39th week of 2010 patent applcation highlights part 73 |
Patent application number | Title | Published |
20100249351 | Synthetic rubber with narrow molecular weight distribution, a process for its preparation and a method of use - A novel process is used to prepare synthetic rubbers (B) which feature very narrow molecular weight distribution and a correspondingly low value for the polydispersity index. The preparation process encompasses the treatment of a synthetic rubber with ultrasound, where the resultant synthetic rubber (B) has a lower weight-average molecular weight (M | 2010-09-30 |
20100249352 | Process for the Production of Diols - The invention relates to a process for the production of diols with a special structure which are characterized by formula (I). These diols are substances which, besides two OH groups, contain a C═C double bond so that they are suitable as monomers for the production of polymers. The process comprises hydrolyzing a corresponding cyclic precursor in aqueous medium in the presence of an acid dissolved in that medium, the hydrolysis being accompanied by the elimination of a carbonyl compound, and subsequently neutralizing the acid present in the reaction mixture with a base, the base having a pK | 2010-09-30 |
20100249353 | Method of Reclaiming Carbonaceous Materials From Scrap Tires and Products Derived Therefrom - The invention relates to recycled rubber produced by a process comprising the steps of: a) shredding cleaned rubber tires into shreds less than 2″ long; b) pyrolyzing the shreds in a reaction chamber of a thermal processor in a first anaerobic environment to produce a char; c) drawing off volatile organics from the reaction chamber; c) removing the char from the reaction chamber; d) cooling the char in a second anaerobic environment; e) removing metal and textile components from the char to obtain pyrolytic carbon black; f) milling and sizing the pyrolytic carbon black so obtained into particles of 325 mesh size or smaller; and, g) utilizing the pyrolytic carbon black from the previous step in a polymerization process that produces said recycled rubber. It also relates to the high quality pyrolytic carbon black recovered from this process. | 2010-09-30 |
20100249354 | INJECTION STRETCH BLOW MOLDED ARTICLES AND SYNDIOTACTIC POLYMERS FOR USE THEREIN - Injection stretch blow molded (ISBM) articles and methods of forming the same are described herein. The ISBM articles generally include a syndiotactic propylene-based polymer. | 2010-09-30 |
20100249355 | METHODS FOR MAKING POLYOLEFINS - A method for making a polyolefin composition according to one embodiment includes altering the concentration of the chain transfer agent present in the reactor to control the HMW and LMW fractions of the polyolefin composition. | 2010-09-30 |
20100249356 | IONIC SILICONE HYDROGELS HAVING IMPROVED HYDROLYTIC STABILITY - The present invention relates to ionic silicone hydrogel polymers displaying improved thermal stability. More specifically, the present invention relates to a polymer formed from reactive components comprising at least one silicone component and at least one ionic component comprising at least one anionic group. The polymers of the present invention display good thermal stability and desirable protein uptake. | 2010-09-30 |
20100249357 | ROOM TEMPERATURE CURABLE POLYMERS AND PRECURSORS THEREOF - A polyester polyol, referred to hereinafter as a MHMS polyol comprises fatty acid based mer units wherein at least about 80 weight percent of the fatty acid based mer units are from methyl 9 (10) hydroxymethylstearate, or is prepared from an oil having fatty acids or fatty acid esters which are at least about 80 weight percent oleic acid or esters thereof and which has an average hydroxyl functionality of from 1.5 to 4. A reaction product, referred to herein after as MHMS alkoxysilane prepolymer, is produced from at least one such MHMS polyol and at least one isocyanate functional silane. The prepolymer is moisture cured to form a silylated MHMS polymer. The process of preparing a MHMS polyol comprises (A) reacting a fatty acid ester wherein at least about 80 weight percent of the fatty acid esters are methyl 9 (10) hydroxymethylstearate, or are prepared from an oil having fatty acids or fatty acid esters which are at least about 80 weight percent oleic acid or esters thereof with an initiator having at least 2 reactive groups selected from primary hydroxyl groups, amine groups, terminal isocyanate groups, terminal carbonyl groups or a combination thereof. The process of preparing at least one MHMS alkoxysilane prepolymer comprises steps of: (a) supplying at least one MHMS polyol; (b) supplying at least one isocyanate functional silane and (c) admixing the MHMS polyol and isocyanate functional silane or combination thereof, optionally in the presence of at least one catalyst to produce at least one MHMS alkoxysilane prepolymer. A process of preparing at least one silylated MHMS polymer comprises steps of: (a) supplying at least one MHMS alkoxysilane prepolymer; and (b) exposing it to moisture under conditions such that at least one silylated MHMS polymer is formed. Articles comprising the polyol, prepolymer, or polymer include elastomers, sealants, adhesives, coatings and the like. | 2010-09-30 |
20100249358 | Organosilicone Compositions and Methods for Preparing Them - Disclosed herein is a composition comprising a structure (M | 2010-09-30 |
20100249359 | WATER-STABLE CATALYSTS FOR POLYURETHANE MANUFACTURE - A method of manufacturing a polyurethane compound comprises mixing together a polyol, a polyisocyanate compound and a catalyst and allowing the mixture to cure to form a polyurethane, and is characterised in that the catalyst is a neutral complex of a metal selected from Ti, Zr, Hf, Al, Fe, Bi or Sn and a multidentate organic ligand having: a) a number of anionic donor sites=x; b) a number of neutral donor sites, capable of forming a co-ordinate bond with the metal, =y; c) where x+y=from 5 to 8; d) x is from 2 to 4; e) the ligand molecule is of a size and conformation to enable each of the anionic donor sites and neutral donor sites to form a bond with the same metal atom. | 2010-09-30 |
