Patent application title: AGROBACTERIUM FOR TRANSIENT TRANSFECTION OF WHOLE PLANTS
Inventors:
Patrick Roemer (Zoerbig, DE)
Luisa Bortesi (Aachen, DE)
Doreen Tiede (Kothen, DE)
Anatoli Giritch (Halle, DE)
Yuri Gleba (Berlin, DE)
IPC8 Class: AC12N1582FI
USPC Class:
800294
Class name: Multicellular living organisms and unmodified parts thereof and related processes method of introducing a polynucleotide molecule into or rearrangement of genetic material within a plant or plant part via agrobacterium
Publication date: 2015-02-19
Patent application number: 20150052638
Abstract:
A process of transiently transfecting a plant or leaves on a plant,
comprising contacting said plant or said leaves with a suspension
comprising Agrobacterium cells of strain CryX or a derivative strain of
strain CryX, wherein said derivative strain has the chromosomal
background of strain CryX or said derivative strain contains the vir
plasmid of strain CryX or a derivative of said vir plasmid.Claims:
1. A process of transiently transfecting a plant or leaves on a plant,
comprising contacting said plant or said leaves with a suspension
comprising Agrobacterium cells of strain CryX or a derivative strain of
strain CryX, wherein said derivative strain has the chromosomal
background of strain CryX or said derivative strain contains the vir
plasmid of strain CryX or a derivative of said vir plasmid.
2. A process of transiently expressing a DNA sequence of interest in a plant, comprising contacting said plant or said leaves on said plant with a suspension comprising Agrobacterium cells of strain CryX or a derivative strain of strain CryX, wherein said derivative strain has the chromosomal background of strain CryX or said derivative strain contains the vir plasmid of strain CryX or a derivative of said vir plasmid.
3. The process according to claim 1, wherein said strain CryX or said derivative strain contains a binary vector having T-DNA comprising a DNA sequence of interest to be transfected into cells of said plant or leaves.
4. The process according to claim 1, wherein said strain CryX or said derivative strain contains a disarmed vir plasmid or disarmed Ti-plasmid.
5. The process according to claim 1, wherein said derivative strain of strain CryX contains a vir plasmid that is a derivative of the vir plasmid of strain CryX, and said derivative strain achieves at least 70% of the T-DNA transfer efficiency from a T-DNA-containing binary vector into plant cells of the T-DNA transfer efficiency with strain CryX.
6. The process according to claim 1, wherein said derivative of the vir plasmid of strain CryX encodes the virG protein of strain CryX.
7. The process according to claim 6, wherein said derivative of the vir plasmid of strain CryX contains the vir region of the vir plasmid of strain CryX.
8. The process according to claim 3, wherein said binary vector comprises a virG gene expressible in said strain CryX or said derivative strain.
9. The process according to claim 8, wherein said virG gene encodes a VirG protein from Agrobacterium tumefaciens strain LBA4404 of SEQ ID NO: 1, or is an N54D mutant of the VirG protein encoded by the virG gene from A. tumefaciens strain LBA4404.
10. The process according to claim 1, wherein said derivative of the vir plasmid of strain CryX is obtained by introducing a T-DNA of interest into the vir plasmid of strain CryX.
11. The process according to claim 1, wherein said plant or said leaves on a plant are contacted with said suspension by spraying or by vacuum infiltrating said plant or said leaves on a plant with said suspension.
12. The process according to claim 1, wherein said plant is a dicot plant such as Nicotiana benthamiana, tobacco, cotton, soybean, rapeseed, pepper, potato, tomato, or a monocot plant.
13. The process according to claim 1, wherein said Agrobacterium strain CryX is the strain having DSM accession No: DSM25686.
14. Agrobacterium strain CryX having DSM accession No: DSM25686 or a derivative strain of strain CryX, wherein said derivative strain has the chromosomal background of strain CryX, or said derivative strain contains the vir plasmid of strain CryX or a derivative of said vir plasmid; or an Agrobacterium cell of strain CryX or of said derivative strain.
15. The Agrobacterium cell according to claim 14, wherein said cell further comprises a binary vector comprising a T-DNA comprising a DNA sequence of interest to be transfected into a plant.
16. A kit comprising an Agrobacterium cell of said strain or said derivative strain as defined in claim 14 and a vector containing in T-DNA a DNA sequence of interest to be transfected into cells of a plant.
17. Vir plasmid of Agrobacterium strain CryX having DSM accession No: DSM25686.
18. Agrobacterium cells having the chromosome of strain CryX having DSM accession No: DSM25686.
19. Aqueous cell suspension of Agrobacterium strain CryX having DSM accession No: DSM25686 or a derivative strain of strain CryX, said suspension having a cell concentration of at most 1.110.sup.6 cfu/ml of the suspension, preferably at most 4.410.sup.5 cfu/ml of the suspension, and more preferably of at most 1.110.sup.5 cfu/ml of the suspension.
Description:
FIELD OF THE INVENTION
[0001] The present invention relates to a process of transiently transfecting a plant or leaves on a plant. The invention also relates to a process of transiently expressing a DNA sequence of interest in a plant or in leaves on a plant. Further, the invention relates to an Agrobacterium strain.
BACKGROUND OF THE INVENTION
[0002] Current genetic engineering processes for agriculture are all based on stable genetic modification of crop species, demonstrated first in 1983 (Fraley et al 1983; Barton et al 1983) and commercialized since 1996. Although agriculture processes based on plant stable genetic transformation is a reality today and is a basis of successful new practices, it has multiple limitations, the main ones being very long time and high cost required for development of transgenic crops. General consensus among the companies involved in plant biotechnology is that the R&D process requires, depending on the crop species, between 8 and 16 years, and the total average development cost is estimated to be between $100 and $150 million. Because of these limitations, after more than 25 years since the discovery of a plant genetic transformation process, only a handful traits and few GM crop species have been commercialized thus far.
[0003] It is known that plant cells and whole plants can also be re-programmed transiently (i.e. without stable integration of new genetic material on a plant chromosome), and the transient processes, such as viral infections, are fast. Such transient processes could in principle allow a very fast modification of plant metabolism in favor of certain products that are of interest to the user. Such processes require a DNA or RNA vector (a virus or a bacterium), that has been engineered to effectively and safely transfect the plant. Earlier attempts to use vectors based on plant viruses have been partially successful in that they allow transfection of plants for manufacturing of high-value recombinant proteins such as certain biopharmaceuticals (Gleba et al 2007, 2008; Lico et al 2008). Use of viruses for manipulation of other traits, such as input traits (for example, herbicide resistance, Shiboleth et al 2001; Zhang and Ghabiral 2006) have been described in the literature, but virus transfection introduces so many undesired changes in the infected host that this kind of transient process is not pursued anymore for input traits. Transient processes can also be built around the ability of Agrobacterium species to transfer part of their Ti plasmid to eukaryotic, in particular, plant cells. Use of Agrobacterium-based transfection is a basis for genetic manipulations such as genetic transformation protocols and of laboratory transient transfection assays. Industrial applications of Agrobacterium-based transfection have also been limited to recombinant protein manufacturing, because the optimal application conditions such as vacuum infiltration of plants with bacterial suspensions cannot be used on a large scale in the field, whereas spraying aerial parts or watering plants with bacterial solutions results in a supposedly very small proportion of plant cells to be transfected, and previous studies simply did not address that specific question.
[0004] Agrobacterium tumefaciens and A. rhizogenes are broadly used in research laboratories worldwide for transient transfection and stable genetic transformation of plants. These applications are based on the ability of Agrobacterium to transfer genetic information to eukaryotic cells. Many of the transgenic plants cultivated today, such as soybeans, canola and cotton, have been generated through Agrobacterium-mediated genetic transformation. The essential difference between the transient and stable transformation is that in the process of stable transformation, Agrobacterium-delivered DNA is eventually integrated into a plant chromosome, and is afterwards inherited by the plant progeny. Such integration events are rare even in laboratory experiments specifically designed to provide massive contacts between plant cells and bacteria; thus for the selection of stable transformants, specific selective screening methods have to be utilized and specific plant explants (rich in meristematic tissues) selected for optimum transformation and regeneration into whole plants are employed. Subsequently, the knowledge accumulated in this science domain is of limited value to those interested in transient processes where many cells of the plant body should be affected without selection for transfected cells.
[0005] Transient transfection, on the other hand, takes into account only earlier steps of Agrobacterium-driven DNA delivery into a nucleus of a plant cell, along with the fact that such delivered DNA molecules can be transcribed in a nucleus even in the absence of DNA integration into a plant chromosome, such expression resulting in a transient metabolic reprogramming of a plant cell. Such reprogramming has been developed into a laboratory tool for rapid evaluation of different genetic experiments. Whereas there is considerable body of knowledge about Agrobacterium-mediated DNA transfer to plant cells, that information is invariably limited to laboratory scale experiments, and thus far, there were very few attempts to develop industrial scale applications involving Agrobacterium as a DNA vector.
[0006] One of the limitations of laboratory applications is the fact that Agrobacterium-based DNA delivery requires certain treatments that are difficult or impossible to apply in open field or on a large scale. In typical transient experiments, cultured plant cells or parts of plants (explants) are treated with an excess of bacteria to provide for maximum delivery. In typical research experiments, one is also interested in expression levels that are not economically viable if done on an industrial scale. In general, the research done in this domain has led the inventors to the conclusion that the parameters seriously affecting transient expression are those allowing for the best interaction access of agrobacteria to plant cells within a plant body. Most such studies utilize vacuum infiltration, injection into plant leaf or surfactant treatment, wounding of plant surface e.g. with razor blades, or combination thereof. In fact, the only group that is developing an Agrobacterium-based transfection process for commercial production of recombinant proteins that does not involve further (virus-based) amplification of the original DNA, is the group of Medicago (D'Aoust et al 2008, 2009; Vezina et al, 2009). Their process relies entirely on vacuum infiltration as a delivery method. However, because of being based on great excess of bacteria to plant cell ratio, current laboratory protocols used for transient transfection of plants do not have serious translational value, i.e. they cannot be directly replicated on an industrial level. Except in few cases (e.g. Vaquero et al, 1999, D'Aoust et al, 2008, 2009) they also have not addressed quantitatively the issue of efficiency of the transient transfection process. (Examples of such research are multiple, we provide a citation for just a few representative ones: Li et al, 1992; Liu et al, 1992; Clough and Bent, 1998; De Buck et al, 1998, 2000; Chung et al, 2000; Yang et al, 2000; Zambre et al, 2003; Wroblewski et al, 2005; Lee and Yang, 2006; Zhao et al, 2006; Shang et al, 2007; Jones et al., 2009; Li et al, 2009; De Felippes and Weigel, 2010).
[0007] One of the industrial processes being under development today is magnifection, a process that is based on vacuum-infiltration of agrobacteria into leaves of plants. The magnifection process (trademarked by Icon Genetics GmbH as magnICON® and covered by several patents/patent applications) is a simple and indefinitely scalable protocol for heterologous protein expression in plants, which is devoid of stable genetic transformation of a plant, but instead relies on transient amplification of viral vectors delivered to multiple areas of a plant body (systemic delivery) by Agrobacterium as DNA precursors. Such a process is in essence an infiltration of whole mature plants with a diluted suspension of agrobacteria carrying T-DNAs encoding viral RNA replicons. In this process, the bacteria assume the (formerly viral) functions of primary infection and systemic movement, whereas the viral vector provides for cell-to-cell (short distance) spread, amplification and high-level protein expression. The scale-up (industrial) version is built around fully assembled viral vectors (rather than pro-vectors requiring in planta assembly) and requires apparatuses for high-throughput Agrobacterium delivery to whole plants by vacuum infiltration. The process can be scaled up but it requires submersion of aerial parts of plants into bacterial suspension under vacuum (the process involves inverting plants grown in pots or in trays), a procedure that imposes limitations on the volumes of biomass that can be treated in this way, on the throughput of the process, on the ways the plants can be cultivated prior to treatment, and it also carries certain costs that limit the use of the process to high-cost products, such as recombinant biopharmaceuticals only. The magnifection process is efficient as it allows transfection of almost all leaf cells in treated plants, or approximately 50% of the total aerial plant biomass (the rest being stems and leaf petioles). The process has been optimized in many ways, see e.g. Marillonnet et al, 2005. However, the current process has been built entirely around bacterial delivery methods such as injection into a plant leaf or vacuum-infiltration (e.g. Simmons et al, 2009), wounding of leaves (Andrews and Curtis, 2005), or pouring agrobacteria into soil (`agrodrenching`, Ryu et al, 2004; Yang et al, 2008), but these methods can not be applied for the mass treatment of the plants in a field (reviewed in Gleba et al, 2004, 2007, 2008; Gleba & Giritch, 2010, 2011; Lico et al, 2008; original articles of our group include Giritch et al. 2006; Marillonnet et al., 2004, 2005; Santi et al, 2006; and ideologically similar papers from other research groups--Voinnet et al, 2003; Sudarshana et al, 2006; Gao et al, 2006; Mett et al, 2007; Lindbo, 2007a,b; Plesha et al, 2007, 2009; Huang et al, 2006; Regnard et al 2009; Green et al, 2009; Shoji et al, 2009).
[0008] Attempts to use Agrobacterium treatment on whole plants (in planta) without vacuum-infiltration have resulted in a very low number of initially transfected cells, thus greatly limiting the practical application of the process. Moreover, since no selection for transfected plant cells is done in transient transfection systems, the entire transient transfection process is of too low efficiency for large scale applications if vacuum-infiltration is to be avoided. Further, several plant species such as soybean or rape seed are difficult to transfect by Agrobacterium, unless specific plant tissue is used, whereby in planta transient transfection has not been achieved to a significant extent.
SUMMARY OF THE INVENTION
[0009] Departing from the prior art, it is an object of the present invention to provide an efficient process of transient in planta transfection. It is another object of the invention to provide an efficient process of transiently expressing a DNA sequence of interest in planta. Further, it is an object of the invention to provide an efficient process allowing transient plant . transfection using Agrobacterium on a large (industrial) scale (i.e. to many plants in parallel) without the need for the application of pressure differences to introduce Agrobacterium into the intercellular space of plants. It is also an object to provide an Agrobacterium cell and strain suitable for this purpose.
[0010] These problems are solved by a process of transiently transfecting a plant or leaves on a plant, comprising contacting said plant or said leaves with a suspension comprising Agrobacterium cells of strain CryX deposited under accession No: DSM25686 or a derivative strain of strain CryX, wherein said derivative strain has the chromosomal background of strain CryX or said derivative strain contains the vir plasmid of strain CryX or a derivative of said vir plasmid.
[0011] Further provided is a process of transiently expressing a DNA sequence of interest in a plant, comprising contacting said plant or said leaves on said plant with a suspension comprising Agrobacterium cells of strain CryX deposited under accession No: DSM25686 or a derivative strain of strain CryX, wherein said derivative strain has the chromosomal background of strain CryX or said derivative strain contains the vir plasmid of strain CryX or a derivative of said vir plasmid.
[0012] The invention also provides an Agrobacterium strain CryX having DSM accession No: DSM25686 or a derivative strain of strain CryX, wherein said derivative strain has the chromosomal background of strain CryX, or said derivative strain contains the vir plasmid of strain CryX or a derivative of said vir plasmid; or an Agrobacterium cell of strain CryX or of said derivative strain.
[0013] The invention also provides Agrobacterium cells of strain CryX having DSM accession No: DSM25686 or a derivative thereof, said cells containing a binary vector containing in T-DNA a DNA sequence of interest to be transfected into cells of a plant, wherein the binary vector may encode a VirG protein from strain CryX or a closely related VirG protein as defined below.
[0014] The invention further provides a kit comprising:
[0015] an Agrobacterium cell of said strain or said derivative strain as defined above and
[0016] a binary vector containing in T-DNA a DNA sequence of interest to be transfected into cells of a plant. The binary vector may encode a VirG protein from strain CryX or a closely related VirG protein as defined below.
[0017] The invention also provides the vir plasmid of strain CryX and Agrobacterium cells having the chromosome of strain CryX.
[0018] The invention further provides an aqueous cell suspension of Agrobacterium strain CryX having DSM accession No: DSM25686 or a derivative strain of strain CryX (as defined herein), said suspension having a cell concentration of at most 1.1106 cfu/ml of the suspension, preferably at most 4.4105 cfu/ml of the suspension, and more preferably of at most 1.1105 cfu/ml of the suspension.
[0019] The inventors of the present invention have found a way of strongly increasing the transient transfection efficiency of plants by Agrobacterium. The inventors have identified an Agrobacterium strain (Agrobacterium strain CryX) that achieves particularly high efficiency in transient transfection in planta with a wide variety of plants. Notably, strain CryX achieves much higher transient transfection efficiency in planta than other Agrobacterium strains that are used as a standard for plant transformation or transfection such as strain LBA4404 or EHA105 (see page 64 of Slater et al., in: Plant Biotechnology, 2nd edition, Oxford University Press, 2008). The inventors have further found that strain CryX achieves higher transient transfection efficiency than related Agrobacterium strains such as Chry5/KYRT1. Moreover, the inventors have found that a particularly high transfection efficiency can be obtained when a virG gene, notably the virG gene from Agrobacterium strain LBA4404 or a virG gene that is closely related to that from LBA4404 is expressed in chrysopine or succinamopine-type Agrobacterium tumefaciens strains.
BRIEF DESCRIPTION OF THE FIGURES
[0020] FIGS. 1A and 1B show T-DNA regions with DNA sequences of interest of vectors used in the examples. Pact2: promoter of Arabidopsis actin2 gene; o: 5'-end from TVCV (turnip vein clearing virus); RdRp: RNA-dependent RNA polymerase open reading frame (ORF) from cr-TMV (crucifer-infecting tobamovirus); MP: movement protein ORF from cr-TMV; N: 3'-non-translated region from cr-TMV; Tnos or nos: nopaline synthase terminator; white segments interrupting grey segments in the RdRp and MP ORFs indicate introns inserted into these ORFs for increasing the likelihood of RNA replicon formation in the cytoplasm of plant cells, which is described in detail in WO2005049839; GUS: coding sequence of GUS protein; GFP: green fluorescent protein coding sequence; fs: frame-shift deleting cell-to-cell movement ability; P35S: 35S promoter; P19: gene silencing suppressor of tomato bushy stunt virus (cf. Plant J. 33, 949-56); Tocs: ocs terminator; LB: left T-DNA border; RB: right T-DNA border.
[0021] FIG. 2 shows a comparison of different Agrobacterium tumefaciens strains for their transient transfection efficiency. Photographs show GFP fluorescence 4 dpi (days post infection) under uv light due to TMV-based GFP expression after syringe infiltration of Nicotiana benthamiana leaves with diluted agrobacterial cultures as described in Example 2. Numerals 10-2, 10-3 and 10-4 show the concentration factors of the overnight agrobacterial cultures of OD=1.3 at 600 nm that correspond to 102-fold, 103-fold and 104-fold dilutions, respectively. The composition of the buffer for infiltration is 5 mM MES, pH5.5 and 10 mM MgSO4. Each infiltration was performed in triplicate using three independent leaves of the same plant.
[0022] (A) TMV-based vector capable of cell-to-cell movement: TMV(MP)-GFP (pNMD560).
[0023] (B) TMV-based vector lacking cell-to-cell movement ability: TMV(fsMP)-GFP (pNMD570).
[0024] 1--Agrobacterium tumefaciens strain AGL1;
[0025] 2--Agrobacterium tumefaciens strain EHA105;
[0026] 3--Agrobacterium tumefaciens strain GV3101;
[0027] 4--Agrobacterium tumefaciens strain ICF320;
[0028] 5--Agrobacterium tumefaciens strain CryX;
[0029] 6--Agrobacterium tumefaciens strain LBA4404;
[0030] 7--Agrobacterium tumefaciens strain LBA9402.
[0031] FIG. 3 demonstrates the influence of virG gene overexpression on transient transfection efficiency for AGL1, EHA105, ICF320 and GV3101 strains. virG sequences from GV3101 and LBA4404 strains carrying the N54D mutation as well as native sequence from LBA4404 strain were used for comparison. Photographs show GFP fluorescence 4 (FIG. 3A) and 6 (FIG. 3B) dpi under uv light due to TMV-based GFP expression after syringe infiltration of Nicotiana benthamiana leaves of the same age from 3 independent plants with diluted agrobacterial cultures as described in Example 3. Numerals 10-2, 10-3 and 10-4 indicate the factors by which the cell concentrations of the overnight agrobacterial cultures of OD=1.3 at 600 nm were reduced. Thus, the factors 10-2, 10-3 and 10-4 correspond to 102-, 103- and 104-fold dilutions, respectively. The composition of the buffer for infiltration: 5 mM MES, pH5.3 and 10 mM MgCl2. In all cases TMV-based vectors capable of cell-to-cell movement were used.
[0032] 1--pNMD560 (no virG) in GV3101;
[0033] 2--pNMD064 (virGN54D/GV3101) in GV3101;
[0034] 3--pNMD063 (virGN54D/LBA4404) in GV3101;
[0035] 4--pNMD062 (virG/LBA4404) in GV3101;
[0036] 5--pNMD560 (no virG) in ICF320;
[0037] 6--pNMD064 (virGN54D/GV3101) in ICF320;
[0038] 7--pNMD063 (virGN54D/LBA4404) in ICF320;
[0039] 8--pNMD062 (virG/LBA4404) in ICF320;
[0040] 9--pNMD560 (no virG) in EHA105;
[0041] 10--pNMD064 (virGN54D/GV3101) in EHA105;
[0042] 11--pNMD063 (virGN54D/LBA4404) in EHA105;
[0043] 12--pNMD062 (virG/LBA4404) in EHA105;
[0044] 13--pNMD560 (no virG) in AGL1;
[0045] 14--pNMD064 (virGN54D/GV3101) in AGL1;
[0046] 15--pNMD063 (virGN54D/LBA4404) in AGL1;
[0047] 16--pNMD062 (virG/LBA4404) in AGL1.
[0048] FIGS. 4A and 4B show the influence of virG gene overexpression on the transient transfection efficiency of GV3101 and CryX strains. virG sequences from GV3101 and LBA4404 strains carrying N54D mutation as well as native sequence from LBA4404 strain were used for comparison. Photographs show GFP fluorescence 3, 4 and 5 dpi under uv light due to TMV-based GFP expression after the syringe infiltration of Nicotiana benthamiana leaves of the same age from 3 independent plants with diluted agrobacterial cultures as described in Example 3. Numerals 10-4 and 10-5 indicate the concentration factors of the overnight agrobacterial cultures of OD=1.3 at 600 nm. The composition of the buffer for infiltration: 5 mM MES, pH5.3 and 10 mM MgCl2. TMV-based vectors capable of cell-to-cell movement were used.
[0049] 1--pNMD560 (no virG) in GV3101 strain;
[0050] 2--pNMD064 (virGN54D/GV3101) in GV3101 strain;
[0051] 3--pNMD063 (virGN54D/LBA4404) in GV3101 strain;
[0052] 4--pNMD560 (no virG) in CryX strain;
[0053] 5--pNMD064 (virGN54D/GV3101) in CryX strain;
[0054] 6--pNMD063 (virGN54D/LBA4404) in CryX strain.
[0055] FIG. 5 shows a comparison of transient transfection efficiencies for CryX and GV3101 strains in a range of dilutions of overnight agrobacterial cultures from 10-3 to 10-7 using syringe infiltration of Nicotiana benthamiana leaves. Numerals 10-3, 10-4, 10-5, 10-6 and 10-7 indicate the concentration factors of the overnight agrobacterial cultures of OD=1.3 at 600 nm. These correspond to 103, 104, 105, 106 and 107-fold dilutions, respectively. The composition of the buffer for infiltration: 5 mM MES, pH5.3 and 10 mM MgCl2 in water. Photographs are taken at 4 dpi.
[0056] 1--pNMD560 (no virG) in GV3101 strain;
[0057] 2--pNMD064 (virGN54D/GV3101) in GV3101 strain;
[0058] 3--pNMD063 (virGN54D/LBA4404) in GV3101 strain;
[0059] 4--pNMD560 (no virG) in CryX strain;
[0060] 5--pNMD064 (virGN54D/GV3101) in CryX strain;
[0061] 6--pNMD063 (virGN54D/LBA4404) in CryX strain.
[0062] FIG. 6 shows the results of testing different Agrobacterium strains for transient transfection of soybean using spraying with suspension of agrobacterial cells. pNMD2190 construct (35S:GUS; 35S:p19 and virGN54D/LBA4404 in the plasmid backbone) was used with AGL1, EHA105, CryX and LBA4404 strains; pNMD2180 construct (35S:GUS; 35S:p19 and virGN54D/GV3101in the plasmid backbone) was used with GV3101 and ICF320 strains. Staining of leaves for the GUS activity was performed at 11 dps.
[0063] (A) For spraying, liquid Agrobacterium cultures of OD600=1.3 were diluted in the ratio 1:10 with buffer containing 5 mM MES, pH5.3; 10 mM MgCl2and 0.05% (v/v) Tween®20.
[0064] (B) For spraying, liquid Agrobacterium cultures of OD600=1.3 were diluted in ratios 1:10, 1:100 and 1:1000 with buffer containing (5 mM MES, pH5.3; 10 mM MgCl2 and 0.05% (v/v) Tween®20) supplemented with silicon carbide particles of size 800 in the concentration 0.3% (w/v).
[0065] FIG. 7 shows test results of CryX and EHA105 strains for transient transfection of cotton Gossipium hirsutum L. using spraying with suspension of agrobacterial cells. For spraying, liquid Agrobacterium cultures of OD600=1.3 were diluted in the ratio 1:10 with buffer containing 5 mM MES pH5.3; 10 mM MgCl2 and 0.25% (v/v) Silwet L-77. For testing, constructs pNMD1971 (35S:GUS; 35S:p19), pNMD2180 (35S:GUS; 35S:p19 and virGN54D/GV3101 in the plasmid backbone) and pNMD2190 (35S:GUS; 35S:p19 and virGN54D/LBA4404 in the plasmid backbone) were used. GUS activity test was performed at 6 dps.
[0066] FIG. 8 shows a comparison of two accessions of Agrobacterium tumefaciens Chry5/KYRT1 strains received from different laboratories using a TMV-based vector capable of cell-to-cell movement (TMV-GFP, pNMD560 vector). Photographs show GFP fluorescence 4 dpi (days post infection) under uv light due to TMV-based GFP expression after syringe infiltration of Nicotiana benthamiana leaves with diluted overnight agrobacterial cultures of OD=1.3 at 600 nm as described in Example 8. The strain obtained from the laboratory of Dr. G. Collins in the University of Kentucky (Lexington, USA) is infiltrated on the right-hand side of each leaf. The accession from the Institute of Cell Biology and Genetics Engineering (ICBGE, Kiev, Ukraine), is infiltrated on the left-hand side of each leaf. The composition of the buffer for infiltration is 5 mM MES, pH5.5 and 10 mM MgSO4. Each infiltration was performed in triplicate using three independent leaves of the same plant.
[0067] 1--ICBGE accession, concentration factor 10-1 (10-fold dilution);
[0068] 2--ICBGE accession, concentration factor 10-2;
[0069] 3--ICBGE accession, concentration factor 10-3;
[0070] 4--Kentucky University accession, concentration factor 10-1;
[0071] 5--Kentucky University accession, concentration factor 10-2;
[0072] 6--Kentucky University accession, concentration factor 10-3.
DETAILED DESCRIPTION OF THE INVENTION
[0073] In the present invention, a particular class of Agrobacterium tumefaciens strains is used for transient transfection of plants such as leaves on a plant. This class of Agrobacterium comprises A. tumefaciens strain CryX and derivative strains thereof as defined below. Strain CryX was deposited with DSMZ-Deutsche Sammlung von Mikroorganismen and Zellkulturen GmbH, Inhoffenstraβe 7B, 38124 Braunschweig, Germany on Feb. 23, 2012 under the Budapest Treaty. Accession number DSM 25686 has been assigned to it. Strain CryX has a chromosomally integrated rifampicin resistance.
[0074] Strain CryX is related to the Chrysanthemum morifolium-derived Agrobacterium strain Chry5 that has been identified by Busch & Puepke in 1991. It has been shown in their paper that the strain is a biotype I by traditional biotype tests and that it produces tumors on at least 10 plant species. It has been characterized as unusual because of its ability to form efficiently large tumors on soybean (Glycine max) and for this reason, it has been subsequently further characterized in a number of papers by various groups. Chry5 is unable to utilize octopine or mannopine as a carbon source; instead it is able to catabolize a single isomer each of nopaline and succinamopine, at the same time it is insensitive to agrocin 84 (Busch & Puepke, 1991). In addition, Chry5-strain-induced tumors produce a family of Amadori-type opines that includes deoxyfructosyl glutamine (Dfg) and its lactone, chrysopine (Chy) (Palanichelvam et al., 2000). The isolates of Chry5 have been shown to contain at least two plasmids, one with a homology with pTiB6. Torisky et al. (1997) have partially disarmed the strain by removing approx. 16.5-kb segment from the 285-kb Ti plasmid of Chry5, including approx. 4 kb of the oncogenic T-DNA, through homologous recombination. This deletion mutant, named KYRT1, has been shown to be an efficient vector organism, and this partially disarmed derivative of Chry5 has since been used by some researchers. More recently, Palanichelvamet et al. (2000) have developed a fully disarmed derivative.
