22nd week of 2014 patent applcation highlights part 36 |
Patent application number | Title | Published |
20140147426 | ANTICARIES COMPOSITIONS AND PROBIOTICS/PREBIOTICS - The present invention discloses different specific bacterial strains isolated from individuals without caries which are characterised in that they present inhibitory activity against cariogenic organisms. The invention also discloses a process for isolating said strains, as well as bioactive peptides, such as anti-microbial peptides of human and bacterial origin, which also show anti-cariogenic activity. Moreover, the present invention also discloses pharmaceutical and/or probiotic/prebiotic compositions, functional foods, mouthwashes, toothpaste, chewing gum, etc., that comprise at least one of the strains and/or at least one of the bioactive peptides described in the invention, or a combination thereof, which are useful in the treatment and/or prevention of infectious diseases of the buccal cavity, preferably caries. | 2014-05-29 |
20140147427 | Spray-Dried Lactobacillus Stems/Cells and the Use of Same Against Helicobacter Pylori - The invention relates to spray-dried | 2014-05-29 |
20140147428 | NEURODEGENERATIVE DISORDERS AND MUSCLE DISEASES IMPLICATING PUFAS - Some aspects of the invention provide for a method of treating Alzheimer's Disease, Mild Cognitive Impairment, Frontotemperal Dementia, Amyotrophic Lateral Sclerosis and/or Multiple Sclerosis using polyunsaturated fatty acids which are modified in certain positions to attenuate oxidative damage by Reactive Oxygen Species (ROS) and/or suppress the rate of formation of reactive products and toxic compounds. | 2014-05-29 |
20140147429 | THERAPEUTIC FUSION PROTEINS - The present invention relates to the construction of a new class of Targeted Secretion Inhibitors (TSIs), which comprise a non-cytotoxic protease, translocation peptide and a targeting moiety peptide, wherein the targeting moiety peptide has a free N-terminal domain and a free C-terminal domain; to a single-chain fusion protein precursor thereof, and to a method of activating said single-chain fusion protein precursor. | 2014-05-29 |
20140147430 | APPLICATION FOR PRDX2 AND/OR PRDX6 IN PREPARATION OF PHARMACEUTICAL COMPOSITION TO TREAT OR PREVENT DAMAGE, AGING OR DISEASE RESULTING FROM INCREASE OF REACTIVE OXYGEN SPECIES - Provided in the present invention is an application for PRDX2 and/or PRDX6 in the preparation of a pharmaceutical composition to treat or prevent damage, aging or diseases resulting from an increase in reactive oxygen species (ROS). | 2014-05-29 |
20140147431 | Compositions and Methods for Modulating Desnutrin-Mediated Adipocyte Lipolysis - The present disclosure provides methods of converting white adipose tissue to brown adipose tissue in an individual, generally involving modulating desnutrin-mediated lipolysis in adipocytes in the individual. The present disclosure further provides methods for treating obesity. The present disclosure further provides methods of identifying an agent that increases the level and/or activity of desnutrin in an adipocyte. | 2014-05-29 |
20140147432 | MODIFIED POLYNUCLEOTIDES FOR THE PRODUCTION OF PROTEINS ASSOCIATED WITH BLOOD AND LYMPHATIC DISORDERS - The invention relates to compositions and methods for the preparation, manufacture and therapeutic use of polynucleotides, primary transcripts and mmRNA molecules. | 2014-05-29 |
20140147433 | METHODS AND DEVICES SUITABLE FOR IMPROVED REATTACHMENT OF DETACHED CARTILAGE TO SUBCHONDRAL BONE - The methods and devices disclosed herein are effective in the promoting the reattachment of delaminated cartilage to bone. The methods (and related devices) are effective in the removal of the acellular layer of the delaminated cartilage or effective in the indentation of the acellular layer of the delaminated cartilage thereby exposing the underlying chondrocyte cells and thereby allowing the promotion of the reattachment of the delaminated cartilage. | 2014-05-29 |
20140147434 | NCoR1 is a Physiological Modulator of Muscle Mass and Oxidative Function - The present invention provides methods of increasing muscle mass and muscle mitochondrial oxidative metabolism. Additionally, the invention provides treating various disorders associated with mitochondrial dysfunction, including but not limited to metabolic disorders, muscular dystrophy disorders, neurodegenerative diseases, chronic inflammatory diseases, and diseases of aging. | 2014-05-29 |
20140147435 | NOGO-A Neutralizing Immunoglobulins for the Treatment of Neurological Diseases - The present invention relates to antibodies to NOGO, pharmaceutical formulations containing them and to the use of such antibodies in the treatment and/or prophylaxis of neurological diseases/disorders. | 2014-05-29 |
20140147436 | POLYPEPTIDE VARIANTS WITH ALTERED EFFECTOR FUNCTION - The present invention concerns polypeptides comprising a variant Fc region. More particularly, the present invention concerns Fc region-containing polypeptides that have altered effector function as a consequence of one or more amino acid modifications in the Fc region thereof. | 2014-05-29 |
20140147437 | METHODS TO ENHANCE CELL-MEDIATED IMMUNITY - This disclosure provides a method for enhancing cell-mediated immunity in individuals with disorders such as cancer or infection that involves administering an inhibitor of GOLPH2 to the individuals. For example, inhibition of GOLPH2 increases the endogenous production of IL-12. | 2014-05-29 |
20140147438 | METHODS OF TREATING VASOMOTOR SYMPTOMS USING ANTIBODIES - The invention features methods for preventing or treating CGRP associated disorders such as vasomotor symptoms, including headaches (e.g., migraine, cluster headache, and tension headache) and hot flushes, by administering an anti-CGRP antagonist antibody. Antagonist antibody G1 and antibodies derived from G1 directed to CGRP are also described. | 2014-05-29 |
20140147439 | ANTI-NERVE GROWTH FACTOR ANTIBODIES AND METHODS OF PREPARING AND USING THE SAME - A method of preparing an antibody suitable for use in a feline is provided. Also provided are chimeric and felinised antibodies which specifically bind to feline neuronal growth factor (NGF) and neutralise the ability of feline NGF to bind to the p75 or TrkA feline NGF receptor. The invention extends to nucleic acids encoding same and to methods of treating pain and arthritis in a feline using said antibodies and/or nucleic acids. | 2014-05-29 |
