gly Val His Val Leu Lys Gly Gly Ile Val Glu Phe Gly Ser Asp Ile 260 265 270 Gly Trp Ser Met Met Glu Ile Ala Glu Met Glu Lys Pro Gln Arg Gln 275 280 285 Met Phe Ala Cys Phe Ala Glu Ala Met Leu Leu Asp Phe Glu Glu Cys 290 295 300 His Thr Asn Phe Ser Trp Gly Arg Asn Asn Ile Thr Leu Glu Lys Met 305 310 315 320 Asp Phe Ile Gly Glu Ala Ser Val Arg His Gly Phe Ser Thr Leu Asn 325 330 335 Leu Asn Pro Gln Pro Gln Ala Ala Val Ala 340 345 69346PRTProchlorococcus marinus 69Met Phe Gly Leu Ile Gly His Ser Thr Ser Phe Glu Asp Ala Lys Arg 1 5 10 15 Lys Ala Leu Gly Leu Gly Tyr Asp His Ile Ala Gln Gly Asp Leu Asp 20 25 30 Val Trp Cys Thr Ala Pro Pro Gln Leu Val Glu Asn Val Lys Val Val 35 40 45 Ser Ala Ile Gly Lys Thr Ile Glu Gly Ala Tyr Ile Asp Ser Cys Phe 50 55 60 Val Pro Glu Met Leu Ser Arg Phe Lys Thr Ala Arg Arg Lys Val Leu 65 70 75 80 Asn Ala Met Glu Leu Ala Gln Lys Lys Glu Ile Ser Ile Thr Ala Leu 85 90 95 Gly Gly Phe Thr Ser Ile Ile Phe Glu Asn Phe Asn Leu Leu Gln Asn 100 105 110 Gln Gln Val Arg Asn Thr Thr Leu Asp Trp Gln Arg Phe Thr Thr Gly 115 120 125 Asn Thr His Thr Ala Trp Val Ile Cys Arg Gln Leu Glu Gln Asn Ala 130 135 140 Pro Arg Ile Gly Ile Asp Leu Ser Lys Ser Lys Val Ala Val Val Gly 145 150 155 160 Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Ser Asn Arg 165 170 175 Thr Gly Val Ser Glu Leu Leu Leu Val Ala Arg Gln Gln Lys Pro Leu 180 185 190 Leu Glu Leu Gln Ser Gln Leu Gly Gly Gly Arg Ile Leu Ser Leu Asp 195 200 205 Asp Ala Leu Pro Glu Ala Asp Ile Val Ile Trp Val Ala Ser Met Pro 210 215 220 Lys Thr Leu Glu Ile Asp Pro Ser Lys Ile Lys Arg Pro Cys Leu Met 225 230 235 240 Ile Asp Gly Gly Tyr Pro Lys Asn Leu Gly Glu Lys Phe Ser Gly Pro 245 250 255 Gly Ile His Val Leu Lys Gly Gly Ile Val Gln Phe Phe Lys Asp Ile 260 265 270 Gly Trp Ser Met Met Glu Leu Ala Glu Met Glu Asn Pro Lys Arg Glu 275 280 285 Met Phe Ala Cys Phe Ala Glu Ala Met Leu Leu Glu Phe Glu Asn Cys 290 295 300 His Thr Asn Phe Ser Trp Gly Arg Asn Asn Ile Thr Leu Glu Lys Met 305 310 315 320 Asp Phe Ile Gly Lys Ala Ser Glu Arg His Gly Phe Ser Ala Val Gly 325 330 335 Leu Lys Ser Asn Ile Gln Thr Leu Thr Val 340 345 70346PRTProchlorococcus marinus 70Met Phe Gly Leu Ile Gly His Ser Thr Ser Phe Glu Asp Ala Lys Arg 1 5 10 15 Lys Ala Ser Met Leu Gly Phe Asp His Ile Ala Asp Gly Asp Leu Asp 20 25 30 Val Trp Cys Thr Ala Pro Pro Gln Leu Val Glu Asn Val Glu Val Lys 35 40 45 Ser Ala Thr Gly Ile Ser Ile Glu Gly Ser Tyr Ile Asp Ser Cys Phe 50 55 60 Val Pro Glu Met Leu Ser Arg Phe Lys Thr Ala Arg Arg Lys Val Leu 65 70 75 80 Asn Ala Met Glu Leu Ala Gln Lys Lys Gly Ile Asn Ile Thr Ala Leu 85 90 95 Gly Gly Phe Thr Ser Ile Ile Phe Glu Asn Phe Asn Leu Leu Gln His 100 105 110 Lys Gln Ile Arg Asn Thr Ser Leu Glu Trp Glu Arg Phe Thr Thr Gly 115 120 125 Asn Thr His Thr Ala Trp Val Ile Cys Arg Gln Leu Glu Ile Asn Ala 130 135 140 Pro Arg Ile Gly Ile Asp Leu Lys Lys Ala Thr Val Ala Val Ile Gly 145 150 155 160 Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Ile Asn Lys 165 170 175 Thr Gly Ile Ser Glu Leu Leu Met Val Ala Arg Gln Gln Glu Pro Leu 180 185 190 Ala Leu Leu Gln Lys Glu Leu Asp Gly Gly Thr Ile Thr Thr Leu Asp 195 200 205 Lys Ala Leu Pro Gln Ala Asp Ile Val Val Trp Val Ala Ser Met Pro 210 215 220 Lys Thr Ile Glu Ile Asp Thr Asp Asn Leu Lys Lys Pro Cys Leu Met 225 230 235 240 Ile Asp Gly Gly Tyr Pro Lys Asn Leu Asp Glu Lys Phe Gln Gly Glu 245 250 255 Asn Ile His Val Leu Lys Gly Gly Ile Val Glu Phe Phe Asn Asp Ile 260 265 270 Gly Trp Asn Met Met Glu Leu Ala Glu Met Gln Asn Pro Gln Arg Glu 275 280 285 Met Phe Ala Cys Phe Ala Glu Ala Met Ile Leu Glu Phe Glu Lys Cys 290 295 300 His Thr Asn Phe Ser Trp Gly Arg Asn Asn Ile Ser Leu Glu Lys Met 305 310 315 320 Glu Phe Ile Gly Ala Ala Ser Leu Lys His Gly Phe Ser Ala Ile Gly 325 330 335 Leu Asp Lys Gln Pro Lys Val Leu Thr Val 340 345 71348PRTSynechococcus sp. 71Met Phe Gly Leu Ile Gly His Ser Thr Ser Phe Glu Ala Ala Arg Arg 1 5 10 15 Lys Ala Leu Glu Leu Gly Phe Asp His Ile Ala Glu Gly Asp Leu Asp 20 25 30 Val Trp Cys Ser Ala Pro Pro Gln Leu Val Glu His Leu Glu Val Thr 35 40 45 Ser Leu Thr Gly Lys Lys Ile Glu Gly Ala Tyr Ile Asp Ser Cys Phe 50 55 60 Val Pro Glu Met Leu Ser Arg Phe Lys Thr Ala Arg Arg Lys Val Leu 65 70 75 80 Asn Ala Met Glu Leu Ala Gln Lys Lys Gly Ile Asn Ile Thr Ala Leu 85 90 95 Gly Gly Phe Thr Ser Ile Ile Phe Glu Asn Phe Asn Leu Leu Lys His 100 105 110 Gln Thr Ile Arg Ser Thr Thr Leu Glu Trp Glu Arg Phe Thr Thr Gly 115 120 125 Asn Thr His Thr Ala Trp Val Ile Ser Arg Gln Val Glu Ile Asn Ala 130 135 140 Pro Leu Leu Gly Ile Asp Leu Ser Lys Ala Arg Val Ala Val Val Gly 145 150 155

160 Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Thr Gln Arg 165 170 175 Thr Gly Ile Lys Glu Leu Leu Met Val Ala Arg Gln Gln Gln Pro Leu 180 185 190 Lys Asp Leu Gln Gln Glu Leu Glu Gly Gly Arg Ile Leu Ser Leu Asp 195 200 205 Glu Ala Leu Pro Glu Ala Asp Val Val Val Trp Val Ala Ser Met Pro 210 215 220 Arg Thr Leu Glu Ile Asp Ser Asp Arg Leu Gln Lys Pro Cys Leu Met 225 230 235 240 Ile Asp Gly Gly Tyr Pro Lys Asn Leu Asp Ser Arg Val Ala Gly Gln 245 250 255 Gly Val His Val Leu Lys Gly Gly Ile Val Glu Phe Val Ser Asp Ile 260 265 270 Gly Trp Thr Met Met Glu Asn Ala Glu Trp Gln Met Glu Lys Pro Gln 275 280 285 Arg Gln Met Phe Ala Cys Phe Ala Glu Ala Ile Leu Leu Glu Phe Glu 290 295 300 Ala Cys His Thr Asn Phe Ser Trp Gly Arg Asn Asn Ile Thr Leu Glu 305 310 315 320 Lys Met Asp Phe Ile Gly Ala Ala Ser Val Arg His Gly Phe Ser Thr 325 330 335 Leu Asn Leu Gln Gly Gln Leu Gln Ala Ala Ala Ala 340 345 72346PRTProchlorococcus marinus 72Met Phe Gly Leu Ile Gly His Ser Thr Ser Phe Glu Asp Ala Lys Arg 1 5 10 15 Lys Ala Ser Met Leu Gly Phe Asp His Ile Ala Asp Gly Asp Leu Asp 20 25 30 Val Trp Cys Thr Ala Pro Pro Gln Leu Val Glu Asn Val Glu Val Arg 35 40 45 Ser Ala Thr Gly Ile Ser Ile Glu Gly Ser Tyr Ile Asp Ser Cys Phe 50 55 60 Val Pro Glu Met Leu Ser Arg Phe Lys Thr Ala Arg Arg Lys Val Leu 65 70 75 80 Asn Ala Met Glu Leu Ala Gln Lys Lys Gly Ile Asn Ile Thr Ala Leu 85 90 95 Gly Gly Phe Thr Ser Ile Ile Phe Glu Asn Phe Asn Leu Leu Gln His 100 105 110 Lys Gln Ile Arg Asn Thr Ser Leu Glu Trp Glu Arg Phe Thr Thr Gly 115 120 125 Asn Thr His Thr Ala Trp Val Ile Cys Arg Gln Leu Glu Ile Asn Ala 130 135 140 Pro Arg Ile Gly Ile Asp Leu Lys Lys Ala Thr Val Ala Val Ile Gly 145 150 155 160 Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Thr Asn Lys 165 170 175 Thr Gly Ile Ser Glu Leu Leu Met Val Ala Arg Gln Gln Glu Pro Leu 180 185 190 Ala Leu Leu Gln Lys Glu Leu Asp Gly Gly Thr Ile Thr Thr Leu Asp 195 200 205 Lys Ala Leu Pro Gln Ala Asp Ile Val Val Trp Val Ala Ser Met Pro 210 215 220 Lys Thr Ile Glu Ile Asp Thr Asp Asn Leu Lys Lys Pro Cys Leu Met 225 230 235 240 Ile Asp Gly Gly Tyr Pro Lys Asn Leu Asp Glu Lys Phe Gln Gly Glu 245 250 255 Asn Ile His Val Leu Lys Gly Gly Ile Val Lys Phe Phe Asn Asp Ile 260 265 270 Gly Trp Asn Met Met Glu Leu Ala Glu Met Gln Asn Pro Gln Arg Glu 275 280 285 Met Phe Ala Cys Phe Ala Glu Ala Met Ile Leu Glu Phe Glu Lys Cys 290 295 300 His Thr Asn Phe Ser Trp Gly Arg Asn Asn Ile Ser Leu Glu Lys Met 305 310 315 320 Glu Phe Ile Gly Ala Ala Ser Leu Lys His Gly Phe Ser Ala Ile Gly 325 330 335 Leu Asp Lys Gln Pro Lys Val Leu Thr Val 340 345 73346PRTProchlorococcus marinus 73Met Phe Gly Leu Ile Gly His Ser Thr Ser Phe Glu Asp Ala Lys Arg 1 5 10 15 Lys Ala Ser Met Leu Gly Phe Asp His Ile Ala Asp Gly Asp Leu Asp 20 25 30 Val Trp Cys Thr Ala Pro Pro Gln Leu Val Glu Asn Val Glu Val Lys 35 40 45 Ser Ala Thr Gly Ile Ser Ile Glu Gly Ser Tyr Ile Asp Ser Cys Phe 50 55 60 Val Pro Glu Met Leu Ser Arg Phe Lys Thr Ala Arg Arg Lys Val Leu 65 70 75 80 Asn Ala Met Glu Leu Ala Gln Lys Lys Gly Ile Asn Ile Thr Ala Leu 85 90 95 Gly Gly Phe Thr Ser Ile Ile Phe Glu Asn Phe Asn Leu Leu Gln His 100 105 110 Lys Gln Ile Arg Asn Thr Ser Leu Glu Trp Glu Arg Phe Thr Thr Gly 115 120 125 Asn Thr His Thr Ala Trp Val Ile Cys Lys Gln Leu Glu Ile Asn Ala 130 135 140 Pro Arg Ile Gly Ile Asp Leu Lys Lys Ala Thr Val Ala Val Ile Gly 145 150 155 160 Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Ile Asn Lys 165 170 175 Thr Gly Ile Ser Glu Leu Leu Met Val Ala Arg Gln Gln Glu Pro Leu 180 185 190 Ala Leu Leu Gln Lys Glu Leu Asp Gly Gly Thr Ile Thr Ser Leu Asp 195 200 205 Glu Ala Leu Pro Gln Ala Asp Ile Val Val Trp Val Ala Ser Met Pro 210 215 220 Lys Thr Ile Glu Ile Asn Thr Asp Asn Leu Gln Lys Pro Cys Leu Met 225 230 235 240 Ile Asp Gly Gly Tyr Pro Lys Asn Leu Asp Glu Lys Phe Gln Gly Glu 245 250 255 Asn Ile Tyr Val Leu Lys Gly Gly Ile Val Glu Phe Phe Asn Asp Ile 260 265 270 Gly Trp Asn Met Met Glu Leu Ala Glu Met Gln Asn Pro Gln Arg Glu 275 280 285 Met Phe Ala Cys Phe Ala Glu Ala Met Ile Leu Glu Phe Glu Lys Cys 290 295 300 His Thr Asn Phe Ser Trp Gly Arg Asn Asn Ile Ser Leu Glu Lys Met 305 310 315 320 Glu Phe Ile Gly Ala Ala Ser Leu Lys His Gly Phe Ser Ala Ile Gly 325 330 335 Leu Asp Lys Gln Pro Lys Val Leu Thr Val 340 345 74341PRTSynechococcus sp. 74Met Phe Gly Leu Ile Gly His Leu Thr Ser Leu Ala His Ala Lys Arg 1 5 10 15 Val Ala Asp Lys Leu Gly Tyr Ser Glu Tyr Ala Glu Ser Asp Leu Glu 20 25 30 Phe Trp Cys Met Ala Pro Pro Gln Val Val Asp Glu Ile Val Val Thr 35 40 45 Ser Ile Thr Gly Gln Lys Ile Tyr Gly Gln Tyr Val Glu Ser Cys Phe 50 55 60 Leu Pro Glu Met Leu Ala Gly Gly Arg Val Lys Ala Ala Cys Arg Lys 65 70 75 80 Ile Leu Asn Ala Met Ala Leu Ala Gln Arg Arg Gly Leu Asn Ile Thr 85 90 95 Thr Leu Gly Gly Phe Ser Ser