SPLIT INTEINS, CONJUGATES AND USES THEREOF

Abstract

Disclosed herein are split inteins, fused proteins of split inteins, and methods of using split inteins to efficiently purify and modify proteins of interest. Thus, provided herein are fusion proteins of a polypeptide and a split intein N-fragment, or variant thereof, as described below in greater detail. Also provided are complexes of the fusion protein and a split intein C-fragment or variant thereof as described in detail below. The complex of the fusion protein and C-fragment or variant thereof can be via a covalent interaction between the fusion protein and C-fragment or variant or via a noncovalent interaction (e.g., ionic, H-bonding, and/or van der Waals interaction). Further provided herein are split intein C-fragments or variants thereof.

Description

BACKGROUND

[0003] Protein splicing is a post-translational process catalyzed by a family of proteins known as inteins.(1) During this process, an intein domain catalyzes its own excision from a larger precursor protein and simultaneously ligates the two flanking polypeptide sequences (exteins) together. While most inteins catalyze splicing in cis, a small subset of these proteins exist as naturally fragmented domains that are separately expressed but rapidly associate and catalyze splicing in trans. Given their capacity to make and break polypeptide bonds (inteins can be considered protein ligases), both cis and trans-splicing inteins have found widespread use as chemical biological tools.(2)

[0004] Despite the growing use of inteins in chemical biology, their practical utility has been constrained by two common characteristics of the family, namely (i) slow kinetics and (ii) context dependent efficiency with respect to the immediate flanking extein sequences.(3,4) Recently, a split intein from the cyanobacterium Nostoc punctiforme (Npu) was shown to catalyze protein trans-splicing on the order of a minute, rather than hours like most cis- or trans-splicing inteins.(5) Furthermore, this intein was slightly more tolerant of sequence variation at the critical +2 C-extein residue than other inteins.(6)

[0005] Thus, a need exists for more robust and more efficient split inteins for use in a variety of protein purification and protein modification applications.

SUMMARY

[0006] Disclosed are split intein N- and C-fragments, variants thereof, and methods of using these split inteins in polypeptide purification and modification.

[0007] Thus, provided herein are fusion proteins of a polypeptide and a split intein N-fragment, or variant thereof, as described below in greater detail. Also provided are complexes of the fusion protein and a split intein C-fragment or variant thereof as described in detail below. The complex of the fusion protein and C-fragment or variant thereof can be via a covalent interaction between the fusion protein and C-fragment or variant or via a noncovalent interaction (e.g., ionic, H-bonding, and/or van der Waals interaction).

[0008] Further provided herein are split intein C-fragments or variants thereof. In some cases the split intein C-fragment further comprises a linker, such as a peptide linker, or other linkers as described below in detail. A specific peptide linker contemplated is -SGGC (SEQ ID NO: 705) attached to any of the split intein C-fragments described below. The linker can be tailored so as to allow for attachment of a split intein C-fragment of interest to a support, e.g., a bead, a resin, a slide, a particle.

[0009] Also provided herein are methods using the split intein N- and C-fragments, or variants thereof, as described in detail below. More particularly, provided herein are methods comprising (a) contacting (1) a fusion protein comprising a polypeptide and a split intein N-fragment, or a variant thereof, as described in detail below and (2) a split intein C-fragment or a variant thereof, as described in detail below; wherein contacting is performed under conditions that permit binding of the split intein N-fragment to the split intein C-fragment to form an intein intermediate; and (b) contacting the intein intermediate with a nucleophile to form a conjugate of the protein and the nucleophile. In various embodiments, the split intein C-fragment, or variant thereof, is bound to a support. In some embodiments, the support is a bead, a resin, a particle or a slide. It will be appreciated that selection of the N-fragment and C-fragment can be from the same wild type split intein (e.g., both from Npu, or a variant of either the N- or C-fragment as discussed in great detail below), or alternatively can be selected from different wild type split inteins or the consensus split intein sequences discussed below, as it has been discovered that the affinity of a N-fragment for a different C-fragment (e.g., Npu N-fragment or variant thereof with Ssp C-fragment or variant thereof) still maintains sufficient binding affinity for use in the disclosed methods. Moreover, such a finding allows for a single C-fragment or variant thereof bound to a support to be useful in purification and/or modification methods disclosed herein with a fusion protein wherein the N-fragment is any of the ones disclosed herein, or a variant thereof. Thus, one can select an N-fragment that has advantages for any individual polypeptide of interest, e.g., one that expresses better than others disclosed herein.

[0010] The fusion protein can be in a whole cell lysate or secreted from a cell (e.g., a mammalian cell) and in a cell supernatant. In some cases, the polypeptide of the fusion protein is an antibody, e.g., an IgG antibody. In some embodiments, the N-fragment is fused to one or both of the heavy chains of the antibody. In some embodiments, the N-fragment is fused to one or both of the light chains of the antibody. The methods disclosed herein can further comprise washing the intein intermediate (prior to contact with the nucleophile) to remove the cell lysate or cell supernatant, for example.

[0011] The methods disclosed herein can further comprise isolating the resulting conjugate of the polypeptide and nucleophile. Thus, the methods disclosed herein can be useful as an efficient purification for polypeptides prepared by recombinant protein methods.

[0012] The nucleophile can be a thiol to form a conjugate that is an α-thioester of the polypeptide. In some cases, the resulting α-thioester can be further modified by contacting with a second nucleophile, employing the well known α-thioester chemistry for protein modification. In some cases, the methods disclosed herein can provide conjugates of the polypeptide, which in some cases is an antibody (e.g., an IgG antibody), and a nucleophile (e.g., a drug, a polymer, an oligonucleotide).

BRIEF DESCRIPTIONS OF THE DRAWINGS

[0013] FIG. 1 shows trans-splicing of split DnaE inteins. (a) Scheme depicting protein trans-splicing of the KanR protein with a variable local C-extein sequence. (b) In vivo relative trans-splicing efficiencies at 30° C. with the endogenous "CFN" C-extein sequence and exogenous "CGN", "CEN", and "CRN" sequences. IC₅₀ values (±SE, n=3-4) are normalized relative to that of intact KanR proteins with the appropriate C-extein tri-peptide.

[0014] FIG. 2 shows in vitro half-lives of trans-splicing reactions. Indicated split intein pairs fused to model exteins Ub or SUMO (Ub-Int^N and Int^C-SUMO) were mixed at either 30° C. or 37° C., and the formation of products was monitored over time by gel electrophoresis. (a) Half-lives were extracted from the reaction progress curves fit to a standard first-order rate equation (±SE, n=3). Representative coomassie-stained SDS-PAGE gels showing (b) fast Ava splicing at 37° C. and (c) inefficient Ssp splicing at 37° C.

[0015] FIG. 3 shows sequence-activity relationships in split DnaE inteins. (a) Inteins in order of in vivo splicing activity with selected slices from the corresponding multiple sequence alignment. (b) Rendering of the Npu structure highlighting the proximity of position 120 to the terminal catalytic residues C1 and N137. (c) In vivo analysis of the C120G mutation in the Aha intein (±SD, n=3). (d) Rendering of the Npu structure highlighting key catalytic residues (sticks) and important non-catalytic positions (spheres) that modulate Ssp activity. (e) In vivo analysis of Ssp-to-Npu point mutations that improve Ssp activity (±SD, n=4). Note that all residue numberings correspond to the relevant positions on Npu as defined by the NMR structure (PDB: 2KEQ).(21)

[0016] FIG. 4 shows engineered versions of ultrafast DnaE inteins support efficient expressed protein ligation. (a) Scheme depicting the formation of the linear thioester intermediate and its use to generate a protein α-thioester for EPL. (b) Coomassie-stained SDS-PAGE gel depicting efficient MESNa thiolysis of ubiquitin from a fused AvaDnaE intein to yield the Ub-MES thioester, 4. (c) Fluorescent SDS-PAGE gels showing the formation of the Ub-CGK(Fluorescein) ligated product (6) from one-pot thiolysis and native chemical ligation reactions using the inteins indicated. (d) Reverse phase HPLC chromatographs showing pH dependence of the relative populations of precursor amide (1) and linear thioester (2).

[0017] FIG. 5 shows sequence alignments of split DnaE inteins. Numbering follows that of Npu as assigned for the NMR structure (PDB 2KEQ). Critical catalytic residues are marked with an asterisk.

[0018] FIG. 6 shows sequence logos for high- and low-activity inteins. Inteins are ranked based on in vivo activity with a "CFN" C-extein sequence. The high and low activity inteins are distinguished based on a cut-off IC₅₀ value of 350 μg/mL of kanamycin, and the Aha intein is included in the high-activity set, given that the C¹²⁰G mutation dramatically restores high activity.

[0019] FIG. 7 shows purification of C-terminal α-thioesters using split-inteins. A) Scheme of the split-intein based purification of protein C-terminal α-thioesters. B) Sequence of WT Npu^C and its mutant Npu^C-AA having a linker to immobilize it onto a solid support (underlined). For the thiolysis experiments in solution the C-terminal Cys residue was previously alkylated with iodoacetamide.

[0020] FIG. 8 shows Purification of soluble protein α-thioesters using the Npu^C-AA affinity column. A) Scheme of the purification strategy using split Npu DnaE intein. B) Purification of Ub-thioester (Ub-COSR) from cell lysates. C) Purification of MBP-thioester (MBP-COSR) from cell lysates. Both purifications were monitored by SDSPAGE analysis stained with Coomassie (top) or Western Blot using an α-His antibody.

[0021] FIG. 9 shows RP-HPLC and MS analysis of Ub and MBP α-thioesters. A) RP-HPLC (top) and MS (bottom) analysis of Ub-COSR eluted from the Npu^C-AA column. B) RP-HPLC (top) and MS (bottom) analysis of MBP-COSR eluted from the Npu^C-AA column.

[0022] FIG. 10 shows the effect of the -1 residue on the efficiency of the on-resin thiolysis. 20 different Ub-Npu^N proteins were expressed containing each of the 20 proteinogenic amino acids at the C-terminus of Ub (-1 residue) and purified over Npu^C-AA columns. Cleavage yields from the Npu^C-AA column were estimated by gel electrophoresis and amounts of thioester versus side reactions (mainly hydrolysis) were determined by RP-HPLC and MS analysis.

[0023] FIG. 11 shows purification of H2B(1-116)-α-thioester under denaturing conditions. A) SDSPAGE analysis of the purification of H2B(1-116) α-thioester over the Npu^C-AA column in the presence of 3 M urea. RP-HPLC (B) and MS (C) analysis of E1 from panel A confirmed the presence of the desired H2B thioester.

[0024] FIG. 12 shows purification of αDEC thioesters expressed in 293T cells using the split-intein column. A) Expression levels of αDEC fused to different inteins in 293T cells. B) Purification of αDEC α-thioester through the Npu^C-AA affinity column. C) Expressed Protein Ligation (EPL) of αDEC-thioester with an N-terminal Cys containing fluorescent peptide.

[0025] FIG. 13 shows EPL directly using Int^C-column eluted thioesters. RP-HPLC (30-73% B gradient, 214 nm and 440 nm detection) and MS analysis of the reactions between the H-CGK(F1)-NH₂ peptide and MBP (A) and PHPT1 (B) MES thioesters, purified from E. coli using the Int^C-column.

[0026] FIG. 14 shows a one-pot purification/ligation experiment of ubiquitin to the H-CGK(Fluorescein)-NH₂ peptide (CGK(F1)). Ub-Npu^N from E. coli cell lysates was bound to the Int^C-column, and after removal of contaminants through extensive washes, intein cleavage and ligation were triggered by addition of 200 mM MES and 1 mM CGK(F1) peptide. Coomassie stained SDS-PAGE analysis and in gel fluorescence of the purification/ligation (left). RP-HPLC (detection at 214 and 440 nm) and ESI-TOF MS (right) of the eluted fractions confirms the desired ligated protein was obtained in one step directly from cell lysates with a ligation yield close to 95% (quantified by RP-HPLC).

[0027] FIG. 15 shows the semi-synthesis of H2B-K120Ac under denaturing conditions. A) Coomassie stained SDS-PAGE analysis of H2B(1-116) α-thioester generation in the presence of 2 M urea (sup: cell lysate supernatant, trit: 1% triton wash of the inclusion bodies, inp: solubilized inclusion bodies used as input for the Int^C-column). E1-E6 were pooled, concentrated to 150 μM and ligated to the peptide H-CVTK(Ac)YTSAK-OH at 1 mM for 3 h at r.t. B) RP-HPLC (left) of the ligation reaction mixture and MS (right) of the ligated H2B-K120Ac product.

[0028] FIG. 16 shows the characterization of αDEC205 ligated to the H-CGK(Fluorescein)-NH2 peptide (CGK(F1)). Elution fractions from the Npu^C-column containing αDEC205-MES thioester were concentrated to 20 μM and ligated to the CGK(F1) fluorescent peptide at 1 mM for 48 h at r.t. A) ESI-TOF MS analysis of degycosylated and fully reduced HC after ligation, showing 75% of the HC are labeled. Expected mass for ligation product=50221.2 Da. Free HC=49575.0 Da. B) SEC-MALS analysis of the ligated antibody showing that it retains its tetrameric structure after thiolysis and ligation (MW=151 kDa, MW calc=148 kDa). C) Binding of αDEC205-CGK(F1) to the DEC205 receptor. Dose dependent binding of αDEC205-CGK(F1) (left) or a control α-DEC205 antibody (right) to CHO cells expressing the mouse DEC205 receptor monitored by flow cytometry using a PE labeled α-mouse IgG. Binding to control CHO/NEO cells, which don't express the receptor is shown in gray.

[0029] FIG. 17 shows purification of αDEC thioesters expressed in CHO cells using a split-intein column. Top) Coomassie stained SDSPAGE gel of the purification of αDEC-MES thioester from CHO cells using a Npu^C-column. Bottom) Western blot analysis of the same purification.

[0030] FIG. 18 shows purification of αDEC thioesters using an Ava^C split-intein column and Western blot analysis of the purification of αDEC thioesters from mammalian cell supernatants using an Ava^C-column.

[0031] FIG. 19 shows expression tests of αDEC205 antibody fused to Ava^N split intein through the C-terminus of the antibody light chain and western blot analysis of CHO cell supernatants expressing the αDEC205-AvaN fusion at different timepoints.

DETAILED DESCRIPTION

[0032] Of the roughly 600 inteins currently catalogued, (7) less than 5% are split inteins, mostly from a family known as the cyanobacterial split DnaE inteins (8). Surprisingly, only six of these, including Npu, have been experimentally analyzed to any extent, (6,9,10) and only Npu and its widely-studied, low-efficiency ortholog from Synechocystis species PCC6803 (Ssp) have been rigorously characterized in vitro.(5,11)

[0033] A rapid survey of 18 split DnaE inteins was performed using an in vivo screening method to accurately compare the efficiencies of split inteins(12,13) In this assay, the two fragments of a split intein are co-expressed in E. coli as fusions to a fragmented aminoglycoside phosphotransferase (KanR) enzyme. Upon trans-splicing, the active enzyme is assembled, and the bacteria become resistant to the antibiotic kanamycin (FIG. 1a). More active inteins confer greater kanamycin resistance and thus have a higher IC₅₀ value for bacterial growth as a function of kanamycin concentration. This assay can be carried out in the background of varying local C-extein sequences without significantly perturbing the dynamic range. Since all DnaE inteins splice the same local extein sequences in their endogenous context, this screen was originally carried out in a wild-type C-extein background (CFN) within the KanR enzyme. As expected, bacteria expressing the Npu intein had a high relative IC₅₀, whereas clones expressing Ssp showed poor resistance to kanamycin. Remarkably, more than half of the DnaE inteins showed splicing efficiency comparable to Npu in vivo at 30° C. (FIG. 1b).

[0034] To confirm that the high IC₅₀ values observed in vivo reflected rapid trans-splicing, a series of kinetic studies were performed under standardized conditions in vitro. For this, individually expressed and purified split DnaE intein fragments fused to model N- and C-extein domains, ubiquitin and SUMO were made. The endogenous local extein residues were preserved as linkers between the extein domains and intein fragments to recapitulate a wild-type-like splicing context. Cognate intein fragments were mixed at 1 μM, and the formation of the Ub-SUMO spliced product at 30° C. and 37° C. was monitored by gel electrophoresis. These assays validated that the new inteins with high-activity in vivo could catalyze trans-splicing in vitro in tens of seconds, substantially faster than Ssp (FIG. 2a). Interestingly, all of the inteins analyzed except Ssp showed increased splicing rates at 37° C. Furthermore, all of the fast-splicing inteins showed low-to-undetectable levels of side reactions (FIG. 2b), again in contrast to Ssp (FIG. 2c).

[0035] The tolerance of the split inteins to C-extein sequence variation was investigated. Previously, the sensitivity of DnaE inteins was noted to changes at the +2 position in the C-extein.(6,12) Thus, all the split DnaE inteins were analyzed in the presence of a +2 glycine (CGN), glutamic acid (CEN), or arginine (CRN) in the in vivo screening assay (FIG. 1b). Like Npu and Ssp, most of the inteins showed a dramatic decrease in activity in the presence of all three +2 mutations. Of the tested amino acids, glutamic acid was tolerated best for every intein, suggesting a conserved mechanism for accommodating a negative charge at this position. To more accurately assess the magnitude of the effect of C-extein mutations on trans-splicing, the Npu, Cra(CS505), and Cwa inteins were analyzed in vitro in the presence of a +2 glycine. All three of these reactions were characterized by rapid accumulation of thioester intermediates, which slowly resolved over tens of minutes into the spliced product and the N-extein cleavage product. Consistent with previously reported observations, these data indicate that split DnaE inteins require steric bulk at the +2 position for branched intermediate resolution and efficient splicing.(12) It is noteworthy that the Cra(CS505) and Cwa inteins showed greater C-extein promiscuity in vivo, while Ssp(PCC7002) did not tolerate any of the mutations tested. This demonstrates that subtle sequence variation between split inteins can afford differential promiscuity. Thus, this property may be further optimized through directed evolution(12) or rational design.

[0036] These data indicate that the split DnaE inteins are highly divergent in activity, despite all having evolved to catalyze trans-splicing on virtually identical substrates. Interestingly, the key catalytic residues involved in splicing are conserved across the entire family (FIG. 5). Thus, residues that affect splicing activity are non-catalytic and perhaps only moderately conserved. The measurements of relative activity can facilitate the discovery of specific sequence features that differentiate high-activity inteins from inefficient ones. Indeed, sequence homology analysis indicates that inteins with high activity are more homologous to one another than they are to the low-activity inteins. One significant outlier to this observation is the intein from Aphanothece halophytica (Aha), which despite having greater than 65% sequence identity to the high-activity inteins, was inactive with the wild-type "CFN" C-extein motif in vivo. Closer inspection of a multiple sequence alignment indicated that this intein has a non-catalytic cysteine (position 120) in place of an otherwise absolutely conserved glycine (FIG. 3a). Furthermore, this position is close to the intein active site, where an extra nucleophile may facilitate undesirable side reactions (FIG. 3b). Gratifyingly, mutating this cysteine to glycine reinstated high activity in the Aha intein whilst the reverse mutation destroyed the splicing activity of Npu (FIG. 3c), validating the predictive capacity of these data.

[0037] Further analysis of the split intein sequence alignment indicated that several positions have strong amino acid conservation amongst the high-activity inteins but diverge for the low-activity inteins (FIG. 3a, 6). These may be sites where the fast inteins have retained beneficial interactions that have been lost in slow ones. To test this idea, several positions were chosen where this sequence-activity correlation was apparent and replaced the residue in Ssp with the corresponding amino acid found in the fast inteins. Consistent with this hypothesis, several point mutations increased the activity of Ssp in vivo (FIG. 3e). While the specific roles of these residues are not explicitly clear, especially given that they lie outside of the active site (FIG. 3d), their locations on the intein fold (14) may provide some insights into their function. For example, at position 56, an aromatic residue is preferred in the high-activity inteins. This position is adjacent to the conserved catalytic TXXH motif (positions 69-72), and an aromatic residue may facilitate packing interactions to stabilize those residues. Similarly, a glutamate is preferred at position 122, proximal to catalytic histidine 125. The glutamate at position 89 is involved in an intimate ion cluster that was previously shown to be important for stabilizing the split intein complex.(13) Interestingly, E23 is distant from the catalytic site and has no obvious structural role. This position is conceivably important for fold stability or dynamics as has previously been observed for activating point mutations in other inteins.(15,16)

[0038] The discovery of new, fast trans-splicing inteins has broad implications for protein chemistry. Indeed, the discovery of Npu fueled a resurgence in the use of split intein-based technologies.(13,17,18) While no single intein may be ideal for every protein chemistry endeavor, the availability of several new fast-splicing split inteins can provide options to enhance the efficiency of most trans-splicing applications. For example, one common problem in working with split inteins is low expression yield or poor solubility of an intein fragment fusion to a protein of interest. Indeed, the over-expression and purification efforts here show that the Ub-IntN and IntC-SUMO fusions have markedly different yields of soluble expression, depending on the intein. Thus, a short-list of highly active split inteins with varying behavior will serve as starting point for empirical optimization of a given trans-splicing application.

[0039] Furthermore, the fragments of the different fast-splicing split inteins can be mixed as non-cognate pairs and still retain highly efficient splicing activity, further expanding the options available for any trans-splicing application. For example, the N-fragment split intein of Npu or variant thereof can bind to the C-fragment of Npu or variant thereof or any of the other split intein C-fragments or variants discussed below. Similarly, the N-fragment of Ssp or variant thereof can bind to the C-fragment of Ssp or variant thereof or any of the other split intein C-fragments or variants thereof discussed below; the N-fragment of Aha or variant thereof can bind to the C-fragment of Aha or variant thereof or any of the other split intein C-fragments or variants thereof discussed below; the N-fragment of Aov or variant thereof can bind to the C-fragment of Aov or variant thereof or any of the other split intein C-fragments or variants thereof discussed below; the N-fragment of Asp or variant thereof can bind to the C-fragment of Asp or variant thereof or any of the other split intein C-fragments or variants thereof discussed below; the N-fragment of Ava or variant thereof can bind to the C-fragment of Ava or variant thereof or any of the other split intein C-fragments or variants thereof discussed below; the N-fragment of Cra(CS5505) or variant thereof can bind to the C-fragment of Cra(CS5505) or variant thereof or any of the other split intein C-fragments or variants thereof discussed below; the N-fragment of Csp(CCY0110) or variant thereof can bind to the C-fragment of Csp(CCY0110) or variant thereof or any of the other split intein C-fragments or variants thereof discussed below; the N-fragment of Csp(PCC8801) or variant thereof can bind to the C-fragment of Csp(PCC8801) or variant thereof or any of the other split intein C-fragments or variants thereof discussed below; the N-fragment of Cwa or variant thereof can bind to the C-fragment of Cwa or variant thereof or any of the other split intein C-fragments or variants thereof discussed below; the N-fragment of Maer(NIES843) or variant thereof can bind to the C-fragment of Maer(NIES843) or variant thereof or any of the other split intein C-fragments or variants thereof discussed below; the N-fragment of Mcht(PCC7420) or variant thereof can bind to the C-fragment of Mcht(PCC7420) or variant thereof or any of the other split intein C-fragments or variants thereof discussed below; the N-fragment of Oli or variant thereof can bind to the C-fragment of Oli or variant thereof or any of the other split intein C-fragments or variants thereof discussed below; the N-fragment of Sel(PC7942) or variant thereof can bind to the C-fragment of Sel(PC7942) or variant thereof or any of the other split intein C-fragments or variants thereof discussed below; the N-fragment of Ssp(PCC7002) or variant thereof can bind to the C-fragment of Ssp(PCC7002) or variant thereof or any of the other split intein C-fragments or variants thereof discussed below; the N-fragment of Tel or variant thereof can bind to the C-fragment of Tel or variant thereof or any of the other split intein C-fragments or variants thereof discussed below; the N-fragment of Ter or variant thereof can bind to the C-fragment of Ter or variant thereof or any of the other split intein C-fragments or variants thereof discussed below; and the N-fragment of Tvu or variant thereof can bind to the C-fragment of Tvu or variant thereof or any of the other split intein C-fragments or variants thereof discussed below.

[0040] The most widely used intein-based technology, expressed protein ligation, exploits cis-acting inteins to generate recombinant protein α-thioester derivatives.(2) In principle, any split intein can be artificially fused and then utilized as a cis-splicing intein in this application (1 in FIG. 4a). Ultrafast split inteins are especially attractive in this regard due to their speed and efficiency. To test this notion, artificially fused variants of Npu, Ava, and Mcht with an N-terminal ubiquitin domain were generated. To prevent splicing, premature C-terminal cleavage or undesired high levels of competing hydrolysis residues Asn137 and Cys+1 were mutated to Ala. Upon reaction with the exogenous thiol sodium 2-mercaptoethanesulfonate (MESNa), the fused DnaE inteins were rapidly cleaved to generate the ubiquitin α-thioester, 4, in a few hours (FIG. 4b). By contrast, MESNa thiolysis of the commonly used MxeGyrA intein was not complete even after one day under identical conditions. The fused DnaE inteins were sufficiently fast to allow for a one-pot thiolysis and native chemical ligation reaction with an N-terminal cysteine-containing fluorescent peptide, 5, to give semisynthetic protein 6 (FIG. 4c). Furthermore, these inteins could be used to efficiently generate α-thioesters of four other structurally unique proteins domains with different C-terminal amino acid residues. These results demonstrate that fused versions of split DnaE inteins will be of general utility for protein semisynthesis.

[0041] The rapid rate of thiolysis observed for the fused DnaE inteins has mechanistic implications as well as practical ones. Without wishing to be bound by theory, one possible explanation for their enhanced reactivity over the MxeGyrA intein is that these inteins drive the N-to-S acyl shift reaction more efficiently, generating a larger population of the reactive linear thioester species 2 (FIG. 4a). This thioester intermediate is generally thought to be transiently populated in protein splicing, and to our knowledge, it has never been directly observed.(1) Surprisingly, when analyzing the ubiquitin-DnaE intein fusions by reverse phase HPLC, two major peaks and a third minor peak were often observed, all bearing the same mass. The relative abundance of these species could be modulated by unfolding the proteins or by changes in pH, and the two major species were almost equally populated from pH 4-6 (FIG. 4d). The major peaks most likely correspond to the precursor amide, 1, and the linear thioester, 2, and the minor peak as the tetrahedral oxythiazolidine intermediate. Importantly, only a single HPLC peak was seen for the ubiquitin-MxeGyrA fusion under identical conditions. These observations, along with the enhanced thiolysis rates, strongly support the notion that these DnaE inteins have a hyper-activated N-terminal splice junction.

[0042] Splicing activities in an entire family of split inteins has been characterized. Ultrafast protein trans-splicing may be the norm, rather than the exception, in this family. Furthermore, different split inteins have varying degrees of tolerance for C-extein mutations, suggesting that traceless protein splicing may be attainable by modestly engineering any highly active intein. A thorough comparison of the activities of a small family of homologous proteins can be used to identify important non-catalytic positions that modulate activity. Finally, by artificially fusing split DnaE intein fragments, new constructs have been provided for the efficient synthesis of protein α-thioesters used in expressed protein ligation. These results will guide the development of improved protein chemistry technologies and should lay the groundwork towards a more fundamental understanding of efficient protein splicing.

Fusion Proteins of Split Intein N-Fragment

[0043] Disclosed herein are fusion proteins of a polypeptide and a split intein N-fragment. As used herein, the term "polypeptide" refers to any amino acid based polymer, interchangeable referred to as a "protein" throughout, and can include glycoproteins and lipoproteins. In some cases, the polypeptide is a polypeptide excreted from a cell (e.g., a mammalian cell). In various cases, the polypeptide is an antibody or a fragment thereof. The polypeptide can be any naturally occurring or synthetic polypeptide of interest, including polypeptides having one or more amino acid residues other than the 20 naturally occurring amino acids.

[0044] In some cases, the polypeptide has a molecular weight of 45 kDa or greater, 50 kDa or greater, 60 kDa or greater, 75 kDa or greater, 100 kDa or greater, 120 kDa or greater, or 150 kDa or greater. The polypeptide can be, e.g., an antibody or a fragment thereof. In cases of antibodies, the split intein N-fragment can be fused to one or both of the heavy chains, and/or to one or both of the light chains. In some cases, the polypeptide is a protein secreted from a cell, e.g., a mammalian cell.

[0045] The split intein N-fragment comprises a sequence as shown in FIG. 5, e.g., Npu (SEQ ID NO: 1), Ssp (SEQ ID NO: 2), Aha (SEQ ID NO: 3), Aov (SEQ ID NO: 4), Asp (SEQ ID NO: 5), Ava (SEQ ID NO: 6), Cra(CS505) (SEQ ID NO: 7), Csp(CCY0110) (SEQ ID NO: 8), Csp(PCC8801) (SEQ ID NO: 9), Cwa (SEQ ID NO: 10), Maer (NIES843) (SEQ ID NO: 11), Mcht(PCC7420) (SEQ ID NO: 12), Oli (SEQ ID NO: 13), Sel(PC7942) (SEQ ID NO: 14), Ssp(PCC7002) (SEQ ID NO: 15), Tel (SEQ ID NO: 16), Ter (SEQ ID NO: 17), Tvu (SEQ ID NO: 18), or a variant thereof. In some cases, the spilt intein N-fragment sequence comprises a sequence other than Npu (SEQ ID NO: 1) or Ssp (SEQ ID NO: 2), and in other cases, comprises a sequence other than Npu (SEQ ID NO: 1), Ssp (SEQ ID NO: 2), or Aha (SEQ ID NO: 3). In some specific cases, the split intein N-fragment sequence comprises a sequence of Ava (SEQ ID NO: 6), Cra (SEQ ID NO: 7), Csp(PCC8801) (SEQ ID NO: 9), Cwa (SEQ ID NO: 10), Mcht (PCC7420) (SEQ ID NO: 12), Oli (SEQ ID NO: 13), Ter (SEQ ID NO: 17) and Tvu (SEQ ID NO: 18). In some cases, the split intein N-fragment has a sequence comprising a consensus sequence of SEQ ID NO: 19: (CLSYDTEILTVEYGAVPIGKIVEENIECTVYSVDENGFVYTQPIAQWHDRGEQEVFE YCLEDGSTIRATKDHKFMTEDGEMLPIDEIFEQGLDLKQVKGLPD).

