Patents - stay tuned to the technology

Inventors list

Assignees list

Classification tree browser

Top 100 Inventors

Top 100 Assignees


Chen, GB

An-Jung Chen, London GB

Patent application numberDescriptionPublished
20090110694Anti-Inflammatory Proteins and Improved Vaccines - A recombinant poxvirus lacking a functional gene corresponding to BI4R in the WR strain of VACV for use as a medicament especially as a vaccine against a disease caused by a poxvirus or another pathogenic agent or for use as a medicament against a disease associated with aberrant cells. An isolated nucleotide or polypeptide encoding a poxvirus sequence corresponding to the sequence of B14 in the WR strain of VACV especially for use as a medicament against undesirable inflammation, immune activation or NF-κB activation. Related compositions and methods.04-30-2009

Bangdao Chen, Oxford GB

Patent application numberDescriptionPublished
20150326398METHOD AND DEVICE FOR COMMUNICATION SECURITY - A method of authenticating communication between a first and second device over an insecure communications network, in which the first device authenticates the second device using a communications protocol including a first communications phase through a first communications channel over the insecure communications network to establish a secure mode of communications between the first and second device, followed by a second communications phase of receiving information from the second device over a second communications channel, such as an empirical channel, and enabling a comparison between the information received from the second device with information generated by the first device thereby enabling authentication of the second device in the event of the information from both devices is consistent.11-12-2015

Beining Chen, Cranfield GB

Patent application numberDescriptionPublished
20080214405MOLECULARLY IMPRINTED POLYMER - A computer aided rational molecular design method that includes establishing a virtual library of functional monomers each having a portion that is capable of polymerizing and a functional group that is capable of interacting with a template molecule with the aid of a computer, designing a molecular model of a biological template molecule by a computer facilitated molecular mechanical method and screening said virtual library of functional monomers and selecting those monomers which have the highest binding score to the template molecule by their functional group.09-04-2008

Changlin Chen, Cleveland GB

Patent application numberDescriptionPublished
20130217081BIOCATALYTIC METHODS TO CONVERT CYCLOHEXANE OXIDATION PROCESS WASTE STREAMS TO USEFUL PRODUCTS - The invention relates to methods for enriching monomer content in a cycloalkane oxidation process mixed organic waste stream. In particular, the methods involve combining a biocatalyst with a mixed organic waste stream from a cycloalkane oxidation process, and enzymatically converting dimeric and/or oligomeric components of said waste stream into monomeric components. The methods may enrich the content of diacids, adipic acid, and/or other α,ω-difunctional C6 alkanes in the mixed organic waste stream. Additionally, the treated mixed organic waste streams may have improved burning efficiency.08-22-2013
20150337275BIOCONVERSION PROCESS FOR PRODUCING NYLON-7, NYLON-7,7 AND POLYESTERS - Embodiments of the present invention relate to methods for the biosynthesis of di- or trifunctional C7 alkanes in the presence of isolated enzymes or in the presence of a recombinant host cell expressing those enzymes. The di- or trifunctional C7 alkanes are useful as intermediates in the production of nylon-7, nylon-7,x, nylon-x,7, and polyesters.11-26-2015