20100249360 | LAMINATING ADHESIVE - [Solution to Problem] The laminating adhesive of the present invention includes a polyisocyanate component (A) and a polyol component (B), wherein the polyisocyanate component (A) contains a polyisocyanate (A1) that does not contain an aromatic ring, and the polyol component (B) contains a macropolyol (B1) that does not contain an aromatic ring but contains a cyclohexane ring. | 2010-09-30 |
20100249361 | PROCESS FOR PRODUCTION OF POLYESTER COPOLYMERS AND A COMPOSITION INCORPORATING THE COPOLYMERS - There is disclosed a process for producing a polyester copolymer. The process comprises the step of condensating a hydroxyacid, a diol, a dicarboxylic acid and a functionalizing agent selected to form a prepolymer having a polyester copolymer backbone with arms comprising cross-linkable groups extending therefrom. The process also comprises the step of coupling said prepolymer in the presence of a coupling agent to cross link the arms of plural prepolymer backbones and thereby form said polyester copolymer comprising said plural straight chain polyester copolymers coupled to each other by said cross-linked arms. The polyester copolymer may be biodegradable and may be used as a modifier to increase the strength of polylactic acid. | 2010-09-30 |
20100249362 | APPARATUS AND METHOD BOTH RELATING TO POLYMER SYNTHESIS - The present invention provides a method and apparatus for producing polylactic acid by depolymerizing lactic acid oligomers and subjecting the obtained lactide to ring-opening polymerization, through which lactide can be efficiently obtained. The present invention relates to a lactide production apparatus for continuously or intermittently producing lactide, comprising: a depolymerization device | 2010-09-30 |
20100249363 | Process for Preparing Polyethylenenaphthalate with 2,6-Naphthalenedicarboxylic Acid - The present invention relates to a process for preparing polyethylene naphthalate, comprising the steps of: esterifying 2,6-naphthalene dicarboxylic acid and ethylene glycol, or glycols using the two materials as major material to obtain prepolymer which comprises bis(beta-hydroxyethyl)naphthalate or low polymer as main material; and performing polycondensation reaction to thereby prepare polyethylene naphthalate. The process of the present invention has advantages of: enabling esterification with a low molar ratio of ethylene glycol to reduce reaction time, thereby increasing process efficiency; minimizing formation of side reaction products to improve properties; and preventing deterioration of the products by performing polycondensation at a low temperature to thereby obtain polyethylene naphthalate polymers of high quality. | 2010-09-30 |
20100249364 | CLEANING DEVICE FOR SEPARATING DILACTIDE FROM MIXTURES, POLYMERISATION DEVICE, METHOD FOR SEPARATING DILACTIDE FROM MIXTURES AND USE THEREOF - The present invention relates to a device for separating a biodegradable, intermolecular cyclic diester of an alpha-hydroxycarboxylic acid from material mixtures which contain in addition the alpha-hydroxycarboxylic acid of the diester corresponding thereto. In particular, the diester is thereby dilactide and the acid lactic acid. Furthermore, the present invention relates to a method for separating dilactide from material mixtures, which is based on a modified, distillative method. In addition, the present invention describes a polymerisation device, in particular for preparing polylactide. Likewise, purposes of use of both the devices and of the method are indicated. | 2010-09-30 |
20100249365 | Polymerizable compositions - The present invention relates to a process for providing improved polymerizable compositions containing phosphoalkyl (meth)acrylate monomers which are synthesized by the reaction of a hydroxy alkyl (meth)acrylate with polyphosphoric acid (PPA). | 2010-09-30 |
20100249366 | MIXTURE OF DODECANETHIOLS, METHOD FOR THE PRODUCTION AND USE THEREOF - A radical polymerization process for the in which a tert-dodecyl mercaptan prepared by reaction of hydrogen sulfide with tri(n-butene) in the presence of a catalyst as chain-transfer agent. | 2010-09-30 |
20100249367 | BENZOTRIAZOLE CONTAINING DONOR-ACCEPTOR TYPE POLYMER AS A MULTI-PURPOSE MATERIAL - This invention is about a material which provides to observe all colors necessary for display technologies in a very small potential range. The material is a derivative of benzotriazole containing donor acceptor type conducting polymer which is soluble, fluorescent and can be used in LEDs, solar cells, electrochromic devices, smart windows and many other technologies. | 2010-09-30 |
20100249368 | Multi-Armed Forms of Activated Polyoxazoline and Methods of Synthesis Thereof - The present disclosure provides novel POZ-2 derivatives, methods for synthesizing POZ-2 derivatives and intermediates useful in such methods. In one embodiment, the POZ-2 derivative comprises two linear POZ chains of the present disclosure linked directly or indirectly to a branching moiety that contains a functional group for linking the POZ-2 derivative to the target molecule. Target molecule-POZ-2 conjugates are also described. In certain embodiment, the POZ-2 derivatives have low polydispersity values and a decreased amount of impurities produced by unwanted side reactions, such as, but not limited to, chain transfer. | 2010-09-30 |
20100249369 | Production and use of highly functional, highly branched or hyperbranched polylysines - The present invention relates to new high-functionality, highly branched or hyperbranched polylysines, to processes for preparing them, and to their use. | 2010-09-30 |
20100249370 | PROCESS FOR THE PRODUCTION OF PRAMLINTIDE - Pramlintide, a peptide having the 37 amino acid sequence KCNTATCATQRLANFLVHSSNNFGPILPPT-NVGSNTY-NH2 is prepared via a convergent three-fragment synthesis strategy from the fragments comprising the amino acid residues 1-12, 13-24 and 25-37, respectively. | 2010-09-30 |
20100249371 | PURIFICATION PROCESS FOR LIPOPEPTIDES - The present invention provides simple, cost effective, rapid, and scalable at industrial scale and provide high purity and yield of Echinocandin-type compounds at low cost as compared to prior art. Moreover the process allows for the removal of impurities by using economical salt-adsorbent complex and provide highly purified Echinocandin type compounds which is highly improved in terms of purity and sufficient for further processing to obtain an active pharmaceutical ingredient such as, the antifungals caspogungin, anidulafungin, and micafungin. | 2010-09-30 |