[0075] In research that led to the present invention, the inventors have initially tested two accessions of Chry5/KYRT1 received from different laboratories. The strain obtained from the laboratory of Dr. G. Collins (Torisky et al., 1997) did not show any superiority over standard comparator strains EHA105 and GV3101 in our transient studies and was excluded from further studies. An accession from the Institute of Cell Biology and Genetics Engineering (Kiev, Ukraine), on the other hand, has been found to be unusually active in its transient transfection and expression efficiency and has been used in the present invention. This latter accession was deposited under the Budapest treaty in the official depository DSMZ-Leibniz-Institut Deutsche Sammlung von Mikroorganismen and Zellkulturen GmbH, Braunschweig, Germany under the name CryX, to reflect the fact that there is no clear provenance information on it.
[0076] The original and subsequent papers have characterized the Chry5 strain in more detail. These studies aimed at standard characterization of molecular biology and genetics of the strain, as well as its comparative ability to induce tumors, to cause genetic transformation of different plant species, as well as its ability to cause transient expression in Agrobacterium-treated explants. Results of these studies are briefly summarized below.
Methods of Comparison Used to Characterize Agrobacterium tumefaciens Chry5
1. Data on Oncogenicity
[0077] In the original paper of Bush & Puepke (1991), it has been established that the Chry5 strain is able to cause tumors on 10 plant species representing 7 plant families. The test involved semi-quantitative evaluation of the number of plants with tumors caused by this strain versus the common laboratory strain B6. There were no significant differences in tumorigenicity between the strains in 6 out of 9 species (beets, kalanchoe, marigold, sunflower, tobacco and tomato). On collard, Chry5 has been approx. two times more efficient, and on soybean--approx. three times more efficient, whereas on pea, it was somewhat less efficient than B6. Torisky et al. (1997) provided additional data on tumor formation on stems of tobacco and tomato; in this study, the Chry5 strain and its partially disarmed derivative KYRT1 have been compared with two other Agrobacterium strains often used in transformation studies, including A281, a succinamopine-type strain containing Bo542 Ti plasmid in the C58 chromosomal background and its disarmed derivative EHA105 strain. It has been shown in that study that whereas the original Chry5 and the other succinamopine strain used, A281, are both highly tumorigenic, the partially disabled derivative KYRT1 and EHA105 were not active.
2. Data on Transformation Efficiency Using Partially Disabled and Fully Disabled Strains
[0078] Torisky et al. (1997) demonstrated that KYRT1 successfully transfers the beta-glucuronidase (GUS) gene into tobacco leaf explants, producing GUS-expressing callus which could be regenerated into viable plants. In these experiments, the transformation efficiency of KYRT1 strain was approximately the same as was shown for EHA105. Grant et al. (2003) found the KYRT1 strain to be on average threefold more efficient than AGL 1 for producing transgenic plants of pea using for evaluation cotyledonary explants of three different plant genotypes.
[0079] In the work of Palanichelvam et al. (2000), it has been shown that KYRT1 derivative is only partially disarmed and contains all of oncogenic T-right and the fragment of T-left regions. A Chry5 derivative with completely disarmed Ti plasmid, pKPSF2 (Palanichelvam et al., 2000), was, however, less efficient for the stable transformation of soybean, as the KYRT1 strain retains some hormonal effect on plant explants enhancing somatic embryogenesis in soybean (Ko et al., 2004).
3. Data Characterizing Transient Activity
[0080] Again, Torisky et al. (1997) were the first to study transient expression of β-glucuronidase transgene caused by the Chry5 derivative KYRT1 by using a quantitative assay of GUS expression in cotyledonary node explants of soybean. These data indicated that KYRT1 derivative was approx. 2.5 times more efficient in causing transient expression when compared to EHA105 or GV3850. KYRT1 was on average 2.8-fold more efficient than EHA105 and C58C1 for producing transient β-glucuronidase (GUS) gene (gus) expression on cotyledonary petioles of a recalcitrant legume plant, lentil (Lens culinaris M.) (Akcay et al., 2009). Akbulut et al. (2008) have measured GUS activity in explants derived from wounded seedlings after treatment with KYRT1 and two other common vectors, C58C1 and EHA105. The quantitative evaluation of GUS expressing spots has shown that after 16 hours of imbibition, there are no statistically significant differences between KYRT1 and C58C1, and after 40 hours, KYRT1 is better by ca. 50%, but only in one of two measurement points.
[0081] Interpretation of the above mentioned data in its entirety is difficult because different authors used different plant species, different plant explants, different strains of Agrobacterium for comparison, and have made their conclusions based on three different activity methods: tumorigenic activity, efficiency of genetic transformation and efficiency of transient expression. The process of interaction of a plant cell and an Agrobacterium is very complex, and it involves transfer of T-DNA-protein complex, transfer of proteins such as VirE2 (via a separate secretion system), transient expression of T-DNA genes in a plant cell, hormonal effect of expressed genes, integration of some T-DNA molecules into a plant chromosomal DNA, etc. Any of these intermediate processes can influence the end result; therefore, data on tumorigenicity and on transformation efficiency gives no information with regard to the efficiency of T-DNA transfer and transient expression. The presented data on transient activity are, on the other hand, limited and the slight differences observed are inconclusive or not practically relevant.
[0082] A major difference in the processes and strains described herein and the methods used in the prior art described above is the different biology of the plant material used for transient expression studies. Whereas all previous authors used in vitro cultured or excised plant explants rich in meristematic tissues (the ultimate goal being ability to transform a plant cell and to regenerate a whole plant from said transgenic cell), such as excised embryo, parts of young seedlings, etc., the present invention relates to transient transfection of intact, developed plants which interact with Agrobacterium differently. On entire plants, agrobacteria enter the leaf via stomata (that is absent in other organs and in meristematic tissues) and not via wounds on plant explants. As mentioned before, all authors without exception were using high bacteria densities when treating plant explants.
[0083] Strain CryX of the present invention contains a vir plasmid that is at least partially disarmed. "Disarmed" means that the vir plasmid and its host Agrobacterium is not oncogenic, i.e. it does not insert oncogenes or genes for the production of opines into plant cells, either because it does not contain such genes or it cannot transfer such genes. A vir plasmid comprises the vir genes (virulence genes) required for T-DNA transfer into plant cells. Vir genes and their functions in T-DNA transfer are known in the art and are e.g. summarized in the book of Slater et al., Plant Biotechnology, 2nd edition; Oxford University Press, 2008; see also Hellens et al., Trends in Plant Science 5 (2000) 446-451.
[0084] Strain CryX of the present invention is a binary strain, i.e. the vir genes required for transfer of T-DNA into plant cells and the T-DNA are on separate plasmids (see e.g. the book of Slater et al. and the article of Hellens et al. regarding binary Agrobacterium strains and vector systems). In the context of a binary Agrobacterium strain, the plasmid containing the vir genes is referred to herein as "vir plasmid" or "vir helper plasmid". The plasmid containing the T-DNA to be transfected is referred to as "vector" or "binary vector". The term "strain" or "Agrobacterium strain" relates to components of the Agrobacterium other than the binary vector. Thus, herein, a binary Agrobacterium strain not containing a binary vector and after introduction of a binary vector are referred to by the same strain name. Deposited strain CryX contains a vir plasmid, but does not contain a binary vector.
[0085] The invention also relates to derivative strains of strain CryX. In an embodiment (i), a derivative strain of strain CryX has the chromosomal background of strain CryX. It may have the same chromosome as CryX. In another embodiment (ii), a derivative strain of strain CryX contains the vir plasmid of strain CryX. In a further embodiment (iii), a derivative strain of strain CryX contains a derivative of the vir plasmid of strain CryX, and may have the chromosome of strain CryX. In embodiment (ii), the strain is a binary strain and is used in the processes of the invention after introduction of a binary vector containing a T-DNA of interest. In embodiments (i) and (iii), the strains may be binary strains. If they are binary strains, they are used in the processes of the invention after introduction of a binary vector containing a T-DNA of interest. Alternatively, in embodiments (i) and (iii), the T-DNA to be transferred into plant cells in the processes of the invention may be inserted into the vir plasmid, such that the vir genes and the T-DNA are present on one and the same plasmid molecule. However, it is generally more convenient and thus preferred to use binary strains.
[0086] The term "chromosomal background" is a standard term in the art of Agrobacterium transformation or transfection (cf. Hellens et al., Trends in Plant Science 5 (2000) 446-451). It relates to genetic material of said Agrobacterium strain other than the Ti plasmids, vir helper plasmids and binary vectors. In one embodiment, a derivative strain of strain CryX has the same chromosome as strain CryX. A derivative strain having the chromosomal background of strain CryX may differ from CryX, for example, in the vir plasmid compared to the vir plasmid of CryX. Thus, a derivative strain of strain CryX may contain a vir plasmid that is a derivative of the vir plasmid of strain CryX.
[0087] Whether a given Agrobacterium strain that has a chromosome that is non-identical to that of strain CryX has a chromosomal background of strain CryX can be tested experimentally by comparing the T-DNA transfer efficiency (or transfection efficiency) from a T-DNA-containing binary vector of strain CryX with the strain to be tested that contains the vir plasmid of CryX and the same binary vector. The strain to be tested is considered having the chromosomal background of CryX if it achieves at least 70%, preferably at least 80% of the T-DNA transfer efficiency of strain CryX. Transfection efficiencies can be determined as described in Example 2. Alternatively, transfection efficiencies can be determined as in Example 2 but using a binary vector encoding a TMV-viral replicon not capable of cell-to-cell movement such as pNMD570. T-DNA transfer efficiency can also be determined by protoplast counting as described in WO 2005049839. In one embodiment, the chromosome of an Agrobacterium strain having the chromosomal background of strain CryX has a chromosome that is the same in base sequence as that of strain CryX.
[0088] A derivative of the vir plasmid of strain CryX achieves, when present in Agrobacterium cells having the same chromosome as strain CryX, a similar efficiency of T-DNA transfer into plant cells from a T-DNA-containing binary vector present in these cells. For this purpose, the derivative vir plasmid has a vir region sufficiently similar to that of the vir plasmid of strain CryX. The derivative vir plasmid may encode the virG protein of strain CryX or a closely related virG protein. Preferably, the derivative vir plasmid contains the virG gene of strain CryX. In one embodiment, the derivative vir plasmid contains genes encoding at least two of the following virulence proteins of CryX: VirA, VirG, VirB1-BirB11, VirC1, VirD1, VirD2, VirD4, VirE1, VirE2, VirF and VirJ. In a further embodiment, a derivative vir plasmid contains at least the genes encoding the following virulence proteins of CryX: VirA, VirG, VirD2, and VirE2. In a further embodiment, a derivative vir plasmid contains the entire vir region, i.e. all vir genes of the vir plasmid of strain CryX. The derivative vir plasmid may differ in the plasmid backbone from the vir plasmid of CryX. For example, the derivative vir plasmid may have a different or additional selective marker gene or may have deleted further nucleic acid portions from outside the vir region. In one embodiment, the derivative vir plasmid is pKYRT1 (U.S. Pat. No. 5,929,306), notably if the derivative strain has the same chromosome as CryX.
[0089] Whether a given vir plasmid is a derivative vir plasmid in the sense of the present invention may be tested experimentally by comparing the T-DNA transfer efficiency from a T-DNA-containing binary vector between Agrobacterium of strain CryX and Agrobacterium having the chromosome of strain CryX but the vir plasmid to be tested under otherwise identical conditions. In one embodiment, the Agrobacterium containing a derivative plasmid according to the invention achieves at least 70%, preferably at least 80%, more preferably at least 90% of the T-DNA transfer efficiency of strain CryX. Transfection efficiencies can be determined as described in Example 2 and as mentioned above.
[0090] "Closely related virG protein" to the virG protein of CryX means a virG protein that differs from the virG protein of CryX in at most 3 non-conservative amino acid substitutions or in at most 6, preferably at most 3 conservative amino acid substitutions. The non-conservative amino acid substitutions may be at positions corresponding to positions 6, 7 or 106 of the amino acid sequence of SEQ ID NO: 1 which is the VirG protein from Agrobacterium strain LBA4404, all other amino acid residues being as in SEQ ID NO:1. In addition, the closely related virG protein may have an asparagine to aspartate substitution at the position corresponding to position 54 of SEQ ID NO: 1. The conservative amino acid substitutions may be at positions 6, 7 and/or 106 of the amino acid sequence of SEQ ID NO: 1.
[0091] Herein, conservative substitutions are substitutions of amino acid residues within each of the following four groups:
[0092] Ala, Pro, Gly, Glu, Asp, Gln, Asn, Ser, Thr
[0093] Val, Ile, Leu, Met
[0094] Lys, Arg, His
[0095] Phe, Tyr, Trp All other amino acid residue substitutions are considered non-conservative.
[0096] Herein, a "T-DNA of interest" is a DNA containing, between T-DNA left and right border sequences, a DNA sequence of interest. A T-DNA of interest may be present or may have been incorporated by sub-cloning into a vir plasmid such as the vir plasmid of strain CryX. In the processes of the invention, it is preferred to use a binary vector system. Therefore, a T-DNA of interest is preferably present or will have been incorporated into into a binary vector.
[0097] The binary vector to be used in the present invention is a DNA molecule comprising a DNA sequence of interest to be transfected into plant cells. The DNA sequence of interest typically encodes a protein or an RNA to be expressed in cells of the transfected plants. The binary vector is generally produced by inserting or cloning a nucleic acid construct containing the DNA sequence of interest into a cloning site within T-DNA of a precursor binary vector, as generally done in Agrobacterium-mediated plant transfection. After said insertion, the nucleic acid construct is flanked by T-DNA left and right border sequences for allowing transfection of said plant with said T-DNA. In the T-DNA of the binary vector, the DNA sequence of interest is present such as to be expressible in plant cells. For this purpose, the DNA sequence of interest is, e.g. in said nucleic acid construct, typically under the control of a promoter active in plant cells. Examples of the DNA sequence of interest are a DNA sequence encoding a DNA viral replicon or an RNA viral replicon or a gene to be expressed. The gene may encode an RNA of interest or a protein of interest to be expressed in cells of the plant(s). Also the viral replicons typically encode an RNA or a protein of interest to be expressed in plants. The DNA construct may comprise, in addition to the DNA sequence of interest, other sequences such as regulatory sequences for expression of the DNA sequence of interest. Binary vectors usable in the invention are known to the skilled person, e.g. from the references cited in the introduction or from text books on plant biotechnology such as Slater, Scott and Fowler, Plant Biotechnology, second edition, Oxford University Press, 2008. The binary vector typically has an antibiotic resistance gene for allowing selection in bacteria such as E. coli.
[0098] For increasing transfection efficiency, the binary vector may comprise, outside the T-DNA, a virG gene expressible in said Agrobacterium strain. Alternatively, an additional plasmid may be inserted into said Agrobacterium strain, whereby said additional plasmid contains a virG gene expressible in said Agrobacterium strain (Pazour et al., Proc. Natl. Acad. Sci. USA 88 (1991) 6941-6945). The virG gene preferably encodes a VirG protein from Agrobacterium tumefaciens strain LBA4404 or a closely related VirG protein. Further, the VirG protein may have the N54D mutation at the position corresponding to position 54 of SEQ ID NO: 1, i.e. the VirG protein from A. tumefaciens strain LBA4404. The N54D mutation in a VirG protein from another Agrobacterium strain was described by Jung et al., Current Microbiology 49 (2004) 334-340.
[0099] The closely related VirG protein may be
[0100] (i) a protein comprising at least 235, preferably at least 239 consecutive amino acids of the amino acid sequence of SEQ ID NO: 1 or of the amino acid sequence of the N54D mutant of the amino acid sequence of SEQ ID NO: 1; or
[0101] (ii) a protein comprising an amino acid sequence having not more than 3 non-conservative amino acid substitutions and not more than 10 conservative amino acid substitutions of the amino acid sequence of SEQ ID NO: 1 or the N54D mutant thereof; or
[0102] (iii) a protein comprising an amino acid sequence having not more than 20, preferably not more than 10, conservative amino acid substitutions of the amino acid sequence of SEQ ID NO: 1 or the N54D mutant thereof.
[0103] In items (ii) and (iii), said protein preferably has an asparagine or aspartate residue at the position corresponding to position 54 of SEQ ID NO: 1
[0104] Possible positions for the conservative amino acid substitutions in the embodiments mentioned above are positions 6, 7, 18, 35, 38, 42, 44, 66, 69, 73, 81, 86, 89, 97, 106, 107, 122, 124, 133, 135, 143, 147, 150, 165, 188, 208, 212, 213, 232, 235, and 238 of SEQ ID NO: 1, while amino acid residues at other positions are those as in SEQ ID NO:1. Possible positions for non-conservative substitutions are positions 6, 7 and 106 of the amino acid sequence of SEQ ID NO: 1.
[0105] In embodiments wherein strong expression of a protein or RNA is desired or wherein accumulation of viral nucleic acids to high amounts in cells of said plant and possible negative effects on plant health is not a concern, the nucleic acid construct or DNA sequence of interest may encode a replicating viral vector that can replicate in plant cells. In order to be replicating, the viral vector contains an origin of replication that can be recognized by a nucleic acid polymerase present in plant cells, such as by the viral polymerase expressed from the replicon. In case of RNA viral vectors, the viral replicons may be formed by transcription, under the control of a plant promoter, from the DNA construct after the latter has been introduced into plant cell nuclei. In case of DNA viral replicons, the viral replicons may be formed by recombination between two recombination sites flanking the sequence encoding the viral replicon in the DNA construct, e.g. as described in WO00/17365 and WO 99/22003. If viral replicons are encoded by the DNA construct, RNA viral replicons are preferred. Use of DNA and RNA viral replicons has been extensively described in the literature at least over the last 15 years. Some examples are the following patent publications by Icon Genetics: WO2008028661, WO2007137788, WO 2006003018, WO2005071090, WO2005049839, WO02097080, WO02088369, and WO02068664. An example of DNA viral vectors are those based on geminiviruses. For the present invention, viral vectors or replicons based on plant RNA viruses, notably based on plus-sense single-stranded RNA viruses are preferred. Examples of such viral vectors are tobacco mosaic virus (TMV) and potexvirus X (PVX) used in the examples. Potexvirus-based viral vectors and expression systems are described in EP2061890. Many other plant viral replicons are described in the patent publications mentioned above.
[0106] When performing the process of the invention, the binary vector containing in T-DNA the DNA sequence of interest may be introduced into the Agrobacterium strain containing the vir plasmid or its derivative by conventional methods such as electroporation. A culture of the strain containing the binary vector is then grown in suitable media, typically in the presence of a selective agent for selecting Agrobacterium cells containing the binary vector, and, optionally, sub-cultured to produce the desired amount of an aqueous suspension comprising the Agrobacterium cells. The obtained suspension may be diluted to the desired concentration with water, a suitable buffer or media and be used for transfecting a plant or leaves on the plant. Alternatively, if the T-DNA is part of the vir plasmid, the T-DNA containing vir plasmid is introduced into Agrobacterium by conventional methods such as electroporation and further treated as described for the binary system.
[0107] In the processes of the invention, in planta transfection is used. In planta means that the processes are performed on whole living plants after the seedling stage, preferably on fully developed plants, rather than on excised or in vitro cultivated plant tissues or organs. Preferably, the process is applied to many plants in parallel such as plants growing on a field.
[0108] Said plants may be contacted with the suspension of Agrobacterium cells by infiltration with or without application of vacuum. In one embodiment, notably when applied to multiple plants in parallel, the plants may be contacted with the suspension by spraying. The aqueous suspension used in the processes of the invention may have a concentration of Agrobacterium cells of at most 1.1109 cfu/ml, which corresponds approximately to an Agrobacterium culture in LB-medium of an optical density at 600 nm of 1. Due to the high transfection efficiency achieved in the invention, much lower concentrations may, however, be used, which allows treatment of many plants such as entire farm fields without the need for huge fermenters for Agrobacterium production. Thus, the concentration is preferably at most 2.2107 cfu/ml, more preferably at most 1.1107 cfu/ml, more preferably at most 4.4106 cfu/ml. In one embodiment, the concentration is at most 1.1106 cfu/ml of the suspension. In a further embodiment, the concentration is at most 4.4105 cfu/ml of the suspension, and in a further embodiment, the concentration is at most 1.1105 cfu/ml of the suspension
[0109] For avoiding determination of cell concentrations in terms of cfu/ml, concentrations of agrobacterial suspensions are frequently assessed by measuring the apparent optical density at 600 nm using a spectrophotometer. Herein, the concentration of 1.1107 cfu/ml corresponds to a calculated optical density at 600 nm of 0.01, whereby the calculated optical density is defined by a 100-fold dilution with water or buffer of a suspension having an optical density of 1.0 at 600 nm. Similarly, the concentrations of 4.4106 cfu/ml, 1.1106 cfu/ml, 4.4105 cfu/ml and 1.1105 cfu/ml of the suspension correspond to a calculated optical density at 600 nm of 0.004, 0.001, 0.0004, and 0.0001 respectively, whereby the calculated optical densities are defined by a 250-fold, 1000-fold, 2500-fold, or 10000-fold, respectively, dilution with water or buffer of a suspension having an optical density of 1.0 at 600 nm.
[0110] Thus, in a particularly preferred embodiment, the invention provides a process, and Agrobacterium cell suspension therefor, of transiently expressing a DNA sequence of interest in a plant, comprising contacting said plant or said leaves on said plant with a suspension comprising Agrobacterium cells of strain CryX or a derivative strain of strain CryX, wherein said derivative strain has the chromosomal background of strain CryX or said derivative strain contains the vir plasmid of strain CryX or a derivative of said vir plasmid, wherein said suspension has any of the maximum Agrobacterium cell concentrations mentioned in any one of the preceding two paragraphs. In this embodiment, the Agrobacterium strain is preferably a binary strain containing a binary vector comprises a virG gene expressible in said strain CryX or said derivative strain. Said virG gene may encodes a VirG protein from Agrobacterium tumefaciens strain LBA4404 of SEQ ID NO: 1, or is an N54D mutant of the VirG protein encoded by the virG gene from A. tumefaciens strain LBA4404.
[0111] It is possible to include an abrasive into the suspension for increasing the transfection efficiency. The abrasive is a particulate material that is essentially insoluble in the aqueous suspension of Agrobacterium cells. The abrasive is believed to weaken, notably if used together with a wetting agent, the surface of plant tissue such as leaves, and thereby facilitates penetration of Agrobacterium cells into the intercellular space of plant tissue. Regarding possible abrasive usable in the presence invention, particle sizes thereof, concentrations and possible commercial products, reference is made to International patent application published as WO 2012/019669 and disclosure regarding abrasives of this publication is incorporated herein.
[0112] The aqueous suspension of the invention may contain an agricultural spray adjuvant. The spray adjuvant may be a surfactant or wetting agent. The surfactant and wetting agent has multiple advantages in the present invention. It reduces the surface tension of the water of the aqueous suspension and makes the waxy surface of plant leaves more permeable for agrobacteria. It further improves the stability of the suspension and reduces settling of the abrasive in the suspension. Surfactants usable in the processes of the present invention are not particularly limited, and are disclosed in International patent application published as WO 2012/019669. Preferred surfactants are nonionic surfactants of an HLB value of 12 or greater, preferably at least 13. As noninionic surfactants, organo-silicone surfactants such as polyalkyleneoxide-modified heptamethyltrisiloxane are most preferred in the present invention. A commercial product is Silwet L77® spray adjuvant from GE Advanced Materials.
[0113] Surfactants such as those disclosed in WO 2012/019669 may be used singly or in combination of two or more surfactants. Notably, the preferred organo-silicone surfactants may be combined with other surfactants. The total concentration of surfactants in the aqueous suspension of the invention may be easily tested by conducting comparative spraying experiments, similarly as done in the examples. However, in general, the total concentration of surfactants may be between 0.005 and 2 volume-%, preferably between 0.01 and 0.5 volume-%, more preferably between 0.025 and 0.2 volume-% of said suspension. Since the density of surfactants is generally close to 1.0 g/ml, the total concentration of surfactants may be defined as being between 0.05 and 20 g per liter of said suspension, preferably between 0.1 and 5.0 g, more preferably between 0.25 and 2.0 g per liter of said suspension (including abrasive). If the above organo-silicone surfactants such as polyalkyleneoxide-modified heptamethyltrisiloxane are used, the concentration of the organo-silicone surfactant in the agrobacterial suspension used for spraying may be between 0.01 and 0.5 volume-%, preferably between 0.05 and 0.2 volume-%. Alternatively, the concentration of the organo-silicone surfactant in the agrobacterial suspension used for spraying may be defined as being between 0.1 and 5.0 g, preferably between 0.5 and 2.0 g per liter of said suspension.
[0114] In order to improve the physical properties of the aqueous suspension, it is possible to add highly dispersed sub-micron size silicic acid (silica) or porous polymers such as urea/formaldehyde condensate (Pergopak®). Notably, where the median particle size of the abrasive is between 0.1 and 30 μm, or in one of the preferred sub-ranges of this range given above, it is possible to add a highly dispersed sub-micron size silica to the suspension. Herein, sub-micron size silica is silica having a median particle size between 0.01 and 0.5 μm, preferably between 0.02 and 0.5 μm, more preferably between 0.02 and 0.1 μm. Highly dispersed silicic acid such as Hi-Sil® 233 (PPG Industries) can contribute to the abrasive properties of the aqueous suspension (see Jensen et al., Bull. Org. mond. Sante, Bull. Wld Hlth Org. 41 (1969) 937-940). These agents may be incorporated in an amount of from 1 to 10 g per liter of the suspension of the invention.
[0115] Further possible additives to the agrobacterial suspension are buffer substances to maintain the pH of the suspension used for spraying at a desired pH, typically between 4.5 and 6.5, preferably between 5.0 and 5.5. Further, inorganic soluble salts such as sodium chloride may be added to adjust the ionic strength of the suspension. Nutrient broth such as LB medium may also be contained in the suspension.
[0116] The aqueous suspension for contacting with plants may be produced as follows. In one method, the Agrobacterium strain or cells containing the desired binary vector to be used in the process of the invention is inoculated into culture medium and grown to a high cell concentration. Larger cultures may be inoculated with small volumes of a highly concentrated culture medium for obtaining large amounts of the culture medium. Agrobacteria are generally grown up to a cell concentration corresponding to an OD at 600 nm of at least 1, typically of about 1.5. Such highly concentrated agrobacterial suspensions are then diluted to achieve the desired cell concentration. For diluting the highly concentrated agrobacterial suspensions, water is used. The water may contain a buffer. The water may further contain the surfactant of the invention. Alternatively, the concentrated agrobacterial suspensions may be diluted with water, and any additives such as the surfactant and the optional buffer substances are added after or during the dilution process. The abrasive may be added before, during or after dilution. It is however preferred to agitate the suspension during addition of the abrasive to uniformly disperse the abrasive in the agrobacterial suspension. The step of diluting the concentrated agrobacterial suspension may be carried out in the spray tank of the sprayer used for spraying the diluted suspensions.
[0117] Said plants, notably leaves on said plant are then contacted with the suspension of Agrobacterium cells to effect transient transfection of cells of the plant. As explained above, contacting may be done by spraying. The sprayer to be used in the process of the invention mainly depends on the number of plants or the area to be sprayed. For one or a small number of plants to be sprayed, pump sprayers as widely used in household and gardening can be used. These may have volumes of the spray tank of between 0.5 and 2 liters. For applications on a medium scale, manually operated hydraulic sprayers such as lever-operated knapsack sprayers or manually operated compression sprayers may be used. However, the high transfection efficiency achieved in the invention has its full potential in the transfection of many plants such as plants growing on a farm field or in a greenhouse. For this purpose, power-operated hydraulic sprayers such as tractor-mounted hydraulic sprayers equipped with spray booms can be used. Aerial application techniques using helicopters or airplanes are also possible for large fields. All these types of sprayers are known in the art and are described for example in the book "Pesticide Application Methods" by G. A. Matthews, third edition, Blackwell Science, 2000. In order to ensure a homogeneous suspension in the spray tanks of the sprayers, small or medium size sprayers may be shaken at regular intervals or continuously during spraying. Large sprayers such as the tractor-mounted sprayers should be equipped with an agitator in the spray tank.
[0118] Considering the presence of agrobacterial cells and abrasive in the suspensions to be sprayed, sprayers used in the invention should produce spray of a droplet size at least of fine spray. Also, medium spray or coarse spray in the classification of sprays used in "Pesticide Application Methods" by G. A. Matthews, third edition, Blackwell Science, 2000, page 74, may be used. The main purpose of the spraying in the invention is wetting of plant tissue with the suspension. Thus, the exact droplet size is not critical. However, the transfection efficiency may be further improved by providing the spray to plant surfaces with increased pressure.
[0119] In the process of the invention, at least parts of plants are sprayed. In an important embodiment, plants growing in soil on a field are sprayed, i.e. plants not growing in movable pots or containers. Such plants cannot be turned upside down and dipped into agrobacterial suspension for vacuum infiltration. At least parts of plants are sprayed such as leaves. Preferably, most leaves are sprayed or entire plants.
[0120] The present invention is used for transient transfection of plants or for transient with a DNA sequence of interest that may then be transiently expressed. The term "transient" means that the no selection methods are used for selecting cells or plants transfected with the DNA sequence of interest in the background of non-transfected cells or plants using, e.g. selectable agents and selectable marker genes capable of detoxifying the selectable agents. As a result, the transfected DNA sequence of interest is generally not stably introduced into plant chromosomal DNA. Instead, transient methods make use of the effect of transfection in the very plants transfected.
[0121] The invention is generally used for transfecting multi-cellular plants, notably, higher plants. Both monocot and dicot plants can be transfected, whereby dicot plants are preferred. Plants for the use in this invention include any plant species with preference given to agronomically and horticulturally important crop species. Common crop plants for the use in present invention include alfalfa, barley, beans, canola, cowpeas, cotton, corn, clover, lotus, lentils, lupine, millet, oats, peas, peanuts, rice, rye, sweet clover, sunflower, sweetpea, soybean, sorghum triticale, yam beans, velvet beans, vetch, wheat, wisteria, and nut plants. The plant species preferred for practicing this invention include, but not restricted to, representatives of Gramineae, Compositeae, Solanaceae and Rosaceae.