Changlin Chen, Ingleby Barwick GB

Patent application numberDescriptionPublished
20130189753METHODS FOR BIOSYNTHESIZING 1,3 BUTADIENE - This document describes biochemical pathways for producing butadiene by forming two vinyl groups in a butadiene synthesis substrate. These pathways described herein rely on enzymes such as mevalonate diphosphate decarboxylase, isoprene synthase, and dehydratases for the final enzymatic step.07-25-2013
20130210090METHODS OF MAKING NYLON INTERMEDIATES FROM GLYCEROL - Embodiments of the invention relate to the enzymatic conversion of bioderived feedstocks to commercially valuable chemicals. The enzymatic conversions of the embodiments of the invention offer the potential for lower cost routes to these value-added chemicals. Some of the chemicals that are useful include nylon intermediates such as caprolactam, adipic acid, 1,6-hexamethylene diamine; butanediols such as 1,4-butanediol, 1,3-butanediol, and 2,3-butanediol; butanols such as 1-butanol, and 2-butanol; succinic acid, butadiene, isoprene, and 3-hydroxypropanoic acid.08-15-2013
20130210104METHODS OF PRODUCING FOUR CARBON MOLECULES - Disclosed are methods for producing butadiene from one or more of several diverse feedstocks including bioderived feedstocks, renewable feedstocks, petrochemical feedstocks and natural gas.08-15-2013
20130224807METHODS OF PRODUCING CARBOXYLIC ACIDS - The invention relates to methods for enriching monomer content in a cycloalkane oxidation process mixed organic waste stream. In particular, the methods involve combining a biocatalyst with a mixed organic waste stream from a cycloalkane oxidation process, and enzymatically converting dimeric and/or oligomeric components of said waste stream into monomeric components. The methods may enrich the content of diacids, adipic acid, and/or other α,ω-difunctional C6 alkanes in the mixed organic waste stream. Additionally, the treated mixed organic waste streams may have improved burning efficiency.08-29-2013
20140141482METHODS FOR BIOSYNTHESIZING 1,3 BUTADIENE - This document describes biochemical pathways for producing butadiene by forming two vinyl groups in a butadiene synthesis substrate. These pathways described herein rely on enzymes such as mevalonate diphosphate decarboxylase, isoprene synthase, and dehydratases for the final enzymatic step.05-22-2014
20140186904Methods Of Producing 7-Carbon Chemicals Via Methyl-Ester Shielded Carbon Chain Elongation - This document describes biochemical pathways for producing pimelic acid, 7-aminoheptanoic acid, 7-hydroxyheptanoic acid, heptamethylenediamine or 1,7-heptanediol by forming two terminal functional groups, comprised of carboxyl, amine or hydroxyl group, in a C7 aliphatic backbone substrate. These pathways, metabolic engineering and cultivation strategies described herein rely on enzymes or homologs accepting methyl ester shielded dicarboxylic acid substrates.07-03-2014
20140193861Methods Of Producing 7-Carbon Chemicals Via Aromatic Compounds - This document describes biochemical pathways for producing pimelic acid, 7-aminoheptanoate, 7-hydroxyheptanoate, heptamethylenediamine, or 1,7-heptanediol by forming two terminal functional groups, comprised of carboxyl, amine or hydroxyl group, in a C7 aliphatic backbone substrate produced from chorismate or benzoate. These pathways, metabolic engineering and cultivation strategies described herein rely on the anaerobic benzoyl-CoA degradation pathway enzymes.07-10-2014
20140193862Methods Of Producing 7-Carbon Chemicals Via Carbon Chain Elongation Associated With Cyclohexane Carboxylate Synthesis - This document describes biochemical pathways for producing pimelic acid, 7-aminoheptanoic acid, 7-hydroxyheptanoic acid, heptamethylenediamine or 1,7-heptanediol by forming two terminal functional groups, comprised of carboxyl, amine or hydroxyl group, in a C7 aliphatic backbone substrate. These pathways, metabolic engineering and cultivation strategies described herein rely on the carbon chain elongation enzymes or homologs thereof associated with the cyclohexane carboxylate biosynthesis from 07-10-2014
20140193863Methods Of Producing 7-Carbon Chemicals Via C1 Carbon Chain Elongation Associated With Coenzyme B Synthesis - This document describes biochemical pathways for producing pimelic acid, 7-aminoheptanoic acid, 7-hydroxyheptanoic acid, heptamethylenediamine or 1,7-heptanediol by forming one or two terminal functional groups, each comprised of carboxyl, amine or hydroxyl group, in a C7 aliphatic backbone substrate. These pathways, metabolic engineering and cultivation strategies described herein rely on the C1 elongation enzymes or homolog associated with coenzyme B biosynthesis.07-10-2014
20140193864Methods Of Producing 7-Carbon Chemicals Via Pyruvate And Succinate Semialdehyde Aldol Condensation - This document describes biochemical pathways for producing one or more of pimelic acid, 7-aminoheptanoic acid, 7-hydroxyheptanoic acid, heptamethylenediamine and 1,7-heptanediol by forming one or two terminal functional groups, comprised of carboxyl, amine or hydroxyl groups, in a C7 aliphatic backbone substrate produced from succinate semialdehyde or pyruvate. These pathways, metabolic engineering and cultivation strategies described herein rely on the aldol condensation of succinate semialdehyde and pyruvate.07-10-2014
20140193865Methods Of Producing 7-Carbon Chemicals From Long Chain Fatty Acids Via Oxidative Cleavage - This document describes biochemical pathways for producing pimelic acid, 7-aminoheptanoic acid, 7-hydroxyheptanoic acid, heptamethylenediamine or 1,7-heptanediol by forming two terminal functional groups, comprised of carboxyl, amine or hydroxyl group, in a C7 aliphatic backbone substrate. These pathways, metabolic engineering and cultivation strategies described herein rely on the fatty acid synthesis pathway and oxidative cleavage of long chain acyl-[acp] intermediates by a monooxgenase (e.g., cytochrome P450) such as that encoded by BioI from microorganisms such as 07-10-2014
20140242655Bioconversion Process for Producing Nylon-7, Nylon-7, 7 and Polyesters - Embodiments of the present invention relate to methods for the biosynthesis of di- or trifunctional C7 alkanes in the presence of isolated enzymes or in the presence of a recombinant host cell expressing those enzymes. The di- or trifunctional C7 alkanes are useful as intermediates in the production of nylon-7, nylon-7,x, nylon-x,7, and polyesters.08-28-2014

Chao Hui Chen, Crawley GB

Patent application numberDescriptionPublished
20120160188System for Heating a Primary Air Stream - A system for heating a primary air stream in a steam generating process comprising at least one primary air heat exchanger to exchange heat between the primary air stream in the primary air heat exchanger(s) and a process fluid.06-28-2012
20130233255Furnace Tube Arrangement for Steam Generator - A furnace tube arrangement for a steam generator is described. A plurality of furnace tubes disposed longitudinally form a generally planar wall structure into which burner throats are let at least two longitudinally spaced levels in familiar manner. Burner throats at the respective levels are so disposed that a vertical mid-line of each throat at a first level is laterally offset from a vertical mid line of a corresponding throat at a second level.09-12-2013
20130264827Steam Generator - A steam generator (10-10-2013
20130305972LOW-RANK COAL PROCESSING APPARATUS AND METHOD - An apparatus for the simultaneous drying and transport of low-rank coal is described. The apparatus has a first pipe having an inner wall surface surroundingly defining a first flow channel and an outer wall surface; a low-rank coal supply system to supply particulate low-rank coal to an inlet of the first flow channel; a transport gas supply to supply transport gas to an inlet of the first flow channel; a heating apparatus to apply heat to an outer wall surface of the first pipe along at least part of the length thereof for example in the form of a drying fluid supply to supply a drying fluid, configured such that a drying fluid is brought into contact with the outer wall surface of the first pipe along at least part of the length thereof. A system of design of thermal power plant incorporating such an apparatus is also described. A method for the simultaneous drying and transport of low-rank coal is also described. A system and method for supplying dried low-rank coal for combustion are also described.11-21-2013