20100249372 | Botulinum neurotoxin a receptor and the use thereof - The present invention is based on the identification of synaptic vessel glycoprotein SV2 as the BoNT/A receptor and the further identification of various BoNT/A-binding fragments of SV2. The disclosure here provides new tools for diagnosing and treating botulism. | 2010-09-30 |
20100249373 | SCREENING METHODS - A method of identifying a compound that modulates NCKX-mediated calcium ion exchange across a cell membrane, the method comprising the steps of providing an adherent cell, the cell membrane of which comprises a NCKX polypeptide or a functionally equivalent variant thereof, exposing the cell in suspension to a fluorescent calcium-sensitive dye, thereby causing intracellular uptake of the dye, settling the cell onto a solid support without allowing the cell to adhere to the solid support, exposing the cell to a test compound, exposing the cell to calcium and potassium ions, and measuring fluorescence from the intracellular calcium-sensitive dye after exposure of the cell to the test compound and the calcium and potassium ions, thereby to determine the rate and/or amount of calcium ion exchange across the cell membrane in the presence of the test compound. | 2010-09-30 |
20100249374 | DIPHENYLMETHANE COMPOUND - Compounds having a diphenylmethane skeleton are superior in broad utility and stability, and are useful as a protecting reagent (anchor) of amino acid and/or peptide in the liquid phase synthesis and the like of a peptide having a C-terminal etc., which are of a carboxamide(-CONHR)-type, and in organic synthetic reaction methods (particularly peptide liquid phase synthetic methods), and may be contained in a kit for peptide liquid phase synthesis. | 2010-09-30 |
20100249375 | IMMOBILIZING MOLECULES ON A SOLID SUPPORT - A method for selectively orienting molecules on a surface of a solid support. The method includes: (a) attaching a linker molecule to the surface of the solid support, the linker molecule including a head group that is capable of binding to the solid support, and a tail group that is capable of chelating to a metal ion; (b) subsequently treating the solid support with a solution containing the metal ion; (c) attaching a metal ion chelating tag to the molecules to form tagged molecules; and (d) capturing the tagged molecules on the solid support by contacting it with the tagged molecules to form a monolayer of molecules on the surface of the solid support in which a majority of the molecules are held in the same orientation with respect to the surface. | 2010-09-30 |
20100249376 | NELL Peptide Expression Systems and Bone Formation Activity of NELL Peptide - The invention generally relates to a bone growth factor, and more particularly to compositions including NELL1, articles of manufacture including NELL1 and methods of using NELL1 to induce bone formation. This invention also provides methods for the expression and purification of NELL1 and NELL2 peptides. | 2010-09-30 |
20100249377 | ENGINEERED HYBIRD PHAGE VECTORS FOR THE DESIGN AND THE GENERATION OF A HUMAN NON-ANTIBODY PEPTIDE OR PROTEIN PHAGE LIBRARY VIA FUSION TO pIX OF M13 PHAGE - The invention relates to a compositions and methods for generating and using pIX phage display libraries for producing non-antibody peptide or protein proteins or peptides using engineered hybrid phage vectors derived from pIX of M 13 phage | 2010-09-30 |
20100249378 | PROCESS OF AQUEOUS PROTEIN EXTRACTION FROM BRASSICACEAE OILSEEDS - A process of aqueous protein extraction from Brassicaceae oilseed meal, such as canola, commercial canola meal or yellow mustard, to obtain a napin-rich protein extract, a cruciferin-rich protein extract, and a low-protein residue. The process comprising the steps of performing aqueous extraction of the Brassicaceae oilseed meal at a pH of from about 2.5 to about 5.0 to obtain a soluble napin-rich protein extract and a cruciferin-rich residue followed by performing aqueous extraction of the cruciferin-rich residue to obtain a soluble cruciferin-rich protein extract and a low-protein residue. The cruciferin-rich residue may be treated with cell wall degrading enzymes to obtain a cruciferin-rich fraction The cruciferin-rich protein products may be substantially free of napin protein and may be useful as a non-allergenic food product for human consumption. | 2010-09-30 |
20100249379 | PROTEIN EXPRESSION FROM MULTIPLE NUCLEIC ACIDS - The current invention reports a method for the recombinant production of a secreted heterologous immunoglobulin in a CHO cell comprising the following steps: i) providing a CHO cell, which is adapted to growth in suspension culture, adapted to growth in serum-free medium, mycoplasma free, and virus free, ii) providing a vector comprising a prokaryotic origin of replication, a first nucleic acid conferring resistance to a prokaryotic selection agent, a second nucleic acid encoding the heavy chain of said heterologous immunoglobulin, a third nucleic acid encoding the light chain of said heterologous immunoglobulin, a fourth nucleic acid conferring resistance to a eukaryotic selection agent, iii) transfecting said CHO cell, wherein said transfecting comprises a) transfecting said CHO cell with said vector comprising a fourth nucleic acid conferring resistance to a first eukaryotic selection agent, b) selecting a CHO cell by growth in cultivation medium containing said first eukaryotic selection agent, c) transfecting said selected CHO cell with said vector comprising a fourth nucleic acid conferring resistance to a second eukaryotic selection agent different to said first eukaryotic selection agent, d) selecting a CHO cell by selected growth in cultivation medium containing said first and said second eukaryotic selection agent, iv) cultivating said transfected CHO cell in a medium in the presence of said first and second eukaryotic selection agent, under conditions suitable for the expression of said second, and third nucleic acid, and v) recovering said secreted heterologous immunoglobulin from the cultivation medium. | 2010-09-30 |