[0046] As used herein, a variant of a split intein N-fragment is a mutated split intein N-fragment as disclosed herein that maintains the activity of the split intein N-fragment (e.g., its ability to bind to a split intein C-fragment and/or catalyze nucleophilic attack of the polypeptide fused to it). Contemplated variants of a split intein N-fragments disclosed herein include mutation of one or more C residues, except for Cysl, to an aliphatic residue, such as an A, I, L, or F, or to a S residue. One such variant contemplated is a mutant Npu with Cys28 and Cys59 mutated to Ser, SEQ ID NO: 20 (CLSYETEILTVEYGLLPIGKIVEKRIESTVYSVDNNGNIYTQPVAQWHDRGEQEVFEY SLEDGSLIRATKDHKFMTVDGQMLPIDEIFERELDLMRVDNLPN).

Mutated Split Intein C-Fragments and Binding to a Support

[0047] The split intein C-fragments disclosed herein are mutated from the naturally occurring sequences to mutate the N137 and C+1 residues to a residue other than Asn or Gln for N137 and a residue other than Cys for C+1 (SEQ ID NOs: 129-146). In some cases, the mutations at these two positions are to a hydrophobic residue, e.g., not containing a free SH thiol (Cys), a carboxylic acid (Asp, Glu), or a base (Arg, His, Lys) or other undesired group (e.g., Asn, Gln) on the side chain. In various cases, the two mutated aliphatic residues can be the same or different and can be A, V, I, S, M, H, L, F, Y, G, or W or can be a unnatural (e.g., not encoded by genetic code) aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid (SEQ ID NOs: 219-236). Specifically contemplated are mutations where both residues are selected from A, I, V, L, Y, G and F (SEQ ID NOs: 309-326). In various cases, at least one of the two mutated residues is A.

[0048] Thus, provided herein is a mutated split intein C-fragment comprising a mutation at N137 and Cys+1 of Npu (SEQ ID NOs: 129, 147, 165, 183, 201, 219, 237, 255, 273, 291, 309, 327, 345, 363, 381 and 399), Ssp (SEQ ID NOs: 130, 148, 166, 184, 202, 220, 238, 256, 274, 292, 310, 328, 346, 364, 382 and 400), Aha (SEQ ID NOs: 131, 149, 167, 185, 203, 221, 239, 257, 275, 293, 311, 329, 347, 365, 383 and 401), Aov (SEQ ID NOs: 132, 150, 168, 186, 204, 222, 240, 258, 276, 294, 312, 330, 348, 366, 384 and 402), Asp (SEQ ID NOs: 133, 151, 169, 187, 205, 223, 241, 259, 277, 295, 313, 331, 349, 367, 385 and 403), Ava (SEQ ID NOs: 134, 152, 170, 188, 206, 224, 242, 260, 278, 296, 314, 332, 350, 368, 386 and 404), Cra(CS505) (SEQ ID NOs: 135, 153, 171, 189, 207, 225, 243, 261, 279, 297, 315, 333, 351, 369, 387 and 405), Csp (CCY0110) (SEQ ID NOs: 136, 154, 172, 190, 208, 226, 244, 262, 280, 298, 316, 334, 352, 370, 388 and 406), Csp(PCC8801) (SEQ ID NOs: 137, 155, 173, 191, 209, 227, 245, 263, 281, 299, 317, 335, 353, 371, 389 and 407), Cwa (SEQ ID NOs: 138, 156, 174, 192, 210, 228, 246, 264, 282, 300, 318, 336, 354, 372, 390 and 408), Maer(NIES843) (SEQ ID NOs: 139, 157, 175, 193, 211, 229, 247, 265, 283, 301, 319, 337, 355, 373, 391 and 409), Mcht(PCC7420) (SEQ ID NOs: 140, 158, 176, 194, 212, 230, 248, 266, 284, 302, 320, 338, 356, 374, 392 and 410), Oli (SEQ ID NOs: 141, 159, 177, 195, 213, 231, 249, 267, 285, 303, 321, 339, 357, 375, 393 and 411), Sel(PC7942) (SEQ ID NOs: 142, 160, 178, 196, 214, 232, 250, 268, 286, 304, 322, 340, 358, 376, 394 and 412), Ssp(PCC7002) (SEQ ID NOs: 143, 161, 179, 197, 215, 233, 251, 269, 287, 305, 323, 341, 359, 377, 395 and 413), Tel (SEQ ID NOs: 144, 162, 180, 198, 216, 234, 252, 270, 288, 306, 324, 342, 360, 378, 396 and 414), Ter (SEQ ID NOs: 145, 163, 181, 199, 217, 235, 253, 271, 289, 307, 325, 343, 361, 379, 397 and 415), or Tvu (SEQ ID NOs: 146, 164, 182, 200, 218, 236, 254, 272, 290, 308, 326, 344, 362, 380, 398 and 416), where the mutation at N137 and Cys+1 is a naturally occurring or unnatural hydrophobic residue. In some specific cases, at least one of the mutations is A (SEQ ID NOs: 183-200, 255-272, 327-344, and 345-416) and in more specific cases, both mutations are A (SEQ IS NOs: 399-416).

[0049] A variety of supports can be used. Generally, the solid support is a polymer or substance that allows for linkage of the split intein C-fragment, optionally via a linker. The linker can be further amino acid residues engineered to the C-terminus of the split intein C-fragment or can be other known linkers for attachment of a peptide to a support. One contemplated linker is a small peptide -SGGC (SEQ ID NO: 705), where the thiol of the C-terminal Cys can be used to attach the split intein C-fragment to the support. Thus, specifically contemplated are mutated split intein C-fragments of the Npu, Ssp, etc. sequences noted above having a -SGGC peptide linker (SEQ ID NO: 705) (e.g., specifying the residues starting at the N137 position: AAFN-SGGC) (SEQ ID NO:706). The length of a pepide linker can be modified to provide varying lengths and flexibility in any individual sitation (e.g., more than 2 Gly residues). It will also be apparent that the C-terminus residue of a peptide linker can be modified to introduce an appropriately reactive functional group to attach the split intein C-fragment to a surface of choice (e.g., Lys to react via an amine, Cys to react via a thiol, or Asp or Glu to react via a carboxylic acid). Other, unnatural amino acid residues are also contemplated for use in a peptide linker to provide other functional group moieties to allow for different attachment chemistry of the C-fragment to a support of interest (e.g., azide, alkynes, carbonyls, amino-oxy, cyano-benzothiazoles, tetrazoles, alkenes, alkyl-halides). The linker can alternatively be a polymeric linker.

[0050] Based upon an analysis of the sequences of the highly active split intein C-fragments investigated, a consensus sequence for the split intein C-fragment is derived: SEQ ID NO: 707 (VKIISRQSLGKQNVYDIGVEKDHNFLLANGLIASN), as well as a mutated version where the N137 is mutated to other than Asn or Gln (SEQ ID NO:708), or more specifically, N137 is mutant to a naturally occurring or unnaturally occurring hydrophobic residue, such as A, V, I, M, H, L, F, Y, G, S, H, or W or can be a unnatural (e.g., not encoded by genetic code) aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentanoic acid, or 2-aminohexanoic acid (SEQ ID NO: 709). Specifically contemplated mutations at N137 for the consensus sequences include A, I, V, L, Y, G, and F (SEQ ID NO: 710). Also contemplated is where N137 is mutated to A (SEQ ID NO: 711).

[0051] Further contemplated are variants of the consensus sequence having a residue at the +1 position other than Cys (SEQ ID NOs: 712, 716, 720, and 724). More specifically the +1 position can be a naturally occurring or unnaturally occurring hydrophobic residue such as A, V, I, M, H, L, F, Y, G, S, H, or W or can be a unnatural (e.g., not encoded by genetic code) aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentanoic acid, or 2-aminohexanoic acid (SEQ ID NOs: 713, 717, 721, and 725). Specifically contemplated are mutation at +1 position is selected from A, I, V, L, Y, G, and F (SEQ ID NOs: 714, 718, 722, and 726). In various cases, at least one of the mutated residues of the consensus sequence is A (SEQ ID NOs: 715, 719, and 723). In some cases, the consensus C-fragment sequence has both mutations as Ala (SEQ ID NO:727). Further contemplated is a consensus sequence comprising FN at the +2 and +3 positions (SEQ ID NO:728-743. Also contemplated is a consensus sequence comprising a peptide linker for attachment to a solid support, and one embodiment is -SGGC at positions +4-+7 (SEQ ID NO: 744-759).

[0052] The split intein C-fragment or variant thereof as disclosed herein can be attached to a solid support via a linker. In various cases, the linker is a polymer, including but not limited to a water-soluble polymer, a nucleic acid, a polypeptide, an oligosaccharide, a carbohydrate, a lipid, or combinations thereof. It is not critical what the linker's chemical structure is, since it serves primarily as a linker. The linker should be chosen so as not to interfere with the activity of the C-fragment. The linker can be made up of amino acids linked together by peptide bonds. Thus, in some embodiments, the linker comprises Y_n, wherein Y is a naturally occurring amino acid or a steroisomer thereof and "n" is any one of 1 through 20. The linker is therefore can be made up of from 1 to 20 amino acids linked by peptide bonds, wherein the amino acids are selected from the 20 naturally-occurring amino acids. In some cases, the 1 to 20 amino acids are selected from Gly, Ala, Ser, Cys. In some cases, the linker is made up of a majority of amino acids that are sterically un-hindered, such as Gly.

[0053] Non-peptide linkers are also possible. For example, alkyl linkers such as --HN--(CH₂), --CO--, wherein s=2-20 can be used. These alkyl linkers may further be substituted by any non-sterically hindering group such as lower alkyl (e.g., C₁-C₆), halogen (e.g., Cl, Br), CN, NH₂, phenyl, etc.

[0054] Another type of non-peptide linker is a polyethylene glycol group, such as: --HN--(CH₂)₂--(O-CH₂--CH₂)_n--O--CH₂--CO, wherein n is such that the overall molecular weight of the linker ranges from approximately 101 to 5000, preferably 101 to 500.

[0055] In some cases, the linker has a length of about 0-14 sub-units (e.g., amino acids).

[0056] In instances wherein the linker is a polynucleotide, the length of the linker in various embodiments is at least about 10 nucleotides, 10-30 nucleotides, or even greater than 30 nucleotides. In various aspects, the bases of the polynucleotide linker are all adenines, all thymines, all cytidines, all guanines, all uracils, or all some other modified base.

[0057] In another embodiment, a non-nucleotide linker of the invention comprises a basic nucleotide, polyether, polyamine, polyamide, peptide, carbohydrate, lipid, polyhydrocarbon, or other polymeric compounds. Specific examples include those described by Seela and Kaiser, Nucleic Acids Res. 1990, 18:6353 and Nucleic Acids Res. 1987, 15:3113; Cload and Schepartz, J. Am. Chem. Soc. 1991, 113:6324; Richardson and Schepartz, J. Am. Chem. Soc. 1991, 113:5109; Ma et al., Nucleic Acids Res. 1993, 21:2585 and Biochemistry 1993, 32:1751; Durand et al., Nucleic Acids Res. 1990, 18:6353; McCurdy et al., Nucleosides & Nucleotides 1991, 10:287; Jschke et al., Tetrahedron Lett. 1993, 34:301; Ono et al., Biochemistry 1991, 30:9914; Arnold et al., International Publication No. WO 89/02439; Usman et al., International Publication No. WO 95/06731; Dudycz et al., International Publication No. WO 95/11910 and Ferentz and Verdine, J. Am. Chem. Soc. 1991, 113:4000, the disclosures of which are all incorporated by reference herein. A "non-nucleotide" further means any group or compound that can be incorporated into a nucleic acid chain in the place of one or more nucleotide units, including either sugar and/or phosphate substitutions, and allows the remaining bases to exhibit their enzymatic activity. The group or compound can be abasic in that it does not contain a commonly recognized nucleotide base, such as adenosine, guanine, cytosine, uracil or thymine, for example at the C1 position of the sugar.

[0058] In various aspects, linkers contemplated include linear polymers (e.g., polyethylene glycol, polylysine, dextran, etc.), branched chain polymers (see, for example, U.S. Pat. No. 4,289,872 to Denkenwalter et al., issued Sep. 15, 1981; U.S. Pat. No. 5,229,490 to Tam, issued Jul. 20, 1993; WO 93/21259 by Frechet et al., published 28 Oct. 1993); lipids; cholesterol groups (such as a steroid); or carbohydrates or oligosaccharides. Other linkers include one or more water soluble polymer attachments such as polyoxyethylene glycol, or polypropylene glycol as described U.S. Pat. Nos. 4,640,835, 4,496,689, 4,301,144, 4,670,417, 4,791,192 and 4,179,337. Other useful polymers as linkers known in the art include monomethoxy-polyethylene glycol, dextran, cellulose, or other carbohydrate based polymers, poly-(N-vinyl pyrrolidone) polyethylene glycol, propylene glycol homopolymers, a polypropylene oxide/ethylene oxide co-polymer, polyoxyethylated polyols (e.g., glycerol) and polyvinyl alcohol, as well as mixtures of these polymers.

[0059] In still other aspects, oligonucleotide such as poly-A or hydrophilic or amphiphilic polymers are contemplated as linkers, including, for example, amphiphiles (including oligonucletoides).

[0060] Contemplated solid supports include resins, particles, and beads. More specific solid supports include polyhydroxy polymers, e.g. based on polysaccharides, such as agarose, dextran, cellulose, starch, pullulan, or the like, and synthetic polymers, such as polyacrylic amide, polymethacrylic amide, poly(hydroxyalkylvinyl ethers), poly(hydroxyalkylacrylates) and polymethacrylates (e.g. polyglycidylmethacrylate), polyvinyl alcohols and polymers based on styrenes and divinylbenzenes, and copolymers in which two or more of the monomers corresponding to the above-mentioned polymers are included. Specific solid supports contemplated include agarose, sepharose, cellulose, polystyrene, polyethylene glycol, derivatized agarose, acrylamide, sephadex, sepharose, polyethyleneglycol (PEG)-acrylamide, and polystyrene-PEG based supports. In some cases, the solid support can be a resin such as p-methylbenzhydrylamine (pMBHA) resin (Peptides International, Louisville, Ky.), polystyrenes (e.g., PAM-resin obtained from Bachem Inc., Peninsula Laboratories, etc.), including chloromethylpolystyrene, hydroxymethylpolystyrene and aminomethylpolystyrene, poly (dimethylacrylamide)-grafted styrene co-divinyl-benzene (e.g., POLYHIPE resin, obtained from Aminotech, Canada), polyamide resin (obtained from Peninsula Laboratories), polystyrene resin grafted with polyethylene glycol (e.g., TENTAGEL or ARGOGEL, Bayer, Tubingen, Germany) polydimethylacrylamide resin (obtained from Milligen/Biosearch, California), or Sepharose (Pharmacia, Sweden). In various embodiments, the solid support can be a magnetic bead, a glass slide, a glass bead, or a metal or inorganic particle (e.g., gold, silica, iron, or mixture thereof).

Methods of Purifying and Modifying Polypeptides

[0061] Site-specific modification of proteins is an invaluable tool to study the molecular details of protein function (19). Moreover, its potential for the discovery and development of protein therapeutics has also been recently acknowledged (20). Several methods have been developed over the years to generate site-specifically modified proteins; one of the most widely used is Expressed Protein Ligation (EPL), which has been applied to many different proteins in a variety of studies to address fundamental questions of protein function. EPL was first described in 1998 (21), as an expansion to recombinant proteins of Native Chemical Ligation (NCL) (19,22), and it consists on the reaction between a C-terminal recombinant protein α-thioester with a synthetic peptide containing a Cys at its N-terminus through the formation of a new native peptide bond between the two fragments. The synthetic nature of the Cys containing peptide allows for the incorporation of almost any chemical modification into the protein of interest.

[0062] In order to apply EPL to any given protein the generation of protein C-terminal thioesters in good yields and high purity is an absolute requirement. A family of single turn-over enzymes, named inteins, has been used since the dawn of EPL for the generation of such thioesters. Inteins are able to catalyze protein splicing, a naturally occurring post-translational modification by which they excise themselves from the polypeptide in which they are embedded, concomitantly forming a new peptide bond between their flanking protein regions (23). Importantly, this reaction occurs via several protein α-thioesters, which can be trapped through a trans-thioesterification reaction with an exogenous thiol.

[0063] Inteins, such as GyrA or VMA, have been successfully harnessed to prepare a wide variety of protein thioesters. In order to isolate the desired protein thioesters inteins are usually fused to affinity tags such as the chitin bidning domain or the hexa-His tag. However, despite the notable success of this strategy, the reaction conditions required for efficient thiolysis (reducing agents, large concentration of thiols and long incubation times) affect the performance of such tags and subsequent additional purification steps are often required to obtain the desired pure product for ligation (24-26). Moreover, depending on the identity of the C-terminal residue of the protein of interest, significant levels of in vivo premature cleavage can occur, significantly reducing the final product yield.

[0064] An ideal system should combine the thioester formation capabilities of inteins with a built-in affinity purification strategy (fully compatible with the thiolysis reaction conditions) and reduced risk of premature cleavage. Naturally split-inteins were investigated, which can perform a reaction analogous to protein splicing but in which the intein itself is split into two different polypeptides. Each of the two intein fragments are completely inactive by themselves but have a strong affinity for each other and, upon binding, they adopt their splicing competent active conformation and are able to carry out protein trans-splicing. Recently, an artificially split version of the DnaB intein has been reported for the purification of unmodified proteins (27). Thus, a purification strategy is provided using naturally split-inteins instead and to harness them for the one pot purification and generation of recombinant protein α-thioesters (FIG. 7) directly from cell lysates.

[0065] Due to the extremely fast reaction kinetics of naturally split inteins, several mutations were introduced to allow efficient thioester formation and minimize in vivo and in vitro undesired cleavage reactions. Specifically, both the C-intein C-terminal catalytic Asn137 and the Cys+1 residues had to be mutated to Ala to prevent premature C- and N-terminal cleavage, respectively. Mutation to two sequential aliphatic residues, natural or unnatural, is also expected to yield comparable results as the AA mutation. Other mutated split intein C-fragments as described above can be used in the described purification and/or modification methods, and are specifically contemplated.

[0066] To develop a split-intein based purification and thioester formation strategy the Npu split-intein was chosen, which is one of the fastest DnaE split-inteins previously known [10]. Initially the ability of split Npu to generate protein thioesters in solution was tested by mixing the model protein ubiquitin fused to NpuN with a mutant NpuC (Asn137 and Cys+1 to Ala) in the presence (and absence) of the thiol MESNa. SDSPAGE, HPLC and MS analysis of the reactions showed the formation of the desired ubiqutin C-terminal α-thioester in a few hours. Encouraged by these results an affinity purification strategy was designed based on the covalent immobilization of the NpuC intein mutant onto a solid support. The immobilized mutated NpuC could then be used to purify NpuN tagged proteins from complex mixtures and addition of an exogenous thiol would cleave off the desired protein α-thioester, which would elute from the column in a highly purified form. Other split intein N-fragments as described above can be used in the methods disclosed herein, and are specifically contemplated.

[0067] An NpuC mutant (Asn¹³⁷ and Cys⁺¹ mutated to Ala, NpuC-AA (SEQ. ID NO: 777) was prepared with a Cys residue at the C-terminus of its C-extein, which was used to immobilize the peptide onto a iodoacetyl resin. With the NpuC-AA affinity resin in hand, it was shown that several protein C-terminal α-thioesters (Ubiquitin, MBP, PHPT1) could be easily produced and purified out of cell lysates (FIG. 8). HPLC and MS analysis confirmed the formation of the desired protein thioesters with very low levels of undesired hydrolysis (FIG. 9). Recovery yields varied between 75 and 95% and the NpuC-AA resin had a consistent loading capacity of 3-6 mg of protein per mL. The utility of the α-thioester derivatives of Ub, MBP, and PHPT1 obtained from the column was demonstrated by ligating each of them to an N-terminal Cys-containing fluorescent peptide (CGK(F1)) to give the corresponding semisynthetic products in excellent yield (FIG. 13). Importantly, one-pot thiolysis/ligation reactions can be carried out, which provides a site-specifically modified protein directly from cell lysates without isolating the intermediate thioester (FIG. 14).

[0068] A concern when working with split-inteins (and also inteins) is the effect of the flanking amino acid sequences on splicing and/or thiolysis activity. Although the N-terminal junction is regarded as more tolerant towards deviations from the native N-extein residues it was important to evaluate the effect that the C-terminal amino acid of the protein of interest (-1 residue according to intein numbering conventions) would have on the yields of thioester formation. A complete library of Ub-X-NpuN fusion proteins was constructed where the C-terminal Ub residue (X) was varied from its native Gly to all other 19 proteinogenic amino acids. Proteins were expressed in E. coli and cell lysates, applied to the NpuC-AA affinity resin and purified. Protein yields were estimated from the SDSPAGE analysis for each purification and hydrolysis levels from RP-HPLC and MS analysis of the elution fractions (FIG. 10). Results show similar trends to those known for non-split inteins, such as GyrA (29), and most amino acids display high yields of cleavage after overnight incubation with MESNa, the exceptions being Pro and Glu, for which recovery were 49 and 50%, respectively. As expected, the Asn α-thioester could not be isolated due to the well-known reaction of its side-chain with the adjacent α-thioester to form a succinimide.

[0069] This purification strategy was very successful for the purification of several soluble proteins under native conditions. However, protein fragments required for EPL sometimes suffer from poor solubility and high toxicity and tend to accumulate in cellular inclusion bodies during expression. The Npu split-intein has been shown to retain a significant level of activity in the presence of denaturants (28), which suggested that this strategy would be compatible under such conditions. Using the model Ub-NpuN protein fusion it was confirmed that both, binding to the NpuC-AA-resin and thioester formation, worked well in the presence of 2 and 4 M urea. Similar levels of both, binding and thiolysis, were obtained than in the absence of denaturant and same reaction conditions.

[0070] The system was next tested for the purification from inclusion bodies of a fragment of the histone H2B. Preparation of site-specifically modified histones using EPL is a topic of major interest due to their crucial role in the understanding of epigenetic regulation. However, histone fragments are remarkably poorly behaved and the preparation of their recombinant C-terminal α-thioesters particularly challenging. A H2B(1-116) fragment fused to NpuN was expressed in E. coli and the inclusion bodies extracted with 6 M urea. The H2B-NpuN fusion was subsequently diluted into a 3 M urea buffer and the corresponding C-terminal α-thioester generated concomitant with purification over the NpuC-AA affinity resin (FIG. 11). Due to its tendency of aggregation, very dilute protein solutions bound more efficiently to the resin, and also longer reaction times were required for efficient thioester generation, obviously, these are parameters that would need to be optimized on a protein to protein basis. Using these conditions, H2B(1-116)C-terminal thioester was obtained in excellent purity (>90% by RP-HPLC) and isolated yield (˜20 mg per L of culture). This represents a significant improvement over previous protocols which afford less protein (4 mg per L of culture) and require the use of multiple chromatographic purification steps including RP-HPLC. Importantly, the H2B(1-116)-MES thioester obtained from the IntC-column can be directly used in EPL reactions without further purification. Accordingly, the protein was successfully ligated to a synthetic H2B(117-125) peptide containing an acetylated Lys at position 120 to yield semi-synthetic H2B-K120Ac (FIG. 15).

[0071] The potential of this thioester formation purification strategy was demonstrated by applying it to the site-specific modification of a monoclonal antibody. Thus, specifically contemplated is a method of purifying an antibody by using a fusion protein of an antibody and a split intein N-fragment as disclosed herein and a mutated split intein C-fragment as disclosed herein.

[0072] The modification of antibodies is a field of intense research, specially focused on the development of therapeutic antibody-drug-conjugates (30). The identity of the N-intein could have a significant effect on the expression levels of its fusion to a given protein of interest. The N-fragment of several of the fastest split DnaE inteins cross-reacted with NpuC, allowing one to use any of them with the same NpuC based affinity column. Accordingly, the expression levels of a model antibody (αDEC, antibody against the DEC205 receptor) were tested and found the highest levels of expression were obtained when αDEC was fused to the AvaN intein (FIG. 12A). αDEC-AvaN fusions were transfected into 293T cells and after 4 days of culture the supernatants were collected and purified over the NpuC-AA-column. The presence of a C-terminal thioester in the purified αDEC was confirmed by reacting it with a short fluorescent peptide with an N-terminal Cys residue (FIGS. 12B and C). MS of the deglycosylated and reduced αDEC-fluorophore conjugate was used to confirm its identity and SEC-MALS demonstrate the product was monodisperse and of the expected size for an IgG antibody.

[0073] Split-inteins can be engineered for the preparation of protein α-thioesters and that the strong affinity between the two split-intein fragments provides a powerful handle for their purification. The generality of the approach is demonstrated by using it to generate highly pure thioesters of both soluble (ubiqutin, MBP, PHPT) and insoluble proteins (H2B fragment) as well as monoclonal antibodies (αDEC). Moreover, several N-inteins can be tested for optimal expression levels of the protein of interest and used with one single NpuC-column.

[0074] Thus, the split inteins disclosed herein can be used to purify and modify a polypeptide of interest. A polypeptide of interest is provided in a fusion protein with a split intein N-fragment, e.g., via well-known recombinant protein methods. The fusion protein is then contacted with a corresponding split intein C-fragment under conditions that allow binding of the N-fragment and C-fragment to form an intein intermediate. The split intein C-fragment can be bound to a support (e.g., a solid support such as a resin) or can subsequently (e.g., after binding to the split intein N-fragment to form the intein intermediate) be bound to a support. This allows for the removal via washing of components that were in the mixture due to the recombinant protein synthesis, allowing the fusion protein to be isolated from the other components. Washes can include detergents, denaturing agents and salt solutions (e.g., NaCl).

[0075] Then, the intein intermediate can be reacted with a nucleophile to release the polypeptide of interest from the bound N- and C-fragment inteins wherein the C-terminus of the polypeptide is modified by the nucleophile added. The nucleophile can be a thiol to directed yield the polypeptide as an α-thioester, which in turn can be further modified, e.g., with a different nucleophile (e.g., a drug, a polymer, another polypeptide, a oligonucleotide), or any other moiety using the well-known α-thioester chemistry for protein modification at the C-terminus. One advantage of this chemistry is that only the C-terminus is modified with a thioester for further modification, thus allowing for selective modification only at the C-terminus and not at any other acidic residue in the polypeptide.

[0076] The nucleophile that is used in the methods disclosed herein either with the intein intermediate or as a subsequent nucleophile reacting with, e.g., a α-thioester, can be any compound or material having a suitable nucleophilic moiety. For example, to form a α-thioester, a thiol moiety is contemplated as the nucleophile. In some cases, the thiol is a 1,2-aminothiol, or a 1,2-aminoselenol. An α-selenothioester can be formed by using a selenothiol (R-SeH). Alternative nucleophiles contemplated include amines (i.e. aminolysis to give amides directly), hydrazines (to give hydrazides), amino-oxy groups (to give hydroxamic acids). Additionally, the nucleophile can be a functional group within a compound of interest for conjugation to the polypeptide of interest (e.g., a drug to form a protein-drug conjugate) or could alternatively bear an additional functional group for subsequent known bioorthogonal reactions such as an azide or an alkyne (for a click chemistry reaction between the two function groups to form a triazole), a tetrazole, an α-ketoacid, an aldehyde or ketone, or a cyanobenzothiazole.

[0077] Additional aspects and details of the invention will be apparent from the following examples, which are intended to be illustrative rather than limiting.

Examples

Materials

[0078] All buffering salts, isopropyl-β-D-thiogalactopyranoside (IPTG), and N,N-diisopropylethylamine (DIPEA) were purchased from Fisher Scientific (Pittsburgh, Pa.). Kanamycin sulfate (Kan), β-Mercaptoethanol (BME), DL-dithiothreitol (DTT), sodium 2-mercaptoethanesulfonate (MESNa), ethanedithiol (EDT), Coomassie brilliant blue, N,N-dimethylformamide (DMF), Tetrakis(triphenylphosphine)palladium(0) (Pd(PPh₃)₄), phenylsilane, triisopropylsilane (TIS), sodium diethyldithiocarbamate trihydrate, and 5(6)-carboxyfluorescein were purchased from Sigma-Aldrich (St. Louis, Mo.). Tris(2-carboxyethyl)phosphine hydrochloride (TCEP) was purchased from Thermo Scientific (Rockford, Ill.). Fmoc-Gly-OH, Fmoc-Lys(Alloc)-OH, and Boc-Cys(Trt)-OH were purchasd from Novabiochem (Laufelfingen, Switzerland). Piperidine was purchased from Alfa Aesar (Ward Hill, Mass.). Dichloromethane (DCM) and rink amide resin were purchased from EMD Chemicals (Billerica, Mass.). 1-Hydroxybenzotriazole hydrate (HOBt) was purchased from AnaSpec (Fremont, Ca). Trifluoroacetic acid (TFA) was purchased from Halocarbon (North Augusta, S.C.). Complete protease inhibitor tablets were purchased from Roche Diagnostics (Mannheim, Germany). Nickel-nitrilotriacetic acid (Ni-NTA) resin was from Novagen (Gibbstown, N.J.). The QuikChange XL II site directed mutagenesis kit was from Agilent (La Jolla, Calif.). DpnI and the Phusion High-Fidelity PCR kit were from New England Biolabs (Ipswich, Mass.). DNA purification kits (QIAprep spin minikit, QIAquick gel extraction kit, QIAquick PCR purification kit) were from Qiagen (Valencia, Calif.). Sub-cloning efficiency DH5 competent cells and One Shot BL21(DE3) chemically competent E. coli were purchased from Invitrogen (Carlsbad, Calif.) and used to generate "in-house" high-competency cell lines. Oligonucleotides were purchased from Integrated DNA Technologies (Coralville, Iowa). The new intein genes were generated synthetically and purchased from GENEWIZ (South Plainfield, N.J.). All plasmids used in this study were sequenced by GENEWIZ.