[0122] Further preferred species for the use in this invention are plants from the following genera: Arabidopsis, Agrostis, Allium, Antirrhinum, Apium, Arachis, Asparagus, Atropa, Avena, Bambusa, Brassica, Bromus, Browaalia, Camellia, Cannabis, Capsicum, Cicer, Chenopodium, Chichorium, Citrus, Coffea, Coix, Cucumis, Curcubita, Cynodon, Dactylis, Datura, Daucus, Digitalis, Dioscorea, Elaeis, Eleusine, Festuca, Fragaria, Geranium, Glycine, Helianthus, Heterocallis, Hevea, Hordeum, Hyoscyamus, Ipomoea, Lactuca, Lens, Lilium, Linum, Lolium, Lotus, Lycopersicon, Majorana, Malus, Mangifera, Manihot, Medicago, Nemesia, Nicotiana, Onobrychis, Oryza, Panicum, Pelargonium, Pennisetum, Petunia, Pisum, Phaseolus, Phleum, Poa, Prunus, Ranunculus, Raphanus, Ribes, Ricinus, Rubus, Saccharum, Salpiglossis, Secale, Senecio, Setaria, Sinapis, Solanum, Sorghum, Stenotaphrum, Theobroma, Trifolium, Trigonella, Triticum, Vicia, Vigna, Vitis, Zea, and the Olyreae, the Pharoideae and others.
[0123] Preferably, the processes of the invention are applied to dicot plant such as Nicotiana benthamiana, tobacco, cotton, soybean, rapeseed, pepper, potato, or tomato.
[0124] In one embodiment, the process of the invention can be used for producing a protein of interest in a plant or in many plants growing on a field. For this purpose, the plants may be sprayed with the suspension comprising the Agrobacterium cells containing the desired binary vector at a desired growth state of the plants. If the main aim is to achieve the highest possible expression levels followed by harvesting plants for obtaining plant material containing high amounts of the protein, viral vectors may be used, since they generally give the highest expression levels.
[0125] In another embodiment, the process of the invention is used for generating or altering a trait in a plant such as an input trait. In this embodiment, excessive expression of a protein or RNA of interest may not be desired for avoiding deleterious effects on plant health. For such embodiments, non-replicating vectors (also referred to herein as "transcriptional vectors"), i.e. vectors lacking a functional origin of replication recognised by a nucleic acid polymerase present in the plant cells are preferred. Another application of the invention is RNA expression, e.g. for RNA interference, wherein the interference signal can spread in the plant from cells having expressed the signal to other cells. An example is the targeting of undesired viral DNA in plants as described by Pooggin in Nat. Biotech. 21 (2003) 131. An example of oncogene silencing that can be adapted to a transient system is described by Escobar et al. Proc. Natl. Acad. Sci. USA 98 (2001) 13437-13442. A further example is the control of coleopteran insect pests through RNA interference similar as described by Baum et al., Nat. Biotech. 25 (2007) 1322-1326 that can be adapted to the transient process of the invention by transiently transfecting pest-infested plants with a DNA sequence of interest encoding the dsRNA such that it can be expressed. Further methods applicable to the transient process of the invention are those described by Huang et al., Proc. Natl. Acad. Sci. USA 103 (2006) 14302-14306; Chuang et al., Proc. Natl. Acad. Sci. USA 97 (2000) 4985-4990.
[0126] Further, the process of the invention allows altering at a desired point in time traits relating to the regulation of flowering time or fruit formation such as tuberisation in potato (Martinez-Garcia et al., Proc. Natl. Acad. Sci. USA 99 (2002) 15211-15216) or the regulation of the flavonoid pathway using a transcription factor (Deluc et al., Plant Physiol. 147 (2008) 2041-2053). Flowering may be induced by transiently expressing the movable florigen protein FT (Zeevaart, Current Opinion in Plant Biology 11 (2008) 541-547; Corbesier et al., Science 316 (2007) 1030-1033). Parthenocarpic fruits in tomatoes may by produced on a large scale using the invention and the method described by Pandolfini et al., BMC Biotechnology 2 (2002). Further applications of the invention are in the context of altering cotton fiber development by way of MYB transcription factors as described by Lee et al., Annals of Botany 100 (2007) 1391-1401 or activation of plant defensive genes (Bergey et al., Proc. Natl. Acad. Sci. USA 93 (1996) 12053-12058.
[0127] The invention also provides a process of protecting crop plants on a field from a pest. In such process, infestation of at least one of the plants from a plurality of plants growing in a lot or farm field may be determined. Due to the rapidness of the process of the invention expression of a protein or RNA detrimental to the pest needs to be caused only if infestation by the pest is determined. Thus, strong and constitutive expression of pest toxins or dsRNA for RNAi even in the absence of a risk of infestation is not necessary. Transient expression of Bacillus thuringiensis endotoxins after the spraying with diluted agrobacterial cultures harbouring corresponding PVX-based expression vectors protected Nicotiana benthamiana plants from feeding damage by larvae of the tobacco hornworm Manduca sexta (cf. FIG. 30 of WO 2012/019660).
EXAMPLES
Reference Example 1
[0128] Determination of Agrobacterium Cell Concentration in Liquid Culture in Terms of Colony Forming Units (cfu)
[0129] The concentration of Agrobacterium cells in liquid suspension in terms of colony forming units per ml (cfu/ml) of liquid suspensions can be determined using the following protocol. Cells of Agrobacterium tumefaciens strain ICF 320 transformed with construct pNMD620 were grown in 7.5 ml of liquid LBS medium containing 25 mg/L kanamycin (AppliChem, A1493) and 50 mg/L rifampicin (Carl Roth, 4163.2). The bacterial culture was incubated at 28° C. with continuous shaking. Absorbance or optical density of bacterial culture expressed in absorbance units (AU) was monitored in 1-ml aliquots of the culture using a spectrophotometer at 600 nm wavelength (OD600). The cell concentration estimated as a number of colony-forming units per milliliter of liquid culture (cfu/ml) can be analyzed at OD600 values 1; 1.3; 1.5; 1.7 and 1.8. For this purpose 250-μl aliquots of liquid culture were diluted with LBS-medium to achieve a final volume of 25 ml (dilution 1:100). 2.5 ml of such 1:100 dilution were mixed with 22.5 ml of LBS to achieve the dilution 1:1000. Liquid culture dilutions 1:100; 1:1,000; 1:10,000; 1:100,000; 1:1,000,000; 1:10,000,000 and 1:100,000,000 were prepared similarly. Aliquots of last three dilutions were spread on agar-solidified LBS medium supplemented with 25 mg/L kanamycin and 50 mg/L rifampicin (250 82 l of bacterial culture per plate of 90 mm diameter). Plating of aliquots for each dilution was performed in triplicate. After 2 days incubation at 28° C., bacterial colonies were counted for each plate. Plating of 1:1,000,000 and 1:10,000,000 dilutions resulted in few hundred and few dozen colonies per plate, respectively. So far as dilution 1:100,000,000 provided just few colonies per plate, this dilution was not used for calculation of cell concentration. The cell concentration was estimated according to the formula: cfu/ml=4×number of colonies per plate×dilution factor.
[0130] For transforming cell concentrations as measured by absorbance measurements at 600 nm (in LB medium) and in terms of cell-forming units, the following relation is used herein: an OD600 of 1.0 corresponds to 1.1×109 cfu/ml.
LBS Medium (Liquid)
[0131] 1% soya peptone (papaic hydrolysate of soybean meal; Duchefa, S1330)
[0132] 0.5% yeast extract (Duchefa, Y1333)
[0133] 1% sodium chloride (Carl Roth, 9265.2) dissolved in water, and the is adjusted to pH 7.5 with 1M NaOH (Carl Roth, 6771.2)
[0134] To prepare the solid LBS medium, liquid LBS medium was supplemented with 1.5% agar (Carl Roth, 2266.2). Media were autoclaved at 121° C. for 20 min.
EXAMPLE 1
Vectors Used in the Following Examples
[0135] In this study we used TMV- and PVX-based viral vectors as well as standard transcriptional vectors based on 35S CaMV promoter.
[0136] TMV-based vectors with cell-to-cell movement ability pNMD560, pNMD062, pNMD063 and pNMD064 (FIG. 1A) were created on the basis of vectors described in Marillonnet et al. (2006). All these vectors are designed for the expression of GFP as a reporter gene; they contain the insertion of a coding sequence of sGFP that is modified green fluorescent protein (GFP) from jelly fish Aequorea victoria (GeneBank accession no. EF030489). The pNMD560 construct contains, in sequential order, a fragment from the Arabidopsis actin 2 (ACT2) promoter (GenBank accession no. AB026654); the 5' end of TVCV (GenBank accession no. BRU03387, base pairs 1-5455) and a fragment of cr-TMV [GenBank accession no. Z29370, base pairs 5457-5677, both together containing 16 intron insertions]; a sGFP coding sequence; cr-TMV 3' nontranslated region (3' NTR; GenBank accession no. Z29370), and the nopaline synthase (Nos) terminator. The entire fragment was cloned between the T-DNA left and right borders of binary vector.
[0137] The pNMD062 plasmid was created on the basis of pNMD560 construct. For this purpose, a DNA fragment comprising the coding sequence and a 5'-upstream genomic region of a virG gene of octopine-type Ti-plasmid from LBA4404 strain of Agrobacterium tumefaciens (GenBank accession no. AF242881.1, base pairs 160603-161600) flanked by the sequence ctgtcgatc from the 5'-terminus and the sequence aagatcgacag (SEQ ID NO: 8) from the 3' terminus was amplified by PCR and inserted into the plasmid backbone using AfeI restriction site.
[0138] The pNMD063 construct was identical to pNMD062 except for the N54D mutation.
[0139] To create pNMD064 construct, a DNA fragment comprising the coding sequence containing the N54D mutation and 5'-upstream genomic region of virG gene of nopaline-type Ti-plasmid from GV3101 strain of Agrobacterium tumefaciens (GenBank accession no. AE007871.2, base pairs 194307-193333) was amplified by PCR and inserted into the plasmid backbone of pNMD560 construct using AfeI restriction site.
[0140] The pNMD570 construct (TMV-based vectors lacking cell-to cell movement ability) was identical to pNMD560 except for a point mutation in the MP-coding sequence leading to an open reading frame shift that distorts MP translation (FIG. 1A).
[0141] The pNMD620 construct, a PVX-based vector without cell-to-cell and systemic movement abilities for GFP expression, contained, in sequential order, a 35S CaMV promoter, coding sequences of the RNA-dependent RNA polymerase, triple gene block modules comprising 25 kDa, 12 kDa and 8 kDa proteins, an sGFP coding sequence and a 3'-untranslated region. The entire fragment was cloned between the T-DNA left and right borders of binary vector (FIG. 1B).
[0142] All transcriptional vectors were created on the basis of pICBV10, a pBIN19-derived binary vector (Marillonnet et al., 2004, 2006). They contained two expression cassettes inserted within right and left borders of the same T-DNA region (FIG. 1B). In the case of the pNMD1971 construct, an expression cassette adjacent to the right border comprised, in sequential order, the Cauliflower mosaic virus (CAMV) 35S promoter, omega translational enhancer from Tobacco Mosaic Virus, coding sequence of beta-glucuronidase from Escherichia coli (GenBank accession no. S69414) containing the intron from Petunia hybrids PSK7 gene (GenBank accession no. AJ224165.1, base pairs 4411-4484), and the terminator from the nopaline synthase gene of Agrobacterium tumefaciens. The second expression cassette was inserted between the first one and the T-DNA left border. It contained, in sequential order, the Cauliflower mosaic virus (CAMV) 35S promoter, omega translational enhancer from Tobacco Mosaic Virus, coding sequence of P19 suppressor of silencing from Tomato Bushy Stunt Virus (TBSV) (GenBank accession no. CAB56483.1) and terminator from octopine synthase gene of Agrobacterium tumefaciens.
[0143] The pNMD2180 construct was created on the basis of the pNMD1971 vector. For this purpose, the NotI/NdeI fragment of the pNMD1971 construct was replaced with same fragment of pNMD064 construct containing virGN54D gene of nopaline-type Ti-plasmid from GV3101 strain of Agrobacterium tumefaciens flanked by 5'-upstream genomic region.
[0144] The pNMD2190 was created in a similar way. The NotI/NdeI fragment of pNMD1971 construct was replaced with same fragment of pNMD063 vector containing virGN54D gene of octopine-type Ti-plasmid from LBA4404 strain of Agrobacterium tumefaciens flanked by 5'-upstream genomic region.
EXAMPLE 2
Strain CryX Shows Stronger Transient Transfection of Nicotiana benthamiana if Compared with Commonly Used Agrobacterium tumefaciens Strains
[0145] We tested the number of Agrobacterium tumefaciens strains including AGL1, EHA105, GV3101, ICF320, CryX, LBA4404 and LBA9402 for the transient transfection of Nicotiana benthamiana plants. For this purpose plant leaves were infiltrated using a needleless syringe with 10-3 and 10-4 dilutions of OD600=1.3 of agrobacterial cultures of the seven above-mentioned strains harboring a GFP expression TMV-based vector capable of cell-to-cell movement (TMV-GFP, pNMD560 construct) as it is shown in FIG. 2A. In parallel, leaves were infiltrated with 10-2 and 10-3 dilutions of the overnight agrobacterial cultures of same strains carrying TMV-based vector lacking cell-to-cell movement ability (TMV(fsMP)-GFP, pNMD570 construct) as it is shown in FIG. 2B.
[0146] Based on the density of fluorescing spots and the intensity of GFP fluorescence, we proved the efficient transient transfection for several strains (e.g., AGL1, EHA105, and LBA9402) however the transient transfection efficiency of CryX strain was significantly higher for both constructs with all tested dilutions of agrobacterial cultures if compared with any other tested strain.
[0147] To provide a quantitative evaluation of transient transfection efficiency for the CryX strain, we estimated the ratio between the number of cells in the bacterial suspension infiltrated in leaves and the number of produced GFP fluorescent spots considered as a single transfection event. For this purpose, leaves of 6-weeks old Nicotiana benthamiana plants were infiltrated using a syringe without needle with 200 μl of agrobacterial cultures of OD600=1.3 diluted by dilution factors of 10-5, 10-6 and 10-7 with a buffer consisting of 5 mM MES, pH 5.3 and 10 mM MgCl2. CryX, EHA105, GV3101 and ICF320 agrobacterial cells carried constructs pNMD560 (TMV-GFP vector). For the scoring of bacterial cells, 100 μl aliquots of bacterial suspensions used for leaf infiltration were plated in triplicate on LB-agar plates containing 50 μl/l rifampicin and 50 μl/l kanamycin. Plates were incubated for 2 days at 28° C. and after that the number of cfu (colony forming units) was counted. According to our estimation, 100 μl of bacterial cultures of CryX, EHA105, GV3101 and ICF320 contained 7.38+/-1.72, 5.00+/-1.50, 2.53+/-0.87 and 6.17+/-1.37 cfu (Table 1). In parallel at 4 dpi Nicotiana benthamiana leaves were scored for GFP fluorescent spots. On average, 7.38+/-1.72, 5.00+/-1.50, 2.53+/-0.87 and 6.17+/-1.37 fluorescent spots were produced per 100 μl of 10-7 dilution of infiltrated agrobacterial culture for CryX, EHA105, GV3101 and ICF320 strains, respectively. Each agrobacterial cell produced 0.46 transfection loci for CryX strain and 0.01 transfection loci for all other tested strains, CryX strain being 46 times more efficient than EHA105, GV3101 and ICF320 strains.
TABLE-US-00001 TABLE 1 Transfection efficiency of CryX in comparison with other strains at concentration factor 10-7 of agrobacterial culture (pNMD560 construct, 4 dpi). CryX EHA105 GV3101 ICF320 GFP spots/ 2.85 +/- 0.83 0.06 +/- 0.02 0.03 +/- 0.01 0.06 +/- 0.02 100 μl input culture cfu/100 μl 7.38 +/- 1.72 5.00 +/- 1.50 2.53 +/- 0.87 6.17 +/- 1.37 input culture GFP spots/ 0.46 0.01 0.01 0.01 cfu of input culture
EXAMPLE 3
Overexpression of virG Gene from LBA4404 Strain Increases the Transient Transfection Efficiency of CryX Strain
[0148] We tested the influence of overexpression of virG genes on the transient transfection efficiency of several Agrobacterium strains. For this purpose we created TMV-based vectors carrying the insertion of virG genes either from GV3101 or LBA4404 strains in their plasmid backbones (FIG. 1A). First, we tested AGL1, EHA105, ICF320 and GV3101 strains using vectors harboring virGN54D genes from GV3101 and LBA404 strains (pNMD063 and pNMD064, respectively) as well as a vector with native virG gene sequence from LBA4404 strain (pNMD062). Nicotiana benthamiana leaves were infiltrated using syringe without needle with 102, 103 and 104-fold dilutions of OD600=1.3 of agrobacterial cultures. Photographs showing GFP fluorescence in the uv light were taken at 4th (FIG. 3A) and 6th dpi (FIG. 3B). Based on the visual evaluation, we demonstrated the strain-specific increase of the transient transfection efficiency. As it is summarized in Table 2, overexpression of virGN54D from GV3101 strain increased the transient transfection efficiency for GV3101 and ICF320 strains; virGN54D from LBA4404 strain improved the transient transfection efficiency of AGL1, EHA105 and LBA4404 strains.
[0149] The CryX strain was tested similarly, as shown in FIG. 4. Nicotiana benthamiana leaves were infiltrated using syringe without needle with liquid CryX and GV3101 agrobacterial cultures of OD600=1.3 diluted 10-4 and 10-5 with buffer for infiltration. GFP expression TMV-based vectors containing virGN54D genes from GV3101 and LBA404 strains in the plasmid backbone (pNMD063 and pNMD064, respectively) were compared with pNMD560 vector containing no virG gene insertion. FIG. 4A depicts the GFP fluorescence for the dilution 10-4 at 3 and 4 dpi; FIG. 4B shows the GFP fluorescence for the dilution 10-5 at 4 and 5 dpi. We demonstrated a significant increase of transient transfection efficiency for CryX strain in combination with virGN54D gene from LBA4404; in contrast, the overexpression of virGN54D gene from GV3101 strain had a negative impact on CryX-mediated transient transfection.
TABLE-US-00002 TABLE 2 Effect of virG overexpression on the T-DNA transfer efficiency Agrobacterium strain virGN54D/GV3101 virGN54D/LBA4404 AGL1 no effect increase GV3101 increase no effect ICF320 increase no effect EHA105 no effect increase LBA4404 no effect increase
EXAMPLE 4
CryX in Combinations with virGN54D/LBA4404 Provides Efficient Transient Transfection of Nicotiana benthamiana in up to 107-Fold Dilutions Using Leaf Infiltration
[0150] To find the maximal effective dilutions of CryX liquid cultures for transient transfection of Nicotiana benthamiana plants, we performed syringe infiltration of leaves with liquid CryX and GV3101 agrobacterial cultures of OD600=1.3 diluted to 10-3, 104, 10-5, 10-6 and 10-7 with buffer for infiltration.
[0151] In our experiments, Agrobacterium tumefaciens strain CryX in combination with virGN54D from LBA4404 strain provided the most efficient transfection of Nicotiana benthamiana plants we ever observed, resulting in the reasonable number of fluorescing spots even at the 10-7 concentration factor of overnight culture (FIG. 5). It allows increasing the dilution of agrobacterial culture used for plant infiltration approx. 100 to 1000-fold compared with 103-fold dilution typically used in Magnicon® system.
[0152] To provide a quantitative evaluation of transient transfection efficiency for CryX strain, we estimated the ratio between the number of cells in the bacterial suspension infiltrated in leaves and the number of produced GFP fluorescent spots considered as a single transfection event. For this purpose leaves of 6-weeks old Nicotiana benthamiana plants were infiltrated using syringe without needle with 200 μl of agrobacterial cultures of OD600=1.3 diluted 10-7 with an aqueous buffer containing 5 mM MES, pH 5.3 and 10 mM MgCl2. CryX agrobacterial cells carried constructs pNMD560 (TMV-GFP vector) and pNMD062 (TMV-GFP vector containing virGN54D from LBA4404 strain in the plasmid backbone). For scoring of bacterial cells, 100 μl aliquots of bacterial suspensions used for leaf infiltration were plated in triplicate on LB-agar plates containing 50 μl/l rifampicin and 50 μl/l kanamycin. Plates were incubated for 2 days at 28° C. and after that the number of cfu (colony forming units) was counted. According to our estimation, 100 μl of bacterial cultures contained 14.7+/-4.4 and 13.9+/-3.4 cfu for pNMD560 and pNMD062 constructs, respectively (Table 3). In parallel at 5 dpi Nicotiana benthamiana leaves were scored for GFP fluorescent spots. In average, 16.3+/-1.5 and 24.0+/-0.0 fluorescent spots were produced per 100 μl of infiltrated agrobacterial culture for pNMD560 and pNMD062 constructs, respectively. In other words, each agrobacterial cell harboring the pNMD560 construct produced about 1.1 transfection loci; for the pNMD062 construct, this value was higher, 1.7, showing an increase of the transfection efficiency due to the overexpression of virG gene.
EXAMPLE 5
Agrobacterium tumefaciens Strain CryX in Combination with virGN54D/LBA4404 Shows High Spraying Transfection Efficiency for Soybean
[0153] We tested the number of Agrobacterium tumefaciens strains including AGL1, EHA105, GV3101, ICF320, CryX and LBA4404 for the transient transfection of soybean Glycine max L. using spraying of plants with suspension of agrobacterial cells. For this purpose, liquid cultures harboring GUS expression vectors were grown to OD600=1.3 and diluted for spraying with buffer containing 5 mM MES pH5.3; 10 mM MgCl2 and 0.05% (v/v) Tween®20 in the ratio 1:10. For testing of AGL1, EHA105, CryX and LBA4404 strains, we used pNMD2190 construct (35S:GUS; 35S:p19 and virGN54D/LBA4404 in the plasmid backbone). GV3101 and ICF320 strains were tested with pNMD2180 vector (35S:GUS; 35S:p19 and virGN54D/GV3101 in the plasmid backbone). Staining of leaves for the GUS activity was performed at 11 days post spraying. Compared to other tested strains which showed no or little transfection, CryX provided significantly higher transient transfection rate as revealed by GUS staining (FIG. 6A).
[0154] Combining surfactant and abrasive treatment, we achieved efficient transient transfection of soybean with CryX strain for up to 10-2 dilutions of agrobacterial cultures when GUS expression transcriptional vector pNMD2190 was used (FIG. 6B).
EXAMPLE 6
Agrobacterium tumefaciens Strain CryX in Combination with virGN54D/LBA4404 Shows Enhanced Transient Spraying Transfection for Cotton
[0155] We tested the transient transfection of cotton with EHA105, GV3101, ICF320, and CryX strains using spraying. For this purpose liquid Agrobacterium cultures of OD600=1.3 were diluted in the ratio 1:10 with buffer containing 5 mM MES, pH5.3; 10 mM MgCl2 and 0.25% (v/v) Silwet L-77. pNMD2180 construct (35S:GUS; 35S:p19 and virGN54D/GV3101in the plasmid backbone) was used with GV3101 and ICF320 strains, and pNMD2190 (35S:GUS; 35S:p19 and virGN54D/LBA4404 in the plasmid backbone) was used with EHA105 and CryX strains. pNMD1971 construct (35S:GUS; 35S:p19) was applied as a control with all strains. GUS staining test was performed at 6 days post spraying. After the staining, few blue dots were found for GV3101 and ICF320 strains (data not shown). Very low transfection efficiency was shown also for EHA105 and CryX strains used with pNMD1971 construct. Compared with all other tested strains, CryX in combination with virGN54D from LBA4404 strain (pNMD2190) demonstrated increased transient transfection efficiency (FIG. 7).
TABLE-US-00003 TABLE 3 Transfection efficiency of CryX in combination with virGN54D/LBA4404 (pNMD062 construct) pNMD062 pNMD560 (virGN54D/ (no virG) LBA4404) Dilution of input agrobacterial culture 10-7 10-7 cfu/100 μl input culture 14.7 +/- 4.4 13,9 +/- 3.4 GFP spots/100 μl input culture, 5dpi 16.3 +/- 1.5 24.0 +/- 0.0 GFP spots/cfu of input culture 1.1 1.7
EXAMPLE 7
ICBGE Accession of Agrobacterium tumefaciens Chry5/KYRT1 Strain Shows Stronger Transient Transfection of Nicotiana benthamiana Compared to Kentucky University Accession of Same Strain
[0156] We tested two accessions of Agrobacterium tumefaciens Chry5/KYRT1 strain received from different laboratories, the laboratory of Dr. G. Collins in the University of Kentucky (Lexington, USA) and the accession from the Institute of Cell Biology and Genetics Engineering (ICBGE, Kiev, Ukraine) for the transient transfection of Nicotiana benthamiana plants. For this purpose, plant leaves were infiltrated using needleless syringe with dilutions using concentration factors of 10-1, 10-2 and 10-3 of an OD600=1.3 of agrobacterial cultures of both strain accessions harboring GFP expression TMV-based vector capable of cell-to-cell movement (TMV-GFP, pNMD560 construct) as it is shown in FIG. 8. Based on the density of fluorescing spots and the intensity of GFP fluorescence, we showed higher transient transfection efficiency for ICBGE accession if compared with Kentucky University accession.
[0157] The content of European patent application No. 12 002 402.1 filed on Apr. 3, 2012 is herein incorporated by reference in its entirety, including description, claims, figures and sequence listing.
REFERENCES
[0158] Akcay et al., Plant Cell Rep 28 (2009) 407-47.
[0159] Akbulut et al, African Journal of Biotechnology 7(8) 1011-1017, 2008
[0160] Andrews, L. B. & Curtis, W. R. (2005). Biotechnol Prog 21, 946-52.
[0161] Barton, K. A., Binns, A. N., Matzke, A. J. & Chilton, M. D. (1983). Cell 32, 1033-43.
[0162] Bush A L, Pueppke S G. Appl Environ Microbiol. 1991 September; 57(9):2468-72.
[0163] Chung, M. H., Chen, M. K. & Pan, S. M. (2000). Transgenic Res 9, 471-6.
[0164] Clough, S. J. & Bent, A. F. (1998). Plant J 16, 735-43.
[0165] D'Aoust, M. A., Lavoie, P. O., Belles-Isles, J., Bechtold, N., Martel, M. & Vezina, L. P. (2009). Methods Mol Biol 483, 41-50.
[0166] D'Aoust, M. A., Lavoie, P. O., Couture, M. M., Trepanier, S., Guay, J. M., Dargis, M., Mongrand, S., Landry, N., Ward, B. J. & Vezina, L. P. (2008). Plant Biotechnol J 6, 930-40.
[0167] De Buck, S., Jacobs, A., Van Montagu, M. & Depicker, A. (1998). Mol Plant Microbe Interact 11, 449-57.
[0168] De Buck, S., De Wilde, C., Van Montagu, M. & Depicker, A. (2000). Mol Plant Microbe Interact 13, 658-65.
[0169] de Felippes, F. F. & Weigel, D. (2010). Methods Mol Biol 592, 255-64.
[0170] Fraley, R. T., Rogers, S. G., Horsch, R. B., Sanders, P. R., Flick, J. S., Adams, S. P., Bittner, M. L., Brand, L. A., Fink, C. L., Fry, J. S., Galluppi, G. R., Goldberg, S. B., Hoffmann, N. L. & Woo, S. C. (1983). Proc Natl Acad Sci USA 80, 4803-7.
[0171] Gleba Y. Y. and Giritch A. (2011) Plant Viral Vectors for Protein Expression. In Recent Advances in Plant Virology. Caister Academic Press. ISBN 978-1-904455-75-2; pp. 387-412.
[0172] Gleba Y. Y. and Giritch A. (2011) Vaccines, antibodies, and pharmaceutical proteins. In Plant Biotechnology and Agriculture. Prospects for the 21st Century. Elsevier Inc. ISBN: 978-0-12-381466-1; pp. 465-476.
[0173] Gleba, Y., Klimyuk, V. & Marillonnet, S. (2007). Curr Opin Biotechnol 18, 134-41.
[0174] Gleba, Y., Marillonnet, S. & Klimyuk, V. (2004). Curr Opin Plant Biol 7, 182-8.
[0175] Gleba, Y., Marillonnet, S. & Klimyuk, V. (2008). Plant virus vectors (gene expression systems). In Encyclopedia of Virology, Third Edition. M. H. V. van Regenmortel, Mahy, B. W. J., eds. (San Diego, Calif.: Elsevier Academic Press), vol. 4, pp. 229-237.
[0176] Giritch, A., Marillonnet, S., Engler, C., van Eldik, G., Botterman, J., Klimyuk, V. & Gleba, Y. (2006). Proc Natl Acad Sci USA 103, 14701-6.
[0177] Grant et al., Plant Cell Rep 21 (2003) 1207-1210.
[0178] Green, B. J., Fujiki, M., Mett, V., Kaczmarczyk, J., Shamloul, M., Musiychuk, K., Underkoffler, S., Yusibov, V. & Mett, V. (2009). Biotechnol J 4, 230-7.
[0179] Huang, Z., Santi, L., LePore, K., Kilbourne, J., Arntzen, C. J. & Mason, H. S. (2006). Vaccine 24, 2506-13.
[0180] Jones, H. D., Doherty, A. & Sparks, C. A. (2009). Methods Mol Biol 513, 131-52.