Chao Hui Chen, Crawley, West Sussex GB

Patent application numberDescriptionPublished
20120167838Heat Recovery Module - A module for heat recovery from exhausted flue gas in a steam generator is described comprising a flue gas outlet conduit defining a flow path for flue gas from a flue gas outlet of a steam generator to a flue gas conduit junction; a first flue gas conduit defining a flow path for flue gas from the junction to a first air heater; a second flue gas conduit defining a flow path for flue gas from the junction to at least one high pressure and at least one low pressure process liquid economiser. A steam generator using the module, a method implementing the flow principles embodied in such a module, and a method of incorporation of such a module into a steam generator, especially by retrofit, are also described.07-05-2012

Chloe Chen, London GB

Patent application numberDescriptionPublished
20160117727ADAPTIVE RETARGETING - Described herein are solutions for improving ad retargeting. For example, described herein are solutions for improving ad retargeting amongst various online marketing channels, such as search engine and native advertising marketing channels. The solutions can include adaptive ad retargeting. Adaptive ad retargeting can be beneficial in that it can solve the problem of ineffectively predicting which search terms to associate with advertising, such as in a more conventional process of selecting search terms in a search engine marketing campaign. Instead, for example, these technologies can identify behavior of individuals who have already interacted with certain advertising online, so that when similar behavior occurs by those individuals or other users, ads can be retargeted to such users effectively according to the similar behavior.04-28-2016

Gaoyun Chen, London GB

Patent application numberDescriptionPublished
20140154815Luminescent Compounds, Complexes and Their Uses - A method of changing the fluorescent properties of a complex, the method comprising: providing a first complex comprising a multidentate ligand that is coordinated to a lanthanide ion, wherein the lanthanide is selected from europium and terbium and the multidentate ligand has at least one optionally substituted phthalimide group coordinated to the lanthanide ion, contacting the complex with an aqueous liquid medium under appropriate conditions, such that at least one phthalimide group is hydrolysed to a phthalamate group, to form a second complex. Complexes and compounds are also disclosed.06-05-2014

George C. Chen, Nottinghamshire GB

Patent application numberDescriptionPublished
20130141839CHARGE STORAGE DEVICE AND METHOD OF MANUFACTURING IT - The present invention provides a charge storage device, comprising a pair of electrodes, each electrode being operable to store electric charge and having a respective capacitance C06-06-2013

George Zheng Chen, Nottingham GB

Patent application numberDescriptionPublished
20100092775POLYMER-CARBON NANOTUBE COMPOSITES - This invention relates to a composite comprising carbon nanotubes coated with a polymer, wherein the polymer comprises at least one hydrophobic monomer unit. This invention also relates to a process for the production of a composite comprising a polymer and carbon nanotubes.04-15-2010

Gong Chen, Leicester GB

Patent application numberDescriptionPublished
20120181232Method of Preparation of Samples for Analysis and Cartridge Therefore - A method of preparing an aqueous sample for use in an analytical process, the sample comprising at least one water-soluble analyte derived from a foodstuff, the method comprising the steps of: (a) providing a solid-phase extraction cartridge comprising first and second sorbent materials arranged to absorb thereon different respective chemical components, the cartridge comprising a chamber containing the first and second sorbent materials and having an inlet and an outlet; (b) flowing through the inlet an aqueous sample comprising at least one water-soluble analyte derived from a foodstuff and impurities, thereby to dispose the sample within at least one of the first and second sorbent materials; (c) flowing through the inlet a washing liquid so as at least partially to separate the at least one water-soluble analyte and the impurities within the first and second sorbent materials; and (d) eluting the at least one water-soluble analyte from the outlet of the cartridge by flowing an elution liquid into the inlet.07-19-2012

Guanhua Chen, Waterlooville GB

Patent application numberDescriptionPublished
20140363081MACHINE READING OF PRINTED DATA - A method of reading data represented by characters formed of an x by y array of dots, e.g. as printed by a dot-matrix printer, is described. An image of the character(s) is captured by a digital camera device and transmitted to a computer, and by using analysis software operating in the computer to which the camera image has been sent, dot shapes are identified and their positions within the captured image detected, using the similarity of dots to idealised representations of dots using a combination of covariance, correlation or colour data. The position information about the detected dots is then processed to determine the distance between dots and to identify “clusters” of adjacent dots in groups of dots close to one another, and to enable such clusters to be mapped on to a notional x by y grid that defines the intended positions of the dots where grid elements intersect. The image is then analysed to determine, for each intersection of the grid, whether a dot is present or not, and starting at one corner of the x by y grid, a binary number is generated corresponding to the presence or absence of a dot at each intersection. This binary number is compared with the binary number in a reference table of binary numbers referenced to information corresponding to a dot-matrix printed character, and an output then produced corresponding to the character(s) identified. By using Reed Solomon mathematics, characters which have been misprinted can still be reliably identified.12-11-2014