Ile Ile Phe Glu Asn Phe Arg Leu Asp 100 105 110 Thr Leu Arg Arg Val Arg Asn Ile Asp Leu Glu Ile Arg Arg Phe Thr 115 120 125 Thr Gly Asn Thr His Thr Ala Tyr Ile Ile Cys Gln Gln Leu Gln Ala 130 135 140 Ala Ala Gln Arg Tyr Ala Met Asp Leu Ala Ala Ala Thr Val Ala Val 145 150 155 160 Val Gly Ala Thr Gly Asp Ile Gly Ser Ala Ile Cys Gln Trp Leu Val 165 170 175 Ala His Thr Ser Pro Ala Lys Leu Leu Leu Ile Ala Arg Glu Arg Arg 180 185 190 Arg Leu Glu Glu Leu Gln Ala Lys Leu Lys Lys Gly Glu Val Cys Ser 195 200 205 Leu Glu Glu Ala Leu Pro Arg Ala Asp Phe Ile Val Trp Val Ala Ser 210 215 220 Met Ser Gln Gly Val Thr Leu Asp Pro Gln Val Leu Pro Asp Pro Cys 225 230 235 240 Val Ile Ile Asp Gly Gly Tyr Pro Lys Asn Ile Ala Ser Lys Leu Gln 245 250 255 Arg Lys Gly Leu Tyr Val Ile Asp Gly Gly Met Val Glu His Ser Leu 260 265 270 Asp Ile Glu Trp Asn Ile Met Gln Phe Leu Asn Val Ala Asn Pro Ala 275 280 285 Arg Gln Leu Phe Ala Cys Phe Ala Glu Ala Met Leu Leu Glu Phe Glu 290 295 300 Gly Leu Tyr Thr Asn Phe Ser Trp Gly Arg Asn Leu Ile Thr Leu Glu 305 310 315 320 Lys Leu Asp Leu Ile Gly Gln Leu Ser Arg Lys His Gly Phe Arg Pro 325 330 335 Leu Met Pro Glu Ala 340 75341PRTSynechococcus sp. 75Met Phe Gly Leu Ile Gly His Leu Thr Ser Leu Ala His Ala Lys Arg 1 5 10 15 Val Ala Asp Lys Leu Gly Tyr Ser Glu Tyr Ala Glu Ser Asp Leu Glu 20 25 30 Phe Trp Cys Met Ala Pro Pro Gln Val Val Asp Glu Ile Thr Val Thr 35 40 45 Ser Ile Thr Gly Gln Lys Ile Tyr Gly Gln Tyr Val Glu Ser Cys Phe 50 55 60 Leu Pro Glu Met Leu Ala Gly Gly Arg Val Lys Ala Ala Cys Arg Lys 65 70 75 80 Val Leu Asn Ala Met Ala Leu Ala Gln Arg Arg Gly Leu Asn Ile Thr 85 90 95 Ala Leu Gly Gly Phe Ser Ser Ile Ile Phe Glu Thr Phe Arg Leu Asp 100 105 110 Ser Leu Arg Arg Val Arg Asn Ile Asp Leu Glu Ile Gln Arg Phe Thr 115 120 125 Thr Gly Asn Thr His Thr Ala Tyr Ile Ile Cys Gln Gln Leu Gln Leu 130 135 140 Ala Ala Gln Arg Tyr Ala Met Asp Leu Ala Ala Ala Thr Val Ala Val 145 150 155 160 Val Gly Ala Thr Gly Asp Ile Gly Ser Ala Ile Cys Gln Trp Leu Val 165 170 175 Ala His Thr His Leu Gly Lys Leu Leu Leu Ile Ala Arg Glu Arg Arg 180 185 190 Arg Leu Glu Glu Leu Gln Ala Lys Leu Lys Gln Gly Glu Ile Ser Ser 195 200 205 Leu Glu Glu Ala Leu Pro Arg Ala Asp Phe Ile Val Trp Val Ala Ser 210 215 220 Met Ser Gln Gly Met Ala Leu Asp Pro Gln Val Leu Pro Asp Pro Cys 225 230 235 240 Val Ile Ile Asp Gly Gly Tyr Pro Lys Asn Ile Ala Ser Ser Leu Gln 245 250 255 Arg Lys Gly Leu Tyr Val Ile Asp Gly Gly Met Val Glu His Ser Leu 260 265 270 Asp Ile Glu Trp Asn Ile Met Gln Phe Leu Asn Val Ala Asn Pro Ala 275 280 285 Arg Gln Leu Phe Ala Cys Phe Ala Glu Ser Met Leu Leu Glu Phe Glu 290 295 300 Gly Leu Tyr Thr Asn Phe Ser Trp Gly Arg Asn Leu Ile Thr Leu Glu 305 310 315 320 Lys Leu Asp Leu Ile Gly Gln Leu Ser Arg Lys His Gly Phe Arg Pro 325 330 335 Leu Met Pro Glu Ala 340 76346PRTProchlorococcus marinus 76Met Phe Gly Leu Ile Gly His Ser Thr Ser Phe Glu Asp Ala Lys Arg 1 5 10 15 Lys Ala Ser Leu Leu Gly Phe Asp His Ile Ala Asp Gly Asp Leu Asp 20 25 30 Val Trp Cys Thr Ala Pro Pro Gln Leu Val Glu Asn Val Glu Val Lys 35 40 45 Ser Ala Thr Gly Ile Ser Ile Glu Gly Ser Tyr Ile Asp Ser Cys Phe 50 55 60 Val Pro Glu Met Leu Ser Arg Phe Lys Thr Ala Arg Arg Lys Val Leu 65 70 75 80 Asn Ala Met Glu Leu Ala Gln Lys Lys Gly Ile Asn Ile Thr Ala Leu 85 90 95 Gly Gly Phe Thr Ser Ile Ile Phe Glu Asn Phe Asn Leu Leu Gln His 100 105 110 Lys Gln Ile Arg Asn Thr Ser Leu Glu Trp Glu Arg Phe Thr Thr Gly 115 120 125 Asn Thr His Thr Ala Trp Val Ile Cys Arg Gln Leu Glu Ile Asn Ala 130 135 140 Pro Arg Ile Gly Ile Asp Leu Lys Thr Ala Thr Val Ala Val Ile Gly 145 150 155 160 Ala Thr Gly Asp Ile Gly Ser Ala Val Cys Arg Trp Leu Val Asn Lys 165 170 175 Thr Gly Ile Ser Glu Leu Leu Met Val Ala Arg Gln Gln Gln Pro Leu 180 185 190 Thr Leu Leu Gln Lys Glu Leu Asp Gly Gly Thr Ile Lys Ser Leu Asp 195 200 205 Glu Ala Leu Pro Gln Ala Asp Ile Val Val Trp Val Ala Ser Met Pro 210 215 220 Lys Thr Ile Glu Ile Glu Ile Glu Asn Leu Lys Lys Pro Cys Leu Met 225 230 235 240 Ile Asp Gly Gly Tyr Pro Lys Asn Leu Asp Glu Lys Phe Lys Gly Lys 245 250 255 Asn Ile His Val Leu Lys Gly Gly Ile Val Glu Phe Phe Asn Asp Ile 260 265 270 Gly Trp Asn Met Met Glu Leu Ala Glu Met Gln Asn Pro Gln Arg Glu 275 280 285 Met Phe Ala Cys Phe Ala Glu Ala Met Ile Leu Glu Phe Glu Lys Cys 290 295 300 His Thr Asn Phe Ser Trp Gly Arg Asn Asn Ile Ser Leu Glu Lys Met 305 310 315 320 Glu Phe Ile Gly Ala Ala Ser Leu Lys His Gly Phe Ser Ala Ile Gly 325 330 335 Leu Asp Lys Gln Pro Lys Val Leu Thr Val 340 345 77231PRTSynechococcus elongatus 77Met Pro Gln Leu Glu Ala Ser Leu Glu Leu Asp Phe Gln Ser Glu Ser 1 5 10 15 Tyr Lys Asp Ala Tyr Ser Arg Ile Asn Ala Ile Val Ile Glu Gly Glu 20 25 30 Gln Glu Ala Phe Asp Asn Tyr Asn Arg Leu Ala Glu Met Leu Pro Asp 35 40 45 Gln Arg Asp Glu Leu His Lys Leu Ala Lys Met Glu Gln Arg His Met 50 55 60 Lys Gly Phe Met Ala Cys Gly Lys Asn Leu Ser Val Thr Pro Asp Met 65 70 75 80 Gly Phe Ala Gln Lys Phe Phe Glu Arg Leu His Glu Asn Phe Lys Ala 85 90 95 Ala Ala Ala Glu Gly Lys Val Val Thr Cys Leu Leu Ile Gln Ser Leu 100 105 110 Ile Ile Glu Cys Phe Ala Ile Ala Ala Tyr Asn Ile Tyr Ile Pro Val 115 120 125 Ala Asp Ala Phe Ala Arg Lys Ile Thr Glu Gly Val Val Arg Asp Glu 130 135 140 Tyr Leu His Arg Asn Phe Gly Glu Glu Trp Leu Lys Ala Asn Phe Asp 145 150 155 160 Ala Ser Lys Ala Glu Leu Glu Glu Ala Asn Arg Gln Asn Leu Pro Leu 165 170 175 Val Trp Leu Met Leu Asn Glu Val Ala Asp Asp Ala Arg Glu Leu Gly 180 185 190 Met Glu Arg Glu Ser Leu Val Glu Asp Phe Met Ile Ala Tyr Gly Glu 195 200 205 Ala Leu Glu Asn Ile Gly Phe Thr Thr Arg Glu Ile Met Arg Met Ser 210 215 220 Ala Tyr Gly Leu Ala Ala Val 225 230 78254PRTSynechococcus elongatus 78Met Arg Thr Pro Trp Asp Pro Pro Asn Pro Thr Phe Ser Leu Ser Ser 1 5 10 15 Val Ser Gly Asp Arg Arg Leu Met Pro Gln Leu Glu Ala Ser Leu Glu 20 25 30 Leu Asp Phe Gln Ser Glu Ser Tyr Lys Asp Ala Tyr Ser Arg Ile Asn 35 40 45 Ala Ile Val Ile Glu Gly Glu Gln Glu Ala Phe Asp Asn Tyr Asn Arg 50 55 60 Leu Ala Glu Met Leu Pro Asp Gln Arg Asp Glu Leu His Lys Leu Ala 65 70 75 80 Lys Met Glu Gln Arg His Met Lys Gly Phe Met Ala Cys Gly Lys Asn 85 90 95 Leu Ser Val Thr Pro Asp Met Gly Phe Ala Gln Lys Phe Phe Glu Arg 100 105 110 Leu His Glu Asn Phe Lys Ala Ala Ala Ala Glu Gly Lys Val Val Thr 115 120 125 Cys Leu Leu Ile Gln Ser Leu Ile Ile Glu Cys Phe

Ala Ile Ala Ala 130 135 140 Tyr Asn Ile Tyr Ile Pro Val Ala Asp Ala Phe Ala Arg Lys Ile Thr 145 150 155 160 Glu Gly Val Val Arg Asp Glu Tyr Leu His Arg Asn Phe Gly Glu Glu 165 170 175 Trp Leu Lys Ala Asn Phe Asp Ala Ser Lys Ala Glu Leu Glu Glu Ala 180 185 190 Asn Arg Gln Asn Leu Pro Leu Val Trp Leu Met Leu Asn Glu Val Ala 195 200 205 Asp Asp Ala Arg Glu Leu Gly Met Glu Arg Glu Ser Leu Val Glu Asp 210 215 220 Phe Met Ile Ala Tyr Gly Glu Ala Leu Glu Asn Ile Gly Phe Thr Thr 225 230 235 240 Arg Glu Ile Met Arg Met Ser Ala Tyr Gly Leu Ala Ala Val 245 250 79231PRTArthrospira maxima 79Met Pro Gln Leu Glu Thr Ile Thr Glu Leu Asp Phe Gln Asn Glu Thr 1 5 10 15 Tyr Lys Asp Ala Tyr Ser Arg Ile Asn Ala Ile Val Ile Glu Gly Glu 20 25 30 Gln Glu Ala Ser Asp Asn Tyr Ile Lys Leu Gly Glu Met Leu Pro Glu 35 40 45 Glu Arg Glu Glu Leu Ile Arg Leu Ser Lys Met Glu Lys Arg His Lys 50 55 60 Lys Gly Phe Gln Ala Cys Gly Arg Asn Leu Glu Val Thr Pro Asp Met 65 70 75 80 Asp Phe Gly Arg Glu Phe Phe Ala Lys Leu His Gly Asn Phe Gln Lys 85 90 95 Ala Ala Ala Glu Gly Lys Leu Val Thr Cys Leu Leu Ile Gln Ser Leu 100 105 110 Ile Ile Glu Ser Phe Ala Ile Ala Ala Tyr Asn Ile Tyr Ile Pro Val 115 120 125 Ala Asp Pro Phe Ala Arg Lys Ile Thr Glu Gly Val Val Lys Asp Glu 130 135 140 Tyr Glu His Leu Asn Phe Gly Glu Glu Trp Leu Lys Ala His Phe Glu 145 150 155 160 Glu Ser Lys Ala Glu Leu Glu Glu Ala Asn Arg Gln Asn Leu Pro Leu 165 170 175 Val Trp Lys Met Leu Asn Gln Val Glu Lys Asp Ala Ser Ile Leu Gly 180 185 190 Met Glu Lys Glu Ala Leu Ile Glu Asp Phe Met Ile Ala Tyr Gly Glu 195 200 205 Ala Leu Ser Asn Ile Gly Phe Thr Thr Arg Asp Ile Met Arg Met Ser 210 215 220 Ala Tyr Gly Leu Ala Gly Val 225 230 80239PRTMicrocoleus chthonoplastes 80Met Gln Thr Gly Glu Asn Leu Leu Met Gln Gln Leu Thr Val Ser Gln 1 5 10 15 Glu Leu Asp Phe Asn Ser Glu Thr Tyr Lys Asp Ala Tyr Ser Arg Ile 20 25 30 Asn Ala Ile Val Ile Glu Gly Glu Gln Glu Ala His Gln Asn Tyr Ile 35 40 45 Gln Leu Ala Glu Leu Leu Pro Asp Gln Lys Asp Glu Leu Thr Ser Leu 50 55 60 Ala Lys Met Glu Asn Arg His Lys Lys Gly Phe Gln Ala Cys Gly Arg 65 70 75 80 Asn Leu Ser Val Thr Ala Asp Met Glu Phe Ala Lys Glu Tyr Phe Ser 85 90 95 Asp Leu His Gln Asn Phe Gln Thr Ala Ala Ala Ser Gly Asn Ile Val 100 105 110 Thr Cys Leu Leu Ile Gln Ser Leu Ile Ile Glu Cys Phe Ala Ile Ala 115 120 125 Ala Tyr Asn Ile Tyr Ile Pro Val Ala Asp Pro Phe Ala Arg Lys Ile 130 135 140 Thr Glu Gly Val Val Lys Asp Glu Tyr Met His Leu Asn Phe Gly Glu 145 150 155 160 Glu Trp Leu Lys Glu Asn Phe Glu Ala Ser Lys Thr Glu Leu Glu Gln 165 170 175 Ala Asn Lys Gln Asn Leu Pro Leu Val Trp Arg Met Leu Asn Gln Val 180 185 190 Glu Lys Asp Ala His Ile Leu Gly Met Glu Lys Asp Ala Leu Val Glu 195 200 205 Asp Phe Met Ile Ala Tyr Gly Glu Ala Leu Ser Asn Ile Gly Phe Thr 210 215 220 Thr Arg Asp Ile Met Arg Met Ser Ala Tyr Gly Leu Thr Ala Ala 225 230 235 81231PRTLyngbya sp. 81Met Pro Gln Leu Glu Ala Ile Ala Glu Ile Asp Phe Asn Thr Asn Thr 1 5 10 15 Tyr Lys Asp Ala Tyr Ser Arg Ile Asn Ala Ile Val Ile Glu Gly Glu 20 25 30 Gln Val Ala His Asp Asn Tyr Ile Lys Leu