11th week of 2010 patent applcation highlights part 49 |
Patent application number | Title | Published |
20100069209 | METHOD AND INSTALLATION FOR ASSEMBLING A COMPOSITE BOX - The invention relates to a method for assembling a composite box, in two parts, the method being implemented by a machine having: a conveyor system for bringing an envelope into position; a store for storing the blanks of the trays; means in the form of extractor arms for removing one of the tray blanks from the store and bringing it to the assembly station, facing the envelope; a device for gluing the edges of the envelope and the tongues of the tray blank during the movement towards the assembly station; a framework having two mobile carriages, a first carriage carrying a die for shaping the blank, and a second carriage carrying a tappet for driving the envelope towards the die and a stamp maintaining a counter-pressure using a suitable device against the pressing device of the die. | 2010-03-18 |
20100069210 | EQUIPMENT FOR MAKING A DUAL COMPONENT PACK TRAY - Apparatus for making a pack tray includes a body with a strip of side walls, the body including an outer envelope lined on the inside with an added sealed plastic film. The apparatus includes at least one station provided with elements for applying glue on a portion at least of the inner surface of the side wall strip of the outer envelope, also called gluing area, before placing a plastic film. The gluing pads include at least one block of a porous material that can, one the one hand, be filled with glue by loading members through a diffusion phenomenon, and that can deposit glue by contact optionally combined with a compression force on the gluing area. The pad is mounted on a bearing structure via members for handling it between expanded positions in which the pad contacts the gluing area for applying glue thereon and a folded position in which the gluing pad is remote from the outer envelope of the pack tray. | 2010-03-18 |
20100069211 | METHOD OF PRODUCING HIGH BURST ZIPPER ASSEMBLIES FOR LARGE RECLOSABLE PACKAGES - The present disclosure relates to a method for producing a high burst slider zipper which allows for bottom filling of reclosable packages, such as large bags, and further provides increased resistance to damage from the dropping or shock loading of the filled package. This is achieved by providing a peel seal or other frangible or separable connection between the zipper profiles, and by sealing a portion of one of the flanges to itself by a hard seal above the peel seal. This causes the external forces on a bag from bottom filling or shock loading to be directed toward the hard seal and further directed so as to cause a shear force against the peel seal, thereby increasing the resistance of the package to external forces. | 2010-03-18 |
20100069212 | APPARATUS AND A METHOD FOR MAKING PACKAGES AND A PACKAGE THEREOF - This invention provides an apparatus and a method for making package which has less rejection rate during manufacturing. The method in the present invention also produces packages with good dimensional accuracy. The apparatus in the present invention is provided for making three side gusset package with improved method of feeding side gusset tube and feeding bottom gusset along with web registration of bottom and side gusset to have printing perfectly located and aligned on package surfaces such that the images or graphics can be printed partially on front side & back side, continuing over side and bottom gusset surfaces. | 2010-03-18 |
20100069213 | Manufacturing Separable Pouches With A Center Cut Blade - A system for manufacturing a plurality of separable pouches comprising a means for forming sealed pouches, a center cut blade and a means for segregating each sealed pouch with the center cut blade is described. The means for forming the sealed pouches includes placing a plurality of different tablets corresponding to different medications into each sealed pouch. The center cut blade includes a side cut on each end of the blade, a center cut in the middle of the blade, and at least one perforation cut between each side cut and the center cut. The means for separating each sealed pouch with the center cut blade provides each sealed pouch with a sealed top end, a sealed bottom end, and two sides, in which at least one side is also sealed. | 2010-03-18 |
20100069214 | Outsert-Forming Method - A method and apparatus for forming informational items such as outserts and booklets may include (a) folding a sheet of paper having product information printed thereon by making a plurality of folds in the sheet of paper to form a first folded article; (b) making a plurality of folds in the first folded article in a second direction perpendicular to the first direction; and (c) making a final fold in the second direction to form an outsert using a folding apparatus having a pair of adjustably-spaced folding rollers having a nip therebetween and a movable blade member, with the folding rollers spaced apart by a distance within a range of 0.25 inches and 0.45 inches. Water scoring may be used to facilitate folding of the sheet of paper. | 2010-03-18 |
20100069215 | CENTRIFUGE AND CENTRIFUGING METHOD - A centrifuge includes a rotator comprising a receiving unit receiving materials and guiding the materials to move upward by centrifugal force to an upper portion of the receiving unit, and a rotator cover covering the upper portion of the receiving unit. The centrifuge also includes a container that is coupled to the rotator cover to be connected to the receiving unit and that receives the materials moved upward along the receiving unit. The centrifuge and a centrifuging method as disclosed herein are used for separating a fluid to which a large centrifugal force is applied and a fluid to which a smaller centrifugal force is applied by adjusting the rotation speed using the principle that centrifugal force during rotation varies according to specific components of a fluid. Thus, using the centrifuge and the centrifugal method, materials can be centrifuged and layers of the materials can be classified and collected accurately and easily. | 2010-03-18 |
20100069216 | CONTROL METHOD OF AUTOMATIC BALANCING CENTRIFUGE USING BALANCER - The present invention relates to a control method of a centrifuge using balancer wherein a balancer containing balls, a liquid, or both balls and a liquid are provided, thereby helping the rotor rotate more stably. | 2010-03-18 |
20100069217 | SOLID-LIQUID SEPARATOR - A liquid cyclone is configured for inflowing raw water containing impurities as targets of collection to be forced to swirl inside to spin down impurities contained in raw water, an inflow pipe is connected with an upper portion of the liquid cyclone to supply the liquid cyclone with raw water, and configured for supplied raw water to be forced to swirl inside the liquid cyclone, a connecting portion is connected with a lower portion of the liquid cyclone, and configured with a discharge port to discharge spun down impurities from the liquid cyclone, an impurity collector is connected to the liquid cyclone with the connecting portion in between, and configured to collect impurities discharged from the liquid cyclone, an obstacle is disposed in or near the discharge port, and cold to prevent impurities collected in the impurity collector from backing up into the liquid cyclone, and an outflow pipe is connected with a top portion of the liquid cyclone, and configured for raw water having got rid of impurities to outflow as treated water from the liquid cyclone; whereby impurities separated from raw water is prevented from being re-mixed in raw water, allowing for an enhanced separation performance. | 2010-03-18 |
20100069218 | PROCESS FOR THE PREPARATION OF CERAMIC GLASS MATERIAL IN THE FORM OF SHEETS, SHEETS THUS OBTAINED AND USE THEREOF - A process allowing to obtain ceramic glass material in the form of sheets of large dimensions usable in constructions for panelling or for flooring is described. | 2010-03-18 |
20100069219 | METHOD OF REFINING A LITHIUM ALUMINOSILICATE GLASS AND GLASS-CERAMIC OBTAINED - The present invention relates to a method of refining lithium aluminosilicate glass capable of being controllably ceramized and free of arsenic oxide, antimony oxide and tin oxide, in which at least 0.05% by weight of at least one sulfide is added to the glass batch materials and said materials are melted at a temperature below 1750° C. | 2010-03-18 |
20100069220 | Method Of Manufacturing S-Glass Fibers In A Direct Melt Operation And Products Formed There From - A method of forming high strength glass fibers in a refractory-lined glass meter, products made there from and batch compositions suited for use in the method are disclosed. The glass composition for use in the method of the present invention is up to about 64-75 weight percent SiO | 2010-03-18 |
20100069221 | Glass composition formulated for a glass-metal bond of a tube collector and glass-metal bond made with glass of said glass composition - The glass-metal bond for a tube collector includes a glass tube and metal part bonded to the glass tube. In order to match the thermal expansion properties, the glass tube has the following composition: SiO | 2010-03-18 |
20100069222 | GLASS COMPOSITION FOR LOW TEMPERATURE SINTERING, GLASS FRIT, DIELECTRIC COMPOSITION AND MULTILAYER CERAMIC CAPACITOR USING THE SAME - The invention relates to a glass composition and a glass frit adequate for low temperature sintering agent at 1,100° C. or less, and a dielectric composition and a multilayer ceramic capacitor using the same. The glass composition comprises aLi | 2010-03-18 |
20100069223 | METHOD FOR THE PREPARATION OF CERAMIC MATERIALS - A novel process for the preparation of boron carbide, boron nitride and silicon carbide powders comprises carbidization or nitrization step of boron oxide or silicon oxide respectively, using nanoparticles substrates. | 2010-03-18 |
20100069224 | CUBIC BORON NITRIDE CERAMIC COMPOSITES AND METHODS OF MAKING THEREOF - Composite materials composed of cubic boron nitride (cBN) and a matrix component of various ceramic oxides, nitrides, and solid solutions of matrix materials as well as whisker reinforcements. Methods of manufacture and their use in high performance machining of ferrous metals are also claimed and disclosed. | 2010-03-18 |
20100069225 | METHOD OF SOLID PCBN SYTHESIS - The invention generally relates to a sintered CBN composite compact having a non-CBN portion. The compact includes about 86 to about 90% CBN and the non CBN portion contains borides and nitrides of Al. The compact is for use as a cutting tool insert in continuous machining of gray cast iron. The sintered compact has a thermal conductivity of 1.25-4 W/cm/° K. in the temperature range of about 200° C. to about 600° C. and sonic velocity of at least about 14.5 Km/sec at room temperature. | 2010-03-18 |
20100069226 | Rare earth phosphate bonded ceramics - An oxide/oxide CMC matrix comprising a rare earth phosphate bonding agent incorporated in the matrix, an insulating layer on the matrix, or both. | 2010-03-18 |
20100069227 | CERAMICS FOR PLASMA TREATMENT APPARATUS - The present invention provides ceramics for a plasma-treatment apparatus which are excellent in corrosion resistance against a halogen-type corrosive gas, plasma, etc., attain reduction in resistance, and inhibit impurity metal contamination caused by composition materials of these ceramics even in a halogen plasma process, and which can be used suitably for the component of the plasma-treatment apparatus for manufacturing a semiconductor, a liquid crystal, etc. The ceramics are used which are prepared in such a way that 3% by weight to 30% by weight of a cerium oxide relative to yttria and 3% by weight to 50% by weight of niobium pentoxide relative to yttria are added to yttria, which are fired in a reducing atmosphere to have an open porosity of 1.0% or less. | 2010-03-18 |
20100069228 | ELECTROCHEMICAL CATALYSTS - A composition useful in electrodes provides higher power capability through the use of nanoparticle catalysts present in the composition. Nanoparticles of transition metals are preferred such as manganese, nickel, cobalt, iron, palladium, ruthenium, gold, silver, and lead, as well as alloys thereof, and respective oxides. These nanoparticle catalysts can substantially replace or eliminate platinum as a catalyst for certain electrochemical reactions. Electrodes, used as anodes, cathodes, or both, using such catalysts have applications relating to metal-air batteries, hydrogen fuel cells (PEMFCs), direct methanol fuel cells (DMFCs), direct oxidation fuel cells (DOFCs), and other air or oxygen breathing electrochemical systems as well as some liquid diffusion electrodes. | 2010-03-18 |
20100069229 | Method For Synthesising A Nano-Product - A method for the synthesis of nano-products, such as atomic titanium oxide wires. The method allows wires of anatase titanium oxide wires to be formed in a range of tunable diameters and aspect ratios in the nanometer and subnanometer size scales. The method also allows the titanium wires to be capped by oleic acid to enhance dispersing and solubility. The method allows the titanium wires to be surface doped with nitrogen species to enhance stability and functionality such as enhanced absorption in the visible wavelength region, which is useful for photodegradation of organic wastes in water by sunlight. | 2010-03-18 |
20100069230 | HETEROPOLY ACID CATALYST AND METHOD OF PREPARING THE SAME - The present invention relates to a heteropoly acid catalyst which is used for the production of methacrylic acid by gas phase oxidation of methacrolein and a preparing method thereof. The present invention, thereby, provides a novel heteropoly acid catalyst having excellent methacrolein conversion rate, methacrylic acid selectivity and yield. | 2010-03-18 |
20100069231 | BASE FOR CATALYST, CATALYST AND METHODS FOR PRODUCING THOSE - The present invention provides a catalyst base material and a catalyst which have high strength, high porosity or high activity and methods of producing the catalyst base material and catalyst. The present invention relates to a method of producing a catalyst base material, the method comprising dispersing or dissolving a hydrophilic polymer coagulant as a first component, a water-soluble thickener as a second component, a colloidal inorganic binder as a third component and an inorganic fiber as a fourth component in water to form a catalytic slurry or paste, supporting the catalytic slurry or paste on a net-like substrate such that the meshes of the net-like substrate are filled up with the slurry or paste, by drying and/or calcinating the substrate. | 2010-03-18 |
20100069232 | AUTOMOBILE EXHAUST GAS PURIFICATION CATALYST AND METHOD OF PRODUCTION OF SAME - An automobile exhaust gas purification catalyst comprised of a support mainly comprised of ZrO | 2010-03-18 |
20100069233 | Nanostructured titanium oxide material and its synthesis procedure - Nanomaterials of the JT phase of the titanium oxide TiO | 2010-03-18 |
20100069234 | GAS ADSORPTION ON METAL-ORGANIC FRAMEWORKS - The present invention involves the use of certain metal organic frameworks that have been treated with water or another metal titrant in the storage of carbon dioxide. The capacity of these frameworks is significantly increased through this treatment. | 2010-03-18 |
20100069235 | Method for Preparing Water-Absorbing Polymer Particles by Suspension Polymerization - In a process for producing water-absorbing polymeric particles by suspension polymerization, a monomer solution is metered into a stirred reactor via at least one feed line, the stirred reactor has a volume of at least 1 m | 2010-03-18 |
20100069236 | METHODS FOR MANFACTURING LI-DOPED SILICA NANOTUBE USING ANODIC ALUMINUM OXIDE TEMPLATE AND USE OF THE LI-DOPED SILICA NANOTUBE FOR ENERGY STORAGE - Disclosed herein are a method of preparing Li-doped silica nanotubes using an anodic aluminum oxide (AAO) template, and a method of storing energy using the prepared Li-doped silica nanotubes. Unlike prior methods for preparing metal nanotubes, according to the disclosed preparation method, the Li-doped silica nanotubes having a uniform size can be easily obtained in mild conditions using a lithium precursor, a silica sol and an anodic aluminum oxide template. The preparation method comprises adsorbing the lithium precursor and the silica sol on the surface of the AAO template, drying the lithium precursor and the silica sol, adsorbed onto the AAO template, in a vacuum, to form nanotubes, and then drying the nanotubes. The Li-doped silica nanotubes prepared according to the disclosed method can be used as economical hydrogen storage materials, electrode materials for lithium secondary batteries, or energy storage sources for automobiles or other transportation means. | 2010-03-18 |
20100069237 | MESOPOROUS SILICA PARTICLES - The present invention relates to (1) hollow silica particles including an outer shell portion having a mesoporous structure with an average pore size of from 1 to 10 nm, wherein the silica particles have an average particle diameter of from 0.05 to 10 μm, and 80% or more of the whole silica particles have a particle diameter falling within the range of ±30% of the average particle diameter; (2) composite silica particles including silica particles which include an outer shell portion having a mesoporous structure with an average pore size of from 1 to 10 nm, and have a BET specific surface area of 100 m | 2010-03-18 |
20100069238 | METHOD FOR ERASING IMAGE ON THERMOREVERSIBLE RECORDING MEDIUM - A method for erasing an image including irradiating an image formed on a thermoreversible recording medium with a laser light having a wavelength of 700 nm to 1,500 nm so as to erase the image, wherein an energy density of the laser light is in a range of the energy density which can erase the image and a center value or less of the range, wherein the thermoreversible recording medium includes a support, and a thermoreversible recording layer on the support, and wherein the thermoreversible recording layer contains a leuco dye serving as an electron-donating color-forming compound and a reversible developer serving as an electron-accepting compound, in which color tone reversibly changes by heat, and at least one of the thermoreversible recording layer and a layer adjacent to the thermoreversible recording layer contains a photothermal conversion material, which absorbs the light and converts the light into heat. | 2010-03-18 |
20100069239 | METHOD FOR ERASING IMAGE ON THERMOREVERSIBLE RECORDING MEDIUM - A method for erasing an image including irradiating an image formed on a thermoreversible recording medium with a laser light having a wavelength of 700 nm to 1,500 nm so as to erase the image, wherein an energy density of the laser light is in a range of the energy density which can erase the image and more than a center value of the range, wherein the thermoreversible recording medium includes a support, and a thermoreversible recording layer on the support, and wherein the thermoreversible recording layer contains a leuco dye serving as an electron-donating color-forming compound and a reversible developer serving as an electron-accepting compound, in which color tone reversibly changes by heat, and at least one of the thermoreversible recording layer and a layer adjacent to the thermoreversible recording layer contains a photothermal conversion material, which absorbs the light and converts the light into heat. | 2010-03-18 |
20100069240 | THERMAL RECORDING MATERIAL - A thermal recording material comprises a support and a thermal recording layer formed thereon, the thermal recording layer containing an electron-donating dye precursor and an electron-receiving developer that causes said dye precursor to develop a color, wherein said thermal recording layer contains vapor-phase synthesis silica, preferably, the vapor-phase synthesis silica has a specific surface area, measured by a BET method, of 50 to 200 m | 2010-03-18 |
20100069241 | THERMOSENSITIVE RECORDING MEDIUM WITH ANTIBACTERIAL PROPERTY - To provide a thermosensitive recording medium including: a support; a thermosensitive recording layer composed mainly of a leuco dye and a developer, formed on a surface of the support; and at least two antibacterial agents which include a zirconium phosphate antibacterial agent and an imidazole antibacterial agent and which are internally contained in the thermosensitive recording medium. | 2010-03-18 |
20100069242 | Novel-Crystalline Modification Of 4-(N-Methyl-Z-Chloro-5Pyridy Methylamino)-2, 5-Dihydrofuran-2-ON - The present invention relates to a defined crystalline modification of the compound of the formula (I), to processes for its preparation and to its use in agrochemical preparations. | 2010-03-18 |
20100069243 | Pyrimidylmethyl-Sulfonamide Compounds - The present invention relates to novel pyrimidylmethyl-sulfonamide compounds and to their N-oxides, their agriculturally acceptable salts and their veterinarily acceptable salts and also to agricultural compositions comprising at least one such compound as active component, and also to their use for controlling harmful fungi. The present invention also relates to a method for controlling arthropod pests. | 2010-03-18 |
20100069244 | Pyridine Compounds for Combating Pests - The present invention relates to a method of combating pest, which method comprises contacting said pest or their food supply, habitat, breeding ground or their locus with a 3-pyridyl compound of the formula (I). In formula (I) n is 1 or 2, y is 0 or 1 and X, R | 2010-03-18 |
20100069245 | Method and Composition for Clearing Sewer Lines of Roots Utilizing Herbicides and Bacteria - A foaming root destroyer is provided that utilizes a combination of herbicides and bacteria to inhibit and destroy the roots and fine root hairs intruding into underground discharge waste pipe systems. Furthermore, the foaming root destroyer can work over a longer period of time providing an enzymatic process to degrade and eliminate the dead root mass in the sewer line. | 2010-03-18 |
20100069246 | Herbicide Combination Comprising Dimethoxytriazinyl-Substituted Difluoromethanesulfonylanilides - The present invention relates to a herbicide combination comprising components (A) and (B) where
| 2010-03-18 |
20100069247 | HERBICIDE COMPOSITION - A herbicide composition contains, as a component A, one or more compounds selected from the group consisting of specific isoxazoline derivatives represented by the general formula [I] (wherein R | 2010-03-18 |
20100069248 | HERBICIDE COMBINATION COMPRISING DIMETHOXYTRIAZINYL SUBSTITUTED DIFLUOROMETHANESULFONYLANILIDES - The present invention relates to a herbicide combination comprising components (A) and (B) where
| 2010-03-18 |
20100069249 | HERBICIDE COMBINATION COMPRISING DIMETHOXYTRIAZINYL-SUBSTITUTED DIFLUOROMETHANESULFONYLANILIDES - The present invention relates to a herbicide combination comprising components (A) and (B) where
| 2010-03-18 |
20100069250 | Digital PCR Calibration for High Throughput Sequencing - Disclosed is a method for accurately determining the number of template molecules in a library of nucleic acids (e.g., DNA) to be sequenced. The method does not require large amounts of the DNA sample, nor does it require the preparation of a standard curve. The method is especially applicable to methodologies for “sequencing by synthesis,” where quantitation of the starting library is important. The method uses quantitative real time PCR, especially digital PCR, which measures the number of individual molecules in a sample. The present method particularly may use a microfluidic device for running large numbers of PCR reactions. Each PCR reaction is monitored in real time by a primer/probe combination. The forward primer is adapted to contain a sequence not on the adapter but which corresponds to a probe sequence. A short probe which generates fluorescence during the PCR process is used. | 2010-03-18 |
20100069251 | METHODS FOR PRODUCING EMBRYONIC STEM CELLS FROM PARTHENOGENETIC EMBRYOS - Means for producing embryonic stem (pES) cells which have a heterozygous genome that is matched to an individual donor are provided. In one embodiment, a means for the generation and isolation of parthenogenetic embryonic stem (pES) cells which have regions of heterozygosity that are fully matched to the oocyte donor at the MHC loci (e.g. (h-)p(MI)ES cells is provided. This is in contrast to the traditional methods of parthenogenesis that generate parthenogenetic embryonic stem (pES) cells having a substantially homozygous haploidentical set of chromosomes that are homozygous at the MHC loci. | 2010-03-18 |
20100069252 | EFFICIENT METHOD FOR PARTIAL SEQUENCING OF PEPTIDE/PROTEIN USING ACID OR BASE LABILE XANTHATES - A method and system for sequencing polypeptides utilizing acid and base labile xanthates. | 2010-03-18 |
20100069253 | Impedance Spectroscopy Measurement of DNA - An impedance spectroscopy system and method are provided for quantitatively measuring DNA. The method provides a transducer having electrode surfaces exposed to a shared local environment. The electrode surfaces are functionalized with an oligonucleotide to interact with a predetermined DNA target. A DNA sample solution is introduced into the local environment. The solution includes nucleotides, polymerase enzyme, and primers. The DNA sample is thermocycled to promote a first DNA target polymerase chain reaction (PCR). Then, capacitance is measured between a pair of transducer electrodes, and in response to measuring the capacitance, a determination is made of the presence of first DNA amplicons in the DNA sample. Typically, a number of thermocycles are performed and capacitance measurements are made after each cycle, so that an amplicon growth rate can be determined. | 2010-03-18 |
20100069254 | Cell Culture Model for Demyelination/Remyelination - A research model for monitoring demyelination or remyelination in a sample of cells that comprises providing cells, typically CNS cells, and contacting cells with a demyelination solution such as one that includes one of hexachlorophene and/or lysophosphatidylcholine. | 2010-03-18 |
20100069255 | METHOD FOR IDENTIFYING THERAPEUTICAL TARGETS IN SECONDARY TUMORS, THE USE OF THEREOF AND MEANS FOR IDENTIFYING, LABELLING AND TARGETING SECONDARY TUMORS - In comparison with primary tumors, where the organ by itself is the starting point of the malignant degeneration, metastases inherit a different emergence. The molecular causes leading to secondary liver malignancies are unknown so far. The aim of the present invention is therefore to make available an easy and efficient method for identifying therapeutical targets in secondary tumors, the use of novel therapeutical targets identified by the method for screening and determining beneficial means and/or drugs, and means and drugs for identifying, labeling and treating secondary metastases in the liver made up of or derived from tumor cells of the colon. In principle, expression of transcription factors is studied in the primary tumor, the secondary tumor and in the healthy organ, wherein the secondary tumor is formed, according to the invention, in particular of transcription factors being enriched in the healthy tissue of the organ, wherein the secondary tumor is formed, e.g. expression of liver enriched transcription factors HNF6 and/or Foxa2 or of NGN3, HSP105B, HSP10, HNF1β, C/EBP is studied, such as by reverse transcription polymerase chain reaction, by gene chip analysis, by Western blotting technique, by studying the DNA binding of liver enriched transcription factors by electromobility shift assay (EMSA) or by genomic sequencing of therapeutical targets, such as of HNF6. | 2010-03-18 |
20100069256 | Markers and Methods for Assessing and Treating Ulcerative Colitis and Related Disorders Using a 20 Gene Panel - A method for assessment of the suitability of a target therapy for a gastrointestinal-related disorder, such as ulcerative colitis, in a subject evaluates the presence, absence, and/or magnitude of expression of one or more genes in a 20- or 5-member gene panel in a sample. The method enables identification of the effectiveness of target therapies prior to starting a patient on such therapies. | 2010-03-18 |
20100069257 | POROUS SAMPLE TESTING DEVICE AND METHODS - Described are devices and methods for parallel testing of formulations on various substrates. | 2010-03-18 |
20100069258 | Hydrophilic Labels for Biomolecules - Compounds, compositions, and methods for optical, including fluorescence optical, determinations useful in labeling biomolecules such as protein and deoxyribonucleic acid for their detection and quantitation. The compounds are diastereomeric cyanines with high hydrophilicity and other desirable properties. | 2010-03-18 |
20100069259 | SAMPLE DEVICE PRESERVATION - A method for archiving sample devices such as microarray slides and membranes is described using an optically clear, solidifying solution. Also described are related methods and kits. | 2010-03-18 |
20100069260 | COMPOSITIONS AND METHODS FOR THE IDENTIFICATION OF INHIBITORS OF PROTEIN SYNTHESIS - Compositions and methods for identifying inhibitors of RNA-target molecule interactions are provided as well as identifying inhibitors that block the role of tRNA in protein synthesis. The methods involve forming a mixture comprising a tRNA fragment molecule containing a modified nucleotide, a target molecule capable of binding to the tRNA fragment, and a test compound. The mixture is incubated under conditions that allow binding of the tRNA and the target molecule in the absence of the test compound. Assays can then be performed that detect whether or not the test compound inhibits the binding of the tRNA molecule and the target molecule. High throughput assays are also provided. | 2010-03-18 |
20100069261 | siRNA targeting proto-oncogene MET - Efficient sequence specific gene silencing is possible through the use of siRNA technology. By selecting particular siRNAs by rational design, one can maximize the generation of an effective gene silencing reagent, as well as methods for silencing genes. Methods, compositions, and kits generated through rational design of siRNAs are disclosed including those directed to nucleotide sequences for proto-oncogene MET. | 2010-03-18 |
20100069262 | Method for Cloning Avian-Derived Antibodies - The invention relates to a procedure for linking cognate pairs of VH and VL encoding sequences from a population of avian cells enriched in particular surface antigen markers. The linking procedure involves a multiplex molecular amplification procedure capable of linking nucleotide sequences of interest in connection with the amplification (multiplex PCR). The method is particularly advantageous for the generation of cognate pair libraries as well as combinatorial libraries of antibody variable region encoding sequences from chickens or other birds. The invention also provides methods for generation of chimeric human/avian antibodies and expression libraries generated by such methods. | 2010-03-18 |
20100069263 | SEQUENCE TAG DIRECTED SUBASSEMBLY OF SHORT SEQUENCING READS INTO LONG SEQUENCING READS - The invention provides compositions and methods for preparing DNA sequencing libraries. In particular, the method relates to preparing DNA sequencing libraries from kilobase scale nucleic acids. The invention also provides methods for assembling short read sequencing data into longer contiguous sequences. The method is useful for various applications in genomics, including genome assembly, full length cDNA sequencing, metagenomics, and the analysis of repetitive sequences of assembled genomes. | 2010-03-18 |
20100069264 | Libraries of recombinant chimeric proteins - The provides methods for generating divergent libraries of recombinant chimeric proteins, comprising identifying a plurality of conserved amino acid sequences, selecting a plurality of consensus amino acid sequences as a backbone corresponding to said conserved amino acid sequences to serve as sites of recombination and as a backbone for recombinant chimeric proteins created, generating overlapping polynucleotides, inducing recombination between said polynucleotides to produce divergent libraries of chimeric polynucleotides wherein the recombinations intentionally take place between the sequences that correspond to the full length consensus amino acids. The advantage is that shuffling between variable regions, while maintaining the consensus backbone, increases the production of active proteins with high diversity, and better properties. | 2010-03-18 |
20100069265 | SYSTEM AND METHOD FOR PROCESSING LARGE NUMBER OF BIOLOGICAL MICROARRAYS - A system and method for processing biological sensors. The system includes a support component configured to support a fluidic component. The fluidic component includes at least a first container and a second container. The first container is capable of holding a first volume of a first fluid, and the second container is capable of holding a second volume of a second fluid. Additionally, the system includes a hybridization component configured to perform a hybridization process on a first sensor and a second sensor. Moreover, the system includes a transport component configured to move the first sensor, directly or indirectly, from the hybridization component into the first container and in contact with the first volume of the first fluid. | 2010-03-18 |
20100069266 | PROCESS FOR THE ENZYMATIC REMOVAL OF FILTER-CAKES PRODUCED BY WATER-BASED DRILLING AND COMPLETION FLUIDS - The invention relates to a process for the solubilization of material containing scleroglucan and/or xanthan gum which comprises putting the above material in contact with an aqueous solution comprising an enzyme selected from a cellulase from | 2010-03-18 |
20100069267 | Non-damaging manganese tetroxide water-based drilling fluids - A water-based drilling fluid containing Mn | 2010-03-18 |
20100069268 | PH-Regulated Thickener System - Compositions comprising: (A) at least one surfactant of the general formula (I) | 2010-03-18 |
20100069269 | USE OF BETAINES AS FOAMING AGENTS AND FOAM DRAINAGE REDUCING AGENTS - The invention relates to the use of a betaine as a foaming agent and a foam drainage reducing agent. The invention also relates to the use of betaine in processes involving foam. | 2010-03-18 |
20100069270 | Energy Recovery and Reuse for Gel Production - The present disclosure relates to systems and methods for producing a fracturing gel using a preheated hydration fluid. The hydration fluid can be preheated using heat energy recycled from a different part of the operation. Recycling the heat energy can, in certain instances, reduce gel production costs and gel hydration times while improving gel yield. | 2010-03-18 |
20100069271 | Viscosity Breaker for Polyacrylamide Friction Reducers - A well treating fluid useful in slickwater fracturing processes contains polyacrylamide friction reducer and a viscosity breaker capable of reducing the viscosity of the well treating fluid to about the viscosity of water at ambient temperatures of typical underground formations. The viscosity breaker is selected from the group consisting of hydrogen peroxide, calcium peroxide, magnesium peroxide, and zinc peroxide and is present in an amount above about 0.002% by weight. | 2010-03-18 |
20100069272 | ENHANCED CRUDE OIL RECOVERY - The present invention relates to the use of phosphate esters as surfactants in techniques for enhanced crude oil recovery from underground formations. The invention also relates to formulations that can be used in enhanced crude oil recovery methods and to be contacted with the rocks of underground formations. | 2010-03-18 |
20100069273 | Method of Improving the Compatibility of an Overbased Detergent with Other Additives in a Lubricating Oil Composition - A method of improving the compatibility of an overbased detergent with other additives in a lubricating oil composition. The method includes the step of the using a detergent have a degree of carbonation of greater than 85%. | 2010-03-18 |
20100069274 | BOTTLE CONVEYOR LUBRICANT COMPOSITION AND METHOD OF USING THE SAME - A bottle conveyor lubricant composition used for polyalkylene terephthalate containers, characterized by comprising (A) a specific chelating compound, and (B) water, and further optionally containing (C) a nonionic surfactant, (D) a water-soluble solvent, (E) a cationic surfactant, and/or (F) an anionic surfactant. Using the specific chelating compound as a main component makes it possible to obtain a bottle conveyor lubricant suitable for moving and conveying PET containers on a stainless steel conveyor. Furthermore, by adding a specific surfactant, it is possible to obtain a bottle conveyor lubricant that can be used alone to enable PET containers to be moved and conveyed not only on stainless steel conveyors but also on resin conveyors. Moreover, the composition has excellent detergency, lubricating ability, sterilizing ability, scale suppressing ability, and stress crack preventing ability, and has an excellent effect of suppressing occurrence of deposit upon being mixed with a beverage. A method of using the composition is also provided. | 2010-03-18 |
20100069275 | Fluorinated lubricants - Polymers of formula | 2010-03-18 |
20100069276 | SKIN OR HAIR CLEANSER COMPOSITION - Provided is a skin or hair cleanser composition having an excellent foaming property and making a good feeling upon use available from cleansing until after drying, which comprises:
| 2010-03-18 |
20100069277 | Shaped toilet bars - Intricately shaped toilet bars with specific compositions and plasticity properties can be advantageously manufactured via three dimensional cutting. Such cut bars are characterized by specific surface profiles and topographic features. Intricately shaped toilet bars with a wide range of formulations for enhanced skin treatment can be thus economically and reliably manufactured. | 2010-03-18 |
20100069278 | Method for the Production of a Windshield Wiping Concentrate in the Form of Tablets, Windshield Wiping Concentrate, and Corresponding Presentation - The invention relates to a method for producing a windshield wiping concentrate in the form of tablets, said windshield wiping concentrate in the form of tablets, and a corresponding presentation. | 2010-03-18 |
20100069279 | HOME CARE COMPOSITIONS COMPRISING HYDROLYSIS RESISTANT ORGANOMODIFIED DISILOXANE SURFACTANTS - Compositions comprising disiloxane surfactant compositions comprising a silicone composition comprising a silicone having the formula: | 2010-03-18 |
20100069280 | HYBRID COPOLYMERS - Hybrid copolymers for use as anti-sealant and dispersant. The polymers are useful in compositions used in aqueous systems. The polymers include at least one synthetic monomeric constituent that is chain terminated by a naturally occurring hydroxyl containing moiety. A process for preparing these hybrid copolymers is also provided. | 2010-03-18 |
20100069281 | Decontamination, Stripping and/or Degreasing Foam Containing Solid Particles - A stabilized foam formed from a foaming aqueous solution comprising from 0.1 to 7 mol of one or more decontamination, stripping and/or degreasing reactants per liter of solution and from 0.01 to 15% by weight of a solid stabilizing agent of solid particles type, with respect to the total weight of the solution, and a process for the preparation of said stabilized foam, to its use in decontaminating, stripping and/or degreasing a surface and to a process for decontaminating, stripping and/or degreasing a surface. | 2010-03-18 |
20100069282 | Particles Comprising a Hueing Dye - A particle for use in a composition comprising: | 2010-03-18 |
20100069283 | LAUNDRY COMPOSITION - Extruded particle comprising a hueing dye. | 2010-03-18 |
20100069284 | Laundry Composition - A particle having a hueing dye and C | 2010-03-18 |
20100069285 | ACIDIC COMPOSITION BASED ON SURFACTANT BLEND - The present invention refers to a concentrate for use in a cleaning and/or washing process comprising
| 2010-03-18 |
20100069286 | POLYALKYLENE GLYCOL-BASED POLY(ESTER-AMIDE) POLYMERS, METHODS OF MAKING AND METHODS OF USING SAME, COMPOSITIONS AND PRODUCTS COMPRISING SAME - Polyether poly(ester-amide) block copolymer having a softening point between 60° C. and 180° C., formed from reaction mixtures comprising a diacid, a poly(alkyleneoxy)diamine, and a poly(alkyleneoxy)polyol, wherein said diacid is a cyclohexane dicarboxylic acid; or formed from reaction mixtures comprising a diacid, a short chain aliphatic diamine having 2-6 carbons, and a poly(alkyleneoxy)polyol. Methods for making and using said block copolymers, compositions and articles comprising said block copolymers. | 2010-03-18 |
20100069287 | Novel Fragrance Compounds - A compound having the structure (A) where R1 is C1 to C5 alkyl, and R2 to R5 are independently selected from H and methyl, having a strong odour and for use as a perfumery ingredient, particularly in Muguet accords/fragrances, is provided. | 2010-03-18 |
20100069288 | USE OF CYSTEINE-RICH WHEY DERIVED PROTEIN IN PATIENTS RECEIVING CHEMOTHERAPY OR RADIOTHERAPY TO IMPROVE PATIENT SURVIVAL - A cysteine-rich undenatured whey-derived protein formulation did not interfere with the tumor-cytotoxic effects of chemotherapy and radiation therapy and did not have a negative effect on the clinical outcome, that is, negatively affect survival and increase mortality. Indeed, use of a high-cysteine undenatured whey derived protein in the treatment of cancer patients resulted in an increase in patient survival. | 2010-03-18 |
20100069289 | ANIMAL FEEDS AND VETERINARY COMPOSITIONS - The present invention relates to an animal feed composition comprising protein from the family Fabaceae and protein from the family Asteraceae and to such formulations which also comprise glucan and/or mannan; such feeds finding utility in stabilising or increasing weight in a target animal, particularly fish, as well as in treating ectoparasitic infections, diarrhoea and bowel disease. | 2010-03-18 |
20100069290 | EJECTION LIQUID AND EJECTION METHOD - The ejection liquid of the present invention includes a compound having a guanidine group, and a carboxyl group or a sulfonic acid group in one molecule, and being represented by the general formula (1), or a salt of the compound, for the purpose of stably ejecting a solution including at least one of a protein and a peptide by imparting thermal energy to the solution. | 2010-03-18 |
20100069291 | COMBINATION COMPRISING CNDAC (2'-CYANO-2'-DEOXY-N4-PALMITOYL-1-BETA-D-ARABINOFURANOSYL-CYTOSINE) AND A CYTOTOXIC AGENT - A first aspect of the invention relates to a combination comprising 2′-cyano-2′-deoxy-N | 2010-03-18 |
20100069292 | INSULIN WITH A BASAL RELEASE PROFILE - A clear basal insulin formulation composed of insulin (preferably human recombinant insulin), buffering agents, precipitating agents, and/or stabilizing agents for subcutaneous, intradermal or intramuscular administration. The formulation is designed to form a precipitate of insulin following injection, creating a slow releasing “basal insulin” over a period of 12 to 24 hours, which can be varied by compositional changes to tailor the release profile to the needs of the individual diabetic patient | 2010-03-18 |
20100069293 | POLYMERIC CARRIER COMPOSITIONS FOR DELIVERY OF ACTIVE AGENTS, METHODS OF MAKING AND USING THE SAME - In part, the present invention is directed to compositions and methods of making compositions comprising a polymeric backbone, a chelating group, a metal ion, and an active agent with a metal binding domain. The compositions can optionally further comprise protective groups. In part, the present invention is directed to prolonging the blood circulation time of an active agent containing a metal binding domain by using a composition comprising a polymeric backbone with a protective group, a chelator, and a metal ion. | 2010-03-18 |
20100069294 | HCV PROTEASE INHIBITORS AND USES THEREOF - The present invention provides compounds, pharmaceutically acceptable compositions thereof, and methods of using the same. | 2010-03-18 |
20100069295 | NOVEL POLY(ETHYLENE OXIDE)-BLOCK-POLY(ESTER) BLOCK COPOLYMERS - The present invention relates to micelle-forming poly(ethylene oxide)-block-poly(ester) block copolymers having reactive groups on the polyester block therein. The biodegradability of these copolymers and their biocompatibilities with a large number of bioactive agents make them suitable as carriers for various bioactive agents. The bioactive agents, such as DNA, RNA, oligonucleotide, protein, peptide, drug and the like, can be coupled to the reactive groups on the polyester block of the copolymer. | 2010-03-18 |
20100069296 | USE OF SOMATOSTATIN ANALOGS IN CLUSTER HEADACHE - The present invention relates to the use of a Somatostatin (SRIF) analog which has a high binding affinity to human SSTR1,2,3,5, or a pharmaceutically acceptable salt thereof for the preparation of a pharmaceutical composition for the treatment of cluster headache. | 2010-03-18 |
20100069297 | Selective Inhibition of TLR4 Signaling - Blocking peptides comprised of the 14 amino acids that correspond to the sequences of the BB-loops of the four known TIR domain-containing adapter proteins (i.e. MyD88, TRAM, TIRAP, and TRIF) and homologous sequences of four TLRs (TLR2, TLR4, TLR1, and TLR6) are described. Adapter BB loop peptides disrupted TLR4, but not TLR2 signaling. TLR2 and TLR4 blocking peptides inhibited TLR4- and TLR2-mediated activation of ERK and cytokine induction, however, these peptides did not inhibit activation of p38. These peptides can be used to treat or prevent an immune or inflammatory response associated with a condition related to TLR4 signaling. | 2010-03-18 |
20100069298 | Methods for Detecting Overexpression of SPARC and Therapeutic and Diagnostic Methods Relating to Same - Methods for detecting elevated levels of SPARC in biological samples using immunohistochemical staining and therapeutic and diagnostic methods relating to those detection methods. | 2010-03-18 |
20100069299 | Ghrelin analogs - The invention comprises peptidyl analogs that possess agonist or antagonist ghrelin activity, along with therapeutic and non-therapeutic uses thereof. | 2010-03-18 |
20100069300 | C-Type Lectin Fold as a Scaffold for Massive Sequence Variation - This invention provides a class of binding proteins with a range of binding specificities and affinities based upon variation at select amino acid positions within a scaffold. The variable positions may be readily modified to produce a library of binding proteins with different binding specificities and affinities. The library may be screened to identify one or more as binding a ligand of interest. Compositions comprising the binding proteins, as well as methods of using the binding proteins are also provided. | 2010-03-18 |
20100069301 | COMPOSITIONS AND METHODS FOR TREATING PATHOLOGIC ANGIOGENESIS AND VASCULAR PERMEABILITY - Compounds, compositions and methods for inhibiting vascular permeability and pathologic angiogenesis are described herein. Methods for producing and screening compounds and compositions capable of inhibiting vascular permeability and pathologic angiogenesis are also described herein. Pharmaceutical compositions are included in the compositions described herein. The compositions described herein are useful in, for example, methods of inhibiting vascular permeability and pathologic angiogenesis, including methods of inhibiting vascular permeability and pathologic angiogenesis induced by specific angiogenic, permeability and inflammatory factors, such as, for example VEGF, bFGF and thrombin. Methods for treating specific diseases and conditions are also provided herein. | 2010-03-18 |
20100069302 | SPECIFIC THERAPY AND MEDICAMENT USING INTEGRIN LIGANDS FOR TREATING CANCER - The invention relates to a combination therapy for the treatment of tumors and tumor metastases comprising administration of integrin ligands, preferably integrin antagonists, together with co-therapeutic agents or therapy forms that have synergistic efficacy when administered consecutively with said ligands, such as chemotherapeutic agents and or radiation therapy. The therapy results in a synergistic potential increase of the inhibition effect of each individual therapeutic on tumor cell proliferation, yielding more effective treatment than found by administering an individual component alone, concurrently or not in the dosage regime of the present invention. | 2010-03-18 |
20100069303 | METHODS OF TREATING BONE DISEASE USING VASCULAR ENDOTHELIAL GROWTH FACTOR FUSION CONSTRUCTS - The 121-amino acid isoform of vascular endothelial growth factor (VEGF | 2010-03-18 |
20100069304 | PROTECTIVE EFFECTS OF INHIBITING THE INTERACTION OF CALMODULIN AND MUTANT HUNTINGTIN PROTEIN - An artificial polypeptide can be used in a treatment for Huntington's disease. The inventive polypeptide sequence is capable of interacting with mutant huntingtin so as to inhibit interactions between mutant huntingtin or a fragment of mutant huntingtin and calmodulin. The inventive polypeptide sequence can be a portion of calmodulin described herein or an analog or derivative thereof that binds with the polyglutamate portion of a mutant huntingtin protein. For example, polypeptide sequence can include a sequence of KDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEV (SEQ ID NO: 1) or a portion thereof analog thereof or derivative thereof. | 2010-03-18 |
20100069305 | Composition for maintaining gastrointestinal homeostasis - The invention relates to a suspension of albumin and tannic acid for maintaining gastrointestinal homeostasis. | 2010-03-18 |
20100069306 | Agonists of Guanylate Cyclase Useful for the Treatment of Gastrointestinal Disorders, Inflammation, Cancer and Other Disorders - The invention provides novel guanylate cyclase-C agonist peptides and their use in the treatment of human diseases including gastrointestinal disorders, inflammation or cancer (e.g., a gastrointestinal cancer). The peptides can be administered either alone or in combination with an inhibitor of cGMP-dependent phosphodiesterase. The gastrointestinal disorder may be classified as either irritable bowel syndrome, constipation, or excessive acidity etc. The gastrointestinal disease may be classified as either inflammatory bowel disease or other GI condition including Crohn's disease and ulcerative colitis, and cancer. | 2010-03-18 |
20100069307 | NEUROPEPTIDE-2 RECEPTOR (Y-2R) AGONISTS - Provided herein are neuropeptide-2 receptor agonists of the formula (I): | 2010-03-18 |
20100069308 | Surfaces containing antibacterial polymers - This invention provides a surface that has been coated with anti-bacterial polymers. Such surfaces would be suitable for use in, for example, medical devices and public surfaces. Additionally, the invention provides a method for coating surfaces with the anti-bacterial polymer. | 2010-03-18 |