Vincent, FR
Adrien Vincent, Cabannes FR
Patent application number | Description | Published |
---|---|---|
20100269697 | GAS FILTRATION STRUCTURE WITH ASYMMETRICAL HEXAGONAL CHANNELS - The invention relates to a gas filter structure for filtering particulate-laden gases, of the honeycomb type and comprising an assembly of longitudinal adjacent channels of mutually parallel axes separated by porous filtering walls, in which: each outlet channel has a wall common to six inlet walls, each common wall constituting a side of said outlet channel; each outlet channel consists of six sides of approximately identical width a, so as to form a channel of approximately hexagonal and regular cross section; at least two adjacent sides of each inlet channel have a different width; at least two inlet channels sharing a wall with one and the same outlet channel share between them a common wall of width b; and in which the ratio of the widths b/a is greater than 0 but less than 1. | 10-28-2010 |
20100300291 | GAS FILTRATION STRUCTURE WITH ASYMMETRICAL HEXAGONAL CHANNELS - The invention relates to a gas filter structure for filtering particulate-laden gases, of the honeycomb type and comprising an assembly of longitudinal adjacent channels of mutually parallel axes separated by porous filtering walls, in which: each outlet channel has a wall common to six inlet walls, each common wall constituting a side of said outlet channel; each outlet channel consists of six sides of approximately identical width a, so as to form a channel of approximately hexagonal and regular cross section; at least two adjacent sides of each inlet channel have a different width; at least two inlet channels sharing a wall with one and the same outlet channel share between them a common wall of width b; and in which the ratio of the widths b/a is greater than 1 but less than 13. | 12-02-2010 |
20100307117 | GAS FILTRATION STRUCTURE WITH CONCAVE OR CONVEX HEXAGONAL CHANNELS - The invention relates to a gas filter structure for filtering particulate-laden gases, of the honeycomb type and comprising an assembly of longitudinal adjacent channels of mutually parallel axes separated by porous filtering walls, in which: each outlet channel has a wall common to six inlet walls, each common wall constituting a side of said outlet channel; each outlet channel consists of six sides of approximately identical width a, so as to form a channel of approximately hexagonal and regular cross section; at least two adjacent sides of each inlet channel have a different width; at least two inlet channels sharing a wall with one and the same outlet channel share between them a common wall of width b; and in which the ratio of the widths b/a is equal to 1. | 12-09-2010 |
20110020185 | GAS FILTRATION STRUCTURE - The subject of the invention is a gas filter structure for filtering particulate-laden gases, of the honeycomb type and comprising an assembly of longitudinal adjacent channels ( | 01-27-2011 |
20110030357 | GAS FILTER STRUCTURE HAVING A VARIABLE WALL THICKNESS - The invention relates to a gas filter structure for filtering particulate-laden gases, of the honeycomb type and comprising an assembly of longitudinal adjacent channels of mutually parallel axes separated by porous filtering walls, said channels being alternately blocked off at one or the other of the ends of the structure so as to define inlet channels and outlet channels for the gas to be filtered and so as to force said gas to pass through the porous walls separating the inlet and outlet channels, said structure being characterized in that the inlet and outlet channels share between them at least one wall of constant average thickness d over the entire length of the filter structure, in that the inlet or outlet channels share between them at least one wall of constant average thickness e over the entire length of the filter structure and in that the e/d ratio is strictly greater than 1. | 02-10-2011 |
20110256379 | BODY ASSEMBLED WITH A MACROPOROUS HARDENED CEMENT - An assembled ceramic body having blocks attached to one another by means of a seal, the lateral surface of the ceramic body possibly being coated with a peripheral coating, the seal and/or the peripheral coating including a set cement having less than 10% of inorganic fibers, as a percentage by weight based on the dry mineral matter, in a section plane perpendicular to at least one of the facing faces of the blocks assembled by said seal, having macropores with an equivalent diameter in the range 200 μm to 40 mm in a quantity such that the total surface area in said section plane occupied by said macropores represents more than 15% and less than 80% of the total surface area observed. | 10-20-2011 |
20130129574 | CATALYTIC FILTER FOR FILTERING A GAS, COMPRISING A JOINT CEMENT INCORPORATING A GEOPOLYMER MATERIAL - The invention relates to a filter structure, for filtering particulate-laden gases, comprising a plurality of honeycomb filtering elements, said structure being obtained by assembling said elements, which are joined together by means of a joint cement, said joint cement being an essentially inorganic, preferably mineral, composite comprising at least: | 05-23-2013 |
Benjamin Vincent, Grenoble FR
Patent application number | Description | Published |
---|---|---|
20100035414 | METHOD FOR PREPARING A GERMANIUM LAYER FROM A SILICON-GERMANIUM-ON-ISOLATOR SUBSTRATE - A method for making a germanium-on-insulator layer from an SGOI substrate, including: a) depositing on the substrate a layer of a metallic element M capable of selectively forming a silicide, the layer being in contact with a silicon-germanium alloy layer; and b) a reaction between the alloy layer and the layer of a metallic element M, by which a stack of M silicide-germanium-insulator layers is obtained. Such a method may, for example, find application to production of electronic devices such as MOSFET transistors. | 02-11-2010 |
20100044836 | PROCESS FOR PRODUCING LOCALISED Ge0I STRUCTURES, OBTAINED BY GERMANIUM CONDENSATION - The invention relates to a process for making at least one GeOI structure by germanium condensation of a SiGe layer supported by a layer of silicon oxide. The layer of silicon oxide is doped with germanium, the concentration of germanium in the layer of silicon oxide being such that it lowers the flow temperature of the layer of silicon oxide below the oxidation temperature allowing germanium condensation of the SiGe layer. | 02-25-2010 |
20110140178 | THREE-DIMENSIONAL CMOS CIRCUIT ON TWO OFFSET SUBSTRATES AND METHOD FOR MAKING SAME - A three-dimensional CMOS circuit having at least a first N-conductivity field-effect transistor and a second P-conductivity field-effect transistor respectively formed on first and second crystalline substrates. The first field-effect transistor is oriented, in the first substrate, with a first secondary crystallographic orientation. The second field-effect transistor is oriented, in the second substrate, with a second secondary crystallographic orientation. The orientations of the first and second transistors form a different angle from the angle formed, in one of the substrates, by the first and second secondary crystallographic directions. The first and second substrates are assembled vertically. | 06-16-2011 |
Benoit Vincent, Champniers FR
Patent application number | Description | Published |
---|---|---|
20120153754 | MOTOR PROVIDED WITH A BRAKING SYSTEM - A motor having a shaft bearing a rotor, a pulley driven by the shaft, at least one caliper brake acting on a wall turning with the pulley, and at least one axial brake. | 06-21-2012 |
Bernard Vincent, Beauchamp FR
Patent application number | Description | Published |
---|---|---|
20110111163 | FLOOR MATTING - Matting material ( | 05-12-2011 |
Bernard Vincent, Gif Sur Yvette FR
Patent application number | Description | Published |
---|---|---|
20140036946 | DEVICE FOR MANAGING HEAT IN AN OPTICAL ELEMENT, AND RELATED HEAT-MANAGEMENT METHOD - A device is provided for managing heat in an optical element, including: the optical element; a material at a reference temperature; and an intermediate gas layer located directly between the reference-temperature material and the optical element, the intermediate gas layer being located on at least a portion of the thickness thereof in a temporary diffusion state defined by a thickness of the intermediate gas layer, such that the ratio of the mean free path of the gas molecules in the intermediate gas layer over said thickness is between 0.1 and 10. The thickness of the intermediate gas layer is between 10 μm and 5 mm. A corresponding heat-management method is implemented in the device for managing the temperature of an optical element. | 02-06-2014 |
Bernard Vincent, Rueil Malmaison FR
Patent application number | Description | Published |
---|---|---|
20110123758 | FLOOR MATTING/CARPETING - A mat/carpet ( | 05-26-2011 |