Gly Glu Met Leu Pro Asp 35 40 45 Gln Lys Asp Glu Leu Val Arg Leu Ser Lys Met Glu Lys Arg His Met 50 55 60 Lys Gly Phe Gln Ala Cys Gly Arg Asn Leu Glu Val Thr Ala Asp Met 65 70 75 80 Asp Tyr Ala His Gln Phe Phe Ser Gln Leu His Gln Asn Phe Lys Asp 85 90 95 Ala Ala Ala Gln Gly Lys Val Val Thr Cys Leu Leu Ile Gln Ser Leu 100 105 110 Ile Ile Glu Ser Phe Ala Ile Ala Ala Tyr Asn Ile Tyr Ile Pro Val 115 120 125 Ala Asp Pro Phe Ala Arg Lys Ile Thr Glu Gly Val Val Asp Asp Glu 130 135 140 Tyr Met His Leu Asn Phe Gly Glu Glu Trp Leu Lys Ala His Phe Glu 145 150 155 160 Glu Ser Lys Ala Glu Leu Gln Glu Ala Asn Ser Gln Asn Leu Pro Leu 165 170 175 Val Trp Lys Met Leu Asn Glu Val Glu Asn Asp Ala His Ile Leu Gly 180 185 190 Met Glu Lys Asp Ala Leu Val Glu Asp Phe Met Ile Ala Tyr Gly Glu 195 200 205 Ala Leu Asn Asn Ile Gly Phe Thr Thr Arg Glu Ile Met Arg Met Ser 210 215 220 Ala His Gly Leu Thr Thr Ala 225 230 82231PRTNodularia spumigena 82Met Gln Gln Leu Ala Ala Glu Leu Lys Ile Asp Phe Gln Ser Glu Lys 1 5 10 15 Tyr Lys Asp Ala Tyr Ser Arg Ile Asn Ala Ile Val Ile Glu Gly Glu 20 25 30 Gln Glu Ala His Asp Asn Tyr Ile Thr Leu Gly Glu Met Leu Pro Glu 35 40 45 Leu Lys Asp Glu Leu Ile Arg Leu Ser Lys Met Glu Ser Arg His Lys 50 55 60 Lys Gly Phe Glu Ala Cys Gly Arg Asn Leu Ser Val Lys Pro Asp Met 65 70 75 80 Pro Phe Ala Gln Lys Phe Phe Ser Gly Leu His Glu Asn Phe Gln Lys 85 90 95 Ala Ala Ala Glu Gly Gln Val Val Thr Cys Leu Leu Ile Gln Ser Leu 100 105 110 Ile Ile Glu Cys Phe Ala Ile Ala Ala Tyr Asn Ile Tyr Ile Pro Val 115 120 125 Ala Asp Asp Phe Ala Arg Lys Ile Thr Glu Gly Val Val Lys Asp Glu 130 135 140 Tyr Ser His Leu Asn Phe Gly Glu Val Trp Leu Lys Glu Asn Phe Ala 145 150 155 160 Gln Ser Lys Ala Glu Leu Glu Ala Ala Asn Arg Gln Asn Leu Pro Ile 165 170 175 Val Trp Lys Met Leu Asn Glu Val Glu Asn Asp Ala His Val Leu Ala 180 185 190 Met Glu Lys Glu Ala Leu Val Glu Asp Phe Met Ile Gln Tyr Gly Glu 195 200 205 Thr Leu Ser Asn Ile Gly Phe Thr Thr Arg Asp Ile Met Lys Met Ser 210 215 220 Ala Tyr Gly Leu Thr Ala Ala 225 230 83231PRTMicrocystis aeruginosa 83Met Pro Glu Leu Ala Val Pro Leu Glu Leu Asp Phe Thr Ser Glu Thr 1 5 10 15 Tyr Lys Ser Ala Tyr Ser Arg Ile Asn Ala Ile Val Ile Glu Gly Glu 20 25 30 Tyr Glu Ala Asn Ser Asn Tyr Ile Gln Leu Ala Asp Ile Leu Thr Asp 35 40 45 Asn Lys Glu Glu Leu His Arg Leu Ala Lys Met Glu Asn Arg His Met 50 55 60 Lys Gly Phe Gln Ala Cys Gly Gln Asn Leu Lys Ile Thr Pro Asp Met 65 70 75 80 Asp Tyr Ala Arg Glu Phe Phe Ser Ser Leu His Asn Asn Phe Gln Ile 85 90 95 Ala Tyr Ala Glu Gly Lys Val Val Thr Cys Leu Leu Ile Gln Ser Leu 100 105 110 Ile Ile Glu Ala Phe Ala Ile Ala Ala Tyr Asn Ile Tyr Ile Pro Val 115 120 125 Ala Asp Pro Phe Ala Arg Lys Ile Thr Glu Gly Val Val Lys Asp Glu 130 135 140 Tyr Leu His Leu Asn Phe Gly Glu Glu Trp Leu Lys Ala Asn Phe Glu 145 150 155 160 Thr Ala Lys Glu Glu Leu Glu Ala Ala Asn Arg Ala Asn Leu Pro Ile 165 170 175 Val Trp Arg Met Leu Asn Gln Val Glu Asn Asp Ala Arg Val Leu Gly 180 185 190 Met Glu Lys Glu Ala Leu Val Glu Asp Phe Met Ile Ser Tyr Gly Glu 195 200 205 Ala Leu Ser Asn Ile Gly Phe Ser Thr Arg Asp Ile Met Arg Met Ser 210 215 220 Ala Tyr Gly Leu Thr Ala Val 225 230 84231PRTMicrocystis aeruginosa 84Met Pro Glu Leu Ala Val Pro Leu Glu Leu Asp Phe Thr Ser Glu Thr 1 5 10 15 Tyr Lys Ser Ala Tyr Ser Arg Ile Asn Ala Ile Val Ile Glu Gly Glu 20 25 30 Tyr Glu Ala Asn Ser Asn Tyr Ile Gln Leu Ala Asp Ile Leu Thr Asp 35 40 45 Asn Lys Glu Glu Leu His Arg Leu Ala Lys Met Glu Asn Arg His Met 50 55 60 Lys Gly Phe Gln Ala Cys Gly Gln Asn Leu Gln Ile Thr Pro Asp Met 65 70 75 80 Glu Tyr Ala Lys Glu Phe Phe Ser Ser Leu His Asn Asn Phe Gln Ile 85 90 95 Ala Tyr Ala Glu Gly Lys Val Val Thr Cys Leu Leu Ile Gln Ser Leu 100 105 110 Ile Ile Glu Ala Phe Ala Ile Ala Ala Tyr Asn Ile Tyr Ile Pro Val 115 120 125 Ala Asp Pro Phe Ala Arg Lys Ile Thr Glu Ser Val Val Lys Asp Glu 130 135 140 Tyr Leu His Leu Asn Phe Gly Glu Glu Trp Leu Lys Ala Asn Phe Glu 145 150 155 160 Thr Ala Lys Glu Glu Leu Glu Ala Ala Asn Arg Ala Asn Leu Pro Ile 165 170 175 Val Trp Arg Met Leu Asn Gln Val Glu Asp Asp Ala Arg Val Leu Ala 180 185 190 Met Glu Lys Glu Ala Leu Val Glu Asp Phe Met Ile Ser Tyr Gly Glu 195 200 205 Ala Leu Asn Asn Ile Gly Phe Ser Thr Arg Asp Ile Met Arg Met Ser 210 215 220 Ala Tyr Gly Leu Thr Ala Val 225 230 85231PRTNostoc sp. 85Met Gln Gln Val Ala Ala Asp Leu Glu Ile Asp Phe Lys Ser Glu Lys 1 5 10 15 Tyr Lys Asp Ala Tyr Ser Arg Ile Asn Ala Ile Val Ile Glu Gly Glu 20 25 30 Gln Glu Ala Tyr Glu Asn Tyr Ile Gln Leu Ser Gln Leu Leu Pro Asp 35 40 45 Asp Lys Glu Asp Leu Ile Arg Leu Ser Lys Met Glu Ser Arg His Lys 50 55 60 Lys Gly Phe Glu Ala Cys Gly Arg Asn Leu Gln Val Ser Pro Asp Met 65 70 75 80 Glu Phe Ala Lys Glu Phe Phe Ala Gly Leu His Gly Asn Phe Gln Lys 85 90 95 Ala Ala Ala Glu Gly Lys Ile Val Thr Cys Leu Leu Ile Gln Ser Leu 100 105 110 Ile Ile Glu Cys Phe Ala Ile Ala Ala Tyr Asn Ile Tyr Ile Pro Val 115 120 125 Ala Asp Asp Phe Ala Arg Lys Ile Thr Glu Gly Val Val Lys Asp Glu 130 135 140 Tyr Ser His Leu Asn Phe Gly Glu Val Trp Leu Gln Lys Asn Phe Ala 145 150 155 160 Gln Ser Lys Ala Glu Leu Glu Glu Ala Asn Arg His Asn Leu Pro Ile 165 170 175 Val Trp Lys Met Leu Asn Gln Val Ala Asp Asp Ala Ala Val Leu Ala 180 185 190 Met Glu Lys Glu Ala Leu Val Glu Asp Phe Met Ile Gln Tyr Gly Glu 195 200 205 Ala Leu Ser Asn Ile Gly Phe Thr Thr Arg Asp Ile Met Arg Met Ser 210 215 220 Ala Tyr Gly Leu Thr Ala Ala 225 230 86231PRTAnabaena variabilis 86Met Gln Gln Val Ala Ala Asp Leu Glu Ile Asp Phe Lys Ser Glu Lys 1 5 10 15 Tyr Lys Asp Ala Tyr Ser Arg Ile Asn Ala Ile Val Ile Glu Gly Glu 20 25 30 Gln Glu Ala Tyr Glu Asn Tyr Ile Gln Leu Ser Gln Leu Leu Pro Asp 35 40 45 Asp Lys Glu Asp Leu Ile Arg Leu Ser Lys Met Glu Ser Arg His Lys 50 55 60 Lys Gly Phe Glu Ala Cys Gly Arg Asn Leu Gln Val Ser Pro Asp Ile 65 70 75 80 Glu Phe Ala Lys Glu Phe Phe Ala Gly Leu His Gly Asn Phe Gln Lys 85 90 95 Ala Ala Ala Glu Gly Lys Val Val Thr Cys Leu Leu Ile Gln Ser Leu 100 105 110 Ile Ile Glu Cys Phe Ala Ile Ala Ala Tyr Asn Ile Tyr Ile Pro Val 115 120 125 Ala Asp Asp Phe Ala Arg Lys Ile Thr Glu Gly Val Val Lys Asp Glu 130 135 140 Tyr Ser His Leu Asn Phe Gly Glu Val Trp Leu Gln Lys Asn Phe Ala 145 150 155 160 Gln Ser Lys Ala Glu Leu Glu Glu Ala Asn Arg His Asn Leu Pro Ile 165 170 175 Val Trp Lys Met Leu Asn Gln Val Ala Asp Asp Ala Ala Val Leu Ala 180 185 190 Met Glu Lys Glu Ala Leu Val Glu Asp Phe Met Ile Gln Tyr Gly Glu 195 200 205 Ala Leu Ser Asn Ile Gly Phe Thr Thr Arg Asp Ile Met Arg Met Ser 210 215 220 Ala Tyr Gly Leu Thr Ala Ala 225 230 87231PRTCrocosphaera watsonii 87Met Gln Glu Leu Ala Val Arg Ser Glu Leu Asp Phe Asn Ser Glu Thr 1 5 10 15 Tyr Lys Asp Ala Tyr Ser Arg Ile Asn Ala Ile Val Ile Glu Gly Glu 20 25 30 Gln Glu Ala Tyr Glu Asn Tyr Ile Asp Met Gly Glu Leu Leu Pro Gly 35 40 45 Asp Lys Asp Glu Leu Ile Arg Leu Ser Lys Met Glu Asn Arg His Lys 50 55 60 Lys Gly Phe Gln Ala Cys Gly Lys Asn Leu Lys Val Thr Pro Asp Met 65 70 75 80 Asp Tyr Ala Glu Arg Phe Phe Ser Gln Leu His Gly Asn Phe Gln Thr 85 90 95 Ala Lys Ala Glu Gly Lys Ile Val Thr Cys Leu Leu Ile Gln Ser Leu 100 105 110 Ile Ile Glu Ala Phe Ala Ile Ala Ala Tyr Asn Ile Tyr Ile Pro Val 115 120 125 Ala Asp Pro Phe Ala Arg Lys Ile Thr Glu Asn Val Val Lys Asp Glu 130 135 140 Tyr Ser His Leu Asn Phe Gly Glu Val Trp Leu Lys Glu Asn Phe Glu 145 150 155 160 Ala Ser Lys Ala Glu Leu Glu Gln Ala Asn Lys Glu Asn Leu Pro Ile 165 170 175 Val Trp Gln Met Leu Asn Glu Val Glu Asp Asp Ala Glu Ile Leu Gly 180 185 190 Met Glu Lys Glu Ala Leu Val Glu Asp Phe Met Ile Ser Tyr Gly Glu 195 200 205 Ala Leu Gly Asn Ile Gly Phe Ser Thr Arg Glu Ile Met Lys Met Ser 210 215 220 Ala His Gly Leu Ala Ala Val 225 230 88251PRTTrichodesmium erythraeum 88Met Pro Lys Leu Glu Ile Ile Pro Thr Met Asp Ser Gln Ser Glu Thr 1 5 10 15 Lys Leu Glu Lys Val Lys Ser Gln Ser Glu Gly Asp Gln Ile Asn Phe 20 25 30 Glu Thr Glu Thr Tyr Lys Asp Ala Tyr Ser Arg Ile Asn Ala Ile Val 35 40 45 Ile Glu Gly Glu Gln Glu Ala Tyr Lys Asn Tyr Ile Lys Leu