[0181] Ko et al., Planta 218 (2004) 536-541.
[0182] Lee, M. W. & Yang, Y. (2006). Methods Mol Biol 323, 225-9.
[0183] Li, X. Q., Liu, C. N., Ritchie, S. W., Peng, J. Y., Gelvin, S. B. & Hodges, T. K. (1992). Plant Mol Biol 20, 1037-48.
[0184] Li, J. F., Park, E., von Arnim, A. G. & Nebenfuhr, A. (2009). Plant Methods 5, 6.
[0185] Lindbo, J. A. (2007). TRBO: a high-efficiency tobacco mosaic virus RNA-based overexpression vector. Plant Physiol 145, 1232-40.
[0186] Lindbo, J. A. (2007). BMC Biotechnol 7, 52.
[0187] Liu, C. N., Li, X. Q. & Gelvin, S. B. (1992). Plant Mol Biol 20, 1071-87.
[0188] Lico, C., Chen, Q. & Santi, L. (2008). J Cell Physiol 216, 366-77.
[0189] Lindbo, J. A. (2007). BMC Biotechnol 7, 52.
[0190] Marillonnet, S., Giritch, A., Gils, M., Kandzia, R., Klimyuk, V. & Gleba, Y. (2004). Proc Natl Acad Sci USA 101, 6852-7.
[0191] Marillonnet, S., Thoeringer, C., Kandzia, R., Klimyuk, V. & Gleba, Y. (2005). Nat Biotechnol 23, 718-23.
[0192] Mett, V., Lyons, J., Musiychuk, K., Chichester, J. A., Brasil, T., Couch, R., Sherwood, R., Palmer, G. A., Streatfield, S. J. & Yusibov, V. (2007. Vaccine 25, 3014-7.
[0193] Palanichelvam K. et al., Mol Plant Microbe Interact. 2000 October; 13 (10):1081-91.
[0194] Plesha, M. A., Huang, T. K., Dandekar, A. M., Falk, B. W. & McDonald, K. A. (2007). Biotechnol Prog 23, 1277-85.
[0195] Plesha, M. A., Huang, T. K., Dandekar, A. M., Falk, B. W. & McDonald, K. A. (2009). Biotechnol Prog 25, 722-34.
[0196] Regnard, G. L., Halley-Stott, R. P., Tanzer, F. L., Hitzeroth, II & Rybicki, E. P. (2010). Plant Biotechnol J 8, 38-46.
[0197] Ryu, C. M., Anand, A., Kang, L. & Mysore, K. S. (2004). Plant J 40, 322-31.
[0198] Santi, L., Giritch, A., Roy, C. J., Marillonnet, S., Klimyuk, V., Gleba, Y., Webb, R., Arntzen, C. J. & Mason, H. S. (2006). Proc Natl Acad Sci USA 103, 861-6.
[0199] Shang, Y., Schwinn, K. E., Bennett, M. J., Hunter, D. A., Waugh, T. L., Pathirana, N. N., Brummell, D. A., Jameson, P. E. & Davies, K. M. (2007). Plant Methods 3, 1.
[0200] Shiboleth, Y. M., Arazi, T., Wang, Y. & Gal-On, A. (2001). J Biotechnol 92, 37-46.
[0201] Shoji, Y., Farrance, C. E., Bi, H., Shamloul, M., Green, B., Manceva, S., Rhee, A., Ugulava, N., Roy, G., Musiychuk, K., Chichester, J. A., Mett, V. & Yusibov, V. (2009). Vaccine 27, 3467-70.
[0202] Simmons, C. W., VanderGheynst, J. S. & Upadhyaya, S. K. (2009). Biotechnol Bioeng 102, 965-70.
[0203] Sudarshana, M. R., Plesha, M. A., Uratsu, S. L., Falk, B. W., Dandekar, A. M., Huang, T. K. & McDonald, K. A. (2006). Plant Biotechnol J 4, 551-9.
[0204] Torisky et al., Plant Cell Reports 17 (1997) 102-108.
[0205] Vaquero, C., Sack, M., Chandler, J., Drossard, J., Schuster, F., Monecke, M., Schillberg, S. & Fischer, R. (1999). Proc Natl Acad Sci USA 96, 11128-33.
[0206] Vezina, L. P., Faye, L., Lerouge, P., D'Aoust, M. A., Marquet-Blouin, E., Burel, C., Lavoie, P. O, Bardor, M. & Gomord, V. (2009). Plant Biotechnol J 7, 442-55.
[0207] Voinnet, O., Rivas, S., Mestre, P. & Baulcombe, D. (2003). Plant J 33, 949-56.
[0208] Wroblewski, T., Tomczak, A. & Michelmore, R. (2005). Plant Biotechnol J 3, 259-73.
[0209] Yang, Y., Li, R. & Qi, M. (2000). Plant J 22, 543-51.
[0210] Yang, L., Wang, H., Liu, J., Li, L., Fan, Y., Wang, X., Song, Y., Sun, S., Wang, L., Zhu, X. & Wang, X. (2008). J Biotechnol 134, 320-4.
[0211] Zambre, M., Terryn, N., De Clercq, J., De Buck, S., Dillen, W., Van Montagu, M., Van Der Straeten, D. & Angenon, G. (2003). Light strongly promotes gene transfer from Agrobacterium tumefaciens to plant cells. Planta 216, 580-6.
[0212] Zhang, C. & Ghabrial, S. A. (2006). Virology 344, 401-11.
[0213] Zhao, M. M., An, D. R., Zhao, J., Huang, G. H., He, Z. H. & Chen, J. Y. (2006). Acta Biochim Biophys Sin (Shanghai) 38, 22-8.
ANNEX
TABLE-US-00004
[0214] SEQ ID NO: 1: Amino acid sequence from Agrobacterium LBA4404 virG protein. N54 is shown in bold. LKHVLLVDDDVAMRHLIIEYLTIHAFKVTAVADSTQFTRVLSSATVDVVVVDLNLGREDGLEIVRNLAAKSDIP- IIIISGDRLEETDKVVALELGASDFI AKPFSIREFLARIRVALRVRPNVVRSKDRRSFCFTDWTLNLRQRRLMSEAGGEVKLTAGEFNLLLAFLEKPRDV- LSREQLLIASRVRDEEVYDRSIDVLI LRLRRKLEADPSSPQLIKTARGAGYFFDADVQVSHGGTMAA SEQ ID NO: 2: T-DNA region sequences of pNMD560, pNMD062, pNMD063, pNMD064 cctgtggttggcacatacaaatggacgaacggataaaccttttcacgcccttttaaatatccgattattctaat- aaacgctcttttctcttaggtttacc cgccaatatatcctgtcaaacactgatagtttaaactgaaggcgggaaacgacaatctgatctaagctagcttg- gaattggtaccacgcgtttcgacaaa atttagaacgaacttaattatgatctcaaatacattgatacatatctcatctagatctaggttatcattatgta- agaaagttttgacgaatatggcacga caaaatggctagactcgatgtaattggtatctcaactcaacattatacttataccaaacattagttagacaaaa- tttaaacaactattttttatgtatgc aagagtcagcatatgtataattgattcagaatcgttttgacgagttcggatgtagtagtagccattatttaatg- tacatactaatcgtgaatagtgaata tgatgaaacattgtatcttattgtataaatatccataaacacatcatgaaagacactttctttcacggtctgaa- ttaattatgatacaattctaatagaa aacgaattaaattacgttgaattgtatgaaatctaattgaacaagccaaccacgacgacgactaacgttgcctg- gattgactcggtttaagttaaccact aaaaaaacggagctgtcatgtaacacgcggatcgagcaggtcacagtcatgaagccatcaaagcaaaagaacta- atccaagggctgagatgattaattag tttaaaaattagttaacacgagggaaaaggctgtctgacagccaggtcacgttatctttacctgtggtcgaaat- gattcgtgtctgtcgattttaattat ttttttgaaaggccgaaaataaagttgtaagagataaacccgcctatataaattcatatattttcctctccgct- ttgaagttttagttttattgcaacaa caacaacaaattacaataacaacaaacaaaatacaaacaacaacaacatggcacaatttcaacaaacaattgac- atgcaaactctccaagccgctgcggg acgcaacagcttggtgaatgatttggcatctcgtcgcgtttacgataatgcagtcgaggagctgaatgctcgtt- ccagacgtcccaaggtaataggaact ttctggatctactttatttgctggatctcgatcttgttttctcaatttccttgagatctggaattcgtttaatt- tggatctgtgaacctccactaaattt ttggttttactagaatcgatctaagttgaccgatcagttagctcgattatagctaccagaatttggcttgacct- tgatggagagatccatgttcatgtta cctgggaaatgatttgtatatgtgaattgaaatctgaactgttgaagttagattgaatctgaacactgtcaatg- ttagattgaatctgaacactgtttaa ggttagatgaagtttgtgtatagattcttcgaaactttaggatttgtagtgtcgtacgttgaacagaaagctat- ttctgattcaatcagggtttatttga ctgtattgaactctttttgtgtgtttgcaggtccacttctccaaggcagtgtctacggaacagaccctgattgc- aacaaacgcatatccggagttcgaga tttcctttactcatacgcaatccgctgtgcactccttggccggaggccttcggtcacttgagttggagtatctc- atgatgcaagttccgttcggttctct gacgtacgacatcggcggtaacttttccgcgcaccttttcaaagggcgcgattacgttcactgctgcatgccta- atctggatgtacgtgacattgctcgc catgaaggacacaaggaagctatttacagttatgtgaatcgtttgaaaaggcagcagcgtcctgtgcctgaata- ccagagggcagctttcaacaactacg ctgagaacccgcacttcgtccattgcgacaaacctttccaacagtgtgaattgacgacagcgtatggcactgac- acctacgctgtagctctccatagcat ttatgatatccctgttgaggagttcggttctgcgctactcaggaagaatgtgaaaacttgtttcgcggcctttc- atttccatgagaatatgcttctagat tgtgatacagtcacactcgatgagattggagctacgttccagaaatcaggtaacattccttagttacctttctt- ttctttttccatcataagtttataga ttgtacatgctttgagatttttctttgcaaacaatctcaggtgataacctgagcttcttcttccataatgagag- cactctcaattacacccacagcttca gcaacatcatcaagtacgtgtgcaagacgttcttccctgctagtcaacgcttcgtgtaccacaaggagttcctg- gtcactagagtcaacacttggtactg caagttcacgagagtggatacgttcactctgttccgtggtgtgtaccacaacaatgtggattgcgaagagtttt- acaaggctatggacgatgcgtggcac tacaaaaagacgttagcaatgcttaatgccgagaggaccatcttcaaggataacgctgcgttaaacttctggtt- cccgaaggtgctcttgaaattggaag tcttcttttgttgtctaaacctatcaatttctttgcggaaatttatttgaagctgtagagttaaaattgagtct- tttaaacttttgtaggtgagagacat ggttatcgtccctctctttgacgcttctatcacaactggtaggatgtctaggagagaggttatggtgaacaagg- acttcgtctacacggtcctaaatcac atcaagacctatcaagctaaggcactgacgtacgcaaacgtgctgagcttcgtggagtctattaggtctagagt- gataattaacggtgtcactgccaggt aagttgttacttatgattgttttcctctctgctacatgtattttgttgttcatttctgtaagatataagaattg- agttttcctctgatgatattattagg tctgaatgggacacagacaaggcaattctaggtccattagcaatgacattcttcctgatcacgaagctgggtca- tgtgcaagatgaaataatcctgaaaa agttccagaagttcgacagaaccaccaatgagctgatttggacaagtctctgcgatgccctgatgggggttatt- ccctcggtcaaggagacgcttgtgcg cggtggttttgtgaaagtagcagaacaagccttagagatcaaggttagtatcatatgaagaaatacctagtttc- agttgatgaatgctattttctgacct cagttgttctctttgagaattatttcttttctaatttgcctgatttttctattaattcattaggttcccgagct- atactgtaccttcgccgaccgattgg tactacagtacaagaaggcggaggagttccaatcgtgtgatctttccaaacctctagaagagtcagagaagtac- tacaacgcattatccgagctatcagt gcttgagaatctcgactcttttgacttagaggcgtttaagactttatgtcagcagaagaatgtggacccggata- tggcagcaaaggtaaatcctggtcca cacttttacgataaaaacacaagattttaaactatgaactgatcaataatcattcctaaaagaccacacttttg- ttttgtttctaaagtaatttttactg ttataacaggtggtcgtagcaatcatgaagtcagaattgacgttgcctttcaagaaacctacagaagaggaaat- ctcggagtcgctaaaaccaggagagg ggtcgtgtgcagagcataaggaagtgttgagcttacaaaatgatgctccgttcccgtgtgtgaaaaatctagtt- gaaggttccgtgccggcgtatggaat gtgtcctaagggtggtggtttcgacaaattggatgtggacattgctgatttccatctcaagagtgtagatgcag- ttaaaaagggaactatgatgtctgcg gtgtacacagggtctatcaaagttcaacaaatgaagaactacatagattacttaagtgcgtcgctggcagctac- agtctcaaacctctgcaaggtaagag gtcaaaaggtttccgcaatgatccctctttttttgtttctctagtttcaagaatttgggtatatgactaacttc- tgagtgttccttgatgcatatttgtg atgagacaaatgtttgttctatgttttaggtgcttagagatgttcacggcgttgacccagagtcacaggagaaa- tctggagtgtgggatgttaggagagg acgttggttacttaaacctaatgcgaaaagtcacgcgtggggtgtggcagaagacgccaaccacaagttggtta- ttgtgttactcaactgggatgacgga aagccggtttgtgatgagacatggttcagggtggcggtgtcaagcgattccttgatatattcggatatgggaaa- acttaagacgctcacgtcttgcagtc caaatggtgagccaccggagcctaacgccaaagtaattttggtcgatggtgttcccggttgtggaaaaacgaag- gagattatcgaaaggtaagttctgca tttggttatgctccttgcattttaggtgttcgtcgctcttccatttccatgaatagctaagattttttttctct- gcattcattcttcttgcctcagttct aactgtttgtggtatttttgttttaattattgctacaggtaaacttctctgaagacttgattttagtccctggg- aaggaagcttctaagatgatcatccg gagggccaaccaagctggtgtgataagagcggataaggacaatgttagaacggtggattccttcttgatgcatc- cttctagaagggtgtttaagaggttg tttatcgatgaaggactaatgctgcatacaggttgtgtaaatttcctactgctgctatctcaatgtgacgtcgc- atatgtgtatggggacacaaagcaaa ttccgttcatttgcagagtcgcgaactttccgtatccagcgcattttgcaaaactcgtcgctgatgagaaggaa- gtcagaagagttacgctcaggtaaag caactgtgttttaatcaatttcttgtcaggatatatggattataacttaatttttgagaaatctgtagtatttg- gcgtgaaatgagtttgctttttggtt tctcccgtgttataggtgcccggctgatgttacgtatttccttaacaagaagtatgacggggcggtgatgtgta- ccagcgcggtagagagatccgtgaag gcagaagtggtgagaggaaagggtgcattgaacccaataaccttaccgttggagggtaaaatttgaccttcaca- caagctgacaagttcgagttactgga gaagggttacaaggtaaagtttccaactttcctttaccatatcaaactaaagttcgaaactttttatttgatca- acttcaaggccacccgatctttctat tcctgattaatttgtgatgaatccatattgacttttgatggttacgcaggatgtgaacactgtgcacgaggtgc- aaggggagacgtacgagaagactgct attgtgcgcttgacatcaactccgttagagatcatatcgagtgcgtcacctcatgttttggtggcgctgacaag- acacacaacgtgttgtaaatattaca ccgttgtgttggacccgatggtgaatgtgatttcagaaatggagaagttgtccaatttccttcttgacatgtat- agagttgaagcaggtctgtctttcct atttcatatgtttaatcctaggaatttgatcaattgattgtatgtatgtcgatcccaagactttcttgttcact- tatatcttaactctctctttgctgtt tcttgcaggtgtccaatagcaattacaaatcgatgcagtattcaggggacagaacttgtttgttcagacgccca- agtcaggagattggcgagatatgcaa ttttactatgacgctcttcttcccggaaacagtactattctcaatgaatttgatgctgttacgatgaatttgag- ggatatttccttaaacgtcaaagatt gcagaatcgacttctccaaatccgtgcaacttcctaaagaacaacctattttcctcaagcctaaaataagaact- gcggcagaaatgccgagaactgcagg taaaatattggatgccagacgatattctttcttttgatttgtaactttttcctgtcaaggtcgataaattttat- ttttttggtaaaaggtcgataatttt tttttggagccattatgtaattttcctaattaactgaaccaaaattatacaaaccaggtttgctggaaaatttg- gttgcaatgatcaaaagaaacatgaa tgcgccggatttgacagggacaattgacattgaggatactgcatctctggtggttgaaaagttttgggattcgt- atgttgacaaggaatttagtggaacg aacgaaatgaccatgacaagggagagcttccaggtaaggacttctcatgaatattagtggcagattagtgttgt- taaagtctttggttagataatcgatg cctcctaattgtccatgttttactggttttctacaattaaaggtggctttcgaaacaagagtcatctacagttg- gtcagttagcggactttaactttgtg gatttgccggcagtagatgagtacaagcatatgatcaagagtcaaccaaagcaaaagttagacttgagtattca- agacgaatatcctgcattgcagacga tagtctaccattcgaaaaagatcaatgcgattttcggtccaatgttttcagaacttacgaggatgttactcgaa- aggattgactcttcgaagtttctgtt ctacaccagaaagacacctgcacaaatagaggacttcttttctgacctagactcaacccaggcgatggaaattc- tggaactcgacatttcgaagtacgat aagtcacaaaacgagttccattgtgctgtagagtacaagatctgggaaaagttaggaattgatgagtggctagc- tgaggtctggaaacaaggtgagttcc taagttccatttttttgtaatccttcaatgttattttaacttttcagatcaacatcaaaattaggttcaatttt- catcaaccaaataatatttttcatgt atatataggtcacagaaaaacgaccttgaaagattatacggccggaatcaaaacatgtctttggtatcaaagga- aaagtggtgatgtgacaacctttatt ggtaataccatcatcattgccgcatgtttgagctcaatgatccccatggacaaagtgataaaggcagctttttg- tggagacgatagcctgatttacattc ctaaaggtttagacttgcctgatattcaggcgggcgcgaacctcatgtggaacttcgaggccaaactcttcagg- aagaagtatggttacttctgtggtcg ttatgttattcaccatgatagaggagccattgtgtaatacgatccgcttaaactaatatctaagttaggttgta- aacatattagagatgttgttcactta gaagagttacgcgagtctttgtgtgatgtagctagtaacttaaataattgtgcgtatttttcacagttagatga- ggccgttgccgaggttcataagaccg cggtaggcggttcgtttgctttttgtagtataattaagtatttgtcagataagagattgtttagagatttgttc- tttgtttgataatgtcgatagtctcg tacgaacctaaggtgagtgatttcctcaatctttcgaagaaggaagagatcttgccgaaggctctaacgaggtt- aaaaaccgtgtctattagtactaaag atattatatctgtcaaggagtcggagactttgtgtgatatagatttgttaatcaatgtgccattagataagtat- agatatgtgggtatcctaggagccgt ttttaccggagagtggctagtgccagacttcgttaaaggtggagtgacgataagtgtgatagataagcgtctgg- tgaactcaaaggagtgcgtgattggt acgtacagagccgcagccaagagtaagaggttccagttcaaattggttccaaattactttgtgtccaccgtgga- cgcaaagaggaagccgtggcaggtaa ggatttttatgatatagtatgcttatgtattttgtactgaaaagcatatcctgcttcattgggatattactgaa- agcatttaactacatgtaaactcact tgatgatcaataaacttgattttgcaggttcatgttcgtatacaagacttgaagattgaggcgggttggcagcc- gttagctctggaagtagtttcagttg ctatggtcaccaataacgttgtcatgaagggtttgagggaaaaggtcgtcgcaataaatgatccggacgtcgaa- ggtttcgaaggtaagccatcttcctg cttatttttataatgaacatagaaataggaagttgtgcagagaaactaattaacctgactcaaaatctaccctc- ataattgttgtttgatattggtcttg tattttgcaggtgtggttgacgaattcgtcgattcggttgcagcatttaaagcggttgacaactttaaaagaag- gaaaaagaaggttgaagaaaagggtg tagtaagtaagtataagtacagaccggagaagtacgccggtcctgattcgtttaatttgaaagaagaaaacgtc- ttacaacattacaaacccgaataatc gataactcgagtatttttacaacaattaccaacaacaacaaacaacaaacaacattacaattacatttacaatt- atcatggtgagcaagggcgaggagct gttcaccggggtggtgcccatcctggtcgagctggacggcgacgtaaacggccacaagttcagcgtgtccggcg- agggcgagggcgatgccacctacggc aagctgaccctgaagttcatctgcaccaccggcaagctgcccgtgccctggcccaccctcgtgaccaccttcag- ctacggcgtgcagtgcttcagccgct accccgaccacatgaagcagcacgacttcttcaagtccgccatgcccgaaggctacgtccaggagcgcaccatc- ttcttcaaggacgacggcaactacaa gacccgcgccgaggtgaagttcgagggcgacaccctggtgaaccgcatcgagctgaagggcatcgacttcaagg- aggacggcaacatcctggggcacaag ctggagtacaactacaacagccacaacgtctatatcatggccgacaagcagaagaacggcatcaaggtgaactt- caagatccgccacaacatcgaggacg gcagcgtgcagctcgccgaccactaccagcagaacacccccatcggcgacggccccgtgctgctgcccgacaac- cactacctgagcacccagtccgccct gagcaaagaccccaacgagaagcgcgatcacatggtcctgctggagttcgtgaccgccgccgggatcactcacg- gcatggacgagctgtacaagtaaagc ggcccctagagcgtggtgcgcacgatagcgcatagtgtttttctctccacttgaatcgaagagatagacttacg- gtgtaaatccgtaggggtggcgtaaa ccaaattacgcaatgttttgggttccatttaaatcgaaaccccttattcctggatcacctgttaacgcacgttt- gacgtgtattacagtgggaataagta aaagtgagaggttcgaatcctccctaaccccgggtaggggcccagcggccgctctagctagagtcaagcagatc- gttcaaacatttggcaataaagtttc ttaagattgaatcctgttgccggtcttgcgatgattatcatataatttctgttgaattacgttaagcatgtaat- aattaacatgtaatgcatgacgttat ttatgagatgggtttttatgattagagtcccgcaattatacatttaatacgcgatagaaaacaaaatatagcgc- gcaaactaggataaattatcgcgcgc ggtgtcatctatgttactagatcgacctgcatccaccccagtacattaaaaacgtccgcaatgtgttattaagt- tgtctaagcgtcaatttgtttacacc acaatatatcctgccaccagccagccaacagctccccgaccggcagctcggcacaaaatcaccactcgatacag- gcagcccatcag SEQ ID NO: 3: Sequence of T-DNA region of pNMD570 cctgtggttggcacatacaaatggacgaacggataaaccttttcacgcccttttaaatatccgattattctaat- aaacgctcttttctcttaggtttacc cgccaatatatcctgtcaaacactgatagtttaaactgaaggcgggaaacgacaatctgatctaagctagcttg- gaattggtaccacgcgtttcgacaaa atttagaacgaacttaattatgatctcaaatacattgatacatatctcatctagatctaggttatcattatgta- agaaagttttgacgaatatggcacga caaaatggctagactcgatgtaattggtatctcaactcaacattatacttataccaaacattagttagacaaaa- tttaaacaactattttttatgtatgc aagagtcagcatatgtataattgattcagaatcgttttgacgagttcggatgtagtagtagccattatttaatg- tacatactaatcgtgaatagtgaata tgatgaaacattgtatcttattgtataaatatccataaacacatcatgaaagacactttctttcacggtctgaa- ttaattatgatacaattctaatagaa aacgaattaaattacgttgaattgtatgaaatctaattgaacaagccaaccacgacgacgactaacgttgcctg- gattgactcggtttaagttaaccact aaaaaaacggagctgtcatgtaacacgcggatcgagcaggtcacagtcatgaagccatcaaagcaaaagaacta- atccaagggctgagatgattaattag tttaaaaattagttaacacgagggaaaaggctgtctgacagccaggtcacgttatctttacctgtggtcgaaat- gattcgtgtctgtcgattttaattat ttttttgaaaggccgaaaataaagttgtaagagataaacccgcctatataaattcatatattttcctctccgct- ttgaagttttagttttattgcaacaa caacaacaaattacaataacaacaaacaaaatacaaacaacaacaacatggcacaatttcaacaaacaattgac- atgcaaactctccaagccgctgcggg acgcaacagcttggtgaatgatttggcatctcgtcgcgtttacgataatgcagtcgaggagctgaatgctcgtt- ccagacgtcccaaggtaataggaact ttctggatctactttatttgctggatctcgatcttgttttctcaatttccttgagatctggaattcgtttaatt- tggatctgtgaacctccactaaatct tttggttttactagaatcgatctaagttgaccgatcagttagctcgattatagctaccagaatttggcttgacc- ttgatggagagatccatgttcatgtt acctgggaaatgatttgtatatgtgaattgaaatctgaactgttgaagttagattgaatctgaacactgtcaat-