[0079] Criterion XT Bis-Tris gels (12%), Immun-blot PVDF membrane (0.2 μm), and Bradford reagent dye concentrate were purchased from Bio-Rad (Hercules, Calif.). 20×MES-SDS running buffer was purchased from Boston Bioproducts (Ashland, Mass.). Mouse anti-myc monoclonal antibody (α-myc) was purchased from Invitrogen (Carlsbad, Calif.). Anti-His Tag, clone HIS.H8 mouse monoclonal antibody (α-His6) was purchased from Millipore (Billerica, Mass.). Mouse HA.11 monoclonal antibody (α-HA) was purchased from Covance (Princeton, N.J.). IRDye 800CW goat anti-Mouse IgG secondary antibody (Licor mouse 800) and Licor Blocking Buffer were purchased from LI-COR Biotechnology (Lincoln, Nebr.).

Equipment

[0080] Size-exclusion chromatography was carried out on an AKTA FPLC system from GE Healthcare. Both preparative and analytical FPLC were carried out on a Superdex 75 10/300 or S200 10/300 column. For all runs, proteins were eluted over 1.35 column volumes of buffer (flow rate: 0.5 mL/min). Analytical RP-HPLC was performed on Hewlett-Packard 1100 and 1200 series instruments equipped with a C18 Vydac column (5 μm, 4.6×150 mm) at a flow rate of 1 mL/min. Preparative RP-HPLC was performed on a Waters prep LC system comprised of a Waters 2545 Binary Gradient Module and a Waters 2489 UV detector. Purifications were carried out on a C18 Vydac 218TP1022 column (10 μM; 22×250 mm). All runs used 0.1% TFA (trifluoroacetic acid) in water (solvent A) and 90% acetonitrile in water with 0.1% TFA (solvent B). For all runs, a two minute isocratic period in initial conditions was followed by a 30 minute linear gradient with increasing buffer B concentration. Electrospray ionization mass spectrometric analysis (ESI-MS) was performed on a Bruker Daltonics MicrOTOF-Q II mass spectrometer. In vivo intein activity assays were carried out on a VersaMax tunable microplate reader from Molecular Devices. Cells were lysed using an S-450D Branson Digital Sonifier. Western blots and coomassie-stained in vitro splicing assay gels were imaged on a LI-COR Odyssey Infrared Imager. Fluorescent fluorescein-containing gels were imaged using the GE ImageQuant LAS 4000 imager.

Compilation of the DnaE Sequence Library and Sequence Analysis

[0081] Protein sequences of the split DnaE inteins were obtained from the NEB InBase1. This list consisted of 23 entries as of May 2011. Of these entries, two were discarded from the study as they did not have a C-intein sequence: Csp(PCC7822) and Nosp(CCY9414). Two pairs of inteins had identical sequences: Nsp(PCC7120) with Asp (these are most likely the same organism with two different names) and Sel(PCC6301) with Sel(PC7942). Thus, Nsp(PCC7120) and Sel(PCC6301) were removed from the library. The Mcht(PCC7420) and Oli C-intein sequences were identical, but both inteins were kept in the library as their N-intein sequences were different. In the InBase, the Aov intein had an "X" at position 87 in place of an absolutely conserved isoleucine (I), so 187 was utilized at this position. The plasmid for the kanamycin resistance assays bearing the Csp(PCC7424) intein proved to be unstable and yielded highly variable results; thus this intein was excluded from the analyses. The final library contained 18 inteins, Table 1.

TABLE-US-00001 TABLE 1 DnaE Intein Name Genus Species Strain Npu Nostoc punctiforme PCC73102 Ssp Synechocystis species PCC6803 Aha Aphanothece halophytica Aov Aphanizomenon ovalisporum Asp Anabaena species PCC7120 Ava Anabaena variabilis ATCC29413 Cra(CS505) Cylindrospermopsis raciborskii CS-505 Csp(CCY0110) Cyanothece species CCY0110 Csp(PCC8801) Cyanothece species PCC8801 Cwa Crocosphaera watsonii WH 8501 Maer(NIES843) Microcystis aeruginosa NIES-843 Mcht(PCC7420)-2 Microcoleus chthonoplastes PCC7420 Oli Oscillatoria limnetica Solar Lake Sel(PC7942) Synechococcus elongatus PC7942 Ssp(PCC7002) Synechococcus species PCC7002 Tel Thermosynechococcus elongatus BP-1 Ter-3 Trichodesmium erythraeum IMS101 Tvu Thermosynechococcus vulcanus

[0082] Given the high homology of DnaE intein sequences, the N- and C-inteins were manually aligned using the multiple alignment software Jalview2. All N-intein sequences were "left-justified" to align the first cysteine residue, and the variable N-intein tail region was not aligned. All C-intein sequences were "right-justified" to align the C-terminal asparagine. The residue numbering used in this study is based on the numbering for the NMR structure of a fused Npu intein (PDB code 2KEQ). Thus, the variable N-intein tail region after residue 102 (the last residue of NpuN) is excluded from the numbering, as is the N-terminal methionine of the C-intein. The C-intein numbering starts at 103, except for the Tel and Tvu inteins, which have a gap at this position and start at 104. For the sequence logos (FIG. 6), the N- and C-intein alignments were each separated into two alignments based on high and low activity. The high activity sequence logos were comprised of Cwa, Cra(CS505), Csp(PCC8801), Ava, Npu, Csp(CCY0110), Mcht(PCC7420), Maer(NIES843), Asp, Oli, and Aha (which was included based on the high activity of the C120G mutant). The low activity sequence logos were comprised of Aov, Ter, Ssp(PCC7002), Tvu, Tel, Ssp, and Sel(PC7942). The sequence logos were generated using WebLogo. (4) Heat maps were generated using the statistical computing and graphics program "R".

Cloning of Plasmids for In Vivo Screening

[0083] The aminoglycoside phosphotransferase (KanR) and Npu gene fragments were cloned into a pBluescript KS (+) vector between KpnI and SacI restriction sites as previously described (36,37). This construct contained the following architecture:

[0084] [KanR promoter]-[RBS]-[myc-KanRN]-[IntN]-[iRBS]-[IntC]-[CFN-KanRC] where the KanR promoter is the constitutive promoter found in most kanamycin-resistant plasmids, RBS is a common E. coli ribosomal binding site, iRBS is an intervening ribosomal binding site preceded by a linker, myc encodes for a c-myc epitope tag (EQKLISEEDL) (SEQ ID NO: 760), KanRN and KanRC are fragments of the KanR protein, and IntN and IntC are split intein fragments. An analogous Ssp plasmid was also constructed as previously described (36,37). These plasmids are referred to as myc-KanR-NpuDnaE-Split and myc-KanR-SspDnaE-Split. To generate the screening vectors for the remaining split inteins, synthetic genes were designed and purchased from GENEWIZ containing the following architecture:

[0085] [5' overhang]-[IntN]-[iRBS]-[IntC]-[3' overhang] where the 5' and 3' overhangs were the exact 39 bp found upstream of NpuN and 25 by found downstream of NpuC, respectively, in the myc-KanR-NpuDnaE-Split plasmid. For all inteins, the purchased gene sequences were codon-optimized with the default E. coli codon usage table generated based on all E. coli coding sequences in GenBank8. The synthetic genes were received in pUC57 vectors.

[0086] To clone the screening plasmids, the entire synthetic gene was amplified with Phusion High-Fidelity Polymerase using primers annealing to the 5' and 3' overhangs. The resulting megaprimer was inserted into the myc-KanR plasmid in place of Npu by overlap-extension PCR with Phusion polymerase (39). This resulted in 18 homologous plasmids containing identical backbones, promotors, and KanR genes, but with different codon-optimized intein genes. The plasmids are named as: myc-KanR-XyzDnaE-Split (where Xyz indicates the intein name as given in Table 1). Specific point mutations were made to various inteins using a QuikChange Site-Directed Mutagenesis kit with the standard recommended protocol.

In Vivo Screening of Relative Intein Activities

[0087] 96-Well Plate Assay:

[0088] Intein activity-coupled kanamycin resistance (KanR) assays were conducted in 96-well plate format as previously described (36,37). Typically, plasmids were transformed into 15 μL of sub-cloning efficiency DH5α cells by heat shock, and the transformed cells were grown for 18 hours at 37° C. in 3 mL of Luria-Bertani (LB) media with 100 μg/mL of ampicillin (LB/amp). The over-night cultures were diluted 250-fold into LB/amp solutions containing 8 different kanamycin concentrations (150 μL per culture). The cells were grown at 30° C. on a 96-well plate, monitoring optical density (OD) at 650 nm every 5 minutes for 24 hours while shaking for one minute preceding each measurement. The endpoint of this growth curve (typically in the stationary phase) was plotted as a function of kanamycin concentration to visualize the dose-response relationship and fitted to a variable-slope dose-response equation to determine IC₅₀ values.

OD Obs = OD Min + ( OD Max - OD Min ) 1 + 10 [ ( log IC 50 - log [ Kan ] ) HillSlope ] ##EQU00001##

In each regression analysis, typically three or four independent dose response curves were collectively fit to the equation above using the GraphPad Prism software. In each fit, OD_Min was fixed to the background absorbance at 650 nm, and all other parameters were allowed to vary. The reported error bars for the IC₅₀ bar graphs (FIG. 1b) represent the standard error in the best-fit IC₅₀ value from three or four collectively fit dose-response curves.

Western Blot Analysis of In Vivo Splicing:

[0089] For the western blot analyses, DH5α cells were transformed with the assay plasmids identically as for the 96-well plate setup and grown for 18 hours at 37° C. while shaking. The overnight cultures were used to inoculate 3 mL of fresh LB/amp at a 1:300 dilution, and the cells were incubated at 30° C. for 24 hours. The ODs of the 30° C. cultures were measured at 650 nm to assess relative bacterial levels, then 150 μL of each culture was transferred to an Eppendorf tube and centrifuged at 17,000 rcf for 2 minutes. The supernatant was aspirated off, and the cell pellets were resuspended/lysed in ˜200 μL of 2×SDS gel loading dye containing 4% BME (the resuspension volumes were varied slightly to normalize for differences in OD). The samples were boiled for 10 minutes, then centrifuged at 17,000 rcf for 1 minute. Each sample (5 μL) was loaded onto a 12% Bis-Tris gel and run in MES-SDS running buffer. The proteins were transferred to PVDF membrane in Towbin transfer buffer (25 mM Tris, 192 mM glycine, 15% methanol) at 100V for 90 minutes. Membranes were blocked with 4% milk in TBST, then the primary antibody (α-myc, 1:5000) and secondary antibody (Licor mouse 800, 1:15,000) were sequentially applied in 4% milk in TBST. The blots were imaged using the Licor Odyssey scanner.

Cloning of Plasmids for In Vitro Splicing Assays

[0090] Ub-IntN Plasmids:

[0091] The N-intein expression plasmids were derived from a previously described NpuN plasmid, pMR-Ub-NpuN(WT) (36,37). This plasmid encoded for the following protein sequence:

TABLE-US-00002 (SEQ ID NO: 761) MHHHHHHGGMQIFVKTLIGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQ ELIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGGGGGKFAEYCLSYET EILTVEYGLLPIGKIVEKRIECTVYSVDNNGNIYTQPVAQWHDRGEQEVF EYCLEDGSLIRATKDHKFMTVDGQMLPIDEIFERELDLMRVDNLPN

where the NpuN sequence is given in bold, the immediate native local extein residues are underlined, and these residues are preceded by His₆-Ub with a Gly₄ linker. Significant in vivo proteolysis was previously observed during expression of this construct, so this plasmid was modified using QuikChange to remove the Gly₄ sequence. The resulting plasmid, pMR-Ub-NpuN-ΔGly₄ was used as the template for all other Ub-IntN plasmids and encoded for the following protein sequence:

TABLE-US-00003 (SEQ ID NO: 762) MHHHHHHGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQ ELIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGKFAEYCLSYETEILT VEYGLLPIGKIVEKRIECTVYSVDNNGNIYTQPVAQWHDRGEQEVFEYCL EDGSLIRATKDHKFMTVDGQMLPIDEIFERELDLMRVDNLPN

[0092] All other IntN plasmids were cloned using overlap-extension PCR to generate Ub-IntN fusion genes in homologous plasmids in a traceless manner (39). Specifically, N-intein genes were amplified by Phusion polymerase from the synthetic gene plasmids using primers with overhangs that anneal to the plasmid sequences surrounding NpuN in pMR-Ub-NpuN-ΔGly₄. The resulting megaprimer was then used to insert the new N-intein gene in place of NpuN to generate a new plasmid called pMR-Ub-IntN that was identical to the NpuN plasmid except for the N-intein gene.

[0093] IntC-SUMO Plasmids:

[0094] The C-intein plasmids were all derived from a previously described NpuC plasmid, pET-NpuC(WT)-SUMO (37). This plasmid encoded for the following protein sequence:

TABLE-US-00004 (SEQ ID NO: 763) MGSSHHHHHHGENLYFQ|GIKIATRKYLGKQNVYDIGVERDHNFALK NGFIASNCFNSGLVPRGSASMSDSEVNQEAKPEVKPEVKPETHINLKVSD GSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPED LDMEDNDIIEAHREQIGGYPYDVPDYA

where the NpuC sequence is given in bold, and the immediate native local extein residues are underlined, followed by a linker sequence and SUMO-HA. This construct is preceded by a His₆-tag and a tobacco etch virus (TEV) protease recognition sequence. The TEV protease cleavage site is indicated by "|" and leaves behind a glycine residue in place of an N-terminal IntC methionine.

[0095] All other IntC plasmids were cloned using overlap-extension PCR to generate IntC-SUMO fusion genes in homologous plasmids in a traceless manner (39). Specifically, C-intein genes were amplified by Phusion polymerase from the synthetic gene plasmids using primers with overhangs that anneal to the plasmid sequences surrounding NpuC in pET-NpuC(WT)-SUMO. The resulting megaprimer was then used to insert the new C-intein gene in place of NpuC to generate a new plasmid called pET-IntC-SUMO that was identical to the NpuC plasmid except for the C-intein gene.

Purification of Proteins for In Vitro Splicing Assays

[0096] Over-Expression and Purification of Ub-IntN Constructs (Except Ub-CwaN):

[0097] E. coli BL21(DE3) cells transformed with each N-intein plasmid were grown in 1 L of LB containing 100 μg/mL of ampicillin at 37° C. until OD₆₀₀=0.6. The cells were then cooled down to 18° C., and expression was induced by addition of 0.5 mM IPTG for 16 hours at 18° C. After harvesting the cells by centrifugation (10,500 rcf, 30 min), the cell pellets were transferred to 50 mL conical tubes with 5 mL of lysis buffer (50 mM phosphate, 300 mM NaCl, 5 mM imidazole, 2 mM BME, pH 8.0) and stored at -80° C. The cell pellets were resuspended by adding an additional 15 mL of lysis buffer supplemented with Complete protease inhibitor cocktail. Cells were lysed by sonication (35% amplitude, 8×20 second pulses separated by 30 seconds on ice). The soluble fraction was recovered by centrifugation (35,000 rcf, 30 min). The soluble fraction was mixed with 2 mL of Ni-NTA resin and incubated at 4° C. for 30 minutes. After incubation, the slurry was loaded onto a fritted column. After discarding the flow-through, the column was washed with 5 column volumes (CV) of lysis buffer, 5 CV of wash buffer 1 (lysis buffer with 20 mM imidazole), and 3 CV of wash buffer 2 (lysis buffer with 50 mM imidazole). The protein was eluted with elution buffer (lysis buffer with 250 mM imidazole) in four 1.5 CV elution fractions. The wash and elution fractions were analyzed by SDS-PAGE.

[0098] After enrichment over the Ni-NTA column, the proteins were purified by gel filtration. The wash and elution fractions were all treated with 50 mM DTT for 30 minutes on ice. For well-expressing proteins, the first elution fraction was then directly injected on an S75 10/300 gel filtration column (3×1 mL injections) and eluted over 1.35 CV in freshly prepared, degassed splicing buffer (100 mM phosphates, 150 mM NaCl, 1 mM DTT, 1 mM EDTA, pH 7.2). For the more dilute, low-yielding proteins, typically the 50 mM imidazole wash fraction and the first two elution fractions were pooled and concentrated four-fold to 3 mL. Then, the concentrated protein was purified by gel filtration identically to the high-yielding constructs. FPLC fractions were analyzed by SDS-PAGE, and the purest fractions were pooled and analyzed by analytical gel filtration, analytical RP-HPLC, and mass spectrometry. The concentration of pure proteins were determined by UV A280 nm and by the Bradford assay.

[0099] Over-Expression and Purification of Ub-CwaN:

[0100] The Ub-CwaN protein did not express well in the soluble fraction, and all of the enriched protein was aggregated, as observed by gel filtration analysis. Thus, after expression, cell lysis, and fractionation, as described above, the protein was extracted from the insoluble fraction of the lysate as follows. First, the lysate pellet was resuspended in 20 mL of Triton wash buffer (lysis buffer with 0.1% Triton X-100) and incubated at room temperature for 30 minutes. The Triton wash was centrifuged at 35,000 rcf for 30 minutes, and the supernatant was discarded. Next, the pellet was resuspended in 20 mL of lysis buffer containing 6 M urea, and the mixture was incubated overnight at 4° C. The mixture was centrifuged at 35,000 rcf for 30 minutes, and then the supernatant was mixed with 2 mL of NiNTA resin. The Ni column was run identically as for the native purifications described above, except that every buffer had a background of 6 M urea. Following enrichment over a Ni-NTA column, the 50 mM imidazole wash and the first two elution fractions were pooled and diluted to 0.2 mg/mL. The diluted protein was refolded into lysis buffer (without urea) by step-wise dialysis removal of the urea at 4° C. The protein was concentrated four-fold to 3 mL and immediately purified by gel filtration as indicated for the native purifications above. The pure protein was analyzed by analytical gel filtration, analytical RP-HPLC, and mass spectrometry. Note that this construct was highly susceptible to aggregation. When re-folded at 2 mg/mL rather than 0.2 mg/mL, less than 10% of the obtained protein was monomeric, whereas more dilute refolding yielded roughly 50% monomeric protein. The obtained protein was 80% monomeric, and the monomer to aggregate ratio did not change after 24 hours of storage at 4° C. The concentration of pure protein was determined by the Bradford assay.

[0101] Over-Expression and Purification of IntC-SUMO Constructs:

[0102] E. coli BL21(DE3) cells transformed with each C-intein plasmid were grown in 1 L of LB medium containing kanamycin (50 μg/mL) at 37° C. until OD₆₀₀=0.6. Then, expression was induced by addition of 0.5 mM IPTG for 3 hours at 37° C. The cells were lysed, and the desired protein was enriched over Ni-NTA resin identically as for the natively purified Ub-IntN proteins. The AvaC-SUMO and Csp(PCC8801)C-SUMO proteins did not express well at 37° C., so the proteins were re-expressed by induction at 18° C. for 16 hours. For each protein, the 50 mM imidazole wash and the first two elution fractions were pooled and dialyzed into TEV cleavage buffer (50 mM phosphate, 300 mM NaCl, 5 mM imidazole, 0.5 mM EDTA, 0.5 mM DTT, pH 8.0) then treated with 40 μg of His-tagged TEV protease overnight at room temperature. The cleavage was confirmed by RP-HPLC/MS, after which the reaction solution was incubated with Ni-NTA resin at room temperature for 30 min. The flow-through and two 1.5 CV washes with wash buffer 1 were collected and pooled. The protein was then concentrated to 3-4 mL, injected onto the S75 10/300 gel filtration column (3×1 mL injections), and eluted over 1.35 CV in freshly prepared, degassed splicing buffer (100 mM phosphates, 150 mM NaCl, 1 mM DTT, 1 mM EDTA, pH 7.2). FPLC fractions were analyzed by SDS-PAGE, and the purest fractions were pooled and analyzed by analytical gel filtration, analytical RP-HPLC, and mass spectrometry. The concentration of pure protein was determined by UV A₂₈₀ nm and by the Bradford assay.

[0103] Usage and Storage of the Ub-IntN and IntC-SUMO Constructs:

[0104] All of the purified proteins were stored at 4° C. and used within two days for splicing assays with their cognate IntC-SUMO. The remaining protein (2 vol. eq.) was mixed with splicing buffer containing 60% glycerol (1 vol. eq.) to yield a 20% glycerol stock that was aliquoted and flash frozen in liquid N₂. The protein aliquots were stored at -80° C. The proteins were fully functional after thawing on ice and could be flash-frozen and re-thawed at least once without detectable loss of function.

In Vitro Splicing Assays

[0105] Kinetic Assay Procedure:

[0106] For a typical assay, individual protein stock solutions of Ub-IntN and IntC-SUMO constructs were prepared in filtered splicing buffer (100 mM phosphate, 150 mM NaCl, 1 mM DTT, 1 mM EDTA, pH 7.2) at 2× the final concentration (e.g. 2.0 μM stock solution for a 1.0 μM reaction). 1 mM TCEP was added (from a pH-neutralized 100 mM stock solution) to each protein solution, and the proteins were incubated at 30° C. or 37° C. for 5 min depending on the reaction temperature. To initiate a reaction, the N- and C-intein were mixed at equal volumes (i.e. equimolar ratios). A typical reaction volume was 300 μL and was carried out in an Eppendorf tube on a heat block. During the reaction, 20 μL aliquots of the reaction solution were removed at the desired time points and quenched in 20 μL of 2× concentrated SDS gel loading dye on ice to afford a final quenched solution with 40 mM Tris (˜pH 7.0), 10% (v/v) glycerol, 1% (w/v) SDS, 0.02% (w/v) bromophenol blue, and 2% (v/v) BME. For each reaction, an artificial zero time point was taken by mixing equivalent amounts of starting materials directly into the quencher solution. Samples were boiled for 10 minutes then centrifuged at 17,000 rcf for 1 minute. Aliquots of starting materials and time points (15 μL) were loaded onto Bis-Tris gels and run in MES-SDS running buffer. The gels were Coomassie-stained then imaged using the Licor Odyssey scanner.

[0107] Note that for the reactions with a CGN C-extein sequence, no BME was used in the quencher solution. Furthermore, before boiling the samples, each sample was treated with 1 μL of 2 N HCl. After boiling and cooling the samples, they were treated with 1 μL of 2 N NaOH. This procedure prevented undesired hydrolysis or thiolysis of the branched intermediate.

[0108] Determination of Kinetic Parameters:

[0109] To determine reaction rates, each lane of a gel was analyzed using the Licor Odyssey quantification function or ImageJ. Given the close proximity of the starting material bands, these bands were typically integrated together. To normalize for loading error, the integrated intensity of each band in a lane was expressed as a fraction intensity of the total band intensity in that lane (which remained relatively constant between lanes). These normalized intensities were plotted as a function of time, and data from three independent reactions were collectively fit to first-order rate equations using the GraphPad Prism software:

Y=S(e^-k^obs.sup.t)+Z For reactant depletion:

Y=Y_max(1-e^-k^obs.sup.t) For product formation:

Y is the fractional intensity of a species, t is time in minutes, S is a scaling factor for reactant depletion (allowed to vary), Z indicates the fraction of reactant remaining at the reaction endpoint (allowed to vary), Y_max is a scaling factor for product formation, and k_obs is the observed first-order rate constant for the splicing reaction (allowed to vary). Half-lives were calculated from the best-fit value for the first-order rate constant:

t 1 / 2 = ln 2 k obs ##EQU00002##

For reactions with no detectable side product formation, the rate of product (Ub-SUMO) and IntN formation were consistent with the rate of starting material depletion.

[0110] Western Blot Analysis of Reactions:

[0111] Western blots of the zero time point and reaction endpoint were carried out to confirm the identities of the observed bands. The quenched time points from the reactions described above were loaded onto 12% Bis-Tris gels (5 μL per sample, two identical gels) and run in MES-SDS running buffer. The resolved proteins were transferred from the gel onto PVDF membrane in CAPS transfer buffer (10 mM N-cyclohexyl-3-aminopropanesulfonic acid, 10% (v/v) methanol, pH 10.5) at 100 V for 60 minutes. Membranes were blocked with Licor Blocking Buffer, then the primary antibody (α-His₆, 1:3000, or α-HA, 1:25,000) was applied in Licor Blocking Buffer. The secondary antibody (Licor mouse 800, 1:15,000) was applied in 4% milk in TBST. The blots were imaged using the Licor Odyssey scanner. Blots from the 30° C. and 37° C. reactions were virtually identical.

HPLC/MS Analysis of Npu-CGN and Cra(CS505)-CGN Reactions

[0112] For the HPLC/MS analysis of Npu-CGN and Cra(CS505)-CGN, individual protein stock solutions of Ub-IntN and IntC-CGN-SUMO were prepared in filtered splicing buffer (100 mM phosphate, 150 mM NaCl, 1 mM DTT, 1 mM EDTA, pH 7.2) at 8.01 μM. 1 mM TCEP was added (from a pH-neutralized 100 mM stock solution) to each protein solution, and the proteins were incubated at 30° C. for 5 min. To initiate a reaction, the N- and C-intein were mixed at equal volumes (i.e. equimolar ratios) and incubated at 30° C. During the reaction, 90 μL aliquots of the reaction solution were removed at the desired time points and quenched in 30 μL of a quenching solution (6 M guanidine hydrochloride with 4% trifluoroacetic acid). 100 μL of each quenched time point were injected onto an analytical C18 RP-HPLC column and eluted over a 25-73% buffer B gradient in 30 minutes, preceded by a two minute isocratic phase in 25% buffer B (see Equipment section for column and running buffer specifications). At different time points, various HPLC peaks were collected and their identities were confirmed by mass spectrometry. The IntC-(Ub)SUMO species were identified by MS, verifying branched intermediate formation and depletion.

Kinetic Modeling

[0113] When comparing the Npu, Cra(CS505), and Cwa reactions in the presence of CGN, higher amounts of cleaved ubiquitin (i.e. N-extein cleavage) were obtained than splice product, despite the fact that the rate of the former was slower than the latter. This observation is inconsistent with N-extein cleavage and splice product formation only occurring from the branched intermediate, since in this scenario splicing and cleavage would be competing first-order reactions occurring from the same reactant (the branched intermediate), leading to more splice product than cleavage (the opposite of that observed). In an attempt to reconcile these observations, a series of kinetic modeling simulations were carried out. All modeling was carried out using the kinetic modeling applet from BPReid (40). Themodels have three basic assumptions about the splicing pathway:

1. The forward and reverse reactions in the first equilibrium are fast. In addition, the position of this equilibrium lies slightly towards the amide. 2. The second equilibrium is also fast and should have K_eq close to 1, since both intermediates are cysteinyl thioesters. 3. For fast inteins, the rate of branched intermediate resolution (k₅) is on the same order of magnitude as the rates of the first two reversible steps, whereas the cleavage rates from L (k₆) and B (k₇) are relatively slow. For slow inteins, branched intermediate resolution (k₅) is also slow, on the same order of magnitude as the cleavage.

[0114] With these assumptions, six scenarios were devised that assess how the relative rates of cleavage and branched intermediate resolution and the equilibrium between the linear and branched intermediates could affect the rates and extents of formation of the cleavage and spliced products. For slow inteins, such as those bearing exogenous C-extein residues, the rate of branched intermediate resolution is similar to the rate of N-extein cleavage. Under these circumstances, three factors are important:

1. The relative rates of cleavage from L versus B (k₆ vs. k₇). 2. The relative rates of branched intermediate resolution versus cleavage (k₅ vs. k₆+k₇). 3. Most importantly, the rates of exchange between the linear and branched intermediates (k₃/k₄). These analyses suggest not only that cleavage should be occurring both from the linear and branched intermediate, but also that cleavage at the linear intermediate may be favored. Protein Thiolysis and Ligation from Fused DnaE Inteins and MxeGyrA

[0115] Solid-Phase Synthesis and Purification of H-Cys-Gly-Lys(Flourescein)-NH₂ (CGK-Fluorescein):

[0116] Fmoc-based solid phase peptide synthesis (SPPS) was used to produce a peptide with the sequence H-Cys-Gly-Lys(Fluorescein)-NH₂. The peptide was synthesized on Rink amide resin at a 0.2 mmol scale as follows: 20% piperidine in DMF was used for Fmoc deprotection using a one minute equilibration of the resin followed by a 20 minute incubation. After Fmoc deprotection, amino acids were coupled using DIC/HOBt as activating agents. First, the amino acid (1.1 mmol) was dissolved in 50:50 DCM:DMF (2 mL) and was activated with DIC (1.0 mmol) and HOBt (1.2 mmol) at 0° C. for 15 minutes. The mixture was added to the N-terminally deprotected resin and coupled for 10 minutes at room temperature.

[0117] After the cysteine was coupled, the lysine side chain was deprotected by treatment with Pd(Ph₃)₄ (0.1 eq.) and phenylsilane (25 eq.) in dry DCM for 30 minutes. The peptidyl resin was washed with DCM (2×5 mL) and DMF (2×5 mL) followed by two washes with 0.5% DIPEA in DMF (v/v) and two washes with 0.5% sodium diethyldithiocarbamate trihydrate in DMF (w/v) to remove any remaining traces of the Pd catalyst. 5(6)-Carboxyfluorescein was then coupled to the lysine side chain using the DIC/HOBt activation method overnight at room temperature. Finally, the peptide was cleaved off the resin using 94% TFA, 1% TIS, 2.5% EDT, and 2.5% H₂O (6.5 mL) for one hour. After cleavage, roughly half of the TFA was evaporated under a stream of nitrogen. The crude peptide was precipitated with cold ether and washed with cold ether twice. Finally, the peptide was purified by RP-HPLC on C18 prep column over a 15-80% buffer B gradient in 40 minutes. The purified peptide was analyzed by analytical RP-HPLC and ESI-MS to confirm its identity. Note that no attempt was made to separately isolate the 5-carboxyfluorescein and 6-carboxyfluorescein conjugates, thus the peptide is a mixture of these two isomers.