Ala Glu 50 55 60 Met Leu Pro Asp Glu Lys Asp Glu Leu Ile Lys Leu Ser Lys Met Glu 65 70 75 80 Asn Arg His Lys Lys Gly Phe Glu Ala Cys Gly Arg Asn Leu His Val 85 90 95 Thr Pro Asp Met Glu Phe Ala Lys Lys Phe Phe Glu Pro Leu His Glu 100 105 110 Asn Phe Gln Thr Ala Ala Ala Thr Gly Asn Val Val Thr Cys Leu Leu 115 120 125 Ile Gln Ser Leu Ile Ile Glu Cys Phe Ala Ile Ala Ala Tyr Asn Ile 130 135 140 Tyr Ile Pro Val Ala Asp Pro Phe Ala Arg Lys Ile Thr Glu Ser Val 145 150 155 160 Val Lys Asp Glu Tyr Ser His Leu Asn Phe Gly Glu Val Trp Leu Lys 165 170 175 Glu Tyr Phe Glu Asp Ser Lys Gln Glu Leu Gln Lys Ala Asn Arg Gln 180 185 190 Asn Leu Pro Leu Val Trp Lys Met Leu Asn Gln Val Glu Lys Asp Ala 195 200 205 Lys Thr Leu Glu Met Glu Lys Glu Ala Leu Ile Glu Asp Phe Met Ile 210 215 220 Ala Tyr Gly Glu Ala Leu Asn Asn Ile Gly Phe Thr Thr Gly Glu Ile 225 230 235 240 Met Arg Met Ser Ala Tyr Gly Leu Ile Ala Ala 245 250 89231PRTSynechococcus sp. 89Met Gln Thr Leu Glu Val Ser Pro Ala Met Asp Phe Gln Ser Glu Thr 1 5 10 15 Tyr Lys Asp Ala Tyr Ser Arg Ile Asn Ala Ile Val Ile Glu Gly Glu 20 25 30 Leu Glu Ala Asn Asn Asn Tyr Lys Gln Leu Ser Glu His Leu Gly Asp 35 40 45 Phe Lys Asp Asp Leu Leu Lys Leu Ala Arg Met Glu Asn Arg His Met 50 55 60 Lys Gly Phe Gln Ala Cys Gly Lys Asn Leu Ser Val Asn Pro Asp Met 65 70 75 80 Pro Phe Ala Lys Glu Phe Phe Ala Gln Leu His Asp Asn Phe Gln Thr 85 90 95 Ala Leu Ala Glu Gly Lys Ile Val Thr Cys Leu Leu Ile Gln Ser Leu 100 105 110 Ile Ile Glu Thr Phe Ala Ile Ser Ala Tyr Asn Ile Tyr Ile Pro Val 115 120 125 Ala Asp Asp Phe Ala Arg Lys Ile Thr Glu Gly Val Val Lys Asp Glu 130 135 140 Tyr Met His Leu Asn Phe Gly Glu Glu Trp Leu Lys Ala Asn Phe Glu 145 150 155 160 Ala Ser Lys Ala Glu Leu Glu Thr Ala Asn Arg Ala Asn Leu Pro Leu 165 170 175 Ile Trp Lys Met Leu Asn Gln Val Glu Glu Asp Ala Ala Val Leu Gly 180 185 190 Met Glu Lys Asp Ala Leu Ile Glu Asp Phe Met Ile Thr Tyr Gly Glu 195 200 205 Ala Leu Ala Asn Ile Gly Phe Ser Ala Arg Asp Val Met Arg Leu Ser 210 215 220 Ala Gln Gly Leu Ala Ala Val 225 230 90232PRTNostoc azollae 90Met Gln Gln Leu Val Glu Glu Ile Glu Lys Ile Asp Phe Gln Ser Glu 1 5 10 15 Lys Tyr Lys Asp Ala Tyr Ser Arg Ile Asn Ala Ile Val Ile Glu Gly 20 25 30 Glu Gln Glu Ala His Glu Asn Tyr Ile Thr Leu Ala Lys Leu Leu Pro 35 40 45 Glu Ser Lys Glu Glu Leu Met Arg Leu Ser Lys Met Glu Ser Arg His 50 55 60 Lys Lys Gly Phe Glu Ala Cys Gly Arg Asn Leu Gln Val Thr Pro Asp 65 70 75 80 Met Gln Phe Ala Lys Glu Phe Phe Ser Gly Leu His Gln Asn Phe Gln 85 90 95 Thr Ala Ala Ala Ala Gly Asn Val Val Thr Cys Leu Leu Ile Gln Ser 100 105 110 Leu Ile Ile Glu Cys Phe Ala Ile Ala Ala Tyr Asn Ile Tyr Ile Pro 115 120 125 Val Ala Asp Asp Phe Ala Arg Lys Ile Thr Glu Gly Val Val Lys Glu 130 135 140 Glu Tyr Ser His Leu Asn Phe Gly Glu Val Trp Leu Lys Glu His Phe 145 150 155 160 Ala Glu Ser Lys Ala Glu Leu Asp Asp Ala Asn Arg Gln Asn Leu Pro 165 170 175 Ile Val Trp Gln Met Leu Asn Gln Val Ala Asp Asp Ala Arg Val Leu 180 185 190 Ala Met Glu Lys Glu Ala Leu Val Glu Asp Phe Met Ile Gln Tyr Gly 195 200 205 Glu Ala Leu Ser Asn Ile Gly Phe Thr Thr Arg Asp Ile Ile Arg Leu 210 215 220 Ser Ala Tyr Gly Leu Ala Thr Val 225 230 91231PRTSynechocystis sp. 91Met Pro Glu Leu Ala Val Arg Thr Glu Phe Asp Tyr Ser Ser Glu Ile 1 5 10 15 Tyr Lys Asp Ala Tyr Ser Arg Ile Asn Ala Ile Val Ile Glu Gly Glu 20 25 30 Gln Glu Ala Tyr Ser Asn Tyr Leu Gln Met Ala Glu Leu Leu Pro Glu 35 40 45 Asp Lys Glu Glu Leu Thr Arg Leu Ala Lys Met Glu Asn Arg His Lys 50 55 60 Lys Gly Phe Gln Ala Cys Gly Asn Asn Leu Gln Val Asn Pro Asp Met 65 70 75 80 Pro Tyr Ala Gln Glu Phe Phe Ala Gly Leu His Gly Asn Phe Gln His 85 90 95 Ala Phe Ser Glu Gly Lys Val Val Thr Cys Leu Leu Ile Gln Ala Leu 100 105 110 Ile Ile Glu Ala Phe Ala Ile Ala Ala Tyr Asn Ile Tyr Ile Pro Val 115 120 125 Ala Asp Asp Phe Ala Arg Lys Ile Thr Glu Gly Val Val Lys Asp Glu 130 135 140 Tyr Thr His Leu Asn Tyr Gly Glu Glu Trp Leu Lys Ala Asn Phe Ala 145 150 155 160 Thr Ala Lys Glu Glu Leu Glu Gln Ala Asn Lys Glu Asn Leu Pro Leu 165 170 175 Val Trp Lys Met Leu Asn Gln Val Gln Gly Asp Ala Lys Val Leu Gly 180 185 190 Met Glu Lys Glu Ala Leu Val Glu Asp Phe Met Ile Ser Tyr Gly Glu 195 200 205 Ala Leu Ser Asn Ile Gly Phe Ser Thr Arg Glu Ile Met Arg Met Ser 210 215 220 Ser Tyr Gly Leu Ala Gly Val 225 230 92231PRTCyanothece sp. 92Met Gln Glu Leu Ala Leu Arg Ser Glu Leu Asp Phe Asn Ser Glu Thr 1 5 10 15 Tyr Lys Asp Ala Tyr Ser Arg Ile Asn Ala Ile Val Ile Glu Gly Glu 20 25 30 Gln Glu Ala Tyr Gln Asn Tyr Leu Asp Met Ala Gln Leu Leu Pro Glu 35 40 45 Asp Glu Ala Glu Leu Ile Arg Leu Ser Lys Met Glu Asn Arg His Lys 50 55 60 Lys Gly Phe Gln Ala Cys Gly Lys Asn Leu Asn Val Thr Pro Asp Met 65 70 75 80 Asp Tyr Ala Gln Gln Phe Phe Ala Glu Leu His Gly Asn Phe Gln Lys 85 90 95 Ala Lys Ala Glu Gly Lys Ile Val Thr Cys Leu Leu Ile Gln Ser Leu 100 105 110 Ile Ile Glu Ala Phe Ala Ile Ala Ala Tyr Asn Ile Tyr Ile Pro Val 115 120 125 Ala Asp Pro Phe Ala Arg Lys Ile Thr Glu Gly Val Val Lys Asp Glu 130 135 140 Tyr Thr His Leu Asn Phe Gly Glu Val Trp Leu Lys Glu His Phe Glu 145 150 155 160 Ala Ser Lys Ala Glu Leu Glu Asp Ala Asn Lys Glu Asn Leu Pro Leu 165 170 175 Val Trp Gln Met Leu Asn Gln Val Glu Lys Asp Ala Glu Val Leu Gly 180 185 190 Met Glu Lys Glu Ala Leu Val Glu Asp Phe Met Ile Ser Tyr Gly Glu 195 200 205 Ala Leu Ser Asn Ile Gly Phe Ser Thr Arg Glu Ile Met Lys Met Ser 210 215 220 Ala Tyr Gly Leu Arg Ala Ala 225 230 93231PRTCyanothece sp. 93Met Gln Glu Leu Ala Leu Arg Ser Glu Leu Asp Phe Asn Ser Glu Thr 1 5 10 15 Tyr Lys Asp Ala Tyr Ser Arg Ile Asn Ala Ile Val Ile Glu Gly Glu 20 25 30 Gln Glu Ala His Gln Asn Tyr Ile Asp Met Ala Gln Leu Leu Pro Glu 35 40 45 Asp Glu Ala Glu Leu Ile Arg Leu Ser Lys Met Glu Asn Arg His Lys 50 55 60 Lys Gly Phe Gln Ala Cys Gly Lys Asn Leu Asp Val Thr Pro Asp Met 65 70 75 80 Asp Tyr Ala Gln Gln Phe Phe Ser Gln Leu His Asn Asn Phe Gln Thr 85 90 95 Ala Lys Ala Glu Gly Lys Ile Val Thr Cys Leu Leu Ile Gln Ser Leu 100 105 110 Ile Ile Glu Ala Phe Ala Ile Ala Ala Tyr Asn Ile Tyr Ile Pro Val 115 120 125 Ala Asp Pro Phe Ala Arg Lys Ile Thr Glu Gly Val Val Lys Asp Glu 130 135 140 Tyr Thr His Leu Asn Phe Gly Glu Ile Trp Leu Lys Glu His Phe Glu 145 150 155 160 Ala Ser Lys Ala Glu Leu Glu Glu Ala Asn Lys Lys Asn Leu Pro Ile 165 170 175 Val Trp Gln Met Leu Asn Gln Val Glu Lys Asp Ala Glu Val Leu Gly 180 185 190 Met Glu Lys Glu Ala Leu Val Glu Asp Phe Met Ile Ser Tyr Gly Glu 195 200 205 Ala Leu Ser Asn Ile Gly Phe Ser Thr Arg Glu Ile Met Lys Met Ser 210 215 220 Ser His Gly Leu Ser Ala Ala 225 230 94231PRTCyanothece sp. 94Met Pro Gln Val Gln Ser Pro Ser Ala Ile Asp Phe Tyr Ser Glu Thr 1 5 10 15 Tyr Gln Asp Ala Tyr Ser Arg Ile Asp Ala Ile Val Ile Glu Gly Glu 20 25 30 Gln Glu Ala His Asp Asn Tyr Leu Lys Leu Thr Glu Leu Leu Pro Asp 35 40 45 Cys Gln Glu Asp Leu Val Arg Leu Ala Lys Met Glu Ala Arg His Lys 50 55 60 Lys Gly Phe Glu Ala Cys Gly Arg Asn Leu Lys Val Thr Pro Asp Met 65 70 75 80 Glu Phe Ala Gln Gln Phe Phe Ala Asp Leu His Asn Asn Phe Gln Lys 85 90 95 Ala Ala Ala Ala Asn Lys Ile Ala Thr Cys Leu Val Ile Gln Ala Leu 100 105 110 Ile Ile Glu Cys Phe Ala Ile Ala Ala Tyr Asn Ile Tyr Ile Pro Val 115 120 125 Ala Asp Asp Phe Ala Arg Lys Ile Thr Glu Asn Val Val Lys Asp Glu 130 135 140 Tyr Thr His Leu Asn Phe Gly Glu Glu Trp Leu Lys Ala Asn Phe Asp 145 150 155 160 Ser Gln Arg Glu Glu Val Glu Ala Ala Asn Arg Glu Asn Leu Pro Ile 165 170 175 Val Trp Arg Met Leu Asn Gln Val Glu Thr Asp Ala His Val Leu Gly 180 185 190 Met Glu Lys Glu Ala Leu Val Glu Ser Phe Met Ile Gln Tyr Gly Glu 195 200 205 Ala Leu Glu Asn Ile Gly Phe Ser Thr Arg Glu Ile Met Arg Met Ser 210 215 220 Val Tyr Gly Leu Ser Ala Ala 225 230 95232PRTNostoc punctiforme 95Met Gln Gln Leu Thr Asp Gln Ser Lys Glu Leu Asp Phe Lys Ser Glu 1 5 10 15 Thr Tyr Lys Asp Ala Tyr Ser Arg Ile Asn Ala Ile Val Ile Glu Gly 20 25 30 Glu Gln Glu Ala His Glu Asn Tyr Ile Thr Leu Ala Gln Leu Leu Pro 35 40 45 Glu Ser His Asp Glu Leu Ile Arg Leu Ser Lys Met Glu Ser Arg His 50 55 60 Lys Lys Gly Phe Glu Ala Cys Gly Arg Asn Leu Ala Val Thr Pro Asp 65 70 75 80 Leu Gln Phe Ala Lys Glu Phe Phe Ser Gly Leu His Gln Asn Phe Gln 85 90 95 Thr Ala Ala Ala Glu Gly Lys Val Val Thr Cys Leu Leu Ile Gln Ser 100 105 110 Leu Ile Ile Glu Cys Phe Ala Ile Ala Ala Tyr Asn Ile Tyr Ile Pro 115 120 125 Val Ala Asp Asp Phe Ala Arg Lys Ile Thr Glu Gly Val Val Lys Glu 130 135 140 Glu Tyr Ser His Leu Asn Phe Gly Glu Val Trp Leu Lys Glu His Phe 145 150 155 160 Ala Glu Ser Lys Ala Glu Leu Glu Leu Ala Asn Arg Gln Asn Leu Pro 165 170 175 Ile Val Trp Lys Met Leu Asn Gln Val Glu Gly Asp Ala His Thr Met 180 185 190 Ala Met Glu Lys Asp Ala Leu Val Glu Asp Phe Met Ile Gln Tyr Gly 195 200 205 Glu Ala Leu Ser Asn Ile Gly Phe Ser Thr Arg Asp Ile Met Arg Leu 210 215 220 Ser Ala Tyr Gly Leu Ile Gly Ala 225 230 96231PRTAcaryochloris marina 96Met Pro Gln Thr Gln Ala Ile Ser Glu Ile Asp Phe Tyr Ser Asp Thr 1 5 10 15 Tyr Lys Asp Ala Tyr Ser Arg Ile Asp Gly Ile Val Ile Glu Gly Glu 20 25 30 Gln Glu Ala His Glu Asn Tyr Ile Arg Leu Gly Glu Met Leu Pro Glu 35 40 45 His Gln Asp Asp Phe Ile Arg Leu Ser Lys Met Glu Ala Arg His Lys 50 55 60 Lys Gly Phe Glu Ala Cys Gly Arg Asn Leu Lys Val Thr Cys Asp Leu 65 70 75 80 Asp Phe Ala Arg Arg Phe Phe Ser Asp Leu His Lys Asn Phe Gln Asp 85 90 95 Ala Ala Ala Glu Asp Lys Val Pro Thr Cys Leu Val Ile Gln Ser Leu 100 105 110 Ile Ile Glu Cys Phe Ala Ile Ala Ala Tyr Asn Ile Tyr Ile Pro Val 115 120 125 Ala Asp Asp Phe Ala Arg Lys Ile Thr Glu Ser Val Val Lys Asp Glu 130 135 140 Tyr Gln His Leu Asn Tyr Gly Glu Glu Trp Leu Lys Ala His Phe Asp 145 150 155 160 Asp Val Lys Ala Glu Ile Gln Glu Ala Asn Arg Lys Asn Leu Pro Ile 165 170 175 Val Trp Arg Met Leu Asn Glu Val Asp Lys Asp Ala Ala Val Leu Gly 180 185 190 Met Glu Lys Glu Ala Leu Val Glu Asp Phe Met Ile Gln Tyr Gly Glu 195 200 205 Ala Leu Ser Asn Ile Gly Phe Ser Thr Gly Glu Ile Met Arg Met Ser 210 215 220 Ala Tyr Gly Leu Val Ala Ala 225 230 97231PRTCyanothece sp. 97Met Gln Glu Leu Val Gln Arg Ser Glu Leu Asp Phe Thr Asn Pro Thr 1 5 10 15 Tyr Lys Asp Ala Tyr Ser Arg Ile Asn Ala Ile Val Ile Glu Gly Glu 20 25 30 Gln Glu Ala His Gln Asn Tyr Ile Asp Met Ala Gln Leu Leu Pro Glu 35 40 45 His Gln Glu Glu Leu Ile Arg Leu Ser Lys Met Glu Asn Arg His Lys 50 55 60 Lys Gly Phe Glu Ala Cys Gly Asn Asn Leu Ser Val Thr Pro Asp Met 65 70 75 80 Gln Tyr Ala Gln Glu Phe Phe Ser Ser Leu His Gly Asn Phe Gln Lys 85 90 95 Ala Lys Ala Glu Gly Lys Ile Val Thr Cys Leu Leu Ile Gln Ser Leu 100 105 110 Ile Ile Glu Ala Phe Ala Ile Ala Ala Tyr Asn Ile Tyr Ile Pro Val 115 120 125 Ala Asp Pro Phe Ala Arg Lys Ile Thr Glu Gly Val Val Lys Asp Glu 130 135 140 Tyr Thr His Leu Asn Phe Gly Glu Val Trp Leu Gln Glu His Phe Glu 145 150 155 160 Glu Ser Lys Ala Glu Leu Glu Glu Ala Asn Lys Ala Asn Leu Pro Ile 165 170 175 Val Trp Glu Met Leu Asn Gln Val Glu Gly Asp Ala Lys Val Leu Gly 180 185 190 Met Glu Lys Glu Ala Leu Val Glu Asp Phe Met Ile Ser Tyr Gly Glu 195 200 205 Ala Leu Ser Asn Ile Gly Phe Ser Thr Arg Asp Ile Met Arg Met Ser 210 215 220 Ser His Gly Leu Val Ala