Guan Yow Chen, Surrey GB

Patent application numberDescriptionPublished
20090061217Nanostructure production methods and apparatus - The present invention relates to a method of forming nanostructures or nanomaterials. The method comprises providing a thermal control barrier on a substrate and forming the nanostructures or nanomaterials. The method may, for example, be used to form carbon nanotubes by plasma enhanced chemical vapour deposition using a carbon containing gas plasma: The temperature of the substrate may be maintained at less than 350° C. while the carbon nanotubes are formed.03-05-2009

I-Jen Chen, Winnersh GB

Patent application numberDescriptionPublished
20140315901Arylpyrrolopyridine derived compounds as LRRK2 inhibitors - The present invention is directed to arylpyrrolopyridine derivatives of formula (A)10-23-2014
20150336942Aminopyridine derived compounds as LRRK2 inhibitors - The present invention is directed to aminopyridine derived compounds of formula (A). The compounds are considered useful for the treatment of diseases associated with LRRK2 such a Lewy body dementia, Parkinson's disease or cancer.11-26-2015
20160102089Arylpyrrolopyridine derived compounds as LRRK2 inhibitors - The present invention is directed to arylpyrrolopyridine derivatives of formula (A) (A). The compounds are considered useful for the treatment of diseases associated with LRRK2 such as Lewy body dementia, Parkinson's disease cancer.04-14-2016

Patent applications by I-Jen Chen, Winnersh GB

Jian-Rong Chen, Shinfield GB

Patent application numberDescriptionPublished
20130120570METHOD, APPARATUS AND SYSTEM FOR PRIORITISING CONTENT FOR DISTRIBUTION - A method of prioritising content for distribution from a camera to a server over an Internet Protocol (IP) network, the method comprising: storing a plurality of audio and/or video data packages to be distributed to the server over the IP network; obtaining information indicating the priority at which each audio and/or video package is to be distributed over the IP network, the priority being determined in accordance with the content of the audio and/or video package; and sending each audio and/or video data package over the IP network, the order in which each audio and/or video data package is sent being determined in accordance with the indicated priority.05-16-2013

Jian-Rong Chen, Reading GB

Patent application numberDescriptionPublished
20140016638VIDEO/AUDIO NETWORK - A packet-based data network including: an audio/video network including a packet-switched network over which data including audio and/or video data packets can be carried; at least one data source connected to the network and operable to assemble packetised data comprising audio/video data at a first resolution and at a second resolution greater than the first resolution, and to transmit data packets carrying multiple audio/video streams at the first resolution by multicast network transmission; and at least one client connected to the network, being a data handling device for handling packetised audio/video data and being arranged to join the multicast group to receive the multiple audio/video streams at the first resolution. The client is associated with a graphical user interface configured in conjunction with a processor to select an audio/video stream.01-16-2014

Jian-Rong Chen, Basingstoke GB

Patent application numberDescriptionPublished
20110055416Video/audio network - A packet-based data network including: an audio/video network comprising: 03-03-2011

Jian-Xin Chen, Lutterworth GB

Patent application numberDescriptionPublished
20100077720METHODS OF REDUCING EMISSIONS FOR A SEQUENTIAL COMBUSTION GAS TURBINE AND COMBUSTOR FOR A GAS TURBINE - In an SEV combustor and a method for reducing emissions in an SEV combustor of a sequential combustion gas turbine, an air/fuel mixture is combusted in a first burner and the hot gases are subsequently introduced into the SEV combustor (04-01-2010

Jin-Tao Chen, Sheffield GB

Patent application numberDescriptionPublished
20120313473Synchronous permanent magnet machine - A synchronous permanent magnet machine includes a permanent magnet arrangement for producing a magnetic field having a flux density distribution that is approximately sinusoidal. The permanent magnet arrangement includes a permanent magnet pole with both low and high energy-product magnets. The permanent magnet pole includes a low energy-product magnet and a high energy-product magnet which have different directions of magnetization, or a disposition of low/high energy-product magnets within the permanent magnet pole is asymmetric with respect to the central region of the permanent magnet pole.12-13-2012

Leon Chen, Bournemouth GB

Patent application numberDescriptionPublished
20130338539SOFTWARE PROGRAM FOR MONITORING A HAND TREMOR OF AN END-USER VIA A COMPUTER MOUSE INPUT DEVICE - A computer receives movement information, wherein the movement information is sent by a computer mouse input device in response to an end-user moving the computer mouse input device. The computer determines a frequency at which an end-user typically tremors based on the movement information received during a specified time interval, by utilizing a fast Fourier transform operation. The computer determines current tremor frequencies of the end-user based on additional movement information, by utilizing the fast Fourier transform operation. The computer modifies a value assigned to a warning counter in response to at least one magnitude of one of the current tremor frequencies exceeding a magnitude of the frequency at which the end-user typically tremors. The computer sends an electronic notification in response to the value assigned to the warning counter exceeding a limit of an acceptable level of hand tremor.12-19-2013
20130339908USING AN ADAPTIVE CURSOR FOR PREVENTING AND/OR REHABILITATING AN INJURY - Disclosed is software allowing a user to operate a computing device while preventing and/or rehabilitating an injury. Three-dimensional gestures of a user are translated into corresponding movement of a cursor on a display device. Different gestures can indicate the same motion of the cursor. As the user gestures to move the cursor, the software determines, based on a history of use specific to the user, whether the user can continue without feeling pain or fatigue. If it is determined that continued use will cause or is likely to cause pain or fatigue, the software can request the user to take a break, or can switch the gesture or motion required by the user to move the cursor in a similar manner.12-19-2013