20110229692 | BASE FOR A FLOOR MAT | 09-22-2011 |
20130030340 | NONWOVEN FIBROUS WEBS CONTAINING CHEMICALLY ACTIVE PARTICULATES AND METHODS OF MAKING AND USING SAME - Nonwoven fibrous webs including a multiplicity of randomly oriented discrete fibers and a multiplicity of chemically active particulates secured to the web, and methods of making and using same. In some embodiments, more than 0% and less than 10% wt. of the nonwoven fibrous web is made of multi-component fibers having at least a first region exhibiting a first melting temperature and a second region exhibiting a second melting temperature greater than the first melting temperature. In other embodiments, the discrete fibers include a first population of monocomponent thermoplastic fibers having a first melting temperature, and a second population of monocomponent fibers having a second melting temperature greater than the first melting temperature. In certain embodiments, at least some of the particulates are bonded to the fibers. In other embodiments, at least some of the particulates are secured within interstices of the fibrous web, without substantial bonding to the fibers. | 01-31-2013 |
20130037481 | NONWOVEN NANOFIBER WEBS CONTAINING CHEMICALLY ACTIVE PARTICULATES AND METHODS OF MAKING AND USING SAME - Nonwoven fibrous webs including a multiplicity of discrete fibers, a population of sub-micrometer fibers having a population median diameter less than one micrometer adjoining the discrete fibers, and a multiplicity of chemically active particulates secured to the nonwoven fibrous web. In some embodiments, more than 0% and less than 10% wt. of the nonwoven fibrous web is made of discrete fibers that are thermoplastic polymeric fibers, and which optionally at least partially melt and coalesce to secure the discrete polymeric fibers to each other. In certain embodiments, at least some of the particulates are bonded to the thermoplastic polymeric fibers. In other embodiments, at least some of the particulates are secured within interstices of the fibrous web, without substantial bonding to the discrete fibers. Methods of making and using such nonwoven fibrous webs are also described. | 02-14-2013 |
20130143020 | ASSEMBLED INTERMEDIATE COMPRISING STAPLE FIBER NONWOVEN WEB AND ARTICLES - An assembled intermediate is described comprising a fluid transport element proximate an absorbent material is described. The fluid transport element comprises a thermoplastic nonwoven web comprising a plurality of bonded staple fibers having an average diameter of 20 to 500 microns and the web has a thickness of 3 to 20 mm, a density ranging from 0.01 to 0.10 g/cm | 06-06-2013 |
Bernard Vincent, Malmaison FR
Patent application number | Description | Published |
---|---|---|
20090130403 | ADHESIVE PAD COMPRISING FIBROUS LAYER OF METAL AND POLYMERIC FIBERS - The present invention provides an adhesive pad comprising a fibrous layer comprising a mixture of metal fibers and polymeric fibers, said fibrous layer having a thickness of at least 3 mm and having on at least one of its opposite major surfaces an adhesive layer, said adhesive layer being configured so as to allow electrical contact between said fibrous layer and a metal substrate when such metal substrate is adhered to said adhesive layer. The opposite major surfaces of the fibrous layer of the adhesive pad are generally planar and generally parallel to each other. In a particular embodiment, the adhesive pad is in the form of a sheet, for example rectangular, square, circular or oval or in the form of a web. | 05-21-2009 |
Cecile Vincent, Talence FR
Patent application number | Description | Published |
---|---|---|
20130209679 | METHOD FOR FORMING A METAL DEPOSIT ON THE SURFACE OF A SUBSTRATE, AND USES THEREOF - The present invention relates to a method for forming a metal deposit on the surface of a solid substrate, said method including at least: 1) a step of functionalizing the surface of the substrate by means of —O—P, —O—P—O, —O—S, or —O—S—O groupings; 2) a step of mixing the substrate with metal or metal-oxide particles sublimated at a low temperature; | 08-15-2013 |
Christophe Vincent, Cesson Sevigne Cedex FR
Patent application number | Description | Published |
---|---|---|
20120192284 | METHOD FOR ACQUISITION OF SOFTWARE APPLICATIONS - A method for acquisition of a software application stored on a software application distribution unit and intended to be supplied to a user computer unit is disclosed wherein, the user computer unit communicates an item of identification information identifying the software application to be acquired to an electronic security module connected to the user computer unit. The module generates, using a secret and identification information, an item of user information and transmits it with the identification information to the unit. The unit protects with the user information the software application identified by the identification information and the protected software application is transmitted to the user computer unit. Thus, the software application is protected with an item of information from the electronic security module of the user. The protected software application then has its protection removed on an electronic security unit equipped with an electronic security module. | 07-26-2012 |
Christophe Vincent, Chevaigne FR
Patent application number | Description | Published |
---|---|---|
20120042379 | SYSTEM AND METHOD FOR DETECTING GENUINE COPIES OF PRE-RECORDED DIGITAL MEDIA - To authenticate a digital medium for a given title, an authentication server selects a number of challenges corresponding to the title from an authentication database, clears an error counter and sends the challenges sequentially to an authentication application in a media reader in which the digital medium is inserted. Upon reception of a response, it is verified if the answer is correct. If this is the case, then the next challenge is sent; otherwise, it is first verified if a correct answer was mandatory and if so, it is deduced that the digital medium is not genuine. If an incorrect may be accepted, then the error counter is incremented and the next challenge is sent. When there are no more challenges to send, it is verified if the error counter is above an acceptable limit. If so, the digital medium is deemed as not genuine. The invention may be used to allow an owner of a digital medium to access further information or content. | 02-16-2012 |
Christophe Vincent, Chevaigni FR
Patent application number | Description | Published |
---|---|---|
20100058448 | METHODS AND A DEVICE FOR ASSOCIATING A FIRST DEVICE WITH A SECOND DEVICE - Methods for associating a first and a second device. Each device broadcasts an identity, the first device stores new identities and counts them. Upon user instruction and if there just one new identity, the first device sends a request for association to the second device that acknowledges this. The second device then sends, upon user instruction, a confirmation to the first device that verifies that the confirmation was sent by the second device and acknowledges this. The method is particularly suitable for use on devices that are unable to display identities of other devices. | 03-04-2010 |
20100058452 | METHODS AND A DEVICE FOR ASSOCIATING A FIRST DEVICE WITH A SECOND DEVICE - A method and device for device association. A user enters login and password on a first device that searches for reachable devices. The first device asks the reachable devices if they know the login, preferably by sending a salted hash of the login. The devices that know the login respond positively and the first device lists the responding devices. The first device then successively performs Secure Remote Authentication (SRP) with each device on the list until an authentication succeeds or there are no further devices on the list. The SRP authentication makes sure that the first device knows the login and that the other device knows a password verifier without transmitting any knowledge that allows recuperation of this info by an eavesdropper. The authenticated devices then establish a secure channel over which a community secret key is transferred, and the first device also calculates and stores the password verifier. | 03-04-2010 |
Claude Vincent, Loyon FR
Patent application number | Description | Published |
---|---|---|
20100160219 | Novel Polypeptides Inducing Dendritic Cell Migration, as Well as Medicines and Pharmaceutical Compositions Containing Same - The invention concerns a polypeptide corresponding to amino acids 26 to 75 of the sequence of GRA5-RH protein of SEQ ID No 1: MASVKRVWAVMIVNVLALIFVGVAGSTRDVGSGGDDSEGARGRE QQQVQQHEQNEDRSLFERGRAAVT-GHPVRTAVGLAAAWAWSLL RLLKRRRRRAIQEESKESATAEEEEVAEEE, its variants acting on dendritic cell migration, homologues acting on dendritic cell migration, and fragments thereof acting on dendritic cell migration, as well as the pharmaceutical compositions thereof comprising such polypeptides and their use for making a medicine for preventing or treating skin and mucous membrane conditions involving dendritic cells or Langerhans cells. | 06-24-2010 |