[0118] Cloning of Ub-Intein Fusions:

[0119] All Ub-Intein fusions were cloned into a modified pTXB1 vector from NEB containing ubiquitin in which a His₆-tag and stop codon were inserted between the MxeGyrA intein and the chitin binding domain. This resulted in a plasmid, pTXB1-Ub-MxeGyrA-ATEA-H₆ that encodes for the following protein, called called Ub-MxeGyrA-ATEA-H₆:

TABLE-US-00005 (SEQ ID NO: 764) MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQL EDGRTLSDYNIQKESTLHLVLRLRGGCITGDALVALPEGESVRIADIVPG ARPNSDNAIDLKVLDRHGNPVLADRLFHSGEHPVYTVRTVEGLRVTGTAN HPLLCLVDVAGVPTLLWKLIDEIKPGDYAVIQRSAFSVDCAGFARGKPEF APTTYTVGVPGLVRFLEAHHRDPDAQAIADELTDGRFYYAKVASVTDAGV QPVYSLRVDTADHAFITNGFVSHATEAHHHHHH

in which the intein sequence for MxeGyrA (N198A) is shown in bold, preceded by ubiquitin and followed by the endogenous local C-extein sequence (underlined) and a His₆-tag.

[0120] This plasmid was modified to replace the MxeGyrA intein with a fused Npu intein. First, the myc-KanR-NpuDnaE-Split plasmid was modified by QuikChange to remove the iRBS sequence separating the NpuN and NpuC genes. The resulting plasmid, myc-KanR-NpuDnaE-Fused, was then used as a template to amplify megaprimers bearing the fused Npu intein with overhangs homologous to the sequences surrounding MxeGyrA in the modified pTXB1 vector. The Npu gene with the N137A mutation was inserted in place of MxeGyrA using overlap-extension PCR with the Phusion polymerase. (39) Importantly, this construct was modified to include the native C-extein residues of Npu (CFN) instead of those for MxeGyrA (TEA). The resulting plasmid, pTXB1-Ub-NpuDnaE-ACFN-H₆ encoded for the following protein:

TABLE-US-00006 (SEQ ID NO: 765) MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQL EDGRTLSDYNIQKESTLHLVLRLRGGCLSYETEILTVEYGLLPIGKIVEK RIECTVYSVDNNGNIYTQPVAQWHDRGEQEVFEYCLEDGSLIRATKDHKF MTVDGQMLPIDEIFERELDLMRVDNLPNIKIATRKYLGKQNVYDIGVERD HNFALKNGFIASACFNHHHHHH

This fusion showed substantial in vivo hydrolysis of ubiquitin when expressed in E. coli. Thus, it was further modified using QuikChange mutagenesis by mutating the +1 cysteine to alanine, generating the plasmid pTXB1-Ub-NpuDnaE-AAFN-H₆. This plasmid encoded for the following protein (Ub-NpuDnaE-AAFN-H₆) that was used for in vitro thiolysis experiments:

TABLE-US-00007 (SEQ ID NO: 766) MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQL EDGRTLSDYNIQKESTLHLVLRLRGGCLSYETEILTVEYGLLPIGKIVEK RIECTVYSVDNNGNIYTQPVAQWHDRGEQEVFEYCLEDGSLIRATKDHKF MTVDGQMLPIDEIFERELDLMRVDNLPNIKIATRKYLGKQNVYDIGVERD HNFALKNGFIASAAFNHHHHHH

The pTXB1-Ub-AvaDnaE-AAFN-H₆ and pTXB1-Ub-MchtDnaE-AAFN-H₆ plasmids, encoding for the following protein sequences (Ub-AvaDnaE-AAFN-H₆ and Ub-MchtDnaE-AAFN-H₆, respectively), were cloned analogously by modifying the pTXB1-Ub-NpuDnaE-AAFN-H₆ plasmid.

TABLE-US-00008 Ub-AvaDnaE-AAFN-H₆ (SEQ ID NO: 767) MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQL EDGRTLSDYNIQKESTLHLVLRLRGGCLSYDTEVLTVEYGFVPIGEIVDK GIECSVFSIDSNGIVYTQPIAQWHHRGKQEVFEYCLEDGSIIKATKDHKF MTQDGKMLPIDEIFEQELDLLQVKGLPEIKIASRKFLGVENVYDIGVGRD HNFFVKNGLIASAAFNHHHHHH Ub-MchtDnaE-AAFN-H₆ (SEQ ID NO: 768) MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQL EDGRTLSDYNIQKESTLHLVLRLRGGCLSYDTQILTVEYGAVAIGEIVEK QIECTVYSVDENGYVYTQPIAQWHNRGEQEVFEYLLEDGATIRATKDHKF MTDEDQMLPIDQIFEQGLELKQVEVLQPVFVKIVRRQSLGVQNVYDIGVE KDHNFCLASGEIASAAFNHHHHHH

As a control for the removal of the +1 Cys residue in the DnaE intein constructs, the +1 Thr residue was mutated from the pTXB1-Ub-MxeGyrA-ATEA-H₆ plasmid by QuikChange mutagenesis to yield the plasmid pTXB1-Ub-MxeGyrA-AAEA-H₆, encoding for the protein Ub-MxeGyrA-AAEA-H₆.

TABLE-US-00009 (SEQ ID NO: 769) MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQL EDGRTLSDYNIQKESTLHLVLRLRGGCITGDALVALPEGESVRIADIVPG ARPNSDNAIDLKVLDRHGNPVLADRLFHSGEHPVYTVRTVEGLRVTGTAN HPLLCLVDVAGVPTLLWKLIDEIKPGDYAVIQRSAFSVDCAGFARGKPEF APTTYTVGVPGLVRFLEAHHRDPDAQAIADELTDGRFYYAKVASVTDAGV QPVYSLRVDTADHAFITNGFVSHAAEAHHHHHH

[0121] Cloning of Additional Fusions to Fused DnaE Inteins:

[0122] Several other proteins were fused to AvaDnaE or MchtDnaE to test the sequence dependence on thiolysis from these inteins. The proteins utilized were the N-terminal SH3 domain of human Grb2 (AAs 1-55+/- an exogenous C-terminal Gly), the SH2 domain of human Abl kinase (AAs 122-217), eGFP, and the catalytic domain of human PARP1 (AAs 657-1015). All plasmids were cloned using the aforementioned methods to yield plasmids encoding the following proteins:

TABLE-US-00010 SH3-AvaDnaE-AAFN-H₆ (SEQ ID NO: 770) MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPK NYIEMCLSYDTEVLTVEYGFVPIGEIVDKGIECSVFSIDSNGIVYTQPIA QWHHRGKQEVFEYCLEDGSIIKATKDHKFMTQDGKMLPIDEIFEQELDLL QVKGLPEIKIASRKFLGVENVYDIGVGRDHNFFVKNGLIASAAFNHHHHH H SH3-Gly-AvaDnaE-AAFN-H₆ (SEQ ID NO: 771) MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPK NYIEMGCLSYDTEVLTVEYGFVPIGEIVDKGIECSVFSIDSNGIVYTQPI AQWHHRGKQEVFEYCLEDGSIIKATKDHKFMTQDGKMLPIDEIFEQELDL LQVKGLPEIKIASRKFLGVENVYDIGVGRDHNFFVKNGLIASAAFNHHHH HH SH3-MchtDnaE-AAFN-H₆ (SEQ ID NO: 772) MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPK NYIEMCLSYDTQILTVEYGAVAIGEIVEKQIECTVYSVDENGYVYTQPIA QWHNRGEQEVFEYLLEDGATIRATKDHKFMTDEDQMLPIDQIFEQGLELK QVEVLQPVFVKIVRRQSLGVQNVYDIGVEKDHNFCLASGEIASAAFNHHH HHH SH2-AvaDnaE-AAFN-H₆ (SEQ ID NO: 773) MLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGR VYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPACLS YDTEVLTVEYGFVPIGEIVDKGIECSVFSIDSNGIVYTQPIAQWHHRGKQ EVFEYCLEDGSIIKATKDHKFMTQDGKMLPIDEIFEQELDLLQVKGLPEI KIASRKFLGVENVYDIGVGRDHNFFVKNGLIASAAFNHHHHHH eGFP-AvaDnaE-AAFN-H₆ (SEQ ID NO: 774) MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICT TGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHN VYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH YLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKCLSYDTEVLTV EYGFVPIGEIVDKGIECSVFSIDSNGIVYTQPIAQWHHRGKQEVFEYCLE DGSIIKATKDHKFMTQDGKMLPIDEIFEQELDLLQVKGLPEIKIASRKFL GVENVYDIGVGRDHNFFVKNGLIASAAFNHHHHHH PARP_C-AvaDnaE-AAFN-H₆ (SEQ ID NO: 775) MVNPGTKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQ IQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNA DSVQAKAEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVD RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPFKQLH NRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSA NYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTT PDPSANISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKL KFNFKTSLWCLSYDTEVLTVEYGFVPIGEIVDKGIECSVFSIDSNGIVYT QPIAQWHHRGKQEVFEYCLEDGSIIKATKDHKFMTQDGKMLPIDEIFEQE LDLLQVKGLPEIKIASRKFLGVENVYDIGVGRDHNFFVKNGLIASAAFNH HHHHH

[0123] Purification of Various Protein-Intein Fusions:

[0124] E. coli BL21(DE3) cells transformed with each Protein-Intein fusion plasmid were grown in 1 L of LB medium containing ampicillin (100 μg/mL) at 37° C. until OD₆₀₀=0.6. Then, expression was induced by addition of 0.5 mM IPTG and incubation for 3 hours at 37° C. or incubation for 16 hours at 18° C. All Ub fusions were expressed at 37° C., the eGFP fusion was expressed at 18° C., and the SH3, SH2, and PARP_C fusions were expressed at both temperatures. After harvesting the cells by centrifugation (10,500 rcf, 30 min), the cell pellets were transferred to 50 mL conical tubes with 5 mL of lysis buffer (50 mM phosphate, 300 mM NaCl, 5 mM imidazole, No BME, pH 8.0) and stored at -80° C. The cell pellets were resuspended by adding an additional 15 mL of lysis buffer supplemented with Complete protein inhibitor cocktail. Cells were lysed by sonication (35% amplitude, 8×20 second pulses separated by 30 seconds on ice). The soluble fraction was recovered by centrifugation (35,000 rcf, 30 min). The soluble fraction was mixed with 2 mL of Ni-NTA resin and incubated at 4° C. for 30 minutes. After incubation, the slurry was loaded onto a fritted column. After discarding the flow-through, the column was washed with 5 column volumes (CV) of lysis buffer, 5 CV of wash buffer 1 (lysis buffer with 20 mM imidazole), and 3 CV of wash buffer 2 (lysis buffer with 50 mM imidazole). The protein was eluted with elution buffer (lysis buffer with 250 mM imidazole) in four 1.5 CV elution fractions. The wash and elution fractions were analyzed by SDS-PAGE with loading dye containing no thiols. The cleanest fractions were pooled and treated with 10 mM TCEP for 20 minutes on ice. Then, the solution was injected on an S75 or 5200 10/300 gel filtration column (2×1 mL injections), and eluted over 1.35 CV in thiolysis buffer (100 mM phosphates, 150 mM NaCl, 1 mM EDTA, 1 mM TCEP, pH 7.2). The FPLC fractions were analyzed by SDS-PAGE with loading dye containing no thiols, and the purest fractions were pooled and analyzed by analytical RP-HPLC and mass spectrometry. The concentration of pure protein was determined by UV A₂₈₀ nm.

[0125] Thiolysis of Ub-Intein Fusions and Ligation of Ubiquitin to a Small Fluorescent Peptide:

[0126] For each Ub-Intein fusion protein, four reactions were carried on a 100 μL scale at 30° C. In the first reaction to monitor background hydrolysis, the fusion protein (501.1M) was incubated in thiolysis buffer (100 mM phosphate, 150 mM NaCl, 1 mM EDTA, 1 mM TCEP, pH 7.2) supplemented with freshly added TCEP (an additional 5 mM). In the second and third reactions, the protein was incubated identically as for the first reaction, except that each reaction had either 100 mM MESNa or 1 mM CGK-Fluorescein. In the fourth reaction, both MESNa and the peptide were added. At various time points, 5 μL of reaction solution were removed and quenched in 30 μL 2×SDS loading dye containing no thiols. As time points were collected, they were stored at -20° C. until the end of the reaction. After the reaction, the 35 μL quenched time points were thawed, treated with 1 μL of a 1 M TCEP stock solution, boiled for 10 minutes, and centrifuged at 17,000 rcf for 1 minute. Time points (5 μL) were loaded onto 12% Bis-Tris gels and run in MES-SDS running buffer. The gels were first imaged on a fluorescence imager to visualize the Ub-CGK-Fluorescein ligation product. Then the gels were coomassie-stained and imaged using the Licor Odyssey scanner. In addition, the reaction endpoints were quenched by 20-fold dilution in H₂O with 0.1% TFA and injected on an analytical C18 RP-HPLC column. The mixture was separated over a 2 minute isocratic phase in 0% B followed by a 0-73% B linear gradient in 30 minutes. The major peaks were collected and analyzed by MS.

[0127] Thiolysis of SH3-, SH2-, eGFP-, and PARP_c-Intein Fusions:

[0128] Thiolysis reactions with several other proteins fused to the AvaDnaE and MchtDnaE fused inteins were carried out analogously to the ubiquitin reactions described above. In a typical reaction, carried out on a 300 μL scale at 30° C., 10 μM fusion protein was treated with 5 mM TCEP in thiolysis buffer then incubated in the presence or absence of MESNa (either 100 mM or 200 mM) added from a pH-adjusted 1 M stock solution. At various time points, aliquots (15 μL) of the reaction solution were quenched in 30 μL of 2×SDS gel loading dye containing no thiols and stored at -20° C. until the end of the reaction. After the reaction, the 45 μL quenched time points were thawed, treated with 1 μL of a 1 M TCEP stock solution, boiled for 10 minutes, and centrifuged at 17,000 rcf for 1 minute. Time points (15 μL) were loaded onto 12% Bis-Tris gels and run in MES-SDS running buffer. Then the gels were coomassie-stained and imaged using the Licor Odyssey scanner. In addition, the reaction endpoints were quenched by 4-fold dilution in H₂O with 0.1% TFA and injected on an analytical C18 RP-HPLC column. The mixture was separated over a 2 minute isocratic phase in 0% B followed by a 0-73% B linear gradient in 30 minutes. The product peaks were collected and analyzed by MS.

Observation of the Linear Thioester Intermediate in Fused DnaE Inteins

[0129] For Npu, Ava, and Mcht fusions to ubiquitin, three peaks were visible for the purified protein when directly injected onto a C18 RP-HPLC column from a neutral buffer. These peaks all had the same mass of the desired protein. When diluted 20-fold in H₂O containing 0.1% TFA (pH 2) and incubated for at least two hours at room temperature, the first two peaks merged into the third peak (FIG. 4d). The same observation could not be made for MxeGyrA under identical conditions. To further confirm that an equilibrium between the precursor amide and linear thioester was occurring, the Ub-NpuDnaE-AAFN-H₆ protein was diluted 20-fold in thiolysis buffer containing 1% SDS. Before boiling, the two major peaks were visible. After boiling for 10 minutes, when the protein was unfolded, the first major peak partially converged into the second major peak, suggesting that the latter was the amide, which should be more stable in the unfolded intein. Additional evidence that the three peaks were in equilibrium came from pH titrations. The protein was diluted 20-fold into citric acid/phosphate buffers ranging from pH 2 to pH 8, incubated at room temperature for 3-4 hours, then analyzed by HPLC over a 30-73% B gradient in 30 minutes (FIG. 4d). The relative abundance of the three species was modulated and showed a bell-shaped pH dependence, similar to the activities of enzymes containing multiple ionizable functional groups in their active sites.

[0130] In addition to observing the desired protein mass from all three observed HPLC peaks, the presence of a -18 Da species was observed in the first two peaks. This mass change is characteristic of a dehydration reaction, and such a reaction has been previously reported by Mootz et. al. for a mutant form of the SspDnaB intein that cannot efficiently catalyze the initial N-to-S acyl shift. (41) Specifically, the tetrahedral intermediate of the forward and reverse acylation reactions can undergo acid-catalyzed dehydration to yield a thiazoline side product. For Mootz and co-workers, this species was an irreversible side-product for their mutant intein under normal reaction conditions, and it lead to low yields. In the systems herein, where the DnaE inteins can react to completion, this species is either an artifact of acidification during RP-HPLC or it is fully reversible under normal reaction conditions. It is noteworthy that the observation of the thiazoline by MS further validates the presence of detectable levels of the tetrahedral intermediate in the present reaction mixtures.

[0131] For the DnaE intein fusions to proteins other than ubiquitin, similar HPLC profiles were observed with multiple peaks at neutral pH, however the ratios of the three peaks varied depending on the sequence. Additionally, for sequences more similar to the endogenous "A-E-Y" DnaE N-extein (such as the SH3 fusions with an "I-E-M" sequence), substantial accumulation of a dehydrated product (as much as 50% by HPLC/MS) was seen, similar to that observed by Mootz et. al. for the split SspDnaB intein. (41) For these constructs, this species appears to accumulate during protein expression resulting in a mixture of "trapped" (dehydrated) and "free" (native, hydrated) fusion protein. Upon addition of MESNa at neutral pH, the "free" protein rapidly undergoes thiolysis to yield the desired product, and the "trapped" protein slowly rehydrates and is also thiolyzed to yield the same desired product. Thus, in the reaction progress curves, a "burst" phase was observed followed by a slower phase. Importantly, the accumulation of dehydrated fusion protein could be reduced by expression at lower temperatures (18° C. instead of 37° C.), and these reactions could be driven faster and closer to completion by increasing the MESNa concentration from 100 mM to 200 mM MESNa. In addition, it is noteworthy that for the SH3 thiolysis reaction, the MchtDnaE intein was substantially more efficient that the AvaDnaE intein, suggesting that different fused DnaE inteins may be preferable depending on the protein of interest.

[0132] Numerous modifications and variations in the invention as set forth in the above illustrative examples are expected to occur to those skilled in the art. Consequently only such limitations as appear in the appended claims should be placed on the invention.

REFERENCES

[0133] (1) Mills, K. V.; Perler, F. B. Protein Pept. Lett. 2005, 12, 751-5.

[0134] (2) Vila-Perello, M.; Muir, T. W. Cell 2010, 143, 191-200.

[0135] (3) Southworth, M.; Amaya, K.; Evans, T.; Xu, M.; Perler, F. Biotechniques 1999, 27, 110-120.

[0136] (4) Amitai, G.; Callahan, B. P.; Stanger, M. J.; Belfort, G.; Belfort, M. Proc. Natl. Acad. Sci. USA 2009, 106, 11005-10.

[0137] (5) Zettler, J.; Schutz, V.; Mootz, H. D. FEBS Lett. 2009, 583, 909-14.

[0138] (6) Iwai, H.; Zuger, S.; Jin, J.; Tam, P.-H. FEBS Lett. 2006, 580, 1853-8.

[0139] (7) Perler, F. B. Nucleic Acids Res. 2002, 30, 383-4.

[0140] (8) Caspi, J.; Amitai, G.; Belenkiy, O.; Pietrokovski, S. Mol. Microbiol. 2003, 50, 1569-77.

[0141] (9) Dassa, B.; Amitai, G.; Caspi, J.; Schueler-Furman, O.; Pietrokovski, S. Biochemistry 2007, 46, 322-330.

[0142] (10) Chen, L.; Zhang, Y.; Li, G.; Huang, H.; Zhou, N. Anal. Biochem. 2010, 407, 180-7.

[0143] (11) Martin, D. D.; Xu, M. Q.; Evans, T. C. Biochemistry 2001, 40, 1393-402.

[0144] (12) Lockless, S. W.; Muir, T. W. Proc. Natl. Acad. Sci. USA 2009, 106, 10999-1004.

[0145] (13) Shah, N. H.; Vila-Perello, M.; Muir, T. W. Angew. Chem. Int. Ed. Engl. 2011, 50, 6511-5.

[0146] (14) Oeemig, J. S.; Aranko, A. S.; Djupsjobacka, J.; Heinamaki, K.; Iwai, H. FEBS Lett. 2009, 583, 1451-1456.

[0147] (15) Du, Z.; Liu, Y.; Ban, D.; Lopez, M. M.; Belfort, M.; Wang, C. J. Mol. Biol. 2010, 400, 755-67.

[0148] (16) Appleby-Tagoe, J. H.; Thiel, I. V.; Wang, Y.; Wang, Y.; Mootz, H. D.; Liu, X.-Q. J. Biol. Chem. 2011, 286, 34440-7.

[0149] (17) Busche, A. E. L.; Aranko, A. S.; Talebzadeh-Farooji, M.; Bernhard, F.; Dotsch, V.; Iwai, H. Angew. Chem. Int. Ed. Engl. 2009, 48, 6128-31.

[0150] (18) Dhar, T.; Mootz, H. D. Chem. Commun. 2011, 47, 3063-5.

[0151] (19) Pellois J-P, Muir T W: Current Opinion in Chemical Biology 2006, 10:487-491.

[0152] (20) Cheriyan M, Perler F B: Adv Drug Deliv Rev 2009.

[0153] (21) Muir T W, Sondhi D, Cole P A: Proc. Natl. Acad. Sci. U.S.A 1998, 95:6705-6710.

[0154] (22) Dawson P E, Muir T W, Clark-Lewis I, Kent S B: Science 1994, 266:776-779.

[0155] (23) Evans T C J R TC, Xu M-Q: Chem Rev 2002, 102:4869-4884.

[0156] (24) Wu Y-W, Oesterlin L K, Tan K-T, Waldmann H, Alexandrov K, Goody R S: Nat Chem Biol 2010, 6:534-540.

[0157] (25) Frutos S, Goger M, Giovani B, Cowburn D, Muir T W: Nature chemical biology 2010, 6:527-533.

[0158] (26) lsen SK, Capili A D, Lu X, Tan D S, Lima C D: Nature 2010, 463:906-912.

[0159] (27) Lu W, Sun Z, Tang Y, Chen J, Tang F, Zhang J, Liu J-N: Journal of Chromatography A 2011, 1218:2553-2560.

[0160] (28) Zettler J, Schutz V, Mootz H D: FEBS Letters 2009, 583:909-914.

[0161] (29) Southworth M W, Amaya K, Evans T C, Xu M Q, Perler F B: BioTechniques 1999, 27:110-114, 116, 118-120.

[0162] (30) Carter P J: Exp Cell Res 2011, 317:1261-1269.

[0163] (31) Perler, F. B. Nucleic Acids Res. 2002, 30, 383-4.

[0164] (32) Waterhouse, A. M.; Procter, J. B.; Martin, D. M. A.; Clamp, M.; Barton, G. J. Bioinformatics 2009, 25, 1189-91.

[0165] (33) Oeemig, J. S.; Aranko, A. S.; Djupsjobacka, J.; Heinamaki, K.; Iwai, H. FEBS Lett. 2009, 583, 1451-1456.

[0166] (34) Crooks, G. E.; Hon, G.; Chandonia, J.-M.; Brenner, S. E. Genome Res. 2004, 14, 1188-90.

[0167] (35) R Development Core Team; R Foundation for Statistical Computing: Vienna, Austria, 2011.

[0168] (36) Lockless, S. W.; Muir, T. W. Proc. Natl. Acad. Sci. USA 2009, 106, 10999-1004.

[0169] (37) Shah, N. H.; Vila-Perello, M.; Muir, T. W. Angew. Chem. Int. Ed. 2011, 50, 6511-5.

[0170] (38) Stothard, P. BioTechniques 2000, 28, 1102, 1104.

[0171] (39) Bryksin, A. V.; Matsumura, I. BioTechniques 2010, 48, 463-5.

[0172] (40) Reid, B. P.; BPReid: Hanover, N. H., 2009.

[0173] (41) Schwarzer, D.; Ludwig, C.; Thiel, I. V.; Mootz, H. D. Biochemistry 2012, 51, 233-42.

[0174] (42) Sun, P.; Ye, S.; Ferrandon, S.; Evans, T. C.; Xu, M.-Q.; Rao, Z. J. Mol. Biol. 2005, 353, 1093-105