Lichun Chen, Southampton GB

Patent application numberDescriptionPublished
20120256166DEPOSITION OF NANOPARTICLES - The invention relates to a process for deposition of elongated nanoparticles from a liquid carrier onto a substrate, and to electronic devices prepared by this process.10-11-2012

Linquin Chen, Bristol GB

Patent application numberDescriptionPublished
20130124456MANAGING DOCUMENT WORKFLOW - Methods and apparatus for managing document workflow, including generating a nonce for providing participant access for a particular step of the document workflow, generating a first number of nonce elements, and assigning nonce elements to a plurality of participants of a step of the document workflow preceding the particular step in a one-to-one correspondence. The nonce is determinate from a number of the nonce elements that is greater than or equal to a second number and less than or equal to the first number.05-16-2013

Min-Che Chen, Manchester GB

Patent application numberDescriptionPublished
20120276082TREATMENT OF CANCER - The present invention relates to agents for use in treating cancer. The agent to be used is an antagonist of Dsg2, wherein said antagonist modulates the function of the amino acid sequence: TQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYR (SEQ ID NO:1), or a fragment or variant thereof, of the EC2 domain of Dsg2. Also included in the invention are specific polypeptides and pharmaceutical preparations. Also included in the invention is a method of screening for antagonists of Dsg2, wherein said antagonist modulates the function of the amino acid sequence: TQDVFVGS VEELSAAHTLVMKINATDADEPNTLNSKISYR (SEQ ID NO: 1), or a fragment or variant thereof, of the EC2 domain of Dsg2.11-01-2012

Minyou Chen, Sheffield GB

Patent application numberDescriptionPublished
20090216347Neuro-Fuzzy Systems - A systematic method of generating a neuro-fuzzy structure a system comprises: recording data relating sample system outputs to sample system inputs, granulating the data to identify rules relating the inputs to the outputs, measuring information loss during the granulation process to enable identification of an optimum number of rules, and constructing the network so that it has a plurality of processing elements corresponding to the rules.08-27-2009

Nongji Chen, Surrey GB

Patent application numberDescriptionPublished
20100104048TIME DELAY MEASUREMENT - A method of processing first and second corresponding signals having a delay therebetween, at least the first signal being a binary signal having chip boundaries, comprises: introducing a plurality of different delays between the first and second signals, successive delay amounts differing from each other by less than the interval between chip boundaries, and for each introduced delay, summing samples of the second signal which are obtained at the times of, at least, chip boundaries between bits of the first signal which have the same state, to obtain a value; thereby to obtain a representation of how the value varies according to the introduced delay, which representation contains a level change associated with an introduced delay which bears a predetermined relationship to the delay between the first and second signals.04-29-2010

Pei-Sheng Chen, York GB

Patent application numberDescriptionPublished
20110315641CONTROLLER FOR AN ACOUSTIC STANDING WAVE GENERATION DEVICE IN ORDER TO PREVENT CLOGGING OF A FILTER - The invention relates to a method and apparatus to continuously monitor and control acoustic energy and vacuum pressure to maintain a net unidirectional flow of multi-phase heterogeneous fluids through a porous filter or membrane. The heterogenous fluid may come form a variety of sources including biological sources such as, blood, bone marrow aspirate (BMA), adipose tissue (lipoaspirate), urine, saliva, etc.12-29-2011

Pei-Sheng Chen, Heslington GB

Patent application numberDescriptionPublished
20150174511CONTROLLER FOR AN ACOUSTIC STANDING WAVE GENERATION DEVICE IN ORDER TO PREVENT CLOGGING OF A FILTER - The invention relates to a method and apparatus to continuously monitor and control acoustic energy and vacuum pressure to maintain a net unidirectional flow of multi-phase heterogeneous fluids through a porous filter or membrane. The heterogeneous fluid may come form a variety of sources including biological sources such as, blood, bone marrow aspirate (BMA), adipose tissue (lipoaspirate), urine, saliva, etc.06-25-2015

Rongsheng Chen, Oxford GB

Patent application numberDescriptionPublished
20130197327ANALYTE SENSOR - An analyte sensor is disclosed that comprises:08-01-2013

Shu Chen, St Andrews GB

Patent application numberDescriptionPublished
20120156088PREPARATION OF FePt AND CoPt NANOPARTICLES - The invention provides a method for the preparation of FePt or CoPt nanoparticles in ionic liquids, which in certain embodiments constitutes a direct method for the preparation of such nanoparticles having the face-centred tetragonal (fct) crystalline form. The invention also provides FePt or CoPt nanoparticles obtainable by a method of the invention.06-21-2012