Cyrille Vincent, Yerres FR
Patent application number | Description | Published |
---|---|---|
20120037268 | DEVICE FOR THE METERED DISPENSING OF LIQUID OR VISCOUS PRODUCTS AND METHOD FOR IMPLEMENTING THIS DEVICE - The invention proposes a device for metered dispensing of at least one liquid or viscous product measured by the weight of the quantity of dispensed product, and the method of using the device. A vertically-movable motor-driven filler nozzle ( | 02-16-2012 |
Dany Vincent, Chateaurenaud FR
Patent application number | Description | Published |
---|---|---|
20090297702 | METHOD FOR RETARDING THE SETTING OF MORTAR AND CONCRETE SURFACES - An exemplary method for set retarding the surface of a mortar or concrete material, comprising applying to the surface of a mortar or concrete, or to the inner surface of a mold for forming the mortar or concrete, a hot melt coating composition which is heated to assume a flowable or sprayable form, and allowing the hot melt coating composition to cool to ambient temperature whereby the composition forms a solidified membrane, and thereafter removing the membrane. Preferably, the hot melt coating composition contains at least one agent operative to retard the setting of the mortar or concrete, and optional finely divided particulate materials, light-reflective pigments, or mixtures thereof. | 12-03-2009 |
20110135829 | ESTER-BASED CONCRETE SURFACE RETARDERS - Compositions and methods of the invention for retarding the surface of a concrete or other hydratable cementitious composition involve the use of at least one alkyl-ester-of-hydroxycarboxy compound contained in the form of particles or as a discontinuous phase distributed within a continuous non-aqueous carrier phase that is spray-applicable in liquid form. The set retarder helps to achieve lower pH and to avoid irritating fogs during spray application of the surface retarder when compared to prior art acid-containing surface retarders. | 06-09-2011 |
20130005860 | High Curing Inducing Surface Applied Setting Retarder - Exemplary methods and compositions of the invention for retarding the surface of a hydratable cementitious composition comprise the use of a non-bituminous cationic emulsion comprising at least one curing compound comprising an acrylic polymer, a paraffin, or a mixture thereof, to hinder evaporation of water; at least one set retarder; and at least one cationic surfactant. | 01-03-2013 |
20140374948 | Composition and Method for Obtaining Exposed Aggregates in Surfaces of Moulded Concrete And Other Cementitious Materials - Surface retarder coating compositions of the invention are based on the use of at least one non-Ordinary Portland Cement (non-OPC) binder and at least one OPC set retarder agent, which are provided in powder form that can be mixed with water at the construction site. The coating is applied onto the surface of a mould or formwork using roller or spray equipment, and concrete can then be cast within 30-60 minutes against the coating. The OPC set-retarding agent operates to retard setting of the concrete so that it can be de-moulded the next day and its surface can be removed using a high pressure water spray to reveal aggregate embedded beneath the removed surface. | 12-25-2014 |
David Vincent, Grenoble FR
Patent application number | Description | Published |
---|---|---|
20110277685 | COATING MATERIAL ATOMIZER - This atomizer (P) comprises: a body comprising an inner portion ( | 11-17-2011 |
Delecroix Vincent, Vernaison FR
Patent application number | Description | Published |
---|---|---|
20110154628 | CIRCULAR NEEDLING MACHINE FED WITH A FIBER SHEET BY A CONVEYOR AND A VERTICAL CHUTE - A circular needling machine for needling a textile structure formed from a helical fiber sheet, includes a needling table disposed beneath a feed table for feeding a helical fiber sheet for needling. The feed table includes a circular belt conveyor for receiving thereon a helical fiber sheet for needling, the conveyor being centered on a vertical axis and having a radial slot opening out under the circular conveyor to unwind continuously the fiber sheet received on the conveyor, the slot opening out under the conveyor towards a substantially straight chute that extends vertically between the conveyor and a support tray of the needling table centered on the vertical axis of the conveyor so as to take up the sheet unwound from the conveyor and bring it onto the needling table, the support tray having means for driving the fiber sheet in rotation about the vertical axis. | 06-30-2011 |
Denis Vincent, Nimes FR
Patent application number | Description | Published |
---|---|---|
20100297631 | Compositions and Methods For Detecting Histamine Related Disorders - The present invention generally relates to methods and compositions (e.g., assay kit) for the diagnosis of histamine related disorders. The invention also relates to a novel molecular target of histamine related disorders and the uses thereof for detecting or diagnosing such diseases, as well as to develop adapted and efficient therapeutic treatment thereof. The invention may be used in any mammalian subject, particularly human subjects. | 11-25-2010 |
Denis Vincent, Saint Martin Le Vinoux FR
Patent application number | Description | Published |
---|---|---|
20130344185 | CONFIGURATION FOR MOULDING A BLEND MADE OF METAL POWDER AROUND A CERAMIC CORE - A configuration for molding of a blend of metal powder around a core, which includes a mold delimiting a cavity, and which includes an elastically deformable portion on which the core is pressed, so as to adapt dimensions of the cavity to dimensions of the core. The elastically deformable portion includes an elastically deformable metal blade on one face of which the core is pressed directly. | 12-26-2013 |
Elodie Vincent, Antony FR
Patent application number | Description | Published |
---|---|---|
20100152797 | ACTIVE IMPLANTABLE MEDICAL DEVICE HAVING ANTITACHYCARDIA ATRIAL AND ANTIBRADYCARDIA VENTRICULAR PACING - An active implantable medical device of the cardiac prosthesis type, including antitachycardia atrial pacing and antibradycardia ventricular pacing therapies. The device includes circuits and control logic for detecting electrical atrial and ventricular spontaneous events (R), delivering low energy antitachycardia atrial pacing, and antibradycardia ventricular pacing, and able to deliver a ventricular pacing (V) in the absence of a detected spontaneous ventricular event (R) after a calculated ventricular escape interval (IE). The device includes a sensor delivering an endocardiac acceleration signal (EA) representative of the movements produced by the contractions of the ventricle. The ventricular sensing switches from detection of an electric potential of spontaneous ventricular depolarization (R), to detection of an endocardiac acceleration peak (PEA | 06-17-2010 |
20130131747 | IMPLANTABLE DEFIBRILLATOR/CARDIOVERTER MEDICAL DEVICE WITH A DYNAMICALLY ADJUSTABLE THRESHOLD FOR VENTRICULAR DETECTION - Methods, devices, and processor-readable storage media are provided for detecting spontaneous ventricular events in a heart using implantable medical devices. A method in this context includes applying a sensitivity function to collected data to detect occurrence of ventricular events. The sensitivity function is based on an adjustable detection threshold. The method further includes determining whether noise is suspected to be present in the data and, if so, increasing the threshold. The method further includes providing a stimulation pulse to the heart when a ventricular event has not occurred after a predetermined escape interval and, following the stimulation pulse, applying a capture test to detect whether an induced depolarization has occurred. If induced polarization is not detected, the threshold is reduced, while the threshold is maintained if induced polarization is detected. | 05-23-2013 |
20140172036 | ACTIVE IMPLANTABLE MEDICAL DEVICE TYPE SUCH AS A PACEMAKER WITH CAPTURE TEST BY ANALYSIS OF A VECTOGRAM - A device produces at least two distinct temporal components (V | 06-19-2014 |
20140172037 | ACTIVE IMPLANTABLE MEDICAL DEVICE TYPE SUCH AS A PACEMAKER WITH DETECTION OF ANODAL STIMULATION BY ANALYSIS OF A VECTOGRAM - A device produces at least two distinct temporal components (V | 06-19-2014 |
Eric Vincent, Brouchy FR
Patent application number | Description | Published |
---|---|---|
20130105718 | BODY FOR ACTUATED VALVE, CORRESPONDING ACTUATED VALVE AND THE MANUFACTURING PROCESS THEREOF | 05-02-2013 |
Franck Vincent, Saint Maur Des Fosses FR
Patent application number | Description | Published |
---|---|---|