20100249380 | Modulating Immune Responses - The invention provides methods for modulating the immune system using anti-CD83 antibodies that can influence CD83 function. | 2010-09-30 |
20100249381 | Method for Purifying FC-Fusion Proteins - The invention relates to a method for the purification of Fc-fusion via blue dye affinity chromatography, in particular for the reduction of the amount of free Fc-moieties in an Fc-fusion proteins preparation. | 2010-09-30 |
20100249382 | MODIFIED Fc MOLECULES - The present invention relates to Fc variants with optimized Fc receptor binding properties, methods for their generation, Fc polypeptides comprising Fc variants with optimized Fc receptor binding properties, and methods for using Fc variants with optimized Fc receptor binding properties. | 2010-09-30 |
20100249383 | Novel Ligand Involved In The Transmigration Of Leukocytes Across the Endothelium and Uses Therefor - The present invention provides methods and compositions involved in the inflammatory response, as well as various pathological processes. In particular, the present invention provides novel antibodies directed against novel glycans that are enriched on endothelial cell surfaces. In addition, the present invention provides methods and compositions involved in a previously unrecognized pathway of the inflammatory response and various pathological processes. In addition the present invention provides methods and compositions suitable to mediate the inflammatory response in various settings, as well as methods and compositions for the identification of other inflammatory response mediators. | 2010-09-30 |
20100249384 | IMMUNOGLOBULIN AGGREGATES - The current invention reports a method for concentrating an immunoglobulin solution by tangential flow filtration wherein the immunoglobulin in polymeric form can be removed after the concentration. | 2010-09-30 |
20100249385 | WATER-SOLUBLE FLUORO-SUBSTITUTED CYANINE DYES AS REACTIVE FLUORESCENCE LABELLING REAGENTS - Disclosed are cyanine dyes that are useful for labelling and detecting biological and other materials. The dyes are of formula (I): | 2010-09-30 |
20100249386 | DINITROXIDE-TYPE BIRADICAL COMPOUNDS OPTIMIZED FOR DYNAMIC NUCLEAR POLARIZATION (DNP) - The present invention relates to the field of organic chemistry and in particular to organic free radicals used as polarizing agents in the technique of Dynamic Nuclear Polarization (DNP), which involves transferring the polarization of electron spins to the nuclei of a compound whose Nuclear Magnetic Resonance (NMR) is being observed. It concerns dinitroxide-type biradical polarizing agents characterized by a rigid linkage between the nitroxide units that enables optimal orientation and distance to be maintained between the aminoxyl groups of said nitroxide units. This particular structure enables, at low temperatures and high fields, optimal transfer of polarization and optimal enhancement of NMR/MAS signals of the polarized nuclei of the compound studied. | 2010-09-30 |
20100249387 | Process for producing coelenteramide or an analog thereof - A process for producing coelenteramide or its analog in a high yield has been desired. The invention provides a process for producing di-O-methylcoelenteramide or its analog, which comprises reacting O-methylcoelenteramine or its analog with 4-methoxyphenylacetyl halide or its analog. The invention also provides a process for producing coelenteramide or its analog, which comprises demethylation of di-O-methylcoelenteramide or its analog. | 2010-09-30 |
20100249388 | PLANTS AND SEEDS OF CORN VARIETY CV251054 - According to the invention, there is provided seed and plants of the corn variety designated CV251054. The invention thus relates to the plants, seeds and tissue cultures of the variety CV251054, and to methods for producing a corn plant produced by crossing a corn plant of variety CV251054 with itself or with another corn plant, such as a plant of another variety. The invention further relates to corn seeds and plants produced by crossing plants of variety CV251054 with plants of another variety, such as another inbred line. The invention further relates to the inbred and hybrid genetic complements of plants of variety CV251054. | 2010-09-30 |
20100249389 | PLANTS AND SEEDS OF CORN VARIETY CV433540 - According to the invention, there is provided seed and plants of the corn variety designated CV433540. The invention thus relates to the plants, seeds and tissue cultures of the variety CV433540, and to methods for producing a corn plant produced by crossing a corn plant of variety CV433540 with itself or with another corn plant, such as a plant of another variety. The invention further relates to corn seeds and plants produced by crossing plants of variety with plants of another variety, such as another inbred line. The invention further relates to the inbred and hybrid genetic complements of plants of variety CV433540. | 2010-09-30 |
20100249390 | PRODUCTION METHODS FOR SOLUBILIZED LIGNIN, SACCHARIDE RAW MATERIAL AND MONOSACCHARIDE RAW MATERIAL, AND SOLUBILIZED LIGNIN - A new lignin degradation product, a method for producing the same, and methods for producing a saccharide raw material and a monosaccharide raw material are provided. | 2010-09-30 |
20100249391 | METHOD FOR PRODUCING DRY ORGANIC PIGMENT - The present invention provides a method for producing dry organic pigment, comprising the successive steps of, in this order: a first step wherein a wet organic pigment is obtained by drying an organic pigment presscake at 70 to 150° C. to a moisture content of 5 to 30%, and a second step wherein a dry organic pigment is obtained by pulverizing and drying the wet organic pigment at a temperature that is higher than the temperature employed in the first step but lower than the decomposition temperature of the organic pigment. The method for producing dry organic pigment enables the dry organic pigment to be obtained with superior productivity while consuming less energy than conventional methods. | 2010-09-30 |