gttagattgaatctgaacactgttta aggttagatgaagtttgtgtatagattcttcgaaactttaggatttgtagtgtcgtacgttgaacagaaagcta- tttctgattcaatcagggtttatttg actgtattgaactctttttgtgtgtttgcaggtccacttctccaaggcagtgtctacggaacagaccctgattg- caacaaacgcatatccggagttcgag atttcctttactcatacgcaatccgctgtgcactccttggccggaggccttcggtcacttgagttggagtatct- catgatgcaagttccgttcggttctc tgacgtacgacatcggcggtaacttttccgcgcaccttttcaaagggcgcgattacgttcactgctgcatgcct- aatctggatgtacgtgacattgctcg ccatgaaggacacaaggaagctatttacagttatgtgaatcgtttgaaaaggcagcagcgtcctgtgcctgaat- accagagggcagctttcaacaactac gctgagaacccgcacttcgtccattgcgacaaacctttccaacagtgtgaattgacgacagcgtatggcactga- cacctacgctgtagctctccatagca tttatgatatccctgttgaggagttcggttctgcgctactcaggaagaatgtgaaaacttgtttcgcggccttt- catttccatgagaatatgcttctaga ttgtgatacagtcacactcgatgagattggagctacgttccagaaatcaggtaacattccttagttacctttct- tttctttttccatcataagtttatag attgtacatgctttgagatttttctttgcaaacaatctcaggtgataacctgagcttcttcttccataatgaga- gcactctcaattacacccacagcttc agcaacatcatcaagtacgtgtgcaagacgttcttccctgctagtcaacgcttcgtgtaccacaaggagttcct- ggtcactagagtcaacacttggtact gcaagttcacgagagtggatacgttcactctgttccgtggtgtgtaccacaacaatgtggattgcgaagagttt- tacaaggctatggacgatgcgtggca ctacaaaaagacgttagcaatgettaatgccgagaggaccatcttcaaggataacgctgcgttaaacttctggt- tcccgaaggtgctcttgaaattggaa gtcttcttttgttgtctaaacctatcaatttctctgcggaaatttatttgaagctgtagagttaaaattgagtc- ttttaaacttttgtaggtgagagaca tggttatcgtccctctctttgacgcttctatcacaactggtaggatgtctaggagagaggttatggtgaacaag- gacttcgtctacacggtcctaaatca catcaagacctatcaagctaaggcactgacgtacgcaaacgtgctgagcttcgtggagtctattaggtctagag- tgataattaacggtgtcactgccagg taagttgttacttatgattgttttcctctctgctacatgtattttgttgttcatttctgtaagatataagaatt- gagttttcctctgatgatattattag gtctgaatgggacacagacaaggcaattctaggtccattagcaatgacattcttcctgatcacgaagctgggtc- atgtgcaagatgaaataatcctgaaa aagttccagaagttcgacagaaccaccaatgagctgatttggacaagtctctgcgatgccctgatgggggttat- tccctcggtcaaggagacgcttgtgc gcggtggttttgtgaaagtagcagaacaagccttagagatcaaggttagtatcatatgaagaaatacctagttt- cagttgatgaatgctattttctgacc tcagttgttctcttttgagaattatttcttttctaatttgcctgatttttctattaattcattaggttcccgag- ctatactgtaccttcgccgaccgatt ggtactacagtacaagaaggcggaggagttccaatcgtgtgatctttccaaacctctagaagagtcagagaagt- actacaacgcattatccgagctatca gtgcttgagaatctcgactcttttgacttagaggcgtttaagactttatgtcagcagaagaatgtggacccgga- tatggcagcaaaggtaaatcctggtc cacacttttacgataaaaacacaagattttaaactatgaactgatcaataatcattcctaaaagaccacacttt- tgtthgtttctaaagtaatttttact gttataacaggtggtcgtagcaatcatgaagtcagaattgacgttgcctttcaagaaacctacagaagaggaaa- tctcggagtcgctaaaaccaggagag gggtcgtgtgcagagcataaggaagtgttgagcttacaaaatgatgctccgttcccgtgtgtgaaaaatctagt- tgaaggttccgtgccggcgtatggaa tgtgtcctaagggtggtggtttcgacaaattggatgtggacattgctgatttccatctcaagagtgtagatgca- gttaaaaagggaactatgatgtctgc ggtgtacacagggtctatcaaagttcaacaaatgaagaactacatagattacttaagtgcgtcgctggcagcta- cagtctcaaacctctgcaaggtaaga ggtcaaaaggtttccgcaatgatccctctttttttgtttctctagthcaagaatttgggtatatgactaacttc- tgagtgttccttgatgcatatttgtg atgagacaaatgtttgttctatgttttaggtgcttagagatgttcacggcgttgacccagagtcacaggagaaa- tctggagtgtgggatgttaggagagg acgttggttacttaaacctaatgcgaaaagtcacgcgtggggtgtggcagaagacgccaaccacaagttggtta- ttgtgttactcaactgggatgacgga aagccggtttgtgatgagacatggttcagggtggcggtgtcaagcgattccttgatatattcggatatgggaaa- acttaagacgctcacgtcttgcagtc caaatggtgagccaccggagcctaacgccaaagtaattttggtcgatggtgttcccggttgtggaaaaacgaag- gagattatcgaaaaggtaagttctgc atttggttatgctccttgcattttaggtgttcgtcgctcttccatttccatgaatagctaagattttttttctc- tgcattcattcttcttgcctcagttc taactgtttgtggtatttttgttttaattattgctacaggtaaacttctctgaagacttgattttagtccctgg- gaaggaagcttctaagatgatcatcc ggagggccaaccaagctggtgtgataagagcggataaggacaatgttagaacggtggattccttcttgatgcat- ccttctagaagggtgtttaagaggtt gtttatcgatgaaggactaatgctgcatacaggttgtgtaaatttcctactgctgctatctcaatgtgacgtcg- catatgtgtatggggacacaaagcaa attccgttcatttgcagagtcgcgaactttccgtatccagcgcattttgcaaaactcgtcgctgatgagaagga- agtcagaagagttacgctcaggtaaa gcaactgtgttttaatcaatttcttgtcaggatatatggattataacttaatttttgagaaatctgtagtattt- ggcgtgaaatgagtttgctttttggt ttctcccgtgttataggtgcccggctgatgttacgtatttccttaacaagaagtatgacggggcggtgatgtgt- accagcgcggtagagagatccgtgaa ggcagaagtggtgagaggaaagggtgcattgaacccaataaccttaccgttggagggtaaaattttgaccttca- cacaagctgacaagttcgagttactg gagaagggttacaaggtaaagtttccaactttcctttaccatatcaaactaaagttcgaaactttttatttgat- caacttcaaggccacccgatctttct attcctgattaatttgtgatgaatccatattgacttttgatggttacgcaggatgtgaaractgtgcacgaggt- gcaaggggagacgtacgagaagactg ctattgtgcgcttgacatcaactccgttagagatcatatcgagtgcgtcacctcatgttttggtggcgctgaca- agacacacaacgtgttgtaaatatta caccgttgtgttggacccgatggtgaatgtgatttcagaaatggagaagttgtccaatttccttcttgacatgt- atagagttgaagcaggtctgtctttc ctatttcatatgtttaatcctaggaatttgatcaattgattgtatgtatgtcgatcccaagactttcttgttca- cttatatcttaactctctctttgctg tttcttgcaggtgtccaatagcaattacaaatcgatgcagtattcaggggacagaacttgtttgttcagacgcc- caagtcaggagattggcgagatatgc aattttactatgacgctcttcttcccggaaacagtactattctcaatgaatttgatgctgttacgatgaatttg- agggatatttccttaaacgtcaaaga ttgcagaatcgacttctccaaatccgtgcaacttcctaaagaacaacctattttcctcaagcctaaaataagaa- ctgcggcagaaatgccgagaactgca ggtaaatattggatgccagacgatattctttcttttgatttgtaactttttcctgtcaaggtcgataaatttta- ttttttttggtaaaaggtcgataatt tttttttggagccattatgtaattttcctaattaactgaaccaaaattatacaaaccaggtttgctggaaaatt- tggttgcaatgatcaaaagaaacatg aatgcgccggatttgacagggacaattgacattgaggatactgcatctctggtggttgaaaagttttgggattc- gtatgttgacaaggaatttagtggaa cgaacgaaatgaccatgacaagggagagcttctccaggtaaggacttctcatgaatattagtggcagattagtg- ttgttaaagtctttggttagataatc gatgcctcctaattgtccatgttttactggttttctacaattaaaggtggctttcgaaacaagagtcatctaca- gttggtcagttagcggactttaactt tgtggatttgccggcagtagatgagtacaagcatatgatcaagagtcaaccaaagcaaaagttagacttgagta- ttcaagacgaatatcctgcattgcag acgatagtctaccattcgaaaaagatcaatgcgattttcggtccaatgttttcagaacttacgaggatgttact- cgaaaggattgactcttcgaagtttc tgttctacaccagaaagacacctgcacaaatagaggacttcttttctgacctagactcaacccaggcgatggaa- attctggaactcgacatttcgaagta cgataagtcacaaaacgagttccattgtgctgtagagtacaagatctgggaaaagttaggaattgatgagtggc- tagctgaggtctggaaacaaggtgag ttcctaagttccatttttttgtaatccttcaatgttattttaacttttcagatcaacatcaaaattaggttcaa- ttttcatcaaccaaataatatttttc atgtatatataggtcacagaaaaacgaccttgaaagattatacggccggaatcaaaacatgtctttggtatcaa- aggaaaagtggtgatgtgacaacctt tattggtaataccatcatcattgccgcatgtttgagctcaatgatccccatggacaaagtgataaaggcagctt- tttgtggagacgatagcctgatttac attcctaaaggtttagacttgcctgatattcaggcgggcgcgaacctcatgtggaacttcgaggccaaactctt- caggaagaagtatggttacttctgtg gtcgttatgttattcaccatgatagaggagccattgtgtattacgatccgcttaaactaatatctaagttaggt- tgtaaacatattagagatgttgttca cttagaagagttacgcgagtctttgtgtgatgtagctagtaacttaaataattgtgcgtatttttcacagttag- atgaggccgttgccgaggttcataag accgcggtaggcggttcgtttgctttttgtagtataattaagtatttgtcagataagagattgtttagagattt- gttctttgtttgataatgtcgatagt ctcgtacgaacctaaggtgagtgatttcctcaatctttcgaagaaggaagagatcttgccgaaggctctaacga- ggttaaaaaccgtgtctattagtact aaagatattatatctgtcaaggagtcggagactttgtgttgatatagatttgttaatcaatgtgccattagata- agtatagatatgtgggtatcctagct aggagccgtttttaccggagagtggctagtgccagacttcgttaaaggtggagtgacgataagtgtgatagata- agcgtctggtgaactcaaaggagtgc gtgattggtacgtacagagccgcagccaagagtaagaggttccagttcaaattggttccaaattactttgtgtc- caccgtggacgcaaagaggaagccgt ggcaggtaaggatttttatgatatagtatgcttatgtattttgtactgaagcatatcctgcttcattgggatat- tactgaaagcatttaactacatgtaa actcacttgatgatcaataaacttgattttgcaggttcatgttcgtatacaagacttgaagattgaggcgggtt- ggcagccgttagctctggaagtagtt tcagttgctatggtcaccaataacgttgtcatgaagggtttgagggaaaaggtcgtcgcaataaatgatccgga- cgtcgaaggtttcgaaggtaagccat cttcctgcttatttttataatgaacatagaaataggaagttgtgcagagaaactaattaacctgactcaaaatc- taccctcataattgttgtttgatatt ggtcttgtattttgcaggtgtggttgacgaattcgtcgattcggttgcagcatttaaagcggttgacaacttta- aaagaaggaaaaagaaggttgaagaa aagggtgtagtaagtaagtataagtacagaccggagaagtacgccggtcctgattcgtttaatttgaaagaaga- aaacgtcttacaacattacaaacccg aataatcgataactcgagtatttttacaacaattaccaacaacaacaaacaacaaacaacattacaattacatt- tacaattatcatggtgagcaagggcg aggagctgttcaccggggtggtgcccatcctggacggcgacgtaaacggccacaagttcagcgtgtccggcgag- ggcgagggcgatgccacctacggcaa gctgaccctgaagttcatctgcaccaccggcaagctgcccgtgccctggcccaccctcgtgaccaccttcagct- acggcgtgcagtgcttcagccgctac cccgaccacatgaagcagcacgacttcttcaagtccgccatgcccgaaggctacgtccaggagcgcaccatctt- cttcaaggacgacggcaactacaaga cccgcgccgaggtgaagttcgagggcgacaccctggtgaaccgcatcgagctgaagggcatcgacttcaaggag- gacggcaacatcctggggcacaagct ggagtacaactacaacagccacaacgtctatatcatggccgacaagcagaagaacggcatcaaggtgaacttca- agatccgccacaacatcgaggacggc agcgtgcagctcgccgaccactaccagcagaacacccccatcggcgacggccccgtgctgctgcccgacaacca- ctacctgagcacccagtccgccctga gcaaagaccccaacgagaagcgcgatcacatggtcctgctggagttcgtgaccgccgccgggatcactcacggc- atggacgagctgtacaagtaaagcgg cccctagagcgtggtgcgcacgatagcgcatagtgtttttctctccacttgaatcgaagagatagacttacggt- gtaaatccgtaggggtggcgtaaacc aaattacgcaatgttttgggttccatttaaatcgaaaccccttatttcctggatcacctgttaacgcacgtttg- acgtgtattacagtgggaataagtaa aagtgagaggttcgaatcctccctaaccccgggtaggggcccagcggccgctctagctagagtcaagcagatcg- ttcaaacatttggcaataaagtttct taagattgaatcctgttgccggtcttgcgatgattatcatataatttctgttgaattacgttaagcatgtaata- attaacatgtaatgcatgacgttatt tatgagatgggtttttatgattagagtcccgcaattatacatttaatacgcgatagaaaacaaaatatagcgcg- caaactaggataaattatcgcgcgcg gtgtcatctatgttactagatcgacctgcatccaccccagtacattaaaaacgtccgcaatgtgttattaagtt- gtctaagcgtcaatttgtttacacca caatatatcctgccaccagccagccaacagctccccgaccggcagctcggcacaaaatcaccactcgatacagg- cagcccatcag SEQ ID NO: 4: Sequence of T-DNA region of pNMD620 cctgtggttggcacatacaaatggacgaacggataaaccttttcacgcccttttaaatatccgattattctaat- aaacgctcttttctcttaggtttacc cgccaatatatcctgtcaaacactgatagtttaaactgaaggcgggaaacgacaaatctgatctaagctaggca- tgcctgcaggtcaacatggtggagca cgacacgcttgtctactccaaaaatatcaaagatacagtctcagaagaccaaagggcaattgagacttttcaac- aaagggtaatatccggaaacctcctc ggattccattgcccagctatctgtcactttattgtgaagatagtggaaaaggaaggtggctcctacaaatgcca- tcattgcgataaaggaaaggccatcg ttgaagatgcctctgccgacagtggtcccaaagatggacccccacccacgaggagcatcgtggaaaaagaagac- gttccaaccacgtcttcaaagcaagt ggattgatgtgatatctccactgacgtaagggatgacgcacaatcccactatccttcgcaagacccttcctcta- tataaggaagttcatttcatttggag aggagaaaactaaaccatacaccaccaacacaaccaaacccaccacgcccaattgttacacacccgcttgaaaa- agaaagtttaacaaatggccaaggtg cgcgaggtttaccaatcttttacagactccaccacaaaaactctcatccaagatgaggcttatagaaacattcg- ccccatcatggaaaaacacaaactag ctaacccttacgctcaaacggttgaagcggctaagatctagaggggttcggcatagccaccaatccctatagca- ttgaattgcatacacatgcagccgct aagaccatagagaataaacttctagaggtgcttggttccatcctaccacaagaacctgttacatttatgtttct- taaacccagaaagctaaactacatga gaagaaacccgcggatcaaggacattttccaaaatgttgccattgaaccaagagacgtagccaggtaccccaag- gaaacaataattgacaaactcacaga gatcacaacggaaacagcatacattagtgacactctgcacttcttggatccgagctacatagtggagacattcc- aaaactgcccaaaattgcaaacattg tatgcgaccttagttctccccgttgaggcagcctttaaaatggaaagcactcacccgaacatatacagcctcaa- atacttcggagatggtttccagtata taccaggcaaccatggtggcggggcataccatcatgaattcgctcatctacaatggctcaaagtgggaaagatc- aagtggagggaccccaaggatagctt tctcggacatctcaattacacgactgagcaggttgagatgcacacagtgacagtacagttgcaggaatcgttcg- cggcaaaccacttgtactgcatcagg agaggagacttgctcacaccggaggtgcgcactttcggccaacctgacaggtacgtgattccaccacagatctt- cctcccaaaagttcacaactgcaaga agccgattctcaagaaaactatgatgcagctcttcttgtatgttaggacagtcaaggtcgcaaaaaattgtgac- atttttgccaaagtcagacaattaat taaatcatctgacttggacaaatactctgctgtggaactggtttacttagtaagctacatggagttccttgccg- atttacaagctaccacctgcttctca gacacactttctggtggcttgctaacaaagacccttgcaccggtgagggcttggatacaagagaaaaagatgca- gctgtttggtcttgaggactacgcga agttagtcaaagcagttgatttccacccggtggatttttctttcaaagtggaaacttgggacttcagattccac- cccttgcaagcgtggaaagccttccg accaagggaagtgtcggatgtagaggaaatggaaagtttgttctcagatggggacctgcttgattgcttcacaa- gaatgccagcttatgcggtaaacgca agatttagctgcaatcaggaaaagaggacgcccgagatggatgtcggtcaagaagttaaagagcctgcaggaga- cagaaatcaatactcaaaccctgcag aaactttcctcaacaagctccacaggaaacacagtagggaggtgaaacaccaggccgcaaagaaagctaaacgc- ctagctgaaatccaggagtcaatgag agctgaaggtgatgccgaaccaaatgaaataagcgggacgatgggggcaatacccagcaacgccgaacttcctg- gcacgaatgatgccagacaagaactc acactcccaaccactaaacctgtccctgcaaggtgggaagatgcttcattcacagattctagtgtggaagagga- gcaggttaaactccttggaaaagaaa ccgttgaaacagcgacgcaacaagtcatcgaaggacttccttggaaacactggattcctcaattaaatgctgtt- ggattcaaggcgctggaaattcagag ggataggagtggaacaatgatcatgcccatcacagaaatggtctccgggctggaaaaagaggacttccctgaag- gaactccaaaagagttggcacgagaa ttgttcgctatgaacagaagccctgccaccatccctttggacctgcttagagccagagactacggcagtgatgt- aaagaacaagagaattggtgccatca caaagacacaggcaacgagttggggcgaatacttgacaggaaagatagaaagcttaactgagaggaaagttgcg- acttgtgtcattcatggagctggagg ttctggaaaaagtcatgccatccagaaggcattgagagaaattggcaagggctcggacatcactgtagtcctgc- cgaccaatgaactgcggctagattgg agtaagaaagtgcctaacactgagccctatatgttcaagacctctgaaaaggcgttaattgggggaacaggcag- catagtcatctttgacgattactcaa aacttcctcccggttacatagaagccttagtctgtttctactctaaaatcaagctaatcattctaacaggagat- agcagacaaagcgtctaccatgaaac tgctgaggacgcctccatcaggcatttgggaccagcaacagagtacttctcaaaatactgccgatactatctca- atgccacacaccgcaacaagaaagat cttgcgaacatgcttggtgtctacagtgagagaacgggagtcaccgaaatcagcatgagcgccgagttcttaga- aggaatcccaactttggtaccctcgg atgagaagagaaagctgtacatgggcaccgggaggaatgacacgttcacatacgctggatgccaggggctaact- aagccgaaggtacaaatagtgttgga
ccacaacacccaagtgtgtagcgcgaatgtgatgtacacggcactttctagagccaccgataggattcacttcg- tgaacacaagtgcaaattcctctgcc ttctgggaaaagttggacagcaccccttacctcaagactttcctatcagtggtgagagaacaagcactcaggga- gtacgagccggcagaggcagagccaa ttcaagagcctgagccccagacacacatgtgtgtcgagaatgaggagtccgtgctagaagagtacaaagaggaa- ctcttggaaaagtttgacagagagat ccactctgaatcccatggtcattcaaactgtgtccaaactgaagacacaaccattcagttgttttcgcatcaac- aagcaaaagatgagaccctcctctgg gcgactatagatgcgcggctcaagaccagcaatcaagaaacaaacttccgagaattcctgagcaagaaggacat- tggggacgttctgtttttaaactacc aaaaagctatgggtttacccaaagagcgtattcctttttcccaagaggtctgggaagcttgtgcccacgaagta- caaagcaagtacctcagcaagtcaaa gtgcaacttgatcaatgggactgtgagacagagcccagacttcgatgaaaataagattatggtattcctcaagt- cgcagtgggtcacaaaggtggaaaaa ctaggtctacccaagattaagccaggtcaaaccatagcagccttttaccagcagactgtgatgctttttggaac- tatggctaggtacatgcgatggttca gacaggctttccagccaaaagaagtcttcataaactgtgagaccacgccagatgacatgtctgcatgggccttg- aacaactggaatttcagcagacctag cttggctaatgactacacagctttcgaccagtctcaggatggagcctgttgcaatttgaggtgctcaaagccaa- agaccactgcataccagaggaaatca ttcaggcatacatagatattaagactaatgcacagattttcctaggcacgttatcaattatgcgcctgactggt- gaaggtcccacttttgatgcaaacac tgagtgcaacatagcttacacccatacaaagtttgacatcccagccggaactgctcaagtttatgcaggagacg- actccgcactggactgtgttccagaa gtgaagcatagtttccacaggcttgaggacaaattactcctaaagtcaaagcctgtaatcacgcagcaaaagaa- gggcagttggcctgagttttgtggtt ggctgatcacaccaaaaggggtgatgaaagacccaattaagctccatgttagcttaaaattggctgaagctaag- ggtgaactcaagaaatgtcaagattc ctatgaaattgatctgagttatgcctatgaccacaaggactctctgcatgacttgttcgatgagaaacagtgtc- aggcacacacactcacttgcagaaca ctaatcaagtcagggagaggcactgtctcactttcccgcctcagaaactttctttaaccgttaagttaccttag- agatttgaataagatggatattctca tcagtagtttgaaaagtttaggttattctaggacttccaaatctttagattcaggacctttggtagtacatgca- gtagccggagccggtaagtccacagc cctaaggaagttgatcctcagacacccaacattcaccgtgcatacactcggtgtccctgacaaggtgagtatca- gaactagaggcatacagaagccagga cctattcctgagggcaacttcgcaatcctcgatgagtatactttggacaacaccacaaggaactcataccaggc- actttttgctgacccttatcaggcac cggagtttagcctagagccccacttctacttggaaacatcatttcgagttccgaggaaagtggcagatttgata- gctggctgtggcttcgatttcgagac gaactcaccggaagaagggcacttagagatcactggcatattcaaagggcccctactcggaaaggtgatagcca- ttgatgaggagtctgagacaacactg tccaggcatggtgttgagtttgttaagccctgccaagtgacgggacttgagttcaaagtagtcactattgtgtc- tgccgcaccaatagaggaaattggcc agtccacagctttctacaacgctatcaccaggtcaaagggattgacatatgtccgcgcaggccataggctgacc- gctccggtcaattctgaaaaagtgta catagtattaggtctatcatttgctttagtttcaattacctttctgctttctagaaatagcttaccccacgtcg- gtgacaacattcacagcttgccacac ggaggagcttacagagacggcaccaaagcaatcttgtacaactccccaaatctagggtcacgagtgagtctaca- caacggaaagaacgcagcatttgctg ccgttttgctactgactttgctgatctatggaagtaaatacatatctcaacgcaatcatacttgtgcttgtggt- aacaatcatagcagtcattagcactt ccttagtgaggactgaaccttgtgtcatcaagattactggggaatcaatcacagtgttggcttgcaaactagat- gcagaaaccataagggccttgccgat ctcaagcctctccgttgaacggttaagtttccattgatactcgaaagaggtcagcaccagctagcaacaaacaa- gaaaggtatggtgagcaagggcgagg agctgttcaccggggtggtgcccatcctggtcgagctggacggcgacgtaaacggccacaagttcagcgtgtcc- ggcgagggcgagggcgatgccaccta cggcaagctgaccctgaagttcatctgcaccaccggcaagctgcccgtgccctggcccaccctcgtgaccacct- tcagctacggcgtgcagtgcttcagc cgctaccccgaccacatgaagcagcacgacttcttcaagtccgccatgcccgaaggctacgtccaggagcgcac- catcttcttcaaggacgacggcaact acaagacccgcgccgaggtgaagttcgagggcgacaccctggtgaaccgcatcgagctgaagggcatcgacttc- aaggacgacggcaactacaagacccg cgccgaggtgaagttcgaggggccacaacgtctatatcatggccgacaagcagaagaacggcatcaaggtgaac- ttcaagatccgccacaacatcgagga cggcagcgtgcagctcgccgaccactaccgcagaacacccccatcggcgacggccccgtgctgctgcccgacaa- ccactacctgagcacccagtccgccc tgagcaaagaccccaacgagaagcgcgatcacatggtcctgctggagttcgtgaccgccgccgggatcactcac- ggcatggacgagctgtacaagtaagc ttggtcgtatcactggaacaacaaccgctgaggctgttgtcactctaccaccaccataactacgtctacataac- cgacgcctaccccagtttcatagtat tttctggtttgattgtatgaataatataaataaaaaaaaaaaaaaaaaaaaaaaactagtgagctcttctgtca- gcgggcccactgcatccaccccagta cattaaaaacgtccgcaatgtgttattaagttgtctaagcgtcaatttgtttacaccacaatatatcctgccac- cagccagccaacagctccccgaccgg cagctcggcacaaaatcaccactcgatacaggcagcccatcag SEQ ID NO: 5: Plasmid backbone insertion containing virG gene of pNMD062 ctgtcgatcagatctggctcgcggcggacgcacgacgccggggcgagaccataggcgatctcctaaatcaatag- tagctgtaacctcgaagcgtttcact tgtaacaacgattgagaatttttgtcataaaattgaaatacttggttcgcatttttgtcatccgcggtcagccg- caattctgacgaactgcccatttagc tggagatgattgtacatccttcacgtgaaaatttctcaagcgctgtgaacaagggttcagattttagattgaaa- ggtgagccgttgaaacacgttcttct tgtcgatgacgacgtcgctatgcggcatcttattattgaataccttacgatccacgccttcaaagtgaccgcgg- tagccgacagcacccagttcacaaga gtactctcttccgcgacggtcgatgtcgtggttgttgatctaaatttaggtcgtgaagatgggctcgagatcgt- tcgtaatctggcggcaaagtctgata ttccaatcataattatcagtggcgaccgccttgaggagacggataaagttgttgcactcgagctaggagcaagt- gattttatcgctaagccgttcagtat cagagagtttctagcacgcattcgggttgccttgcgcgtgcgccccaacgttgtccgctccaaagaccgacggt- ctttttgttttactgactggacactt aatctcaggcaacgtcgcttgatgtccgaagctggcggtgaggtgaaacttacggcaggtgagttcaatcttct- cctcgcgtttttagagaaaccccgcg acgttctatcgcgcgagcaacttctcattgccagtcgagtacgcgacgaggaggtttatgacaggagtatagat- gttctcattttgaggctgcgccgcaa acttgaggcggatccgtcaagccctcaactgataaaaacagcaagaggtgccggttatttctttgacgcggacg- tgcaggtttcgcacggggggacgatg gcagcctaagatcgacag SEQ ID NO: 6: Plasmid backbone insertion containing virG gene of pNMD063, pNMD2190 ctgtcgatcagatctggctcgcggcggacgcacgacgccggggcgagaccataggcgatctcctaaatcaatag- tagctgtaacctcgaagcgtttcact tgtaacaacgattgagaatttttgtcataaaattgaaatacttggttcgcatttttgtcatccgcggtcagccg- caattctgacgaactgcccatttagc tggagatgattgtacatccttcacgtgaaaatttctcaagtgctgtgaacaagggttcagattttagattgaaa- ggtgagccgttgaaacacgttcttct tgtcgatgacgacgtcgctatgcggcatcttattattgaataccttacgatccacgccttcaaagtgaccgcgg- tagccgacagcacccagttcacaaga gtactctcttccgcgacggtcgatgtcgtggttgttgatctagatttaggtcgtgaagatgggctcgagatcgt- tcgtaatctggcggcaaagtctgata ttccaatcataattatcagtggcgaccgccttgaggagacggataaagttgttgcactcgagctaggagcaagt- gattttatcgctaagccgttcagtat cagagagtttctagcacgcattcgggttgccttgcgcgtgcgccccaacgttgtccgctccaaagaccgacggt- ctttttgttttactgactggacactt aatctcaggcaacgtcgcttgatgtccgaagctggcggtgaggtgaaacttacggcaggtgagttcaatcttct- cctcgcgtttttagagaaaccccgcg acgttctatcgcgcgagcaacttctcattgccagtcgagtacgcgacgaggaggtttatgacaggagtatagat- gttctcattttgaggctgcgccgcaa acttgaggcggatccgtcaagccctcaactgataaaaacagcaagaggtgccggttatttctttgacgcggacg- tgcaggtttcgcacggggggacgatg gcagcctaagatcgacag SEQ ID NO: 7: full-length nucleotide sequence of pNMD1971 ttaagattgaatcctgttgccggtcttgcgatgattatcatataatttctgttgaattacgttaagcatgtaat- aattaacatgtaatgcatgacgttat ttatgagatgggtttttatgattagagtcccgcaattatacatttaatacgcgatagaaaacaaaatatagcgc- gcaaactaggataaattatcgcgcgc ggtgtcatctatgttactagatcgacctgcaggcatgccaattccaatcccacaaaaatctgagcttaacagca- cagttgctcctctcagagcagaatcg ggtattcaacaccctcatatcaactactacgttgtgtataacggtccacatgccggtatatacgatgactgggg- ttgtacaaaggcggcaacaaacggcg ttcccggagttgcacacaagaaatttgccactattacagaggcaagagcagcagctgacgcgtacacaacaagt- cagcaaacagacaggttgaacttcat ccccaaaggagaagctcaactcaagcccaagagctttgctaaggccctaacaagcccaccaaagcaaaaagccc- actggctcacgctaggaaccaaaagg cccagcagtgatccagccccaaaagagatctcctttgccccggagattacaatggacgatttcctctatcttta- cgatctaggaaggaagttcgaaggtg aaggtgacgacactatgttcaccactgataatgagaaggttagcctcttcaatttcagaaagaatgctgaccca- cagatggttagagaggcctacgcagc aggtctcatcaagacgatctacccgagtaacaatctccaggagatcaaataccttcccaagaaggttaaagatg- cagtcaaaagattcaggactaattgc atcaagaacacagagaaagacatatttctcaagatcagaagtactattccagtatggacgattcaaggcttgct- tcataaaccaaggcaagtaatagaga ttggagtctctaaaaaggtagttcctactgaatctaaggccatgcatggagtctaagattcaaatcgaggatct- aacagaactcgccgtgaagactggcg aacagttcatacagagtcttttacgactcaatgacaagaagaaaatcttcgtcaacatggtggagcacgacact- ctggtctactccaaaaatgtcaaaga tacagtctcagaagaccaaagggctattgagacttttcaacaaaggataatttcgggaaacctcctcggattcc- attgcccagctatctgtcacttcatc gaaaggacagtagaaaaggaaggtggctcctacaaatgccatcattgcgataaaggaaaggctatcattcaaga- tctctctgccgacagtggtcccaaag atggacccccacccacgaggagcatcgtggaaaaagaagacgttccaaccacgtcttcaaagcaagtggattga- tgtgacatctccactgacgtaaggga tgacgcacaatcccactatccttcgcaagacccttcctctatataaggaagttcatttcatttggagaggacac- gctcgagtataagagctctattttta caacaattaccaacaacaacaaacaacaaacaacattacaattacatttacaattaccatggaacgagctatac- aaggaaacgatgctagggaacaagct tatggtgaacgttggaatggaggatcaggaagttccacttctcccttcaaacttcctgacgaaagtccgagttg- gactgagtggcggctacataacgatg agacgatttcgaatcaagataatccccttggtttcaaggaaagctggggtttcgggaaagttgtatttaagaga- tatctcagatacgacgggacggaaac ttcactgcacagagtccttggatcttggacgggagattcggttaactatgcagcatctcgatttctcggtttcg- accagatcggatgtacctatagtatt cggtttcgaggagttagtgtcaccatttctggagggtcgcgaactcttcagcatctcagtgaaatggcaattcg- gtctaagcaagaactgctacagctta ccccagtcaaagtggaaagtgatgtatcaagaggatgccctgaaggtgttgaaaccttcgaagaagaaagcgag- taaggatcctctagagtcctgcttta atgagatatgcgagacgcctatgatcgcatgatatttgctttcaattctgttgtgcacgttgtaaaaaacctga- gcatgtgtagctcagatccttaccgc cggtttcggttcattctaatgaatatatcacccgttactatcgtatttttatgaataatattctccgttcaatt- tactgattgtaccctactacttatat gtacaatattaaaatgaaaacaatatattgtgctgaataggtttatagcgacatctatgatagagcgccacaat- aacaaacaattgcgttttattattac aaatccaattttaaaaaaagcggcagaaccggtcaaacctaaaagactgattacataaatcttattcaaatttc- aaaagtgccccaggggctagtatcta cgacacaccgagcggcgaactaataacgctcactgaagggaactccggttccccgccggcgcgcatgggtgaga- ttccttgaagttgagtattggccgtc