Schuh
Andre Schuh, Toronto CA
| Patent application number | Description | Published |
|---|---|---|
| 20110021759 | Diagnosis and Treatment of Blood Disorders - Based on the discovery of the nucleotide and amino acid differences which distinguish the Gov | 01-27-2011 |
Andrew H. Schuh, Thornhill CA
| Patent application number | Description | Published |
|---|---|---|
| 20090006586 | MODEL DRIVEN PORTLET DEVELOPMENT SYSTEM AND PROGRAM PRODUCT - Under the present invention desired portlet behaviors are embodied as portlet patterns. When a developer wishes to create a new portlet for a portal page, the developer will select a presentation template, select one or more portlet patterns and input values for the selected portlet patterns. Thereafter, the portlet will be encoded by binding the values to the selected patterns according to the presentation template. Once encoded, the portlet will be bound to a portal server catalog corresponding to the portal page. The binding to the portal server catalog allows the portlet to be visible to end users visiting the portal page. Then, if an end user selects the portlet, an instance thereof will be created by an instantiator portlet. Any underlying functions of the portlet can then be carried out by the instantiator portlet. | 01-01-2009 |
Anna Schuh, Oxford GB
| Patent application number | Description | Published |
|---|---|---|
| 20160053320 | NON-INVASIVE PRENATAL SCREENING - The present invention is concerned with prenatal screening and in particular non-invasive prenatal screening, as well as primers, primer sets and kits. In one instance, the invention provides a method of prenatal screening comprising: (a) amplifying a region encompassing the site of a mutation site responsible for the disorder, the amplification being performed on a DNA sample obtained from a pregnant female which comprises both maternal and fetal DNA; (b) sequencing a plurality of products from the amplification and determining whether or not the mutant allele is represented at a different frequency to that expected from the genotype of the pregnant female alone. | 02-25-2016 |
Bernhard Schuh, Nuernberg DE
| Patent application number | Description | Published |
|---|---|---|
| 20140144262 | ACTUATING DEVICE - An actuating device has an actuating member ( | 05-29-2014 |
| 20140291908 | ACTUATING DEVICE - An actuating device has a linearly-movable fluidly operated piston drive (1). A pivot shaft (3) is movably, rotatably mounted in a housing (2). A lever arm (4) is connected with the pivot shaft (3) in a torsionally rigid manner. An adjustment mechanism (5) connects the piston drive (1) with the pivot shaft (3). A damping device (6) dampens movement of the lever arm (4). The damping device (6) is associated with the housing (2) and with the pivot shaft (3). | 10-02-2014 |
Bernhard Schuh, Nurnberg DE
| Patent application number | Description | Published |
|---|---|---|
| 20120073392 | Actuating Device - An actuating device has a drive element with a cylinder ( | 03-29-2012 |
Birgit Schuh, Vienna AT
| Patent application number | Description | Published |
|---|---|---|
| 20140147456 | CETP FRAGMENTS - The present invention relates to a peptide consisting of 6 to 20 amino acid residues and being derived from amino acid sequence VFKGTLKYGYTTAWWLGIDQSIDFEIDSAI (SEQ ID No. 23), wherein said peptide comprises amino acid sequence WWLGID (SEQ ID No. 24) and antibodies binding to these peptides. | 05-29-2014 |
| 20150306191 | VACCINE - The present invention relates to a vaccine capable to induce the formation of antibodies directed to PCSK9 in vivo. | 10-29-2015 |
Christian Schuh, Hamburg DE
| Patent application number | Description | Published |
|---|---|---|
| 20150322296 | PRESSURE-SENSITIVE ADHESIVE COMPOUND CONTAINING A CROSS-LINKED NANOPARTICLE NETWORK, METHOD OF PRODUCTION AND USE THEREOF - Pressure-sensitive adhesive compound comprising at least two components forming one phase each, from which an IPN with at least two phases is produced by a cross-linking build-up reaction, the first phase having at least a softening point temperature of less than 23° C., and the second phase, after the build up reaction, having a softening temperature of greater than 23° C., the two phases having a morphology of a cross-linked nanoparticle network after the build-up reaction. | 11-12-2015 |
| 20150337175 | Method for Removing Permeates from Flat Structures, and Corresponding Adhesive Tape - The invention relates to an easy-to-carry-out and effective method and a suitable device for absorbing permeates from flat structures. The method according to the invention comprises the following steps: gluing an adhesive tape containing at least one getter material onto the flat structure, storing the composite so obtained and consisting of the adhesive tape and the flat structure, and removing at least part of the adhesive tape which contains a getter material from the flat structure, the adhesive tape being designed to absorb at least partially at least one permeate from the flat structure. The invention further relates to an adhesive tape comprising at least one substrate layer having a water vapor permeation rate of <1 g/(m | 11-26-2015 |