Ala 225 230 98231PRTCyanothece sp. 98Met Gln Glu Leu Val Gln Arg Ser Glu Leu Asp Phe Thr Asn Pro Thr 1 5 10 15 Tyr Lys Asp Ala Tyr Ser Arg Ile Asn Ala Ile Val Ile Glu Gly Glu 20 25 30 Gln Glu Ala His Gln Asn Tyr Ile Asp Met Ala Gln Leu Leu Pro Glu 35 40 45 His Gln Glu Glu Leu Ile Arg Leu Ser Lys Met Glu Asn Arg His Lys 50 55 60 Lys Gly Phe Glu Ala Cys Gly Asn Asn Leu Ser Val Thr Pro Asp Met 65 70 75 80 Gln Tyr Ala Gln Glu Phe Phe Ser Ser Leu His Gly Asn Phe Gln Lys 85 90 95 Ala Lys Ala Glu Gly Lys Ile Val Thr Cys Leu Leu Ile Gln Ser Leu 100 105 110 Ile Ile Glu Ala Phe Ala Ile Ala Ala Tyr Asn Ile Tyr Ile Pro Val 115 120 125 Ala Asp Pro Phe Ala Arg Lys Ile Thr Glu Gly Val Val Lys Asp Glu 130 135 140 Tyr Thr His Leu Asn Phe Gly Glu Val Trp Leu Gln Glu His Phe Glu 145 150 155 160 Glu Ser Lys Ala Glu Leu Glu Glu Ala Asn Lys Ala Asn Leu Pro Ile 165 170 175 Val Trp Glu Met Leu Asn Gln Val Glu Gly Asp Ala Lys Val Leu Gly 180 185 190 Met Glu Lys Glu Ala Leu Val Glu Asp Phe Met Ile Ser Tyr Gly Glu 195 200 205 Ala Leu Ser Asn Ile Gly Phe Ser Thr Arg Asp Ile Met Arg Met Ser 210 215 220 Ser His Gly Leu Val Ala Ala 225 230 99240PRTSynechococcus sp. 99Met Asn Val Leu Pro Asn Thr Pro Gln Pro Leu Ala Asp Glu Gly Gly 1 5 10 15 Thr Thr Leu Asp Tyr Gly Ser Ala Val Tyr Arg Gln Ala Tyr Ser Arg 20 25 30 Ile Asn Gly Ile Val Ile Glu Gly Glu Gln Glu Ala His Asp Asn Tyr 35 40 45 Leu Lys Leu Ala Glu Met Leu Pro Glu Gly Ala Glu Glu Leu His Lys 50 55 60 Leu Ala Lys Met Glu Leu Arg His Met Lys Gly Phe Gln Ser Cys Gly 65 70 75 80 Lys Asn Leu Gln Val Glu Pro Asp Arg Glu Phe Ala Arg Thr Phe Phe 85 90 95 Ala Pro Leu Arg Asn Asn Phe Gln Lys Ala Ala Ala Ala Gly Asp Leu 100 105 110 Val Thr Cys Leu Val Ile Gln Ser Leu Ile Ile Glu Cys Phe Ala Ile 115 120 125 Ala Ala Tyr Asn Ile Tyr Ile Pro Val Ala Asp Glu Phe Ala Arg Lys 130 135 140 Ile Thr Glu Gly Val Val Lys Asp Glu Tyr Leu His Leu Asn Phe Gly 145 150 155 160 Glu Arg Trp Leu Gly Glu His Phe Gly Glu Val Lys Gly Gln Ile Glu 165 170 175 Ala Ala Asn Ala Gln Asn Leu Pro Leu Val Trp Gln Met Leu Gln Gln 180 185 190 Val Asp Gln Asp Val Glu Ala Ile Tyr Met Asp Arg Glu Ala Ile Val 195 200 205 Glu Asp Phe Met Ile Ala Tyr Gly Glu Ala Leu Ala Asn Ile Gly Phe 210 215 220 Ser Thr Arg Glu Val Met Arg Leu Ser Ala Gln Gly Leu Arg Ala Ala 225 230 235 240 100241PRTSynechococcus sp. 100Met Ala Ser Ser Leu Leu Asp Pro Ala Val Asp Gly Thr Pro Val Leu 1 5 10 15 Asp Val Glu Leu Pro Asp Phe Thr Thr Glu Ala Tyr Lys Ser Ala Tyr 20 25 30 Ser Arg Ile Asn Ala Ile Val Ile Glu Gly Glu Gln Glu Ala His Asp 35 40 45 Asn Tyr Ile Ser Leu Gly Thr Leu Ile Pro Asp Gln Ala Asp Glu Leu 50 55 60 Ala Gln Leu Ala Arg Met Glu Met Lys His Met Lys Gly Phe Gln Ala 65 70 75 80 Cys Gly Lys Asn Leu Ser Val Glu Pro Asp Met Val Phe Ala Lys Glu 85 90 95 Phe Phe Ser Asp Leu His Gly Asn Phe Arg Ser Ala Leu Glu Glu Asn 100 105 110 Lys Val Val Thr Cys Leu Val Ile Gln Ala Leu Met Ile Glu Ala Phe 115 120 125 Ala Ile Ala Ala Tyr His Ile Tyr Ile Pro Val Ala Asp Pro Phe Ala 130 135 140 Arg Lys Ile Thr Glu Gly Val Val Lys Asp Glu Tyr Thr His Leu Asn 145 150 155 160 Tyr Gly Gln Glu Trp Leu Lys Ala Asn Phe Asp Ser Ser Arg Asp Glu 165 170 175 Ile Ile Glu Ala Asn Lys Ala Asn Leu Pro Ile Ile Arg Arg Met Leu 180 185 190 Glu Glu Val Ala Asp Asp Ala Ala Glu Leu Lys Met Glu Lys Glu Ser 195 200 205 Leu Ile Glu Asp Phe Leu Ile Ala Tyr Gln Glu Ala Leu Met Asp Ile 210 215 220 Gly Phe Asn Ser Arg Asp Leu Ala Arg Met Ser Ala Ala Ala Leu Val 225 230 235 240 Ala 101243PRTSynechococcus sp. 101Met Pro Thr Pro Val Thr Ser Glu Val Ala Val Leu Asp Gly Gln Ala 1 5 10 15 Gly Ser Ala Gln Ala Leu Pro Asp Phe Ser Ser Glu Ala Tyr Lys Asp 20 25 30 Ala Tyr Ser Arg Ile Asn Ala Ile Val Ile Glu Gly Glu Gln Glu Ala 35 40 45 His Asp Asn Tyr Ile Ser Leu Gly Thr Leu Ile Pro Glu Gln Ala Asp 50 55 60 Glu Leu Ala Arg Leu Ala Arg Met Glu Met Lys His Met Lys Gly Phe 65 70 75 80 Met Ser Cys Gly Arg Asn Leu Gly Val Glu Ala Asp Met Pro Phe Ala 85 90 95 Lys Glu Phe Phe Gly Pro Leu His Gly Asn Phe Gln Thr Ala Leu Lys 100 105 110 Glu Gly Lys Val Val Thr Cys Leu Leu Ile Gln Ala Leu Leu Ile Glu 115 120 125 Ala Phe Ala Ile Ser Ala Tyr His Ile Tyr Ile Pro Val Ala Asp Pro 130 135 140 Phe Ala Arg Lys Ile Thr Glu Gly Val Val Lys Asp Glu Tyr Thr His 145 150 155 160 Leu Asn Tyr Gly Gln Glu Trp Leu Lys Ala Asn Phe Glu Ala Ser Arg 165 170 175 Glu Glu Leu Met Glu Ala Asn Lys Val Asn Leu Pro Leu Ile Arg Ser 180 185 190 Met Leu Glu Gln Val Ala Lys Asp Ala Ala Val Leu Lys Met Glu Lys 195 200 205 Glu Asp Leu Ile Glu Asp Phe Leu Ile Ala Tyr Gln Glu Ala Leu Glu 210 215 220 Glu Ile Gly Phe Thr Ser Arg Asp Ile Ala Arg Met Ala Ala Ala Ala 225 230 235 240 Leu Ser Ile 102239PRTSynechococcus sp. 102Met Thr Thr Leu Asn Ala Pro Glu Ala Ala Val Val Glu Gly Leu Asp 1 5 10 15 Ala Leu Pro Asp Phe Thr Thr Glu Ala Tyr Lys Asp Ala Tyr Ser Arg 20 25 30 Ile Asn Ala Ile Val Ile Glu Gly Glu Gln Glu Ala His Asp Asn Tyr 35 40 45 Ile Ser Leu Gly Ser Leu Ile Pro Asp Gln Lys Asp Glu Leu Ala Lys 50 55 60 Leu Ala Arg Met Glu Met Lys His Met Lys Gly Phe Thr Ser Cys Gly 65 70 75 80 Arg Asn Leu Gly Val Glu Ala Asp Met Val Phe Ala Lys Lys Phe Phe 85 90 95 Glu Pro Leu His Gly Asn Phe Gln Ala Ala Leu Lys Glu Gly Lys Val 100 105 110 Val Thr Cys Leu Leu Ile Gln Ala Leu Leu Ile Glu Ala Phe Ala Ile 115 120 125 Ser Ala Tyr His Ile Tyr Ile Pro Val Ala Asp Pro Phe Ala Arg Lys 130 135 140 Ile Thr Glu Gly Val Val Lys Asp Glu Tyr Thr His Leu Asn Tyr Gly 145 150 155 160 Gln Glu Trp Leu Lys Ala Asn Phe Glu Ala Ser Lys Asp Glu Leu Phe 165 170 175 Glu Ala Asn Lys Ala Asn Leu Pro Leu Ile Arg Ser Met Leu Glu Glu 180 185 190 Val Ala Ser Asp Ala Ala Val Leu His Met Glu Lys Glu Asp Leu Ile 195 200 205 Glu Asp Phe Leu Ile Ala Tyr Gln Glu Ala Leu Gly Glu Ile Gly Phe 210 215 220 Thr Ser Arg Asp Ile Ala Arg Met Ala Ala Ala Ala Leu Ala Val 225 230 235 103243PRTSynechococcus sp. 103Met Pro Thr Pro Val Thr Ser Glu Val Ala Val Leu Asp Glu Gln Ala 1 5 10 15 Gly Ser Ala Ser Leu Leu Pro Asp Phe Ser Ser Glu Ala Tyr Lys Asp 20 25 30 Ala Tyr Ser Arg Ile Asn Ala Ile Val Ile Glu Gly Glu Gln Glu Ala 35 40 45 His Asp Asn Tyr Ile Ser Leu Gly Thr Leu Ile Pro Asp Gln Ala Asp 50 55 60 Glu Leu Ala Arg Leu Ala Arg Met Glu Met Lys His Met Lys Gly Phe 65 70 75 80 Thr Ser Cys Gly Arg Asn Leu Gly Val Asp Ala Asp Met Pro Phe Ala 85 90 95 Lys Thr Phe Phe Ala Pro Leu His Gly Asn Phe Gln Thr Ala Leu Lys 100 105 110 Asp Gly Lys Val Val Thr Cys Leu Leu Ile Gln Ala Leu Leu Ile Glu 115 120 125 Ala Phe Ala Ile Ser Ala Tyr His Ile Tyr Ile Pro Val Ala Asp Pro 130 135 140 Phe Ala Arg Lys Ile Thr Glu Gly Val Val Lys Asp Glu Tyr Thr His 145 150 155 160 Leu Asn Tyr Gly Gln Glu Trp Leu Lys Ala Asn Phe Asp Ala Ser Arg 165 170 175 Glu Glu Leu Met Glu Ala Asn Lys Val Asn Leu Pro Leu Ile Arg Ser 180 185 190 Met Leu Glu Gln Val Ala Glu Asp Ala Ala Val Leu Lys Met Glu Lys 195 200 205 Glu Asp Leu Ile Glu Asp Phe Leu Ile Ala Tyr Gln Glu Ala Leu Glu 210 215 220 Gln Ile Gly Phe Thr Ser Arg Asp Ile Ala Arg Met Ala Ala Ala Ala 225 230 235 240 Leu Ala Val 104239PRTSynechococcus sp. 104Met Thr Thr Leu Asn Ala Pro Glu Ala Ala Val Val Glu Gly Leu Asp 1 5 10 15 Ala Leu Pro Asp Phe Thr Thr Glu Ala Tyr Lys Asp Ala Tyr Ser Arg 20 25 30 Ile Asn Ala Ile Val Ile Glu Gly Glu Gln Glu Ala His Asp Asn Tyr 35 40 45 Ile Ser Leu Gly Thr Leu Ile Pro Asp Gln Lys Asp Glu Leu Ala Lys 50 55 60 Leu Ala Arg Met Glu Met Lys His Met Lys Gly Phe Thr Ser Cys Gly 65 70 75 80 Arg Asn Leu Gly Val Glu Ala Asp Leu Ala Phe Ala Lys Lys Phe Phe 85 90 95 Glu Pro Leu His Gly Asn Phe Gln Ala Ala Leu Lys Glu Gly Lys Val 100 105 110 Val Thr Cys Leu Leu Ile Gln Ala Leu Leu Ile Glu Ala Phe Ala Ile 115 120 125 Ser Ala Tyr His Ile Tyr Ile Pro Val Ala Asp Pro Phe Ala Arg Lys 130 135 140 Ile Thr Glu Gly Val Val Lys Asp Glu Tyr Thr His Leu Asn Tyr Gly 145 150 155 160 Gln Glu Trp Leu Lys Ala Asn Phe Glu Ala Ser Lys Asp Glu Leu Phe 165 170 175 Glu Ala Asn Lys Ala Asn Leu Pro Leu Ile Arg Ser Met Leu Glu Asp 180 185 190 Val Ala Ser Asp Ala Ala Val Leu His Met Glu Lys Glu Asp Leu Ile 195 200 205 Glu Asp Phe Leu Ile Ala Tyr Gln Glu Ala Leu Gly Glu Ile Gly Phe 210 215 220 Thr Ser Arg Asp Ile Ala Arg Met Ala Ala Ala Ala Leu Ala Val 225 230 235 105243PRTSynechococcus sp. 105Met Ala Pro Ala Asn Val Leu Pro Asn Thr Pro Pro Ser Pro Thr Asp 1 5 10 15 Gly Gly Gly Thr Ala Leu Asp Tyr Ser Ser Pro Arg Tyr Arg Gln Ala 20 25 30 Tyr Ser Arg Ile Asn Gly Ile Val Ile Glu Gly Glu Gln Glu Ala His 35 40 45 Asp Asn Tyr Leu Lys Leu Ala Glu Met Leu Pro Glu Ala Ala Glu Glu 50 55 60 Leu Arg Lys Leu Ala Lys Met Glu Leu Arg His Met Lys Gly Phe Gln 65 70 75 80 Ala Cys Gly Lys Asn Leu Gln Val Glu Pro Asp Val Glu Phe Ala Arg 85 90 95 Ala Phe Phe Ala Pro Leu Arg Asp Asn Phe Gln Ser Ala Ala Ala Ala 100 105 110 Gly Asp Leu Val Ser Cys Phe Val Ile Gln Ser Leu Ile Ile Glu Cys 115 120 125 Phe Ala Ile Ala Ala Tyr Asn Ile Tyr Ile Pro Val Ala Asp Asp Phe 130 135 140 Ala Arg Lys Ile Thr Glu Gly Val Val Lys Asp Glu Tyr Leu His Leu 145 150 155 160 Asn Phe Gly Glu Arg Trp Leu Gly Glu His Phe Ala Glu Val Lys Ala 165 170 175 Gln Ile Glu Ala Ala Asn Ala Gln Asn Leu Pro Leu Val Arg Gln Met 180 185 190 Leu Gln Gln