20140133791 | CRANKSHAFT BEARING CAP WITH OPTIMIZED PILLARS - A crankshaft bearing cap in a shape of a half-cylinder of axis X coinciding with the axis of the crankshaft and including diametrically opposed attachment pillars, each column-shaped pillar including a substantially oval upper surface incorporating a bearing surface surrounding a borehole through which a fixing screw can pass and a bearing surface for a screw head, the surface surrounding the borehole, and each attachment pillar further including at least two lateral and vertical grooves over a portion of the height of the pillar, the grooves being situated outside a vertical bearing cylinder having a base equal to the bearing surface and outside of a volume defined by the transverse plane passing through the axes of the attachment holes and extending symmetrically in the X-direction over a length. | 05-15-2014 |
Francois Vincent, Clamart FR
Patent application number | Description | Published |
---|---|---|
20090132691 | METHOD AND SYSTEM TO MANAGE COMMUNICATIONS - A method to manage communications between a communication network using radiofrequency waves and a network such as the Internet, linked by a gateway, with control members producing; parameters related to established communications, including a user identifier and a communication identifier, or parameters related to failed connections, including a connection identifier and a user identifier, Internet access by the general public being notably allowed from the radiofrequency network in particular by a step (Etp | 05-21-2009 |
Francois Vincent, Toulouse FR
Patent application number | Description | Published |
---|---|---|
20130176162 | METHOD AND DEVICE FOR DETECTING A TARGET BY MASKED HIGH ENERGY REFLECTORS - Methods and devices for detecting, in a scene, a first type reflector is provided. The method includes identifying, using a radar in a mobile system, a zone of a distance-radial velocity space that contains a second type reflector. The second type reflector is capable of concealing the first type reflector. The method includes modeling an order two phase shift over time of theoretical first type and second type reflectors. The method includes creating a filter a distance and a radial velocity. The method includes illuminating the scene. The method includes acquiring raw radar data from the echoes reflected by the reflectors of the scene. The method includes obtaining distance profiles. The method includes applying a filter on the distance profiles. The method includes detecting the first type reflector among the second type reflector. | 07-11-2013 |
François Vincent, La Buisse FR
Patent application number | Description | Published |
---|---|---|
20100001716 | Direct Current Measuring Device With Wide Measuring Range, Electro-Technical Unit Comprising One Such Measuring Device and Switchgear Unit Having One Such Electro-Technical Unit - A direct current measuring device comprising at least one first magnetic sensor and at least one second magnetic sensor sensitive to a magnetic field generated by an electric current flowing in a conductor. The measuring device comprises a processing unit connected to the magnetic sensors and designed to generate an output signal dependent on the measurement signals supplied by the magnetic sensors. Said processing unit comprises selection means supplying the output signal dependent, for weak electric currents on the first measurement signals from at least one first magnetic sensor, and dependent, for strong electric currents, on the second measurement signals from at least one second magnetic sensor. | 01-07-2010 |
20100156441 | Capacitive divider device, voltage sensor, trip device module and electrical protection apparatus provided with such a device - A multilayer capacitive divider comprising a first and second main electrode formed on the same level to apply an input voltage, and a common electrode formed on another level to supply an attenuated voltage, said device comprising at least a first auxiliary electrode formed on yet another level, said electrodes being arranged so as to form capacitive units, said auxiliary electrode extending towards a side of said device towards which the second main electrode is arranged so as to connect said auxiliary electrode to the second main electrode by means of a linear conductor. | 06-24-2010 |
François Vincent, La Buisse FR
Patent application number | Description | Published |
---|---|---|
20100156441 | Capacitive divider device, voltage sensor, trip device module and electrical protection apparatus provided with such a device - A multilayer capacitive divider comprising a first and second main electrode formed on the same level to apply an input voltage, and a common electrode formed on another level to supply an attenuated voltage, said device comprising at least a first auxiliary electrode formed on yet another level, said electrodes being arranged so as to form capacitive units, said auxiliary electrode extending towards a side of said device towards which the second main electrode is arranged so as to connect said auxiliary electrode to the second main electrode by means of a linear conductor. | 06-24-2010 |
Grégory Vincent, Massy FR
Patent application number | Description | Published |
---|---|---|
20130228687 | SPECTRAL BAND-PASS FILTER HAVING HIGH SELECTIVITY AND CONTROLLED POLARIZATION - According to one aspect, the invention relates a spectral band-pass filter, which is optimized for the transmission of an incident wave at at least a first given central wavelength λ | 09-05-2013 |
Grégory Vincent, Paris FR
Patent application number | Description | Published |
---|---|---|
20130187049 | SPECTRAL FILTER HAVING A STRUCTURED MEMBRANE AT THE SUB-WAVELENGTH SCALE, AND METHOD FOR MANUFACTURING SUCH A FILTER - According to a first aspect, the present invention relates to a spectral filter suitable for filtering an incident wave at at least a first given central wavelength λ | 07-25-2013 |
Grégory Vincent, Massy FR
Patent application number | Description | Published |
---|---|---|
20130228687 | SPECTRAL BAND-PASS FILTER HAVING HIGH SELECTIVITY AND CONTROLLED POLARIZATION - According to one aspect, the invention relates a spectral band-pass filter, which is optimized for the transmission of an incident wave at at least a first given central wavelength λ | 09-05-2013 |
Grégory Vincent, Paris FR
Patent application number | Description | Published |
---|---|---|
20130187049 | SPECTRAL FILTER HAVING A STRUCTURED MEMBRANE AT THE SUB-WAVELENGTH SCALE, AND METHOD FOR MANUFACTURING SUCH A FILTER - According to a first aspect, the present invention relates to a spectral filter suitable for filtering an incident wave at at least a first given central wavelength λ | 07-25-2013 |
Herv Vincent, Caen FR
Patent application number | Description | Published |
---|---|---|
20100011264 | MULTI-CLOCK SYSTEM-ON-CHIP WITH UNIVERSAL CLOCK CONTROL MODULES FOR TRANSITION FAULT TEST AT SPEED MULTI-CORE - A multi-clock system-on-chip (D) comprises i) a core (CE) comprising asynchronous clock domains provided for exchanging test data therebetween, ii) a clock generator unit (CGU) arranged for delivering primary clock signals (clk | 01-14-2010 |
Hugues Vincent, Antony FR
Patent application number | Description | Published |
---|---|---|
20110302185 | DATA PUBLICATION AND SUBSCRIPTION SYSTEM - A data publication and subscription system includes one transmitter publishing data and one receiver subscribing to data, the data being described by one or more identifiers, the transmitters and receivers being interconnected via a network. The system includes an ontological knowledge base common to said transmitters and receivers, at least one data transmitter and receiver, each including a semantic module connected to said base and adapted to analyze a semantic request to find all identifiers semantically associated with this request, said transmitter publishing and said receiver subscribing to data via said identifiers found by the semantic module. The system applies notably to the connection of a plurality of different communications devices, each including data publication and subscription services. | 12-08-2011 |
20120143954 | METHOD FOR ADAPTING DATA IN A DATA TRANSMISSION SYSTEM, AND ASSOCIATED SYSTEM - A system for adapting data including at least one sender executing at least one calling application and one receiver executing at least one called application, the senders and receivers being interconnected via a communication network, said calling application generating messages addressed to said called application, said messages being structured according to a first syntax S | 06-07-2012 |
Jean-Noel Vincent, Garat FR
Patent application number | Description | Published |
---|---|---|