20140147440 | USES OF NANOG INHIBITORS AND RELATED METHODS - The present invention relates to substances and compositions thereof useful in the control of cancer stem cell persistence and concomitant tumor recurrence and/or control of tumor growth. In particular, the invention relates to substances and compositions useful in the treatment of cancers and/or tumors linked to cancer stem cells, preferably brain cancers and/or tumors, in a subject. | 2014-05-29 |
20140147441 | COMPOSITIONS CONTAINING ALPHA-1-ANTITRYPSIN AND METHODS FOR USE - Methods and compositions for treating patients (e.g., patients who are insulin resistant, patients who have diabetes, or are at risk for developing diabetes) are disclosed herein. The methods can include administration of an α1 antitrypsin (AAT) polypeptide or an agent, such as a nucleic acid molecule or organic compound, that promotes the expression or activity of α1-antitrypsin. | 2014-05-29 |
20140147442 | USE OF IL-23 ANTAGONISTS FOR TREATMENT OF INFECTION - Methods and compositions comprising antagonists of IL-23 are provided for the treatment of infections, such as chronic bacterial, viral and fungal infections. | 2014-05-29 |
20140147443 | COMPOSITIONS AND METHODS FOR DIAGNOSING AND TREATING CANCER - An isolated antibody that specifically binds to an extracellular domain of human DLL4 and affects growth of a tumor comprising cancer stem cells is described. Also described is a method of treating cancer comprising administering a therapeutically effective amount of an anti-DLL4 antibody. | 2014-05-29 |
20140147444 | SELECTIVE BINDING AGENTS OF OSTEOPROTEGERIN BINDING PROTEIN - Selective binding agents of osteoprotegerin binding protein (OPGbp) are provided by the invention. More particularly, the invention provides for antibodies and antigen binding domains which selectively bind to OPGbp and may be used to prevent or treat conditions relating to loss of bone mass. Nucleic acid molecules encoding said antibodies and antigen binding domains, and expression vectors and host cells for the production of same are also provided. | 2014-05-29 |
20140147445 | Selective Targeting of the CD40L/Mac-1 Interaction by Small Peptide Inhibitors and its Use for the Treatment of Inflammation and Atherogenesis - The CD40L/Mac-1 interaction is selectively targeted by small peptide inhibitors and/or antibodies and such peptides are used for the specific treatment of inflammation and atherogenesis. In particular, pharmaceutical compositions comprising a polypeptide having the amino acid sequence EQLKKSKTL and antibodies specifically binding to an epitope are disclosed. | 2014-05-29 |
20140147446 | ANTIBODY THERAPY FOR MODULATING FUNCTION OF INTESTINAL RECEPTORS AND METHODS OF TREATING DIABETES AND OBESITY - The present invention provides pharmaceutical compositions formulated for direct delivery to the GI tract of a patient comprising an antibody specific for a target apical intestinal receptor. The present invention further provides methods of treating diseases and conditions in a patient comprising administering directly to the GI tract of the patient, compositions of the present invention wherein modulation of the target apical intestinal receptor by the antibody treats the condition. | 2014-05-29 |
20140147447 | ANTI-CXCL13 ANTIBODIES AND METHODS OF USING THE SAME - Compositions and methods are provided for treating diseases associated with CXCL13 expression, including certain autoimmune diseases, inflammatory diseases, and cancers. In particular, anti-CXCL13 monoclonal antibodies have been developed to neutralize CXCL13. | 2014-05-29 |
20140147448 | NOVEL COMPOSITIONS AND METHODS OF PREVENTING OR AMELIORATING ABNORMAL THROMBUS FORMATION AND CARDIOVASCULAR DISEASE - The invention includes compositions and methods useful for treating preventing abnormal thrombus formation and subsequent cardiovascular disease in diabetic patients and patients with increased cardiovascular risk. | 2014-05-29 |
20140147449 | Compositions and Methods for Treating Inflammatory Conditions of the Ocular Surface - This application discloses ophthalmic formulations and methods for treating inflammatory disease and conditions of the ocular surface with one or more C-C chemokine receptor type 7 (CCR7) antagonists. The compositions may be formulated for subconjunctival or topical administration to the eye and are effective in the treatment of inflammatory disease and conditions of the ocular surface. | 2014-05-29 |
20140147450 | ANTIBODIES TO CD70 - The present invention relates to antibodies and antigen binding fragments thereof which bind to the human CD70 protein with high affinity and display potent inhibition of tumour cell growth. | 2014-05-29 |
20140147451 | COMPOSITIONS COMPRISING SOLUBLE CD84 OR ANTI-CD84 ANTIBODIES AND METHODS FOR DIAGNOSING AND TREATING B-CLL - A method of diagnosing B-CLL in a subject in need thereof is provided. The method comprising determining in a biological sample of the subject a level of CD84 isoform C (SEQ ID NO: 30), wherein an increase in the level of the CD84 isoform C (SEQ ID NO: 30) beyond a predetermined threshold with respect to a level of the CD84 in a biological sample from a healthy individual is indicative of the B-CLL. | 2014-05-29 |
20140147452 | METHOD FOR REMOVAL OF TOXINS FROM MUCOSAL MEMBRANES - The present invention provides novel mucoadhesive compounds useful in the prevention of diseases and disorders of or which are associated with the mucosal membrane. | 2014-05-29 |
20140147453 | FUSION PEPTIDE COMPRISING dhFas-1 DOMAIN AND MMP SUBSTRATE AND USE THEREOF FOR PREVENTING AND TREATING RHEUMATOID ARTHRITIS - The present invention relates to a fusion peptide comprising dhFas-1 domain and MMP substrate and use thereof. More specifically, the present invention relates to a fusion peptide, comprising a) a dhFas-1 domain which is the fourth fas-1 domain of βig-h3 lacking H1 and H2 regions; b) a MMP (Matrix metalloproteinase) substrate; and c) a peptide comprising RGD motif and an use thereof for preventing and treating inflammatory disease. The fusion peptide of the present invention inhibits expension of rheumatoid arthritis by adhesion and migration of sinoviocytes and may be used for preventing or treating inflammatory disease by inhibiting infiltration of immune cells. | 2014-05-29 |
20140147454 | TERMINALLY MODIFIED RNA - The invention relates to compositions and methods for the manufacture and optimization of modified mRNA molecules via optimization of their terminal architecture. | 2014-05-29 |