cgctctaccgaaagttacgggcaccattcaacccggtccagcacggcggccgggtaaccgacttgctgccccga- gaattatgcagcatttttttggtgta tgtgggccccaaatgaagtgcaggtcaaaccttgacagtgacgacaaatcgttgggcgggtccagggcgaattt- tgcgacaacatgtcgaggctcagcag gacctgcataagctcttctgtcagcgggcccactgcatccaccccagtacattaaaaacgtccgcaatgtgtta- ttaagttgtctaagcgtcaatttgtt tacaccacaatatatcctgccaccagccagccaacagctccccgaccggcagctcggcacaaaatcaccactcg- atacaggcagcccatcagtcagatct cctttgcgacgctcaccgggctggttgccctcgccgctgggctggcggccgtctatggccctgcaaacgcgcca- gaaacgccgtcgaagccgtgtgcgag acaccgcggccgccggcgttgtggatacctcgcggaaaacttggccctcactgacagatgaggggcggacgttg- acacttgaggggccgactcacccggc gcggcgttgacagatgaggggcaggctcgatttcggccggcgacgtggagctggccagcctcgcaaatcggcga- aaacgcctgattttacgcgagtttcc cacagatgatgtggacaagcctggggataagtgccctgcggtattgacacttgaggggcgcgactactgacaga- tgaggggcgcgatccttgacacttga ggggcagagtgctgacagatgaggggcgcacctattgacatttgaggggctgtccacaggcagaaatccagcat- ttgcaagggtttccgcccgtttttcg gccaccgctaacctgtcttttaacctgcttttaaaccaatatttataaaccttgtttttaaccagggctgcgcc- ctgtgcgcgtgaccgcgcacgccgaa ggggggtgcccccccttctcgaaccctcccggcccgctaacgcgggcctcccatcccccccaggggctgcgccc- ctcggccgcgaacggcctcaccccaa aaatggcagcgctggccaattcgtgcgcggaacccctatttgtttatttttctaaatacattcaaatatgtatc- cgctcatgagacaataaccctgataa atgcttcaataatattgaaaaaggaagagtatggctaaaatgagaatatcaccggaattgaaaaaactgatcga- aaaataccgctgcgtaaaagatacgg aaggaatgtctcctgctaaggtatataagctggtgggagaaaatgaaaacctatatttaaaaatgacggacagc- cggtataaagggaccacctatgatgt ggaacgggaaaaggacatgatgctatggctggaaggaaagctgcctgttccaaaggtcctgcactttgaacggc- atgatggctggagcaatctgctcatg agtgaggccgatggcgtcctttgctcggaagagtatgaagatgaacaaagccctgaaaagattatcgagctgta- tgcggagtgcatcaggctctttcact ccatcgacatatcggattgtccctatacgaatagcttagacagccgcttagccgaattggattacttactgaat- aacgatctggccgatgtggattgcga aaactgggaagaagacactccatttaaagatccgcgcgagctgtatgattttttaaagacggaaaagcccgaag- aggaacttgtcttttcccacggcgac ctgggagacagcaacatctttgtgaaagatggcaaagtaagtggctttattgatcttgggagaagcggcgggcg- gacaagtggtatgacattgccttctg cgtccggtcgatcagggaggatatcggggaagaacagtatgtcgagctattttttgacttactggggatcaagc- ctgattgggagaaaataaaatattat attttactggatgaattgttttagctgtcagaccaagtttactcatatatactttagattgatttaaaacttca- tttttaatttaaaaggatctaggtga agatcctttttgataatctcatgaccaaaatcccttaacgtgagttttcgttccactgagcgtcagaccccgta- gaaaagatcaaaggatcttcttgaga tcctttttttctgcgcgtaatctgctgcttgcaaacaaaaaaaccaccgctaccagcggtggtttgtttgccgg- atcaagagctaccaactctttttccg aaggtaactggcttcagcagagcgcagataccaaatactgtccttctagtgtagccgtagttaggccaccactt- caagaactctgtagcaccgcctacat acctcgctctgctaatcctgttaccagtggctgctgccagtggcgataagtcgtgtcttaccgggttggactca- agacgatagttaccggataaggcgca gcggtcgggctgaacggggggttcgtgcacacagcccagcttggagcgaacgacctacaccgaactgagatacc- tacagcgtgagctatgagaaagcgcc acgcttcccgaagggagaaaggcggacaggtatccggtaagcggcagggtcggaacaggagagcgcacgaggga- gcttccagggggaaacgcctggtatc tttatagtcctgtcgggtttcgccacctctgacttgagcgtcgatttttgtgatgctcgtcaggggggcggagc- ctatggaaaaacgccagcaacgcggc ctttttacggttcctggcagatcctagatgtggcgcaacgatgccggcgacaagcaggagcgcaccgacttctt- ccgcatcaagtgttttggctctcagg ccgaggcccacggcaagtatttgggcaaggggtcgctggtattcgtgcagggcaagattcggaataccaagtac- gagaaggacggccagacggtctacgg gaccgacttcattgccgataaggtggattatctggacaccaaggcaccaggcgggtcaaatcaggaataagggc- acattgccccggcgtgagtcggggca atcccgcaaggagggtgaatgaatcggacgtttgaccggaaggcatacaggcaagaactgatcgacgcggggtt- ttccgccgaggatgccgaaaccatcg caagccgcaccgtcatgcgtgcgccccgcgaaaccttccagtccgtcggctcgatggtccagcaagctacggcc- aagatcgagcgcgacagcgtgcaact ggctccccctgccctgcccgcgccatcggccgccgtggagcgttcgcgtcgtctcgaacaggaggcggcaggtt- tggcgaagtcgatgaccatcgacacg cgaggaactatgacgaccaagaagcgaaaaaccgccggcgaggacctggcaaaacaggtcagcgaggccaagca- ggccgcgttgctgaaacacacgaagc agcagatcaaggaaatgcagctttccttgttcgatattgcgccgtggccggacacgatgcgagcgatgccaaac-
gacacggcccgctctgccctgttcac cacgcgcaacaagaaaatcccgcgcgaggcgctgcaaaacaaggtcattttccacgtcaacaaggacgtgaaga- tcacctacaccggcgtcgagctgcgg gccgacgatgacgaactggtgtggcagcaggtgttggagtacgcgaagcgcacccctatcggcgagccgatcac- cttcacgttctacgagctttgccagg acctgggctggtcgatcaatggccggtattacacgaaggccgaggaatgcctgtcgcgcctacaggcgacggcg- atgggcttcacgtccgaccgcgttgg gcacctggaatcggtgtcgctgctgctgcaccgcttccgcgtcctggaccgtggcaagaaaacgtcccgttgcc- aggtcctgatcgacgaggaaatcgtc gtgctgtttgctggcgaccactacacgaaattcatatgggagaagtaccgcaagctgtcgccgacggcccgacg- gatgttcgactatttcagctcgcacc gggagccgtacccgctcaagctcaagctggaaaccttccgcctcatgtgcggatcggattccacccgcgtgaag- aagtggcgcgagcaggtcggcgaagc ctgcgaagagttgcgaggcagcggcctggtggaacacgcctgggtcaatgatgacctggtgcattgcaaacgct- agggccttgtggggtcagttccggct gggggttcagcagccagcgcctgatctggggaaccctgtggttggcacatacaaatggacgaacggataaacct- tttcacgcccttttaaatatccgatt attctaataaacgctcttttctcttaggtttacccgccaatatatcctgtcaaacactgatagtttaaactgaa- ggcgggaaacgacaatctgatctaag ctaggcatggaattccaatcccacaaaaatctgagcttaacagcacagttgctcctctcagagcagaatcgggt- attcaacaccctcatatcaactacta cgttgtgtataacggtccacatgccggtatatacgatgactggggttgtacaaggcggcaacaaacggcgttcc- cggagttgcacacaagaaatttgcca ctattacagaggcaagagcagcagctgacgcgtacacaacaagtcagcaaacagacaggttgaacttcatcccc- aaaggagaagctcaactcaagcccaa gagctttgctaaggccctaacaagcccaccaaagcaaaaagcccactggctcacgctaggaaccaaaaggccca- gcagtgatccagccccaaaagagatc tcctttgccccggagattacaatggacgatttcctctatctttacgatctaggaaggaagttcgaaggtgaagg- tgacgacactatgttcaccactgata atgagaaggttagcctcttcaatttcagaaagaatgctgacccacagatggttagagaggcctacgcagcaggt- ctcatcaagacgatctacccgagtaa caatctccaggagatcaaataccttcccaagaaggttaaagatgcagtcaaaagattcaggactaattgcatca- agaacacagagaaagacatatttctc aagatcagaagtactattccagtatggacgattcaaggcttgcttcataaaccaaggcaagtaatagagattgg- agtctctaaaaaggtagttcctactg aatctaaggccatgcatggagtctaagattcaaatcgaggatctaacagaactcgccgtgaagactggcgaaca- gttcatacagagtcttttacgactca atgacaagaagaaaatcttcgtcaacatggtggagcacgacactctggtctactccaaaaatgtcaaagataca- gtctcagaagaccaaagggctattga gacttttcaacaaaggataatttcgggaaacctcctcggattccattgcccagctatctgtcacttcatcgaaa- ggacagtagaaaaggaaggtggctcc tacaaatgccatcattgcgataaaggaaaggctatcattcaagatctctctgccgacagtggtcccaaagatgg- acccccacccacgaggagcatcgtgg aaaaagaagacgttccaaccacgtcttcaaagcaagtggattgatgtgacatctccactgacgtaagggatgac- gcacaatcccactatccttcgcaaga cccttcctctatataaggaagttcatttcatttggagaggacacgctcgagtataagagctcatttttacaaca- attaccaacaacaacaaacaacaaac aacattacaattatcgatgggtcagtccctatgttacgtcctgtagaaaccccaacccgtgaaatcaaaaaact- cgacggcctgtgggcattcagtctgg atcgcgaaaactgtggaattgatcagcgttggtgggaaagcgcgttacaagaaagccgggcaattgctgtgcca- ggcagttttaacgatcagttcgccga tgcagatattcgtaattatgcgggcaacgtctggtatcagcgcgaagtctttataccgaaaggtaagtagtgtt- tttggataactgagtttgcctatgat tttgtatttactgagatgtttgtcctctttgtgcaggttgggcaggccagcgtatcgtgctgcgtttcgatgcg- gtcactcattacggcaaagtgtgggt caataatcaggaagtgatggagcatcagggcggctatacgccatttgaagccgatgtcacgccgtatgttattg- ccgggaaaagtgtacgtatcaccgtt tgtgtgaacaacgaactgaactggcagactatcccgccgggaatggtgattaccgacgaaaacggcaagaaaaa- gcagtcttacttccatgatttcttta actatgccggaatccatcgcagcgtaatgctctacaccacgccgaacacctgggtggacgatatcaccgtggtg- acgcatgtcgcgcaagactgtaacca cgcgtctgttgactggcaggtggtggccaatggtgatgtcagcgttgaactgcgtgatgcggatcaacaggtgg- ttgcaactggacaaggcactagcggg actttgcaagtggtgaatccgcacctctggcaaccgggtgaaggttatctctatgaactgtgcgtcacagccaa- aagccagacagagtgtgatatctacc cgcttcgcgtcggcatccggtcagtggcagtgaagggccaacagttcctgattaaccacaaaccgttctacttt- actggctttggtcgtcatgaagatgc ggacttacgtggcaaaggattcgataacgtgctgatggtgcacgaccacgcattaatggactggattggggcca- actcctaccgtacctcgcattaccct tacgctgaagagatgctcgactgggcagatgaacatggcatcgtggtgattgatgaaactgctgctgtcggctt- taacctctctttaggcattggtttcg aagcgggcaacaagccgaaagaactgtacagcgaagaggcagtcaacggggaaactcagcaagcgcacttacag- gcgattaaagagctgatagcgcgtga caaaaaccacccaagcgtggtgatgtggagtattgccaacgaaccggatacccgtccgcaaggtgcacgggaat- atttcgcgccactggcggaagcaacg cgtaaactcgacccgacgcgtccgatcacctgcgtcaatgtaatgttctgcgacgctcacaccgataccatcag- cgatctctttgatgtgctgtgcctga accgttattacggatggtatgtccaaagcggcgatttggaaacggcagagaaggtactggaaaaagaacttctg- gcctggcaggagaaactgcatcagcc gattatcatcaccgaatacggcgtggatacgttagccgggctgcactcaatgtacaccgacatgtggagtgaag- agtatcagtgtgcatggctggatatg tatcaccgcgtctttgatcgcgtcagcgccgtcgtcggtgaacaggtatggaatttcgccgattttgcgacctc- gcaaggcatattgcgcgttggcggta acaagaaagggatcttcactcgcgaccgcaaaccgaagtcggcggcttttctgctgcaaaaacgctggactggc- atgaacttcggtgaaaaaccgcagca gggaggcaaacaatgaatcaacaactctcctggcgcaccatcgtcggctacagcctcgggattgggatcctcta- gagtcaagcagatcgttcaaacattt ggcaataaagtttc
Sequence CWU
1
1
81241PRTAgrobacterium tumefaciens 1Leu Lys His Val Leu Leu Val Asp Asp Asp
Val Ala Met Arg His Leu 1 5 10
15 Ile Ile Glu Tyr Leu Thr Ile His Ala Phe Lys Val Thr Ala Val
Ala 20 25 30 Asp
Ser Thr Gln Phe Thr Arg Val Leu Ser Ser Ala Thr Val Asp Val 35
40 45 Val Val Val Asp Leu Asn
Leu Gly Arg Glu Asp Gly Leu Glu Ile Val 50 55
60 Arg Asn Leu Ala Ala Lys Ser Asp Ile Pro Ile
Ile Ile Ile Ser Gly 65 70 75
80 Asp Arg Leu Glu Glu Thr Asp Lys Val Val Ala Leu Glu Leu Gly Ala
85 90 95 Ser Asp
Phe Ile Ala Lys Pro Phe Ser Ile Arg Glu Phe Leu Ala Arg 100
105 110 Ile Arg Val Ala Leu Arg Val
Arg Pro Asn Val Val Arg Ser Lys Asp 115 120
125 Arg Arg Ser Phe Cys Phe Thr Asp Trp Thr Leu Asn
Leu Arg Gln Arg 130 135 140
Arg Leu Met Ser Glu Ala Gly Gly Glu Val Lys Leu Thr Ala Gly Glu 145
150 155 160 Phe Asn Leu
Leu Leu Ala Phe Leu Glu Lys Pro Arg Asp Val Leu Ser 165
170 175 Arg Glu Gln Leu Leu Ile Ala Ser
Arg Val Arg Asp Glu Glu Val Tyr 180 185
190 Asp Arg Ser Ile Asp Val Leu Ile Leu Arg Leu Arg Arg
Lys Leu Glu 195 200 205
Ala Asp Pro Ser Ser Pro Gln Leu Ile Lys Thr Ala Arg Gly Ala Gly 210
215 220 Tyr Phe Phe Asp
Ala Asp Val Gln Val Ser His Gly Gly Thr Met Ala 225 230
235 240 Ala 210393DNAArtificial
SequenceT-DNA region sequences of pNMD560 2cctgtggttg gcacatacaa
atggacgaac ggataaacct tttcacgccc ttttaaatat 60ccgattattc taataaacgc
tcttttctct taggtttacc cgccaatata tcctgtcaaa 120cactgatagt ttaaactgaa
ggcgggaaac gacaatctga tctaagctag cttggaattg 180gtaccacgcg tttcgacaaa
atttagaacg aacttaatta tgatctcaaa tacattgata 240catatctcat ctagatctag
gttatcatta tgtaagaaag ttttgacgaa tatggcacga 300caaaatggct agactcgatg
taattggtat ctcaactcaa cattatactt ataccaaaca 360ttagttagac aaaatttaaa
caactatttt ttatgtatgc aagagtcagc atatgtataa 420ttgattcaga atcgttttga
cgagttcgga tgtagtagta gccattattt aatgtacata 480ctaatcgtga atagtgaata
tgatgaaaca ttgtatctta ttgtataaat atccataaac 540acatcatgaa agacactttc
tttcacggtc tgaattaatt atgatacaat tctaatagaa 600aacgaattaa attacgttga
attgtatgaa atctaattga acaagccaac cacgacgacg 660actaacgttg cctggattga
ctcggtttaa gttaaccact aaaaaaacgg agctgtcatg 720taacacgcgg atcgagcagg
tcacagtcat gaagccatca aagcaaaaga actaatccaa 780gggctgagat gattaattag
tttaaaaatt agttaacacg agggaaaagg ctgtctgaca 840gccaggtcac gttatcttta
cctgtggtcg aaatgattcg tgtctgtcga ttttaattat 900ttttttgaaa ggccgaaaat
aaagttgtaa gagataaacc cgcctatata aattcatata 960ttttcctctc cgctttgaag
ttttagtttt attgcaacaa caacaacaaa ttacaataac 1020aacaaacaaa atacaaacaa
caacaacatg gcacaatttc aacaaacaat tgacatgcaa 1080actctccaag ccgctgcggg
acgcaacagc ttggtgaatg atttggcatc tcgtcgcgtt 1140tacgataatg cagtcgagga
gctgaatgct cgttccagac gtcccaaggt aataggaact 1200ttctggatct actttatttg
ctggatctcg atcttgtttt ctcaatttcc ttgagatctg 1260gaattcgttt aatttggatc
tgtgaacctc cactaaatct tttggtttta ctagaatcga 1320tctaagttga ccgatcagtt
agctcgatta tagctaccag aatttggctt gaccttgatg 1380gagagatcca tgttcatgtt
acctgggaaa tgatttgtat atgtgaattg aaatctgaac 1440tgttgaagtt agattgaatc
tgaacactgt caatgttaga ttgaatctga acactgttta 1500aggttagatg aagtttgtgt
atagattctt cgaaacttta ggatttgtag tgtcgtacgt 1560tgaacagaaa gctatttctg
attcaatcag ggtttatttg actgtattga actctttttg 1620tgtgtttgca ggtccacttc
tccaaggcag tgtctacgga acagaccctg attgcaacaa 1680acgcatatcc ggagttcgag
atttccttta ctcatacgca atccgctgtg cactccttgg 1740ccggaggcct tcggtcactt
gagttggagt atctcatgat gcaagttccg ttcggttctc 1800tgacgtacga catcggcggt
aacttttccg cgcacctttt caaagggcgc gattacgttc 1860actgctgcat gcctaatctg
gatgtacgtg acattgctcg ccatgaagga cacaaggaag 1920ctatttacag ttatgtgaat
cgtttgaaaa ggcagcagcg tcctgtgcct gaataccaga 1980gggcagcttt caacaactac
gctgagaacc cgcacttcgt ccattgcgac aaacctttcc 2040aacagtgtga attgacgaca
gcgtatggca ctgacaccta cgctgtagct ctccatagca 2100tttatgatat ccctgttgag
gagttcggtt ctgcgctact caggaagaat gtgaaaactt 2160gtttcgcggc ctttcatttc
catgagaata tgcttctaga ttgtgataca gtcacactcg 2220atgagattgg agctacgttc
cagaaatcag gtaacattcc ttagttacct ttcttttctt 2280tttccatcat aagtttatag
attgtacatg ctttgagatt tttctttgca aacaatctca 2340ggtgataacc tgagcttctt
cttccataat gagagcactc tcaattacac ccacagcttc 2400agcaacatca tcaagtacgt
gtgcaagacg ttcttccctg ctagtcaacg cttcgtgtac 2460cacaaggagt tcctggtcac
tagagtcaac acttggtact gcaagttcac gagagtggat 2520acgttcactc tgttccgtgg
tgtgtaccac aacaatgtgg attgcgaaga gttttacaag 2580gctatggacg atgcgtggca
ctacaaaaag acgttagcaa tgcttaatgc cgagaggacc 2640atcttcaagg ataacgctgc
gttaaacttc tggttcccga aggtgctctt gaaattggaa 2700gtcttctttt gttgtctaaa
cctatcaatt tctttgcgga aatttatttg aagctgtaga 2760gttaaaattg agtcttttaa
acttttgtag gtgagagaca tggttatcgt ccctctcttt 2820gacgcttcta tcacaactgg
taggatgtct aggagagagg ttatggtgaa caaggacttc 2880gtctacacgg tcctaaatca
catcaagacc tatcaagcta aggcactgac gtacgcaaac 2940gtgctgagct tcgtggagtc
tattaggtct agagtgataa ttaacggtgt cactgccagg 3000taagttgtta cttatgattg
ttttcctctc tgctacatgt attttgttgt tcatttctgt 3060aagatataag aattgagttt
tcctctgatg atattattag gtctgaatgg gacacagaca 3120aggcaattct aggtccatta
gcaatgacat tcttcctgat cacgaagctg ggtcatgtgc 3180aagatgaaat aatcctgaaa
aagttccaga agttcgacag aaccaccaat gagctgattt 3240ggacaagtct ctgcgatgcc
ctgatggggg ttattccctc ggtcaaggag acgcttgtgc 3300gcggtggttt tgtgaaagta
gcagaacaag ccttagagat caaggttagt atcatatgaa 3360gaaataccta gtttcagttg
atgaatgcta ttttctgacc tcagttgttc tcttttgaga 3420attatttctt ttctaatttg
cctgattttt ctattaattc attaggttcc cgagctatac 3480tgtaccttcg ccgaccgatt
ggtactacag tacaagaagg cggaggagtt ccaatcgtgt 3540gatctttcca aacctctaga
agagtcagag aagtactaca acgcattatc cgagctatca 3600gtgcttgaga atctcgactc
ttttgactta gaggcgttta agactttatg tcagcagaag 3660aatgtggacc cggatatggc
agcaaaggta aatcctggtc cacactttta cgataaaaac 3720acaagatttt aaactatgaa
ctgatcaata atcattccta aaagaccaca cttttgtttt 3780gtttctaaag taatttttac
tgttataaca ggtggtcgta gcaatcatga agtcagaatt 3840gacgttgcct ttcaagaaac
ctacagaaga ggaaatctcg gagtcgctaa aaccaggaga 3900ggggtcgtgt gcagagcata
aggaagtgtt gagcttacaa aatgatgctc cgttcccgtg 3960tgtgaaaaat ctagttgaag
gttccgtgcc ggcgtatgga atgtgtccta agggtggtgg 4020tttcgacaaa ttggatgtgg
acattgctga tttccatctc aagagtgtag atgcagttaa 4080aaagggaact atgatgtctg
cggtgtacac agggtctatc aaagttcaac aaatgaagaa 4140ctacatagat tacttaagtg
cgtcgctggc agctacagtc tcaaacctct gcaaggtaag 4200aggtcaaaag gtttccgcaa
tgatccctct ttttttgttt ctctagtttc aagaatttgg 4260gtatatgact aacttctgag
tgttccttga tgcatatttg tgatgagaca aatgtttgtt 4320ctatgtttta ggtgcttaga
gatgttcacg gcgttgaccc agagtcacag gagaaatctg 4380gagtgtggga tgttaggaga
ggacgttggt tacttaaacc taatgcgaaa agtcacgcgt 4440ggggtgtggc agaagacgcc
aaccacaagt tggttattgt gttactcaac tgggatgacg 4500gaaagccggt ttgtgatgag
acatggttca gggtggcggt gtcaagcgat tccttgatat 4560attcggatat gggaaaactt
aagacgctca cgtcttgcag tccaaatggt gagccaccgg 4620agcctaacgc caaagtaatt
ttggtcgatg gtgttcccgg ttgtggaaaa acgaaggaga 4680ttatcgaaaa ggtaagttct
gcatttggtt atgctccttg cattttaggt gttcgtcgct 4740cttccatttc catgaatagc
taagattttt tttctctgca ttcattcttc ttgcctcagt 4800tctaactgtt tgtggtattt
ttgttttaat tattgctaca ggtaaacttc tctgaagact 4860tgattttagt ccctgggaag
gaagcttcta agatgatcat ccggagggcc aaccaagctg 4920gtgtgataag agcggataag
gacaatgtta gaacggtgga ttccttcttg atgcatcctt 4980ctagaagggt gtttaagagg
ttgtttatcg atgaaggact aatgctgcat acaggttgtg 5040taaatttcct actgctgcta
tctcaatgtg acgtcgcata tgtgtatggg gacacaaagc 5100aaattccgtt catttgcaga
gtcgcgaact ttccgtatcc agcgcatttt gcaaaactcg 5160tcgctgatga gaaggaagtc
agaagagtta cgctcaggta aagcaactgt gttttaatca 5220atttcttgtc aggatatatg
gattataact taatttttga gaaatctgta gtatttggcg 5280tgaaatgagt ttgctttttg
gtttctcccg tgttataggt gcccggctga tgttacgtat 5340ttccttaaca agaagtatga
cggggcggtg atgtgtacca gcgcggtaga gagatccgtg 5400aaggcagaag tggtgagagg
aaagggtgca ttgaacccaa taaccttacc gttggagggt 5460aaaattttga ccttcacaca
agctgacaag ttcgagttac tggagaaggg ttacaaggta 5520aagtttccaa ctttccttta
ccatatcaaa ctaaagttcg aaacttttta tttgatcaac 5580ttcaaggcca cccgatcttt
ctattcctga ttaatttgtg atgaatccat attgactttt 5640gatggttacg caggatgtga
acactgtgca cgaggtgcaa ggggagacgt acgagaagac 5700tgctattgtg cgcttgacat
caactccgtt agagatcata tcgagtgcgt cacctcatgt 5760tttggtggcg ctgacaagac
acacaacgtg ttgtaaatat tacaccgttg tgttggaccc 5820gatggtgaat gtgatttcag
aaatggagaa gttgtccaat ttccttcttg acatgtatag 5880agttgaagca ggtctgtctt
tcctatttca tatgtttaat cctaggaatt tgatcaattg 5940attgtatgta tgtcgatccc
aagactttct tgttcactta tatcttaact ctctctttgc 6000tgtttcttgc aggtgtccaa
tagcaattac aaatcgatgc agtattcagg ggacagaact 6060tgtttgttca gacgcccaag
tcaggagatt ggcgagatat gcaattttac tatgacgctc 6120ttcttcccgg aaacagtact
attctcaatg aatttgatgc tgttacgatg aatttgaggg 6180atatttcctt aaacgtcaaa
gattgcagaa tcgacttctc caaatccgtg caacttccta 6240aagaacaacc tattttcctc
aagcctaaaa taagaactgc ggcagaaatg ccgagaactg 6300caggtaaaat attggatgcc
agacgatatt ctttcttttg atttgtaact ttttcctgtc 6360aaggtcgata aattttattt
tttttggtaa aaggtcgata attttttttt ggagccatta 6420tgtaattttc ctaattaact
gaaccaaaat tatacaaacc aggtttgctg gaaaatttgg 6480ttgcaatgat caaaagaaac
atgaatgcgc cggatttgac agggacaatt gacattgagg 6540atactgcatc tctggtggtt
gaaaagtttt gggattcgta tgttgacaag gaatttagtg 6600gaacgaacga aatgaccatg
acaagggaga gcttctccag gtaaggactt ctcatgaata 6660ttagtggcag attagtgttg
ttaaagtctt tggttagata atcgatgcct cctaattgtc 6720catgttttac tggttttcta
caattaaagg tggctttcga aacaagagtc atctacagtt 6780ggtcagttag cggactttaa
ctttgtggat ttgccggcag tagatgagta caagcatatg 6840atcaagagtc aaccaaagca
aaagttagac ttgagtattc aagacgaata tcctgcattg 6900cagacgatag tctaccattc
gaaaaagatc aatgcgattt tcggtccaat gttttcagaa 6960cttacgagga tgttactcga
aaggattgac tcttcgaagt ttctgttcta caccagaaag 7020acacctgcac aaatagagga
cttcttttct gacctagact caacccaggc gatggaaatt 7080ctggaactcg acatttcgaa
gtacgataag tcacaaaacg agttccattg tgctgtagag 7140tacaagatct gggaaaagtt
aggaattgat gagtggctag ctgaggtctg gaaacaaggt 7200gagttcctaa gttccatttt
tttgtaatcc ttcaatgtta ttttaacttt tcagatcaac 7260atcaaaatta ggttcaattt
tcatcaacca aataatattt ttcatgtata tataggtcac 7320agaaaaacga ccttgaaaga
ttatacggcc ggaatcaaaa catgtctttg gtatcaaagg 7380aaaagtggtg atgtgacaac
ctttattggt aataccatca tcattgccgc atgtttgagc 7440tcaatgatcc ccatggacaa
agtgataaag gcagcttttt gtggagacga tagcctgatt 7500tacattccta aaggtttaga
cttgcctgat attcaggcgg gcgcgaacct catgtggaac 7560ttcgaggcca aactcttcag
gaagaagtat ggttacttct gtggtcgtta tgttattcac 7620catgatagag gagccattgt
gtattacgat ccgcttaaac taatatctaa gttaggttgt 7680aaacatatta gagatgttgt
tcacttagaa gagttacgcg agtctttgtg tgatgtagct 7740agtaacttaa ataattgtgc
gtatttttca cagttagatg aggccgttgc cgaggttcat 7800aagaccgcgg taggcggttc
gtttgctttt tgtagtataa ttaagtattt gtcagataag 7860agattgttta gagatttgtt
ctttgtttga taatgtcgat agtctcgtac gaacctaagg 7920tgagtgattt cctcaatctt
tcgaagaagg aagagatctt gccgaaggct ctaacgaggt 7980taaaaaccgt gtctattagt
actaaagata ttatatctgt caaggagtcg gagactttgt 8040gtgatataga tttgttaatc
aatgtgccat tagataagta tagatatgtg ggtatcctag 8100gagccgtttt taccggagag
tggctagtgc cagacttcgt taaaggtgga gtgacgataa 8160gtgtgataga taagcgtctg
gtgaactcaa aggagtgcgt gattggtacg tacagagccg 8220cagccaagag taagaggttc
cagttcaaat tggttccaaa ttactttgtg tccaccgtgg 8280acgcaaagag gaagccgtgg
caggtaagga tttttatgat atagtatgct tatgtatttt 8340gtactgaaag catatcctgc