20110260574 | MAGNETIC CORE AND USE OF MAGNETIC CORE FOR ELECTRICAL MACHINES - A magnetic core is described comprising a stack of electrical steel sheets with a known preferential direction of permeability. In the stack the preferential direction of permeability of successive single sheets and in addition or alternatively of successive groups of sheets differs by a predetermined shift angle. Further the use of a magnetic core is described. | 10-27-2011 |
Karen Vincent, Leymen FR
Patent application number | Description | Published |
---|---|---|
20120121585 | SILENT Fc VARIANTS OF ANTI-CD40 ANTIBODIES - The present invention relates to silent Fc variants of anti-CD40 antibodies and compositions and methods of use of said antibodies for treating pathological disorders such as autoimmune and inflammatory disorders and/or for preventing or reducing the risk of graft rejection in transplantation. | 05-17-2012 |
20140341898 | SILENT Fc VARIANTS OF ANTI-CD40 ANTIBODIES - The present invention relates to silent Fc variants of anti-CD40 antibodies and compositions and methods of use of said antibodies for treating pathological disorders such as autoimmune and inflammatory disorders and/or for preventing or reducing the risk of graft rejection in transplantation. | 11-20-2014 |
Karen Jane Vincent, Leymen FR
Patent application number | Description | Published |
---|---|---|
20100322930 | FIBRONECTIN-BASED BINDING MOLECULES AND THEIR USE - The invention provides fibronectin-based binding molecules and methods for introducing donor CDRs into a fibronectin-based binding scaffold, in particular, Fn3. The fibronectin-based binding molecules of the invention may be further conjugated to another moiety, for example, Fc, anti-FcRn, HSA, anti-HSA, and PEG, for improved half life and stability, particularly in mammalian cells. The invention also provides methods for screening such molecules for binding to a target antigen as well as the manufacture and purification of a candidate binder. | 12-23-2010 |
Laurent Vincent, Bondoufle FR
Lionel Vincent, Fontaine FR
Patent application number | Description | Published |
---|---|---|
20130338951 | ELECTRONIC SYSTEM WITH EMBEDDED SENSORS, METHOD FOR ESTIMATING AN OPERATING PHYSICAL QUANTITY, AND CORRESPONDING COMPUTER PROGRAM - A system comprising: an electronic circuit exhibiting, in operation, a value | 12-19-2013 |
Loic Vincent, Vitry-Sur-Seine FR
Patent application number | Description | Published |
---|---|---|
20140024653 | COMPOSITIONS AND METHODS FOR TREATING CANCER USING PI3K INHIBITOR AND MEK INHIBITOR - Methods of treating patients with cancer are provided, wherein the methods comprise administering to the patient an effective amount of a MEK inhibitor and an effective amount of a PI3K inhibitor. Compositions in which the MEK and PI3K inhibitors are combined also are described. | 01-23-2014 |
Loic Vincent, Evry FR
Patent application number | Description | Published |
---|---|---|
20100209959 | TUMOUR-CELL-FIXING CELLS - The present invention relates to an isolated cell capable of fixing tumour cells, expressing the CD10 protein and expressing at least one MDR protein, and to the use of this cell for screening for anti-tumour compounds. | 08-19-2010 |
20140271665 | Combinations of Kinase Inhibitors for the Treatment of Cancer - The present invention provides methods of treating cancer by administering a compound of formula I, optionally as a pharmaceutically acceptable salt, solvate and/or hydrate thereof, in combination with an inhibitor that targets HER2 and/or HER3. | 09-18-2014 |
Loïc Vincent, Venissieux FR
Patent application number | Description | Published |
---|---|---|
20100039222 | KEYLESS ACCESS SYSTEM AND METHOD FOR A TRUCK AND TRUCK EQUIPPED WITH SUCH A SYSTEM - A keyless access system is provided for a truck including a tractor area and a cargo area provided with at least an access door. This system includes a main control unit located in the tractor area and adapted to interact with a customer identification device to selectively operate a control access arrangement which allows or prevents access to a driver cabin of the truck, a secondary control unit located in or near the cargo area and adapted to interact with the same customer identification device and to selectively operate an actuator which locks or unlocks the access door, and a bidirectional telecommunication arrangement between the main and secondary units. | 02-18-2010 |
Loïc Vincent, Venlssieux FR
Patent application number | Description | Published |
---|---|---|
20100007461 | METHOD FOR PASSIVE KEYLESS ENTRY OF A MOTOR VEHICLE ESPECIALLY OF AN INDUSTRIAL VEHICLE - A vehicle unlocking sequence includes passively authenticating a vehicle user, granting the authenticated vehicle user access to the vehicle and setting the vehicle main switch into an on-state. A vehicle locking sequence includes passively authenticating the vehicle user, configuring the vehicle, upon a first action from the authenticated vehicle user, into a first locking mode whereby access to the vehicle is denied to a non authenticated user, or configuring the vehicle, upon a second action from the authenticated vehicle user, into a second locking mode whereby access to the vehicle is denied to a non authenticated user and the vehicle main switch is set into an off-state. | 01-14-2010 |
Loïc Vincent, Venissieux FR
Patent application number | Description | Published |
---|---|---|
20100039222 | KEYLESS ACCESS SYSTEM AND METHOD FOR A TRUCK AND TRUCK EQUIPPED WITH SUCH A SYSTEM - A keyless access system is provided for a truck including a tractor area and a cargo area provided with at least an access door. This system includes a main control unit located in the tractor area and adapted to interact with a customer identification device to selectively operate a control access arrangement which allows or prevents access to a driver cabin of the truck, a secondary control unit located in or near the cargo area and adapted to interact with the same customer identification device and to selectively operate an actuator which locks or unlocks the access door, and a bidirectional telecommunication arrangement between the main and secondary units. | 02-18-2010 |
Marc Vincent, Arvillard FR
Patent application number | Description | Published |
---|---|---|
20120006980 | PHOTOSENSITIVE INTEGRATED CIRCUIT EQUIPPED WITH A REFLECTIVE LAYER AND CORRESPONDING METHOD OF PRODUCTION - A method for producing a photosensitive integrated circuit including producing circuit control transistors, producing, above the control transistors, and between at least one upper electrode and at least one lower electrode, at least one photodiode, by amorphous silicon layers into which photons from incident electromagnetic radiation are absorbed, producing at least one passivation layer, between the lower electrode and the control transistors, and producing, between the control transistors and the external surface of the integrated circuit, a reflective layer capable of reflecting photons not absorbed by the amorphous silicon layers. | 01-12-2012 |
Nicole Vincent, Paris FR
Patent application number | Description | Published |
---|---|---|
20120070051 | Ultrasound Browser - The invention relates to a method for processing image data, comprising the steps of: receiving a first set of ultrasound image data representing a given volume, said set being organized into first planes sharing a common segment; and, on the basis of the first data set, reconstructing a second set of image data representing at least partially the given volume, said second set being organized into second planes parallel to each other. | 03-22-2012 |
20140321750 | DYNAMIC GESTURE RECOGNITION PROCESS AND AUTHORING SYSTEM - Gesture recognition is performed by receiving a video frame from a camera, drawing a scribble pointing out one element within the video frame, tracking the scribble across subsequent frames by propagating the scribble on the remainder of the video, aggregating related scribbles determined by tracking the scribble, attaching a tag to the aggregated related scribbles to form a gesture model, and comparing a current scribble with the stored gesture model. | 10-30-2014 |
Olivier Vincent, Cornebarrieu FR
Patent application number | Description | Published |
---|---|---|
20110042513 | ENERGY-ABSORBING STRUCTURAL ELEMENT MADE OF A COMPOSITE MATERIAL AND AIRCRAFT FUSELAGE HAVING SAID ABSORBER - An aircraft fuselage has at least one reinforcement frame ( | 02-24-2011 |
Olivier Vincent, Beaugency FR
Patent application number | Description | Published |
---|---|---|
20080292761 | Steam Cooking Method and Oven with an Improved Water Supply - The inventive steam cooking method is designed to be carried out in a cooking oven ( | 11-27-2008 |
Paul Vincent, Toulouse FR
Patent application number | Description | Published |
---|---|---|