Val Glu Ala Asp Val Glu Ala Ile Tyr Met Asp Arg Glu 195 200 205 Ala Ile Val Glu Asp Phe Met Ile Ala Tyr Gly Glu Ala Leu Ala Ser 210 215 220 Ile Gly Phe Asn Thr Arg Glu Val Met Arg Leu Ser Ala Gln Gly Leu 225 230 235 240 Arg Ala Ala 106239PRTSynechococcus sp. 106Met Thr Thr Leu Asn Ala Pro Glu Ala Ala Val Val Glu Gly Leu Asp 1 5 10 15 Ala Leu Pro Asp Phe Thr Thr Glu Ala Tyr Lys Asp Ala Tyr Ser Arg 20 25 30 Ile Asn Ala Ile Val Ile Glu Gly Glu Gln Glu Ala His Asp Asn Tyr 35 40 45 Ile Ser Leu Gly Ser Leu Ile Pro Asp Gln Lys Asp Glu Leu Ala Lys 50 55 60 Leu Ala Arg Met Glu Met Lys His Met Lys Gly Phe Thr Ser Cys Gly 65 70 75 80 Arg Asn Leu Gly Val Glu Ala Asp Met Val Phe Ala Lys Thr Phe Phe 85 90 95 Glu Pro Leu His Gly Asn Phe Gln Ala Ala Leu Lys Glu Gly Lys Val 100 105 110 Val Thr Cys Leu Leu Ile Gln Ala Leu Leu Ile Glu Ala Phe Ala Ile 115 120 125 Ser Ala Tyr His Ile Tyr Ile Pro Val Ala Asp Pro Phe Ala Arg Lys 130 135 140 Ile Thr Glu Gly Val Val Lys Asp Glu Tyr Thr His Leu Asn Tyr Gly 145 150 155 160 Gln Glu Trp Leu Lys Ala Asn Phe Glu Ala Ser Lys Asp Glu Leu Phe 165 170 175 Glu Ala Asn Lys Ala Asn Leu Pro Leu Ile Arg Ser Met Leu Glu Glu 180 185 190 Val Ala Ser Asp Ala Ala Val Leu His Met Glu Lys Glu Asp Leu Ile 195 200 205 Glu Asp Phe Leu Ile Ala Tyr Gln Glu Ala Leu Gly Glu Ile Gly Phe 210 215 220 Thr Ser Arg Asp Ile Ala Arg Met Ala Ala Ala Ala Leu Ala Val 225 230 235 107239PRTSynechococcus sp. 107Met Thr Thr Leu Asn Ala Pro Glu Ala Ser Val Met Glu Gly Gln Asp 1 5 10 15 Ala Leu Pro Asp Phe Thr Thr Glu Ala Tyr Lys Asp Ala Tyr Ser Arg 20 25 30 Ile Asn Ala Ile Val Ile Glu Gly Glu Gln Glu Ala His Asp Asn Tyr 35 40 45 Ile Ser Leu Gly Thr Leu Ile Pro Asp Gln Ala Glu Glu Leu Ala Arg 50 55 60 Leu Ala Arg Met Glu Met Lys His Met Lys Gly Phe Thr Ser Cys Gly 65 70 75 80 Arg Asn Leu Gly Val Gln Ala Asp Met Ala Phe Ala Arg Lys Phe Phe 85 90 95 Glu Pro Leu His Gly Asn Phe Gln Ser Ala Leu Lys Glu Gly Lys Val 100 105 110 Val

Thr Cys Leu Leu Ile Gln Ala Leu Leu Ile Glu Ala Phe Ala Ile 115 120 125 Ser Ala Tyr His Ile Tyr Ile Pro Val Ala Asp Pro Phe Ala Arg Lys 130 135 140 Ile Thr Glu Gly Val Val Lys Asp Glu Tyr Thr His Leu Asn Tyr Gly 145 150 155 160 Gln Glu Trp Leu Lys Ala Asn Phe Glu Ala Ser Lys Glu Glu Leu Phe 165 170 175 Glu Ala Asn Lys Ala Asn Leu Pro Leu Ile Arg Ser Met Leu Glu Asp 180 185 190 Val Ala Ala Asp Ala Ala Val Leu His Met Glu Lys Glu Asp Leu Ile 195 200 205 Glu Asp Phe Leu Ile Ala Tyr Asn Glu Ala Leu Ser Glu Ile Gly Phe 210 215 220 Ser Ser Arg Asp Ile Ala Arg Met Ala Ala Ala Ala Leu Ala Leu 225 230 235 108242PRTSynechococcus sp. 108Met Pro Thr Leu Asp Ser Thr Leu Val Ala Val Leu Asp Asp Gln Gln 1 5 10 15 Gly Leu Ala Glu Leu Pro Asp Phe Thr Thr Asp Ala Tyr Lys Asp Ala 20 25 30 Tyr Ser Arg Ile Asn Ala Ile Val Ile Glu Gly Glu Lys Glu Ala His 35 40 45 Asp Asn Tyr Leu Ser Leu Gly Thr Leu Ile Pro Glu Gln Ala Glu Glu 50 55 60 Leu Ala Lys Leu Ala Lys Met Glu Met Lys His Met Lys Gly Phe Thr 65 70 75 80 Ala Cys Ala Lys Asn Leu Asp Val Val Ala Asp Met Pro Phe Ala Gln 85 90 95 Glu Phe Phe Ala Pro Leu His Gly Asn Phe Gln Ser Ala Leu Lys Glu 100 105 110 Gly Lys Val Val Thr Cys Leu Leu Ile Gln Ala Leu Leu Ile Glu Ala 115 120 125 Phe Ala Ile Ser Ala Tyr His Ile Tyr Ile Pro Val Ala Asp Pro Phe 130 135 140 Ala Arg Lys Ile Thr Glu Gly Val Val Lys Asp Glu Tyr Thr His Leu 145 150 155 160 Asn Tyr Gly Gln Glu Trp Leu Lys Ala Asn Phe Glu Ala Ser Arg Asp 165 170 175 Glu Leu Met Glu Ala Asn Lys Val Asn Leu Pro Leu Ile Arg Ser Met 180 185 190 Leu Glu Gln Val Ala Ala Asp Ala Ser Val Leu His Met Glu Lys Glu 195 200 205 Asp Leu Ile Glu Asp Phe Leu Ile Ala Tyr Gln Glu Ala Leu Asn Glu 210 215 220 Ile Gly Phe Ser Ser Arg Asp Ile Ala Arg Met Ala Ala Ala Ala Leu 225 230 235 240 Ser Ile 109239PRTSynechococcus sp. 109Met Thr Thr Leu Asn Ala Pro Asp Ala Ala Val Val Glu Gly Leu Asp 1 5 10 15 Ala Leu Pro Asp Phe Thr Thr Glu Ala Tyr Lys Asp Ala Tyr Ser Arg 20 25 30 Ile Asn Ala Ile Val Ile Glu Gly Glu Gln Glu Ala His Asp Asn Tyr 35 40 45 Ile Ala Leu Gly Thr Leu Ile Pro Asp Gln Lys Asp Glu Leu Ala Arg 50 55 60 Leu Ala Arg Met Glu Met Lys His Met Lys Gly Phe Thr Ser Cys Gly 65 70 75 80 Arg Asn Leu Gly Val Lys Ala Asp Met Val Phe Ala Lys Thr Phe Phe 85 90 95 Glu Pro Leu His Arg Asn Phe Gln Ser Ala Leu Gln Glu Gly Lys Val 100 105 110 Val Thr Cys Leu Leu Ile Gln Ala Leu Leu Ile Glu Ala Phe Ala Ile 115 120 125 Ser Ala Tyr His Ile Tyr Ile Pro Val Ala Asp Pro Phe Ala Arg Lys 130 135 140 Ile Thr Glu Gly Val Val Lys Asp Glu Tyr Thr His Leu Asn Tyr Gly 145 150 155 160 Gln Glu Trp Leu Lys Ala Asn Phe Glu Ala Ser Lys Asp Glu Leu Phe 165 170 175 Glu Ala Asn Lys Ala Asn Leu Pro Leu Ile Arg Ser Met Leu Asp Asp 180 185 190 Val Ala Gly Asp Ala Ala Val Leu His Met Glu Lys Glu Asp Leu Ile 195 200 205 Glu Asp Phe Leu Ile Ala Tyr Gln Glu Ala Leu Gly Glu Ile Gly Phe 210 215 220 Thr Ser Arg Asp Ile Ala Arg Met Ala Ala Ala Ala Leu Ala Val 225 230 235 110253PRTSynechococcus sp. 110Met Pro Ser Leu Glu Thr Thr Ile Ala Ala Ser Glu Thr Ala Ser Ala 1 5 10 15 Ser Ala Ser Met Ala Val Gly Gly Ser Val Glu Gln Asp Leu Gly Leu 20 25 30 Pro Asp Phe Ser Ser Ser Thr Tyr Lys Asp Ala Tyr Ser Arg Ile Asn 35 40 45 Ala Ile Val Ile Glu Gly Glu Gln Glu Ala His Asp Asn Tyr Ile Ser 50 55 60 Leu Gly His Leu Ile Pro Asp Gln Ala Glu Glu Leu Glu Arg Leu Ala 65 70 75 80 Arg Met Glu Leu Lys His Lys Lys Gly Phe Thr Ala Cys Ala Lys Asn 85 90 95 Leu Ser Val Ile Ala Asp Met Asp Phe Ala Lys Glu Phe Phe Ser Pro 100 105 110 Leu His Gly Asn Phe Gln Ala Ala Leu Ala Glu Gly Lys Val Val Thr 115 120 125 Cys Leu Leu Ile Gln Ala Ile Leu Ile Glu Ala Phe Ala Ile Ser Ala 130 135 140 Tyr His Ile Tyr Ile Pro Val Ala Asp Pro Phe Ala Arg Lys Ile Thr 145 150 155 160 Glu Gly Val Val Lys Asp Glu Tyr Thr His Leu Asn Tyr Gly Gln Glu 165 170 175 Trp Leu Lys Ala Asn Leu Glu Ser Ser Arg Gly Glu Leu Glu Gln Ala 180 185 190 Asn Arg Val Asn Leu Pro Leu Val Arg Lys Met Leu Glu Gln Val Ala 195 200 205 Gly Asp Ala Ala Val Leu His Met Asp Gln Glu Asp Leu Met Ala Asp 210 215 220 Phe Met Thr Ser Tyr Gln Glu Ala Leu Thr Asp Ile Gly Phe Thr Thr 225 230 235 240 Arg Glu Ile Ala Lys Met Ala Thr Ala Ala Leu Leu Gly 245 250 111235PRTGloeobacter violaceus 111Met Asn Arg Thr Ala Pro Ser Ser Ala Ala Leu Asp Tyr Arg Ser Asp 1 5 10 15 Thr Tyr Arg Asp Ala Tyr Ser Arg Ile Asn Ala Ile Val Leu Glu Gly 20 25 30 Glu Arg Glu Ala His Ala Asn Tyr Leu Thr Leu Ala Glu Met Leu Pro 35 40 45 Asp His Ala Glu Ala Leu Lys Lys Leu Ala Ala Met Glu Asn Arg His 50 55 60 Phe Lys Gly Phe Gln Ser Cys Ala Arg Asn Leu Glu Val Thr Pro Asp 65 70 75 80 Asp Pro Phe Ala Arg Ala Tyr Phe Glu Gln Leu Asp Gly Asn Phe Gln 85 90 95 Gln Ala Ala Ala Glu Gly Asp Leu Thr Thr Cys Met Val Ile Gln Ala 100 105 110 Leu Ile Ile Glu Cys Phe Ala Ile Ala Ala Tyr Asn Val Tyr Ile Pro 115 120 125 Val Ala Asp Ala Phe Ala Arg Lys Val Thr Glu Gly Val Val Lys Asp 130 135 140 Glu Tyr Thr His Leu Asn Phe Gly Gln Gln Trp Leu Lys Glu Arg Phe 145 150 155 160 Val Thr Val Arg Glu Gly Ile Glu Arg Ala Asn Ala Gln Asn Leu Pro 165 170 175 Ile Val Trp Arg Met Leu Asn Ala Val Glu Ala Asp Thr Glu Val Leu 180 185 190 Gln Met Asp Lys Glu Ala Ile Val Glu Asp Phe Met Ile Ala Tyr Gly 195 200 205 Glu Ala Leu Gly Asp Ile Gly Phe Ser Met Arg Asp Val Met Lys Met 210 215 220 Ser Ala Arg Gly Leu Ala Ser Ala Pro Arg Gln 225 230 235 112243PRTSynechococcus sp. 112Met Pro Thr Leu Asn Ser Pro Glu Val Ala Ala Ile Ser Asp Gln Asp 1 5 10 15 Gly Ser Ala Ser Gln Leu Pro Asp Phe Ser Ser Ala Ala Tyr Lys Asp 20 25 30 Ala Tyr Ser Arg Ile Asn Ala Ile Val Ile Glu Gly Glu Gln Glu Ala 35 40 45 His Asp Asn Tyr Ile Ser Leu Gly Thr Leu Ile Pro Asp Gln Ala Asp 50 55 60 Glu Leu Lys Gly Leu Ala Arg Met Glu Met Lys His Met Lys Gly Phe 65 70 75 80 Thr Ala Cys Gly Asn Asn Leu Gly Val Thr Ala Asp Met Asp Phe Ala 85 90 95 Arg Thr Phe Phe Ala Pro Leu His Gly Asn Phe Gln Lys Ala Met Lys 100 105 110 Glu Gly Lys Val Val Thr Cys Leu Leu Ile Gln Ala Leu Leu Ile Glu 115 120 125 Ala Phe Ala Ile Ser Ala Tyr His Ile Tyr Ile Pro Val Ala Asp Pro 130 135 140 Phe Ala Arg Lys Ile Thr Glu Gly Val Val Lys Asp Glu Tyr Thr His 145 150 155 160 Leu Asn Tyr Gly Gln Glu Trp Leu Lys Ala Asn Phe Glu Ala Ser Lys 165 170 175 Asp Glu Leu Met Glu Ala Asn Lys Val Asn Leu Pro Leu Ile Arg Ser 180 185 190 Met Leu Glu Glu Val Ala Lys Asp Ala Ala Val Leu His Met Glu Lys 195 200 205 Glu Asp Leu Ile Glu Asp Phe Leu Ile Ala Tyr Gln Glu Ala Leu Asn 210 215 220 Glu Ile Gly Phe Ser Ser Arg Asp Ile Ala Arg Met Ala Ala Ala Ala 225 230 235 240 Leu Ala Val 113243PRTSynechococcus sp. 113Met Pro Thr Leu Glu Thr Ser Glu Val Ala Val Leu Glu Asp Ser Met 1 5 10 15 Ala Ser Gly Ser Arg Leu Pro Asp Phe Thr Ser Glu Ala Tyr Lys Asp 20 25 30 Ala Tyr Ser Arg Ile Asn Ala Ile Val Ile Glu Gly Glu Gln Glu Ala 35 40 45 His Asp Asn Tyr Ile Ala Leu Gly Thr Leu Ile Pro Glu Gln Lys Asp 50 55 60 Glu Leu Ala Arg Leu Ala Arg Met Glu Met Lys His Met Lys Gly Phe 65 70 75 80 Thr Ser Cys Gly Arg Asn Leu Gly Val Glu Ala Asp Leu Pro Phe Ala 85 90 95 Lys Glu Phe Phe Ala Pro Leu His Gly Asn Phe Gln Ala Ala Leu Gln 100 105 110 Glu Gly Lys Val Val Thr Cys Leu Leu Ile Gln Ala Leu Leu Ile Glu 115 120 125 Ala Phe Ala Ile Ser Ala Tyr His Ile Tyr Ile Pro Val Ala Asp Pro 130 135 140 Phe Ala Arg Lys Ile Thr Glu Gly Val Val Lys Asp Glu Tyr Thr His 145 150 155 160 Leu Asn Tyr Gly Gln Glu Trp Leu Lys Ala Asn Phe Glu Ala Ser Lys 165 170 175 Asp Glu Leu Met Glu Ala Asn Lys Ala Asn Leu Pro