ttcattggga tattactgaa agcatttaac tacatgtaaa 8400ctcacttgat gatcaataaa
cttgattttg caggttcatg ttcgtataca agacttgaag 8460attgaggcgg gttggcagcc
gttagctctg gaagtagttt cagttgctat ggtcaccaat 8520aacgttgtca tgaagggttt
gagggaaaag gtcgtcgcaa taaatgatcc ggacgtcgaa 8580ggtttcgaag gtaagccatc
ttcctgctta tttttataat gaacatagaa ataggaagtt 8640gtgcagagaa actaattaac
ctgactcaaa atctaccctc ataattgttg tttgatattg 8700gtcttgtatt ttgcaggtgt
ggttgacgaa ttcgtcgatt cggttgcagc atttaaagcg 8760gttgacaact ttaaaagaag
gaaaaagaag gttgaagaaa agggtgtagt aagtaagtat 8820aagtacagac cggagaagta
cgccggtcct gattcgttta atttgaaaga agaaaacgtc 8880ttacaacatt acaaacccga
ataatcgata actcgagtat ttttacaaca attaccaaca 8940acaacaaaca acaaacaaca
ttacaattac atttacaatt atcatggtga gcaagggcga 9000ggagctgttc accggggtgg
tgcccatcct ggtcgagctg gacggcgacg taaacggcca 9060caagttcagc gtgtccggcg
agggcgaggg cgatgccacc tacggcaagc tgaccctgaa 9120gttcatctgc accaccggca
agctgcccgt gccctggccc accctcgtga ccaccttcag 9180ctacggcgtg cagtgcttca
gccgctaccc cgaccacatg aagcagcacg acttcttcaa 9240gtccgccatg cccgaaggct
acgtccagga gcgcaccatc ttcttcaagg acgacggcaa 9300ctacaagacc cgcgccgagg
tgaagttcga gggcgacacc ctggtgaacc gcatcgagct 9360gaagggcatc gacttcaagg
aggacggcaa catcctgggg cacaagctgg agtacaacta 9420caacagccac aacgtctata
tcatggccga caagcagaag aacggcatca aggtgaactt 9480caagatccgc cacaacatcg
aggacggcag cgtgcagctc gccgaccact accagcagaa 9540cacccccatc ggcgacggcc
ccgtgctgct gcccgacaac cactacctga gcacccagtc 9600cgccctgagc aaagacccca
acgagaagcg cgatcacatg gtcctgctgg agttcgtgac 9660cgccgccggg atcactcacg
gcatggacga gctgtacaag taaagcggcc cctagagcgt 9720ggtgcgcacg atagcgcata
gtgtttttct ctccacttga atcgaagaga tagacttacg 9780gtgtaaatcc gtaggggtgg
cgtaaaccaa attacgcaat gttttgggtt ccatttaaat 9840cgaaacccct tatttcctgg
atcacctgtt aacgcacgtt tgacgtgtat tacagtggga 9900ataagtaaaa gtgagaggtt
cgaatcctcc ctaaccccgg gtaggggccc agcggccgct 9960ctagctagag tcaagcagat
cgttcaaaca tttggcaata aagtttctta agattgaatc 10020ctgttgccgg tcttgcgatg
attatcatat aatttctgtt gaattacgtt aagcatgtaa 10080taattaacat gtaatgcatg
acgttattta tgagatgggt ttttatgatt agagtcccgc 10140aattatacat ttaatacgcg
atagaaaaca aaatatagcg cgcaaactag gataaattat 10200cgcgcgcggt gtcatctatg
ttactagatc gacctgcatc caccccagta cattaaaaac 10260gtccgcaatg tgttattaag
ttgtctaagc gtcaatttgt ttacaccaca atatatcctg 10320ccaccagcca gccaacagct
ccccgaccgg cagctcggca caaaatcacc actcgataca 10380ggcagcccat cag
10393310397DNAArtificial
SequenceT-DNA region of pNMD570 3cctgtggttg gcacatacaa atggacgaac
ggataaacct tttcacgccc ttttaaatat 60ccgattattc taataaacgc tcttttctct
taggtttacc cgccaatata tcctgtcaaa 120cactgatagt ttaaactgaa ggcgggaaac
gacaatctga tctaagctag cttggaattg 180gtaccacgcg tttcgacaaa atttagaacg
aacttaatta tgatctcaaa tacattgata 240catatctcat ctagatctag gttatcatta
tgtaagaaag ttttgacgaa tatggcacga 300caaaatggct agactcgatg taattggtat
ctcaactcaa cattatactt ataccaaaca 360ttagttagac aaaatttaaa caactatttt
ttatgtatgc aagagtcagc atatgtataa 420ttgattcaga atcgttttga cgagttcgga
tgtagtagta gccattattt aatgtacata 480ctaatcgtga atagtgaata tgatgaaaca
ttgtatctta ttgtataaat atccataaac 540acatcatgaa agacactttc tttcacggtc
tgaattaatt atgatacaat tctaatagaa 600aacgaattaa attacgttga attgtatgaa
atctaattga acaagccaac cacgacgacg 660actaacgttg cctggattga ctcggtttaa
gttaaccact aaaaaaacgg agctgtcatg 720taacacgcgg atcgagcagg tcacagtcat
gaagccatca aagcaaaaga actaatccaa 780gggctgagat gattaattag tttaaaaatt
agttaacacg agggaaaagg ctgtctgaca 840gccaggtcac gttatcttta cctgtggtcg
aaatgattcg tgtctgtcga ttttaattat 900ttttttgaaa ggccgaaaat aaagttgtaa
gagataaacc cgcctatata aattcatata 960ttttcctctc cgctttgaag ttttagtttt
attgcaacaa caacaacaaa ttacaataac 1020aacaaacaaa atacaaacaa caacaacatg
gcacaatttc aacaaacaat tgacatgcaa 1080actctccaag ccgctgcggg acgcaacagc
ttggtgaatg atttggcatc tcgtcgcgtt 1140tacgataatg cagtcgagga gctgaatgct
cgttccagac gtcccaaggt aataggaact 1200ttctggatct actttatttg ctggatctcg
atcttgtttt ctcaatttcc ttgagatctg 1260gaattcgttt aatttggatc tgtgaacctc
cactaaatct tttggtttta ctagaatcga 1320tctaagttga ccgatcagtt agctcgatta
tagctaccag aatttggctt gaccttgatg 1380gagagatcca tgttcatgtt acctgggaaa
tgatttgtat atgtgaattg aaatctgaac 1440tgttgaagtt agattgaatc tgaacactgt
caatgttaga ttgaatctga acactgttta 1500aggttagatg aagtttgtgt atagattctt
cgaaacttta ggatttgtag tgtcgtacgt 1560tgaacagaaa gctatttctg attcaatcag
ggtttatttg actgtattga actctttttg 1620tgtgtttgca ggtccacttc tccaaggcag
tgtctacgga acagaccctg attgcaacaa 1680acgcatatcc ggagttcgag atttccttta
ctcatacgca atccgctgtg cactccttgg 1740ccggaggcct tcggtcactt gagttggagt
atctcatgat gcaagttccg ttcggttctc 1800tgacgtacga catcggcggt aacttttccg
cgcacctttt caaagggcgc gattacgttc 1860actgctgcat gcctaatctg gatgtacgtg
acattgctcg ccatgaagga cacaaggaag 1920ctatttacag ttatgtgaat cgtttgaaaa
ggcagcagcg tcctgtgcct gaataccaga 1980gggcagcttt caacaactac gctgagaacc
cgcacttcgt ccattgcgac aaacctttcc 2040aacagtgtga attgacgaca gcgtatggca
ctgacaccta cgctgtagct ctccatagca 2100tttatgatat ccctgttgag gagttcggtt
ctgcgctact caggaagaat gtgaaaactt 2160gtttcgcggc ctttcatttc catgagaata
tgcttctaga ttgtgataca gtcacactcg 2220atgagattgg agctacgttc cagaaatcag
gtaacattcc ttagttacct ttcttttctt 2280tttccatcat aagtttatag attgtacatg
ctttgagatt tttctttgca aacaatctca 2340ggtgataacc tgagcttctt cttccataat
gagagcactc tcaattacac ccacagcttc 2400agcaacatca tcaagtacgt gtgcaagacg
ttcttccctg ctagtcaacg cttcgtgtac 2460cacaaggagt tcctggtcac tagagtcaac
acttggtact gcaagttcac gagagtggat 2520acgttcactc tgttccgtgg tgtgtaccac
aacaatgtgg attgcgaaga gttttacaag 2580gctatggacg atgcgtggca ctacaaaaag
acgttagcaa tgcttaatgc cgagaggacc 2640atcttcaagg ataacgctgc gttaaacttc
tggttcccga aggtgctctt gaaattggaa 2700gtcttctttt gttgtctaaa cctatcaatt
tctttgcgga aatttatttg aagctgtaga 2760gttaaaattg agtcttttaa acttttgtag
gtgagagaca tggttatcgt ccctctcttt 2820gacgcttcta tcacaactgg taggatgtct
aggagagagg ttatggtgaa caaggacttc 2880gtctacacgg tcctaaatca catcaagacc
tatcaagcta aggcactgac gtacgcaaac 2940gtgctgagct tcgtggagtc tattaggtct
agagtgataa ttaacggtgt cactgccagg 3000taagttgtta cttatgattg ttttcctctc
tgctacatgt attttgttgt tcatttctgt 3060aagatataag aattgagttt tcctctgatg
atattattag gtctgaatgg gacacagaca 3120aggcaattct aggtccatta gcaatgacat
tcttcctgat cacgaagctg ggtcatgtgc 3180aagatgaaat aatcctgaaa aagttccaga
agttcgacag aaccaccaat gagctgattt 3240ggacaagtct ctgcgatgcc ctgatggggg
ttattccctc ggtcaaggag acgcttgtgc 3300gcggtggttt tgtgaaagta gcagaacaag
ccttagagat caaggttagt atcatatgaa 3360gaaataccta gtttcagttg atgaatgcta
ttttctgacc tcagttgttc tcttttgaga 3420attatttctt ttctaatttg cctgattttt
ctattaattc attaggttcc cgagctatac 3480tgtaccttcg ccgaccgatt ggtactacag
tacaagaagg cggaggagtt ccaatcgtgt 3540gatctttcca aacctctaga agagtcagag
aagtactaca acgcattatc cgagctatca 3600gtgcttgaga atctcgactc ttttgactta
gaggcgttta agactttatg tcagcagaag 3660aatgtggacc cggatatggc agcaaaggta
aatcctggtc cacactttta cgataaaaac 3720acaagatttt aaactatgaa ctgatcaata
atcattccta aaagaccaca cttttgtttt 3780gtttctaaag taatttttac tgttataaca
ggtggtcgta gcaatcatga agtcagaatt 3840gacgttgcct ttcaagaaac ctacagaaga
ggaaatctcg gagtcgctaa aaccaggaga 3900ggggtcgtgt gcagagcata aggaagtgtt
gagcttacaa aatgatgctc cgttcccgtg 3960tgtgaaaaat ctagttgaag gttccgtgcc
ggcgtatgga atgtgtccta agggtggtgg 4020tttcgacaaa ttggatgtgg acattgctga
tttccatctc aagagtgtag atgcagttaa 4080aaagggaact atgatgtctg cggtgtacac
agggtctatc aaagttcaac aaatgaagaa 4140ctacatagat tacttaagtg cgtcgctggc
agctacagtc tcaaacctct gcaaggtaag 4200aggtcaaaag gtttccgcaa tgatccctct
ttttttgttt ctctagtttc aagaatttgg 4260gtatatgact aacttctgag tgttccttga
tgcatatttg tgatgagaca aatgtttgtt 4320ctatgtttta ggtgcttaga gatgttcacg
gcgttgaccc agagtcacag gagaaatctg 4380gagtgtggga tgttaggaga ggacgttggt
tacttaaacc taatgcgaaa agtcacgcgt 4440ggggtgtggc agaagacgcc aaccacaagt
tggttattgt gttactcaac tgggatgacg 4500gaaagccggt ttgtgatgag acatggttca
gggtggcggt gtcaagcgat tccttgatat 4560attcggatat gggaaaactt aagacgctca
cgtcttgcag tccaaatggt gagccaccgg 4620agcctaacgc caaagtaatt ttggtcgatg
gtgttcccgg ttgtggaaaa acgaaggaga 4680ttatcgaaaa ggtaagttct gcatttggtt
atgctccttg cattttaggt gttcgtcgct 4740cttccatttc catgaatagc taagattttt
tttctctgca ttcattcttc ttgcctcagt 4800tctaactgtt tgtggtattt ttgttttaat
tattgctaca ggtaaacttc tctgaagact 4860tgattttagt ccctgggaag gaagcttcta
agatgatcat ccggagggcc aaccaagctg 4920gtgtgataag agcggataag gacaatgtta
gaacggtgga ttccttcttg atgcatcctt 4980ctagaagggt gtttaagagg ttgtttatcg
atgaaggact aatgctgcat acaggttgtg 5040taaatttcct actgctgcta tctcaatgtg
acgtcgcata tgtgtatggg gacacaaagc 5100aaattccgtt catttgcaga gtcgcgaact
ttccgtatcc agcgcatttt gcaaaactcg 5160tcgctgatga gaaggaagtc agaagagtta
cgctcaggta aagcaactgt gttttaatca 5220atttcttgtc aggatatatg gattataact
taatttttga gaaatctgta gtatttggcg 5280tgaaatgagt ttgctttttg gtttctcccg
tgttataggt gcccggctga tgttacgtat 5340ttccttaaca agaagtatga cggggcggtg
atgtgtacca gcgcggtaga gagatccgtg 5400aaggcagaag tggtgagagg aaagggtgca
ttgaacccaa taaccttacc gttggagggt 5460aaaattttga ccttcacaca agctgacaag
ttcgagttac tggagaaggg ttacaaggta 5520aagtttccaa ctttccttta ccatatcaaa
ctaaagttcg aaacttttta tttgatcaac 5580ttcaaggcca cccgatcttt ctattcctga
ttaatttgtg atgaatccat attgactttt 5640gatggttacg caggatgtga acactgtgca
cgaggtgcaa ggggagacgt acgagaagac 5700tgctattgtg cgcttgacat caactccgtt
agagatcata tcgagtgcgt cacctcatgt 5760tttggtggcg ctgacaagac acacaacgtg
ttgtaaatat tacaccgttg tgttggaccc 5820gatggtgaat gtgatttcag aaatggagaa
gttgtccaat ttccttcttg acatgtatag 5880agttgaagca ggtctgtctt tcctatttca
tatgtttaat cctaggaatt tgatcaattg 5940attgtatgta tgtcgatccc aagactttct
tgttcactta tatcttaact ctctctttgc 6000tgtttcttgc aggtgtccaa tagcaattac
aaatcgatgc agtattcagg ggacagaact 6060tgtttgttca gacgcccaag tcaggagatt
ggcgagatat gcaattttac tatgacgctc 6120ttcttcccgg aaacagtact attctcaatg
aatttgatgc tgttacgatg aatttgaggg 6180atatttcctt aaacgtcaaa gattgcagaa
tcgacttctc caaatccgtg caacttccta 6240aagaacaacc tattttcctc aagcctaaaa
taagaactgc ggcagaaatg ccgagaactg 6300caggtaaaat attggatgcc agacgatatt
ctttcttttg atttgtaact ttttcctgtc 6360aaggtcgata aattttattt tttttggtaa
aaggtcgata attttttttt ggagccatta 6420tgtaattttc ctaattaact gaaccaaaat
tatacaaacc aggtttgctg gaaaatttgg 6480ttgcaatgat caaaagaaac atgaatgcgc
cggatttgac agggacaatt gacattgagg 6540atactgcatc tctggtggtt gaaaagtttt
gggattcgta tgttgacaag gaatttagtg 6600gaacgaacga aatgaccatg acaagggaga
gcttctccag gtaaggactt ctcatgaata 6660ttagtggcag attagtgttg ttaaagtctt
tggttagata atcgatgcct cctaattgtc 6720catgttttac tggttttcta caattaaagg
tggctttcga aacaagagtc atctacagtt 6780ggtcagttag cggactttaa ctttgtggat
ttgccggcag tagatgagta caagcatatg 6840atcaagagtc aaccaaagca aaagttagac
ttgagtattc aagacgaata tcctgcattg 6900cagacgatag tctaccattc gaaaaagatc
aatgcgattt tcggtccaat gttttcagaa 6960cttacgagga tgttactcga aaggattgac
tcttcgaagt ttctgttcta caccagaaag 7020acacctgcac aaatagagga cttcttttct
gacctagact caacccaggc gatggaaatt 7080ctggaactcg acatttcgaa gtacgataag
tcacaaaacg agttccattg tgctgtagag 7140tacaagatct gggaaaagtt aggaattgat
gagtggctag ctgaggtctg gaaacaaggt 7200gagttcctaa gttccatttt tttgtaatcc
ttcaatgtta ttttaacttt tcagatcaac 7260atcaaaatta ggttcaattt tcatcaacca
aataatattt ttcatgtata tataggtcac 7320agaaaaacga ccttgaaaga ttatacggcc
ggaatcaaaa catgtctttg gtatcaaagg 7380aaaagtggtg atgtgacaac ctttattggt
aataccatca tcattgccgc atgtttgagc 7440tcaatgatcc ccatggacaa agtgataaag
gcagcttttt gtggagacga tagcctgatt 7500tacattccta aaggtttaga cttgcctgat
attcaggcgg gcgcgaacct catgtggaac 7560ttcgaggcca aactcttcag gaagaagtat
ggttacttct gtggtcgtta tgttattcac 7620catgatagag gagccattgt gtattacgat
ccgcttaaac taatatctaa gttaggttgt 7680aaacatatta gagatgttgt tcacttagaa
gagttacgcg agtctttgtg tgatgtagct 7740agtaacttaa ataattgtgc gtatttttca
cagttagatg aggccgttgc cgaggttcat 7800aagaccgcgg taggcggttc gtttgctttt
tgtagtataa ttaagtattt gtcagataag 7860agattgttta gagatttgtt ctttgtttga
taatgtcgat agtctcgtac gaacctaagg 7920tgagtgattt cctcaatctt tcgaagaagg
aagagatctt gccgaaggct ctaacgaggt 7980taaaaaccgt gtctattagt actaaagata
ttatatctgt caaggagtcg gagactttgt 8040gtgatataga tttgttaatc aatgtgccat
tagataagta tagatatgtg ggtatcctag 8100ctaggagccg tttttaccgg agagtggcta
gtgccagact tcgttaaagg tggagtgacg 8160ataagtgtga tagataagcg tctggtgaac
tcaaaggagt gcgtgattgg tacgtacaga 8220gccgcagcca agagtaagag gttccagttc
aaattggttc caaattactt tgtgtccacc 8280gtggacgcaa agaggaagcc gtggcaggta
aggattttta tgatatagta tgcttatgta 8340ttttgtactg aaagcatatc ctgcttcatt
gggatattac tgaaagcatt taactacatg 8400taaactcact tgatgatcaa taaacttgat
tttgcaggtt catgttcgta tacaagactt 8460gaagattgag gcgggttggc agccgttagc
tctggaagta gtttcagttg ctatggtcac 8520caataacgtt gtcatgaagg gtttgaggga
aaaggtcgtc gcaataaatg atccggacgt 8580cgaaggtttc gaaggtaagc catcttcctg
cttattttta taatgaacat agaaatagga 8640agttgtgcag agaaactaat taacctgact
caaaatctac cctcataatt gttgtttgat 8700attggtcttg tattttgcag gtgtggttga
cgaattcgtc gattcggttg cagcatttaa 8760agcggttgac aactttaaaa gaaggaaaaa
gaaggttgaa gaaaagggtg tagtaagtaa 8820gtataagtac agaccggaga agtacgccgg
tcctgattcg tttaatttga aagaagaaaa 8880cgtcttacaa cattacaaac ccgaataatc
gataactcga gtatttttac aacaattacc 8940aacaacaaca aacaacaaac aacattacaa
ttacatttac aattatcatg gtgagcaagg 9000gcgaggagct gttcaccggg gtggtgccca
tcctggtcga gctggacggc gacgtaaacg 9060gccacaagtt cagcgtgtcc ggcgagggcg
agggcgatgc cacctacggc aagctgaccc 9120tgaagttcat ctgcaccacc ggcaagctgc
ccgtgccctg gcccaccctc gtgaccacct 9180tcagctacgg cgtgcagtgc ttcagccgct
accccgacca catgaagcag cacgacttct 9240tcaagtccgc catgcccgaa ggctacgtcc
aggagcgcac catcttcttc aaggacgacg 9300gcaactacaa gacccgcgcc gaggtgaagt
tcgagggcga caccctggtg aaccgcatcg 9360agctgaaggg catcgacttc aaggaggacg
gcaacatcct ggggcacaag ctggagtaca 9420actacaacag ccacaacgtc tatatcatgg
ccgacaagca gaagaacggc atcaaggtga 9480acttcaagat ccgccacaac atcgaggacg
gcagcgtgca gctcgccgac cactaccagc 9540agaacacccc catcggcgac ggccccgtgc
tgctgcccga caaccactac ctgagcaccc 9600agtccgccct gagcaaagac cccaacgaga
agcgcgatca catggtcctg ctggagttcg 9660tgaccgccgc cgggatcact cacggcatgg
acgagctgta caagtaaagc ggcccctaga 9720gcgtggtgcg cacgatagcg catagtgttt
ttctctccac ttgaatcgaa gagatagact 9780tacggtgtaa atccgtaggg gtggcgtaaa
ccaaattacg caatgttttg ggttccattt 9840aaatcgaaac cccttatttc ctggatcacc
tgttaacgca cgtttgacgt gtattacagt 9900gggaataagt aaaagtgaga ggttcgaatc
ctccctaacc ccgggtaggg gcccagcggc 9960cgctctagct agagtcaagc agatcgttca
aacatttggc aataaagttt cttaagattg 10020aatcctgttg ccggtcttgc gatgattatc
atataatttc tgttgaatta cgttaagcat 10080gtaataatta acatgtaatg catgacgtta
tttatgagat gggtttttat gattagagtc 10140ccgcaattat acatttaata cgcgatagaa
aacaaaatat agcgcgcaaa ctaggataaa 10200ttatcgcgcg cggtgtcatc tatgttacta
gatcgacctg catccacccc agtacattaa 10260aaacgtccgc aatgtgttat taagttgtct
aagcgtcaat ttgtttacac cacaatatat 10320cctgccacca gccagccaac agctccccga
ccggcagctc ggcacaaaat caccactcga 10380tacaggcagc ccatcag
1039747351DNAArtificial SequenceT-DNA
region of pNMD620 4cctgtggttg gcacatacaa atggacgaac ggataaacct tttcacgccc
ttttaaatat 60ccgattattc taataaacgc tcttttctct taggtttacc cgccaatata
tcctgtcaaa 120cactgatagt ttaaactgaa ggcgggaaac gacaatctga tctaagctag
gcatgcctgc 180aggtcaacat ggtggagcac gacacgcttg tctactccaa aaatatcaaa
gatacagtct 240cagaagacca aagggcaatt gagacttttc aacaaagggt aatatccgga
aacctcctcg 300gattccattg cccagctatc tgtcacttta ttgtgaagat agtggaaaag
gaaggtggct 360cctacaaatg ccatcattgc gataaaggaa aggccatcgt tgaagatgcc
tctgccgaca 420gtggtcccaa agatggaccc ccacccacga ggagcatcgt ggaaaaagaa
gacgttccaa 480ccacgtcttc aaagcaagtg gattgatgtg atatctccac tgacgtaagg
gatgacgcac 540aatcccacta tccttcgcaa gacccttcct ctatataagg aagttcattt
catttggaga 600ggagaaaact aaaccataca ccaccaacac aaccaaaccc accacgccca
attgttacac 660acccgcttga aaaagaaagt ttaacaaatg gccaaggtgc gcgaggttta
ccaatctttt 720acagactcca ccacaaaaac tctcatccaa gatgaggctt atagaaacat
tcgccccatc 780atggaaaaac acaaactagc taacccttac gctcaaacgg ttgaagcggc
taatgatcta 840gaggggttcg gcatagccac caatccctat agcattgaat tgcatacaca
tgcagccgct 900aagaccatag agaataaact tctagaggtg cttggttcca tcctaccaca
agaacctgtt 960acatttatgt ttcttaaacc cagaaagcta aactacatga gaagaaaccc
gcggatcaag 1020gacattttcc aaaatgttgc cattgaacca agagacgtag ccaggtaccc
caaggaaaca 1080ataattgaca aactcacaga gatcacaacg gaaacagcat acattagtga
cactctgcac 1140ttcttggatc cgagctacat agtggagaca ttccaaaact gcccaaaatt
gcaaacattg 1200tatgcgacct tagttctccc cgttgaggca gcctttaaaa tggaaagcac
tcacccgaac 1260atatacagcc tcaaatactt cggagatggt ttccagtata taccaggcaa
ccatggtggc 1320ggggcatacc atcatgaatt cgctcatcta caatggctca aagtgggaaa
gatcaagtgg 1380agggacccca aggatagctt tctcggacat ctcaattaca cgactgagca
ggttgagatg 1440cacacagtga cagtacagtt gcaggaatcg ttcgcggcaa accacttgta
ctgcatcagg 1500agaggagact tgctcacacc ggaggtgcgc actttcggcc aacctgacag
gtacgtgatt 1560ccaccacaga tcttcctccc aaaagttcac aactgcaaga agccgattct
caagaaaact 1620atgatgcagc tcttcttgta tgttaggaca gtcaaggtcg caaaaaattg
tgacattttt 1680gccaaagtca gacaattaat taaatcatct gacttggaca aatactctgc
tgtggaactg 1740gtttacttag taagctacat ggagttcctt gccgatttac aagctaccac
ctgcttctca 1800gacacacttt ctggtggctt gctaacaaag acccttgcac cggtgagggc
ttggatacaa 1860gagaaaaaga tgcagctgtt tggtcttgag gactacgcga agttagtcaa
agcagttgat 1920ttccacccgg tggatttttc tttcaaagtg gaaacttggg acttcagatt
ccaccccttg 1980caagcgtgga aagccttccg accaagggaa gtgtcggatg tagaggaaat
ggaaagtttg 2040ttctcagatg gggacctgct tgattgcttc acaagaatgc cagcttatgc
ggtaaacgca 2100gaggaagatt tagctgcaat caggaaaacg cccgagatgg atgtcggtca
agaagttaaa 2160gagcctgcag gagacagaaa tcaatactca aaccctgcag aaactttcct
caacaagctc 2220cacaggaaac acagtaggga ggtgaaacac caggccgcaa agaaagctaa
acgcctagct 2280gaaatccagg agtcaatgag agctgaaggt gatgccgaac caaatgaaat
aagcgggacg 2340atgggggcaa tacccagcaa cgccgaactt cctggcacga atgatgccag
acaagaactc 2400acactcccaa ccactaaacc tgtccctgca aggtgggaag atgcttcatt
cacagattct 2460agtgtggaag aggagcaggt taaactcctt ggaaaagaaa ccgttgaaac
agcgacgcaa 2520caagtcatcg aaggacttcc ttggaaacac tggattcctc aattaaatgc
tgttggattc 2580aaggcgctgg aaattcagag ggataggagt ggaacaatga tcatgcccat
cacagaaatg 2640gtctccgggc tggaaaaaga ggacttccct gaaggaactc caaaagagtt
ggcacgagaa 2700ttgttcgcta tgaacagaag ccctgccacc atccctttgg acctgcttag
agccagagac 2760tacggcagtg atgtaaagaa caagagaatt ggtgccatca caaagacaca
ggcaacgagt 2820tggggcgaat acttgacagg aaagatagaa agcttaactg agaggaaagt
tgcgacttgt 2880gtcattcatg gagctggagg ttctggaaaa agtcatgcca tccagaaggc
attgagagaa 2940attggcaagg gctcggacat cactgtagtc ctgccgacca atgaactgcg
gctagattgg 3000agtaagaaag tgcctaacac tgagccctat atgttcaaga cctctgaaaa
ggcgttaatt 3060gggggaacag gcagcatagt catctttgac gattactcaa aacttcctcc
cggttacata 3120gaagccttag tctgtttcta ctctaaaatc aagctaatca ttctaacagg
agatagcaga 3180caaagcgtct accatgaaac tgctgaggac gcctccatca ggcatttggg
accagcaaca 3240gagtacttct caaaatactg ccgatactat ctcaatgcca cacaccgcaa
caagaaagat 3300cttgcgaaca tgcttggtgt ctacagtgag agaacgggag tcaccgaaat
cagcatgagc 3360gccgagttct tagaaggaat cccaactttg gtaccctcgg atgagaagag
aaagctgtac 3420atgggcaccg ggaggaatga cacgttcaca tacgctggat gccaggggct
aactaagccg 3480aaggtacaaa tagtgttgga ccacaacacc caagtgtgta gcgcgaatgt
gatgtacacg 3540gcactttcta gagccaccga taggattcac ttcgtgaaca caagtgcaaa
ttcctctgcc 3600ttctgggaaa agttggacag caccccttac ctcaagactt tcctatcagt
ggtgagagaa 3660caagcactca gggagtacga gccggcagag gcagagccaa ttcaagagcc
tgagccccag 3720acacacatgt gtgtcgagaa tgaggagtcc gtgctagaag agtacaaaga
ggaactcttg 3780gaaaagtttg acagagagat ccactctgaa tcccatggtc attcaaactg
tgtccaaact 3840gaagacacaa ccattcagtt gttttcgcat caacaagcaa aagatgagac