20130278474 | Directional Mobile Antenna with Polarization Switching by Displacement of Radiating Panels - An antenna with polarization switching comprises a support comprising at least two faces each supporting a plurality of waveguides fed with radiofrequency signals and pierced with apertures disposed so as to illuminate radiating elements placed some distance from the said apertures. For at least one given antenna pointing, the said support is able to toggle between at least two different configurations, the said support being configured so as to place, in the second configuration, the second face in a position identical to that taken by the first face in the first configuration, several radiating elements of the first face being, in the said position, oriented differently from radiating elements of the second face. It applies notably to the switching of antennas embedded onboard moving objects on the ground having to operate high-speed communications with a satellite, in particular a geostationary satellite. | 10-24-2013 |
Philippe Vincent, Aix En Provence FR
Patent application number | Description | Published |
---|---|---|
20090065648 | COMPENSATION ACTUATOR FOR A ROTORCRAFT FLIGHT CONTROL - The invention relates to an actuator ( | 03-12-2009 |
Philippe Vincent, Nesles La Vallee FR
Patent application number | Description | Published |
---|---|---|
20090096595 | Driver Alert System for the Steering Wheel of a Motor Vehicle - A driver alert system for the steering wheel of a motor vehicle. The system comprises an electric motor, an eccentric mass connected to the electric motor, and a control circuit for providing electric supply to the electric motor in response to an alert activation signal The motor is controlled by the control circuit to an operation level of voltage during a portion of a vibration period with a non-vibration period following the vibration period, and the motor is over or under-controlled with respect to the operation range at the beginning or end of said vibration period. | 04-16-2009 |
Philippe Vincent, Epernon FR
Patent application number | Description | Published |
---|---|---|
20090189052 | Motor Support Device For Heating, Ventilation and/or Air-Conditioning System - The invention relates to a support device ( | 07-30-2009 |
20110100596 | Local Seal Casing of the "Maze" Type, for a Passenger Compartment Heating, Ventilation and/or Air Conditioning Installation | 05-05-2011 |
20140175926 | Motor Mount With Improved Decoupling For Ventilation System - The invention relates to a mount | 06-26-2014 |
20140378045 | Fastening Device for an Actuator and a Housing, in Particular for a Motor Vehicle - The invention proposes a device for attaching an actuator ( | 12-25-2014 |
Philippe Vincent, Nans Les Pins FR
Patent application number | Description | Published |
---|---|---|
20090283642 | BREAKABLE COUPLING DEVICE, AND AN ASSOCIATED TRIM ACTUATOR - A breakable coupling device for coupling together first and second main transmission shafts stationary in translation along a longitudinal axis of rotation of the device comprises a blocking device having a discontinuous first housing and a continuous second housing forming a closed loop; a compression device; at least one drive device connecting the blocking device and the compression device together in rotation about the longitudinal axis below a predetermined torque, wherein the discontinuous first housing is configured to receive the at least one drive device below the predetermined torque; and a shifting device configured to shift the at least one drive device non-reversibly from the discontinuous first housing towards the continuous second housing when the torque exerted on the at least one drive device is greater than the predetermined torque. | 11-19-2009 |
20090317252 | POWER-ASSISTED CONTROL SYSTEM FOR A ROTORCRAFT - An assisted control system for controlling the attitude of a rotorcraft comprises a flight control device; at least one control member configured to act on an aerodynamic element of the rotorcraft; a mechanical connection connecting the flight control device to the at least one control member, the mechanical connection including at least one connecting rod moveable in translation, a crank device pivotably disposed about a stationary support shaft passing through the crank device, and a motor including a drive rotor and a stator configured to facilitate a pivoting movement of the crank device about the stationary support; a motor control device configured to control a rotation of the drive rotor relative to the stator; and at least one sensor configured to measure information representative of an operation performed by the flight control device under pilot control and to deliver a signal to the motor control device. | 12-24-2009 |
Pierre Vincent, Villard De Lans FR
Patent application number | Description | Published |
---|---|---|
20090066440 | METHOD FOR AUTOMATIC IMPEDANCE MATCHING FOR A RADIOFREQUENCY CIRCUIT AND TRANSMISSION OR RECEPTION SYSTEM WITH AUTOMATIC MATCHING - The invention relates to a method for automatically matching the antenna impedance for a radiofrequency transmission circuit having an amplifier. An impedance matching network is inserted between the amplifier and the antenna. The output current i and voltage V from the amplifier and their phase shift are measured, and from this the complex impedance, defined by V/i, is deduced. The antenna impedance is calculated as a function of this complex impedance and as a function of the known present values of the adjustable impedances of the matching network. New values are calculated, from the calculated value of the antenna impedance, for the adjustable impedances of the matching network that allow an overall load impedance of the amplifier to be obtained which is as close as possible to the nominal load impedance Z | 03-12-2009 |
20110018649 | ELECTRICAL RESONATOR DEVICE WITH A WIDE FREQUENCY VARIATION RANGE - An electrical resonator device, capable of operating at variable frequency ω, including: an acoustic wave resonator, a first electrical circuit coupled in parallel to the resonator with an adjustable complex impedance whose imaginary part is equal to | 01-27-2011 |
20150079912 | MILLIMETER BAND TRANSMITTING/RECEIVING SYSTEM - In the field of millimeter band transmitting/receiving systems for a high-speed contactless transmission, an architecture is provided with a common processing circuit supplying modulation signals and a plurality of transmitting/receiving integrated circuits, all identical to one another, receiving these signals, and also a common clock. The transmitting/receiving integrated circuits each comprise: an oscillator locked with the clock signal to produce a carrier frequency, a transmit channel comprising a first controllable phase shift circuit, a frequency transposition to the carrier frequency, and a power amplifier, a receive channel comprising a low noise amplifier, a frequency transposition from the carrier frequency, and a second controllable phase shift circuit. An antenna is associated with each transmitting/receiving circuit. | 03-19-2015 |
Pierre Vincent, La Rochelle FR
Patent application number | Description | Published |
---|---|---|
20130091729 | INSOLE FOR A FOOTWEAR ARTICLE - The invention relates to an insole, and to an article of footwear provided with such an insole, with application to the design of shoes wherein an improvement in comfort is sought. | 04-18-2013 |
Regis Vincent, Grigney FR
Patent application number | Description | Published |
---|---|---|
20080308007 | Method for Preparing Bitumen Base - The invention concerns a method for preparing a bitumen base, including the following essential steps: a) introducing a bitumen in a container equipped with mixing means, and bringing the bitumen to a temperature of 120° C. to 300° C.; b) introducing at least one chemical blowing additive into the container, and mixing, said chemical blowing additive being of general formula Ar1-R—Ar2 ( | 12-18-2008 |
Régis Vincent, Grygny FR
Patent application number | Description | Published |
---|---|---|
20130041075 | USE OF ORGANOGELATOR DERIVATIVES IN BITUMINOUS COMPOSITIONS TO IMPROVE THE RESISTANCE OF SAME TO CHEMICAL STRESS - The disclosure includes the use in a bituminous composition of an organogelator derivative which has a molar mass no higher than 2,000 g/mol and includes at least one hydrogen bonds donor D, at least one hydrogen bonds acceptor A and at least one compatibilizer agent C in the bitumen, the compatibilizer agent C including a group selected among: | 02-14-2013 |
Régis Vincent, Grigny FR
Patent application number | Description | Published |
---|---|---|
20100192804 | BITUMINOUS COMPOSITION WITH THERMOREVERSIBLE PROPERTIES - The invention relates to a bituminous composition that comprises a major portion of at least one bitumen and a minor portion of at least one chemical additive, said additive being an organogelling agent that generates a network of hydrogen bonds between the organogelling molecules constituting the same, and trapping the bitumen phase up to a maximum temperature T | 08-05-2010 |