Sophie Chen, London GB

Patent application numberDescriptionPublished
20100016420Composition for the Treatment of Resistant Cancers Comprising Oridonin - The present invention relates to the treatment of therapy-resistant neoplasias. The compounds and methods of the invention are particularly useful for the treatment of taxol-resistant human cancers, particularly cervical and breast cancer. Components of the compositions of the present invention show strong synergy with one another allowing them to be used in relatively low amounts for the treatment of stage IV or recurrent cancer which may have grown resistant to the traditional chemotherapeutic agents. These compositions comprise oridonin.01-21-2010

Tianbao Chen, Belfast GB

Patent application numberDescriptionPublished
20100249035PEPTIDES, COMPOSITIONS AND USES THEREOF - Described is an N-terminal hexapeptide fragment of maximakinin, QUB 698.8, which exhibits potent tissue selective actions on smooth muscle. It demonstrates a high degree of selectivity for arterial smooth muscle over small intestinal smooth muscle, causing potent relaxation of arterial smooth muscle, while causing less potent contraction of ileal smooth muscle. It may be used treatment of diseases of the cardiovascular system and in promotion of angiogenesis.09-30-2010
20120295851PEPTIDES, COMPOSITIONS AND USES THEREOF - Described is an N-terminal hexapeptide fragment of maximakinin, QUB 698.8, which exhibits potent tissue selective actions on smooth muscle. It demonstrates a high degree of selectivity for arterial smooth muscle over small intestinal smooth muscle, causing potent relaxation of arterial smooth muscle, while causing less potent contraction of ileal smooth muscle. It may be used treatment of diseases of the cardiovascular system and in promotion of angiogenesis.11-22-2012

Weiping Chen, Liverpool GB

Patent application numberDescriptionPublished
20090124812Ferrocenediphosphines - Compounds of the formula I in the form of enantiomerically pure diastereomers or a mixture of diastereomers, (I), where the radicals R05-14-2009
20090270499Process for Synthesizing Atazanavir - This invention relates to a process for synthesizing Atazanvir, including novel intermediates and novel steps to various intermediates along the synthetic pathway.10-29-2009
20100160660BIS(FERROCENYLPHOSPHINO) FERROCENE LIGANDS USED IN ASSYMETRIC HYDROGENATION REACTIONS - Abstract Compounds of the formula (I) in the form of racemates, enantiomerically pure diastereomers or a mixture of diastereomers, where the radicals R06-24-2010
20100168422METHODS AND INTERMEDIATES USEFUL IN THE SYNTHESIS OF HEXAHYDROFURO [2,3-B]FURAN-3-OL - Provided herein are compounds and methods useful for preparing hexahydrofuro[2,3-b]furan-3-ol. Hexahydrofuro[2,3-b]furan-3-ol can be efficiently synthesized in four steps from readily available starting materials.07-01-2010

Patent applications by Weiping Chen, Liverpool GB

Wei-Ping Chen, Liverpool GB

Patent application numberDescriptionPublished
20080281106Process for the Production of Asymmetric Transformation Catalysts - The present invention relates to process for the production of chiral ligands comprising providing a starting material of Formula (A): wherein X* is a chiral or achiral directing group; and (i) is an optionally substituted mono- or polycyclic aryl or cycloalkyl group; ortholithiating the substrate; converting the ortho-lithiated substrate to a phosphine group having the formula —PR11-13-2008

Xiabao Chen, Swindon GB

Patent application numberDescriptionPublished
20110286425METHOD AND APPARATUS FOR DATA TRANSFER IN A PACKET-SWITCHED NETWORK - Apparatus for and methods of enabling a gateway node of a first packet-switched data network to select a first channel for transferring a tunnelled data packet to a destination packet data protocol address of a mobile node provided service in the first network are disclosed. The gateway node is configured to select the first channel from a plurality of channels configured to transfer data packets to the destination packet data protocol address of the mobile node, and the selection is performed by matching a packet data protocol address, associated with a data packet received by the gateway node, to one or more data packet filters associated with the plurality of channels.11-24-2011
20160094685TELECOMMUNICATIONS APPARATUS AND METHOD - A telecommunications system for communicating internet packet data in accordance with a first internet protocol (IPV6) via a packet radio network operable in accordance a second internet protocol (IPV4). The system comprises a user equipment operable to request a bearer for communicating internet protocol data according to the second internet protocol (IPV4) to and from a gateway support node of the packet radio network. The gateway support node is operable to establish a tunnelling protocol bearer for communicating the internet packet data to and from the user equipment across the packet radio network. The user equipment is operable in combination with the gateway support node to form an address which is compatible with the first internet protocol (IPv6). The address includes an interface identifier having a tunnel end identifier of the tunnelling protocol bearer which ends at the gateway support node of the packet radio network. The internet packet data is communicated to and from a correspondent node via the gateway support node and the established bearer using internet protocol address which is compatible with the first internet protocol (Ipv6).03-31-2016

Xianfeng Chen, Birmingham GB

Patent application numberDescriptionPublished
20090201503Torsion Sensor - A torsion sensor using an optical waveguide in optical communication with a diffraction grating, preferably a tilted grating, and most preferably a tilted Bragg grating, which provides the optical waveguide and grating with a torsion-dependent collective optical transmission spectrum. Changes in the collective optical transmission spectrum of the waveguide and grating, induced by changes in the amount of torsion applied to the waveguide, may be detected by detecting a corresponding change in the intensity of optical radiation transmitted through the grating from a controlled optical source. The degree of change in the collective optical transmission spectrum is dependent upon the degree of torsion (twist) applied to the optical waveguide. Measuring the magnitude and/or sense (i.e. increase/decrease) in the intensity of optical radiation transmitted through the grating from an optical source enables torsion to be sensed.08-13-2009