20100249392 | Glucopyranosyl-substituted benzonitrile derivatives, pharmaceutical compositions containing such compounds, their use and process for their manufacture - Glucopyranosyl-substituted benzonitrile derivatives defined according to claim | 2010-09-30 |
20100249393 | COLORIMETRIC-OXYCARBONYL PROTECTING GROUPS FOR USE IN ORGANIC SYNTHESES - The present invention provides for reagents for the introduction of colorimetric-oxycarbonyl protecting groups, compounds bearing colorimetric-oxycarbonyl protecting groups, and the use thereof in solid-supported organic syntheses of oligonucleotides, polypeptides, polysaccharides, and combinatorial libraries. | 2010-09-30 |
20100249394 | PROCESSES FOR PRODUCING DECITABINE - New processes for producing decitabine are provided. | 2010-09-30 |
20100249395 | METHODS FOR PREPARING CAPECITABINE AND BETA-ANOMER-RICH TRIALKYL CARBONATE COMPOUND USED THEREIN - The present invention relates to a method for preparing capecitabine and a method for preparing a β-anomer-rich trialkyl carbonate compound used therein, and a highly pure capecitabine can be efficiently prepared with a high yield by the method of the present invention using the β-anomer-rich trialkyl carbonate compound as an intermediate. | 2010-09-30 |
20100249396 | BENZAZEPINONE COMPOUND - The present invention relates to a benzazepinone compound represented by the following formula (I): | 2010-09-30 |
20100249397 | Process for the synthesis of ivabradine and addition salts thereof with a pharmaceutically acceptable acid - Process for the synthesis of ivabradine of formula (I): | 2010-09-30 |
20100249398 | Process for the synthesis of ivabradine and addition salts thereof with a pharmaceutically acceptable acid - Process for the synthesis of ivabradine of formula (I): | 2010-09-30 |
20100249399 | AMIDE DERIVATIVE AND PHARMACEUTICAL COMPOSITION CONTAINING THE SAME - Disclosed is a compound having a strong affinity to serotonin-4 receptors, which is useful as an enterokinesis-promoting agent or a digestive tract function-improving agent. Specifically, disclosed is a compound represented by Formula (1) or a pharmaceutically acceptable salt thereof. Also specifically disclosed is a pharmaceutical composition containing a compound represented by Formula (1) or a pharmaceutically acceptable salt thereof. [In Formula (1), Ar represents a group represented by Formula (Ar-1) or Formula (Ar-2).] | 2010-09-30 |
20100249400 | NOVEL DIHYDRONAPHTHALENE COMPOUND AND USE THEREOF - Disclosed is a compound represented by the formula (I) below as a dihydronaphthalene compound having a chemical structure which is excellent in production efficiency when compared with lasofoxifene and nafoxidine. This compound is useful as a proteasome inhibitor and/or an antitumor agent. | 2010-09-30 |
20100249401 | Process for the preparation of sterically hindered nitroxyl ethers - The present invention relates to a novel process for the preparation of a sterically hindered nitroxyl ether from the corresponding sterically hindered nitroxyl radical by reacting it with a carbonyl compound and a hydroperoxide. The compounds prepared by this process are effective stabilizers for polymers against harmful effects of light, oxygen and/or heat, as flame-retardants for polymers and as polymerization regulators. | 2010-09-30 |
20100249402 | NOVEL BENZAMIDINE DERIVATIVES, PROCESS FOR THE PREPARATION THEREOF AND PHARMACEUTICAL COMPOSITION FOR PREVENTING OR TREATING OSTEPOROSIS COMPRISING THE SAME - The present invention relates to novel benzamidine derivatives, a process for the preparation thereof and a pharmaceutical composition for preventing or treating osteoporosis comprising the same. The benzamidine derivatives of the present invention effectively inhibit osteoclast differentiation at an extremely low concentration, and thus can be advantageously used for the prevention and treatment of osteoporosis. | 2010-09-30 |
20100249403 | USE OF OXAZINE COMPOUNDS FOR MAKING CHROMOGENIC MATERIALS - Heterocyclic compounds incorporating a [1,3]oxazine ring may be used to make chromogenic materials. These molecules switch from a colorless state to a colored form upon addition of either acid or base. In both instances, the [1,3]oxazine ring opens in response to the pH change forming an indolium cation, after the addition of acid, or a phenolate anion, after the addition of base. Alternatively, the switch may occur in response to a change in electrical current or potential or a change in temperature. Chromophores absorb in the visible region of the electromagnetic spectrum. Hence, their formation translates into the appearance of color. These processes are fully reversible and the original colorless state can be regenerated by switching the pH back to neutral. Thus, these halochromic compounds can be used to develop displays, filters, indicators, lenses, sensors, switches, or windows able to switch their color in response to pH changes. | 2010-09-30 |
20100249404 | Method for Carrying Out Chemical Reactions with the Aid of an Inductively Heated Heating Medium - The invention relates to a method for carrying out a chemical reaction for producing a target compound by heating in a reactor a reaction medium containing at least one first reactant, such that a chemical bond inside the first reactant or between the first and a second reactant is formed or modified. The reaction medium is brought into contact with a solid heating medium that can be warmed by electromagnetic induction and that is inside the reactor and is surrounded by the reaction medium. Said heating medium is heated by electromagnetic induction with the aid of an inductor and the target bond is formed from the first reactant or from the first and a second reactant and said target bond is separated from the heating medium. | 2010-09-30 |
20100249405 | Organic Compounds - The present invention relates to novel IAP inhibitor compounds of formula I: | 2010-09-30 |
20100249406 | PHENYL-SUBSTITUTED 1,3.5-TRIAZINE COMPOUND, PROCESS FOR PRODUCING THE SAME, AND ORGANIC ELECTROLUMINESCENT DEVICE CONTAINING THE SAME AS COMPONENT - A phenyl-substituted 1,3,5-triazine compound represented by the general formula (1); | 2010-09-30 |
20100249407 | Novel Compound Having Affinity to Amyloid - The invention relates to a compound which has affinity with amyloid, shows sufficiently rapid clearance from normal tissues and is suppressed in toxicity such as mutagenicity, and also relates to a low-toxic diagnostic agent for Alzheimer's disease containing the compound. The compound is represented by the following formula (1) or a salt thereof: | 2010-09-30 |
20100249408 | USE OF NOVEL COMPOUND HAVING AFFINITY FOR AMYLOID, AND PROCESS FOR PRODUCTION OF THE SAME - The invention provides a reagent for detecting amyloid in a biological tissue which can detect amyloid in vitro and in vivo with high sensitivity using a compound which has affinity with amyloid and is suppressed in toxicity such as mutagenicity. | 2010-09-30 |
20100249409 | PROCESS FOR STEREOSELECTIVE SYNTHESIS OF LAMIVUDINE - The present invention discloses a process for stereoselective synthesis of Lamivudine comprising the following steps: (a) performing a glycosylation-reaction between the compound of formula (I) and cytosine or protected cytosine, and separating the reaction product by recrystallization to obtain the intermediate of formula (II); and (b) deprotecting the intermediate of formula (II) to obtain Lamivudine. | 2010-09-30 |
20100249410 | PROCESS FOR PREPARING N-ALKYLATED HYDROXYPYRIMIDINONE COMPOUNDS - Potassium salts of Compound A and methods for their preparation are disclosed, wherein Compound A is of formula: | 2010-09-30 |
20100249411 | Stereoselective Alkylation of Chiral 2-Methly-4 Protected Piperazines - In an illustrative embodiment, the present invention describes the synthesis of the following compound and similar compounds, in high stereochemical purity by a novel stereoselective alkylation process: | 2010-09-30 |
20100249412 | Process for the manufacture of dihydropteridinones - Disclosed are processes for preparing dihydropteridinones of general formula (I) | 2010-09-30 |
20100249413 | STABILIZED PHARMACEUTICAL COMPOSITION - [Problem] A stable liquid-form pharmaceutical composition wherein the decomposition with time is prevented and a stabilization method thereof is provided, for providing a liquid-form pharmaceutical composition of 1-(2-methoxyethyl)-2-methyl-4,9-dioxo-3-(pyrazin-2-ylmethyl)-4,9-dihydro-1H-naphtho[2,3-d]imidazol-3-ium or a pharmaceutically acceptable salt thereof to a clinical field. | 2010-09-30 |
20100249414 | CRYSTALLINE FORM II OF 7-(DIMETHOXY-METHYL) CAMPTOTHECIN, ITS USE AS INTERMEDIATE AND PRODUCTS OBTAINED THEREFROM - This invention relates to a process for preparing a crystalline form of (4S)-11-(dimethoxymethyl)-4-ethyl-4-hydroxy-1H-pyrano[3′,4′:6,7]indolizino[1,2-b]qui-noline-3,14(4H,12H)-dione (also named 7-(dimethoxy-methyl)camptothecin). With the provision of a particular crystallization step, in appropriate way, a new crystalline form of the above compound is obtained. The process for the preparation of the polymorph Form II comprises transforming camptothecin to the corresponding 7-(dimethoxy-methyl)-camptothecin, and crystallizing it from methanol. | 2010-09-30 |
20100249415 | Process for preparation of temsirolimus - The present invention provides two synthetic routes for the preparation of Temsirolimus (compound 1b and analog of Temsirolimus 1a). The first route includes the synthesis of CCI-779 by directly reacting rapamycin (4b) or Prolyl-rapamycin (4a) with substituent-2,2-bis(methoxy) propionic acid anhydride(11) in the presence of an organic base, followed by deprotection to give CCI-779 or Proline CCI-779. The second route includes a process involving a reaction of rapamycin-OH-31-sily ether (4d) or Prolyl-rapamycin-OH-31-sily ether (4c) with substituent-2,2-bis(methoxy) propionic acid anhydride(11) in the presence of an organic base and followed by subsequent hydrolysis step to obtain the desired CCI-779 or Proline CCI-779. | 2010-09-30 |
20100249416 | CHEMICAL SYNTHESIS OF I-124BETA CIT IODINE-124 [2-BETA-CARBOMETHOXY-3BETA- (4. -IODOPHENYL) -TROPANE] FOR PET INVESTIGATIONS AND FOR RADIOTHERAPY - The present invention concerns a new molecule, I-124βCIT Iodine-124[2β-carbomethoxy-3β-(4-iodophenyl)-tropane] and its process of synthesis, for use in PET investigations. | 2010-09-30 |
20100249417 | NOVEL NAPHTHYRIDINE DERIVATIVE MONOHYDRATE AND METHOD FOR PRODUCING THE SAME - Disclosed is 1-(2-(4-((2,3-dihydro(1,4)dioxino(2,3-c)pyridin-7-ylmethyl)amino)piperidin-1-yl)ethyl)-7-fluoro-1,5-naphthyridin-2(1H)-one monohydrate, which has strong antibacterial activity. The compound is highly safe and useful as an original drug for pharmaceutical preparations. Also disclosed is a method which is useful for producing 1-(2-(4-((2,3-dihydro(1,4)dioxino(2,3-c)pyridin-7-ylmethyl)amino)piperidin-1-yl)ethyl)-7-fluoro-1,5-naphthyridin-2(1H)-one monohydrate. | 2010-09-30 |
20100249418 | NOVEL COMPOUND HAVING AFFINITY FOR AMYLOID - A compound effective as a probe targeting amyloid for image diagnosis and a reagent comprising the compound for detecting amyloid deposited on a biological tissue are provided. Provided are a compound represented by the following formula (1): | 2010-09-30 |
20100249419 | UTILIZATION OF NOVEL COMPOUNDS WITH AMYLOID AFFINITY AND METHOD OF PRODUCING THE SAME - The invention provides a reagent for detecting amyloid deposited in a biological tissue which can detect amyloid in vitro and in vivo with high sensitivity using a compound which has affinity with amyloid and is suppressed in toxicity such as mutagencity. The reagent for detecting amyloid deposited in a biological tissue comprises a compound represented by the following formula (1) or a salt thereof: | 2010-09-30 |
20100249420 | Process for preparing quinuclidinium carbamate derivatives - A new process for preparing carbamate derivatives having the structure of formula (I) | 2010-09-30 |
20100249421 | BIPHENYL COMPOUNDS USEFUL AS MUSCARINIC RECEPTOR ANTAGONISTS - This invention provides compounds of formula I: | 2010-09-30 |
20100249422 | ACYLATION REACTION OF HYDROXYL GROUP - Disclosed is a selective ester production process of an alcoholic hydroxyl group, which proceeds under chemically mild conditions, while having adequate environmental suitability, operability and economical efficiency. Specifically disclosed is a process for producing an ester compound, which is characterized in that an alcohol and a carboxylic acid ester compound are reacted in the presence of a compound containing zinc element, thereby selectively acylating a hydroxyl group of the alcohol. | 2010-09-30 |