Gerd Schuh, Schwegenheim DE
| Patent application number | Description | Published |
|---|---|---|
| 20080312395 | Acrylate Polymers Based on Tert.- Butyl Acrylate Which are to be Used in Spray Formulations - The present invention relates to polymers obtainable by free-radical polymerization of | 12-18-2008 |
Henrik Schuh, Friedrichshafen DE
| Patent application number | Description | Published |
|---|---|---|
| 20090235770 | SWITCHING DEVICE FOR A GEARGOX - A shift device ( | 09-24-2009 |
| 20100078288 | TRANSMISSION SWITCHING ELEMENT - An electromagnetically actuated transmission shifting element of a motor vehicle, in particular an electromagnetically actuated transmission brake ( | 04-01-2010 |
Jean-Francois Schuh, La Ciotat FR
| Patent application number | Description | Published |
|---|---|---|
| 20110230147 | RADIOFREQUENCY COMMUNICATION DEVICE WITH AN OFFSET ANTENNA - The invention relates to a radiofrequency communication device that comprises a gripping beating body having a surface; an electronic and/or electric circuit extending in the gripping beating body; at least one antenna provided in the vicinity of the electronic circuit. The device includes a connection circuit for connection to the antenna, that is provided at least partially in the gripping beating body and extends from the electronic circuit up to connection points of the antenna, said antenna connection points being accessible from the outside of the beating body. | 09-22-2011 |
| 20140330987 | METHOD OF PROGRAMMING A USB DEVICE - The invention is a method of programming a device comprising a USB® connector and a USB® chip. The USB® connector comprises first and second sets of connection pins. The USB® chip comprises a USB® interface and a programming interface. The method comprises a step of activating a selecting pin of said first set for selecting the programming interface and a step of sending programming data to the USB® chip through said second set and through the programming interface. | 11-06-2014 |
Jorg Schuh, Emskirchen DE
| Patent application number | Description | Published |
|---|---|---|
| 20080260318 | ROLLER BEARING WITH A BRAKING DEVICE - A roller bearing ( | 10-23-2008 |
| 20100284643 | ROLLING BEARING WITH A SPLIT BEARING RING - A rolling bearing, with a bearing inner and outer ring where at least one of the bearing rings is split, in a parting plane ( | 11-11-2010 |
Lothar Schuh, Plankstadt DE
| Patent application number | Description | Published |
|---|---|---|
| 20130096975 | METHOD AND SYSTEM FOR ADAPTING A PRODUCTION FLOW SCHEDULE FOR A PRODUCTION PROCESS - A method and system are disclosed for adapting a production flow schedule for one or more production processes, each having one or more process steps that use power for the execution thereof. An exemplary method includes identifying at least one availability time window in which there is a predetermined minimum power availability within a predetermined optimization time period based on a piece of availability information which indicates a forecast power availability during the optimization time period; providing an indication of one or more flexible process steps, which can be executed in a plurality of alternative time windows within the optimization time period; and for each of the flexible process steps, temporally rearranging the corresponding flexible process step into one of the corresponding alternative time windows if the rescheduling is within the availability time window in order to obtain an adapted production flow schedule. | 04-18-2013 |
Lother Schuh, Plankstadt DE
| Patent application number | Description | Published |
|---|---|---|
| 20130304237 | REMOTE MANAGEMENT OF INDUSTRIAL PROCESSES - Systems and other embodiments for causing a service request to be produced are described. A system can comprise an analysis component that evaluates an information set to produce an evaluation result. The information set can include a first piece of information from a first information source and a second piece of information from a second information source. The system can also comprise a determination component that proactively makes a determination on if a service request should be produced, where the determination based, at least in part, on the evaluation result. The system can further comprise a production component that causes the service request to be produced in response to the determination being positive. | 11-14-2013 |