20140147455 | ANTIGEN SURROGATES IN AUTOIMMUNE DISEASE - The present invention provides for the identification of an antigen surrogate to the native antigens for the autoimmune disease pemphigus vulgaris. Ligands are discovered using large random peptoid or cyclic peptoid libraries that are screened against known antibodies to autoimmune diseases. The ligands may be useful as drugs in the treatment of such diseases and can also be used in combination with the comcomitant removal of T-cells associated with autoimmune disorders. | 2014-05-29 |
20140147456 | CETP FRAGMENTS - The present invention relates to a peptide consisting of 6 to 20 amino acid residues and being derived from amino acid sequence VFKGTLKYGYTTAWWLGIDQSIDFEIDSAI (SEQ ID No. 23), wherein said peptide comprises amino acid sequence WWLGID (SEQ ID No. 24) and antibodies binding to these peptides. | 2014-05-29 |
20140147457 | RECOMBINANT HVT VECTORS EXPRESSING ANTIGENS OF AVIAN PATHOGENS AND USES THEREOF - The present invention provides recombinant herpesvirus of turkeys (HVT) vectors that contain and express antigens of avian pathogens, compositions comprising the recombinant HVT vectors, polyvalent vaccines comprising the recombinant HVT vectors and one or more wild type viruses or recombinant vectors. The present invention further provides methods of vaccination against a variety of avian pathogens and method of producing the recombinant HVT vectors. | 2014-05-29 |
20140147458 | NOVEL VARICELLA-ZOSTER VIRUS STRAINS, AND CHICKEN POX AND HERPES ZOSTER VIRUS VACCINE USING SAME - The present invention relates to novel Varicella-zoster virus strain and to a chicken pox and herpes zoster virus vaccine using the same. More particularly, the present invention relates to genome DNA of VZV MAV/06 strain isolated from a Korean patient, to an open reading frame (ORF) thereof, to a protein coded by the genome DNA of VZV MAV/06 strain and the ORF thereof, and to a vaccine composition which contains the protein as an active ingredient. | 2014-05-29 |
20140147459 | COMPUTATIONALLY OPTIMIZED BROADLY REACTIVE ANTIGENS FOR H1N1 INFLUENZA - Described herein is the generation of optimized H1N1 influenza HA polypeptides for eliciting a broadly reactive immune response to H1N1 influenza virus isolates. The optimized HA polypeptides were developed through a series of HA protein alignments, and subsequent generation of consensus sequences, based on selected H1N1 viruses isolated from 1918-2012. Provided herein are optimized H1N1 HA polypeptides, and compositions, fusion proteins and VLPs comprising the HA polypeptides. Further provided are codon-optimized nucleic acid sequences encoding the HA polypeptides. Methods of eliciting an immune response against influenza virus in a subject are also provided by the present disclosure. | 2014-05-29 |
20140147460 | TRUNCATED L1 PROTEIN OF HUMAN PAPILLOMAVIRUS TYPE 33 - The present invention relates to a truncated L1 protein of Human Papillomavirus (HPV) Type 33, a sequence encoding the same, a method for preparing the same, and a virus-like particle comprising the same, wherein the protein and the virus-like particle are useful for preventing HPV (particularly HPV33) infection, and a disease caused by HPV (particularly HPV33) infection, such as cervical cancer. The invention also relates to the use of the protein and the virus-like particle in the preparation of a pharmaceutical composition or a vaccine for preventing HPV (particularly HPV33) infection, and a disease caused by HPV (particularly HPV33) infection, such as cervical cancer. | 2014-05-29 |
20140147461 | POLYPEPTIDES FOR INDUCING A PROTECTIVE IMMUNE RESPONSE AGAINST STAPHYLOCOCCUS AUREUS - The present invention features polypeptides comprising an amino acid sequence structurally related to SEQ ID NO: 1 and uses of such polypeptides and compositions thereof. SEQ ID NO: 1 is a full length | 2014-05-29 |
20140147462 | COMPOSITIONS AND METHODS FOR TREATMENT OF HEMATOLOGICAL MALIGNANCIES - Use of a chimeric protein selected from the group consisting of CTLA4-FasL and CD40-FasL proteins for treatment of lymphoma and/or a multiple myeloma and/or a leukemia as described herein, and pharmaceutical compositions and methods of treatment thereof. | 2014-05-29 |
20140147463 | VACCINE AGAINST RSV - Provided is a vaccine against respiratory syncytial virus (RSV), comprising a recombinant human adenovirus of serotype 26 that comprises nucleic acid encoding a RSV F protein or immunologically active part thereof. | 2014-05-29 |
20140147464 | METHOD AND COMPOSITION FOR INDUCING AUTOPHAGY - A method for inducing autophagy in a subject having an autophagy defect is provided. The method of the present invention includes the step of administering to the subject a therapeutically effective amount of a | 2014-05-29 |
20140147465 | RECOMBINANT GALLID HERPESVIRUS 3 (MDV SEROTYPE 2) VECTORS EXPRESSING ANTIGENS OF AVIAN PATHOGENS AND USES THEREOF - The present invention provides recombinant Gallid herpesvirus 3 (MDV-2) vectors that contain and express antigens of avian pathogens, recombinant Gallid herpesvirus 3 (MDV-2) vectors that contain a mutated gC gene, compositions comprising the recombinant Gallid herpesvirus 3 (MDV-2) vectors, polyvalent vaccines comprising the recombinant Gallid herpesvirus 3 (MDV-2) vectors and one or more wild type viruses or recombinant vectors. The present invention further provides methods of vaccination against a variety of avian pathogens and method of producing the recombinant Gallid herpesvirus 3 (MDV-2) vectors. | 2014-05-29 |
20140147466 | RECOMBINANT LOW VIRULENCE BOVINE HERPESVIRUS-1 (BOHV-1) VACCINE VECTORS - The present disclosure teaches generally in the field of vaccination and disease control in cattle and bovine animals. A recombinant bovine herpesvirus 1 (BoHV-1) vaccine vector is provided for efficient control of one or more bovine pathogens such as those associated with bovine respiratory disease complex, such as bovine viral diarrhea virus (BVDV), and which ameliorates disease conditions caused thereby. Protocols for the management of confined or herded bovine animals are also enabled herein. | 2014-05-29 |
20140147467 | Novel broth medium and blood free solid media - The present invention relates to new contamination resistant artificial media for the routine cultivation of | 2014-05-29 |
20140147468 | LPRG AS A CHAPERONE OF IMMUNE ADJUVANTS - An adjuvant combination that stimulates immune activation or response includes a hydrophobic immune adjuvant and a pathogen derived lipoprotein that chaperones the hydrophobic immune adjuvant to an immune receptor. | 2014-05-29 |
20140147469 | PROCESS FOR DETERGENT-FREE PRODUCTION OF OUTER MEMBRANE VESICLES OF A GRAM-NEGATIVE BACTERIUM - The present invention relates to the fields of medical microbiology and vaccines. In particular the invention relates to a process for detergent-free preparation of outer membrane vesicles (OMV) of Gram negative bacteria for use in vaccines, to OMV obtainable by said process, and to a pharmaceutical composition comprising such OMV. The present invention further relates to the use of OMV of the present invention as a medicament in particular for use in a method for eliciting an immune response. | 2014-05-29 |
20140147470 | METHODS OF PREDICTING HOST RESPONSIVENESS TO CANCER IMMUNOTHERAPIES BY EX VIVO INDUCTION OF LEUKOCYTE-FUNCTION-ASSOCIATED mRNAs - Embodiments of the invention relate generally to ex vivo methods of quantifying expression of leukocyte-function associated mRNAs and using the quantification to characterize an individual's potential responsiveness to cancer immunotherapy. Certain embodiments relate to methods to monitor the efficacy of ongoing cancer immunotherapy by evaluating expression of leukocyte-function associated mRNAs genes before and administration of an anti-cancer immunotherapy regimen. | 2014-05-29 |
20140147471 | IMMUNOSTIMULATORY COMPOSITIONS AND METHODS OF USE THEREOF - Immunostimulatory compositions and methods of use are described to either enhance or diminish the immune stimulation effects of a honey or honey isolate by recognition of the presence of type II arabinogalactan compounds and utilising this knowledge to tailor the concentration of such compounds thereby adjusting the immune stimulation effects. | 2014-05-29 |
20140147472 | BIOADHESIVE COMPOSITION AND DEVICE FOR REPAIRING TISSUE DAMAGE - Provided is a bioadhesive composition and device including same, the composition including a polymeric matrix and at least one synthetic bioadhesive polymer carried by the polymeric matrix, the polymeric matrix including at least one synthetic thermoplastic polymer characterized by one or more of (a) an average molecular weight in the range of between 20,000 Da to 90,000 Da; and (b) it includes polycaprolactone (PCL); wherein exposure to heat causes the bioadhesive composition to transform into a non-solid state and to cohesively adhere to a biological tissue upon subsequent cooling thereof. Also provided herein are methods of preparing the composition or device, and use of the composition or device in therapy, e.g. for treating hernia. | 2014-05-29 |
20140147473 | Functional Nanostructured "Jelly Rolls" with Nanosheet Components - The present disclosure relates to multilayered materials that are designed to roll spontaneously into micron-sized, cylindrical “jelly roll” or scroll structures. Specifically in this disclosure, at least one of the layers is comprised of a nanosheet material. | 2014-05-29 |
20140147474 | PHARMACEUTICAL EMULSION COMPOSITIONS COMPRISING PROGESTOGEN - Described are a sterile, ready-to-use, pharmaceutical oil-in water emulsion compositions for parenteral administration comprising:
| 2014-05-29 |
20140147475 | VACCINE TO PROTECT A RUMINANT AGAINST PNEUMONIA CAUSED BY PASTEURELLA MULTOCIDA - The present invention pertains to a vaccine comprising live attenuated | 2014-05-29 |
20140147476 | ORGANIC NANOTUBE HAVING HYDROPHOBIZED INNER SURFACE, AND ENCAPSULATED MEDICINAL AGENT PREPARED USING THE NANOTUBE - Provided is an organic nanotube having a hydrophobized inner surface, formed by molecules including an asymmetric bipolar lipid molecule represented by the following General Formula (1) and a derivative thereof represented by the following General Formula (2), wherein the organic nanotube has a hydrophilized outer surface and a hydrophobized inner surface of a hollow cylinder and is formed by binary self-assembly, the organic nanotube encapsulates a hydrophobic guest in the hollow cylinder, has a function of refolding a denatured protein, and has a function of sustainably-releasing a hydrophobic drug according to the change in hydrophobicity of the inner surface of the tube or external stimulus, | 2014-05-29 |
20140147477 | PRODRUGS OF (1S,9S)-9-[[(1S)-1-CARBOXY-3-PHENYLPROPYL]AMINO]OCTAHYDRO-10-OXO-6H-PYRID- AZINO[1,2-A][1,2]DIAZEPINE-1-CARBOXYLIC ACID AND THEIR USE IN TRANSDERMAL THERAPEUTIC SYSTEMS - The present invention relates to diester prodrugs of cilazaprilate which undergo enzymatic cleavage to release the active metabolite cilazaprilate that is used for the treatment of hypertension and congestive heart failure. Furthermore the diester prodrugs of cilazaprilate possess all the properties necessary to be topically administered, preferably via transdermal therapeutic systems. | 2014-05-29 |
20140147478 | MICROCUP COMPOSITIONS - The present invention is directed to a composition for preparing the microcups and the toughness of the display panel formed from such a composition may be significantly improved. In some cases, the panel may have an elongation at break of more than 10% and it can be completely peeled off from the substrate layer on which it is formed, without causing any damage to the panel. | 2014-05-29 |
20140147479 | METHOD OF SOFT TISSUE AUGMENTATION - Particles according to the invention are made of a viscoelastic medium, are injectable gel particles, and have a size, when subjected to a physiological salt solution, in the range of from 1 to 5 mm. The particles are useful in a soft tissue augmentation implant. The implant comprises particles of a viscoelastic medium, wherein a major volume of the particles are injectable gel particles according to the invention. The implant is useful in a method of soft tissue augmentation in a mammal, including man, comprising subepidermal administration at a site in said mammal where soft tissue augmentation is desirable, of an implant according to the invention. | 2014-05-29 |
20140147480 | SYNTHESIS AND USE OF TRANS-1,3,3,3-TETRAFLUOROPROPENE/VINYLIDENE FLUORIDE COPOLYMERS - A copolymer comprising trans-1,3,3,3-tetrafluoropropene units and vinylidene fluoride units, and methods of making the same. A method of preventing biofouling on an article of manufacture, comprising applying such copolymer to the article of manufacture. A process of preparing a surface having a surface energy of between about 20 and about 30 mJ/m | 2014-05-29 |
20140147481 | ANTI-INFLAMMATORY AND QUORUM SENSING INHIBITION COMPOUNDS AND METHODS OF MAKING AND USING THEM - The invention provides novel compositions based on a structure designated as “Honaucin A”, including Honaucin A variants and analogs, and pharmaceutical compositions, liposomes and nanoparticles comprising them, and methods of making and using them. In one embodiment these Honaucin A compounds, and variants and analogs thereof are used to ameliorate (including to treat or prevent) inflammation. In one embodiment, these Honaucin A compounds, and variants and analogs thereof are used to ameliorate (including to treat or prevent) inflammation. In one embodiment, these Honaucin A compounds, and variants and analogs thereof are used as bacterial quorumsensing inhibitors. Accordingly, in alternative embodiments the compositions of the invention are used as anti-bacterial agents. | 2014-05-29 |
20140147482 | ARTIFICIAL TISSUE CONSTRUCTS COMPRISING ALVEOLAR CELLS AND METHODS FOR USING THE SAME - The present invention comprises artificial tissue constructs that serve as in vitro models of mammalian lung tissue. The artificial tissue constructs of the present invention comprise functionally equivalent in vitro tissue scaffolds that enable immunophysiological function of the lung. The constructs can serve as novel platforms for the study of lung diseases (e.g., interstitial lung diseases, fibrosis, influenza, RSV) as well as smoke- and smoking-related diseases. The artificial tissue constructs of the present invention comprise the two components of alveolar tissue, epithelial and endothelial cell layers. | 2014-05-29 |
20140147483 | CONFORMAL COATING OF CELLS FOR IMMUNOISOLATION - Hydrodynamic methods for conformally coating non-uniform size cells and cell clusters for implantation, thus preventing immune rejection or inflammation or autoimmune destruction while preserving cell functionality. A method for conformally coating cells and c clusters with hydrogels that are biocompatible, mechanically and chemically stable and porous, with an appropriate pore cut-off size. The methods of the invention are advantageously reproducible and result in a relatively high yield of coated versus non-coated cell clusters, without compromising cell functionality. Conformal coating devices configured to perform the methods of the invention, methods of optimally utilizing said devices and purifying the coated islets, and coated biomaterials made by said methods. | 2014-05-29 |
20140147484 | Cell-Free Tissue Engineered Vascular Grafts - A composition containing a macrophage inhibitor may be administered in an effective amount to prevent, inhibit or reduce restenosis, thrombus or aneurysm formation in implanted polymeric vascular grafts. The composition may be administered prior to vascular graft implantation, at the same time as vascular graft implantation, following vascular graft implantation, or any combination thereof. Examplary macrophage inhibitors include bisphosphonates, anti-folate drugs and antibodies, preferably in a controlled release or liposomal formulation. | 2014-05-29 |
20140147485 | POLYMER FOR CREATING HEMOCOMPATIBLE SURFACE - A polymer comprising a phosphoryl choline moiety(ies), a composition comprising the polymer and optionally a bioactive agent, an implantable device such as a DES or a non-implantable device such as an angioplasty balloon comprising thereon a coating comprising the polymer and optionally a bioactive agent, and a method of using the device for the treatment of a disorder in a human being are provided. | 2014-05-29 |
20140147486 | IMPLANTS FOR THE TREATMENT OF DOPAMINE ASSOCIATED STATES - Biodegradable implants comprising dopamine modulating compounds are described. | 2014-05-29 |
20140147487 | Methods of Using Water-Soluble Inorganic Compounds for Implants - A method for controlling generation of biologically desirable voids in a composition placed in proximity to bone or other tissue in a patient by selecting at least one water-soluble inorganic material having a desired particle size and solubility, and mixing the water-soluble inorganic material with at least one poorly-water-soluble or biodegradable matrix material. The matrix material, after it is mixed with the water-soluble inorganic material, is placed into the patient in proximity to tissue so that the water-soluble inorganic material dissolves at a predetermined rate to generate biologically desirable voids in the matrix material into which bone or other tissue can then grow. | 2014-05-29 |
20140147488 | FEED OR FOOD PRODUCT COMPOSITION - The present invention relates to a feed or food product composition which comprises a mixture of bovine colostrum, comprising bioactive components, and organic particulate matter having a size between 0.3 and 7 mm in diameter. The composition is especially adapted to deliver the mixture of bioactive bovine colostrum components to the digestive tract of a mammal. | 2014-05-29 |
20140147489 | RAPIDLY DISSOLVING FILM FOR DELIVERY OF AN ACTIVE AGENT - A rapidly dissolving film is provided for delivery of an active agent to a moist body surface, e.g., mucosal tissue. The film comprises a film-forming binder, a rapidly dissolving polymeric material, and an active agent. | 2014-05-29 |
20140147490 | HLA CLASS I A2 TUMOR ASSOCIATED ANTIGEN PEPTIDES AND VACCINE COMPOSITIONS - A composition or vaccine composition comprising at least one peptide that has less than 600 contiguous amino acids having 100% identity to a native sequence of CEA, HER2/neu, MAGE2, MAGE3, or p53, the peptide further comprising at least one epitope selected from Table 6. | 2014-05-29 |
20140147491 | TREATMENT OF AUTISM SPECTRUM DISORDERS USING GLYCYL-L-2-METHYLPROLYL-L-GLUTAMIC ACID - This invention provides compounds, compositions and methods for treating Autism Spectrum Disorders (ASD) using glycyl-2-methylprolyl-glutamic acid (G-2-MePE) and analogs thereof. Autism Spectrum Disorders include Autism, Autistic Disorder Asperger Syndrome, Childhood Disintegrative Disorder, Pervasive Developmental Disorder—Not Otherwise Specified (PDD-NOS), Fragile X Syndrome, and Rett Syndrome. Compositions containing compounds include water-soluble formulations, water-in-oil micro-emulsions, water-in-oil coarse emulsions, water-in-oil liquid crystals, nanocapsules, tablets, and orally administered gels. The compounds and compositions of this invention can be administered intravenously, intraventricularly, parenterally, or orally, and can be effective in treating neurodegeneration, promoting neurological function, treating seizure activity and other symptoms of ASD, and can prolong life in animals including human beings having Autism Spectrum Disorders. | 2014-05-29 |
20140147492 | METHODS AND COMPOSITIONS FOR ENHANCING THE UPTAKE OF THERAPEUTIC AGENTS BY TARGET CELLS - The present invention relates to a new use of a known medicament. Specifically, the invention relates to methods and compositions for enhancing the therapeutic efficacy of a therapeutic agent by increasing the uptake of the therapeutic agent by target cells, and in particular relates to a pharmaceutical composition comprising a regulating agent of lipid raft/caveolae-dependent endocytic pathway and some therapeutic agents, such as anti-tumor agents. The invention also relates to a method for screening a regulating agent of lipid raft/caveolae-dependent endocytic pathway capable of enhancing the therapeutic efficacy of anti-tumor agents. | 2014-05-29 |