cctcctctgg 3900gcgactatag atgcgcggct caagaccagc aatcaagaaa caaacttccg
agaattcctg 3960agcaagaagg acattgggga cgttctgttt ttaaactacc aaaaagctat
gggtttaccc 4020aaagagcgta ttcctttttc ccaagaggtc tgggaagctt gtgcccacga
agtacaaagc 4080aagtacctca gcaagtcaaa gtgcaacttg atcaatggga ctgtgagaca
gagcccagac 4140ttcgatgaaa ataagattat ggtattcctc aagtcgcagt gggtcacaaa
ggtggaaaaa 4200ctaggtctac ccaagattaa gccaggtcaa accatagcag ccttttacca
gcagactgtg 4260atgctttttg gaactatggc taggtacatg cgatggttca gacaggcttt
ccagccaaaa 4320gaagtcttca taaactgtga gaccacgcca gatgacatgt ctgcatgggc
cttgaacaac 4380tggaatttca gcagacctag cttggctaat gactacacag ctttcgacca
gtctcaggat 4440ggagccatgt tgcaatttga ggtgctcaaa gccaaacacc actgcatacc
agaggaaatc 4500attcaggcat acatagatat taagactaat gcacagattt tcctaggcac
gttatcaatt 4560atgcgcctga ctggtgaagg tcccactttt gatgcaaaca ctgagtgcaa
catagcttac 4620acccatacaa agtttgacat cccagccgga actgctcaag tttatgcagg
agacgactcc 4680gcactggact gtgttccaga agtgaagcat agtttccaca ggcttgagga
caaattactc 4740ctaaagtcaa agcctgtaat cacgcagcaa aagaagggca gttggcctga
gttttgtggt 4800tggctgatca caccaaaagg ggtgatgaaa gacccaatta agctccatgt
tagcttaaaa 4860ttggctgaag ctaagggtga actcaagaaa tgtcaagatt cctatgaaat
tgatctgagt 4920tatgcctatg accacaagga ctctctgcat gacttgttcg atgagaaaca
gtgtcaggca 4980cacacactca cttgcagaac actaatcaag tcagggagag gcactgtctc
actttcccgc 5040ctcagaaact ttctttaacc gttaagttac cttagagatt tgaataagat
ggatattctc 5100atcagtagtt tgaaaagttt aggttattct aggacttcca aatctttaga
ttcaggacct 5160ttggtagtac atgcagtagc cggagccggt aagtccacag ccctaaggaa
gttgatcctc 5220agacacccaa cattcaccgt gcatacactc ggtgtccctg acaaggtgag
tatcagaact 5280agaggcatac agaagccagg acctattcct gagggcaact tcgcaatcct
cgatgagtat 5340actttggaca acaccacaag gaactcatac caggcacttt ttgctgaccc
ttatcaggca 5400ccggagttta gcctagagcc ccacttctac ttggaaacat catttcgagt
tccgaggaaa 5460gtggcagatt tgatagctgg ctgtggcttc gatttcgaga cgaactcacc
ggaagaaggg 5520cacttagaga tcactggcat attcaaaggg cccctactcg gaaaggtgat
agccattgat 5580gaggagtctg agacaacact gtccaggcat ggtgttgagt ttgttaagcc
ctgccaagtg 5640acgggacttg agttcaaagt agtcactatt gtgtctgccg caccaataga
ggaaattggc 5700cagtccacag ctttctacaa cgctatcacc aggtcaaagg gattgacata
tgtccgcgca 5760gggccatagg ctgaccgctc cggtcaattc tgaaaaagtg tacatagtat
taggtctatc 5820atttgcttta gtttcaatta cctttctgct ttctagaaat agcttacccc
acgtcggtga 5880caacattcac agcttgccac acggaggagc ttacagagac ggcaccaaag
caatcttgta 5940caactcccca aatctagggt cacgagtgag tctacacaac ggaaagaacg
cagcatttgc 6000tgccgttttg ctactgactt tgctgatcta tggaagtaaa tacatatctc
aacgcaatca 6060tacttgtgct tgtggtaaca atcatagcag tcattagcac ttccttagtg
aggactgaac 6120cttgtgtcat caagattact ggggaatcaa tcacagtgtt ggcttgcaaa
ctagatgcag 6180aaaccataag ggccattgcc gatctcaagc cactctccgt tgaacggtta
agtttccatt 6240gatactcgaa agaggtcagc accagctagc aacaaacaag aaaggtatgg
tgagcaaggg 6300cgaggagctg ttcaccgggg tggtgcccat cctggtcgag ctggacggcg
acgtaaacgg 6360ccacaagttc agcgtgtccg gcgagggcga gggcgatgcc acctacggca
agctgaccct 6420gaagttcatc tgcaccaccg gcaagctgcc cgtgccctgg cccaccctcg
tgaccacctt 6480cagctacggc gtgcagtgct tcagccgcta ccccgaccac atgaagcagc
acgacttctt 6540caagtccgcc atgcccgaag gctacgtcca ggagcgcacc atcttcttca
aggacgacgg 6600caactacaag acccgcgccg aggtgaagtt cgagggcgac accctggtga
accgcatcga 6660gctgaagggc atcgacttca aggaggacgg caacatcctg gggcacaagc
tggagtacaa 6720ctacaacagc cacaacgtct atatcatggc cgacaagcag aagaacggca
tcaaggtgaa 6780cttcaagatc cgccacaaca tcgaggacgg cagcgtgcag ctcgccgacc
actaccagca 6840gaacaccccc atcggcgacg gccccgtgct gctgcccgac aaccactacc
tgagcaccca 6900gtccgccctg agcaaagacc ccaacgagaa gcgcgatcac atggtcctgc
tggagttcgt 6960gaccgccgcc gggatcactc acggcatgga cgagctgtac aagtaagctt
ggtcgtatca 7020ctggaacaac aaccgctgag gctgttgtca ctctaccacc accataacta
cgtctacata 7080accgacgcct accccagttt catagtattt tctggtttga ttgtatgaat
aatataaata 7140aaaaaaaaaa aaaaaaaaaa aaactagtga gctcttctgt cagcgggccc
actgcatcca 7200ccccagtaca ttaaaaacgt ccgcaatgtg ttattaagtt gtctaagcgt
caatttgttt 7260acaccacaat atatcctgcc accagccagc caacagctcc ccgaccggca
gctcggcaca 7320aaatcaccac tcgatacagg cagcccatca g
735151018DNAArtificial SequencePlasmid backbone insertion
containing virG gene of pNMD062 5ctgtcgatca gatctggctc gcggcggacg
cacgacgccg gggcgagacc ataggcgatc 60tcctaaatca atagtagctg taacctcgaa
gcgtttcact tgtaacaacg attgagaatt 120tttgtcataa aattgaaata cttggttcgc
atttttgtca tccgcggtca gccgcaattc 180tgacgaactg cccatttagc tggagatgat
tgtacatcct tcacgtgaaa atttctcaag 240cgctgtgaac aagggttcag attttagatt
gaaaggtgag ccgttgaaac acgttcttct 300tgtcgatgac gacgtcgcta tgcggcatct
tattattgaa taccttacga tccacgcctt 360caaagtgacc gcggtagccg acagcaccca
gttcacaaga gtactctctt ccgcgacggt 420cgatgtcgtg gttgttgatc taaatttagg
tcgtgaagat gggctcgaga tcgttcgtaa 480tctggcggca aagtctgata ttccaatcat
aattatcagt ggcgaccgcc ttgaggagac 540ggataaagtt gttgcactcg agctaggagc
aagtgatttt atcgctaagc cgttcagtat 600cagagagttt ctagcacgca ttcgggttgc
cttgcgcgtg cgccccaacg ttgtccgctc 660caaagaccga cggtcttttt gttttactga
ctggacactt aatctcaggc aacgtcgctt 720gatgtccgaa gctggcggtg aggtgaaact
tacggcaggt gagttcaatc ttctcctcgc 780gtttttagag aaaccccgcg acgttctatc
gcgcgagcaa cttctcattg ccagtcgagt 840acgcgacgag gaggtttatg acaggagtat
agatgttctc attttgaggc tgcgccgcaa 900acttgaggcg gatccgtcaa gccctcaact
gataaaaaca gcaagaggtg ccggttattt 960ctttgacgcg gacgtgcagg tttcgcacgg
ggggacgatg gcagcctaag atcgacag 101861018DNAArtificial SequencePlasmid
backbone insertion containing virG gene of pNMD063 6ctgtcgatca
gatctggctc gcggcggacg cacgacgccg gggcgagacc ataggcgatc 60tcctaaatca
atagtagctg taacctcgaa gcgtttcact tgtaacaacg attgagaatt 120tttgtcataa
aattgaaata cttggttcgc atttttgtca tccgcggtca gccgcaattc 180tgacgaactg
cccatttagc tggagatgat tgtacatcct tcacgtgaaa atttctcaag 240tgctgtgaac
aagggttcag attttagatt gaaaggtgag ccgttgaaac acgttcttct 300tgtcgatgac
gacgtcgcta tgcggcatct tattattgaa taccttacga tccacgcctt 360caaagtgacc
gcggtagccg acagcaccca gttcacaaga gtactctctt ccgcgacggt 420cgatgtcgtg
gttgttgatc tagatttagg tcgtgaagat gggctcgaga tcgttcgtaa 480tctggcggca
aagtctgata ttccaatcat aattatcagt ggcgaccgcc ttgaggagac 540ggataaagtt
gttgcactcg agctaggagc aagtgatttt atcgctaagc cgttcagtat 600cagagagttt
ctagcacgca ttcgggttgc cttgcgcgtg cgccccaacg ttgtccgctc 660caaagaccga
cggtcttttt gttttactga ctggacactt aatctcaggc aacgtcgctt 720gatgtccgaa
gctggcggtg aggtgaaact tacggcaggt gagttcaatc ttctcctcgc 780gtttttagag
aaaccccgcg acgttctatc gcgcgagcaa cttctcattg ccagtcgagt 840acgcgacgag
gaggtttatg acaggagtat agatgttctc attttgaggc tgcgccgcaa 900acttgaggcg
gatccgtcaa gccctcaact gataaaaaca gcaagaggtg ccggttattt 960ctttgacgcg
gacgtgcagg tttcgcacgg ggggacgatg gcagcctaag atcgacag
1018710627DNAArtificial Sequencefull-length nucleotide sequence of
pNMD1971 7ttaagattga atcctgttgc cggtcttgcg atgattatca tataatttct
gttgaattac 60gttaagcatg taataattaa catgtaatgc atgacgttat ttatgagatg
ggtttttatg 120attagagtcc cgcaattata catttaatac gcgatagaaa acaaaatata
gcgcgcaaac 180taggataaat tatcgcgcgc ggtgtcatct atgttactag atcgacctgc
aggcatgcca 240attccaatcc cacaaaaatc tgagcttaac agcacagttg ctcctctcag
agcagaatcg 300ggtattcaac accctcatat caactactac gttgtgtata acggtccaca
tgccggtata 360tacgatgact ggggttgtac aaaggcggca acaaacggcg ttcccggagt
tgcacacaag 420aaatttgcca ctattacaga ggcaagagca gcagctgacg cgtacacaac
aagtcagcaa 480acagacaggt tgaacttcat ccccaaagga gaagctcaac tcaagcccaa
gagctttgct 540aaggccctaa caagcccacc aaagcaaaaa gcccactggc tcacgctagg
aaccaaaagg 600cccagcagtg atccagcccc aaaagagatc tcctttgccc cggagattac
aatggacgat 660ttcctctatc tttacgatct aggaaggaag ttcgaaggtg aaggtgacga
cactatgttc 720accactgata atgagaaggt tagcctcttc aatttcagaa agaatgctga
cccacagatg 780gttagagagg cctacgcagc aggtctcatc aagacgatct acccgagtaa
caatctccag 840gagatcaaat accttcccaa gaaggttaaa gatgcagtca aaagattcag
gactaattgc 900atcaagaaca cagagaaaga catatttctc aagatcagaa gtactattcc
agtatggacg 960attcaaggct tgcttcataa accaaggcaa gtaatagaga ttggagtctc
taaaaaggta 1020gttcctactg aatctaaggc catgcatgga gtctaagatt caaatcgagg
atctaacaga 1080actcgccgtg aagactggcg aacagttcat acagagtctt ttacgactca
atgacaagaa 1140gaaaatcttc gtcaacatgg tggagcacga cactctggtc tactccaaaa
atgtcaaaga 1200tacagtctca gaagaccaaa gggctattga gacttttcaa caaaggataa
tttcgggaaa 1260cctcctcgga ttccattgcc cagctatctg tcacttcatc gaaaggacag
tagaaaagga 1320aggtggctcc tacaaatgcc atcattgcga taaaggaaag gctatcattc
aagatctctc 1380tgccgacagt ggtcccaaag atggaccccc acccacgagg agcatcgtgg
aaaaagaaga 1440cgttccaacc acgtcttcaa agcaagtgga ttgatgtgac atctccactg
acgtaaggga 1500tgacgcacaa tcccactatc cttcgcaaga cccttcctct atataaggaa
gttcatttca 1560tttggagagg acacgctcga gtataagagc tctattttta caacaattac
caacaacaac 1620aaacaacaaa caacattaca attacattta caattaccat ggaacgagct
atacaaggaa 1680acgatgctag ggaacaagct tatggtgaac gttggaatgg aggatcagga
agttccactt 1740ctcccttcaa acttcctgac gaaagtccga gttggactga gtggcggcta
cataacgatg 1800agacgatttc gaatcaagat aatccccttg gtttcaagga aagctggggt
ttcgggaaag 1860ttgtatttaa gagatatctc agatacgacg ggacggaaac ttcactgcac
agagtccttg 1920gatcttggac gggagattcg gttaactatg cagcatctcg atttctcggt
ttcgaccaga 1980tcggatgtac ctatagtatt cggtttcgag gagttagtgt caccatttct
ggagggtcgc 2040gaactcttca gcatctcagt gaaatggcaa ttcggtctaa gcaagaactg
ctacagctta 2100ccccagtcaa agtggaaagt gatgtatcaa gaggatgccc tgaaggtgtt
gaaaccttcg 2160aagaagaaag cgagtaagga tcctctagag tcctgcttta atgagatatg
cgagacgcct 2220atgatcgcat gatatttgct ttcaattctg ttgtgcacgt tgtaaaaaac
ctgagcatgt 2280gtagctcaga tccttaccgc cggtttcggt tcattctaat gaatatatca
cccgttacta 2340tcgtattttt atgaataata ttctccgttc aatttactga ttgtacccta
ctacttatat 2400gtacaatatt aaaatgaaaa caatatattg tgctgaatag gtttatagcg
acatctatga 2460tagagcgcca caataacaaa caattgcgtt ttattattac aaatccaatt
ttaaaaaaag 2520cggcagaacc ggtcaaacct aaaagactga ttacataaat cttattcaaa
tttcaaaagt 2580gccccagggg ctagtatcta cgacacaccg agcggcgaac taataacgct
cactgaaggg 2640aactccggtt ccccgccggc gcgcatgggt gagattcctt gaagttgagt
attggccgtc 2700cgctctaccg aaagttacgg gcaccattca acccggtcca gcacggcggc
cgggtaaccg 2760acttgctgcc ccgagaatta tgcagcattt ttttggtgta tgtgggcccc
aaatgaagtg 2820caggtcaaac cttgacagtg acgacaaatc gttgggcggg tccagggcga
attttgcgac 2880aacatgtcga ggctcagcag gacctgcata agctcttctg tcagcgggcc
cactgcatcc 2940accccagtac attaaaaacg tccgcaatgt gttattaagt tgtctaagcg
tcaatttgtt 3000tacaccacaa tatatcctgc caccagccag ccaacagctc cccgaccggc
agctcggcac 3060aaaatcacca ctcgatacag gcagcccatc agtcagatca ggatctcctt
tgcgacgctc 3120accgggctgg ttgccctcgc cgctgggctg gcggccgtct atggccctgc
aaacgcgcca 3180gaaacgccgt cgaagccgtg tgcgagacac cgcggccgcc ggcgttgtgg
atacctcgcg 3240gaaaacttgg ccctcactga cagatgaggg gcggacgttg acacttgagg
ggccgactca 3300cccggcgcgg cgttgacaga tgaggggcag gctcgatttc ggccggcgac
gtggagctgg 3360ccagcctcgc aaatcggcga aaacgcctga ttttacgcga gtttcccaca
gatgatgtgg 3420acaagcctgg ggataagtgc cctgcggtat tgacacttga ggggcgcgac
tactgacaga 3480tgaggggcgc gatccttgac acttgagggg cagagtgctg acagatgagg
ggcgcaccta 3540ttgacatttg aggggctgtc cacaggcaga aaatccagca tttgcaaggg
tttccgcccg 3600tttttcggcc accgctaacc tgtcttttaa cctgctttta aaccaatatt
tataaacctt 3660gtttttaacc agggctgcgc cctgtgcgcg tgaccgcgca cgccgaaggg
gggtgccccc 3720ccttctcgaa ccctcccggc ccgctaacgc gggcctccca tccccccagg
ggctgcgccc 3780ctcggccgcg aacggcctca ccccaaaaat ggcagcgctg gccaattcgt
gcgcggaacc 3840cctatttgtt tatttttcta aatacattca aatatgtatc cgctcatgag
acaataaccc 3900tgataaatgc ttcaataata ttgaaaaagg aagagtatgg ctaaaatgag
aatatcaccg 3960gaattgaaaa aactgatcga aaaataccgc tgcgtaaaag atacggaagg
aatgtctcct 4020gctaaggtat ataagctggt gggagaaaat gaaaacctat atttaaaaat
gacggacagc 4080cggtataaag ggaccaccta tgatgtggaa cgggaaaagg acatgatgct
atggctggaa 4140ggaaagctgc ctgttccaaa ggtcctgcac tttgaacggc atgatggctg
gagcaatctg 4200ctcatgagtg aggccgatgg cgtcctttgc tcggaagagt atgaagatga
acaaagccct 4260gaaaagatta tcgagctgta tgcggagtgc atcaggctct ttcactccat
cgacatatcg 4320gattgtccct atacgaatag cttagacagc cgcttagccg aattggatta
cttactgaat 4380aacgatctgg ccgatgtgga ttgcgaaaac tgggaagaag acactccatt
taaagatccg 4440cgcgagctgt atgatttttt aaagacggaa aagcccgaag aggaacttgt
cttttcccac 4500ggcgacctgg gagacagcaa catctttgtg aaagatggca aagtaagtgg
ctttattgat 4560cttgggagaa gcggcagggc ggacaagtgg tatgacattg ccttctgcgt
ccggtcgatc 4620agggaggata tcggggaaga acagtatgtc gagctatttt ttgacttact
ggggatcaag 4680cctgattggg agaaaataaa atattatatt ttactggatg aattgtttta
gctgtcagac 4740caagtttact catatatact ttagattgat ttaaaacttc atttttaatt
taaaaggatc 4800taggtgaaga tcctttttga taatctcatg accaaaatcc cttaacgtga
gttttcgttc 4860cactgagcgt cagaccccgt agaaaagatc aaaggatctt cttgagatcc
tttttttctg 4920cgcgtaatct gctgcttgca aacaaaaaaa ccaccgctac cagcggtggt
ttgtttgccg 4980gatcaagagc taccaactct ttttccgaag gtaactggct tcagcagagc
gcagatacca 5040aatactgtcc ttctagtgta gccgtagtta ggccaccact tcaagaactc
tgtagcaccg 5100cctacatacc tcgctctgct aatcctgtta ccagtggctg ctgccagtgg
cgataagtcg 5160tgtcttaccg ggttggactc aagacgatag ttaccggata aggcgcagcg
gtcgggctga 5220acggggggtt cgtgcacaca gcccagcttg gagcgaacga cctacaccga
actgagatac 5280ctacagcgtg agctatgaga aagcgccacg cttcccgaag ggagaaaggc
ggacaggtat 5340ccggtaagcg gcagggtcgg aacaggagag cgcacgaggg agcttccagg
gggaaacgcc 5400tggtatcttt atagtcctgt cgggtttcgc cacctctgac ttgagcgtcg
atttttgtga 5460tgctcgtcag gggggcggag cctatggaaa aacgccagca acgcggcctt
tttacggttc 5520ctggcagatc ctagatgtgg cgcaacgatg ccggcgacaa gcaggagcgc
accgacttct 5580tccgcatcaa gtgttttggc tctcaggccg aggcccacgg caagtatttg
ggcaaggggt 5640cgctggtatt cgtgcagggc aagattcgga ataccaagta cgagaaggac
ggccagacgg 5700tctacgggac cgacttcatt gccgataagg tggattatct ggacaccaag
gcaccaggcg 5760ggtcaaatca ggaataaggg cacattgccc cggcgtgagt cggggcaatc
ccgcaaggag 5820ggtgaatgaa tcggacgttt gaccggaagg catacaggca agaactgatc
gacgcggggt 5880tttccgccga ggatgccgaa accatcgcaa gccgcaccgt catgcgtgcg
ccccgcgaaa 5940ccttccagtc cgtcggctcg atggtccagc aagctacggc caagatcgag
cgcgacagcg 6000tgcaactggc tccccctgcc ctgcccgcgc catcggccgc cgtggagcgt
tcgcgtcgtc 6060tcgaacagga ggcggcaggt ttggcgaagt cgatgaccat cgacacgcga
ggaactatga 6120cgaccaagaa gcgaaaaacc gccggcgagg acctggcaaa acaggtcagc
gaggccaagc 6180aggccgcgtt gctgaaacac acgaagcagc agatcaagga aatgcagctt
tccttgttcg 6240atattgcgcc gtggccggac acgatgcgag cgatgccaaa cgacacggcc
cgctctgccc 6300tgttcaccac gcgcaacaag aaaatcccgc gcgaggcgct gcaaaacaag
gtcattttcc 6360acgtcaacaa ggacgtgaag atcacctaca ccggcgtcga gctgcgggcc
gacgatgacg 6420aactggtgtg gcagcaggtg ttggagtacg cgaagcgcac ccctatcggc
gagccgatca 6480ccttcacgtt ctacgagctt tgccaggacc tgggctggtc gatcaatggc
cggtattaca 6540cgaaggccga ggaatgcctg tcgcgcctac aggcgacggc gatgggcttc
acgtccgacc 6600gcgttgggca cctggaatcg gtgtcgctgc tgcaccgctt ccgcgtcctg
gaccgtggca 6660agaaaacgtc ccgttgccag gtcctgatcg acgaggaaat cgtcgtgctg
tttgctggcg 6720accactacac gaaattcata tgggagaagt accgcaagct gtcgccgacg
gcccgacgga 6780tgttcgacta tttcagctcg caccgggagc cgtacccgct caagctggaa
accttccgcc 6840tcatgtgcgg atcggattcc acccgcgtga agaagtggcg cgagcaggtc
ggcgaagcct 6900gcgaagagtt gcgaggcagc ggcctggtgg aacacgcctg ggtcaatgat
gacctggtgc 6960attgcaaacg ctagggcctt gtggggtcag ttccggctgg gggttcagca
gccagcgcct 7020gatctgggga accctgtggt tggcacatac aaatggacga acggataaac
cttttcacgc 7080ccttttaaat atccgattat tctaataaac gctcttttct cttaggttta
cccgccaata 7140tatcctgtca aacactgata gtttaaactg aaggcgggaa acgacaatct
gatctaagct 7200aggcatggaa ttccaatccc acaaaaatct gagcttaaca gcacagttgc
tcctctcaga 7260gcagaatcgg gtattcaaca ccctcatatc aactactacg ttgtgtataa
cggtccacat 7320gccggtatat acgatgactg gggttgtaca aaggcggcaa caaacggcgt
tcccggagtt 7380gcacacaaga aatttgccac tattacagag gcaagagcag cagctgacgc
gtacacaaca 7440agtcagcaaa cagacaggtt gaacttcatc cccaaaggag aagctcaact
caagcccaag 7500agctttgcta aggccctaac aagcccacca aagcaaaaag cccactggct
cacgctagga 7560accaaaaggc ccagcagtga tccagcccca aaagagatct cctttgcccc
ggagattaca 7620atggacgatt tcctctatct ttacgatcta ggaaggaagt tcgaaggtga
aggtgacgac 7680actatgttca ccactgataa tgagaaggtt agcctcttca atttcagaaa
gaatgctgac 7740ccacagatgg ttagagaggc ctacgcagca ggtctcatca agacgatcta
cccgagtaac 7800aatctccagg agatcaaata ccttcccaag aaggttaaag atgcagtcaa
aagattcagg 7860actaattgca tcaagaacac agagaaagac atatttctca agatcagaag
tactattcca 7920gtatggacga ttcaaggctt gcttcataaa ccaaggcaag taatagagat
tggagtctct 7980aaaaaggtag ttcctactga atctaaggcc atgcatggag tctaagattc
aaatcgagga 8040tctaacagaa ctcgccgtga agactggcga acagttcata cagagtcttt
tacgactcaa 8100tgacaagaag aaaatcttcg tcaacatggt ggagcacgac actctggtct
actccaaaaa 8160tgtcaaagat acagtctcag aagaccaaag ggctattgag acttttcaac
aaaggataat 8220ttcgggaaac ctcctcggat tccattgccc agctatctgt cacttcatcg
aaaggacagt 8280agaaaaggaa ggtggctcct acaaatgcca tcattgcgat aaaggaaagg
ctatcattca 8340agatctctct gccgacagtg gtcccaaaga tggaccccca cccacgagga
gcatcgtgga 8400aaaagaagac gttccaacca cgtcttcaaa gcaagtggat tgatgtgaca
tctccactga 8460cgtaagggat gacgcacaat cccactatcc ttcgcaagac ccttcctcta
tataaggaag 8520ttcatttcat ttggagagga cacgctcgag tataagagct catttttaca
acaattacca 8580acaacaacaa acaacaaaca acattacaat tacatttaca attatcgatg
ggtcagtccc 8640ttatgttacg tcctgtagaa accccaaccc gtgaaatcaa aaaactcgac
ggcctgtggg 8700cattcagtct ggatcgcgaa aactgtggaa ttgatcagcg ttggtgggaa
agcgcgttac 8760aagaaagccg ggcaattgct gtgccaggca gttttaacga tcagttcgcc
gatgcagata 8820ttcgtaatta tgcgggcaac gtctggtatc agcgcgaagt ctttataccg
aaaggtaagt 8880agtgtttttg gataactgag tttgcctatg attttgtatt tactgagatg
tttgtcctct 8940ttgtgcaggt tgggcaggcc agcgtatcgt gctgcgtttc gatgcggtca
ctcattacgg 9000caaagtgtgg gtcaataatc aggaagtgat ggagcatcag ggcggctata
cgccatttga 9060agccgatgtc acgccgtatg ttattgccgg gaaaagtgta cgtatcaccg
tttgtgtgaa 9120caacgaactg aactggcaga ctatcccgcc gggaatggtg attaccgacg
aaaacggcaa 9180gaaaaagcag tcttacttcc atgatttctt taactatgcc ggaatccatc
gcagcgtaat 9240gctctacacc acgccgaaca cctgggtgga cgatatcacc gtggtgacgc
atgtcgcgca 9300agactgtaac cacgcgtctg ttgactggca ggtggtggcc aatggtgatg
tcagcgttga 9360actgcgtgat gcggatcaac aggtggttgc aactggacaa ggcactagcg
ggactttgca 9420agtggtgaat ccgcacctct ggcaaccggg tgaaggttat ctctatgaac
tgtgcgtcac 9480agccaaaagc cagacagagt gtgatatcta cccgcttcgc gtcggcatcc
ggtcagtggc 9540agtgaagggc caacagttcc tgattaacca caaaccgttc tactttactg
gctttggtcg 9600tcatgaagat gcggacttac gtggcaaagg attcgataac gtgctgatgg
tgcacgacca 9660cgcattaatg gactggattg gggccaactc ctaccgtacc tcgcattacc
cttacgctga 9720agagatgctc gactgggcag atgaacatgg catcgtggtg attgatgaaa
ctgctgctgt 9780cggctttaac ctctctttag gcattggttt cgaagcgggc aacaagccga
aagaactgta 9840cagcgaagag gcagtcaacg gggaaactca gcaagcgcac ttacaggcga
ttaaagagct 9900gatagcgcgt gacaaaaacc acccaagcgt ggtgatgtgg agtattgcca
acgaaccgga 9960tacccgtccg caaggtgcac gggaatattt cgcgccactg gcggaagcaa
cgcgtaaact 10020cgacccgacg cgtccgatca cctgcgtcaa tgtaatgttc tgcgacgctc
acaccgatac 10080catcagcgat ctctttgatg tgctgtgcct gaaccgttat tacggatggt
atgtccaaag 10140cggcgatttg gaaacggcag agaaggtact ggaaaaagaa cttctggcct
ggcaggagaa 10200actgcatcag ccgattatca tcaccgaata cggcgtggat acgttagccg
ggctgcactc 10260aatgtacacc gacatgtgga gtgaagagta tcagtgtgca tggctggata
tgtatcaccg 10320cgtctttgat cgcgtcagcg ccgtcgtcgg tgaacaggta tggaatttcg
ccgattttgc 10380gacctcgcaa ggcatattgc gcgttggcgg taacaagaaa gggatcttca
ctcgcgaccg 10440caaaccgaag tcggcggctt ttctgctgca aaaacgctgg actggcatga
acttcggtga 10500aaaaccgcag cagggaggca aacaatgaat caacaactct cctggcgcac
catcgtcggc 10560tacagcctcg ggaattggga tcctctagag tcaagcagat cgttcaaaca
tttggcaata 10620aagtttc
10627811DNAArtificial Sequence3'-terminus 8aagatcgaca g
11
User Contributions:
Comment about this patent or add new information about this topic: