08th week of 2015 patent applcation highlights part 37 |
Patent application number | Title | Published |
20150050690 | CELL COLLECTION APPARATUS, CELL COLLECTING SYSTEM, AND CELL COLLECTING METHOD - In order to pick up a sufficient amount of cells for a genetic test from a section of a biological tissue with a simple structure and a simple operation, provided is a cell collection apparatus comprising: a substrate which is provided to be dividable into a plurality of small pieces along a predetermined dividing line, and which has a flat surface to which a section of a biological tissue can be pasted; a sheet-shaped expandable member to which the substrate can be adhered in a detachable manner, and which is expandable in a direction along the surface; a expansion unit for expanding the expandable member in at least a region adhered with the substrate, in a direction along the surface; and a pickup unit for detaching and picking up the divided small pieces from the expandable member. | 2015-02-19 |
20150050691 | METHOD FOR PREPARING MUTANT ESCHERICHIA COLI CAPABLE OF SIMULTANEOUSLY UTILIZING GLUCOSE AND XYLOSE - The present invention relates to a method for preparing a mutant | 2015-02-19 |
20150050692 | METHOD OF CULTURING E. COLI CELLS FOR HIGH DENSITY - Disclosed is a method of culturing | 2015-02-19 |
20150050693 | METHODS FOR CONTROLLING THE GALACTOSYLATION PROFILE OF RECOMBINANTLY-EXPRESSED PROTEINS - The present invention relates to methods for modulating the glycosylation profile of recombinantly-expressed proteins. In particular, the present invention relates to methods of controlling the galactosylation profile of recombinantly-expressed proteins by supplementing production medium, e.g., a hydrolysate-based or a chemically defined medium, with manganese and/or D-galactose. | 2015-02-19 |
20150050694 | METHOD OF STERILIZING SEPARATION MEMBRANE MODULE, METHOD OF PRODUCING CHEMICAL BY CONTINUOUS FERMENTATION, AND MEMBRANE SEPARATION-TYPE CONTINUOUS FERMENTATION APPARATUS - A method of sterilizing a separation membrane module using water vapor includes: a liquid supplying step of supplying a liquid having a boiling point of 80° C. or higher at atmospheric pressure to a secondary side of the separation membrane module such that a filling ratio of the liquid in a space surrounded by a filtration portion of a separation membrane is 70% or more, the filtration portion being used for filtration; a liquid sealing step of isolating the secondary side of the separation membrane module such that the filling ratio of the liquid supplied to the secondary side in the liquid supplying step is 70% or more; and a sterilization step of sterilizing the separation membrane module by supplying water vapor to a primary side of the separation membrane module while the secondary side of the separation membrane module is isolated. | 2015-02-19 |
20150050695 | Helicase Dependent Amplification of DNA Molecules Using Nucleotide Analogs - This invention covers processes for the isothermal amplification of DNA molecules having a preselected sequence. It is based on the unexpected discovery that primers having, at some positions, adenine substituted by 2-aminopurine or diaminopurine, guanine by inosine, thymine by 2-thiothymine, and cytosine by N4-ethylcytosine (“SAMRS nucleotides”) were accepted by enzymes used in the standard helicase-dependent amplification (HDA). Further unexpected was the discovery that target nucleotides are efficiently amplified in an HDA-like process (hereinafter abbreviated as simply HDA) using substituted primers. Also discovered was the diminution of spurious products through the use of SAMRS-substituted primers. | 2015-02-19 |
20150050696 | Cloning Method - The present invention relates to a method based on the use of restriction enzyme digestion and ligation via cleavage sites, thereby to prepare two or more standardized expression cassettes. | 2015-02-19 |
20150050697 | NUCLEOTIDE ANALOGS - Provided herein is technology relating to the manipulation and detection of nucleic acids, including but not limited to compositions, methods, and kits related to nucleotides comprising a chemically reactive linking moiety. | 2015-02-19 |
20150050698 | DEVELOPMENT OF NUCLEIC ACID GEL MATRIX FOR CELL-FREE PROTEIN SYNTHESIS OF CELL NUCLEUS REPLICATE, AND METHOD FOR PRODUCING SAME - Provided are a nucleic acid gel matrix for the cell-free protein synthesis of a cell nucleus replicate that contains an X-type nucleic acid nanostructure, an expression plasmid containing a DNA fragment, transcription and translation constituents, and a lipid membrane component, and a method for producing same. The nucleic acid gel matrix for the cell-free synthesis of a cell nucleus replicate is a polymorphic gel matrix that contains the X-type nucleic acid nanostructure, the expression plasmid containing the DNA fragment, the transcription and translation constituents, and the lipid membrane component. | 2015-02-19 |
20150050699 | RNA-DIRECTED DNA CLEAVAGE BY THE Cas9-crRNA COMPLEX - Isolation or in vitro assembly of the Cas9-crRNA complex of the | 2015-02-19 |
20150050700 | NOVEL CELLULASE - The objects of the present invention are to provide a cellulase that has activity to produce glucose by hydrolyzing crystalline cellulose and which is suitable for saccharification of crystalline cellulose, such as wood, by enzymatic method; and a method of producing glucose and alcohol from crystalline cellulose by utilizing the cellulase. | 2015-02-19 |
20150050701 | CELLULASE COMPOSITIONS HAVING IMPROVED THERMOSTABILITY AND SYNERGY - A variant Cel5a endoglucanase has increased thermostability, increased enzymatic activity and/or increased expression in a host, relative to wild type Cel5a. The improved variant Cel5a endoglucanase may be used to hydrolyze more cellulose at a higher temperature for a more efficient and cost-effective production of biofuels as compared to wild type Cel5a. A variant Cel5a endoglucanase is combined with variant Cel6a and variant Cel7a cellobiohydrolases resulting in more effective hydrolysis of cellulose. | 2015-02-19 |
20150050702 | RECOMBINANT C1 BETA-GLUCOSIDASE FOR PRODUCTION OF SUGARS FROM CELLULOSIC BIOMASS - The invention relates to expression of a recombinant C1 β-glucosidase. The invention also provides methods for producing a fermentable sugar from cellobiose by contacting cellobiose with a recombinant host cell comprising a polynucleotide sequence encoding C1 β-glucosidase, operably linked to heterologous promoter, under conditions in which β-glucosidase is expressed and secreted by the cell and the cellobiose is enzymatically converted by said β-glucosidase to glucose. Methods of the invention may be used for conversion of a biomass substrate to a fermentable sugar, and ultimately to ethanol or other biofuel. | 2015-02-19 |
20150050703 | Microorganism able to Produce L-Amino Acid, and Method for Producing L-Amino Acid by Using the Same - The present invention relates to a microorganism able to produce L-threonine or L-tryptophan, and to a method for producing L-threonine or L-tryptophan by using same. More specifically, the present invention relates to: recombinant | 2015-02-19 |
20150050704 | BIOSYNTHETIC PATHWAY FOR HETEROLOGOUS EXPRESSION OF A NONRIBOSOMAL PEPTIDE SYNTHETASE DRUG AND ANALOGS - The present invention is directed to the biosynthetic pathway for a nonribosomal peptide synthetase (NRPS) derived drug and analogs thereof. The invention also discloses polynucleotide sequences useful for heterologous expression in a convenient microbial host for the synthesis of the NRPS derived drug. | 2015-02-19 |
20150050705 | Epoxidation Using Peroxygenase - The invention relates to enzymatic methods for epoxidation of a non-cyclicaliphatic alken, or a terpen. | 2015-02-19 |
20150050706 | DILUTE CHEMICAL REACTION PROCESS - Disclosed is a process for carrying out a cyclisation reaction, a polymerization reaction, an enzymatic reaction showing substrate inhibition, an enzymatic reaction showing product inhibition, a reaction showing precipitation of the substrate or of a reactant, the process comprising the steps of