Leu Ile Arg Ser 180 185 190 Met Leu Glu Gln Val Ala Ala Asp Ala Ala Val Leu Gln Met Glu Lys 195 200 205 Glu Asp Leu Ile Glu Asp Phe Leu Ile Ala Tyr Gln Glu Ala Leu Cys 210 215 220 Glu Ile Gly Phe Ser Ser Arg Asp Ile Ala Arg Met Ala Ala Ala Ala 225 230 235 240 Leu Ala Val 114239PRTSynechococcus sp. 114Met Thr Thr Leu Asn Ala Pro Glu Ala Pro Val Leu Glu Gly Gln Asp 1 5 10 15 Ala Leu Pro Asp Phe Thr Thr Ala Ala Tyr Lys Asp Ala Tyr Ser Arg 20 25 30 Ile Asn Ala Ile Val Ile Glu Gly Glu Gln Glu Ala His Asp Asn Tyr 35 40 45 Ile Ser Leu Gly Thr Leu Ile Pro Glu Gln Ala Glu Glu Leu Lys Arg 50 55 60 Leu Ala Arg Met Glu Met Lys His Met Lys Gly Phe Thr Ser Cys Gly 65 70 75 80 Arg Asn Leu Gly Val Glu Ala Asp Leu Pro Phe Ala Lys Lys Phe Phe 85 90 95 Glu Pro Leu His Gly Asn Phe Gln Ala Ala Leu Lys Glu Gly Lys Val 100 105 110 Val Thr Cys Leu Leu Ile Gln Ala Leu Leu Ile Glu Ala Phe Ala Ile 115 120 125 Ser Ala Tyr His Ile Tyr Ile Pro Val Ala Asp Pro Phe Ala Arg Lys 130 135 140 Ile Thr Glu Gly Val Val Lys Asp Glu Tyr Thr His Leu Asn Tyr Gly 145 150 155 160 Gln Glu Trp Leu Lys Ala Asn Phe Glu Ala Ser Lys Asn Glu Leu Phe 165 170 175 Glu Ala Asn Lys Ala Asn Leu Pro Leu Ile Arg Ser Met Leu Glu Asp 180 185 190 Val Ala Ala Asp Ala Ala Val Leu His Met Glu Lys Glu Asp Leu Ile 195 200 205 Glu Asp Phe Leu Ile Ala Tyr Gln Glu Ala Leu Gly Glu Ile Gly Phe 210 215 220 Thr Ser Arg Asp Ile Ala Arg Met Ala Ala Ala Ala Leu Ala Val 225 230 235 115243PRTProchlorococcus marinus 115Met Pro Thr Leu Glu Met Pro Glu Ala Ala Val Leu Asp Ser Thr Val 1 5 10 15 Gly Ser Ser Glu Ala Leu Pro Asp Phe Thr Ser Asp Ala Tyr Lys Asp 20 25 30 Ala Tyr Ser Arg Ile Asn Ala Ile Val Ile Glu Gly Glu Gln Glu Ala 35 40 45 His Asp Asn Tyr Ile Ala Ile Gly Thr Leu Leu Pro Asp His Val Glu 50 55 60 Glu Leu Lys Arg Leu Ala Lys Met Glu Met Arg His Lys Lys Gly Phe 65 70 75 80 Thr Ala Cys Gly Lys Asn Leu Gly Val Thr Ala Asp Met Asp Phe Ala 85 90 95 Arg Glu Phe Phe Ala Pro Leu Arg Asp Asn Phe Gln Thr Ala Leu Glu 100 105 110 Gln Gly Lys Thr Pro Thr Cys Leu Leu Ile Gln Ala Leu Leu Ile Glu 115 120 125 Ala Phe Ala Ile Ser Ala Tyr His Thr Tyr Ile Pro Val Ser Asp Pro 130 135 140 Phe Ala Arg Lys Ile Thr Glu Gly Val Val Lys Asp Glu Tyr Thr His 145 150 155 160 Leu Asn Tyr Gly Glu Ala Trp Leu Lys Ala Asn Leu Glu Ser Cys Arg 165 170 175 Glu Glu Leu Leu Glu Ala Asn Arg Glu Asn Leu Pro Leu Ile Arg Arg 180 185 190 Met Leu Asp Gln Val Ala Gly Asp Ala Ala Val Leu Gln Met Asp Lys 195 200 205 Glu Asp Leu Ile Glu Asp Phe Leu Ile Ala Tyr Gln Glu Ser Leu Thr 210 215 220 Glu Ile Gly Phe Asn Thr Arg Glu Ile Thr Arg Met Ala Ala Ala Ala 225 230 235 240 Leu Val Ser 116249PRTCyanobium sp. 116Met Ala Ser Val Ala His Pro Ala Val Ala Val Gln Pro Ala Thr Lys 1 5 10 15 Pro Ala Asp Thr Ala Ala Glu Arg Gly Asp Gly Leu Pro Asp Phe Ser 20 25 30 Ser Asp Thr Tyr Lys Asp Ala Tyr Ser Arg Ile Asn Ala Ile Val Ile 35 40 45 Glu Gly Glu Gln Glu Ala His Asp Asn Tyr Ile Ala Leu Gly Thr Leu 50 55 60 Ile Pro Asp Gln Ala Asp Glu Leu Ala Lys Leu Ala Arg Met Glu Leu 65 70 75 80 Lys His Met Lys Gly Phe Thr Ala Cys Ala Asn Asn Leu Gly Val Thr 85 90 95 Ala Asp Met Pro Phe Ala Lys Glu Phe Phe Ala Pro Leu His Gly Asn 100 105 110 Phe Gln Arg Ala Leu Ala Glu Gly Lys Val Thr Thr Cys Leu Leu Ile 115 120 125 Gln Ala Ile Leu Ile Glu Ala Phe Ala Ile Ser Ala Tyr His Ile Tyr 130 135 140 Ile Pro Val Ala Asp Pro Phe Ala Arg Arg Ile Thr Glu Gly Val Val 145 150 155 160 Lys Asp Glu Tyr Thr His Leu Asn Tyr Gly Gln Glu Trp Leu Lys Ala 165 170 175 Asn Leu Ala Asp Val Arg Glu Glu Leu Glu Gln Ala Asn Arg Glu Asn 180 185 190 Leu Pro Leu Val Arg Lys Met Leu Glu Gln Val Ala Gly Asp Ala Ala 195 200 205 Val Leu Gln Met Asp Lys Glu

Asp Leu Met Ala Asp Phe Leu Ser Ser 210 215 220 Tyr Gln Glu Ala Leu Met Asp Ile Gly Phe Thr Gly Arg Glu Ile Ala 225 230 235 240 Lys Leu Ala Ala Ala Ala Leu Val Gly 245 117243PRTProchlorococcus marinus 117Met Pro Thr Leu Glu Met Pro Val Ala Ala Val Leu Asp Ser Thr Val 1 5 10 15 Gly Ser Ser Glu Ala Leu Pro Asp Phe Thr Ser Asp Arg Tyr Lys Asp 20 25 30 Ala Tyr Ser Arg Ile Asn Ala Ile Val Ile Glu Gly Glu Gln Glu Ala 35 40 45 His Asp Asn Tyr Ile Ala Ile Gly Thr Leu Leu Pro Asp His Val Glu 50 55 60 Glu Leu Lys Arg Leu Ala Lys Met Glu Met Arg His Lys Lys Gly Phe 65 70 75 80 Thr Ala Cys Gly Lys Asn Leu Gly Val Glu Ala Asp Met Asp Phe Ala 85 90 95 Arg Glu Phe Phe Ala Pro Leu Arg Asp Asn Phe Gln Thr Ala Leu Gly 100 105 110 Gln Gly Lys Thr Pro Thr Cys Leu Leu Ile Gln Ala Leu Leu Ile Glu 115 120 125 Ala Phe Ala Ile Ser Ala Tyr His Thr Tyr Ile Pro Val Ser Asp Pro 130 135 140 Phe Ala Arg Lys Ile Thr Glu Gly Val Val Lys Asp Glu Tyr Thr His 145 150 155 160 Leu Asn Tyr Gly Glu Ala Trp Leu Lys Ala Asn Leu Glu Ser Cys Arg 165 170 175 Glu Glu Leu Leu Glu Ala Asn Arg Glu Asn Leu Pro Leu Ile Arg Arg 180 185 190 Met Leu Asp Gln Val Ala Gly Asp Ala Ala Val Leu Gln Met Asp Lys 195 200 205 Glu Asp Leu Ile Glu Asp Phe Leu Ile Ala Tyr Gln Glu Ser Leu Thr 210 215 220 Glu Ile Gly Phe Asn Thr Arg Glu Ile Thr Arg Met Ala Ala Ala Ala 225 230 235 240 Leu Val Ser 118239PRTSynechococcus sp. 118Met Pro Thr Leu Asn Ala Pro Glu Val Ser Val Leu Glu Gly Gln Asp 1 5 10 15 Ala Leu Pro Asp Phe Thr Thr Ala Glu Tyr Lys Asp Ala Tyr Ser Arg 20 25 30 Ile Asn Ala Ile Val Ile Glu Gly Glu Gln Glu Ala His Asp Asn Tyr 35 40 45 Ile Ser Leu Gly Thr Leu Ile Pro Glu Gln Ala Asp Glu Leu Ser Arg 50 55 60 Leu Ala Arg Met Glu Met Lys His Met Lys Gly Phe Thr Ala Cys Ala 65 70 75 80 Arg Asn Leu Gly Val Glu Ala Asp Met Pro Phe Ala Lys Asp Phe Phe 85 90 95 Gly Pro Leu His Gly Asn Phe Gln Val Ala Leu Lys Glu Gly Lys Val 100 105 110 Val Thr Cys Leu Leu Ile Gln Ala Leu Leu Ile Glu Ala Phe Ala Ile 115 120 125 Ser Ala Tyr His Ile Tyr Ile Pro Val Ala Asp Pro Phe Ala Arg Lys 130 135 140 Ile Thr Glu Gly Val Val Lys Asp Glu Tyr Thr His Leu Asn Tyr Gly 145 150 155 160 Gln Glu Trp Leu Lys Ala Asn Phe Glu Ala Ser Lys Asp Glu Met Phe 165 170 175 Ala Ala Asn Lys Ala Asn Leu Pro Leu Ile Arg Ser Met Leu Glu Gly 180 185 190 Val Ala Ala Asp Ala Ala Val Leu His Met Glu Lys Glu Asp Leu Ile 195 200 205 Glu Asp Phe Leu Ile Ala Tyr Gln Glu Ala Leu Asn Glu Ile Gly Phe 210 215 220 Ser Ser Arg Asp Ile Ala Lys Met Ala Ala Ala Ala Leu Ala Ile 225 230 235 119251PRTProchlorococcus marinus 119Met His Asn Glu Leu Lys Ile Thr Asp Met Gln Thr Leu Glu Ser Asn 1 5 10 15 Lys Lys Thr Ile Glu Glu Ser Thr Asn Ser Ile Ser Leu Asp Leu Pro 20 25 30 Asp Phe Thr Thr Asp Ser Tyr Lys Asp Ala Tyr Ser Arg Ile Asn Ala 35 40 45 Ile Val Ile Glu Gly Glu Gln Glu Ala His Asp Asn Tyr Ile Ser Ile 50 55 60 Ala Thr Leu Ile Pro Asn Glu Leu Glu Glu Leu Thr Lys Leu Ala Arg 65 70 75 80 Met Glu Met Lys His Lys Lys Gly Phe Thr Ala Cys Gly Arg Asn Leu 85 90 95 Asp Val Val Ala Asp Met Glu Phe Ala Lys Lys Phe Phe Ser Lys Leu 100 105 110 His Gly Asn Phe Gln Val Ala Leu Lys Lys Gly Asn Val Thr Thr Cys 115 120 125 Leu Leu Ile Gln Ala Ile Leu Ile Glu Ala Phe Ala Ile Ser Ala Tyr 130 135 140 Asn Val Tyr Ile Arg Val Ala Asp Pro Phe Ala Lys Lys Ile Thr Glu 145 150 155 160 Gly Val Val Lys Asp Glu Tyr Leu His Leu Asn Tyr Gly Gln Gln Trp 165 170 175 Leu Lys Glu Asn Leu Ser Thr Cys Lys Asp Glu Leu Met Glu Ala Asn 180 185 190 Lys Val Asn Leu Pro Leu Ile Lys Lys Met Leu Asp Glu Val Ala Asp 195 200 205 Asp Ala Ser Val Leu Ala Met Asp Arg Glu Glu Leu Met Glu Glu Phe 210 215 220 Met Ile Ala Tyr Gln Asp Thr Leu Met Glu Ile Gly Leu Asp Asn Arg 225 230 235 240 Glu Ile Ala Arg Met Ala Met Ala Ala Ile Val 245 250 120229PRTSynechococcus sp. 120Met Leu Glu Gly Gln Asp Ala Leu Pro Asp Phe Thr Thr Ala Glu Tyr 1 5 10 15 Lys Asp Ala Tyr Ser Arg Ile Asn Ala Ile Val Ile Glu Gly Glu Gln 20 25 30 Glu Ala His Asp Asn Tyr Ile Ser Leu Gly Thr Leu Ile Pro Glu Gln 35 40 45 Ala Glu Glu Leu Ser Arg Leu Ala Arg Met Glu Met Lys His Met Lys 50 55 60 Gly Phe Thr Ala Cys Ala Arg Asn Leu Gly Val Glu Ala Asp Met Pro 65 70 75 80 Phe Ala Lys Glu Phe Phe Gly Pro Leu His Gly Asn Phe Gln Val Ala 85 90 95 Leu Lys Glu Gly Lys Val Val Thr Cys Leu Leu Ile Gln Ala Leu Leu 100 105 110 Ile Glu Ala Phe Ala Ile Ser Ala Tyr His Ile Tyr Ile Pro Val Ala 115 120 125 Asp Pro Phe Ala Arg Lys Ile Thr Glu Gly Val Val Lys Asp Glu Tyr 130 135 140 Thr His Leu Asn Tyr Gly Gln Glu Trp Leu Lys Ala Asn Phe Glu Ala 145 150 155 160 Ser Lys Asp Glu Met Phe Ala Ala Asn Lys Ala Asn Leu Pro Leu Ile 165 170 175 Arg Ser Met Leu Glu Gly Val Ala Ala Asp Ala Ala Val Leu His Met 180 185 190 Glu Lys Glu Asp Leu Ile Glu Asp Phe Leu Ile Ala Tyr Gln Glu Ala 195 200 205 Leu Asn Glu Ile Gly Phe Ser Ser Arg Asp Ile Ala Lys Met Ala Ala 210 215 220 Ala Ala Leu Ala Ile 225 121251PRTProchlorococcus marinus 121Met His Asn Glu Leu Lys Ile Thr Asp Met Gln Thr Leu Glu Ser Asn 1 5 10 15 Lys Lys Thr Ile Glu Glu Ser Ile Asn Pro Ile Ser Leu Asp Leu Pro 20 25 30 Asp Phe Thr Thr Asp Ser Tyr Lys Asp Ala Tyr Ser Arg Ile Asn Ala 35 40 45 Ile Val Ile Glu Gly Glu Gln Glu Ala His Asp Asn Tyr Ile Ser Ile 50 55 60 Ala Thr Leu Ile Pro Asn Glu Val Glu Glu Leu Thr Lys Leu Ala Arg 65 70 75 80 Met Glu Met Lys His Lys Lys Gly Phe Thr Ala Cys Gly Arg Asn Leu 85 90 95 Gly Val Val Ala Asp Met Asp Phe Ala Lys Lys Phe Phe Ser Lys Leu 100 105 110 His Gly Asn Phe Gln Val Ala Leu Glu Lys Gly Asn Leu Thr Thr Cys 115 120 125 Leu Leu Ile Gln Ala Ile Leu Ile Glu Ala Phe Ala Ile Ser Ala Tyr 130 135 140 Asn Val Tyr Ile Arg Val Ala Asp Pro Phe Ala Lys Lys Ile Thr Glu 145 150 155 160 Gly Val Val Lys Asp Glu Tyr Leu His Leu Asn Tyr Gly