Xiaodong Chen, London GB

Patent application numberDescriptionPublished
20100054225CHAOTIC SPREADING CODES AND THEIR GENERATION - Generation of a set of spreading codes starts with determining first and second chaotic pseudo-random noise codes having delta-peak-like autocorrelation functions and a low cross-correlation function. Further codes are obtained by the steps: (a) generating a further pseudo-random noise code by computing D03-04-2010

Xiao-He Chen, Oxford GB

Patent application numberDescriptionPublished
20100286262PTGS2 HAPLOTYPES - It has been demonstrated that a group of single nucleotide polymorphisms can be used to determine the presence or absence of certain extended PTGS2 haplotypes in the genome of a subject or individual, in order to determine the susceptibility to disease of the subject, the disease prognosis of the subject, or predict the response to therapy of the subject, thereby allowing personalised therapy of said subject.11-11-2010

Xiaohui Chen, Manchester GB

Patent application numberDescriptionPublished
20160137547LEUCITE GLASS CERAMICS - A leucite glass-ceramic is prepared from a glass comprising: about 66.8 to about 71.9 mol % of SiO05-19-2016

Xiaohui Chen, Whitechapel GB

Patent application numberDescriptionPublished
20100119431Strong Glass-Ceramic - The present invention relates generally dental ceramics. In particular, invention relates to a high strength, high reliability, dental glass-ceramic that contains uniform, ellipsoidal reinforcing leucite crystals.05-13-2010

Xiaojing Chen, London GB

Patent application numberDescriptionPublished
20160051457CHLORINE-CONTAINING SILICATE GLASSES AND GLASS CERAMICS - A chlorine-containing silicate glass comprising SiO02-25-2016

Xinuo Chen, Coventry GB

Patent application numberDescriptionPublished
20100011309DATA VISUALISATION SYSTEMS - A method in a computer of building a visual representation model for presenting plural forms of data from a data source to a user, comprising the steps of creating a first file of data (model file) representative of one or more physical attributes of one or more elements associated with one of a plurality of nodes in the visual representation, creating a second file of data (configuration file) representative of visual attributes of the one or more elements for each of the plurality of nodes in the visual representation and associating a variation in the visual appearance of the nodes in correlation with variation in the data from the data source which is associated with the nodes.01-14-2010

Yangjian Chen, Kent GB

Patent application numberDescriptionPublished
20160112958TRANSMIT POWER CONTROL METHOD AND SYSTEM IN MOBILE COMMUNICATIONS DEVICE - A method of transmit power control in a mobile telecommunications device is provided. One of a plurality of signal paths providing different output power and different gains is assigned in a first gain adjustment and a first power measurement in a current time slot. The same one of the signal paths is assigned in at least a second gain adjustment and a second power measurement in the same current time slot.04-21-2016
20160118180TRANSFORMER WITH TWO TRANSFORMATION RATIO - A transformer includes a first winding conductor and a second winding conductor, magnetically coupled to the first winding conductor. A first transformation ratio is achieved between the second winding conductor and the first winding conductor. A first distance between the first winding conductor and the second winding conductor is higher than a distance threshold, and accordingly, a first coupling factor between the first winding conductor and the second winding conductor is lower than a coupling factor threshold.04-28-2016

Yangsheng Chen, West Midlands GB

Patent application numberDescriptionPublished
20080265808Motor Drive Voltage-Boost Control - A drive system for a motor having a rotor and a phase winding (a, b, c) comprises; a drive circuit including switch means associated with the winding a, b, c for varying the current passing through the winding; rotor position sensing means arranged to sense the position of the rotor; control means arranged to provide drive signals to control the switch means; a power input for connection to a power supply at a nominal voltage; and boost means in electric communication with the power input and power output, and controllable to boost the nominal voltage to a higher voltage for application to the winding.10-30-2008

Yi-Chieh Chen, Glasgow GB

Patent application numberDescriptionPublished
20140320859MEASUREMENT APPARATUS AND METHOD - A measurement system (10-30-2014