20140147493 | PCR-BASED GENE DELIVERY CARRIER AND METHOD FOR PREPARING THE SAME - Disclosed is an efficient carrier for gene delivery to cells based on PCR. The PCR-based gene delivery carrier includes: a shell composed of neutral liposomes; and template DNA and PCR components including polymerase, dNTPs and primers for amplification of the template DNA by PCR, within an inner space defined by the shell. The gene delivery carrier enhances the gene loading efficiency of neutral liposomes without cytotoxicity. Further disclosed is a method for preparing the gene delivery carrier. | 2014-05-29 |
20140147494 | Delivery Substrates From Aligned Polymer Biomaterials For Tissue Repair - An aligned polymer article including substrates, wherein the substrates are not covalently bonded to the aligned collagen and a method of forming such articles wherein substrates are mixed with a polymer in solution to form a polymer-substrate mixture. The mixture is placed in an electrochemical cell and a voltage is applied to the cell generating a pH gradient, wherein the polymer aligns in the cell and migrates to the isoelectric plane of the polymer solution. | 2014-05-29 |
20140147495 | MicroRNA-Based Methods and Compositions For the Diagnosis, Prognosis and Treatment of Breast Cancer - The present invention provides novel methods and compositions for the diagnosis, prognosis and treatment of breast cancer. The invention also provides methods of identifying anti-breast cancer agents. | 2014-05-29 |
20140147496 | COMPOSITION AND METHOD FOR FERTILITY THERAPY USING NUTRITIONAL SUPPLEMENTS - A new composition and method are described for male fertility therapy. In one particular embodiment, the composition comprises Lepidium meyenii, carnitine and Coenzyme Q10. When it is administered to males as fertility therapy following the recommended therapeutic regimen, enhanced sperm count, sperm quality, and sperm motility results. | 2014-05-29 |
20140147497 | PEDIATRIC FORMULATION - The present invention is directed to pediatric formulation of (R)-N-[-1-(1-naphthyl)-ethyl]-3-[3-(trifluoromethyl)phenyl]propan-1-amine hydrochloride (hereinafter referred to as Cinacalcet HCl) and method of administering the same. | 2014-05-29 |
20140147498 | COMPOSITIONS CONTAINING COENZYME Q-10 AND DIHYDROLIPOIC ACID - The invention describes compositions, including soft gelatin capsules, that include dihydrolipoic acid and the reduced form of coenzyme Q | 2014-05-29 |
20140147499 | ABUSE-PROOFED ORAL DOSAGE FORM - The present invention relates to an abuse-proofed oral dosage form with controlled release of (1R,2R)-3-(3-dimethylamino-1-ethyl-2-methyl-propyl)phenol for once daily administration, which comprises the active ingredient and/or one or more of the pharmaceutically acceptable salts thereof (A), at least one synthetic or natural polymer (C), delayed-release auxiliary substances, optionally physiologically acceptable auxiliary substances (B) and optionally a wax (D), component (C) or (D) in each case exhibiting a breaking strength of at least 500 N, preferably of at least 1000 N. | 2014-05-29 |
20140147500 | Preparation and Use of Combination Enzyme and Gastrointestinal Modulator Delivery Systems - Pharmaceutical compositions comprising one or more digestive enzymes and one or more gastrointestinal modulators of acid are provided. The one or more digestive enzymes may be coated, e.g., with a lipid. Also disclosed are methods for their use and controlled delivery in treating individuals with neurological, behavioral, infectious, or genetic diseases or conditions susceptible to treatment with digestive enzymes. | 2014-05-29 |
20140147501 | METHOD FOR THE EMBEDDING AND ENCAPSULATION OF COMPONENTS - Controlled release, discrete, solid particles which contain an encapsulated and/or embedded component such as a heat sensitive or readily oxidizable pharmaceutically, biologically, or nutritionally active component are continuously produced without substantial destruction of the matrix material or encapsulant. A release-rate controlling component is incorporated into the matrix to control the rate of release of the encapsulant from the particles. The additional component may be a hydrophobic component or a high water binding capacity component for extending the release time. The plasticizable matrix material, such as starch, is admixed with at least one plasticizer, such as water, and at least one release-rate controlling component under low shear mixing conditions to plasticize the plasticizable material without substantially destroying the at least one plasticizable material and to obtain a substantially homogeneous plasticized mass. The plasticizer content is substantially reduced and the temperature of the plasticized mass are substantially reduced prior to admixing the plasticized mass with the encapsulant to avoid substantial destruction of the encapsulant and to obtain a formable, extrudable mixture. The mixture is extruded through a die without substantial or essentially no expansion and cut into discrete, relatively dense particles. Release properties may also be controlled by precoating the encapsulant and/or coating the extrudate particles with a film-forming component. | 2014-05-29 |
20140147502 | HYDROLYSATES MADE OF PLANT EXTRACTS AND ANTIBACTERIAL AGENT CONTAINING THE SAME - The present invention relates to an antibacterial agent and a hydrolysate made of at least one extract that has been produced by extraction using ethanol/water from dried plant material of: a) at least one of the plants selected from the group consisting of: | 2014-05-29 |
20140147503 | Pharmaceutical Composition Comprising Deferasirox - The present invention relates to a pharmaceutical composition comprising deferasirox, a process for preparing such pharmaceutical composition, and its use in the treatment of chronic iron overload. The pharmaceutical composition comprises nanosized deferasirox having improved surface area and solubility. It also relates to a method for treatment of chronic iron overload which comprises administering a pharmaceutical composition comprising nanosized deferasirox. | 2014-05-29 |