Gln Glu Trp 165 170 175 Leu Lys Glu Asn Leu Ser Thr Cys Lys Glu Glu Leu Met Glu Ala Asn 180 185 190 Lys Val Asn Leu Pro Leu Ile Lys Lys Met Leu Asp Glu Val Ala Asp 195 200 205 Asp Ala Ser Val Leu Ala Met Asp Lys Glu Glu Leu Met Glu Glu Phe 210 215 220 Met Ile Ala Tyr Gln Asp Thr Leu Met Glu Ile Gly Leu Asp Asn Arg 225 230 235 240 Glu Ile Ala Arg Met Ala Met Ala Ala Ile Val 245 250 122238PRTProchlorococcus marinus 122Met Gln Thr Leu Glu Ser Asn Lys Lys Thr Asn Leu Glu Asn Ser Ile 1 5 10 15 Asp Leu Pro Asp Phe Thr Thr Asp Ser Tyr Lys Asp Ala Tyr Ser Arg 20 25 30 Ile Asn Ala Ile Val Ile Glu Gly Glu Gln Glu Ala His Asp Asn Tyr 35 40 45 Ile Ser Leu Ala Thr Leu Ile Pro Asn Glu Leu Glu Glu Leu Thr Lys 50 55 60 Leu Ala Lys Met Glu Leu Lys His Lys Arg Gly Phe Thr Ala Cys Gly 65 70 75 80 Arg Asn Leu Gly Val Gln Ala Asp Met Ile Phe Ala Lys Glu Phe Phe 85 90 95 Ser Lys Leu His Gly Asn Phe Gln Val Ala Leu Ser Asn Gly Lys Thr 100 105 110 Thr Thr Cys Leu Leu Ile Gln Ala Ile Leu Ile Glu Ala Phe Ala Ile 115 120 125 Ser Ala Tyr His Val Tyr Ile Arg Val Ala Asp Pro Phe Ala Lys Lys 130 135 140 Ile Thr Gln Gly Val Val Lys Asp Glu Tyr Leu His Leu Asn Tyr Gly 145 150 155 160 Gln Glu Trp Leu Lys Glu Asn Leu Ala Thr Cys Lys Asp Glu Leu Met 165 170 175 Glu Ala Asn Lys Val Asn Leu Pro Leu Ile Lys Lys Met Leu Asp Gln 180 185 190 Val Ser Glu Asp Ala Ser Val Leu Ala Met Asp Arg Glu Glu Leu Met 195 200 205 Glu Glu Phe Met Ile Ala Tyr Gln Asp Thr Leu Leu Glu Ile Gly Leu 210 215 220 Asp Asn Arg Glu Ile Ala Arg Met Ala Met Ala Ala Ile Val 225 230 235 123242PRTProchlorococcus marinus 123Met Pro Thr Leu Glu Ser Ser Glu Val Ala Val Ile Ser Asp Leu Glu 1 5 10 15 Gly Arg Asp Gly Ser Leu Pro Asp Phe Thr Thr Glu Gln Tyr Lys Asp 20 25 30 Ala Tyr Ser Arg Ile Asn Ala Ile Val Ile Glu Gly Glu Lys Glu Ala 35 40 45 His Asp Asn Tyr Val Ala Ile Gly Thr Val Ile Pro Glu Lys Ala Asp 50 55 60 Glu Leu Lys Lys Leu Ala Ile Met Glu Leu Arg His Met Lys Gly Phe 65 70 75 80 Thr Ala Cys Gly Lys Asn Leu Gly Val Val Ala Asp Met Glu Phe Ala 85 90 95 Gln Arg Phe Phe Ala Pro Leu His Gly Asn Phe Gln Lys Ala Leu Glu 100 105 110 Asn Gly Lys Ile Thr Thr Cys Phe Leu Ile Gln Ala Ile Leu Ile Glu 115 120 125 Ala Phe Ala Ile Ser Ala Tyr His Val Tyr Ile Arg Val Ala Asp Pro 130 135 140 Phe Ala Lys Lys Ile Thr Glu Gly Val Val Lys Asp Glu Tyr Leu His 145 150 155 160 Leu Asn Tyr Gly Gln Glu Trp Leu Lys Ala Asn Leu Ala Thr Cys Lys 165 170 175 Asp Glu Leu Ile Ala Ala Asn Lys Glu Asn Leu Pro Leu Ile Asn Ser 180 185 190 Met Leu Asp Gln Val Ala Asn Asp Ala Gln Val Leu Tyr Met Glu Lys 195 200 205 Glu Glu Leu Met Glu Glu Phe Met Ile Ala Tyr Gln Asp Ser Leu Met 210 215 220 Glu Ile Gly Leu Asp Ala Arg Glu Ile Ala Arg Met Ala Leu Ala Ala 225 230 235 240 Ile Ala 124241PRTProchlorococcus marinus 124Met Gln Ala Phe Ala Ser Asn Asn Leu Thr Val Glu Lys Glu Glu Leu 1 5 10 15 Ser Ser Asn Ser Leu Pro Asp Phe Thr Ser Glu Ser Tyr Lys Asp Ala 20 25 30 Tyr Ser Arg Ile Asn Ala Val Val Ile Glu Gly Glu Gln Glu Ala Tyr 35 40 45 Ser Asn Phe Leu Asp Leu Ala Lys Leu Ile Pro Glu His Ala Asp Glu 50 55 60 Leu Val Arg Leu Gly Lys Met Glu Lys Lys His Met Asn Gly Phe Cys 65 70 75 80 Ala Cys Gly Arg Asn Leu Ala Val Lys Pro Asp Met Pro Phe Ala Lys 85 90 95 Thr Phe Phe Ser Lys Leu His Asn Asn Phe Leu Glu Ala Phe Lys Val 100 105 110 Gly Asp Thr Thr Thr Cys Leu Leu Ile Gln Cys Ile Leu Ile Glu Ser 115 120 125 Phe Ala Ile Ser Ala Tyr His Val Tyr Ile Arg Val Ala Asp Pro Phe 130 135 140 Ala Lys Arg Ile Thr Glu Gly Val Val Gln Asp Glu Tyr Leu His Leu 145 150 155 160 Asn Tyr Gly Gln Glu Trp Leu Lys Ala Asn Leu Glu Thr Val Lys Lys 165 170 175 Asp Leu Met Arg Ala Asn Lys Glu Asn Leu Pro Leu Ile Lys Ser Met 180 185 190 Leu Asp Glu Val Ser Asn Asp Ala Glu Val Leu His Met Asp Lys Glu 195 200 205 Glu Leu Met Glu Glu Phe Met Ile Ala Tyr Gln Asp Ser Leu Leu Glu 210 215 220 Ile Gly Leu Asp Asn Arg Glu Ile Ala Arg Met Ala Leu Ala Ala Val 225 230 235 240 Ile 125241PRTProchlorococcus marinus 125Met Gln Ala Phe Ala Ser Asn Asn Leu Thr Val Glu Lys Glu Glu Leu 1 5 10 15 Ser Ser Asp Ser Leu Pro Asp Phe Thr Ser Glu Ser Tyr Lys Asp Ala 20 25 30 Tyr Ser Arg Ile Asn Ala Val Val Ile Glu Gly Glu Gln Glu Ala Tyr 35 40 45 Ser Asn Phe Leu Asp Leu Ala Lys Leu Ile Pro Glu His Ala Asp Glu 50 55 60 Leu Val Arg Leu Gly Lys Met Glu Lys Lys His Met Asn Gly Phe Cys 65 70 75 80 Ala Cys Gly Arg Asn Leu Ala Val Lys Pro Asp Met Pro Phe Ala Lys 85 90 95 Thr Phe Phe Ser Lys Leu His Asn Asn Phe Leu Glu Ala Phe Lys Val 100 105 110 Gly Asp Thr Thr Thr Cys Leu Leu Ile Gln Cys Ile Leu Ile Glu Ser 115 120 125 Phe Ala Ile Ser Ala Tyr His Val Tyr Ile Arg Val Ala Asp Pro Phe 130 135 140 Ala Lys Arg Ile Thr Glu Gly Val Val Gln Asp Glu Tyr Leu His Leu 145 150 155 160 Asn Tyr Gly Gln Glu Trp Leu Lys Ala Asn Leu Glu Thr Val Lys Lys 165 170 175 Asp Leu Met Arg Ala Asn Lys Glu Asn Leu Pro Leu Ile Lys Ser Met 180 185 190 Leu Asp Glu Val Ser Asn Asp Ala Glu Val Leu His Met Asp Lys Glu 195 200 205 Glu Leu Met Glu Glu Phe Met Ile Ala Tyr Gln Asp Ser Leu Leu Glu 210 215 220 Ile Gly Leu Asp Asn Arg Glu Ile Ala Arg Met Ala Leu Ala Ala Val 225 230 235 240 Ile 126237PRTProchlorococcus marinus 126Met Gln Thr Leu Thr Asn Gln Val Ala Ser Ala Asp Glu Leu Asp Asn 1 5 10 15 Leu Pro Asp Phe Ser Ser Ser Gln Tyr Lys Asp Ala Tyr Ser Arg Ile 20 25 30 Asn Ala Ile Val Ile Glu Gly Glu Lys Glu Ala His Asp Asn Tyr Met

35 40 45 Ser Ile Gly Thr Leu Ile Pro Asp Lys Ala Asp Glu Leu Lys Lys Leu 50 55 60 Ala Val Met Glu Leu Lys His Met Arg Gly Phe Thr Ala Cys Gly Lys 65 70 75 80 Asn Leu Gly Val Lys Ala Asp Ile Pro Phe Ala Glu Lys Phe Phe Ser 85 90 95 Pro Leu His Gly Asn Phe Gln Lys Ala Phe Lys Glu Glu Asn Leu Thr 100 105 110 Thr Cys Phe Leu Ile Gln Ala Ile Leu Ile Glu Ala Phe Ala Ile Ser 115 120 125 Ala Tyr His Val Tyr Ile Arg Val Ala Asp Pro Phe Ala Lys Lys Ile 130 135 140 Thr Glu Asn Val Val Lys Asp Glu Tyr Leu His Leu Asn Tyr Gly Gln 145 150 155 160 Gln Trp Leu Lys Ala Asn Leu Asp Thr Cys Lys Glu Glu Leu Met Lys 165 170 175 Ala Asn Lys Glu Asn Leu Pro Leu Ile Lys Ser Met Leu Asp Gln Val 180 185 190 Ala Asp Asp Ala Cys Ser Leu Ser Met Asp Lys Glu Glu Leu Met Glu 195 200 205 Glu Phe Met Ile Ala Tyr Gln Asp Ser Leu Leu Glu Ile Gly Leu Asp 210 215 220 Ser Arg Glu Ile Ala Arg Met Ala Leu Ala Ala Leu Val 225 230 235 127243PRTProchlorococcus marinus 127Met Gln Thr Leu Glu Ser Asn Lys Asn Ile Gln Ile Gly Ser Ser Pro 1 5 10 15 Glu Ser Asp Ser Ala Asn Leu Pro Asp Phe Thr Thr Asp Ala Tyr Lys 20 25 30 Asp Ala Tyr Ser Arg Ile Asn Ala Ile Val Ile Glu Gly Glu Gln Glu 35 40 45 Ala Tyr Asp Asn Tyr Ile Ser Ile Ala Thr Leu Leu Pro Asn Asp Ser 50 55 60 Glu Glu Leu Thr Lys Leu Ala Lys Met Glu Leu Lys His Lys Arg Gly 65 70 75 80 Phe Thr Ala Cys Gly Lys Asn Leu Gly Val Glu Ala Asp Met Ser Phe 85 90 95 Ala Lys Glu Phe Phe Ser Lys Leu His Gly Asn Phe Gln Ala Ala Leu 100 105 110 Lys Asn Glu Ser Leu Thr Thr Cys Leu Leu Ile Gln Ala Ile Leu Ile 115 120 125 Glu Ala Phe Ala Ile Ser Ala Tyr His Val Tyr Ile Arg Val Ala Asp 130 135 140 Pro Phe Ala Lys Lys Ile Thr Gln Gly Val Val Asn Asp Glu Tyr Leu 145 150 155 160 His Leu Asn Tyr Gly Glu Lys Trp Leu Lys Glu Asn Leu Ser Thr Cys 165 170 175 Lys Asp Glu Leu Ile Ala Ala Asn Lys Val Asn Leu Pro Ile Ile Lys 180 185 190 Lys Met Leu Asp Gln Val Ala Asp Asp Ala Ala Thr Leu Ala Met Asp 195 200 205 Lys Glu Glu Leu Met Glu Glu Phe Met Ile Ala Tyr Gln Asp Ala Leu 210 215 220 Leu Glu Met Gly Leu Asp Asn Arg Glu Ile Ala Arg Met Ala Met Ala 225 230 235 240 Ala Ile Val 128250PRTProchlorococcus marinus 128Met Asn Lys Ser Leu Thr Asp Met Gln Thr Leu Glu Ser Lys Lys Asp 1 5 10 15 Ile Gln Leu Glu Gly Ser Thr Asp Asn Asp Ser Ala Asn Leu Pro Asp 20 25 30 Phe Thr Thr Asp Ala Tyr Lys Asp Ala Tyr Ser Arg Ile Asn Ala Ile 35 40 45 Val Ile Glu Gly Glu Gln Glu Ala Tyr Asp Asn Tyr Ile Ser Ile Ala 50 55 60 Thr Leu Leu Pro Asn Asp Ser Glu Glu Leu Thr Lys Leu Ala Lys Met 65 70 75 80 Glu Leu Lys His Lys Arg Gly Phe Thr Ala Cys Gly Lys Asn Leu Gly 85 90 95 Val Glu Ala Asp Met Pro Phe Ala Lys Glu Phe Phe Ser Lys Leu His 100 105 110 Gly Asn Phe Gln Ile Ala Leu Lys Asp Gly Asn Leu Thr Thr Cys Leu 115 120 125 Leu Ile Gln Ala Ile Leu Ile Glu Ala Phe Ala Ile Ser Ala Tyr His 130 135 140 Val Tyr Ile Arg Val Ala Asp Pro Phe Ala Lys Lys Ile Thr Gln Gly 145 150 155 160 Val Val Asn Asp Glu Tyr Leu His Leu Asn Tyr Gly Glu Lys Trp Leu 165 170 175 Lys Glu Asn Leu His Thr Cys Lys Asp Glu Leu Ile Ala Ala Asn Lys 180 185 190 Val Asn Leu Pro Leu Ile Lys Lys Met Leu Asp Gln Val Ala Glu Asp 195 200 205 Ala Ala Thr Leu Ser Met Asp Lys Glu Glu Leu Met Glu Glu Phe Met 210 215 220 Ile Ala Tyr Gln Asp Ala Leu Leu Glu Met Gly Leu Asp Asn Arg Glu 225 230 235 240 Ile Ala Arg Met Ala Met Ala Ala Ile Val 245 250



User Contributions:

Comment about this patent or add new information about this topic:

CAPTCHA
Images included with this patent application:
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and imageMETHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
METHODS AND COMPOSITIONS FOR THE RECOMBINANT BIOSYNTHESIS OF N-ALKANES diagram and image
New patent applications in this class:
DateTitle
2022-09-22Electronic device
2022-09-22Front-facing proximity detection using capacitive sensor
2022-09-22Touch-control panel and touch-control display apparatus
2022-09-22Sensing circuit with signal compensation
2022-09-22Reduced-size interfaces for managing alerts
Website © 2025 Advameg, Inc.