Yuehua Chen, Southampton GB

Patent application numberDescriptionPublished
20080212917Fiber Optic Temperature and Pressure Sensor and System Incorporating Same - A sensing system including a sensor having an enclosure that defines a chamber, a fiber optic segment extending from outside the enclosure into the chamber, and a sequence of optical processing elements within the chamber. The elements include a fiber Bragg grating, a polarizer, a side hole fiber, and a mirror. A light source is arranged to direct light to the sensor(s). A spectral analyzer is arranged to detect light reflected back from the sensor(s). The fiber Bragg grating substantially reflects a first spectral envelope while transmitting the remainder of the optical spectrum to the polarizer and side hole fiber. The polarizer, side hole fiber, and mirror cooperate to return an optical signal within a second spectra! envelope. The characteristic wavelength of a peak in the first spectral envelope is highly sensitive to temperature and relatively weakly sensitive to pressure. The period of the optical signal within the second spectral envelope is highly sensitive to pressure and relatively weakly sensitive to temperature. The spectral analyzer measures these spectral components to simultaneously derive a measure of temperature and pressure that effectively compensates for temperature-pressure cross-sensitivity of the sensor(s).09-04-2008
20100135608FIBER OPTIC TEMPERATURE & PRESSURE SENSOR & SYSTEM INCORPORATING SAME - A sensing system including a sensor having an enclosure that defines a chamber, a fiber optic segment extending from outside the enclosure into the chamber, and a sequence of optical processing elements within the chamber. The elements include a fiber Bragg grating, a polarizer, a side hole fiber, and a mirror. A light source is arranged to direct light to the sensor(s). A spectral analyzer is arranged to detect light reflected back from the sensor(s). The fiber Bragg grating substantially reflects a first spectral envelope while transmitting the remainder of the optical spectrum to the polarizer and side hole fiber. The polarizer, side hole fiber, and mirror cooperate to return an optical signal within a second spectral envelope. The characteristic wavelength of a peak in the first spectral envelope is highly sensitive to temperature and relatively weakly sensitive to pressure. The period of the optical signal within the second spectral envelope is highly sensitive to pressure and relatively weakly sensitive to temperature. The spectral analyzer measures these spectral components to simultaneously derive a measure of temperature and pressure that effectively compensates for temperature-pressure cross-sensitivity of the sensor(s).06-03-2010
20130070235MULTIPLE SPECTRUM CHANNEL, MULTIPLE SENSOR FIBER OPTIC MONITORING SYSTEM - A multiple sensor fiber optic sensing system includes an optical fiber having at least first fiber optic sensors and second fiber optic sensors deployed along its length. In response to an interrogating pulse, the first fiber optic sensors generate responses in a first optical spectrum window, and the second fiber optic sensors generate responses in a second, different optical spectrum window. The responses in the first optical spectrum window are measured in a first optical spectrum channel, and the responses in the second optical spectrum window are measure in a second, different optical spectrum channel and provide simultaneous indications of one or more parameters, such as temperature and pressure, in the environment in which the sensors are deployed.03-21-2013

Patent applications by Yuehua Chen, Southampton GB

Yuhui Chen, St. Andrews GB

Patent application numberDescriptionPublished
20130316253METHOD FOR PRODUCING CATHODE MATERIAL FOR RECHARGEABLE LITHIUM-AIR BATTERIES, CATHODE MATERIAL FOR RECHARGEABLE LITHIUM-AIR BATTERIES AND RECHARGEABLE LITHIUM-AIR BATTERY - A method for producing a cathode material for rechargeable lithium-air batteries, which has a cathode catalyst loaded onto carbon, includes: a step of sonicating a mixed solution including a carbon having a specific surface area of 20 to 1,500 m11-28-2013
20140255802STABLE NON-AQUEOUS ELECTROLYTE PROMOTING IDEAL REACTION PROCESS IN RECHARGEABLE LITHIUM-AIR BATTERIES - The present invention relates to a lithium-air battery including: a negative electrode containing a negative-electrode active material; a positive electrode using oxygen as a positive-electrode active material; and an electrolyte medium arranged between the negative electrode and the positive electrode; wherein the electrolyte medium includes as primary solvent one or more compounds having an —N—CO— group in the molecule.09-11-2014

Zhiqian Chen, Brighton GB

Patent application numberDescriptionPublished
20100156333Motor control device and drive device for hybrid vehicle - A hybrid drive device includes a first motor; an operative mechanism that drivingly connects the first motor to an engine of a vehicle; a second motor that is drivingly connected to a drive wheel; an engine rotation speed sensor that detects a rotation speed of the engine; a magnetic pole position sensor that detects a magnetic pole position of the second motor; a current sensor that detects a current flowing to the first motor; a sensorless motor control device that estimates a magnetic pole position of the first motor based on the current detected by the current sensor, and drivingly controls the first motor; and a second motor control device that drivingly controls the second motor based on the magnetic pole position detected by the magnetic pole position sensor.06-24-2010
20150028923HIGH EFFICIENCY GATE DRIVE CIRCUIT FOR POWER TRANSISTORS - An improved gate drive circuit is provided for a power device, such as a transistor. The gate driver circuit may include: a current control circuit; a first secondary current source that is used to control the switching transient during turn off of the power transistor and a second secondary current source that is used to control the switching transient during turn on of the power transistor. In operation, the current control circuit operates, during turn on of the power transistor, to source a gate drive current to a control node of the power transistor and, during turn off of the power transistor, to sink a gate drive current from the control node of the power transistor. The first and second secondary current sources adjust the gate drive current to control the voltage or current rate of change and thereby the overshoot during the switching transient.01-29-2015

Zhizhi Chen, London GB

Patent application numberDescriptionPublished
20100113425PYRROLOBENZODIAZEPINES - Compounds of the formula I:05-06-2010
20110162227PYRROLOBENZODIAZEPINES - Methods of preparing ZC-423 (I) which result in varying enantiomeric ratios.07-07-2011
20110201803PYRROLOBENZODIAZEPINES - The invention relates to certain pyrrolobenzodiazepines (PBDs), and in particular pyrrolobenzodiazepine dimers bearing C2 substitutions, including compounds of formula (T): wherein: R08-18-2011

Patent applications by Zhizhi Chen, London GB

Website © 2016 Advameg, Inc.