| 2015-02-19 |
20150050707 | TREATMENT OF BIOMASS - A process for the treatment of biomass comprising subjecting biomass to microbial digestion to produce volatile fatty acids and/or solvents followed by wet oxidation to reduce biosolid volume while retaining or increasing the concentration of the volatile fatty acids and/or solvents. | 2015-02-19 |
20150050708 | MICROORGANISMS AND METHODS FOR PRODUCING BUTADIENE AND RELATED COMPOUNDS BY FORMATE ASSIMILATION - Provided herein are non-naturally occurring microbial organisms having a formaldehyde fixation pathway and a formate assimilation pathway, which can further include a methanol metabolic pathway, a methanol oxidation pathway, a hydrogenase and/or a carbon monoxide dehydrogenase. These microbial organisms can further include a butadiene, 1,3-butanediol, crotyl alcohol or 3-buten-2-ol pathway. Additionally provided are methods of using such microbial organisms to produce butadiene, 1,3-butanediol, crotyl alcohol or 3-buten-2-ol. | 2015-02-19 |
20150050709 | PROCESSING BIOMASS - Some products such as solvents, e.g., butanol, are toxic to solvent-producing microorganisms, yet fructose metabolism can facilitate the increase of protective substrates such as triglycerides, which can protect the microorganism from the toxic effect of the product. Methods are provided for producing a product, e.g., a solvent from fructose derived from a cellulosic or lignocellulosic material. Using the methods herein, a fructose solution can be fermented to a solvent more rapidly, and with better yields, than a glucose solution. | 2015-02-19 |
20150050710 | LIVING FATTY MATERIAL FROM WHICH IMMUNITY IS REMOVED AND METHOD FOR MANUFACTURING SAME - The present invention relates to a living fatty material from which immunity is removed, and a method for manufacturing the same, and more specifically, to a living fat tissue from which immunity is removed and to a method for manufacturing the same, comprising the steps of collecting fat tissues; irradiating the fat tissues with 20 to 500 kGy of gamma (γ) rays; and applying centrifugal separation of the fat tissues irradiated with gamma rays. | 2015-02-19 |
20150050711 | DEVICE FOR MANUFACTURING POLYMER FIBERS AND USES THEREOF - There is provided a device, and related method and uses, for drawing a polymer fiber, the device comprising: a. at least two polymer compartments, wherein each polymer compartment is capable of retaining a polymer solution, and wherein adjacent compartments comprise different polymer solutions; and b. a slider comprising at least one prong, wherein the prong is capable of contacting the different polymer solutions, and wherein the slider is arranged in a retractable manner from the at least two polymer compartments. There is further provided a system and a related method for manufacturing a polymer fiber. | 2015-02-19 |
20150050712 | POLYSILICATE-POLYSILICONE ENZYME IMMOBILIZATION MATERIALS - The present invention generally relates to improvements in enzyme immobilization, particularly for use in the field of carbon dioxide capture and sequestering. It has been discovered that the utilization of sol-gel processes to immobilize enzymes in polysilicate-polysilicone copolymer coatings and particles, and the deposition of these coatings on solid state supports or use of suspensions of these particles, provides significant benefits for use in industrial applications involving enzymatic catalysts. | 2015-02-19 |
20150050713 | Technology for the Preparation of Microparticles - Microspheres are produced by contacting a solution of a macromolecule or small molecule in a solvent with an antisolvent and a counterion, and chilling the solution. The microspheres are useful for preparing pharmaceuticals, nutraceuticals, cosmetic products and the like of defined dimensions. | 2015-02-19 |
20150050714 | Acryloyloxyethylphosphorylcholine Containing Polymer Conjugates And Their Preparation - The present invention relates to polymeric reagents and conjugates thereof, methods for synthesizing the polymeric reagents and conjugates, pharmaceutical compositions comprising the conjugates and methods of using the polymer conjugates including therapeutic methods where conjugates are administered to patients. | 2015-02-19 |
20150050715 | Stably Tethered Structures of Defined Compositions with Multiple Functions or Binding Specificities - The present invention concerns methods and compositions for stably tethered structures of defined compositions with multiple functionalities and/or binding specificities. Particular embodiments concern stably tethered structures comprising a homodimer of a first monomer, comprising a dimerization and docking domain attached to a first precursor, and a second monomer comprising an anchoring domain attached to a second precursor. The first and second precursors may be virtually any molecule or structure, such as antibodies, antibody fragments, antibody analogs or mimetics, aptamers, binding peptides, fragments of binding proteins, known ligands for proteins or other molecules, enzymes, detectable labels or tags, therapeutic agents, toxins, pharmaceuticals, cytokines, interleukins, interferons, radioisotopes, proteins, peptides, peptide mimetics, polynucleotides, RNAi, oligosaccharides, natural or synthetic polymeric substances, nanoparticles, quantum dots, organic or inorganic compounds, etc. The disclosed methods and compositions provide a simple, easy to purify way to obtain any binary compound attached to any monomeric compound, or any trinary compound. | 2015-02-19 |
20150050716 | NOVEL ADAMTS-13 MUTANT - An enhanced disintegrin-like domain, and metalloprotease, with an isolated human thrombospondin type 1 motif, member 13 (ADAMTS-13) that includes substitutions at one or more positions in the isolated human ADAMTS-13. | 2015-02-19 |
20150050717 | BACTERIOPHAGES EXPRESSING ANTIMICROBIAL PEPTIDES AND USES THEREOF - The present invention is generally related to engineered bacteriophages expressing antimicrobial peptides or lytic enzymes or fragments thereof for targeting a broad spectrum of bacterial hosts, and for the long-term suppression of bacterial phage resistance for reducing bacterial infections. In some embodiments, bacteriophages express antimicrobial peptides or antimicrobial polypeptides (e.g. phage lytic enzymes) which are secreted from the host bacteria, or alternatively released upon lysis of the bacterial host cell. Aspects of the present invention also relate to the use of the engineered bacteriophages for the reduction of bacterial infections, both in a subject or for bioremediation purposes, in clinical settings and wound healing. | 2015-02-19 |
20150050718 | METHOD FOR PRESERVING ENZYME - The problem is to provide a method for inexpensively and simply preserving an enzyme of a microbial biomass obtained by culturing and improve the enzyme activity during preservation. Provided is a method for preserving nitrile hydratase, characterized in that microbes having nitrile hydratase activity are cultured while being protected from light, and the resulting biomass is crushed using a high-pressure homogenizer and preserved while being protected from light. | 2015-02-19 |
20150050719 | DISPENSING ASSEMBLY - A dispensing assembly comprising a cartridge holder is presented. The cartridge holder can receive a cartridge for dispensing a fluid. The cartridge can comprise a reservoir for receiving the fluid. The reservoir can comprise an outlet. The reservoir can have an adjustable volume for forcing the fluid through the outlet. The cartridge can further comprise a nozzle for dispensing the fluid. The nozzle can be connected to the outlet. The dispensing assembly can further comprise an actuator for actuating the adjustable volume. The dispensing assembly can further comprise an impulse generator for imparting an impulse to the nozzle. The impulse generator can comprise an actor for contacting the nozzle. The dispenser assembly can further comprise a controller for controlling the actor and the impulse generator. | 2015-02-19 |