20100249423 | TOLPERISONE CONTROLLED RELEASE TABLET - A GRDDS (Gastro Retentive Drug Delivery System) containing tolperisone and having a 2-methyl-1-(4-methylphenyl)-propenone (4-MMPPO) fraction of less than 1.5 ppm for the extended release of the active substance tolperisone while avoiding the formation of 4-MMPPO in the gastrointestinal tract. | 2010-09-30 |
20100249424 | METHOD FOR PREPARING 5-HALOALKYL-4,5-DIHYDROISOXAZOLE DERIVATIVES - Disclosed is a method for preparing a compound of Formula 1 | 2010-09-30 |
20100249425 | PREPARATION OF AN INORGANIC SUBSTRATE HAVING ANTIMICROBIAL PROPERTIES - The invention relates to a process for modifying an inorganic substrate, directed toward giving it antimicrobial properties, said process consisting in grafting in one or more steps onto a surface of said substrate groups with intrinsic antimicrobial properties or groups capable of releasing species with antimicrobial properties. The grafting is performed by means of an organophosphorus coupling agent. | 2010-09-30 |
20100249426 | STABILIZED PHARMACEUTICAL COMPOSITION - It is an object of the present invention to provide a pharmaceutical composition containing a stable azole-based compound, which is useful as an antifungal agent. According to the present invention, the above-mentioned object can be achieved by adding magnesium hydroxide carbonate, triethylamine, arginine, or another such basic substance to an azole-based compound that is unstable in acids. The above-mentioned pharmaceutical composition is stable enough that the compound will not degrade if the temperature, humidity, or other such conditions should change during production or storage. Also, this composition is useful as a therapeutic agent for deep mycoses because systemic administration is possible by applying it to an oral agent or an injection. | 2010-09-30 |
20100249427 | BIOLUMINESCENT PROTEASE ASSAY - A sensitive bioluminescent assay to detect proteases including caspases, trypsin and tryptase is provided. | 2010-09-30 |
20100249428 | PROCESS FOR THE PREPARATION OF PROPIONIC ACID DERIVATIVES - The invention relates to a process for the preparation of a compound of formula (I) | 2010-09-30 |
20100249429 | PROCESS FOR THE MANUFACTURE OF VALSARTAN - The present invention relates to a process for the manufacture of an angiotensin receptor blocker (ARB; also called angiotension II receptor antagonist or AT | 2010-09-30 |
20100249430 | PROCESS FOR PREPARING VALSARTAN - The invention relates to novel compound of formula (IV), which is an organic acid salt of N-[(2′-cyanobipheny1-4-yl)methyl]-(L)-valine ester. This compound is an useful intermediate for process of preparation of Valsartan of formula (I), chemically known as (S)-N-(1-Carboxy-2-methylprop-1-yl)-N-pentanoyl-N-[2′-(1H-terazol-5-yl)biphenyl-4-ylmethyl]amine. This invention also relates to a process for preparing Valsartan using novel intermediate of formula (IV). | 2010-09-30 |
20100249431 | PROCESS FOR MANUFACTURING DISULFONIC ACID COMPOUND, ASYMMETRIC MANNICH CATALST, PROCESS FOR MANUFACTURING BETA-AMINOCARBONYL DERIVATIVE, AND NOVEL DISULFONATE - Hexamethylphosphoramide (HMPA) was added to a reaction vessel containing (R)-1,1′-binaphthyl-2,2′-dithiol and potassium hydroxide. The vessel was purged with oxygen and stirred at 80° C. for 5 days under 7 atmospheres of oxygen. After being cooled to room temperature, the reaction product was purified to yield potassium (R)-1,1′-binaphthyl-2,2′-disulfonate. The (R)-1,1′-binaphthyl-2,2′-disulfonic acid obtained from the disulfonate and 2,6-diphenylpyridine were stirred in acetonitrile, and then the solvent was evaporated under reduced pressure. Subsequently, magnesium sulfate and distilled CH | 2010-09-30 |
20100249432 | METHOD FOR THE PRODUCTION OF DISUBSTITUTED IMIDAZOLIUM SALTS - Process for preparing 1,3-disubstituted imidazolium salts of the formula I | 2010-09-30 |
20100249433 | PROCESS FOR THE PURIFICATION OF ROPINIROLE HYDROCHLORIDE - An improved process is described for the purification of ropinirole hydrochloride. The process includes (i) dissolving ropinirole hydrochloride in water; (ii) treating the solution obtained in step (i) with sodium dithionate and charcoal; (iii) treating the filtrate obtained in step (ii) with water immiscible solvent and base and isolating the free base; and (iv) treating the free base obtained in step (iii) with ethanolic HCl to give ropinirole hydrochloride. | 2010-09-30 |
20100249434 | METHOD FOR THE VINYLATION OF AMIDES - A process for preparing an N-vinyl compound by vinylating a compound having at least one nitrogen atom (referred to hereinafter as compound for short) with acetylene, wherein
| 2010-09-30 |
20100249435 | POLYMORPHS OF ENANTIOPURE ERDOSTEINE - The present invention provides novel crystalline polymorphs of enantiopure Erdosteine, referred to as Form I and Form II, and processes for the preparation thereof. | 2010-09-30 |
20100249436 | METHOD FOR PRODUCING CARBONATE COMPOUND - The present invention is to provide a novel production process capable of selectively producing various kinds of carbonate compounds without any inhibition in high yields without using phosgene and without producing hydrogen chloride as a by-product. The present invention relates to a process for producing a compound having a carbonate bond by reacting a compound (1) with a compound having one OH group or a compound having two or more OH groups in the presence of a halogen salt. In the formula (1) shown below, X | 2010-09-30 |
20100249437 | PROCESS FOR PREPARATION OF CITALOPRAM AND ENANTIOMERS - The present invention provides a process for preparation of 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-5-isobenzofuran carbonitrile comprising reacting a compound of formula IVa, in the presence of a base with a compound of formula RX, | 2010-09-30 |
20100249438 | PREPARATION OF ESCITALOPRAM - A substantially pure (S)-4-[4-(dimethylamino)-1-(4′-fluorophenyl)-1-hydroxybutyl]-3-(hydroxymethyl)benzonitrile intermediate for preparing escitalopram is prepared by: | 2010-09-30 |