20140147504 | TETRACYCLINE TOPICAL FORMULATIONS, PREPARATION AND USES THEREOF - The invention relates to a topical suspension formulation that includes a tetracycline, a liquid medium and a polymeric gelling agent. The tetracycline may be in the form of its pharmaceutically acceptable salts, hydrates, or polymorphs and is in a suspended form within the formulation. The liquid medium is selected such that it does not dissolve or substantially minimally dissolves the tetracycline. The gelling agent is a polymeric hydrocarbon gelling agent. Preferably, the tetracycline has a particle size of less than or equal to about 20 microns. | 2014-05-29 |
20140147505 | SOLID PHARMACEUTICAL DOSAGE FORM OF TICAGRELOR - The present invention relates to a solid pharmaceutical dosage form comprising ticagrelor as pharmaceutically active ingredient, to certain particles of ticagrelor and to processes of preparing the same. | 2014-05-29 |
20140147506 | Delivery of Submicrometer and Nanometer Aerosols to the Lungs using Hygroscopic Excipients or Dual Stream Nasal Delivery - Pharmaceutically engineered aerosols (e.g. submicrometer and nano-particles and droplets) containing a hygroscopic growth excipient or agent are employed to improve the delivery of respiratory aerosols to the lung. Inclusion of the hygroscopic agent results in near zero depositional loss in the nose-mouth-throat regions and near 100% deposition of the aerosol in the lung. Targeting of the aerosol to specific lung depths is also possible. In addition, methods and apparatuses for delivering aerosols to the lung are provided. The aerosol is delivered to one nostril of a patient while a relatively high humidity gaseous carrier is delivered to the other nostril, resulting in post-nasopharyngeal growth of the aerosol to a size that promotes deposition in the lung. | 2014-05-29 |
20140147507 | CARBIDE-DERIVED-CARBON-BASED OXYGEN CARRIERS - An oxygen delivery system is disclosed. The basis of the oxygen deliver system is a carbide-derived carbon (CDC). The CDC can be tuned to carry O | 2014-05-29 |
20140147508 | Nano-Carrier, Complex of Anticancer Drug and Nano-Carrier, Pharmaceutical Composition Thereof, Method for Manufacturing the Complex, and Method for Treating Cancer by Using the Pharmaceutical Composition - The present invention relates to a nano-carrier for an anticancer drug, which comprises: a metal nanoparticle; and a polynucleotide for connecting with an anticancer drug having a pyrimidine group or a purine group, wherein the polynucleotide is connected to a surface of the metal nanoparticle, and the anticancer drug is bound to the polynucleotide through the pyrimidine group or the purine group. In addition, the present invention also provides a complex of an anticancer drug and a nano-carrier, a pharmaceutical composition thereof, a method for manufacturing the complex, and a method for treating a cancer by using the pharmaceutical composition. | 2014-05-29 |
20140147509 | MICROORGANISM COMPRISING PARTICLES AND USES OF SAME - A particle is disclosed. The particle comprising: (i) at least one inner core which comprises a solid matrix of nutrients for microorganism growth; (ii) an inner membrane being fabricated from a water-soluble polymer, the inner membrane surrounding the inner core and a population of dried microorganisms; and (iii) an outer porous membrane surrounding the inner membrane, the outer porous membrane being insoluble in water. Methods of generating same, propagating microorganisms within and uses of same are also disclosed. | 2014-05-29 |
20140147510 | MULTIPHASIC POLYMERIC PARTICLES CAPABLE OF SHAPE-SHIFTING VIA ENVIRONMENTAL STIMULATION - Provided herein are methods of making and controlling multiphasic polymeric micro-components capable of shape-shifting. Such a multiphasic micro-component comprises a first phase (that can include a first polymer) and at least one additional phase distinct from said first phase (that can include a second polymer). One or more of the first phase and additional phase comprises a component that is responsive to an external stimulus. Thus, the micro-component exhibits a substantial physical deformation in response to: (i) the presence of the external stimulus or (ii) a change in the external stimulus. Exemplary external stimuli include temperature, pressure, light, pH, ionic strength, hydrophobicity/hydrophilicity, solvent, concentration, a stimulator chemical, sonic energy, electric energy, pressure, magnetic fields, and combinations thereof. | 2014-05-29 |
20140147511 | METHODS OF PROCESSING FETAL SUPPORT TISSUES, FETAL SUPPORT TISSUE POWDER PRODUCTS, AND USES THEREOF - Disclosed herein, are methods of preparing fetal support tissue powders. Further disclosed herein, are methods of using the fetal support tissue powder product. | 2014-05-29 |
20140147512 | DENTAL MINERALIZATION - A method is provided for mineralizing a dental surface or subsurface including contacting the dental surface with a protein disrupting agent and stabilized amorphous calcium phosphate (ACP) or amorphous calcium fluoride phosphate (ACFP). | 2014-05-29 |
20140147513 | Aqueous Microbicidal Compositions Comprising Copper Ions - Largely aqueous, liquid inanimate surface treatment compositions which impart a microbicidal benefit to treated surfaces which compositions comprise (or in certain preferred embodiments may consist essentially of, or may consist of): a copper source material which releases copper ions into the treatment composition, 0% wt. and up to but excluding 20% wt. of at least one alcohol which independently of other constituents present exhibits a microbicidal effect, at least one quaternary ammonium compound which provides a microbicidal benefit, optionally but very preferably at least one detersive surfactant, further, optionally one or more further constituents which impart one or more advantageous technical or aesthetic benefits to the compositions, including one or more detersive surfactants, and water, wherein the compositions are at a pH such that the surface treatment compositions, exhibit a microbicidal or germicidal or antimicrobial effect on treated inanimate surfaces or when used to treat an airspace, e.g. ambient air, characterized in exhibiting a microbicidal benefit when tested against one or more challenge microorganisms, preferably against Poliovirus type 1 Sabin (“PV1”), according to one or more of the following standardized test protocols: ASTM E1052 Standard Test Method for Efficacy of Antimicrobial Agents against Viruses in Suspension, or ASTM E1053 Standard Test Method to Assess Virucidal Activity of Chemicals Intended for Disinfection of Inanimate, Nonporous Environmental Surfaces, or European Standard Surface Test, EN13697, or AOAC Germicidal Spray Products as Disinfectant Test Method, AOAC Index, 17 | 2014-05-29 |