20150050720 | DEVICE FOR DETECTION OF ANALYTES IN AFFINITY BIOASSAYS - A device for detection of analytes in affinity bioassays comprising at least one transparent wall portion, at least one test recess adapted to receive at least one test strip and arranged such that said test strip is visible through the transparent wall portion, at least one cavity adapted to receive a container containing a fluid sample, said cavity being in fluid communication with said at least one test recess, and piercing means arranged in correspondence with said at least one cavity, such that upon insertion of a container in the cavity the container is pierced and at least a portion of the sample is released from the container and reaches the test recess. The invention further relates to the use of such a device for detection of analytes of a nucleic acid amplification reaction and to a detection kit comprising such a device and a test strip. | 2015-02-19 |
20150050721 | CHIP FOR ANALYSIS OF TARGET SUBSTANCE - The present invention provides a chip for analysis of a target substance that is compact and allows analysis of a target substance with less time and effort. The chip for analysis of a target substance includes a first flexible substrate | 2015-02-19 |
20150050722 | Cell Culture Strain Array Systems and Methods for Using the Same - Aspects of the invention include cell culture systems that include a cell culture plate operatively coupled to a plenum device. The plenum device includes a base component, one or more wall components configured to define a bounded volume, and one or more strain platens that are configured to support the cell culture plate when the cell culture plate is operatively coupled to the plenum device. In some instances, the plenum device includes a pressure modulator configured to provide a substantially uniform pressure in the bounded volume upon application of an external pressure source via an internal side opening in a wall component. Aspects of the invention further include system components and kits thereof, as well as methods of using the systems, e.g., in cell culture applications, which may include, e.g., candidate agent screening applications. | 2015-02-19 |
20150050723 | Optoelectronic Detection System - The invention described herein provides methods for the detection of soluble antigens. In particular, the methods provide for the detection of soluble proteins and chemicals. In addition, the invention provides methods of detecting a nucleic acid sequence in a sample. Also described is an emittor cell comprising an Fc receptor and an emittor molecule for the detection of a target particle in a sample wherein the target particle to be detected is bound by one or more antibodies. Also provided is an optoelectronic sensor device for detecting a target particle in a plurality of samples. | 2015-02-19 |
20150050724 | SILAGE WASTE RECOVERY PROCESS, FACILITY, SYSTEM, AND PRODUCT - A silo of conventional construction is provided with a collection pan at its bottom to collect effluent. The effluent can be stored and/or processed. Processing can include separation of water to concentrate the effluent. The effluent can contain fermentation product, such as alcohol, generated within the silo prior to collection, and it can also be fermented after collection. Processed effluent can be handled safely without risk of contamination to ground water at the silo site. | 2015-02-19 |
20150050725 | Laboratory Incubator Having Improved Moisture Distribution - The present invention relates to a laboratory incubator, more particularly, a gassing incubator, comprising an outer housing incorporating a door and an inner housing surrounding an internal chamber, which comprises a floor, a ceiling, three side walls and a lateral surface that is capable of being closed by said door or by an additional, inner door, and in which a flow channel is present, which comprises at least one air inlet opening in an end region and at least one air outlet opening in a different end region, wherein said at least one air outlet opening is formed such that effluent air is guided along at least one of the side walls and/or the lateral surface in the peripheral region of the internal chamber, and wherein a water reservoir capable of being heated is disposed within the flow channel such that air flowing in the flow channel is passed across or through said water reservoir. | 2015-02-19 |
20150050726 | INSTRUMENT FOR CASSETTE FOR SAMPLE PREPARATION - A parallel processing system for processing samples is described. In one embodiment, the parallel processing system includes an instrument interface parallel controller to control a tray motor driving system, a close-loop heater control and detection system, a magnetic particle transfer system, a reagent release system, a reagent pre-mix pumping system and a wash buffer pumping system. | 2015-02-19 |
20150050727 | PURIFICATION - The invention provides methods of purifying one or more biological analytes from a sample. The method comprises incubating the sample with nanoparticles and centrifuging a biphasic system. The biological analytes can be one or more of an enzyme, a protein, a nucleic acid, an organelle, a cell, a bacteria, a virus, or any other biological material which requires purification. | 2015-02-19 |
20150050728 | Identification Of Novel Cell Surface Markers For Pancreatic Progenitor Cells And Definite Endodermal Cells - Methods of identifying, isolating and qualifying pancreatic progenitor cells and definite endodermal cells. An isolated population of pancreatic progenitor cells, including at least 75% of cells having a TROP-2+ and/or TROP-2+/GPR50+ expression pattern and an isolated population of definite endodermal cells, including at least 50% of cells having a SOX17+/SOX7+/GSC+/CER+/FOXA2+/CXCR4+/NANOG expression pattern. Nucleic acid constructs including a reporter protein under the transcriptional regulation of SOX17 regulatory sequence or of PDX1 regulatory sequence, and cells comprising same, and methods and kits using same. | 2015-02-19 |
20150050729 | Compositions for Treatment of Cancer - The present invention provides compositions and methods for treating cancer in a human. The invention includes relates to administering a genetically modified T cell to express a CAR wherein the CAR comprises an antigen binding domain, a transmembrane domain, a costimulatory signaling region, and a CD3 zeta signaling domain. | 2015-02-19 |
20150050730 | Process for Ex Vivo Expansion of Stem Cells in a Bioreactor - The present invention refers to a process of ex vivo expansion of stem cells, in a bioreactor, in particular hematopoietic stem/progenitor cells co-cultured with mesenchymal stem cells immobilized on microcarriers, for transplantation. The process comprises the steps of: a) forming a suspension of mesenchymal stem cells immobilized on microcarriers, b) inoculating in a bioreactor containing an expansion medium, hematopoietic cells co-cultured with mesenchymal stem cells immobilized on microcarriers c) expansion of hematopoietic cells. The process of the invention is capable of being implemented in a Kit. | 2015-02-19 |
20150050731 | METHOD FOR PRODUCING PLURIPOTENT STEM CELLS DERIVED FROM DENTAL PULP - Disclosed is a method for producing pluripotent stem cell-enriched human dental pulp-derived cells. The method is characterized in that it includes (a) culturing a dental pulp suspension in a feeder cells-culture vessel containing feeder cells whose proliferative ability is suppressed, on a membrane having micropores that can block passage of the feeder cells and supported in the feeder cells-culture vessel in a manner to prevent the lower side face thereof from contacting with the feeder cells, thereby preventing direct contact with the feeder cells, and, (b) a step for recovering the cells proliferating on the membrane. | 2015-02-19 |
20150050732 | SELECTIVE DIFFERENTIATION, IDENTIFICATION, AND MODULATION OF HUMAN TH17 CELLS - The embodiments provide for the modulation of both the differentiation and activity of human Th17 cells. More specifically, human Th17 cell differentiation can modulated by TGF-β and IL-21, and their agonists and antagonists. Function of Th17 cells can be modulated by, for example, BLT1 or podoplanin, and their agonists and antagonists. Additionally, the embodiments provide for the identification of Th17 cells. More specifically, human Th17 cells specifically upregulate BLT1 and podoplanin. | 2015-02-19 |
20150050733 | REPROGRAMMING CELLS BY THREE-DIMENSIONAL CULTIVATION - Methods for reprogramming cells by culturing the cells under a condition that allows formation of a three-dimensional cell aggregate are provided. The cells and cell aggregates obtained using the methods are also provided. | 2015-02-19 |
20150050734 | Carbon Nanotubes And Methods Of Use - The present disclosure provides carbon nanotube substrates, and methods of using those substrates, for the treatment and/or amelioration of neurological conditions associated with elevated levels of neural chloride. One aspect of the present disclosure provides a substrate comprising, consisting of or consisting essentially of high-conductivity few-walled CNTs dispersed thereon, wherein the CNTs comprise an intrinsic electrical conductivity of at least 2,500 S/cm. In certain embodiments, the CNTs comprise an intrinsic electrical conductivity in a range of about 1,000 S/cm to about 3,000 S/cm. In an alternative embodiment, the CNTs compromise an intrinsic electrical conductivity in a range of about 1,500 S/cm to about 2,500 S/cm. | 2015-02-19 |
20150050735 | WELL PLATES - Well plates for use in various laboratory experiments may include a plurality of wells each having an interior wall that includes a ledge positioned at a fixed depth within the well. | 2015-02-19 |
20150050736 | Hybrid Tissue Scaffold For Tissue Engineering - A hybrid tissue scaffold is provided which comprises a porous primary scaffold having a plurality of pores and a porous secondary scaffold having a plurality of pores, wherein the secondary scaffold resides in the pores of the primary scaffold to provide a hybrid scaffold. The pores of the porous primary scaffold may have a pore size in a range of 0.50 mm to 5.0 mm, and the pores of the porous secondary scaffold may have a pore size in a range of 50 μm to 600 μm. The primary scaffold may provide 5% to 30% of a volume of the hybrid scaffold. | 2015-02-19 |
20150050737 | METHOD FOR CULTURING PLURIPOTENT STEM CELL, AND POLYPEPTIDE TO BE USED THEREFOR - A polypeptide including: (1) a first region containing at least one selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO:1) and an amino acid sequence represented by RGD; and (2) a second region containing (2-i) an amino acid sequence represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO:2), (2-ii) an amino acid sequence having an identity of not less than 50% to the amino acid sequence represented by SEQ ID NO:2 and having an adsorption ability to a cultivation container, or (2-iii) an amino acid sequence that is the amino acid sequence represented by SEQ ID NO:2 in which from 1 to 30 amino acid residues are added, substituted, or deleted, and has an adsorption ability to a cultivation container, in which the polypeptide includes from 40 to 450 amino acid residues. | 2015-02-19 |
20150050738 | COMPOSITIONS AND METHODS FOR MODULATING RNA - Aspects of the invention relate to methods for increasing gene expression in a targeted manner. In some embodiments, methods and compositions are provided that are useful for posttranscriptionally altering protein and/or RNA levels in a targeted manner. Aspects of the invention disclosed herein provide methods and compositions that are useful for protecting RNAs from degradation (e.g., exonuclease mediated degradation). | 2015-02-19 |
20150050739 | RECOMBINATION SYSTEM - The present invention relates to a method for carrying out recombination at a target locus. | 2015-02-19 |
20150050740 | METHOD FOR INTRODUCING AN EXOGENOUS DNA BY OVERCOMING THE RESTRICTION MODIFICATION BARRIER OF A TARGET BACTERIUM - The present invention discloses a method for introducing an exogenous DNA by overcoming the restriction modification barrier of the target bacterium. The method provided in the present invention comprises the steps of 1) co-expressing all DNA-methyltransferase-encoding genes in the genome of the target bacterium in | 2015-02-19 |
20150050741 | TRANSPORTERS OF OIL SENSORS FOR DOWNHOLE HYDROCARBON DETECTION - Various embodiments of the present disclosure pertain to nanocomposites for detecting hydrocarbons in a geological structure. In some embodiments, the nanocomposites include: a core particle; a polymer associated with the core particle; a sulfur-based moiety associated with the polymer; and a releasable probe molecule associated with the core particle, where the releasable probe molecule is releasable from the core particle upon exposure to hydrocarbons. Additional embodiments of the present disclosure pertain to methods of detecting hydrocarbons in a geological structure by utilizing the nanocomposites of the present disclosure. | 2015-02-19 |
20150050742 | Analysis of Occurrence of Corrosion Products with ZPGM and PGM Catalysts Coated on Metallic Substrates - The present disclosure provides identification techniques on platinum group metal (PGM) and zero platinum group metal (ZPGM) catalyst systems, in order to identify responsible materials for the formation of corrosion products, such as hexavalent chromium compounds. Identification analyses, such as X-ray diffraction analysis (XRD) and X-ray fluorescence (XRF) may be performed on various thermally treated PGM and ZPGM catalyst systems. Results of identification analyses may show that for both PGM and ZPGM catalysts, hexavalent chromium (Cr | 2015-02-19 |
20150050743 | METHOD AND DEVICE FOR SENSING HUMIDITY WITH REVERSIBLE MOLECULAR DIMERIZATION - The present invention relates to the use of reversible dimerization of methylene blue (MB) for sensing humidity. The invention preferably uses titanate nanowires coated with MB. The self-organizational properties of MB on the surface of this nanostructured material studied by spectroscopic means revealed that the light absorption properties of the MB molecules are humidity dependent. Based on the observed humidity dependent metachromasy, we fabricated a humidity sensor using optical fiber technology which is adapted for medical, industrial or environmental applications. The sensor operates with excellent linearity over the relative humidity (RH) levels ranging from 8 to 98%. The response and recovery time can be reduced to 0.5 s while the device exhibits excellent reproducibility with low hysteresis. These performances allow the implementation of the sensor in a breathing monitoring system. Furthermore, the metachromasy was observed for other dyes. This calls for a detailed study of molecular configuration on functional surfaces since it can substantially modify the sensitization efficacy of dyes, e.g. in light conversion. | 2015-02-19 |
20150050744 | DIAGNOSTIC AGENT AND DIAGNOSTIC METHOD FOR IRRITABLE BOWEL SYNDROME INDUCED BY ABNORMAL PROLIFERATION OF ENTEROBACTERIA - [Problem to be Solved] | 2015-02-19 |
20150050745 | PEROXIDE INDICATOR - An indicator for detecting peroxide can detect the peroxide through change of hue thereof by reacting the peroxide according to a predefined concentration and a predefined sterilization treatment condition thereof. The indicator has better resistance against weather or light and preservation stability than those of prior indicators including inorganic compounds or organic compounds as discoloration components, can clearly change an arbitrary hue thereof under suitable discoloration rate, and has visible distinguishability. The indicator for detecting peroxide includes powdery metal sulfide, that undergoes discoloration by reacting with the peroxide. In particular a discoloration layer including the metal sulfide is applied onto at least a portion of a base substrate. | 2015-02-19 |