Sequence CWU 1

1

7771102PRTNostoc punctiforme 1Cys Leu Ser Tyr Glu Thr Glu Ile Leu Thr Val Glu Tyr Gly Leu Leu 1 5 10 15 Pro Ile Gly Lys Ile Val Glu Lys Arg Ile Glu Cys Thr Val Tyr Ser 20 25 30 Val Asp Asn Asn Gly Asn Ile Tyr Thr Gln Pro Val Ala Gln Trp His 35 40 45 Asp Arg Gly Glu Gln Glu Val Phe Glu Tyr Cys Leu Glu Asp Gly Ser 50 55 60 Leu Ile Arg Ala Thr Lys Asp His Lys Phe Met Thr Val Asp Gly Gln 65 70 75 80 Met Leu Pro Ile Asp Glu Ile Phe Glu Arg Glu Leu Asp Leu Met Arg 85 90 95 Val Asp Asn Leu Pro Asn 100 2123PRTSynechocystis PCC6803 2Cys Leu Ser Phe Gly Thr Glu Ile Leu Thr Val Glu Tyr Gly Pro Leu 1 5 10 15 Pro Ile Gly Lys Ile Val Ser Glu Glu Ile Asn Cys Ser Val Tyr Ser 20 25 30 Val Asp Pro Glu Gly Arg Val Tyr Thr Gln Ala Ile Ala Gln Trp His 35 40 45 Asp Arg Gly Glu Gln Glu Val Leu Glu Tyr Glu Leu Glu Asp Gly Ser 50 55 60 Val Ile Arg Ala Thr Ser Asp His Arg Phe Leu Thr Thr Asp Tyr Gln 65 70 75 80 Leu Leu Ala Ile Glu Glu Ile Phe Ala Arg Gln Leu Asp Leu Leu Thr 85 90 95 Leu Glu Asn Ile Lys Gln Thr Glu Glu Ala Leu Asp Asn His Arg Leu 100 105 110 Pro Phe Pro Leu Leu Asp Ala Gly Thr Ile Lys 115 120 3110PRTAphanothece halophytica 3Cys Leu Ser Tyr Asp Thr Glu Ile Trp Thr Val Glu Tyr Gly Ala Met 1 5 10 15 Pro Ile Gly Lys Ile Val Glu Glu Lys Ile Glu Cys Ser Val Tyr Thr 20 25 30 Val Asp Glu Asn Gly Phe Val Tyr Thr Gln Pro Ile Ala Gln Trp His 35 40 45 Pro Arg Gly Gln Gln Glu Ile Ile Glu Tyr Thr Leu Glu Asp Gly Arg 50 55 60 Lys Ile Arg Ala Thr Lys Asp His Lys Met Met Thr Glu Ser Gly Glu 65 70 75 80 Met Leu Pro Ile Glu Glu Ile Phe Gln Arg Glu Leu Asp Leu Lys Val 85 90 95 Glu Thr Phe His Glu Met Ser Leu Leu Arg Arg Gly Ala Lys 100 105 110 4 101PRTAphanizomenon ovalisporum 4Cys Leu Ser Ala Asp Thr Glu Ile Leu Thr Val Glu Tyr Gly Phe Leu 1 5 10 15 Pro Ile Gly Glu Ile Val Gly Lys Ala Ile Glu Cys Arg Val Tyr Ser 20 25 30 Val Asp Gly Asn Gly Asn Ile Tyr Thr Gln Ser Ile Ala Gln Trp His 35 40 45 Asn Arg Gly Glu Gln Glu Val Phe Glu Tyr Thr Leu Glu Asp Gly Ser 50 55 60 Ile Ile Arg Ala Thr Lys Asp His Lys Phe Met Thr Thr Asp Gly Glu 65 70 75 80 Met Leu Pro Ile Asp Glu Ile Phe Ala Arg Gln Leu Asp Leu Met Gln 85 90 95 Val Gln Gly Leu His 100 5 102PRTAnabaena PCC7120 5Cys Leu Ser Tyr Asp Thr Glu Val Leu Thr Val Glu Tyr Gly Phe Val 1 5 10 15 Pro Ile Gly Glu Ile Val Glu Lys Gly Ile Glu Cys Ser Val Phe Ser 20 25 30 Ile Asn Asn Asn Gly Ile Val Tyr Thr Gln Pro Ile Ala Gln Trp His 35 40 45 His Arg Gly Lys Gln Glu Val Phe Glu Tyr Cys Leu Glu Asp Gly Ser 50 55 60 Ile Ile Lys Ala Thr Lys Asp His Lys Phe Met Thr Gln Asp Gly Lys 65 70 75 80 Met Leu Pro Ile Asp Glu Ile Phe Glu Gln Glu Leu Asp Leu Leu Gln 85 90 95 Val Lys Gly Leu Pro Glu 100 6 102PRTAnabaena variabilis 6Cys Leu Ser Tyr Asp Thr Glu Val Leu Thr Val Glu Tyr Gly Phe Val 1 5 10 15 Pro Ile Gly Glu Ile Val Asp Lys Gly Ile Glu Cys Ser Val Phe Ser 20 25 30 Ile Asp Ser Asn Gly Ile Val Tyr Thr Gln Pro Ile Ala Gln Trp His 35 40 45 His Arg Gly Lys Gln Glu Val Phe Glu Tyr Cys Leu Glu Asp Gly Ser 50 55 60 Ile Ile Lys Ala Thr Lys Asp His Lys Phe Met Thr Gln Asp Gly Lys 65 70 75 80 Met Leu Pro Ile Asp Glu Ile Phe Glu Gln Glu Leu Asp Leu Leu Gln 85 90 95 Val Lys Gly Leu Pro Glu 100 7 118PRTCylindrospermopsis raciborskii 7Cys Leu Ser Tyr Glu Thr Glu Val Leu Thr Leu Glu Tyr Gly Phe Val 1 5 10 15 Pro Ile Gly Glu Ile Val Asn Lys Gln Met Val Cys Thr Val Phe Ser 20 25 30 Leu Asn Asp Ser Gly Asn Val Tyr Thr Gln Pro Ile Gly Gln Trp His 35 40 45 Asp Arg Gly Val Gln Asp Leu Tyr Glu Tyr Cys Leu Asp Asp Gly Ser 50 55 60 Thr Ile Arg Ala Thr Lys Asp His Lys Phe Met Thr Thr Gln Gly Glu 65 70 75 80 Met Val Pro Ile Asp Glu Ile Phe His Gln Gly Trp Glu Leu Val Gln 85 90 95 Val Ser Gly Ile Ser Lys Leu Val Gln Gln Arg Thr Leu Pro Phe Ile 100 105 110 Ile Val Asp Arg Lys Leu 115 899PRTCyanothece CCY0110 8Cys Leu Ser Tyr Asp Thr Glu Ile Leu Thr Val Glu Tyr Gly Pro Met 1 5 10 15 Pro Ile Gly Lys Ile Val Glu Glu Asn Ile Asn Cys Ser Val Tyr Thr 20 25 30 Val Asn Lys Asn Gly Phe Val Tyr Thr Gln Ser Ile Ala Gln Trp His 35 40 45 His Arg Gly Glu Gln Glu Val Phe Glu Tyr Tyr Leu Glu Asp Gly Glu 50 55 60 Thr Ile Arg Ala Thr Lys Asp His Lys Phe Met Thr Thr Glu Gly Lys 65 70 75 80 Met Leu Pro Ile Asp Glu Ile Phe Glu Asn Asn Leu Asp Leu Lys Lys 85 90 95 Leu Thr Val 999PRTCyanothece PCC8801 9Cys Leu Ser Tyr Asp Thr Glu Ile Leu Thr Val Glu Tyr Gly Ala Ile 1 5 10 15 Pro Ile Gly Lys Val Val Glu Glu Asn Ile Asp Cys Thr Val Tyr Thr 20 25 30 Val Asp Lys Asn Gly Phe Val Tyr Thr Gln Asn Ile Ala Gln Trp His 35 40 45 Leu Arg Gly Gln Gln Glu Val Phe Glu Tyr Tyr Leu Asp Asp Gly Ser 50 55 60 Ile Leu Arg Ala Thr Lys Asp His Gln Phe Met Thr Leu Glu Gly Glu 65 70 75 80 Met Leu Pro Ile His Glu Ile Phe Glu Arg Gly Leu Glu Leu Lys Lys 85 90 95 Ile Lys Ile 10106PRTCrocosphaera watsonii 10Cys Leu Ser Tyr Asp Thr Glu Ile Leu Thr Val Glu Tyr Gly Ala Met 1 5 10 15 Tyr Ile Gly Lys Ile Val Glu Glu Asn Ile Asn Cys Thr Val Tyr Thr 20 25 30 Val Asp Lys Asn Gly Phe Val Tyr Thr Gln Thr Ile Ala Gln Trp His 35 40 45 Asn Arg Gly Glu Gln Glu Ile Phe Glu Tyr Asp Leu Glu Asp Gly Ser 50 55 60 Lys Ile Lys Ala Thr Lys Asp His Lys Phe Met Thr Ile Asp Gly Glu 65 70 75 80 Met Leu Pro Ile Asp Glu Ile Phe Glu Lys Asn Leu Asp Leu Lys Gln 85 90 95 Val Val Ser His Pro Asp Asp Tyr Leu Val 100 105 11100PRTMicrocystis aeruginosa 11Cys Leu Gly Gly Glu Thr Leu Ile Leu Thr Glu Glu Tyr Gly Leu Leu 1 5 10 15 Pro Ile Ala Lys Ile Val Ser Glu Glu Ile Asn Cys Thr Val Tyr Thr 20 25 30 Val Asp Gln Asn Gly Phe Val Tyr Ser Gln Pro Ile Ser Gln Trp His 35 40 45 Glu Arg Gly Leu Gln Glu Val Phe Glu Tyr Thr Leu Glu Asn Gly Gln 50 55 60 Thr Ile Gln Ala Thr Lys Asp His Lys Phe Met Thr Ser Asp Gly Glu 65 70 75 80 Met Leu Ala Ile Asp Thr Ile Phe Glu Arg Gly Leu Asp Leu Lys Ser 85 90 95 Ser Asp Phe Ser 100 12104PRTMicrocoleus chthonoplastes 12Cys Leu Ser Tyr Asp Thr Gln Ile Leu Thr Val Glu Tyr Gly Ala Val 1 5 10 15 Ala Ile Gly Glu Ile Val Glu Lys Gln Ile Glu Cys Thr Val Tyr Ser 20 25 30 Val Asp Glu Asn Gly Tyr Val Tyr Thr Gln Pro Ile Ala Gln Trp His 35 40 45 Asn Arg Gly Glu Gln Glu Val Phe Glu Tyr Leu Leu Glu Asp Gly Ala 50 55 60 Thr Ile Arg Ala Thr Lys Asp His Lys Phe Met Thr Asp Glu Asp Gln 65 70 75 80 Met Leu Pro Ile Asp Gln Ile Phe Glu Gln Gly Leu Glu Leu Lys Gln 85 90 95 Val Glu Val Leu Gln Pro Val Phe 100 13112PRTOscillatoria limnetica 13Cys Leu Ser Tyr Asn Thr Glu Val Leu Thr Val Glu Tyr Gly Pro Leu 1 5 10 15 Pro Ile Gly Lys Ile Val Asp Glu Gln Ile His Cys Arg Val Tyr Ser 20 25 30 Val Asp Glu Asn Gly Phe Val Tyr Thr Gln Ala Ile Ala Gln Trp His 35 40 45 Asp Arg Gly Tyr Gln Glu Ile Phe Ala Tyr Glu Leu Ala Asp Gly Ser 50 55 60 Val Ile Arg Ala Thr Lys Asp His Gln Phe Met Thr Glu Asp Gly Gln 65 70 75 80 Met Phe Pro Ile Asp Glu Ile Trp Glu Lys Gly Leu Asp Leu Lys Lys 85 90 95 Leu Pro Thr Val Gln Asp Leu Pro Ala Ala Val Gly Tyr Thr Val Ser 100 105 110 14113PRTSynechococcus elongatus 14Cys Leu Ala Ala Asp Thr Glu Val Leu Thr Val Glu Tyr Gly Pro Ile 1 5 10 15 Ala Ile Gly Lys Leu Val Glu Glu Asn Ile Arg Cys Gln Val Tyr Cys 20 25 30 Cys Asn Pro Asp Gly Tyr Ile Tyr Ser Gln Pro Ile Gly Gln Trp His 35 40 45 Gln Arg Gly Glu Gln Glu Val Ile Glu Tyr Glu Leu Ser Asp Gly Arg 50 55 60 Ile Ile Arg Ala Thr Ala Asp His Arg Phe Met Thr Glu Glu Gly Glu 65 70 75 80 Met Leu Ser Leu Asp Glu Ile Phe Glu Arg Ser Leu Glu Leu Lys Gln 85 90 95 Ile Pro Thr Pro Leu Leu Ala Ile Ala Gln Pro Ser Pro Leu Ala Thr 100 105 110 Ala 15107PRTSynechococcus PCC7002 15Cys Leu Ala Gly Gly Thr Pro Val Val Thr Val Glu Tyr Gly Val Leu 1 5 10 15 Pro Ile Gln Thr Ile Val Glu Gln Glu Leu Leu Cys His Val Tyr Ser 20 25 30 Val Asp Ala Gln Gly Leu Ile Tyr Ala Gln Leu Ile Glu Gln Trp His 35 40 45 Gln Arg Gly Asp Arg Leu Leu Tyr Glu Tyr Glu Leu Glu Asn Gly Gln 50 55 60 Met Ile Arg Ala Thr Pro Asp His Arg Phe Leu Thr Thr Thr Gly Glu 65 70 75 80 Leu Leu Pro Ile Asp Glu Ile Phe Thr Gln Asn Leu Asp Leu Ala Ala 85 90 95 Trp Ala Val Pro Asp Ser Leu Pro Arg Thr Ala 100 105 16117PRTThermosynechococcus elongatus 16Cys Leu Ser Gly Glu Thr Ala Val Met Thr Val Glu Tyr Gly Ala Val 1 5 10 15 Pro Ile Arg Arg Leu Val Gln Glu Arg Leu Ser Cys His Val Tyr Ser 20 25 30 Leu Asp Gly Gln Gly His Leu Tyr Thr Gln Pro Ile Ala Gln Trp His 35 40 45 Phe Gln Gly Phe Arg Pro Val Tyr Glu Tyr Gln Leu Glu Asp Gly Ser 50 55 60 Thr Ile Cys Ala Thr Pro Asp His Arg Phe Met Thr Thr Arg Gly Gln 65 70 75 80 Met Leu Pro Ile Glu Gln Ile Phe Gln Glu Gly Leu Glu Leu Trp Gln 85 90 95 Val Ala Ile Ala Pro Arg Gln Ala Leu Leu Gln Gly Leu Lys Pro Ala 100 105 110 Val Gln Met Ser Gly 115 17101PRTTrichodesmium erythraeum 17Cys Leu Thr Tyr Glu Thr Glu Ile Met Thr Val Glu Tyr Gly Pro Leu 1 5 10 15 Pro Ile Gly Lys Ile Val Glu Tyr Arg Ile Glu Cys Thr Val Tyr Thr 20 25 30 Val Asp Lys Asn Gly Tyr Ile Tyr Thr Gln Pro Ile Ala Gln Trp His 35 40 45 Asn Arg Gly Met Gln Glu Val Tyr Glu Tyr Ser Leu Glu Asp Gly Thr 50 55 60 Val Ile Arg Ala Thr Pro Glu His Lys Phe Met Thr Glu Asp Gly Gln 65 70 75 80 Met Leu Pro Ile Asp Glu Ile Phe Glu Arg Asn Leu Asp Leu Lys Cys 85 90 95 Leu Gly Thr Leu Glu 100 18117PRTThermosynechococcus vulcanus 18Cys Leu Ser Gly Glu Thr Ala Val Met Thr Val Glu Tyr Gly Ala Ile 1 5 10 15 Pro Ile Arg Arg Leu Val Gln Glu Arg Leu Ile Cys Gln Val Tyr Ser 20 25 30 Leu Asp Pro Gln Gly His Leu Tyr Thr Gln Pro Ile Ala Gln Trp His 35 40 45 Phe Gln Gly Phe Arg Pro Val Tyr Ala Tyr Gln Leu Glu Asp Gly Ser 50 55 60 Thr Ile Cys Ala Thr Pro Asp His Arg Phe Met Thr Thr Ser Gly Gln 65 70 75 80 Met Leu Pro Ile Glu Gln Ile Phe Arg Glu Gly Leu Glu Leu Trp Gln 85 90 95 Val Ala Ile Ala Pro Pro Gly Ala Leu Ala Gln Gly Leu Lys Pro Ala 100 105 110 Val Gln Met Ser Cys 115 19102PRTArtificial SequencePeptide consensus sequence 19Cys Leu Ser Tyr Asp Thr Glu Ile Leu Thr Val Glu Tyr Gly Ala Val 1 5 10 15 Pro Ile Gly Lys Ile Val Glu Glu Asn Ile Glu Cys Thr Val Tyr Ser 20 25 30 Val Asp Glu Asn Gly Phe Val Tyr Thr Gln Pro Ile Ala Gln Trp His 35 40 45 Asp Arg Gly Glu Gln Glu Val Phe Glu Tyr Cys Leu Glu Asp Gly Ser 50 55 60 Thr Ile Arg Ala Thr Lys Asp His Lys Phe Met Thr Glu Asp Gly Glu 65 70 75 80 Met Leu Pro Ile Asp Glu Ile Phe Glu Gln Gly Leu Asp Leu Lys Gln 85 90 95 Val Lys Gly Leu Pro Asp 100 20102PRTArtificial SequencePeptide consensus sequence 20Cys Leu Ser Tyr Glu Thr Glu Ile Leu Thr Val Glu Tyr Gly Leu Leu 1 5 10 15 Pro Ile Gly Lys Ile Val Glu Lys Arg Ile Glu Ser Thr Val Tyr Ser 20 25 30 Val Asp Asn Asn Gly Asn Ile Tyr Thr Gln Pro Val Ala Gln Trp His 35 40 45 Asp Arg Gly Glu Gln Glu Val Phe Glu Tyr Ser Leu Glu Asp Gly Ser 50 55 60 Leu Ile Arg Ala Thr Lys Asp His Lys Phe Met Thr Val Asp Gly Gln 65 70 75 80 Met Leu Pro Ile Asp Glu Ile Phe Glu Arg Glu Leu Asp Leu Met Arg 85 90 95 Val Asp Asn Leu Pro Asn 100 21102PRTNostoc punctiformeMISC_FEATURE(28)..(28)Xaa is Ala or Ser 21Cys Leu Ser Tyr Glu Thr Glu Ile Leu Thr Val Glu Tyr Gly Leu Leu 1 5 10 15 Pro Ile Gly Lys Ile Val Glu Lys Arg Ile Glu Xaa Thr Val Tyr Ser 20 25 30 Val Asp Asn Asn Gly Asn Ile Tyr Thr Gln Pro Val Ala Gln Trp His 35 40 45 Asp Arg Gly Glu Gln Glu Val Phe Glu Tyr Xaa Leu Glu Asp

Gly Ser 50 55 60 Leu Ile Arg Ala Thr Lys Asp His Lys Phe Met Thr Val Asp Gly Gln 65 70 75 80 Met Leu Pro Ile Asp Glu Ile Phe Glu Arg Glu Leu Asp Leu Met Arg 85 90 95 Val Asp Asn Leu Pro Asn 100 22123PRTSynechocystis PCC6803MISC_FEATURE(28)..(28)Xaa is Ala or Ser 22Cys Leu Ser Phe Gly Thr Glu Ile Leu Thr Val Glu Tyr Gly Pro Leu 1 5 10 15 Pro Ile Gly Lys Ile Val Ser Glu Glu Ile Asn Xaa Ser Val Tyr Ser 20 25 30 Val Asp Pro Glu Gly Arg Val Tyr Thr Gln Ala Ile Ala Gln Trp His 35 40 45 Asp Arg Gly Glu Gln Glu Val Leu Glu Tyr Glu Leu Glu Asp Gly Ser 50 55 60 Val Ile Arg Ala Thr Ser Asp His Arg Phe Leu Thr Thr Asp Tyr Gln 65 70 75 80 Leu Leu Ala Ile Glu Glu Ile Phe Ala Arg Gln Leu Asp Leu Leu Thr 85 90 95 Leu Glu Asn Ile Lys Gln Thr Glu Glu Ala Leu Asp Asn His Arg Leu 100 105 110 Pro Phe Pro Leu Leu Asp Ala Gly Thr Ile Lys 115 120 23110PRTAphanothece halophyticaMISC_FEATURE(28)..(28)Xaa is Ala or Ser 23Cys Leu Ser Tyr Asp Thr Glu Ile Trp Thr Val Glu Tyr Gly Ala Met 1 5 10 15 Pro Ile Gly Lys Ile Val Glu Glu Lys Ile Glu Xaa Ser Val Tyr Thr 20 25 30 Val Asp Glu Asn Gly Phe Val Tyr Thr Gln Pro Ile Ala Gln Trp His 35 40 45 Pro Arg Gly Gln Gln Glu Ile Ile Glu Tyr Thr Leu Glu Asp Gly Arg 50 55 60 Lys Ile Arg Ala Thr Lys Asp His Lys Met Met Thr Glu Ser Gly Glu 65 70 75 80 Met Leu Pro Ile Glu Glu Ile Phe Gln Arg Glu Leu Asp Leu Lys Val 85 90 95 Glu Thr Phe His Glu Met Ser Leu Leu Arg Arg Gly Ala Lys 100 105 110 24101PRTAphanizomenon ovalisporumMISC_FEATURE(28)..(28)Xaa is Ala or Ser 24Cys Leu Ser Ala Asp Thr Glu Ile Leu Thr Val Glu Tyr Gly Phe Leu 1 5 10 15 Pro Ile Gly Glu Ile Val Gly Lys Ala Ile Glu Xaa Arg Val Tyr Ser 20 25 30 Val Asp Gly Asn Gly Asn Ile Tyr Thr Gln Ser Ile Ala Gln Trp His 35 40 45 Asn Arg Gly Glu Gln Glu Val Phe Glu Tyr Thr Leu Glu Asp Gly Ser 50 55 60 Ile Ile Arg Ala Thr Lys Asp His Lys Phe Met Thr Thr Asp Gly Glu 65 70 75 80 Met Leu Pro Ile Asp Glu Ile Phe Ala Arg Gln Leu Asp Leu Met Gln 85 90 95 Val Gln Gly Leu His 100 25102PRTAnabaena PCC7120MISC_FEATURE(28)..(28)Xaa is Ala or Ser 25Cys Leu Ser Tyr Asp Thr Glu Val Leu Thr Val Glu Tyr Gly Phe Val 1 5 10 15 Pro Ile Gly Glu Ile Val Glu Lys Gly Ile Glu Xaa Ser Val Phe Ser 20 25 30 Ile Asn Asn Asn Gly Ile Val Tyr Thr Gln Pro Ile Ala Gln Trp His 35 40 45 His Arg Gly Lys Gln Glu Val Phe Glu Tyr Xaa Leu Glu Asp Gly Ser 50 55 60 Ile Ile Lys Ala Thr Lys Asp His Lys Phe Met Thr Gln Asp Gly Lys 65 70 75 80 Met Leu Pro Ile Asp Glu Ile Phe Glu Gln Glu Leu Asp Leu Leu Gln 85 90 95 Val Lys Gly Leu Pro Glu 100 26102PRTAnabaena variabilisMISC_FEATURE(28)..(28)Xaa is Ala or Ser 26Cys Leu Ser Tyr Asp Thr Glu Val Leu Thr Val Glu Tyr Gly Phe Val 1 5 10 15 Pro Ile Gly Glu Ile Val Asp Lys Gly Ile Glu Xaa Ser Val Phe Ser 20 25 30 Ile Asp Ser Asn Gly Ile Val Tyr Thr Gln Pro Ile Ala Gln Trp His 35 40 45 His Arg Gly Lys Gln Glu Val Phe Glu Tyr Xaa Leu Glu Asp Gly Ser 50 55 60 Ile Ile Lys Ala Thr Lys Asp His Lys Phe Met Thr Gln Asp Gly Lys 65 70 75 80 Met Leu Pro Ile Asp Glu Ile Phe Glu Gln Glu Leu Asp Leu Leu Gln 85 90 95 Val Lys Gly Leu Pro Glu 100 27118PRTCylindrospermopsis raciborskiiMISC_FEATURE(28)..(28)Xaa is Ala or Ser 27Cys Leu Ser Tyr Glu Thr Glu Val Leu Thr Leu Glu Tyr Gly Phe Val 1 5 10 15 Pro Ile Gly Glu Ile Val Asn Lys Gln Met Val Xaa Thr Val Phe Ser 20 25 30 Leu Asn Asp Ser Gly Asn Val Tyr Thr Gln Pro Ile Gly Gln Trp His 35 40 45 Asp Arg Gly Val Gln Asp Leu Tyr Glu Tyr Xaa Leu Asp Asp Gly Ser 50 55 60 Thr Ile Arg Ala Thr Lys Asp His Lys Phe Met Thr Thr Gln Gly Glu 65 70 75 80 Met Val Pro Ile Asp Glu Ile Phe His Gln Gly Trp Glu Leu Val Gln 85 90 95 Val Ser Gly Ile Ser Lys Leu Val Gln Gln Arg Thr Leu Pro Phe Ile 100 105 110 Ile Val Asp Arg Lys Leu 115 2899PRTCyanothece CCY0110MISC_FEATURE(28)..(28)Xaa is Ala or Ser 28Cys Leu Ser Tyr Asp Thr Glu Ile Leu Thr Val Glu Tyr Gly Pro Met 1 5 10 15 Pro Ile Gly Lys Ile Val Glu Glu Asn Ile Asn Xaa Ser Val Tyr Thr 20 25 30 Val Asn Lys Asn Gly Phe Val Tyr Thr Gln Ser Ile Ala Gln Trp His 35 40 45 His Arg Gly Glu Gln Glu Val Phe Glu Tyr Tyr Leu Glu Asp Gly Glu 50 55 60 Thr Ile Arg Ala Thr Lys Asp His Lys Phe Met Thr Thr Glu Gly Lys 65 70 75 80 Met Leu Pro Ile Asp Glu Ile Phe Glu Asn Asn Leu Asp Leu Lys Lys 85 90 95 Leu Thr Val 2999PRTCyanothece PCC8801MISC_FEATURE(28)..(28)Xaa is Ala or Ser 29Cys Leu Ser Tyr Asp Thr Glu Ile Leu Thr Val Glu Tyr Gly Ala Ile 1 5 10 15 Pro Ile Gly Lys Val Val Glu Glu Asn Ile Asp Xaa Thr Val Tyr Thr 20 25 30 Val Asp Lys Asn Gly Phe Val Tyr Thr Gln Asn Ile Ala Gln Trp His 35 40 45 Leu Arg Gly Gln Gln Glu Val Phe Glu Tyr Tyr Leu Asp Asp Gly Ser 50 55 60 Ile Leu Arg Ala Thr Lys Asp His Gln Phe Met Thr Leu Glu Gly Glu 65 70 75 80 Met Leu Pro Ile His Glu Ile Phe Glu Arg Gly Leu Glu Leu Lys Lys 85 90 95 Ile Lys Ile 30106PRTCrocosphaera watsoniiMISC_FEATURE(28)..(28)Xaa is Ala or Ser 30Cys Leu Ser Tyr Asp Thr Glu Ile Leu Thr Val Glu Tyr Gly Ala Met 1 5 10 15 Tyr Ile Gly Lys Ile Val Glu Glu Asn Ile Asn Xaa Thr Val Tyr Thr 20 25 30 Val Asp Lys Asn Gly Phe Val Tyr Thr Gln Thr Ile Ala Gln Trp His 35 40 45 Asn Arg Gly Glu Gln Glu Ile Phe Glu Tyr Asp Leu Glu Asp Gly Ser 50 55 60 Lys Ile Lys Ala Thr Lys Asp His Lys Phe Met Thr Ile Asp Gly Glu 65 70 75 80 Met Leu Pro Ile Asp Glu Ile Phe Glu Lys Asn Leu Asp Leu Lys Gln 85 90 95 Val Val Ser His Pro Asp Asp Tyr Leu Val 100 105 31100PRTMicrocystis aeruginosaMISC_FEATURE(28)..(28)Xaa is Ala or Ser 31Cys Leu Gly Gly Glu Thr Leu Ile Leu Thr Glu Glu Tyr Gly Leu Leu 1 5 10 15 Pro Ile Ala Lys Ile Val Ser Glu Glu Ile Asn Xaa Thr Val Tyr Thr 20 25 30 Val Asp Gln Asn Gly Phe Val Tyr Ser Gln Pro Ile Ser Gln Trp His 35 40 45 Glu Arg Gly Leu Gln Glu Val Phe Glu Tyr Thr Leu Glu Asn Gly Gln 50 55 60 Thr Ile Gln Ala Thr Lys Asp His Lys Phe Met Thr Ser Asp Gly Glu 65 70 75 80 Met Leu Ala Ile Asp Thr Ile Phe Glu Arg Gly Leu Asp Leu Lys Ser 85 90 95 Ser Asp Phe Ser 100 32104PRTMicrocoleus chthonoplastesMISC_FEATURE(28)..(28)Xaa is Ala or Ser 32Cys Leu Ser Tyr Asp Thr Gln Ile Leu Thr Val Glu Tyr Gly Ala Val 1 5 10 15 Ala Ile Gly Glu Ile Val Glu Lys Gln Ile Glu Xaa Thr Val Tyr Ser 20 25 30 Val Asp Glu Asn Gly Tyr Val Tyr Thr Gln Pro Ile Ala Gln Trp His 35 40 45 Asn Arg Gly Glu Gln Glu Val Phe Glu Tyr Leu Leu Glu Asp Gly Ala 50 55 60 Thr Ile Arg Ala Thr Lys Asp His Lys Phe Met Thr Asp Glu Asp Gln 65 70 75 80 Met Leu Pro Ile Asp Gln Ile Phe Glu Gln Gly Leu Glu Leu Lys Gln 85 90 95 Val Glu Val Leu Gln Pro Val Phe 100 33112PRTOscillatoria limneticaMISC_FEATURE(28)..(28)Xaa is Ala or Ser 33Cys Leu Ser Tyr Asn Thr Glu Val Leu Thr Val Glu Tyr Gly Pro Leu 1 5 10 15 Pro Ile Gly Lys Ile Val Asp Glu Gln Ile His Xaa Arg Val Tyr Ser 20 25 30 Val Asp Glu Asn Gly Phe Val Tyr Thr Gln Ala Ile Ala Gln Trp His 35 40 45 Asp Arg Gly Tyr Gln Glu Ile Phe Ala Tyr Glu Leu Ala Asp Gly Ser 50 55 60 Val Ile Arg Ala Thr Lys Asp His Gln Phe Met Thr Glu Asp Gly Gln 65 70 75 80 Met Phe Pro Ile Asp Glu Ile Trp Glu Lys Gly Leu Asp Leu Lys Lys 85 90 95 Leu Pro Thr Val Gln Asp Leu Pro Ala Ala Val Gly Tyr Thr Val Ser 100 105 110 34113PRTSynechococcus elongatusMISC_FEATURE(28)..(28)Xaa is Ala or Ser 34Cys Leu Ala Ala Asp Thr Glu Val Leu Thr Val Glu Tyr Gly Pro Ile 1 5 10 15 Ala Ile Gly Lys Leu Val Glu Glu Asn Ile Arg Xaa Gln Val Tyr Xaa 20 25 30 Xaa Asn Pro Asp Gly Tyr Ile Tyr Ser Gln Pro Ile Gly Gln Trp His 35 40 45 Gln Arg Gly Glu Gln Glu Val Ile Glu Tyr Glu Leu Ser Asp Gly Arg 50 55 60 Ile Ile Arg Ala Thr Ala Asp His Arg Phe Met Thr Glu Glu Gly Glu 65 70 75 80 Met Leu Ser Leu Asp Glu Ile Phe Glu Arg Ser Leu Glu Leu Lys Gln 85 90 95 Ile Pro Thr Pro Leu Leu Ala Ile Ala Gln Pro Ser Pro Leu Ala Thr 100 105 110 Ala 35107PRTSynechococcus PCC7002MISC_FEATURE(28)..(28)Xaa is Ala or Ser 35Cys Leu Ala Gly Gly Thr Pro Val Val Thr Val Glu Tyr Gly Val Leu 1 5 10 15 Pro Ile Gln Thr Ile Val Glu Gln Glu Leu Leu Xaa His Val Tyr Ser 20 25 30 Val Asp Ala Gln Gly Leu Ile Tyr Ala Gln Leu Ile Glu Gln Trp His 35 40 45 Gln Arg Gly Asp Arg Leu Leu Tyr Glu Tyr Glu Leu Glu Asn Gly Gln 50 55 60 Met Ile Arg Ala Thr Pro Asp His Arg Phe Leu Thr Thr Thr Gly Glu 65 70 75 80 Leu Leu Pro Ile Asp Glu Ile Phe Thr Gln Asn Leu Asp Leu Ala Ala 85 90 95 Trp Ala Val Pro Asp Ser Leu Pro Arg Thr Ala 100 105 36117PRTThermosynechococcus elongatusMISC_FEATURE(28)..(28)Xaa is Ala or Ser 36Cys Leu Ser Gly Glu Thr Ala Val Met Thr Val Glu Tyr Gly Ala Val 1 5 10 15 Pro Ile Arg Arg Leu Val Gln Glu Arg Leu Ser Xaa His Val Tyr Ser 20 25 30 Leu Asp Gly Gln Gly His Leu Tyr Thr Gln Pro Ile Ala Gln Trp His 35 40 45 Phe Gln Gly Phe Arg Pro Val Tyr Glu Tyr Gln Leu Glu Asp Gly Ser 50 55 60 Thr Ile Xaa Ala Thr Pro Asp His Arg Phe Met Thr Thr Arg Gly Gln 65 70 75 80 Met Leu Pro Ile Glu Gln Ile Phe Gln Glu Gly Leu Glu Leu Trp Gln 85 90 95 Val Ala Ile Ala Pro Arg Gln Ala Leu Leu Gln Gly Leu Lys Pro Ala 100 105 110 Val Gln Met Ser Gly 115 37101PRTTrichodesmium erythraeumMISC_FEATURE(28)..(28)Xaa is Ala or Ser 37Cys Leu Thr Tyr Glu Thr Glu Ile Met Thr Val Glu Tyr Gly Pro Leu 1 5 10 15 Pro Ile Gly Lys Ile Val Glu Tyr Arg Ile Glu Xaa Thr Val Tyr Thr 20 25 30 Val Asp Lys Asn Gly Tyr Ile Tyr Thr Gln Pro Ile Ala Gln Trp His 35 40 45 Asn Arg Gly Met Gln Glu Val Tyr Glu Tyr Ser Leu Glu Asp Gly Thr 50 55 60 Val Ile Arg Ala Thr Pro Glu His Lys Phe Met Thr Glu Asp Gly Gln 65 70 75 80 Met Leu Pro Ile Asp Glu Ile Phe Glu Arg Asn Leu Asp Leu Lys Xaa 85 90 95 Leu Gly Thr Leu Glu 100 38117PRTThermosynechococcus vulcanusMISC_FEATURE(28)..(28)Xaa is Ala or Ser 38Cys Leu Ser Gly Glu Thr Ala Val Met Thr Val Glu Tyr Gly Ala Ile 1 5 10 15 Pro Ile Arg Arg Leu Val Gln Glu Arg Leu Ile Xaa Gln Val Tyr Ser 20 25 30 Leu Asp Pro Gln Gly His Leu Tyr Thr Gln Pro Ile Ala Gln Trp His 35 40 45 Phe Gln Gly Phe Arg Pro Val Tyr Ala Tyr Gln Leu Glu Asp Gly Ser 50 55 60 Thr Ile Xaa Ala Thr Pro Asp His Arg Phe Met Thr Thr Ser Gly Gln 65 70 75 80 Met Leu Pro Ile Glu Gln Ile Phe Arg Glu Gly Leu Glu Leu Trp Gln 85 90 95 Val Ala Ile Ala Pro Pro Gly Ala Leu Ala Gln Gly Leu Lys Pro Ala 100 105 110 Val Gln Met Ser Xaa 115 3936PRTNostoc punctiforme 39Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Asn 35 4036PRTSynechocystis PCC6803 40Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Asn 35 4136PRTAphanothece halophytica 41Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Asn 35 4236PRTAphanizomenon ovalisporum 42Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Asn 35 4336PRTAnabaena PCC7120 43Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Asn 35 4436PRTAnabaena variabilis 44Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Asn 35 4536PRTCylindrospermopsis raciborskii 45Met Val Lys Ile Val Ser

Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Asn 35 4636PRTCyanothece CCY0110 46Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Asn 35 4736PRTCyanothece PCC8801 47Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Asn 35 4836PRTCrocosphaera watsonii 48Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Asn 35 4936PRTMicrocystis aeruginosa 49Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Asn 35 5036PRTMicrocoleus chthonoplastes 50Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Asn 35 5136PRTOscillatoria limnetica 51Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Asn 35 5236PRTSynechococcus elongatus 52Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Asn 35 5336PRTSynechococcus PCC7002 53Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Asn 35 5435PRTThermosynechococcus elongatus 54Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Asn 35 5536PRTTrichodesmium erythraeum 55Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Asn 35 5635PRTThermosynechococcus vulcanus 56Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Asn 35 5736PRTNostoc punctiformeMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 57Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Xaa 35 5836PRTSynechocystis PCC6803MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 58Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Xaa 35 5936PRTAphanothece halophyticaMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 59Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Xaa 35 6036PRTAphanizomenon ovalisporumMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 60Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa 35 6136PRTAnabaena PCC7120MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 61Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa 35 6236PRTAnabaena variabilisMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 62Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa 35 6336PRTCylindrospermopsis raciborskiiMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 63Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Xaa 35 6436PRTCyanothece CCY0110MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 64Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Xaa 35 6536PRTCyanothece PCC8801MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 65Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa 35 6636PRTCrocosphaera watsoniiMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 66Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa 35 6736PRTMicrocystis aeruginosaMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 67Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Xaa 35 6836PRTMicrocoleus chthonoplastesMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 68Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa 35 6936PRTOscillatoria limneticaMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 69Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa 35 7036PRTSynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 70Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Xaa 35 7136PRTSynechococcus PCC7002MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 71Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Xaa 35 7235PRTThermosynechococcus elongatusMISC_FEATURE(35)..(35)Xaa is any amino acid excluding Asn and/or Gln 72Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa 35 7336PRTTrichodesmium erythraeumMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 73Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Xaa 35 7435PRTThermosynechococcus vulcanusMISC_FEATURE(35)..(35)Xaa is any amino acid excluding Asn and/or Gln 74Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa 35 7536PRTNostoc punctiformeMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 75Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Xaa 35 7636PRTSynechocystis PCC6803MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 76Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Xaa 35 7736PRTAphanothece halophyticaMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 77Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Xaa 35 7836PRTAphanizomenon ovalisporumMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 78Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa 35 7936PRTAnabaena PCC7120MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 79Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa 35 8036PRTAnabaena variabilisMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 80Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa 35 8136PRTCylindrospermopsis raciborskiiMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 81Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Xaa 35 8236PRTCyanothece CCY0110MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 82Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Xaa 35 8336PRTCyanothece PCC8801MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 83Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa 35 8436PRTCrocosphaera watsoniiMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 84Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa 35 8536PRTMicrocystis aeruginosaMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 85Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Xaa 35 8636PRTMicrocoleus chthonoplastesMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 86Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa 35 8736PRTOscillatoria limneticaMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine,

2-aminopentoic acid, or 2-aminohexaanoic acid 87Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa 35 8836PRTSynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 88Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Xaa 35 8936PRTSynechococcus PCC7002MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 89Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Xaa 35 9035PRTThermosynechococcus elongatusMISC_FEATURE(35)..(35)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 90Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa 35 9136PRTTrichodesmium erythraeumMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 91Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Xaa 35 9235PRTThermosynechococcus vulcanusMISC_FEATURE(35)..(35)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 92Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa 35 9336PRTNostoc punctiformeMISC_FEATURE(36)..(36)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 93Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Xaa 35 9436PRTSynechocystis PCC6803MISC_FEATURE(36)..(36)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 94Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Xaa 35 9536PRTAphanothece halophyticaMISC_FEATURE(36)..(36)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 95Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Xaa 35 9636PRTAphanizomenon ovalisporumMISC_FEATURE(36)..(36)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 96Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa 35 9736PRTAnabaena PCC7120MISC_FEATURE(36)..(36)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 97Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa 35 9836PRTAnabaena variabilisMISC_FEATURE(36)..(36)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 98Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa 35 9936PRTCylindrospermopsis raciborskiiMISC_FEATURE(36)..(36)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 99Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Xaa 35 10036PRTCyanothece CCY0110MISC_FEATURE(36)..(36)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 100Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Xaa 35 10136PRTCyanothece PCC8801MISC_FEATURE(36)..(36)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 101Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa 35 10236PRTCrocosphaera watsoniiMISC_FEATURE(36)..(36)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 102Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa 35 10336PRTMicrocystis aeruginosaMISC_FEATURE(36)..(36)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 103Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Xaa 35 10436PRTMicrocoleus chthonoplastesMISC_FEATURE(36)..(36)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 104Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa 35 10536PRTOscillatoria limneticaMISC_FEATURE(36)..(36)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 105Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa 35 10636PRTSynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 106Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Xaa 35 10736PRTSynechococcus PCC7002MISC_FEATURE(36)..(36)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 107Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Xaa 35 10835PRTThermosynechococcus elongatusMISC_FEATURE(35)..(35)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 108Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa 35 10936PRTTrichodesmium erythraeumMISC_FEATURE(36)..(36)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 109Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Xaa 35 11035PRTThermosynechococcus vulcanusMISC_FEATURE(35)..(35)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 110Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa 35 11136PRTNostoc punctiforme 111Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Ala 35 11236PRTSynechocystis PCC6803 112Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Ala 35 11336PRTAphanothece halophytica 113Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Ala 35 11436PRTAphanizomenon ovalisporum 114Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Ala 35 11536PRTAnabaena PCC7120 115Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Ala 35 11636PRTAnabaena variabilis 116Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Ala 35 11736PRTCylindrospermopsis raciborskii 117Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Ala 35 11836PRTCyanothece CCY0110 118Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Ala 35 11936PRTCyanothece PCC8801 119Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Ala 35 12036PRTCrocosphaera watsonii 120Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Ala 35 12136PRTMicrocystis aeruginosa 121Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Ala 35 12236PRTMicrocoleus chthonoplastes 122Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Ala 35 12336PRTOscillatoria limnetica 123Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Ala 35 12436PRTSynechococcus elongatus 124Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Ala 35 12536PRTSynechococcus PCC7002 125Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Ala 35 12635PRTThermosynechococcus elongatus 126Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Ala 35 12736PRTTrichodesmium erythraeum 127Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Ala 35 12835PRTThermosynechococcus vulcanus 128Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Ala 35 12939PRTNostoc punctiformeMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 129Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 13039PRTSynechocystis PCC6803MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 130Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn 35 13139PRTAphanothece halophyticaMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 131Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Xaa Xaa Phe Asn 35 13239PRTAphanizomenon ovalisporumMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 132Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 13339PRTAnabaena PCC7120MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 133Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20

25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 13439PRTAnabaena variabilisMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 134Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 13539PRTCylindrospermopsis raciborskiiMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 135Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn 35 13639PRTCyanothece CCY0110MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 136Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 13739PRTCyanothece PCC8801MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 137Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 13839PRTCrocosphaera watsoniiMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 138Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 13939PRTMicrocystis aeruginosaMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 139Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 14039PRTMicrocoleus chthonoplastesMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 140Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 14139PRTOscillatoria limneticaMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 141Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 14239PRTSynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 142Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn 35 14339PRTSynechococcus PCC7002MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 143Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn 35 14438PRTThermosynechococcus elongatusMISC_FEATURE(35)..(35)Xaa is any amino acid excluding Asn and/or Gln 144Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn 35 14539PRTTrichodesmium erythraeumMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 145Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 14638PRTThermosynechococcus vulcanusMISC_FEATURE(35)..(35)Xaa is any amino acid excluding Asn and/or Gln 146Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn 35 14739PRTNostoc punctiformeMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 147Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 14839PRTSynechocystis PCC6803MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 148Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn 35 14939PRTAphanothece halophyticaMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 149Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Xaa Xaa Phe Asn 35 15039PRTAphanizomenon ovalisporumMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 150Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 15139PRTAnabaena PCC7120MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 151Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 15239PRTAnabaena variabilisMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 152Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 15339PRTCylindrospermopsis raciborskiiMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 153Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn 35 15439PRTCyanothece CCY0110MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 154Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 15539PRTCyanothece PCC8801MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 155Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 15639PRTCrocosphaera watsoniiMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 156Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 15739PRTMicrocystis aeruginosaMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 157Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 15839PRTMicrocoleus chthonoplastesMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 158Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 15939PRTOscillatoria limneticaMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 159Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 16039PRTSynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 160Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn 35 16139PRTSynechococcus PCC7002MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 161Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn 35 16238PRTThermosynechococcus elongatusMISC_FEATURE(35)..(35)Xaa is any amino acid excluding Asn and/or Gln 162Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn 35 16339PRTTrichodesmium erythraeumMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 163Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 16438PRTThermosynechococcus vulcanusMISC_FEATURE(35)..(35)Xaa is any amino acid excluding Asn and/or Gln 164Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn 35 16539PRTNostoc punctiformeMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 165Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 16639PRTSynechocystis PCC6803MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 166Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn 35 16739PRTAphanothece halophyticaMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 167Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Xaa Xaa Phe Asn 35 16839PRTAphanizomenon ovalisporumMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 168Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 16939PRTAnabaena PCC7120MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 169Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 17039PRTAnabaena variabilisMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 170Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 17139PRTCylindrospermopsis raciborskiiMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 171Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn 35 17239PRTCyanothece CCY0110MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 172Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 17339PRTCyanothece PCC8801MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 173Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 17439PRTCrocosphaera watsoniiMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 174Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 17539PRTMicrocystis aeruginosaMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 175Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa

Phe Asn 35 17639PRTMicrocoleus chthonoplastesMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 176Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 17739PRTOscillatoria limneticaMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 177Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 17839PRTSynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 178Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn 35 17939PRTSynechococcus PCC7002MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 179Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn 35 18038PRTThermosynechococcus elongatusMISC_FEATURE(35)..(35)Xaa is any amino acid excluding Asn and/or Gln 180Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn 35 18139PRTTrichodesmium erythraeumMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 181Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 18238PRTThermosynechococcus vulcanusMISC_FEATURE(35)..(35)Xaa is any amino acid excluding Asn and/or Gln 182Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn 35 18339PRTNostoc punctiformeMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 183Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 18439PRTSynechocystis PCC6803MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 184Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Xaa Ala Phe Asn 35 18539PRTAphanothece halophyticaMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 185Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Xaa Ala Phe Asn 35 18639PRTAphanizomenon ovalisporumMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 186Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 18739PRTAnabaena PCC7120MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 187Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 18839PRTAnabaena variabilisMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 188Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 18939PRTCylindrospermopsis raciborskiiMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 189Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Xaa Ala Phe Asn 35 19039PRTCyanothece CCY0110MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 190Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 19139PRTCyanothece PCC8801MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 191Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 19239PRTCrocosphaera watsoniiMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 192Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 19339PRTMicrocystis aeruginosaMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 193Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 19439PRTMicrocoleus chthonoplastesMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 194Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 19539PRTOscillatoria limneticaMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 195Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 19639PRTSynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 196Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Xaa Ala Phe Asn 35 19739PRTSynechococcus PCC7002MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 197Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Xaa Ala Phe Asn 35 19838PRTThermosynechococcus elongatusMISC_FEATURE(35)..(35)Xaa is any amino acid excluding Asn and/or Gln 198Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Ala Phe Asn 35 19939PRTTrichodesmium erythraeumMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 199Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 20038PRTThermosynechococcus vulcanusMISC_FEATURE(35)..(35)Xaa is any amino acid excluding Asn and/or Gln 200Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Ala Phe Asn 35 20139PRTNostoc punctiformeMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 201Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 20239PRTSynechocystis PCC6803MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 202Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn 35 20339PRTAphanothece halophyticaMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 203Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Xaa Xaa Phe Asn 35 20439PRTAphanizomenon ovalisporumMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 204Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 20539PRTAnabaena PCC7120MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 205Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 20639PRTAnabaena variabilisMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 206Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 20739PRTCylindrospermopsis raciborskiiMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 207Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn 35 20839PRTCyanothece CCY0110MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 208Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 20939PRTCyanothece PCC8801MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 209Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 21039PRTCrocosphaera watsoniiMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 210Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 21139PRTMicrocystis aeruginosaMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 211Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 21239PRTMicrocoleus chthonoplastesMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 212Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 21339PRTOscillatoria limneticaMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile,

Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 213Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 21439PRTSynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 214Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn 35 21539PRTSynechococcus PCC7002MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 215Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn 35 21638PRTThermosynechococcus elongatusMISC_FEATURE(35)..(35)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 216Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn 35 21739PRTTrichodesmium erythraeumMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 217Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 21838PRTThermosynechococcus vulcanusMISC_FEATURE(35)..(35)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 218Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn 35 21939PRTNostoc punctiformeMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 219Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 22039PRTSynechocystis PCC6803MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 220Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn 35 22139PRTAphanothece halophyticaMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 221Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Xaa Xaa Phe Asn 35 22239PRTAphanizomenon ovalisporumMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 222Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 22339PRTAnabaena PCC7120MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 223Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 22439PRTAnabaena variabilisMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 224Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 22539PRTCylindrospermopsis raciborskiiMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 225Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn 35 22639PRTCyanothece CCY0110MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 226Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 22739PRTCyanothece PCC8801MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 227Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 22839PRTCrocosphaera watsoniiMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 228Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 22939PRTMicrocystis aeruginosaMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 229Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 23039PRTMicrocoleus chthonoplastesMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 230Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 23139PRTOscillatoria limneticaMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 231Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 23239PRTSynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 232Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn 35 23339PRTSynechococcus PCC7002MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 233Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn 35 23438PRTThermosynechococcus elongatusMISC_FEATURE(35)..(35)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 234Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn 35 23539PRTTrichodesmium erythraeumMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 235Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 23638PRTThermosynechococcus vulcanusMISC_FEATURE(35)..(35)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 236Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn 35 23739PRTNostoc punctiformeMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 237Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 23839PRTSynechocystis PCC6803MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 238Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn 35 23939PRTAphanothece halophyticaMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 239Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Xaa Xaa Phe Asn 35 24039PRTAphanizomenon ovalisporumMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 240Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 24139PRTAnabaena PCC7120MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 241Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 24239PRTAnabaena variabilisMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 242Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20

25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 24339PRTCylindrospermopsis raciborskiiMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 243Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn 35 24439PRTCyanothece CCY0110MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 244Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 24539PRTCyanothece PCC8801MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 245Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 24639PRTCrocosphaera watsoniiMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 246Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 24739PRTMicrocystis aeruginosaMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 247Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 24839PRTMicrocoleus chthonoplastesMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 248Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 24939PRTOscillatoria limneticaMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 249Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 25039PRTSynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 250Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn 35 25139PRTSynechococcus PCC7002MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 251Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn 35 25238PRTThermosynechococcus elongatusMISC_FEATURE(35)..(35)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 252Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn 35 25339PRTTrichodesmium erythraeumMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 253Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 25438PRTThermosynechococcus vulcanusMISC_FEATURE(35)..(35)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 254Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn 35 25539PRTNostoc punctiformeMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 255Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 25639PRTSynechocystis PCC6803MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 256Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Xaa Ala Phe Asn 35 25739PRTAphanothece halophyticaMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 257Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Xaa Ala Phe Asn 35 25839PRTAphanizomenon ovalisporumMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 258Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 25939PRTAnabaena PCC7120MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 259Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 26039PRTAnabaena variabilisMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 260Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 26139PRTCylindrospermopsis raciborskiiMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 261Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Xaa Ala Phe Asn 35 26239PRTCyanothece CCY0110MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 262Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 26339PRTCyanothece PCC8801MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 263Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 26439PRTCrocosphaera watsoniiMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 264Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 26539PRTMicrocystis aeruginosaMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 265Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 26639PRTMicrocoleus chthonoplastesMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 266Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 26739PRTOscillatoria limneticaMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 267Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 26839PRTSynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 268Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Xaa Ala Phe Asn 35 26939PRTSynechococcus PCC7002MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 269Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Xaa Ala Phe Asn 35 27038PRTThermosynechococcus elongatusMISC_FEATURE(35)..(35)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 270Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Ala Phe Asn 35 27139PRTTrichodesmium erythraeumMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 271Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 27238PRTThermosynechococcus vulcanusMISC_FEATURE(35)..(35)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 272Met Lys Ile Val Gly Arg

Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Ala Phe Asn 35 27339PRTNostoc punctiformeMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 273Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 27439PRTSynechocystis PCC6803MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 274Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn 35 27539PRTAphanothece halophyticaMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 275Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Xaa Xaa Phe Asn 35 27639PRTAphanizomenon ovalisporumMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 276Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 27739PRTAnabaena PCC7120MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 277Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 27839PRTAnabaena variabilisMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 278Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 27939PRTCylindrospermopsis raciborskiiMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 279Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn 35 28039PRTCyanothece CCY0110MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 280Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 28139PRTCyanothece PCC8801MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 281Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 28239PRTCrocosphaera watsoniiMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 282Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 28339PRTMicrocystis aeruginosaMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 283Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 28439PRTMicrocoleus chthonoplastesMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 284Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 28539PRTOscillatoria limneticaMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 285Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 28639PRTSynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 286Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn 35 28739PRTSynechococcus PCC7002MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 287Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn 35 28838PRTThermosynechococcus elongatusMISC_FEATURE(35)..(35)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 288Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn 35 28939PRTTrichodesmium erythraeumMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 289Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 29038PRTThermosynechococcus vulcanusMISC_FEATURE(35)..(35)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 290Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn 35 29139PRTNostoc punctiformeMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 291Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 29239PRTSynechocystis PCC6803MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 292Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn 35 29339PRTAphanothece halophyticaMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 293Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Xaa Xaa Phe Asn 35 29439PRTAphanizomenon ovalisporumMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 294Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 29539PRTAnabaena PCC7120MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 295Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 29639PRTAnabaena variabilisMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 296Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 29739PRTCylindrospermopsis raciborskiiMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 297Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn 35 29839PRTCyanothece CCY0110MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 298Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 29939PRTCyanothece PCC8801MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 299Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 30039PRTCrocosphaera watsoniiMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 300Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 30139PRTMicrocystis aeruginosaMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 301Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 30239PRTMicrocoleus chthonoplastesMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 302Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 30339PRTOscillatoria limneticaMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 303Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 30439PRTSynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 304Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn 35 30539PRTSynechococcus PCC7002MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 305Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn 35 30638PRTThermosynechococcus elongatusMISC_FEATURE(35)..(35)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 306Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn 35 30739PRTTrichodesmium erythraeumMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 307Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 30838PRTThermosynechococcus vulcanusMISC_FEATURE(35)..(35)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 308Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn 35 30939PRTNostoc punctiformeMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 309Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 31039PRTSynechocystis PCC6803MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 310Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn 35 31139PRTAphanothece halophyticaMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 311Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Xaa Xaa Phe Asn 35 31239PRTAphanizomenon ovalisporumMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 312Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 31339PRTAnabaena PCC7120MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 313Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 31439PRTAnabaena variabilisMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 314Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 31539PRTCylindrospermopsis raciborskiiMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 315Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1

5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn 35 31639PRTCyanothece CCY0110MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 316Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 31739PRTCyanothece PCC8801MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 317Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 31839PRTCrocosphaera watsoniiMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 318Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 31939PRTMicrocystis aeruginosaMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 319Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 32039PRTMicrocoleus chthonoplastesMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 320Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 32139PRTOscillatoria limneticaMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 321Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 32239PRTSynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 322Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn 35 32339PRTSynechococcus PCC7002MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 323Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn 35 32438PRTThermosynechococcus elongatusMISC_FEATURE(35)..(35)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 324Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn 35 32539PRTTrichodesmium erythraeumMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 325Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn 35 32638PRTThermosynechococcus vulcanusMISC_FEATURE(35)..(35)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 326Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn 35 32739PRTNostoc punctiformeMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 327Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 32839PRTSynechocystis PCC6803MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 328Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Xaa Ala Phe Asn 35 32939PRTAphanothece halophyticaMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 329Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Xaa Ala Phe Asn 35 33039PRTAphanizomenon ovalisporumMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 330Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 33139PRTAnabaena PCC7120MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 331Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 33239PRTAnabaena variabilisMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 332Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 33339PRTCylindrospermopsis raciborskiiMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 333Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Xaa Ala Phe Asn 35 33439PRTCyanothece CCY0110MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 334Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 33539PRTCyanothece PCC8801MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 335Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 33639PRTCrocosphaera watsoniiMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 336Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 33739PRTMicrocystis aeruginosaMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 337Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 33839PRTMicrocoleus chthonoplastesMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 338Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 33939PRTOscillatoria limneticaMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 339Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 34039PRTSynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 340Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Xaa Ala Phe Asn 35 34139PRTSynechococcus PCC7002MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 341Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Xaa Ala Phe Asn 35 34238PRTThermosynechococcus elongatusMISC_FEATURE(35)..(35)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 342Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Ala Phe Asn 35 34339PRTTrichodesmium erythraeumMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 343Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn 35 34438PRTThermosynechococcus vulcanusMISC_FEATURE(35)..(35)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 344Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Ala Phe Asn 35 34539PRTNostoc punctiformeMISC_FEATURE(37)..(37)Xaa is any amino acid excluding Cys 345Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Ala Xaa Phe Asn 35 34639PRTSynechocystis PCC6803MISC_FEATURE(37)..(37)Xaa is any amino acid excluding Cys 346Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Ala Xaa Phe Asn 35 34739PRTAphanothece halophyticaMISC_FEATURE(37)..(37)Xaa is any amino acid excluding Cys 347Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Ala Xaa Phe Asn 35 34839PRTAphanizomenon ovalisporumMISC_FEATURE(37)..(37)Xaa is any amino acid excluding Cys 348Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn 35 34939PRTAnabaena PCC7120MISC_FEATURE(37)..(37)Xaa is any amino acid excluding Cys 349Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn 35 35039PRTAnabaena variabilisMISC_FEATURE(37)..(37)Xaa is any amino acid excluding Cys 350Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn 35 35139PRTCylindrospermopsis raciborskiiMISC_FEATURE(37)..(37)Xaa is any amino acid excluding Cys 351Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Ala Xaa Phe Asn 35 35239PRTCyanothece CCY0110MISC_FEATURE(37)..(37)Xaa is any amino acid excluding Cys 352Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn 35 35339PRTCyanothece PCC8801MISC_FEATURE(37)..(37)Xaa is any amino acid excluding Cys 353Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Ala Xaa Phe Asn 35 35439PRTCrocosphaera watsoniiMISC_FEATURE(37)..(37)Xaa is any amino acid excluding Cys 354Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Ala Xaa Phe Asn 35 35539PRTMicrocystis aeruginosaMISC_FEATURE(37)..(37)Xaa is any amino acid excluding Cys 355Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn 35 35639PRTMicrocoleus chthonoplastesMISC_FEATURE(37)..(37)Xaa is any amino acid excluding Cys 356Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn 35 35739PRTOscillatoria limneticaMISC_FEATURE(37)..(37)Xaa is any amino acid excluding Cys 357Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn 35 35839PRTSynechococcus elongatusMISC_FEATURE(37)..(37)Xaa is any amino acid excluding Cys 358Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val

Ala Ser Ala Xaa Phe Asn 35 35939PRTSynechococcus PCC7002MISC_FEATURE(37)..(37)Xaa is any amino acid excluding Cys 359Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Ala Xaa Phe Asn 35 36038PRTThermosynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Cys 360Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Ala Xaa Phe Asn 35 36139PRTTrichodesmium erythraeumMISC_FEATURE(37)..(37)Xaa is any amino acid excluding Cys 361Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn 35 36238PRTThermosynechococcus vulcanusMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Cys 362Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Ala Xaa Phe Asn 35 36339PRTNostoc punctiformeMISC_FEATURE(37)..(37)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 363Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Ala Xaa Phe Asn 35 36439PRTSynechocystis PCC6803MISC_FEATURE(37)..(37)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 364Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Ala Xaa Phe Asn 35 36539PRTAphanothece halophyticaMISC_FEATURE(37)..(37)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 365Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Ala Xaa Phe Asn 35 36639PRTAphanizomenon ovalisporumMISC_FEATURE(37)..(37)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 366Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn 35 36739PRTAnabaena PCC7120MISC_FEATURE(37)..(37)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 367Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn 35 36839PRTAnabaena variabilisMISC_FEATURE(37)..(37)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 368Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn 35 36939PRTCylindrospermopsis raciborskiiMISC_FEATURE(37)..(37)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 369Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Ala Xaa Phe Asn 35 37039PRTCyanothece CCY0110MISC_FEATURE(37)..(37)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 370Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn 35 37139PRTCyanothece PCC8801MISC_FEATURE(37)..(37)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 371Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Ala Xaa Phe Asn 35 37239PRTCrocosphaera watsoniiMISC_FEATURE(37)..(37)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 372Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Ala Xaa Phe Asn 35 37339PRTMicrocystis aeruginosaMISC_FEATURE(37)..(37)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 373Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn 35 37439PRTMicrocoleus chthonoplastesMISC_FEATURE(37)..(37)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 374Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn 35 37539PRTOscillatoria limneticaMISC_FEATURE(37)..(37)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 375Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn 35 37639PRTSynechococcus elongatusMISC_FEATURE(37)..(37)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 376Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Ala Xaa Phe Asn 35 37739PRTSynechococcus PCC7002MISC_FEATURE(37)..(37)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 377Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Ala Xaa Phe Asn 35 37838PRTThermosynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 378Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Ala Xaa Phe Asn 35 37939PRTTrichodesmium erythraeumMISC_FEATURE(37)..(37)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 379Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn 35 38038PRTThermosynechococcus vulcanusMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 380Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Ala Xaa Phe Asn 35 38139PRTNostoc punctiformeMISC_FEATURE(37)..(37)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 381Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Ala Xaa Phe Asn 35 38239PRTSynechocystis PCC6803MISC_FEATURE(37)..(37)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 382Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Ala Xaa Phe Asn 35 38339PRTAphanothece halophyticaMISC_FEATURE(37)..(37)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 383Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Ala Xaa Phe Asn 35 38439PRTAphanizomenon ovalisporumMISC_FEATURE(37)..(37)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 384Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn 35 38539PRTAnabaena PCC7120MISC_FEATURE(37)..(37)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 385Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn 35 38639PRTAnabaena variabilisMISC_FEATURE(37)..(37)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 386Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn 35 38739PRTCylindrospermopsis raciborskiiMISC_FEATURE(37)..(37)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 387Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Ala Xaa Phe Asn 35 38839PRTCyanothece CCY0110MISC_FEATURE(37)..(37)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 388Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn 35 38939PRTCyanothece PCC8801MISC_FEATURE(37)..(37)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 389Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Ala Xaa Phe Asn 35 39039PRTCrocosphaera watsoniiMISC_FEATURE(37)..(37)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 390Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Ala Xaa Phe Asn 35 39139PRTMicrocystis aeruginosaMISC_FEATURE(37)..(37)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 391Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn 35 39239PRTMicrocoleus chthonoplastesMISC_FEATURE(37)..(37)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 392Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn 35 39339PRTOscillatoria limneticaMISC_FEATURE(37)..(37)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 393Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn

35 39439PRTSynechococcus elongatusMISC_FEATURE(37)..(37)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 394Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Ala Xaa Phe Asn 35 39539PRTSynechococcus PCC7002MISC_FEATURE(37)..(37)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 395Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Ala Xaa Phe Asn 35 39638PRTThermosynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 396Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Ala Xaa Phe Asn 35 39739PRTTrichodesmium erythraeumMISC_FEATURE(37)..(37)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 397Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn 35 39838PRTThermosynechococcus vulcanusMISC_FEATURE(36)..(36)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 398Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Ala Xaa Phe Asn 35 39939PRTNostoc punctiforme 399Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Ala Ala Phe Asn 35 40039PRTSynechocystis PCC6803 400Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Ala Ala Phe Asn 35 40139PRTAphanothece halophytica 401Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Ala Ala Phe Asn 35 40239PRTAphanizomenon ovalisporum 402Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Ala Ala Phe Asn 35 40339PRTAnabaena PCC7120 403Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Ala Ala Phe Asn 35 40439PRTAnabaena variabilis 404Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Ala Ala Phe Asn 35 40539PRTCylindrospermopsis raciborskii 405Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Ala Ala Phe Asn 35 40639PRTCyanothece CCY0110 406Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Ala Ala Phe Asn 35 40739PRTCyanothece PCC8801 407Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Ala Ala Phe Asn 35 40839PRTCrocosphaera watsonii 408Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Ala Ala Phe Asn 35 40939PRTMicrocystis aeruginosa 409Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Ala Ala Phe Asn 35 41039PRTMicrocoleus chthonoplastes 410Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Ala Ala Phe Asn 35 41139PRTOscillatoria limnetica 411Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Ala Ala Phe Asn 35 41239PRTSynechococcus elongatus 412Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Ala Ala Phe Asn 35 41339PRTSynechococcus PCC7002 413Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Ala Ala Phe Asn 35 41438PRTThermosynechococcus elongatus 414Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Ala Ala Phe Asn 35 41539PRTTrichodesmium erythraeum 415Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Ala Ala Phe Asn 35 41638PRTThermosynechococcus vulcanus 416Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Ala Ala Phe Asn 35 41743PRTNostoc punctiformeMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 417Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 41843PRTSynechocystis PCC6803MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 418Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 41943PRTAphanothece halophyticaMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 419Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 42043PRTAphanizomenon ovalisporumMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 420Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 42143PRTAnabaena PCC7120MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 421Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 42243PRTAnabaena variabilisMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 422Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 42343PRTCylindrospermopsis raciborskiiMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 423Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 42443PRTCyanothece CCY0110MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 424Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 42543PRTCyanothece PCC8801MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 425Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 42643PRTCrocosphaera watsoniiMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 426Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 42743PRTMicrocystis aeruginosaMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 427Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 42843PRTMicrocoleus chthonoplastesMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 428Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 42943PRTOscillatoria limneticaMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 429Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 43043PRTSynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 430Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 43143PRTSynechococcus PCC7002MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 431Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 43242PRTThermosynechococcus elongatusMISC_FEATURE(35)..(35)Xaa is any amino acid excluding Asn and/or Gln 432Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 43343PRTTrichodesmium erythraeumMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 433Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 43442PRTThermosynechococcus vulcanusMISC_FEATURE(35)..(35)Xaa is any amino acid excluding Asn and/or Gln 434Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 43543PRTNostoc punctiformeMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 435Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 43643PRTSynechocystis PCC6803MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 436Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 43743PRTAphanothece halophyticaMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 437Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 43843PRTAphanizomenon ovalisporumMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 438Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu

20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 43943PRTAnabaena PCC7120MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 439Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 44043PRTAnabaena variabilisMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 440Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 44143PRTCylindrospermopsis raciborskiiMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 441Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 44243PRTCyanothece CCY0110MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 442Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 44343PRTCyanothece PCC8801MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 443Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 44443PRTCrocosphaera watsoniiMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 444Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 44543PRTMicrocystis aeruginosaMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 445Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 44643PRTMicrocoleus chthonoplastesMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 446Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 44743PRTOscillatoria limneticaMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 447Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 44843PRTSynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 448Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 44943PRTSynechococcus PCC7002MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 449Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 45042PRTThermosynechococcus elongatusMISC_FEATURE(35)..(35)Xaa is any amino acid excluding Asn and/or Gln 450Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 45143PRTTrichodesmium erythraeumMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 451Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 45242PRTThermosynechococcus vulcanusMISC_FEATURE(35)..(35)Xaa is any amino acid excluding Asn and/or Gln 452Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 45343PRTNostoc punctiformeMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 453Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 45443PRTSynechocystis PCC6803MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 454Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 45543PRTAphanothece halophyticaMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 455Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 45643PRTAphanizomenon ovalisporumMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 456Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 45743PRTAnabaena PCC7120MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 457Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 45843PRTAnabaena variabilisMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 458Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 45943PRTCylindrospermopsis raciborskiiMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 459Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 46043PRTCyanothece CCY0110MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 460Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 46143PRTCyanothece PCC8801MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 461Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 46243PRTCrocosphaera watsoniiMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 462Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 46343PRTMicrocystis aeruginosaMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 463Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 46443PRTMicrocoleus chthonoplastesMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 464Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 46543PRTOscillatoria limneticaMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 465Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 46643PRTSynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 466Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 46743PRTSynechococcus PCC7002MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 467Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 46842PRTThermosynechococcus elongatusMISC_FEATURE(35)..(35)Xaa is any amino acid excluding Asn and/or Gln 468Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 46943PRTTrichodesmium erythraeumMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 469Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 47042PRTThermosynechococcus vulcanusMISC_FEATURE(35)..(35)Xaa is any amino acid excluding Asn and/or Gln 470Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 47143PRTNostoc punctiformeMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 471Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 47243PRTSynechocystis PCC6803MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 472Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 47343PRTAphanothece halophyticaMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 473Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 47443PRTAphanizomenon ovalisporumMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 474Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 47543PRTAnabaena PCC7120MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 475Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 47643PRTAnabaena variabilisMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 476Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 47743PRTCylindrospermopsis raciborskiiMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 477Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 47843PRTCyanothece CCY0110MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 478Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40

47943PRTCyanothece PCC8801MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 479Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 48043PRTCrocosphaera watsoniiMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 480Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 48143PRTMicrocystis aeruginosaMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 481Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 48243PRTMicrocoleus chthonoplastesMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 482Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 48343PRTOscillatoria limneticaMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 483Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 48443PRTSynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 484Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 48543PRTSynechococcus PCC7002MISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 485Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 48642PRTThermosynechococcus elongatusMISC_FEATURE(35)..(35)Xaa is any amino acid excluding Asn and/or Gln 486Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 48743PRTTrichodesmium erythraeumMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Asn and/or Gln 487Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 48842PRTThermosynechococcus vulcanusMISC_FEATURE(35)..(35)Xaa is any amino acid excluding Asn and/or Gln 488Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 48943PRTNostoc punctiformeMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 489Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 49043PRTSynechocystis PCC6803MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 490Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 49143PRTAphanothece halophyticaMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 491Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 49243PRTAphanizomenon ovalisporumMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 492Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 49343PRTAnabaena PCC7120MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 493Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 49443PRTAnabaena variabilisMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 494Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 49543PRTCylindrospermopsis raciborskiiMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 495Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 49643PRTCyanothece CCY0110MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 496Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 49743PRTCyanothece PCC8801MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 497Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 49843PRTCrocosphaera watsoniiMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 498Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 49943PRTMicrocystis aeruginosaMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 499Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 50043PRTMicrocoleus chthonoplastesMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 500Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 50143PRTOscillatoria limneticaMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 501Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 50243PRTSynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 502Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 50343PRTSynechococcus PCC7002MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 503Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 50442PRTThermosynechococcus elongatusMISC_FEATURE(35)..(35)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 504Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 50543PRTTrichodesmium erythraeumMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 505Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 50642PRTThermosynechococcus vulcanusMISC_FEATURE(35)..(35)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 506Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 50743PRTNostoc punctiformeMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 507Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 50843PRTSynechocystis PCC6803MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 508Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 50943PRTAphanothece halophyticaMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 509Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 51043PRTAphanizomenon ovalisporumMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His,

Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 510Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 51143PRTAnabaena PCC7120MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 511Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 51243PRTAnabaena variabilisMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 512Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 51343PRTCylindrospermopsis raciborskiiMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 513Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 51443PRTCyanothece CCY0110MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 514Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 51543PRTCyanothece PCC8801MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 515Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 51643PRTCrocosphaera watsoniiMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 516Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 51743PRTMicrocystis aeruginosaMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 517Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 51843PRTMicrocoleus chthonoplastesMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 518Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 51943PRTOscillatoria limneticaMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 519Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 52043PRTSynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 520Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 52143PRTSynechococcus PCC7002MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 521Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 52242PRTThermosynechococcus elongatusMISC_FEATURE(35)..(35)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 522Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 52343PRTTrichodesmium erythraeumMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 523Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 52442PRTThermosynechococcus vulcanusMISC_FEATURE(35)..(35)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 524Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 52543PRTNostoc punctiformeMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 525Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 52643PRTSynechocystis PCC6803MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 526Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 52743PRTAphanothece halophyticaMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 527Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 52843PRTAphanizomenon ovalisporumMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 528Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 52943PRTAnabaena PCC7120MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 529Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 53043PRTAnabaena variabilisMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 530Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 53143PRTCylindrospermopsis raciborskiiMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 531Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 53243PRTCyanothece CCY0110MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 532Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 53343PRTCyanothece PCC8801MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 533Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 53443PRTCrocosphaera watsoniiMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 534Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 53543PRTMicrocystis aeruginosaMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 535Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 53643PRTMicrocoleus chthonoplastesMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 536Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 53743PRTOscillatoria limneticaMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 537Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 53843PRTSynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu,

Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 538Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 53943PRTSynechococcus PCC7002MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 539Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 54042PRTThermosynechococcus elongatusMISC_FEATURE(35)..(35)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 540Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 54143PRTTrichodesmium erythraeumMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 541Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 54242PRTThermosynechococcus vulcanusMISC_FEATURE(35)..(35)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 542Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 54343PRTNostoc punctiformeMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 543Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 54443PRTSynechocystis PCC6803MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 544Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 54543PRTAphanothece halophyticaMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 545Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 54643PRTAphanizomenon ovalisporumMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 546Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 54743PRTAnabaena PCC7120MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 547Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 54843PRTAnabaena variabilisMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 548Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 54943PRTCylindrospermopsis raciborskiiMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 549Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 55043PRTCyanothece CCY0110MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 550Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 55143PRTCyanothece PCC8801MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 551Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 55243PRTCrocosphaera watsoniiMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 552Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 55343PRTMicrocystis aeruginosaMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 553Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 55443PRTMicrocoleus chthonoplastesMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 554Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 55543PRTOscillatoria limneticaMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 555Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 55643PRTSynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 556Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 55743PRTSynechococcus PCC7002MISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 557Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 55842PRTThermosynechococcus elongatusMISC_FEATURE(35)..(35)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 558Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 55943PRTTrichodesmium erythraeumMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 559Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 56042PRTThermosynechococcus vulcanusMISC_FEATURE(35)..(35)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 560Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 56143PRTNostoc punctiformeMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 561Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 56243PRTSynechocystis PCC6803MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 562Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 56343PRTAphanothece halophyticaMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 563Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 56443PRTAphanizomenon ovalisporumMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 564Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 56543PRTAnabaena PCC7120MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 565Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 56643PRTAnabaena variabilisMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 566Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 56743PRTCylindrospermopsis raciborskiiMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 567Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 56843PRTCyanothece CCY0110MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 568Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu

20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 56943PRTCyanothece PCC8801MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 569Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 57043PRTCrocosphaera watsoniiMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 570Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 57143PRTMicrocystis aeruginosaMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 571Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 57243PRTMicrocoleus chthonoplastesMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 572Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 57343PRTOscillatoria limneticaMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 573Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 57443PRTSynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 574Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 57543PRTSynechococcus PCC7002MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 575Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 57642PRTThermosynechococcus elongatusMISC_FEATURE(35)..(35)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 576Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 57743PRTTrichodesmium erythraeumMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 577Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 57842PRTThermosynechococcus vulcanusMISC_FEATURE(35)..(35)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 578Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 57943PRTNostoc punctiformeMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 579Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 58043PRTSynechocystis PCC6803MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 580Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 58143PRTAphanothece halophyticaMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 581Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 58243PRTAphanizomenon ovalisporumMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 582Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 58343PRTAnabaena PCC7120MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 583Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 58443PRTAnabaena variabilisMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 584Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 58543PRTCylindrospermopsis raciborskiiMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 585Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 58643PRTCyanothece CCY0110MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 586Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 58743PRTCyanothece PCC8801MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 587Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 58843PRTCrocosphaera watsoniiMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 588Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 58943PRTMicrocystis aeruginosaMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 589Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 59043PRTMicrocoleus chthonoplastesMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 590Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 59143PRTOscillatoria limneticaMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 591Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 59243PRTSynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 592Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 59343PRTSynechococcus PCC7002MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 593Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 59442PRTThermosynechococcus elongatusMISC_FEATURE(35)..(35)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 594Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 59543PRTTrichodesmium erythraeumMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 595Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 59642PRTThermosynechococcus vulcanusMISC_FEATURE(35)..(35)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 596Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 59743PRTNostoc punctiformeMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 597Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 59843PRTSynechocystis PCC6803MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 598Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 59943PRTAphanothece halophyticaMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 599Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 60043PRTAphanizomenon ovalisporumMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 600Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 60143PRTAnabaena PCC7120MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 601Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 60243PRTAnabaena variabilisMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 602Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 60343PRTCylindrospermopsis raciborskiiMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 603Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 60443PRTCyanothece CCY0110MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 604Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 60543PRTCyanothece PCC8801MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 605Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 60643PRTCrocosphaera watsoniiMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 606Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 60743PRTMicrocystis aeruginosaMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 607Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 60843PRTMicrocoleus chthonoplastesMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 608Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 60943PRTOscillatoria limneticaMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 609Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 61043PRTSynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is Ala, Ile

Val Leu, Tyr, Gly or Phe 610Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 61143PRTSynechococcus PCC7002MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 611Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 61242PRTThermosynechococcus elongatusMISC_FEATURE(35)..(35)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 612Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 61343PRTTrichodesmium erythraeumMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 613Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 61442PRTThermosynechococcus vulcanusMISC_FEATURE(35)..(35)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 614Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 61543PRTNostoc punctiformeMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 615Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 61643PRTSynechocystis PCC6803MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 616Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 61743PRTAphanothece halophyticaMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 617Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 61843PRTAphanizomenon ovalisporumMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 618Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 61943PRTAnabaena PCC7120MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 619Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 62043PRTAnabaena variabilisMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 620Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 62143PRTCylindrospermopsis raciborskiiMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 621Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 62243PRTCyanothece CCY0110MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 622Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 62343PRTCyanothece PCC8801MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 623Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 62443PRTCrocosphaera watsoniiMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 624Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 62543PRTMicrocystis aeruginosaMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 625Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 62643PRTMicrocoleus chthonoplastesMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 626Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 62743PRTOscillatoria limneticaMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 627Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 62843PRTSynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 628Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 62943PRTSynechococcus PCC7002MISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 629Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 63042PRTThermosynechococcus elongatusMISC_FEATURE(35)..(35)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 630Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 63143PRTTrichodesmium erythraeumMISC_FEATURE(36)..(36)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 631Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 63242PRTThermosynechococcus vulcanusMISC_FEATURE(35)..(35)Xaa is Ala, Ile Val Leu, Tyr, Gly or Phe 632Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 63343PRTNostoc punctiformeMISC_FEATURE(37)..(37)Xaa is any amino acid excluding Cys 633Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 63439PRTSynechocystis PCC6803MISC_FEATURE(37)..(37)Xaa is any amino acid excluding Cys 634Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Ala Xaa Phe Asn 35 63539PRTAphanothece halophyticaMISC_FEATURE(37)..(37)Xaa is any amino acid excluding Cys 635Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Ala Xaa Phe Asn 35 63643PRTAphanizomenon ovalisporumMISC_FEATURE(37)..(37)Xaa is any amino acid excluding Cys 636Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 63743PRTAnabaena PCC7120MISC_FEATURE(37)..(37)Xaa is any amino acid excluding Cys 637Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 63843PRTAnabaena variabilisMISC_FEATURE(37)..(37)Xaa is any amino acid excluding Cys 638Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 63943PRTCylindrospermopsis raciborskiiMISC_FEATURE(37)..(37)Xaa is any amino acid excluding Cys 639Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 64043PRTCyanothece CCY0110MISC_FEATURE(37)..(37)Xaa is any amino acid excluding Cys 640Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 64143PRTCyanothece PCC8801MISC_FEATURE(37)..(37)Xaa is any amino acid excluding Cys 641Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 64243PRTCrocosphaera watsoniiMISC_FEATURE(37)..(37)Xaa is any amino acid excluding Cys 642Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 64343PRTMicrocystis aeruginosaMISC_FEATURE(37)..(37)Xaa is any amino acid excluding Cys 643Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 64443PRTMicrocoleus chthonoplastesMISC_FEATURE(37)..(37)Xaa is any amino acid excluding Cys 644Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 64543PRTOscillatoria limneticaMISC_FEATURE(37)..(37)Xaa is any amino acid excluding Cys 645Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 64643PRTSynechococcus elongatusMISC_FEATURE(37)..(37)Xaa is any amino acid excluding Cys 646Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 64743PRTSynechococcus PCC7002MISC_FEATURE(37)..(37)Xaa is any amino acid excluding Cys 647Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 64842PRTThermosynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Cys 648Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 64943PRTTrichodesmium erythraeumMISC_FEATURE(37)..(37)Xaa is any amino acid excluding Cys 649Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 65042PRTThermosynechococcus vulcanusMISC_FEATURE(36)..(36)Xaa is any amino acid excluding Cys 650Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 65143PRTNostoc punctiformeMISC_FEATURE(37)..(37)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 651Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1

5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 65243PRTSynechocystis PCC6803MISC_FEATURE(37)..(37)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 652Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 65343PRTAphanothece halophyticaMISC_FEATURE(37)..(37)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 653Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 65443PRTAphanizomenon ovalisporumMISC_FEATURE(37)..(37)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 654Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 65543PRTAnabaena PCC7120MISC_FEATURE(37)..(37)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 655Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 65643PRTAnabaena variabilisMISC_FEATURE(37)..(37)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 656Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 65743PRTCylindrospermopsis raciborskiiMISC_FEATURE(37)..(37)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 657Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 65843PRTCyanothece CCY0110MISC_FEATURE(37)..(37)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 658Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 65943PRTCyanothece PCC8801MISC_FEATURE(37)..(37)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 659Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 66043PRTCrocosphaera watsoniiMISC_FEATURE(37)..(37)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 660Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 66143PRTMicrocystis aeruginosaMISC_FEATURE(37)..(37)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 661Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 66243PRTMicrocoleus chthonoplastesMISC_FEATURE(37)..(37)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 662Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 66343PRTOscillatoria limneticaMISC_FEATURE(37)..(37)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 663Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 66443PRTSynechococcus elongatusMISC_FEATURE(37)..(37)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 664Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 66543PRTSynechococcus PCC7002MISC_FEATURE(37)..(37)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 665Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 66642PRTThermosynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 666Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 66743PRTTrichodesmium erythraeumMISC_FEATURE(37)..(37)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 667Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 66842PRTThermosynechococcus vulcanusMISC_FEATURE(36)..(36)Xaa is Ala, Val, Ile, Ser, Met, His, Leu, Phe, Tyr, Gly or Trp or can be a unnatural aliphatic amino acid residue such as norleucine, 2-aminobutyric acid, nor-valine, 2-aminopentoic acid, or 2-aminohexaanoic acid 668Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 66943PRTNostoc punctiformeMISC_FEATURE(37)..(37)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 669Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 67043PRTSynechocystis PCC6803MISC_FEATURE(37)..(37)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 670Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 67143PRTAphanothece halophyticaMISC_FEATURE(37)..(37)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 671Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 67243PRTAphanizomenon ovalisporumMISC_FEATURE(37)..(37)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 672Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 67343PRTAnabaena PCC7120MISC_FEATURE(37)..(37)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 673Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 67443PRTAnabaena variabilisMISC_FEATURE(37)..(37)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 674Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 67543PRTCylindrospermopsis raciborskiiMISC_FEATURE(37)..(37)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 675Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 67643PRTCyanothece CCY0110MISC_FEATURE(37)..(37)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 676Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 67743PRTCyanothece PCC8801MISC_FEATURE(37)..(37)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 677Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 67843PRTCrocosphaera watsoniiMISC_FEATURE(37)..(37)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 678Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 67943PRTMicrocystis aeruginosaMISC_FEATURE(37)..(37)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 679Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 68043PRTMicrocoleus chthonoplastesMISC_FEATURE(37)..(37)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 680Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 68143PRTOscillatoria limneticaMISC_FEATURE(37)..(37)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 681Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 68243PRTSynechococcus elongatusMISC_FEATURE(37)..(37)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 682Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 68343PRTSynechococcus PCC7002MISC_FEATURE(37)..(37)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 683Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 68442PRTThermosynechococcus elongatusMISC_FEATURE(36)..(36)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 684Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala

Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 68543PRTTrichodesmium erythraeumMISC_FEATURE(37)..(37)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 685Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 68642PRTThermosynechococcus vulcanusMISC_FEATURE(36)..(36)Xaa is Ala, Ile, Val, Leu, Tyr, Gly or Phe 686Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 68743PRTNostoc punctiforme 687Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Ala Ala Phe Asn Ser Gly Gly Cys 35 40 68843PRTSynechocystis PCC6803 688Met Val Lys Val Ile Gly Arg Arg Ser Leu Gly Val Gln Arg Ile Phe 1 5 10 15 Asp Ile Gly Leu Pro Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ala 20 25 30 Ile Ala Ala Ala Ala Phe Asn Ser Gly Gly Cys 35 40 68943PRTAphanothece halophytica 689Met Val Lys Ile Ile Lys Arg Gln Ser Leu Gly Arg Gln Asn Val Tyr 1 5 10 15 Asp Val Cys Val Glu Thr Asp His Asn Phe Val Leu Ala Asn Gly Cys 20 25 30 Val Ala Ser Ala Ala Phe Asn Ser Gly Gly Cys 35 40 69043PRTAphanizomenon ovalisporum 690Met Val Lys Ile Thr Ala Arg Lys Phe Val Gly Arg Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu His His His Asn Phe Ala Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Ala Ala Phe Asn Ser Gly Gly Cys 35 40 69139PRTAnabaena PCC7120 691Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Arg Arg Asp His Asn Phe Phe Ile Lys Asn Gly Leu 20 25 30 Ile Ala Ser Ala Ala Phe Asn 35 69243PRTAnabaena variabilis 692Met Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu 20 25 30 Ile Ala Ser Ala Ala Phe Asn Ser Gly Gly Cys 35 40 69343PRTCylindrospermopsis raciborskii 693Met Val Lys Ile Val Ser Arg Arg Tyr Leu Gly Lys Ala Asp Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Lys Asp His Asn Phe Ile Ile Lys Asn Gly Leu 20 25 30 Val Ala Ser Ala Ala Phe Asn Ser Gly Gly Cys 35 40 69443PRTCyanothece CCY0110 694Met Val Lys Ile Ile Glu Arg Arg Ser Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ser Asn Asn Leu 20 25 30 Ile Ala Ser Ala Ala Phe Asn Ser Gly Gly Cys 35 40 69543PRTCyanothece PCC8801 695Met Val Lys Ile Val Ser Tyr Arg Ser Leu Gly Lys Gln Phe Val Tyr 1 5 10 15 Asp Ile Gly Val Ala Gln Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Ala Ala Phe Asn Ser Gly Gly Cys 35 40 69643PRTCrocosphaera watsonii 696Met Val Lys Ile Ile Gly Cys Arg Ser Leu Gly Thr Gln Lys Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Ser 20 25 30 Ile Ala Ser Ala Ala Phe Asn Ser Gly Gly Cys 35 40 69743PRTMicrocystis aeruginosa 697Met Val Lys Ile Ile Gly Arg Gln Ser Leu Gly Arg Lys Pro Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Gly Asn Gly Leu 20 25 30 Ile Ala Ser Ala Ala Phe Asn Ser Gly Gly Cys 35 40 69843PRTMicrocoleus chthonoplastes 698Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Ala Ala Phe Asn Ser Gly Gly Cys 35 40 69943PRTOscillatoria limnetica 699Met Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu 20 25 30 Ile Ala Ser Ala Ala Phe Asn Ser Gly Gly Cys 35 40 70043PRTSynechococcus elongatus 700Met Val Lys Ile Val Arg Arg Arg Ser Leu Gly Val Gln Pro Val Tyr 1 5 10 15 Asp Leu Gly Val Ala Thr Val His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Val Ala Ser Ala Ala Phe Asn Ser Gly Gly Cys 35 40 70143PRTSynechococcus PCC7002 701Met Val Lys Ile Ile Arg Arg Lys Phe Ile Gly His Ala Pro Thr Tyr 1 5 10 15 Asp Ile Gly Leu Ser Gln Asp His Asn Phe Leu Leu Gly Gln Gly Leu 20 25 30 Ile Ala Ala Ala Ala Phe Asn Ser Gly Gly Cys 35 40 70242PRTThermosynechococcus elongatus 702Met Lys Ile Val Gly Arg Arg Leu Met Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Ala Asp His Asn Phe Val Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Ala Ala Phe Asn Ser Gly Gly Cys 35 40 70343PRTTrichodesmium erythraeum 703Met Val Lys Ile Val Ser Arg Lys Leu Ala Lys Thr Glu Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Thr Lys Asp His Asn Phe Val Leu Ala Asn Gly Leu 20 25 30 Ile Ala Ser Ala Ala Phe Asn Ser Gly Gly Cys 35 40 70442PRTThermosynechococcus vulcanus 704Met Lys Ile Val Gly Arg Arg Leu Val Gly Trp Gln Ala Val Tyr Asp 1 5 10 15 Ile Gly Leu Ala Gly Asp His Asn Phe Leu Leu Ala Asn Gly Ala Ile 20 25 30 Ala Ala Ala Ala Phe Asn Ser Gly Gly Cys 35 40 7054PRTArtificial SequenceLinker 705Ser Gly Gly Cys 1 7068PRTArtificial SequenceLinker 706Ala Ala Phe Asn Ser Gly Gly Cys 1 5 70735PRTArtificial SequenceC-fragment consensus sequence 707Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Asn 35 70835PRTArtificial SequenceC-fragment consensus sequence 708Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa 35 70935PRTArtificial SequenceC-fragment consensus sequence 709Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa 35 71035PRTArtificial SequenceC-fragment consensus sequence 710Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa 35 71135PRTArtificial SequenceC-fragment consensus sequence 711Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Ala 35 71236PRTArtificial SequenceC-fragment consensus sequence 712Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Xaa 35 71336PRTArtificial SequenceC-fragment consensus sequence 713Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Xaa 35 71436PRTArtificial SequenceC-fragment consensus sequence 714Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Xaa 35 71536PRTArtificial SequenceC-fragment consensus sequence 715Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Ala 35 71636PRTArtificial SequenceC-fragment consensus sequence 716Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Xaa 35 71736PRTArtificial SequenceC-fragment consensus sequence 717Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Xaa 35 71836PRTArtificial SequenceC-fragment consensus sequence 718Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Xaa 35 71936PRTArtificial SequenceC-fragment consensus sequence 719Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Ala 35 72036PRTArtificial SequenceC-fragment consensus sequence 720Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Xaa 35 72136PRTArtificial SequenceC-fragment consensus sequence 721Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Xaa 35 72236PRTArtificial SequenceC-fragment consensus sequence 722Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Xaa 35 72336PRTArtificial SequenceC-fragment consensus sequence 723Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Ala 35 72436PRTArtificial SequenceC-fragment consensus sequence 724Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Ala Xaa 35 72536PRTArtificial SequenceC-fragment consensus sequence 725Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Ala Xaa 35 72636PRTArtificial SequenceC-fragment consensus sequence 726Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Ala Xaa 35 72736PRTArtificial SequenceC-fragment consensus sequence 727Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Ala Ala 35 72838PRTArtificial SequenceC-fragment consensus sequence 728Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Xaa Phe Asn 35 72938PRTArtificial SequenceC-fragment consensus sequence 729Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Xaa Phe Asn 35 73038PRTArtificial SequenceC-fragment consensus sequence 730Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Xaa Phe Asn 35 73138PRTArtificial SequenceC-fragment consensus sequence 731Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Ala Phe Asn 35 73238PRTArtificial SequenceC-fragment consensus sequence 732Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Xaa Phe Asn 35 73338PRTArtificial SequenceC-fragment consensus sequence 733Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Xaa Phe Asn 35 73438PRTArtificial SequenceC-fragment consensus sequence 734Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Xaa Phe Asn 35 73538PRTArtificial SequenceC-fragment consensus sequence 735Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Ala Phe Asn 35 73638PRTArtificial SequenceC-fragment consensus sequence 736Val Lys Ile Ile Ser Arg Gln Ser

Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Xaa Phe Asn 35 73738PRTArtificial SequenceC-fragment consensus sequence 737Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Xaa Phe Asn 35 73838PRTArtificial SequenceC-fragment consensus sequence 738Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Xaa Phe Asn 35 73938PRTArtificial SequenceC-fragment consensus sequence 739Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Ala Phe Asn 35 74038PRTArtificial SequenceC-fragment consensus sequence 740Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Ala Xaa Phe Asn 35 74138PRTArtificial SequenceC-fragment consensus sequence 741Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Ala Xaa Phe Asn 35 74238PRTArtificial SequenceC-fragment consensus sequence 742Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Ala Xaa Phe Asn 35 74338PRTArtificial SequenceC-fragment consensus sequence 743Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Ala Ala Phe Asn 35 74442PRTArtificial SequenceC-fragment consensus sequence 744Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 74542PRTArtificial SequenceC-fragment consensus sequence 745Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 74642PRTArtificial SequenceC-fragment consensus sequence 746Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 74742PRTArtificial SequenceC-fragment consensus sequence 747Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 74842PRTArtificial SequenceC-fragment consensus sequence 748Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 74942PRTArtificial SequenceC-fragment consensus sequence 749Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 75042PRTArtificial SequenceC-fragment consensus sequence 750Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 75142PRTArtificial SequenceC-fragment consensus sequence 751Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 75242PRTArtificial SequenceC-fragment consensus sequence 752Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 75342PRTArtificial SequenceC-fragment consensus sequence 753Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 75442PRTArtificial SequenceC-fragment consensus sequence 754Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Xaa Phe Asn Ser Gly Gly Cys 35 40 75542PRTArtificial SequenceC-fragment consensus sequence 755Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Xaa Ala Phe Asn Ser Gly Gly Cys 35 40 75642PRTArtificial SequenceC-fragment consensus sequence 756Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 75742PRTArtificial SequenceC-fragment consensus sequence 757Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 75842PRTArtificial SequenceC-fragment consensus sequence 758Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Ala Xaa Phe Asn Ser Gly Gly Cys 35 40 75942PRTArtificial SequenceC-fragment consensus sequence 759Val Lys Ile Ile Ser Arg Gln Ser Leu Gly Lys Gln Asn Val Tyr Asp 1 5 10 15 Ile Gly Val Glu Lys Asp His Asn Phe Leu Leu Ala Asn Gly Leu Ile 20 25 30 Ala Ser Ala Ala Phe Asn Ser Gly Gly Cys 35 40 76010PRTArtificial Sequencec-myc epitope tag 760Glu Gln Lys Leu Ile Ser Glu Glu Asp Leu 1 5 10 761102PRTArtificial SequenceN-fragment modified consensus sequence 761Cys Leu Ser Tyr Asp Thr Glu Ile Leu Thr Val Glu Tyr Gly Ala Val 1 5 10 15 Pro Ile Gly Lys Ile Val Glu Glu Asn Ile Glu Xaa Thr Val Tyr Ser 20 25 30 Val Asp Glu Asn Gly Phe Val Tyr Thr Gln Pro Ile Ala Gln Trp His 35 40 45 Asp Arg Gly Glu Gln Glu Val Phe Glu Tyr Xaa Leu Glu Asp Gly Ser 50 55 60 Thr Ile Arg Ala Thr Lys Asp His Lys Phe Met Thr Glu Asp Gly Glu 65 70 75 80 Met Leu Pro Ile Asp Glu Ile Phe Glu Gln Gly Leu Asp Leu Lys Gln 85 90 95 Val Lys Gly Leu Pro Asp 100 762196PRTArtificial SequenceSynthetic peptide 762Met His His His His His His Gly Gly Met Gln Ile Phe Val Lys Thr 1 5 10 15 Leu Thr Gly Lys Thr Ile Thr Leu Glu Val Glu Ser Ser Asp Thr Ile 20 25 30 Asp Asn Val Lys Ser Lys Ile Gln Asp Lys Glu Gly Ile Pro Pro Asp 35 40 45 Gln Gln Glu Leu Ile Phe Ala Gly Lys Gln Leu Glu Asp Gly Arg Thr 50 55 60 Leu Ser Asp Tyr Asn Ile Gln Lys Glu Ser Thr Leu His Leu Val Leu 65 70 75 80 Arg Leu Arg Gly Gly Gly Gly Gly Gly Lys Phe Ala Glu Tyr Cys Leu 85 90 95 Ser Tyr Glu Thr Glu Ile Leu Thr Val Glu Tyr Gly Leu Leu Pro Ile 100 105 110 Gly Lys Ile Val Glu Lys Arg Ile Glu Cys Thr Val Tyr Ser Val Asp 115 120 125 Asn Asn Gly Asn Ile Tyr Thr Gln Pro Val Ala Gln Trp His Asp Arg 130 135 140 Gly Glu Gln Glu Val Phe Glu Tyr Cys Leu Glu Asp Gly Ser Leu Ile 145 150 155 160 Arg Ala Thr Lys Asp His Lys Phe Met Thr Val Asp Gly Gln Met Leu 165 170 175 Pro Ile Asp Glu Ile Phe Glu Arg Glu Leu Asp Leu Met Arg Val Asp 180 185 190 Asn Leu Pro Asn 195 763192PRTArtificial SequenceSynthetic peptide 763Met His His His His His His Gly Gly Met Gln Ile Phe Val Lys Thr 1 5 10 15 Leu Thr Gly Lys Thr Ile Thr Leu Glu Val Glu Ser Ser Asp Thr Ile 20 25 30 Asp Asn Val Lys Ser Lys Ile Gln Asp Lys Glu Gly Ile Pro Pro Asp 35 40 45 Gln Gln Glu Leu Ile Phe Ala Gly Lys Gln Leu Glu Asp Gly Arg Thr 50 55 60 Leu Ser Asp Tyr Asn Ile Gln Lys Glu Ser Thr Leu His Leu Val Leu 65 70 75 80 Arg Leu Arg Gly Gly Lys Phe Ala Glu Tyr Cys Leu Ser Tyr Glu Thr 85 90 95 Glu Ile Leu Thr Val Glu Tyr Gly Leu Leu Pro Ile Gly Lys Ile Val 100 105 110 Glu Lys Arg Ile Glu Cys Thr Val Tyr Ser Val Asp Asn Asn Gly Asn 115 120 125 Ile Tyr Thr Gln Pro Val Ala Gln Trp His Asp Arg Gly Glu Gln Glu 130 135 140 Val Phe Glu Tyr Cys Leu Glu Asp Gly Ser Leu Ile Arg Ala Thr Lys 145 150 155 160 Asp His Lys Phe Met Thr Val Asp Gly Gln Met Leu Pro Ile Asp Glu 165 170 175 Ile Phe Glu Arg Glu Leu Asp Leu Met Arg Val Asp Asn Leu Pro Asn 180 185 190 764156PRTArtificial SequenceSynthetic peptide 764Gly Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Asn Cys Phe Asn Ser Gly Leu Val Pro Arg Gly Ser Ala 35 40 45 Ser Met Ser Asp Ser Glu Val Asn Gln Glu Ala Lys Pro Glu Val Lys 50 55 60 Pro Glu Val Lys Pro Glu Thr His Ile Asn Leu Lys Val Ser Asp Gly 65 70 75 80 Ser Ser Glu Ile Phe Phe Lys Ile Lys Lys Thr Thr Pro Leu Arg Arg 85 90 95 Leu Met Glu Ala Phe Ala Lys Arg Gln Gly Lys Glu Met Asp Ser Leu 100 105 110 Arg Phe Leu Tyr Asp Gly Ile Arg Ile Gln Ala Asp Gln Thr Pro Glu 115 120 125 Asp Leu Asp Met Glu Asp Asn Asp Ile Ile Glu Ala His Arg Glu Gln 130 135 140 Ile Gly Gly Tyr Pro Tyr Asp Val Pro Asp Tyr Ala 145 150 155 765283PRTArtificial SequenceSynthetic peptide 765Met Gln Ile Phe Val Lys Thr Leu Thr Gly Lys Thr Ile Thr Leu Glu 1 5 10 15 Val Glu Pro Ser Asp Thr Ile Glu Asn Val Lys Ala Lys Ile Gln Asp 20 25 30 Lys Glu Gly Ile Pro Pro Asp Gln Gln Arg Leu Ile Phe Ala Gly Lys 35 40 45 Gln Leu Glu Asp Gly Arg Thr Leu Ser Asp Tyr Asn Ile Gln Lys Glu 50 55 60 Ser Thr Leu His Leu Val Leu Arg Leu Arg Gly Gly Cys Ile Thr Gly 65 70 75 80 Asp Ala Leu Val Ala Leu Pro Glu Gly Glu Ser Val Arg Ile Ala Asp 85 90 95 Ile Val Pro Gly Ala Arg Pro Asn Ser Asp Asn Ala Ile Asp Leu Lys 100 105 110 Val Leu Asp Arg His Gly Asn Pro Val Leu Ala Asp Arg Leu Phe His 115 120 125 Ser Gly Glu His Pro Val Tyr Thr Val Arg Thr Val Glu Gly Leu Arg 130 135 140 Val Thr Gly Thr Ala Asn His Pro Leu Leu Cys Leu Val Asp Val Ala 145 150 155 160 Gly Val Pro Thr Leu Leu Trp Lys Leu Ile Asp Glu Ile Lys Pro Gly 165 170 175 Asp Tyr Ala Val Ile Gln Arg Ser Ala Phe Ser Val Asp Cys Ala Gly 180 185 190 Phe Ala Arg Gly Lys Pro Glu Phe Ala Pro Thr Thr Tyr Thr Val Gly 195 200 205 Val Pro Gly Leu Val Arg Phe Leu Glu Ala His His Arg Asp Pro Asp 210 215 220 Ala Gln Ala Ile Ala Asp Glu Leu Thr Asp Gly Arg Phe Tyr Tyr Ala 225 230 235 240 Lys Val Ala Ser Val Thr Asp Ala Gly Val Gln Pro Val Tyr Ser Leu 245 250 255 Arg Val Asp Thr Ala Asp His Ala Phe Ile Thr Asn Gly Phe Val Ser 260 265 270 His Ala Thr Glu Ala His His His His His His 275 280 766222PRTArtificial SequenceSynthetic peptide 766Met Gln Ile Phe Val Lys Thr Leu Thr Gly Lys Thr Ile Thr Leu Glu 1 5 10 15 Val Glu Pro Ser Asp Thr Ile Glu Asn Val Lys Ala Lys Ile Gln Asp 20 25 30 Lys Glu Gly Ile Pro Pro Asp Gln Gln Arg Leu Ile Phe Ala Gly Lys 35 40 45 Gln Leu Glu Asp Gly Arg Thr Leu Ser Asp Tyr Asn Ile Gln Lys Glu 50 55 60 Ser Thr Leu His Leu Val Leu Arg Leu Arg Gly Gly Cys Leu Ser Tyr 65 70 75 80 Glu Thr Glu Ile Leu Thr Val Glu Tyr Gly Leu Leu Pro Ile Gly Lys 85 90 95 Ile Val Glu Lys Arg Ile Glu Cys Thr Val Tyr Ser Val Asp Asn Asn 100 105 110 Gly Asn Ile Tyr Thr Gln Pro Val Ala Gln Trp His Asp Arg Gly Glu 115 120 125 Gln Glu Val Phe Glu Tyr Cys Leu Glu Asp Gly Ser Leu Ile Arg Ala 130 135 140 Thr Lys Asp His Lys Phe Met Thr Val Asp Gly Gln Met Leu Pro Ile 145

150 155 160 Asp Glu Ile Phe Glu Arg Glu Leu Asp Leu Met Arg Val Asp Asn Leu 165 170 175 Pro Asn Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val 180 185 190 Tyr Asp Ile Gly Val Glu Arg Asp His Asn Phe Ala Leu Lys Asn Gly 195 200 205 Phe Ile Ala Ser Ala Ala Phe Asn His His His His His His 210 215 220 767222PRTArtificial SequenceSynthetic peptide 767Met Gln Ile Phe Val Lys Thr Leu Thr Gly Lys Thr Ile Thr Leu Glu 1 5 10 15 Val Glu Pro Ser Asp Thr Ile Glu Asn Val Lys Ala Lys Ile Gln Asp 20 25 30 Lys Glu Gly Ile Pro Pro Asp Gln Gln Arg Leu Ile Phe Ala Gly Lys 35 40 45 Gln Leu Glu Asp Gly Arg Thr Leu Ser Asp Tyr Asn Ile Gln Lys Glu 50 55 60 Ser Thr Leu His Leu Val Leu Arg Leu Arg Gly Gly Cys Leu Ser Tyr 65 70 75 80 Asp Thr Glu Val Leu Thr Val Glu Tyr Gly Phe Val Pro Ile Gly Glu 85 90 95 Ile Val Asp Lys Gly Ile Glu Cys Ser Val Phe Ser Ile Asp Ser Asn 100 105 110 Gly Ile Val Tyr Thr Gln Pro Ile Ala Gln Trp His His Arg Gly Lys 115 120 125 Gln Glu Val Phe Glu Tyr Cys Leu Glu Asp Gly Ser Ile Ile Lys Ala 130 135 140 Thr Lys Asp His Lys Phe Met Thr Gln Asp Gly Lys Met Leu Pro Ile 145 150 155 160 Asp Glu Ile Phe Glu Gln Glu Leu Asp Leu Leu Gln Val Lys Gly Leu 165 170 175 Pro Glu Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val 180 185 190 Tyr Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly 195 200 205 Leu Ile Ala Ser Ala Ala Phe Asn His His His His His His 210 215 220 768224PRTArtificial SequenceSynthetic peptide 768Met Gln Ile Phe Val Lys Thr Leu Thr Gly Lys Thr Ile Thr Leu Glu 1 5 10 15 Val Glu Pro Ser Asp Thr Ile Glu Asn Val Lys Ala Lys Ile Gln Asp 20 25 30 Lys Glu Gly Ile Pro Pro Asp Gln Gln Arg Leu Ile Phe Ala Gly Lys 35 40 45 Gln Leu Glu Asp Gly Arg Thr Leu Ser Asp Tyr Asn Ile Gln Lys Glu 50 55 60 Ser Thr Leu His Leu Val Leu Arg Leu Arg Gly Gly Cys Leu Ser Tyr 65 70 75 80 Asp Thr Gln Ile Leu Thr Val Glu Tyr Gly Ala Val Ala Ile Gly Glu 85 90 95 Ile Val Glu Lys Gln Ile Glu Cys Thr Val Tyr Ser Val Asp Glu Asn 100 105 110 Gly Tyr Val Tyr Thr Gln Pro Ile Ala Gln Trp His Asn Arg Gly Glu 115 120 125 Gln Glu Val Phe Glu Tyr Leu Leu Glu Asp Gly Ala Thr Ile Arg Ala 130 135 140 Thr Lys Asp His Lys Phe Met Thr Asp Glu Asp Gln Met Leu Pro Ile 145 150 155 160 Asp Gln Ile Phe Glu Gln Gly Leu Glu Leu Lys Gln Val Glu Val Leu 165 170 175 Gln Pro Val Phe Val Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln 180 185 190 Asn Val Tyr Asp Ile Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala 195 200 205 Ser Gly Glu Ile Ala Ser Ala Ala Phe Asn His His His His His His 210 215 220 769283PRTArtificial SequenceSynthetic peptide 769Met Gln Ile Phe Val Lys Thr Leu Thr Gly Lys Thr Ile Thr Leu Glu 1 5 10 15 Val Glu Pro Ser Asp Thr Ile Glu Asn Val Lys Ala Lys Ile Gln Asp 20 25 30 Lys Glu Gly Ile Pro Pro Asp Gln Gln Arg Leu Ile Phe Ala Gly Lys 35 40 45 Gln Leu Glu Asp Gly Arg Thr Leu Ser Asp Tyr Asn Ile Gln Lys Glu 50 55 60 Ser Thr Leu His Leu Val Leu Arg Leu Arg Gly Gly Cys Ile Thr Gly 65 70 75 80 Asp Ala Leu Val Ala Leu Pro Glu Gly Glu Ser Val Arg Ile Ala Asp 85 90 95 Ile Val Pro Gly Ala Arg Pro Asn Ser Asp Asn Ala Ile Asp Leu Lys 100 105 110 Val Leu Asp Arg His Gly Asn Pro Val Leu Ala Asp Arg Leu Phe His 115 120 125 Ser Gly Glu His Pro Val Tyr Thr Val Arg Thr Val Glu Gly Leu Arg 130 135 140 Val Thr Gly Thr Ala Asn His Pro Leu Leu Cys Leu Val Asp Val Ala 145 150 155 160 Gly Val Pro Thr Leu Leu Trp Lys Leu Ile Asp Glu Ile Lys Pro Gly 165 170 175 Asp Tyr Ala Val Ile Gln Arg Ser Ala Phe Ser Val Asp Cys Ala Gly 180 185 190 Phe Ala Arg Gly Lys Pro Glu Phe Ala Pro Thr Thr Tyr Thr Val Gly 195 200 205 Val Pro Gly Leu Val Arg Phe Leu Glu Ala His His Arg Asp Pro Asp 210 215 220 Ala Gln Ala Ile Ala Asp Glu Leu Thr Asp Gly Arg Phe Tyr Tyr Ala 225 230 235 240 Lys Val Ala Ser Val Thr Asp Ala Gly Val Gln Pro Val Tyr Ser Leu 245 250 255 Arg Val Asp Thr Ala Asp His Ala Phe Ile Thr Asn Gly Phe Val Ser 260 265 270 His Ala Ala Glu Ala His His His His His His 275 280 770201PRTArtificial SequenceSynthetic peptide 770Met Glu Ala Ile Ala Lys Tyr Asp Phe Lys Ala Thr Ala Asp Asp Glu 1 5 10 15 Leu Ser Phe Lys Arg Gly Asp Ile Leu Lys Val Leu Asn Glu Glu Cys 20 25 30 Asp Gln Asn Trp Tyr Lys Ala Glu Leu Asn Gly Lys Asp Gly Phe Ile 35 40 45 Pro Lys Asn Tyr Ile Glu Met Cys Leu Ser Tyr Asp Thr Glu Val Leu 50 55 60 Thr Val Glu Tyr Gly Phe Val Pro Ile Gly Glu Ile Val Asp Lys Gly 65 70 75 80 Ile Glu Cys Ser Val Phe Ser Ile Asp Ser Asn Gly Ile Val Tyr Thr 85 90 95 Gln Pro Ile Ala Gln Trp His His Arg Gly Lys Gln Glu Val Phe Glu 100 105 110 Tyr Cys Leu Glu Asp Gly Ser Ile Ile Lys Ala Thr Lys Asp His Lys 115 120 125 Phe Met Thr Gln Asp Gly Lys Met Leu Pro Ile Asp Glu Ile Phe Glu 130 135 140 Gln Glu Leu Asp Leu Leu Gln Val Lys Gly Leu Pro Glu Ile Lys Ile 145 150 155 160 Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr Asp Ile Gly Val 165 170 175 Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu Ile Ala Ser Ala 180 185 190 Ala Phe Asn His His His His His His 195 200 771202PRTArtificial SequenceSynthetic peptide 771Met Glu Ala Ile Ala Lys Tyr Asp Phe Lys Ala Thr Ala Asp Asp Glu 1 5 10 15 Leu Ser Phe Lys Arg Gly Asp Ile Leu Lys Val Leu Asn Glu Glu Cys 20 25 30 Asp Gln Asn Trp Tyr Lys Ala Glu Leu Asn Gly Lys Asp Gly Phe Ile 35 40 45 Pro Lys Asn Tyr Ile Glu Met Gly Cys Leu Ser Tyr Asp Thr Glu Val 50 55 60 Leu Thr Val Glu Tyr Gly Phe Val Pro Ile Gly Glu Ile Val Asp Lys 65 70 75 80 Gly Ile Glu Cys Ser Val Phe Ser Ile Asp Ser Asn Gly Ile Val Tyr 85 90 95 Thr Gln Pro Ile Ala Gln Trp His His Arg Gly Lys Gln Glu Val Phe 100 105 110 Glu Tyr Cys Leu Glu Asp Gly Ser Ile Ile Lys Ala Thr Lys Asp His 115 120 125 Lys Phe Met Thr Gln Asp Gly Lys Met Leu Pro Ile Asp Glu Ile Phe 130 135 140 Glu Gln Glu Leu Asp Leu Leu Gln Val Lys Gly Leu Pro Glu Ile Lys 145 150 155 160 Ile Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr Asp Ile Gly 165 170 175 Val Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu Ile Ala Ser 180 185 190 Ala Ala Phe Asn His His His His His His 195 200 772203PRTArtificial SequenceSynthetic peptide 772Met Glu Ala Ile Ala Lys Tyr Asp Phe Lys Ala Thr Ala Asp Asp Glu 1 5 10 15 Leu Ser Phe Lys Arg Gly Asp Ile Leu Lys Val Leu Asn Glu Glu Cys 20 25 30 Asp Gln Asn Trp Tyr Lys Ala Glu Leu Asn Gly Lys Asp Gly Phe Ile 35 40 45 Pro Lys Asn Tyr Ile Glu Met Cys Leu Ser Tyr Asp Thr Gln Ile Leu 50 55 60 Thr Val Glu Tyr Gly Ala Val Ala Ile Gly Glu Ile Val Glu Lys Gln 65 70 75 80 Ile Glu Cys Thr Val Tyr Ser Val Asp Glu Asn Gly Tyr Val Tyr Thr 85 90 95 Gln Pro Ile Ala Gln Trp His Asn Arg Gly Glu Gln Glu Val Phe Glu 100 105 110 Tyr Leu Leu Glu Asp Gly Ala Thr Ile Arg Ala Thr Lys Asp His Lys 115 120 125 Phe Met Thr Asp Glu Asp Gln Met Leu Pro Ile Asp Gln Ile Phe Glu 130 135 140 Gln Gly Leu Glu Leu Lys Gln Val Glu Val Leu Gln Pro Val Phe Val 145 150 155 160 Lys Ile Val Arg Arg Gln Ser Leu Gly Val Gln Asn Val Tyr Asp Ile 165 170 175 Gly Val Glu Lys Asp His Asn Phe Cys Leu Ala Ser Gly Glu Ile Ala 180 185 190 Ser Ala Ala Phe Asn His His His His His His 195 200 773243PRTArtificial SequenceSynthetic peptide 773Met Leu Glu Lys His Ser Trp Tyr His Gly Pro Val Ser Arg Asn Ala 1 5 10 15 Ala Glu Tyr Leu Leu Ser Ser Gly Ile Asn Gly Ser Phe Leu Val Arg 20 25 30 Glu Ser Glu Ser Ser Pro Gly Gln Arg Ser Ile Ser Leu Arg Tyr Glu 35 40 45 Gly Arg Val Tyr His Tyr Arg Ile Asn Thr Ala Ser Asp Gly Lys Leu 50 55 60 Tyr Val Ser Ser Glu Ser Arg Phe Asn Thr Leu Ala Glu Leu Val His 65 70 75 80 His His Ser Thr Val Ala Asp Gly Leu Ile Thr Thr Leu His Tyr Pro 85 90 95 Ala Cys Leu Ser Tyr Asp Thr Glu Val Leu Thr Val Glu Tyr Gly Phe 100 105 110 Val Pro Ile Gly Glu Ile Val Asp Lys Gly Ile Glu Cys Ser Val Phe 115 120 125 Ser Ile Asp Ser Asn Gly Ile Val Tyr Thr Gln Pro Ile Ala Gln Trp 130 135 140 His His Arg Gly Lys Gln Glu Val Phe Glu Tyr Cys Leu Glu Asp Gly 145 150 155 160 Ser Ile Ile Lys Ala Thr Lys Asp His Lys Phe Met Thr Gln Asp Gly 165 170 175 Lys Met Leu Pro Ile Asp Glu Ile Phe Glu Gln Glu Leu Asp Leu Leu 180 185 190 Gln Val Lys Gly Leu Pro Glu Ile Lys Ile Ala Ser Arg Lys Phe Leu 195 200 205 Gly Val Glu Asn Val Tyr Asp Ile Gly Val Gly Arg Asp His Asn Phe 210 215 220 Phe Val Lys Asn Gly Leu Ile Ala Ser Ala Ala Phe Asn His His His 225 230 235 240 His His His 774385PRTArtificial SequenceSynthetic peptide 774Met Val Ser Lys Gly Glu Glu Leu Phe Thr Gly Val Val Pro Ile Leu 1 5 10 15 Val Glu Leu Asp Gly Asp Val Asn Gly His Lys Phe Ser Val Ser Gly 20 25 30 Glu Gly Glu Gly Asp Ala Thr Tyr Gly Lys Leu Thr Leu Lys Phe Ile 35 40 45 Cys Thr Thr Gly Lys Leu Pro Val Pro Trp Pro Thr Leu Val Thr Thr 50 55 60 Leu Thr Tyr Gly Val Gln Cys Phe Ser Arg Tyr Pro Asp His Met Lys 65 70 75 80 Gln His Asp Phe Phe Lys Ser Ala Met Pro Glu Gly Tyr Val Gln Glu 85 90 95 Arg Thr Ile Phe Phe Lys Asp Asp Gly Asn Tyr Lys Thr Arg Ala Glu 100 105 110 Val Lys Phe Glu Gly Asp Thr Leu Val Asn Arg Ile Glu Leu Lys Gly 115 120 125 Ile Asp Phe Lys Glu Asp Gly Asn Ile Leu Gly His Lys Leu Glu Tyr 130 135 140 Asn Tyr Asn Ser His Asn Val Tyr Ile Met Ala Asp Lys Gln Lys Asn 145 150 155 160 Gly Ile Lys Val Asn Phe Lys Ile Arg His Asn Ile Glu Asp Gly Ser 165 170 175 Val Gln Leu Ala Asp His Tyr Gln Gln Asn Thr Pro Ile Gly Asp Gly 180 185 190 Pro Val Leu Leu Pro Asp Asn His Tyr Leu Ser Thr Gln Ser Ala Leu 195 200 205 Ser Lys Asp Pro Asn Glu Lys Arg Asp His Met Val Leu Leu Glu Phe 210 215 220 Val Thr Ala Ala Gly Ile Thr Leu Gly Met Asp Glu Leu Tyr Lys Cys 225 230 235 240 Leu Ser Tyr Asp Thr Glu Val Leu Thr Val Glu Tyr Gly Phe Val Pro 245 250 255 Ile Gly Glu Ile Val Asp Lys Gly Ile Glu Cys Ser Val Phe Ser Ile 260 265 270 Asp Ser Asn Gly Ile Val Tyr Thr Gln Pro Ile Ala Gln Trp His His 275 280 285 Arg Gly Lys Gln Glu Val Phe Glu Tyr Cys Leu Glu Asp Gly Ser Ile 290 295 300 Ile Lys Ala Thr Lys Asp His Lys Phe Met Thr Gln Asp Gly Lys Met 305 310 315 320 Leu Pro Ile Asp Glu Ile Phe Glu Gln Glu Leu Asp Leu Leu Gln Val 325 330 335 Lys Gly Leu Pro Glu Ile Lys Ile Ala Ser Arg Lys Phe Leu Gly Val 340 345 350 Glu Asn Val Tyr Asp Ile Gly Val Gly Arg Asp His Asn Phe Phe Val 355 360 365 Lys Asn Gly Leu Ile Ala Ser Ala Ala Phe Asn His His His His His 370 375 380 His 385 775505PRTArtificial SequenceSynthetic peptide 775Met Val Asn Pro Gly Thr Lys Ser Lys Leu Pro Lys Pro Val Gln Asp 1 5 10 15 Leu Ile Lys Met Ile Phe Asp Val Glu Ser Met Lys Lys Ala Met Val 20 25 30 Glu Tyr Glu Ile Asp Leu Gln Lys Met Pro Leu Gly Lys Leu Ser Lys 35 40 45 Arg Gln Ile Gln Ala Ala Tyr Ser Ile Leu Ser Glu Val Gln Gln Ala 50 55 60 Val Ser Gln Gly Ser Ser Asp Ser Gln Ile Leu Asp Leu Ser Asn Arg 65 70 75 80 Phe Tyr Thr Leu Ile Pro His Asp Phe Gly Met Lys Lys Pro Pro Leu 85 90 95 Leu Asn Asn Ala Asp Ser Val Gln Ala Lys Ala Glu Met Leu Asp Asn 100 105 110 Leu Leu Asp Ile Glu Val Ala Tyr Ser Leu Leu Arg Gly Gly Ser Asp 115 120 125 Asp Ser Ser Lys Asp Pro Ile Asp Val Asn Tyr Glu Lys Leu Lys Thr 130 135 140 Asp Ile Lys Val Val Asp Arg Asp Ser Glu Glu Ala Glu Ile Ile Arg 145 150 155 160 Lys Tyr Val Lys Asn Thr His Ala Thr Thr His Asn Ala Tyr Asp Leu 165 170 175 Glu Val Ile Asp Ile Phe Lys Ile Glu Arg Glu Gly Glu Cys Gln Arg 180 185 190 Tyr Lys Pro Phe Lys Gln Leu His Asn Arg Arg Leu Leu Trp His Gly 195 200 205 Ser Arg Thr Thr Asn Phe Ala

Gly Ile Leu Ser Gln Gly Leu Arg Ile 210 215 220 Ala Pro Pro Glu Ala Pro Val Thr Gly Tyr Met Phe Gly Lys Gly Ile 225 230 235 240 Tyr Phe Ala Asp Met Val Ser Lys Ser Ala Asn Tyr Cys His Thr Ser 245 250 255 Gln Gly Asp Pro Ile Gly Leu Ile Leu Leu Gly Glu Val Ala Leu Gly 260 265 270 Asn Met Tyr Glu Leu Lys His Ala Ser His Ile Ser Lys Leu Pro Lys 275 280 285 Gly Lys His Ser Val Lys Gly Leu Gly Lys Thr Thr Pro Asp Pro Ser 290 295 300 Ala Asn Ile Ser Leu Asp Gly Val Asp Val Pro Leu Gly Thr Gly Ile 305 310 315 320 Ser Ser Gly Val Asn Asp Thr Ser Leu Leu Tyr Asn Glu Tyr Ile Val 325 330 335 Tyr Asp Ile Ala Gln Val Asn Leu Lys Tyr Leu Leu Lys Leu Lys Phe 340 345 350 Asn Phe Lys Thr Ser Leu Trp Cys Leu Ser Tyr Asp Thr Glu Val Leu 355 360 365 Thr Val Glu Tyr Gly Phe Val Pro Ile Gly Glu Ile Val Asp Lys Gly 370 375 380 Ile Glu Cys Ser Val Phe Ser Ile Asp Ser Asn Gly Ile Val Tyr Thr 385 390 395 400 Gln Pro Ile Ala Gln Trp His His Arg Gly Lys Gln Glu Val Phe Glu 405 410 415 Tyr Cys Leu Glu Asp Gly Ser Ile Ile Lys Ala Thr Lys Asp His Lys 420 425 430 Phe Met Thr Gln Asp Gly Lys Met Leu Pro Ile Asp Glu Ile Phe Glu 435 440 445 Gln Glu Leu Asp Leu Leu Gln Val Lys Gly Leu Pro Glu Ile Lys Ile 450 455 460 Ala Ser Arg Lys Phe Leu Gly Val Glu Asn Val Tyr Asp Ile Gly Val 465 470 475 480 Gly Arg Asp His Asn Phe Phe Val Lys Asn Gly Leu Ile Ala Ser Ala 485 490 495 Ala Phe Asn His His His His His His 500 505 77639PRTNostoc punctiforme 776Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Asp Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Asn Cys Phe Asn 35 77743PRTNostoc punctiforme 777Met Ile Lys Ile Ala Thr Arg Lys Tyr Leu Gly Lys Gln Asn Val Tyr 1 5 10 15 Asp Ile Gly Val Glu Arg Asp His Asn Asp Ala Leu Lys Asn Gly Phe 20 25 30 Ile Ala Ser Ala Ala Phe Asn Ser Gly Gly Cys 35 40

Claims

1. A fusion protein comprising a split intein N-fragment and a polypeptide, wherein the split intein N-fragment comprises a sequence selected from the group consisting of SEQ ID NOs: 1-19, or a variant thereof.

2. The fusion protein of claim 1, wherein the split intein N-fragment comprises a sequence of SEQ ID NO: 19, or a variant thereof.

3. The fusion protein of claim 1, wherein the split intein N-fragment comprises a sequence selected from the group consisting of SEQ ID NO: 20-38 and 761, or a variant thereof.

4. The fusion protein of claim 1, wherein the polypeptide has a molecular weight of 40 kDa or greater.

5. The fusion protein of claim 4, wherein the polypeptide is an antibody or fragment thereof.

6. The fusion protein of claim 5 wherein the antibody is an IgG antibody or fragment thereof.

7. The fusion protein of claim 6, wherein a heavy chain of the antibody is fused to the split intein N-fragment.

8. The fusion protein of claim 7, wherein each heavy chain of the antibody is fused to the split intein N-fragment.

9. The fusion protein of claim 6, wherein a light chain of the antibody is fused to the split intein N-fragment.

10. The fusion protein of claim 1, wherein the polypeptide is secreted from a cell.

11. A complex comprising the fusion protein of claim 1 and the split intein C-fragment of claim 12.

12. A split intein C-fragment comprising a sequence selected from the group consisting of SEQ ID NOs: 57-74, or a variant thereof.

13. The split intein C-fragment of claim 12 comprising a sequence selected from the group consisting of SEQ ID NOs: 75-128, or a variant thereof.

14. The split intein C-fragment of claim 12 comprising a sequence of SEQ ID NO: 707, or a variant thereof.

15. The split intein C-fragment of claim 14 comprising a sequence selected from the group consisting of SEQ ID NOs: 708-711, or a variant thereof.

16. The split intein C-fragment of claim 12 attached to a support.

17. The split intein C-fragment of claim 16, wherein the support comprises a particle, a bead, a resin, or a slide.

18. The split intein C-fragment of claim 17, wherein the split intein C-fragment comprises a sequence selected from the group consisting of SEQ ID NOs: 417-704 and 745-759, or a variant thereof.

19. A method comprising (a) contacting (1) a fusion protein comprising a polypeptide and a split intein N-fragment comprising a sequence selected from the group consisting of SEQ ID NO: 1-19, or a variant thereof, and (2) a split intein C-fragment comprising a sequence selected from the group consisting of SEQ ID NO: 57-74, or a variant thereof, wherein contacting is performed under conditions that permit binding of the split intein N-fragment to the split intein C-fragment to form an intein intermediate; and (b) contacting the intein intermediate with a nucleophile to form a conjugate of the protein and the nucleophile.

20-34. (canceled)

Images