Matthias Benedikt Schuh, Obersuessbach DE
| Patent application number | Description | Published |
|---|---|---|
| 20130158351 | ENDOBRONCHIAL TUBE WITH INTEGRATED IMAGE SENSOR - An endobronchial tube comprising at least two lumens of different lengths for selectively associating with a patient about at least two locations relative to the Tracheal Carina. said tube comprising: a first lumen having an open distal end that associates proximally to the Carina within the Trachea, with a first inflatable cuff; a second lumen having an open distal end that extends distally, past the Carina and associates within one of the Left Bronchial branch and Right Bronchial branch with a second inflatable cuff; a dedicated image sensor lumen spanning the length of said first lumen, the dedicated image sensor lumen comprising an image sensor and illumination source disposed adjacent to the distal end of said first lumen, and configured to provide an image of the Tracheal bifurcation of the Tracheal Carina, the openings of the Left Bronchial branch, and the opening Right Bronchial branch; and at least one dedicated cleaning lumen disposed parallel with said dedicated image sensor lumen along the length of said endobronchial tube and wherein said cleaning lumen is configured to forms a cleaning nozzle at the distal end, wherein said cleaning nozzle is directed toward said image sensor lumen at its distal end. | 06-20-2013 |
Nadja Schuh, Eindhoven NL
| Patent application number | Description | Published |
|---|---|---|
| 20090025753 | Lithographic Apparatus And Contamination Removal Or Prevention Method - A lithographic apparatus is disclosed having an in situ ozonizer, which is used to produce ozone gas, for example, by UV irradiation of an oxygen-containing gas. The thus produced ozone is dissolved in ultra-pure water by contacting the ozone with the ultra-pure water through a permeable membrane. | 01-29-2009 |
| 20090027635 | Lithographic Apparatus and Contamination Removal or Prevention Method - An immersion lithographic apparatus is cleaned by use of a cleaning liquid consisting essentially of ultra-pure water and (a) a mixture of hydrogen peroxide and ozone, or (b) hydrogen peroxide at a concentration of up to 5%, or (c) ozone at a concentration of up to 50 ppm, or (d) oxygen at concentration of up to 10 ppm, or (e) any combination selected from (a)-(d). | 01-29-2009 |
| 20110188013 | LITHOGRAPHIC APPARATUS AND CONTAMINATION REMOVAL OR PREVENTION METHOD - An immersion lithographic apparatus is cleaned by use of a cleaning liquid consisting essentially of ultra-pure water and (a) a mixture of hydrogen peroxide and ozone, or (b) hydrogen peroxide at a concentration of up to 5%, or (c) ozone at a concentration of up to 50 ppm, or (d) oxygen at concentration of up to 10 ppm, or (e) any combination selected from (a)-(d). | 08-04-2011 |
| 20160033875 | LITHOGRAPHIC APPARATUS AND CONTAMINATION REMOVAL OR PREVENTION METHOD - An immersion lithographic apparatus is cleaned by use of a cleaning liquid consisting essentially of ultra-pure water and (a) a mixture of hydrogen peroxide and ozone, or (b) hydrogen peroxide at a concentration of up to 5%, or (c) ozone at a concentration of up to 50 ppm, or (d) oxygen at concentration of up to 10 ppm, or (e) any combination selected from (a)-(d). | 02-04-2016 |
Patrick Schuh, Elchingen DE
| Patent application number | Description | Published |
|---|---|---|
| 20120281325 | Limiting Circuit - A limiting circuit has a signal input and a signal output for limiting an output signal that is present at the signal output and that can be fed to a further circuit connected to the output of the limiting circuit. A voltage connection for feeding a bias voltage and a transistor are present, wherein the gate connection of the transistor is connected to the voltage connection by means of a first matching circuit and to the signal input by means of a second matching circuit. | 11-08-2012 |
Peter Schuh, Lohr Am Main DE
| Patent application number | Description | Published |
|---|---|---|
| 20090158869 | DEVICE FOR PROCESSING WORKPIECES - In practical application, it often happens that a large number of motion sensors and control mechanisms is required in order to carry out controlled movements, e.g., of welding tongs. The object of the present invention is to provide a solution for controlling the movement of a pair of welding tongs in the most efficient and economical manner possible with a minimum of electrical and mechanical expenditure. | 06-25-2009 |
Rainer Schuh, Wr. Neustadt AT
| Patent application number | Description | Published |
|---|---|---|
| 20140345780 | MOUNTING ELEMENT FOR FASTENING A TENSIONING FRAME PART OF A TENSIONING FRAME AND METHOD FOR FASTENING A TENSIONING FRAME PART OF A TENSIONING FRAME BY MEANS OF THE MOUNTING - Mounting element ( | 11-27-2014 |
Rainer Karl Schuh, Wiener Neustadt AT
| Patent application number | Description | Published |
|---|---|---|
| 20090013611 | Tarpaulin mounting frame - A tarpaulin mounting frame for tightening a tarpaulin includes a frame profile having at least one groove. A anchor profile having a rounded-off foot on its edge facing the tarpaulin, wherein the rounded-off foot is insertable into the groove of the frame profile and is pivotable therein. The anchor profile has at least one receptacle for a weatherstrip, wherein the anchor profile reaches a position substantially parallel to the plane of the tarpaulin by pivoting around the foot and thereby tightens the tarpaulin, wherein the anchor profile between the foot and the receptacle for the weatherstrip is in contact with the frame profile. | 01-15-2009 |
| 20110088857 | TARPAULIN MOUNTING FRAME - A tarpaulin mounting frame for tightening a tarpaulin includes a frame profile having at lease one groove. A anchor profile having a rounded-off foot on its edge facing the tarpaulin, wherein the rounded-off foot is insertable into the groove of the frame profile and is pivotable therein. The anchor profile has at least one receptacle for a weatherstrip, wherein the anchor profile reaches a position substantially parallel to the plane of the tarpaulin by pivoting around the foot and thereby tightens the tarpaulin, wherein the anchor profile between the foot and the receptacle for the weatherstrip is in contact with the frame profile. | 04-21-2011 |
Saulo Saraiva Schuh, Porto Alegre BR
| Patent application number | Description | Published |
|---|---|---|
| 20150363647 | MOBILE AUGMENTED REALITY FOR MANAGING ENCLOSED AREAS - Example embodiments relate to providing mobile augmented reality for an enclosed area. In example embodiments, controller device receives a fixed video stream from a fixed camera and a mobile video stream of a current field of view of a mobile user device. The mobile user device comprises a reality augmentation module to project information on the current field of view. Further, the controller device includes a tracking module to identify a position and orientation of a mobile user of the mobile user device based on image processing of the fixed video stream and a fuzzy map module to use a fuzzy map of the enclosed area and the position and orientation of the mobile user to identify items of interest in the current field of view of the mobile user device, where the fuzzy map is generated based on a floor plan of the enclosed area. | 12-17-2015 |
Stefan Schuh, Saarbrucken DE
| Patent application number | Description | Published |
|---|---|---|
| 20150120652 | REPLICATED DATA STORAGE SYSTEM AND METHODS - A method for storing data in a replicated data storage system according to the invention comprises the steps of: partitioning the data into data blocks; and storing multiple replicas of a data block in a machine readable medium. | 04-30-2015 |
Stefan Schuh, Saarbruecken DE
| Patent application number | Description | Published |
|---|---|---|
| 20150154116 | DATA PROCESSING IN A MULTIPLE PROCESSOR SYSTEM - A data processing system including multiple processors with a hierarchical cache structure comprising multiple levels of cache between the processors and a main memory, wherein at least one page mover is positioned closer to the main memory and is connected to the cache memories of the at least one shared cache level (L2, L3, L4), the main memory and to the multiple processors to move data between the cache memories of the at least one shared cache level, the main memory and the processors. In response to a request from one of the processors, the at least one page mover fetches data of a storage area line-wise from at least one of the following memories: the cache memories and the main memory maintaining multiple processor cache memory access coherency. | 06-04-2015 |
Tobias Schuh, Furth DE
| Patent application number | Description | Published |
|---|---|---|
| 20130346717 | Method and Industrial Automation Component for Indirect Memory Addressing - An automation component and method for indirect addressing by a program of an industrial automation component, wherein to accesses a number of cells in the memory, an associated address is ascertained at runtime of the program, such that during writing of the program, an association between a structure and the addresses is created and stored, where at the runtime, for accessing the memory, a relevant element of the structure is ascertained in a first step, the associated address is read from the stored association in a second step, and the memory is accessed via the address in a third step. | 12-26-2013 |
Walter Schuh, Burmoos AT
| Patent application number | Description | Published |
|---|---|---|