20150050746 | METHODS FOR FABRICATING HIGH ASPECT RATIO PROBES AND DEFORMING HIGH ASPECT RATIO NANOPILLARS AND MICROPILLARS - Methods for fabricating of high aspect ratio probes and deforming micropillars and nanopillars are described. Use of polymers in deforming nanopillars and micropillars is also described. | 2015-02-19 |
20150050747 | DIRECTED DNA CO-POLYMER MASS AMPLIFICATION FOR ssDNA DETECTION - The disclosure generally relates to the use of a bio-barcode (BBC) method for capture and demonstrates hybridization co-polymerization amplification readout of the BBC as a method of rapid detection of single stranded DNA output with an increased sensitivity for the initial target input to the BBC assay. The BBC assay reporter ssDNA can be modified for rapid readout. Two ssDNA molecules are designed to co-polymerize and then continually hybridize into double stranded DNA. The double stranded DNA can be optically and/or electrically detected. Kits related to the two ssDNA molecules and the BBC assay also are disclosed. | 2015-02-19 |
20150050748 | TEST DEVICE, REACTION APPARATUS AND REACTIVE TEST METHOD - A test device having a micro flow channel including a reaction part where a reactant that is reactive to a tested chemical dispersed in a tested fluid is fixed, and at least one actuator for actuating the tested fluid to move in at least one of two opposite sides of the micro flow channel so as to homogenize a density distribution of the tested chemical in the tested fluid. The tested fluid is sent in the micro flow channel a plurality of times. | 2015-02-19 |
20150050749 | METHOD FOR IDENTIFICATION AND DETECTION OF MUTANT GENE USING INTERCALATOR - The invention provides a method for detection of mutant-type DNA or/and wild-type DNA by contacting at least one of a single-stranded DNA having a substituted nucleotide, a deficient nucleotide region, or an inserted nucleotide region (mutant-type DNA), or/and a wild-type single-stranded DNA corresponding to the mutant-type DNA (wild-type DNA) with a probe hybridizing with both single-stranded DNAs, to form a hybrid with the mutant-type DNA (mutant-type hybrid) or/and a hybrid with the wild-type DNA (wild-type hybrid) (at least one of the obtained mutant-type hybrid and wild-type hybrid has a loop structure), (2) contacting the obtained mutant-type hybrid or/and wild-type hybrid with an intercalator, and (3) detecting the presence or absence of the mutant-type DNA or/and the wild-type DNA by separating the conjugate of mutant-type hybrid and intercalator or/and the conjugate of wild-type hybrid and intercalator. | 2015-02-19 |
20150050750 | PLASMA PROCESSING METHOD AND PLASMA PROCESSING APPARATUS - A plasma processing method of etching a multilayered material having a structure where a first magnetic layer | 2015-02-19 |
20150050751 | METHOD OF CONTROLLING THRESHOLD VOLTAGE AND METHOD OF FABRICATING SEMICONDUCTOR DEVICE - A method of controlling a threshold voltage is provided. The method of controlling a threshold voltage includes performing a film-thickness measuring step to measure the thickness of a film layer on a wafer to obtain a film-thickness value. Then, at least one parameter is decided, selected, or generated according to the film-thickness value. Next, an ion implantation process is performed on the wafer, wherein the ion implantation process is executed according to the parameter to form a threshold voltage adjustment region in the wafer below the film layer. | 2015-02-19 |
20150050752 | METHODS FOR CLEANING A WAFER EDGE INCLUDING A NOTCH - In a method for removing metal at the edge of a wafer, including from a notch in the edge of the wafer, water is dripped or otherwise supplied onto the up-facing metal-plated front side of the wafer, while rotating the wafer. A metal etchant, such as sulfuric acid, is provided onto the back side of the wafer, at a flow rate multiple times greater than the water flow rate. The etchant flows over the edge of the wafer and the notch, and onto an annular edge on the front side of the wafer. The metal plated in the notch is removed, even if the notch has a radial depth greater than the width of the exclusion zone. The flow rates of the water and the etchant, and the rotation speed may be adjusted to provide a static water film, with the etchant diffusing into the outer edge of the water film. | 2015-02-19 |
20150050753 | ACCELERATED RELAXATION OF STRAIN-RELAXED EPITAXIAL BUFFERS BY USE OF INTEGRATED OR STAND-ALONE THERMAL PROCESSING - Implementations of the present disclosure generally relate to methods and apparatus for forming a film on a substrate. More particularly, implementations of the present disclosure relate to methods and apparatus for heteroepitaxial growth of crystalline films. In one implementation, a method of heteroepitaxial deposition of a strain relaxed buffer (SRB) layer on a substrate is provided. The method comprises epitaxially depositing a buffer layer over a dissimilar substrate, rapidly heating the buffer layer to relax the buffer layer, rapidly cooling the buffer layer and determining whether the buffer layer has achieved a desired thickness. | 2015-02-19 |
20150050754 | METHOD FOR POSTDOPING A SEMICONDUCTOR WAFER - A method for treating a semiconductor wafer having a basic doping is disclosed. The method includes determining a doping concentration of the basic doping, and adapting the basic doping of the semiconductor wafer by postdoping. The postdoping includes at least one of the following methods: a proton implantation and a subsequent thermal process for producing hydrogen induced donors, and a neutron irradiation. In this case, at least one of the following parameters is dependent on the determined doping concentration of the basic doping: an implantation dose of the proton implantation, a temperature of the thermal process, and an irradiation dose of the neutron irradiation. | 2015-02-19 |
20150050755 | METROLOGY MARKS FOR BIDIRECTIONAL GRATING SUPERPOSITION PATTERNING PROCESSES - Cut spacer reference marks, targets having such cut spacer reference marks, and methods of making the same by forming spacer gratings around grating lines on a first layer, and fabricating a template mask that extends across and perpendicular to such spacer gratings. Cut spacer gratings are etched into a second layer using the template mask to superimpose at least a portion of the spacer gratings of the first layer into the second layer. | 2015-02-19 |
20150050756 | METHOD OF MANUFACTURING ORGANIC LIGHT-EMITTING DISPLAY APPARATUS - A method of manufacturing an organic light-emitting display apparatus includes providing an organic light-emitting device including a first electrode, a second electrode and an intermediate layer including an organic emission layer, on a substrate; forming a pre-thin film encapsulation layer including an inorganic layer including a low temperature viscosity (“LVT”) inorganic material, on the organic light-emitting device; and selectively irradiating a beam having certain energy to a local area of the pre-thin film encapsulation layer. | 2015-02-19 |
20150050757 | METHOD FOR TESTING SUSCEPTOR OF CHEMICAL VAPOR DEPOSITION APPARATUS AND METHOD FOR MANUFACTURING ORGANIC LIGHT EMITTING DISPLAY APPARATUS BY USING THE SAME - A method for testing a susceptor of a chemical vapor deposition (CVD) apparatus includes preparing a substrate including a transparent conductive layer, disposing the substrate with the transparent conductive layer on the susceptor of the CVD apparatus, and determining whether or not the susceptor of the CVD apparatus is normal by measuring a surface resistance across the transparent conductive layer. | 2015-02-19 |
20150050758 | METHOD FOR MANUFACTURING FLEXIBLE DISPLAY DEVICE - A method for manufacturing a flexible display device includes forming a separation layer on a carrier substrate, laminating a flexible substrate having an area that is larger than an area of the separation layer, to the separation layer; forming a dummy pattern on and along an edge of the flexible substrate; exposing a portion of the separation layer by removing a portion of the flexible substrate at a side of the flexible substrate; and separating the separation layer and the flexible substrate from each other. | 2015-02-19 |
20150050759 | SUBMOUNT, OPTICAL MODULE PROVIDED WITH SUBMOUNT, AND SUBMOUNT MANUFACTURING METHOD - In manufacturing a submount, a first electrode layer ( | 2015-02-19 |
20150050760 | SEMICONDUCTOR LIGHT EMITTING DEVICE AND METHOD FOR MANUFACTURING SAME - A method for manufacturing a semiconductor light emitting device comprises step of: arraying semiconductor light emitting elements on an adhesive sheet so that electrodes of the semiconductor light emitting elements face the adhesive sheet; forming a wafer thereof by filling spaces between side surfaces of the semiconductor light emitting elements arrayed on the adhesive sheet with a resin and curing the resin; peeling the adhesive sheet from the wafer; overlaying the wafer on a substrate from which numerous substrates can be obtained by subdivision into individual pieces and the electrodes of the semiconductor light emitting elements and electrodes formed on the large circuit substrate are joined; and subdividing the large circuit substrate, to which the wafer has been joined, into individual semiconductor light emitting devices so that the planar size of the semiconductor light emitting element and that of the circuit substrate are roughly equal. | 2015-02-19 |
20150050761 | LIGHT EMITTING DIODES AND A METHOD OF PACKAGING THE SAME - Disclosed herein is a method of assembling an array of light emitting diode (LED) dies on a substrate comprising: positioning dies in fluid; exposing the dies to a magnetic force to attract the dies onto magnets that are arranged at pre-determined locations either on or near the substrate; and forming permanent connections between the dies and the substrate thereby constituting an array of LED dies on a substrate. | 2015-02-19 |
20150050762 | SEPARATION METHOD OF GaN SUBSTRATE BY WET ETCHING - Disclosed herein is a method of separating a GaN substrate by wet etching. The method employs chemical lift-off, and includes forming oxide layers separated from each other and a GaN column in each space between the oxide layers on a substrate, forming an n-GaN layer covering an upper space on the oxide layers and the n-GaN columns, sequentially forming an active layer, a p-GaN layer, and a p-type electrode on the n-GaN layer, and removing the oxide layers and wet etching the n-GaN columns to separate the substrate. The method can achieve improvement in epitaxial growth of GaN and reduction in fabrication costs through a simple process. In addition, the method can increase a luminous area and light extraction efficiency. | 2015-02-19 |
20150050763 | SEMICONDUCTOR LIGHT EMITTING DEVICE - According to one embodiment, a semiconductor light emitting device includes an n-type layer, a light emitting layer, a p-type layer, and a transparent electrode. The n-type layer includes a nitride semiconductor and has a thickness not more than 500 nm. The light emitting layer is provided on the n-type layer. The p-type layer is provided on the light emitting layer and includes a nitride semiconductor. The transparent electrode contacts the n-type layer. The n-type layer is disposed between the transparent electrode and the light emitting layer. | 2015-02-19 |
20150050764 | Method for manufacturing diode - The present invention discloses a diode and a manufacturing method thereof and a display apparatus. The diode comprises a composite anode, a transparent metal oxide layer, a basic stack layer, and a composite cathode. The composite anode comprises a transparent anode layer and a first transparent metal layer. The first transparent metal layer is formed on the transparent anode layer. The transparent metal oxide layer is formed on the first transparent metal layer. The basic stack layer is formed on the transparent metal oxide layer. The composite cathode comprises two second transparent metal layers. The two second transparent metal layers are formed on the basic stack layer. Both transmittance and efficiency of the diode are significantly improved. The reliability of the diode is improved to elongate the lifetime of the diode. | 2015-02-19 |
20150050765 | PHOTOLITHOGRAPHIC METHODS OF PRODUCING STRUCTURES IN RADIATION-EMITTING SEMICONDUCTOR COMPONENTS - A photolithographic method which produces a structure in a radiation-emitting semiconductor component by providing a semiconductor wafer having a semiconductor layer sequence, applying a first photoresist layer to the semiconductor wafer, providing a mask, and arranging the mask relative to the coated semiconductor wafer, exposing the first photoresist layer and imaging the mask in the first photoresist layer, arranging the mask or a different mask relative to the semiconductor wafer at another position different from a first position and again exposing the first photoresist layer and imaging the mask in the first photoresist layer or applying a second photoresist layer to the first photoresist layer, arranging the mask or a different mask relative to the semiconductor wafer at a second position, and exposing the second photoresist layer and imaging the mask in the second photoresist layer, forming a patterned photoresist layer and patterning the semiconductor wafer. | 2015-02-19 |
20150050766 | METHOD FOR PREVENTING SHORT CIRCUIT BETWEEN METAL WIRES IN ORGANNIC LIGHT EMITTING DIODE DISPLAY DEVICE - Disclosed is a method for preventing a short circuit between metal wires in an organic light emitting diode display device. The method includes: forming an inorganic layer on a substrate; forming an opening in the inorganic layer for exposing a part of the substrate; forming a metal layer on the inorganic layer, the metal layer including two metal wires respectively positioned at two sides of the opening; forming an organic layer on the two metal wires of the metal layer; and forming an indium tin oxide layer on the organic layer. The present invention can ensure that the short circuit does not occur between the metal wires by forming the opening in the inorganic layer. | 2015-02-19 |
20150050767 | EVAPORATION MASK AND METHOD OF MANUFACTURING DISPLAY UNIT - An evaporation mask includes: a mask body including a pattern region configured of a plurality of passage holes; and an adjusting frame configured to hold the mask body and having a mechanism capable of adjusting positions of the passage holes on the mask body. The adjusting frame has a frame-like base material, and a movable member that is provided along one or more sides of the base material to be bonded with an outer edge of the mask body, and at least a part of which is deformable on the base material. One or a plurality of slits are provided at a selective region of the movable member. | 2015-02-19 |
20150050768 | LASER DIODE DEVICE AND METHOD OF MANUFACTURING LASER DIODE DEVICE - A laser diode device includes: a semiconductor substrate including a semi-polar surface, the semiconductor substrate being formed of a hexagonal III-nitride semiconductor; an epitaxial layer including a light emitting layer, the epitaxial layer being formed on the semi-polar surface of the semiconductor substrate, and the epitaxial layer including a ridge section; a first electrode formed on a top surface of the ridge section; an insulating layer covering the epitaxial layer in an adjacent region of the ridge section and a side surface of the ridge section, the insulating layer covering part or all of side surfaces of the first electrode continuously from the epitaxial layer; a pad electrode formed to cover a top surface of the first electrode and the insulating layer, the pad electrode being electrically connected to the first electrode; and a second electrode formed on a surface, of the semiconductor substrate, opposite to the semi-polar surface. | 2015-02-19 |
20150050769 | SOLAR-POWERED ENERGY-AUTONOMOUS SILICON-ON-INSULATOR DEVICE - A solar-powered autonomous CMOS circuit structure is fabricated with monolithically integrated photovoltaic solar cells. The structure includes a device layer including an integrated circuit and a solar cell layer. Solar cell structures in the solar cell layer can be series connected during metallization of the device layer or subsequently. The device layer and the solar cell layer are formed using a silicon-on-insulator substrate. Subsequent spalling of the silicon-on-insulator substrate through the handle substrate thereof facilitates production of a relatively thin solar cell layer that can be subjected to a selective etching process to isolate the solar cell structures. | 2015-02-19 |
20150050770 | PROCESS FOR PRODUCING LAYERED MEMBER AND LAYERED MEMBER - The object is to provide a photoelectric surface member which allows higher quantum efficiency. In order to achieve this object, a photoelectric surface member | 2015-02-19 |
20150050771 | METHOD AND TOOL TO REVERSE THE CHARGES IN ANTI-REFLECTION FILMS USED FOR SOLAR CELL APPLICATIONS - A method is provided for making a solar cell. The method includes providing a stack including a substrate, a barrier layer disposed on the substrate, and an anti-reflective layer disposed on the barrier layer, where the anti-reflective layer has charge centers. The method also includes generating a corona with a charging tool and contacting the anti-reflective layer with the corona thereby injecting charge into at least some of the charge centers in the anti-reflective layer. Ultra-violet illumination and temperature-based annealing may be used to modify the charge of the anti-reflective layer. | 2015-02-19 |
20150050772 | METHOD OF FORMING CHALCOPYRITE THIN FILM SOLAR CELL - In a method of forming a CIGS film absorption layer, a first precursor is provided including a first substrate having a major process precursor film formed thereon, the major process precursor film containing two or more of Cu, In, Ga, and Se. A second precursor is provided including a second substrate having an element supplying precursor film formed thereon, the element supply precursor film containing two or more of Cu, In, Ga and Se. The precursors are oriented with the major process precursor film and element supplying precursor film facing one another so as to allow diffusion of elements between the films during annealing. The oriented films are annealed and then the precursors are separated, wherein the CIGS film is formed over the first substrate and either a CIGS film or a precursor film containing two or more of Cu, In, Ga, and Se remains over the second substrate. | 2015-02-19 |
20150050773 | METHOD FOR PRODUCING AN ELECTRICALLY CONDUCTIVE CONTACT ON A SOLAR CELL - A method is provided for producing an electrically conductive contact on a rear face and/or front face of a solar cell. The method interconnects solar cells in a cost-effective manner and ensures that cell damage, which leads to a reduction in power, is avoided. The rear face and/or front face of the solar cell is treated in the region of the contact and, after the treatment in the region, a pasty adhesive or an adhesive tape is applied in strips. | 2015-02-19 |
20150050774 | SEMICONDUCTOR DEVICE AND METHOD FOR MANUFACTURING THE SEMICONDUCTOR DEVICE - An object is to provide favorable interface characteristics of a thin film transistor including an oxide semiconductor layer without mixing of an impurity such as moisture. Another object is to provide a semiconductor device including a thin film transistor having excellent electric characteristics and high reliability, and a method by which a semiconductor device can be manufactured with high productivity. A main point is to perform oxygen radical treatment on a surface of a gate insulating layer. Accordingly, there is a peak of the oxygen concentration at an interface between the gate insulating layer and a semiconductor layer, and the oxygen concentration of the gate insulating layer has a concentration gradient. The oxygen concentration is increased toward the interface between the gate insulating layer and the semiconductor layer. | 2015-02-19 |
20150050775 | METHOD FOR MANUFACTURING SEMICONDUCTOR DEVICE - An object is to provide a semiconductor device including an oxide semiconductor, which has stable electrical characteristics and high reliability. In a manufacturing process of a bottom-gate transistor including an oxide semiconductor layer, heat treatment in an atmosphere containing oxygen and heat treatment in vacuum are sequentially performed for dehydration or dehydrogenation of the oxide semiconductor layer. In addition, irradiation with light having a short wavelength is performed concurrently with the heat treatment, whereby elimination of hydrogen, OH, or the like is promoted. A transistor including an oxide semiconductor layer on which dehydration or dehydrogenation treatment is performed through such heat treatment has improved stability, so that variation in electrical characteristics of the transistor due to light irradiation or a bias-temperature stress (BT) test is suppressed. | 2015-02-19 |
20150050776 | SPUTTERING TARGET, METHOD FOR MANUFACTURING THE SAME, AND METHOD FOR MANUFACTURING SEMICONDUCTOR DEVICE - A deposition technique for forming an oxynitride film is provided. A highly reliable semiconductor element is manufactured with the use of the oxynitride film. The oxynitride film is formed with the use of a sputtering target including an oxynitride containing indium, gallium, and zinc, which is obtained by sintering a mixture of at least one of indium nitride, gallium nitride, and zinc nitride as a raw material and at least one of indium oxide, gallium oxide, and zinc oxide in a nitrogen atmosphere. In this manner, the oxynitride film can contain nitrogen at a necessary concentration. The oxynitride film can be used for a gate, a source electrode, a drain electrode, or the like of a transistor. | 2015-02-19 |
20150050777 | Integrated circuit package having surface-mount blocking elements - A first cavity-down ball grid array (BGA) package includes a substrate member and an array of bond balls. The array of bond balls includes a pair of parallel extending rows of outer mesh bond balls and a row of inner signal bond balls that is parallel to the pair of rows of outer mesh bond balls. A surface-mount blocking element is disposed between the row of inner signal bond balls and the pair of rows of outer mesh bond balls. The surface-mount blocking element is either a passive or an active component of the BGA package. In one example, the first cavity-down BGA package is surface-mounted to a second cavity-down BGA package to form a package-on-package (POP) security module. The surface-mount blocking element provides additional physical barrier against the probing of the inner signal bond balls. Sensitive data is therefore protected from unauthorized access. | 2015-02-19 |
20150050778 | METHOD AND APPARATUS FOR PRODUCING SEMICONDUCTOR DEVICE - Disclosed is a method for producing a semiconductor device in which solder joints are made between a semiconductor chip with bumps and a substrate with electrodes corresponding to the bumps through a thermosetting adhesive layer, the method including the successive steps of: (A) forming a thermosetting adhesive layer in advance on a surface including bumps of the semiconductor chip; (B) laying a surface on the thermosetting adhesive layer side of the semiconductor chip, on which the thermosetting adhesive layer is formed, and a substrate one upon another, followed by pre-bonding using a heat tool to obtain a pre-bonded laminate; and (C) interposing a protective film having a thermal conductivity of 100 W/mK or more between the heat tool and a surface on the semiconductor chip side of the pre-bonded laminate, melting a solder between the semiconductor chips and the substrate and simultaneously curing the thermosetting adhesive layer using the heat tool. There is provided a method and an apparatus for producing a semiconductor device, which is capable of making a satisfactory joint without causing catching of a resin of an adhesive film between bumps and electrode pads. | 2015-02-19 |
20150050779 | Packaged Semiconductor Devices, Methods of Packaging Semiconductor Devices, and PoP Devices - Packaged semiconductor devices, methods of packaging semiconductor devices, and package-on-package (PoP) devices are disclosed. In some embodiments, a method of packaging a semiconductor device includes forming through-package vias (TPVs) over a carrier, and coupling a semiconductor device to the carrier. The semiconductor device includes contact pads disposed on a surface thereof and an insulating material disposed over the contact pads. A molding material is formed over the carrier between the TPVs and the semiconductor device. Openings are formed in the insulating material using a laser drilling process over the contact pads, and a redistribution layer (RDL) is formed over the insulating material and the openings in the insulating material. A portion of the RDL is coupled to a top surface of each of the contact pads. | 2015-02-19 |
20150050780 | ADHESIVE SHEET AND METHOD FOR MANUFACTURING SEMICONDUCTOR DEVICE - The adhesive sheet of the invention comprises a resin composition containing (A) a high-molecular-weight component, (B1) a thermosetting component having a softening point of below 50° C., (B2) a thermosetting component having a softening point of between 50° C. and 100° C. and (C) a phenol resin having a softening point of no higher than 100° C., the composition containing 11 to 22 mass % of the (A) high-molecular-weight component, 10 to 20 mass % of the (B1) thermosetting component having a softening point of below 50° C., 10 to 20 mass % of the (B2) thermosetting component having a softening point of between 50° C. and 100° C. and 15 to 30 mass % of the phenol resin having a softening point of no higher than 100° C., based on 100 mass % of the resin composition. | 2015-02-19 |
20150050781 | SEMICONDUCTOR PACKAGE WITH EMBEDDED DIE AND ITS METHODS OF FABRICATION - Embodiments of the present invention describe a semiconductor package having an embedded die. The semiconductor package comprises a coreless substrate that contains the embedded die. The semiconductor package provides die stacking or package stacking capabilities. Furthermore, embodiments of the present invention describe a method of fabricating the semiconductor package that minimizes assembly costs. | 2015-02-19 |
20150050782 | FABRICATION METHOD OF PACKAGING SUBSTRATE - A packaging substrate and a semiconductor package using the packaging substrate are provided. The packaging substrate includes: a substrate body having a die attach area, a circuit layer formed around the die attach area and having a plurality of conductive traces each having a wire bonding pad, and a surface treatment layer formed on the wire bonding pads. Therein, only one of the conductive traces is connected to an electroplating line so as to prevent cross-talk that otherwise occurs between conductive traces due to too many electroplating lines in the prior art. | 2015-02-19 |
20150050783 | Molding Chamber Apparatus and Curing Method - An embodiment is a molding chamber. The molding chamber comprises a mold-conforming chase, a substrate-base chase, a first radiation permissive component, and a microwave generator coupled to a first waveguide. The mold-conforming chase is over the substrate-base chase, and the mold-conforming chase is moveable in relation to the substrate-base chase. The first radiation permissive component is in one of the mold-conforming chase or the substrate-base chase. The microwave generator and the first waveguide are together operable to direct microwave radiation through the first radiation permissive component. | 2015-02-19 |
20150050784 | BI-DIRECTIONAL SILICON CONTROLLED RECTIFIER STRUCTURE - Fabrication methods for bi-directional silicon controlled rectifier device structures. A well of a first conductivity type is formed in a device region, which may be defined from a device layer of a semiconductor-on-insulator substrate. An anode of a first silicon controlled rectifier is formed in the first well. A cathode of a second silicon controlled rectifier is formed in the first well. The anode of the first silicon controlled rectifier has the first conductivity type. The cathode of the second silicon controlled rectifier has a second conductivity type opposite to the first conductivity type. | 2015-02-19 |
20150050785 | METHOD OF FORMING A COMPLEMENTARY METAL-OXIDESEMICONDUCTOR (CMOS) DEVICE - A complementary metal-oxide-semiconductor (CMOS) device and methods of formation thereof are disclosed. In a particular example, a method of forming a CMOS device includes forming a first layer on an extension layer of a wafer, forming a first gate on a portion of the first layer, and forming an expansion region proximate to the extension layer. The method also includes removing a portion of the first gate to create a cavity and removing a portion of the first layer to extend the cavity to the extension layer. | 2015-02-19 |
20150050786 | THIN FILM TRANSISTOR - A thin film transistor is provided. The thin film transistor includes a source electrode, a drain electrode, a semiconducting layer, a transition layer, an insulating layer and a gate electrode. The drain electrode is spaced apart from the source electrode. The gate electrode is insulated from the source electrode, the drain electrode, and the semiconductor layer by the insulating layer. The transition layer is sandwiched between the insulating layer and the semiconductor layer. The transition layer is a silicon-oxide cross-linked polymer layer including a plurality of Si atoms. The plurality of Si atoms is bonded with atoms of the insulating layer and atoms of the semiconductor layer. | 2015-02-19 |
20150050787 | FULLY SILICIDED GATE FORMED ACCORDING TO THE GATE-FIRST HKMG APPROACH - When forming field-effect transistors, a common problem is the formation of a Schottky barrier at the interface between a metal thin film in the gate electrode and a semiconductor material, typically polysilicon, formed thereupon. Fully silicided gates are known in the state of the art, which may overcome this problem. However, formation of a fully silicided gate is hindered by the fact that silicidation of the source and drain regions and of the gate electrode are normally performed simultaneously. The claimed method proposes two consecutive silicidation processes which are decoupled with respect to each other. During the first silicidation process, a metal silicide is formed forming an interface with the source and drain regions and without affecting the gate electrode. During the second silicidation, a metal silicide layer having an interface with the gate electrode is formed, without affecting the transistor source and drain regions. | 2015-02-19 |
20150050788 | Current steering element formation for memory arrays - The present invention is a method for forming a self-aligned, three dimensional structure in a crystalline surface and then converting that self-aligned, three dimensional structure into an array of diodes or current switches so as to minimize reverse leakage in the resulting array. | 2015-02-19 |
20150050789 | Meander Line Resistor Structure - A method comprises implanting ions in a substrate to form a first active region and a second active region, depositing a first dielectric layer over the substrate, forming a first via and a second via in the first dielectric layer, wherein the first via is over the first active region and the second via is over the second active region, depositing a second dielectric layer over the first dielectric layer, forming a third via and a fourth via in the second dielectric layer, wherein the third via is over the first via and the fourth via is over the second via and forming a connector in a metallization layer over the second dielectric layer, wherein the connector is electrically connected to the third via and the fourth via. | 2015-02-19 |