Régis Vincent, Grygny FR
Patent application number | Description | Published |
---|---|---|
20130041075 | USE OF ORGANOGELATOR DERIVATIVES IN BITUMINOUS COMPOSITIONS TO IMPROVE THE RESISTANCE OF SAME TO CHEMICAL STRESS - The disclosure includes the use in a bituminous composition of an organogelator derivative which has a molar mass no higher than 2,000 g/mol and includes at least one hydrogen bonds donor D, at least one hydrogen bonds acceptor A and at least one compatibilizer agent C in the bitumen, the compatibilizer agent C including a group selected among: | 02-14-2013 |
Régis Vincent, Grigny FR
Patent application number | Description | Published |
---|---|---|
20090030118 | Charged Thermoplastic Resin Based Bituminous Mastic - The invention relates to charged bituminous mastics that are used in industrial applications, particularly in the manufacture of indoor or outdoor coatings used for sealing and/or damping vibrations and/or thermal insulation and/or soundproofing and/or fire protection (fire-proofing). The aim of the invention is to provide a mastic which is deformation-resistant when thermally charged and which is also static in ambient temperature conditions prevailing during laying and when ambient temperature is 40° C., which also holds well when cold, offering good dimensional stability. In order to achieve said aim, styrene-indene copolymer resin having a Tg of 40-150° C. and a penetrability at 50° C. of ≦10 is used as a structuring agent A of a bituminous mastic comprising bitumen B, a charge C and a polymer D. | 01-29-2009 |
20100192804 | BITUMINOUS COMPOSITION WITH THERMOREVERSIBLE PROPERTIES - The invention relates to a bituminous composition that comprises a major portion of at least one bitumen and a minor portion of at least one chemical additive, said additive being an organogelling agent that generates a network of hydrogen bonds between the organogelling molecules constituting the same, and trapping the bitumen phase up to a maximum temperature T | 08-05-2010 |
20130298800 | BITUMINOUS COMPOSITION WITH THERMOREVERSIBLE PROPERTIES - The invention relates to a method of making a theremorevsible bituminous composition. The method includes transferring an additive to a bitumen to form a mixture, and stirring the mixture until its appearance is homogenous. The additive can be an organogelator with general formula R″—(COOH) | 11-14-2013 |
Remi Vincent, Grenoble FR
Patent application number | Description | Published |
---|---|---|
20130071771 | PROTON-EXCHANGE MEMBRANE FUEL CELL ELECTRODE STRUCTURATION - An electrode for an electrochemical system, such as a fuel cell, is formed by an active layer including: pores; at least one catalyst; at least one ionomer; and electrically-conductive particles. The catalyst content per pore ranges between 30 and 500 mg/cm | 03-21-2013 |
20130127945 | REFRIGERATED INK JET DEVICE AND METHOD IMPLEMENTING SUCH A DEVICE - In the inkjet printing method according to the invention, ink is ejected at a temperature lower than or equal to 20° C., advantageously ranging between −20° C. and 20° C. The corresponding device comprises a temperature regulation system selected from among: a system for cooling the ink reservoir; a system for cooling the nozzles, advantageously with an in situ Peltier effect; a climatic chamber, advantageously at controlled temperature and humidity, intended to receive the printing device or the nozzles only. | 05-23-2013 |
20140065519 | METHOD FOR FABRICATING A FUEL CELL INCLUDING A MEMBRANE-ELECTRODE ASSEMBLY - A method for fabricating a fuel cell includes fixedly attaching a reinforcement to a proton-exchange membrane and to an electrode placed against a first face of the proton-exchange membrane. The reinforcement has a median aperture through which an interior portion of the electrode is exposed. Fixedly attaching the reinforcement includes superimposing an inner edge of the reinforcement over a periphery of the electrode, and causing a projecting portion of the reinforcement to project the proton-exchange membrane so as to limit gas permeation into the proton-exchange membrane, and forming filigrees by a wet process in a gas diffusion layer, thereby forming a recess therein, and placing the gas diffusion layer so that the inner edge of the reinforcement extends into the recess in the gas diffusion layer. | 03-06-2014 |
20140099565 | FUEL CELL COMPRISING A PROTON-EXCHANGE MEMBRANE, HAVING AN INCREASED SERVICE LIFE - A fuel cell having a proton-exchange membrane, an anode, and a cathode. The anode and cathode are fixed on opposing sides of the proton-exchange membrane. The anode demarcates a flow conduit between a molecular-hydrogen inlet area and a molecular-hydrogen outlet area. A quantity of catalyst at the molecular-hydrogen outlet area is smaller than a quantity of catalyst at the molecular-hydrogen inlet area. The anode also has a thickness that decreases continuously between the molecular-hydrogen inlet and outlet areas. | 04-10-2014 |
20140127605 | PEMFC ELECTRODE STRUCTURING - A method of deposition, by drop-on-demand inkjet printing, of the catalytic layer of a fuel cell comprising the deposition, on a printing surface, of an ink generating substantially circular structures comprising a bead at their periphery. | 05-08-2014 |
20140193740 | FUEL CELL COMPRISING A PROTON-EXCHANGE MEMBRANE, HAVING AN INCREASED SERVICE LIFE - A fuel cell includes a proton-exchange membrane, and a cathode and anode fixed on its opposite sides. The anode delimits a flow conduit between a molecular-oxygen inlet area and a water outlet area. The cathode includes a support for catalyst material. The support has first and second materials to which catalyst is fixed, the first material being a graphitized material. The second material has a resistance to corrosion by oxygen that is greater than that of the first material. A quantity of the second material at the inlet area is greater than a quantity of the second material at the water outlet. The cathode comprises a first layer including the first material and a second layer including the second material. A thickness of the second layer decreases between the molecular-oxygen inlet area and the water outlet area. | 07-10-2014 |
20140199608 | FUEL CELL LIMITING THE PHENOMENON OF CORROSION - A fuel cell includes three membrane-electrode assemblies. and first and second bipolar metal plates interposed between the membrane-electrode assemblies. Each of the bipolar plates comprises two metal sheets facing a respective membrane-electrode assembly and fixedly attached by welds. The two metal sheets comprise successive guiding channels for guiding gas extending in a common longitudinal direction. The guiding channels are distributed in a transversal direction The welds are made in bottoms of the guiding channel and include welds of the first bipolar plate and welds of the second bipolar plate. Some of the welds of the first bipolar plate are not superimposed on the welds of the second bipolar plate and are offset longitudinally and transversally relative to the welds of the second bipolar plate. | 07-17-2014 |
20140234748 | METALLIC BIPOLAR PLATE FOR A PROTON-EXCHANGE MEMBRANCE FUEL CELL - A metallic plate for a proton-exchange membrane fuel cell (PEMFC) having, on at least one of its surfaces, a coating including: conductive material fillers; a polymer used as a binder; and a metal cation absorbing compound. | 08-21-2014 |
20140287347 | METHOD FOR FABRICATING A MEMBRANE-ELECTRODE ASSEMBLY - A method for fabricating a membrane-electrode assembly having a proton-exchange membrane includes supplying a proton-exchange membrane, depositing cathodic electrocatalytic ink on a first face of a first gas diffusion layer, assembling the proton-exchange membrane with the first gas diffusion layer, including securing the first face of the first gas diffusion layer with a first face of the proton-exchange membrane, depositing anodic electrocatalytic ink on a second face of the proton-exchange membrane, the second face being opposite the first face, and assembling the second gas diffusion layer with the membrane, including securing a second face thereof with a first face of the second gas diffusion layer. | 09-25-2014 |
Rèmi Vincent, Connaux FR
Patent application number | Description | Published |
---|---|---|
20120174447 | PARALLAX EFFECT SECURITY ELEMENT - The present invention relates to a security article, in particular a security document, comprising a security element ( | 07-12-2012 |
20120182443 | PARALLAX EFFECT SECURITY ELEMENT - The present invention relates to a security element ( | 07-19-2012 |
20120189159 | PARALLAX EFFECT SECURITY ELEMENT - The present invention relates to a security element ( | 07-26-2012 |
Robert Vincent, Beziers FR
Patent application number | Description | Published |
---|---|---|
20120197394 | Auditory ossicle prosthesis with stabiliser element - An auditory ossicle prosthesis ( | 08-02-2012 |