| 20140212831 | MEDICAL OR DENTAL TREATMENT DEVICE FOR DISPENSING A MEDIUM - A medical or dental treatment device for use in an oral or dental procedure, comprises a base part with a power supply unit and an electrical or electronic control device and a set of different parts for use with the base part. The set of different parts comprises at least one delivery part for a first treatment phase and comprising a sound or ultrasound source, a movable piston and a piston operating element operable to deliver a substance from the delivery part to a treatment site, and at least one active part for use in a second treatment phase to act on the treatment site. The active part comprises a sound source, an ultrasound source and/or an electromagnetic radiation source. The delivery part and the active part are selectively connectible to the base part for use in consecutive treatment phases (the first can precede or follow the second). | 07-31-2014 |
Walter Schuh, Buermoos AT
| Patent application number | Description | Published |
|---|---|---|
| 20110143305 | MEDICAL OR DENTAL TREATMENT DEVICE FOR DISPENSING A MEDIUM - A medical or dental treatment device for dispensing a medium having a base part with a power supply unit and an electrical or electronic control device and at least one delivery part that can be connected detachably to the base part via a coupling device and which has a sound source, such as an ultrasound source, and a delivery device for dispensing the medium from the delivery part. In addition, at least one active part, which can be connected detachably to the base part via the coupling device, may also be provided. | 06-16-2011 |
| 20140255871 | DYNAMOELECTRIC CONVERTER AND MEDICAL OR DENTAL DEVICE HAVING A DYNAMOELECTRIC CONVERTER - Fluid-operated dynamoelectric converters for medical or dental devices are described. The dynamoelectric converters have: a fluid line which is designed in one piece with an outer sleeve of the dynamoelectric converter and protrudes at its end which faces away from the dynamoelectric converter beyond a connecting end of the medical or dental device; a fluid-operated impeller which is designed in one piece with a rotor sleeve receiving the magnetic element; a one-piece, sleeve-shaped magnetic return element which surrounds the rotor and the electric winding of the stator and has a magnetically conductive material. | 09-11-2014 |
Wolfgang Schuh, Vohrenbach DE
| Patent application number | Description | Published |
|---|---|---|
| 20130264228 | IDENTIFICATION DEVICE AND METHOD OF MANUFACTURING A CONTINUOUS STRUCTURE - The invention relates to an identification device comprising at least one magnetically-responsive micro-wire ( | 10-10-2013 |
Wolfgang Schuh, Stadtprozelten DE
| Patent application number | Description | Published |
|---|---|---|
| 20120178282 | DATA CABLE CONNECTOR MODULE AND PROCESS FOR ITS ASSEMBLY TO CABLE - A data cable connector module with a fixation element for the positioning and fixation of the cable conductors of a multi core cable, conductor receiving units for bent IDCs, IDC receiving units for fixation of connected IDCs; a centric metallic shield star electrically conductively connected with a fixation element housing; and a contact module with a contact module metal housing, an isolation socket for the reception of bent slide circuit board contacts; at least one circuit board, a front connector face; and a fixation element connector face with at least one end isolator block guided plug-in contacts, the fixation element and the contact module being developed so that they can be brought into contact with the IDCs, causing the cable conductors of the fixation element to be electrically conductively connected with the slide contacts of the contact module; and a process for the assembly of the module to a cable. | 07-12-2012 |
| 20130203282 | DATA CABLE CONNECTOR MODULE AND PROCESS FOR ITS ASSEMBLY TO CABLE - A data cable connector module with a fixation element for positioning and fixation of cable conductors of a multi core cable, with: conductor receiving units with conductor guide and connection openings for bent IDCs, IDC receiving units for fixation of connected IDCs with contact openings; a centric metallic shield star which shields each conductor pair and is electrically conductively connected with the housing of the fixation element; and a detachably connectable, changeable contact module with a metal housing, an isolation socket for receiving bent slide contacts with connector ends for connection to a circuit board which connects the slide contacts and the module plug-in contacts, a front connector face for external connectors; and a fixation element connector face with in at least one end isolator block guided module plug-in contacts. The fixation element and the contact module are electrically conductively connectable with the IDCs. | 08-08-2013 |