20140147514 | EXTRACTION OF VITAMINS AND MINERALS FROM PLANT MATTER - A process for extracting vitamins and minerals from a first plant matter(s) is disclosed wherein the said first plant matter(s) is treated with acidic matter followed by extraction with water. Said treatment converts the water-insoluble vitamins and minerals into water-soluble forms leading to a more comprehensive extraction with better yields of the plant constituents. Suitable selection of the first and second plant matter(s) and their proportions yields an extract that is a ready-made formulation of the desired vitamins and minerals in RDA quantities. Other advantages are reduced processing times and processing steps. Extraction of guava fruits, guava leaves, holy basil leaves, lemon peels, amla fruits, annato seeds, Wrightia tinctoria, Lantana camara, bamboo shoots, mustard seeds, and curry leaves is described. | 2014-05-29 |
20140147515 | Methods And Compositions For Controlling Parasitic Infections Of Animals - A composition for preventing or reducing harmful effects of protozoal infection is provided, comprising in one embodiment a yeast cell wall and a preparation derived from oregano. The composition may further include a mineral nutrient selected from selenium and/or zinc. The composition may also include a preparation derived from Yucca. Efficacy of the composition is shown against a variety of protozoal organisms. | 2014-05-29 |
20140147516 | POLYMORPHISMS PREDICTIVE OF PLATINUM-COORDINATING COMPOUND-INDUCED OTOTOXICITY - Methods of determining a subject's ototoxicity risk from administration of a pharmacotherapeutic compound having an ototoxicity risk, methods of administering a pharmacotherapeutic compound having an ototoxicity risk and oligonucleotides, peptide nucleic acids, arrays, and addressable collections for performing embodiments of the methods are provided herein. | 2014-05-29 |
20140147517 | Use of Amisulpride as an Anti-Emetic - Amisulpride is used in the therapy of nausea, vomiting or retches. The therapy may utilize a novel injectable formulation, in unit dosage form, comprising less than 50 mg amisulpride. | 2014-05-29 |
20140147518 | SOLUTIONS COMPRISING POLYETHYLENE GLYCOL AND ELECTROLYTES - The invention provides a solution in water comprising the following components at the following concentrations:
| 2014-05-29 |
20140147519 | Migraine Treatment - A migraine treatment formulation is designed to be administered upon onset of migraine symptoms. The migraine treatment formulation is able to reduce the nausea and pain associated with a migraine headache through a pharmaceutical composition that carries a reduced chance of causing digestive discomfort. The treatment formulation accomplishes this through a combination of organic and inorganic agents, administered orally, that are optimized for absorption through the mucosal membrane and the lining of the stomach. The higher absorption rate of the active constituents quickly alleviates the various symptoms associated with a migraine headache while preventing unabsorbed constituents from causing digestive issues. | 2014-05-29 |
20140147520 | Water-based Personal Moisturizers and Lubricants, in Particular Vaginal Lubricants, and Uses Thereof - There is a need for water-based sperm- and egg-friendly vaginal lubricant. We describe novel water-based nature-friendly personal moisturizers and lubricants that relieve vaginal dryness. In addition to being non-spermicidal, sperm- and egg-friendly and biological-fluids mimicking, these personal moisturizers and lubricants also enhance sperm survival and motility, promote binding of sperm to eggs and facilitate the process of fertilization. Novel articles, and systems as well as methods of preparation and use of the novel compositions are also provided. | 2014-05-29 |
20140147521 | BREATH ALCOHOL EQUALIZATION COMPOSITION - There is provided a residual mouth alcohol inhibitor configured as an oral composition that absorbs residual mouth alcohol that remains in the mouth of an individual following the consumption of alcohol. The oral composition comprises a combination of sodium bicarbonate, calcium carbonate, parsley, kelp, fructose, citric acid, natural flavors, artificial flavors, maltodextrin, and silicon dioxide whereby the ratio of sodium bicarbonate to calcium bicarbonate in the composition is approximately 1:1 and the ratio of sodium bicarbonate to parsley in the composition is approximately 2:1 and the ratio of parsley to kelp in the composition is approximately 4:1. | 2014-05-29 |
20140147522 | GASTRIC HEALTH SUPPLEMENT AND METHODS THEREOF - The invention provides novel compositions that can be used as a supplement (e.g. feed supplement) to animals such as, horses. In certain embodiments, the composition comprises an effective amount of a preparation obtained from sea buckthorn and an effective amount of an amino acid. In other embodiments, the composition includes specific combinations of components selected from the group of a preparation obtained from sea buckthorn, glutamine, aloe vera extract, pectin, and lecithin. The invention also provides methods and uses of the composition for alleviating, treating or preventing an ulcer-related condition in a subject identified in need thereof. | 2014-05-29 |
20140147523 | EXTRACTS OF SOLANUM ESURIALE AND SOLANUM GLAUCOPHYLLUM AND METHODS OF TREATING SKIN - The present invention relates to compositions comprising extracts of | 2014-05-29 |
20140147524 | Truely Re'Vived - Truely Re'Vived is a Natural, holistic product line that allows an alternative choice for a natural way of life. By combining key natural ingredients Truely Re' Vived sets forth the natural healing processes (faster than the normal pace) without the use of chemicals. Truly Re'Vived's has a variety of phenomenal products: “Earth” was created to heal a variety of skin disorders. “Wind” was created to revive, and restore the balance of all grades of hair, giving it life. “Sun” was created to moisturize and heal lip irritancies. “Moon” is a Body Lotion that revitalizes the skins for a healthy appearance. Truely Re'Vived is the alternative to medicine and a true gift that the worlds needs. | 2014-05-29 |
20140147525 | Two Component Systems For Delivering Stabilized Ascorbic Acid - Stable, topical compositions comprising high levels of ascorbic acid are provided, which comprise an anhydrous component containing at least 15 weight % ascorbic acid and an oil-in-water emulsion component combined at the point of use. Such compositions provide increased permeation of ascorbic acid. | 2014-05-29 |