20100249439 | PROCESS FOR CONTROLLED CRYSTAL SIZE IN 1,2-SUBSTITUTED 3,4-DIOXO-1-CYCLOBUTENE COMPOUNDS - This application discloses a novel process for the preparation of 2-Hydroxy-N,N-dimethyl-3-[[2-[[1(R)-(5-methyl-2-furanyl)propyl]amino]-3,4-dioxo-1-cyclobuten-1-yl]amino]benzamide, which has utility, for example, in the treatment of CXC chemokine-mediated diseases. | 2010-09-30 |
20100249440 | Method and Apparatus for Producing Purified Botanical Oil - Disclosed is a method for producing botanical oil with no by-produced trans fatty acids comprising the steps of;
| 2010-09-30 |
20100249441 | METHOD FOR PRODUCING FATTY ACID ALKYL ESTER AND/OR GLYCERIN - In the method of the present invention for producing fatty acid alkyl ester and/or glycerin, as a heat source for an alcohol refining step of refining alcohol from unreacted alcohol that remains without reacting in a first reaction step, at least a part of heat of the unreacted alcohol is used. This allows reducing costs in production of fatty acid alkyl ester and/or glycerin over a solid catalyst. | 2010-09-30 |
20100249442 | CONTINUOUS METHOD FOR THE HETEROGENICALLY CATALYZED ESTERIFICATION OF FATTY ACIDS - Continuous method for the esterification of free fatty acids in plant and animal fats with alcohols using a heterogenic acid catalyst. | 2010-09-30 |
20100249443 | TITANIUM COMPOUND AND PROCESS FOR ASYMMETRIC CYANATION OF IMINES - The present invention relates to titanium catalysts for asymmetric synthesis reactions produced by bringing a reaction mixture obtained by contacting water and a titanium alkoxide into contact with an optically active ligand represented by the general formula (a), wherein R1, R2, R3, and R4 are independently a hydrogen atom, an alkyl group, or the like, and A* represents a group with two or more carbon atoms having an asymmetric carbon atom or axial asymmetry. The invention further relates to a process for asymmetric cyanation of imines, wherein the process comprises reacting an imine with a cyanating agent in the presence of the titanium catalyst. | 2010-09-30 |
20100249444 | Method for Preparation of Cross-Condensed Compound Between Amino Acids and Aminoalkylsilane Having Alkoxy Groups Using Microwave - The present invention provides a method of preparing a cross-condensed compound of an amino-acid derivative and (aminoalkyl) trialkoxysilane using microwave, including: irradiating and heating an amino-acid derivative and (aminoalkyl) trialkoxysilane in a microwave reactor to obtain a reaction product (step 1); and refining the reaction product obtained in the step 1 by removing an unreacted solid material from the reaction product and then leaving the reaction product at room temperature under vacuum to remove excess (aminoalkyl) trialkoxysilane therefrom (step 2). According to the method, since a cross-condensation reaction is performed using microwave, unlike a conventional condensation reaction, economic efficiency is increased due to no catalyst, short reaction time and no solvent. Further, the yield and selectivity of products is increased, and the condensation reaction can be environment-friendly performed because a solvent which can badly influence the environment may not be used. | 2010-09-30 |
20100249445 | POST-SPIN-ON SILYLATION METHOD FOR HYDROPHOBIC AND HYDROFLUORIC ACID-RESISTANT POROUS SILICA FILMS - A method of silylating porous silica films comprises: preparing a porous silica film; and grafting the film with a hydrophobic functional group while annealing the film. The porous silica film is a sol-gel silica film, a mesoporous silica film, in situ crystallized polycrystalline pure-silica zeolite (PSZ), spin-on PSZ, and spin-on PSZ MEL (or PSZ MEL-structural type) films. The hydrophobic functional group is trimethylchlorosilane (TMCS); dimethyldichlorosilane; methyltrichlorosilane; alkylchlorosilanes, such as (CH | 2010-09-30 |
20100249446 | METHOD FOR PRODUCING N-METHACRYLOYL-4-CYANO-3-TRIFLUOROMETHYLANILINE - A method for producing N-methacryloyl-4-cyano-3-trifluoromethylaniline, wherein 4-cyano-3-trifluoromethylaniline is crystallized from a mixed solvent of methanol and water, and the obtained 4-cyano-3-trifluoromethylaniline is reacted with methacryloyl chloride improved separation property even in industrial production in a large scale. | 2010-09-30 |
20100249447 | PURIFICATION OF FULLERENE DERIVATIVES FROM VARIOUS IMPURITIES - Purification methods for fullerene derivatives are described. The method comprises passing a solution of fullerene derivatives containing impurities such as other fullerene derivatives and polycyclic aromatic hydrocarbons through activated charcoals. Fullerene derivatives with high purity were obtained. | 2010-09-30 |
20100249448 | SUPPORTED COMPOSITE PARTICLE MATERIAL, PRODUCTION PROCESS OF SAME AND PROCESS FOR PRODUCING COMPOUNDS USING SUPPORTED COMPOSITE PARTICLE MATERIAL AS CATALYST FOR CHEMICAL SYNTHESIS - A supported composite particle material comprises: a composite particle formed of an oxidized nickel and X (wherein X represents at least one of elements selected from the group consisting of nickel, palladium, platinum, ruthenium, gold, silver and copper); and a support on which the composite particle is supported, the supported composite particle material having a supported layer in which the composite particle is localized. | 2010-09-30 |
20100249449 | METHOD FOR AMIDATING OF NITRILE IN THE PRESENCE OF SULFURIC ACID - The present invention relates to a process for preparing carboxamides by amidating nitriles in the presence of sulphuric acid, wherein the reaction is performed in a Taylor reactor. The process enables a simple and inexpensive preparation of these compounds. The present invention further provides processes for preparing (meth)acrylamides and alkyl(meth)acrylates, which comprise an inventive amidation reaction. | 2010-09-30 |
20100249450 | PROCESS FOR PRODUCING POLYISOCYANATE - A method for producing a polyisocyanate includes a purification step of purifying an unpurified polyisocyanate, the purification step including a tar ingredient removal step of removing tar ingredients from an unpurified polyisocyanate, and a distillation step of distilling the unpurified polyisocyanate from which tar ingredients have been removed through a dividing wall distillation column. | 2010-09-30 |