Sébastien Vincent, Grenoble FR
Patent application number | Description | Published |
---|---|---|
20110207295 | METHOD OF DETACHING SEMI-CONDUCTOR LAYERS AT LOW TEMPERATURE - A method for producing a structure having an ultra thin buried oxide (UTBOX) layer by assembling a donor substrate with a receiver substrate wherein at least one of the substrates includes an insulating layer having a thickness of less than 50 nm that faces the other substrate, conducting a first heat treatment for reinforcing the assembly between the two substrates at temperature below 400° C., and conducting a second heat treatment at temperature above 900° C., wherein the exposure time between 400° C. and 900° C. between the heat treatments is less than 1 minute and advantageously less than 30 seconds. | 08-25-2011 |
Thomas Vincent, Palaiseau FR
Patent application number | Description | Published |
---|---|---|
20130099051 | TURBOSHAFT ENGINE ATTACHED TO A PYLON OF THE FUSELAGE OF AN AIRCRAFT BY A FAILSAFE SUSPENSION SYSTEM - A suspension system including a front suspension plane located at an intermediate turboshaft engine casing and connecting same to a pylon, a rear suspension plane located at an exhaust casing of the turboshaft engine and connecting same to the pylon, and a failsafe intermediate suspension plane located between the front and rear planes and including at least one connecting rod connecting the turboshaft engine having a structural outer casing to the pylon, the connecting rod mounted on the turboshaft engine with a predetermined clearance that renders the connecting rod inoperable while the suspension system of the rear plane is operating. The connecting rod is advantageously arranged between the outer casing and the pylon, and an element made of a flexible material is combined with the connecting rod to create the predetermined clearance by an elastically deformable nature thereof. | 04-25-2013 |
Thomas Alain Christian Vincent, Palaiseau FR
Patent application number | Description | Published |
---|---|---|
20090133406 | FAN NOZZLE OF ADJUSTABLE SECTION - Varying the flowsection for air leaving the fan as a function of flying conditions. According to the invention, the nozzle has a ring of deformable panels arranged close to its trailing edge, each panel having a dual-strip type structure made up of two materials presenting different coefficients of expansion, together with controlled heater means that are thermally coupled to the set of panels. | 05-28-2009 |
20110308634 | TURBOJET NACELLE HAVING A REMOVABLE AIR INTAKE STRUCTURE - A turbojet engine nacelle, including an air intake structure for directing an airflow towards a fan of the turbojet engine, a middle structure attached to the air intake structure for surrounding the fan of the turbojet engine, the air intake structure including an inner panel attached to the middle structure and defining a fixed structure with the middle structure, and an outer panel including an air intake lip at the end thereof opposite the middle structure, the outer panel being longitudinally translatably movable relative to the inner panel. The nacelle further includes at least one rod having one end attached onto a flange of the air intake lip and a mechanism rigidly connected to the middle structure for securing and locking the other end of each rod by applying a traction force thereon. | 12-22-2011 |
20120219415 | METALLIC ANNULAR CONNECTION STRUCTURE FOR AIRCRAFT TURBOMACHINE - A metallic annular connection structure between two parts for an aircraft turbomachine, with an arbitrary half-section including two primary branches and a base forming a first U opening up in the radial direction from a longitudinal axis, and two secondary branches forming a second U with one of the two primary branches opening up in the longitudinal direction. The primary and secondary branches and the base of the first U are made in a single piece. | 08-30-2012 |
20130014515 | LINK BETWEEN THE EXHAUST CASING AND A STRUCTURAL RING OF THE FAN DUCT OF A JET ENGINEAANM Bellabal; Francois RobertAACI FontainebleauAACO FRAAGP Bellabal; Francois Robert Fontainebleau FRAANM Seize; GuilhemAACI Corbeil EssonnesAACO FRAAGP Seize; Guilhem Corbeil Essonnes FRAANM Vincent; Thomas Alain ChristianAACI PalaiseauAACO FRAAGP Vincent; Thomas Alain Christian Palaiseau FR - An assembly including an outer ring of an exhaust casing, a structural ring of an external duct of a fan channel and of a two-flow jet engine that is concentric relative to the outer ring of the exhaust casing, and at least one first and second linking arm or rod forming a hyperstatic link by being attached by one end to the outer ring of the exhaust casing and, by the other end, to the structural ring. The link formed by the first linking arm or rod is configured to break when a predetermined load is exceeded, and the second linking arm or rod is configured to form a force-transmission path between the rings when the link is broken. | 01-17-2013 |
20130167553 | HYPERSTATIC TRUSS COMPRISING CONNECTING RODS - A hyperstatic truss including connecting rods, used for suspension of a first ring, forming part of an engine case, inside a second ring concentric to the first ring, the connecting rods being secured at one end to the first ring and at the other end to the second ring. The tensile stiffness of the connecting rods is greater than the compressive stiffness thereof. The truss for example can be used for suspension of a ducted-fan turbine engine with an elongate bypass duct. | 07-04-2013 |
20130327058 | DEVICE FOR SUSPENDING A TURBOJET ENGINE - A turbojet is suspended by attachments including hinged links. An attachment includes a support including three branches with passages through which a pin passes, the pin being oriented generally parallel to a direction that is tangential to a casing and being hinged to a central branch of the support by a ball joint. | 12-12-2013 |
20140130512 | TURBINE ENGINE ATTACHMENT STRUCTURE - An attachment structure for attaching a power plant including unducted propellers to a fuselage of an aircraft, the attachment structure being connected by first and second fasteners to respective front and rear spars penetrating into the fuselage and fastened to a carrier structure of the aircraft, and including a central longitudinal beam secured at its front end to a first frame, arranged in the plane of the front spar, that is secured at its rear end to a second rear frame, cantilevered out and arranged upstream from the unducted propellers, and that is secured to a third intermediate frame, arranged in the plane of the rear spar between the first and second frames. The first, second, and third frames are connected together by force-takeup beams, an assembly as constituted in this way forming a cradle for receiving the power plant via a standard attachment. | 05-15-2014 |
Thomas Alain Christian Vincent, Crosne FR
Patent application number | Description | Published |
---|---|---|
20120207594 | GAS TURBINE ENGINE AIR INTAKE IN A NACELLE - An assembly including a gas turbine engine and a nacelle in which the engine is housed, the nacelle including an air intake fairing that forms an air inlet and includes: a member for deflecting foreign objects, which together with the fairing, forms an air intake duct; and, downstream from the deflecting member, a secondary deflecting channel, and a main channel for supplying air to the engine. The air intake duct is configured to deflect at least some of the foreign objects sucked in through the air inlet towards the secondary deflecting channel. The secondary deflecting channel is shaped such that the flow velocity of the air flowing therethrough increases from upstream to downstream, the secondary channel having an outlet with an opening leading into the outer wall of the nacelle. | 08-16-2012 |
Virginie Vincent, Le Mans FR
Patent application number | Description | Published |
---|---|---|
20130299150 | Heat Exchanger For A Motor Vehicle - A heat exchanger comprises: a plurality of tubes for the circulation of a coolant which are arranged as a core bundle of tubes having a width in a longitudinal direction, a depth in a transverse direction, and a height in a vertical direction; a first header and a second header into which the tubes of the core bundle open; and a first partition arranged respectively in the first and second headers. The first partition respectively divides the first header and the second header, at least partially, into a first compartment and a second compartment which are adjacent in the transverse direction. The heat exchanger further comprises at least one second partition dividing the first compartment and the second compartment of the first header into a first chamber, a fourth chamber, and at least one return compartment which is adjacent, in the longitudinal direction, to the first and fourth chambers. | 11-14-2013 |