Class / Patent application number | Description | Number of patent applications / Date published |
514180700 | Anti-inflammatory | 34 |
20100292159 | METHOD OF TREATMENT OR PROPHYLAXIS OF INFLAMMATORY PAIN - This invention discloses the use of angiotensin II receptor 2 (AT | 11-18-2010 |
20110009333 | PHARMACEUTICAL OR COSMETIC COMPOSITION AND USE OF A PKC INHIBITOR WITH AN MMP INHIBITOR FOR INHIBITING LANGERHANS' CELL MIGRATION - Disorders of the skin or mucous membranes which are linked to migration of Langerhans cells are treated by the administration of an effective amount of at least one retinoid, optionally in combination with a PKC inhibitor. | 01-13-2011 |
20110028404 | Composition Comprising Vegetable Peptone for Promoting Stem Cell Proliferation - The present invention relates to a composition for promoting stem cell proliferation which contains a vegetable peptone. More specifically, this invention relates to: a serum-free composition for culturing stem cells which contains a vegetable peptone; a composition for improving skin condition containing the vegetable peptone as an active ingredient; and a composition for improving skin condition containing a culture medium as an active ingredient in which cultured stem cells are removed after being cultured in a serum-free composition medium for stem cell culture containing the vegetable peptone. Since the disclosed serum-free composition for culturing stem cells does not need the use of expensive animal serum, the manufacturing cost can be remarkably lowered. Also the use of anima serum in the medium can basically prevent contamination material caused by the use of animal serum. In addition, the disclosed composition containing the vegetable peptone and the medium in which the stem cells are cultured in the serum-free medium both serve to promote and activated the proliferation of stem cells, and improve various skin conditions. | 02-03-2011 |
20110065649 | USE OF MULTIVALENT SYNTHETIC LIGANDS OF SURFACE NUCLEOLIN FOR TREATING CANCER OR INFLAMMATION - A method for treating disorders involving deregulation of cell proliferation and/or angiogenesis comprising the administration of an effective amount of a multivalent synthetic compound comprising a support on which at least 3 pseudopeptide units are grafted, said compound being of formula (I). | 03-17-2011 |
20110092438 | Composition for external application comprising transcription factor decoy as active ingredient - The present invention provides an external preparation composition of transcription factor decoy of good skin permeability, the composition comprising a transcription factor decoy dissolved in a fatty acid-based ionic liquid obtained from a fatty acid having 2 to 20 carbon atoms and an organic amine compound having 4 to 12 carbon atoms. | 04-21-2011 |
20110160143 | Topical Acyl Glutathione Psoriasis Compositions - Topical compositions to treat inflammatory skin conditions such as psoriasis comprise an effective amount of S-acyl glutathione derivative and a carrier. Methods for treating inflammatory skin conditions such as psoriasis comprise applying a composition containing S-acyl glutathione derivative in a dermatologically acceptable carrier to skin tissue. The acyl group is a saturated or unsaturated aliphatic C | 06-30-2011 |
20110160144 | Topical Acyl Glutathione Formulations - Topical compositions to prevent and to treat skin aging comprise an effective amount of S-acyl glutathione derivative and a carrier. Methods for preventing and treating skin aging comprise applying a composition containing S-acyl glutathione derivative in a dermatologically acceptable carrier to skin tissue. The acyl group is a saturated or unsaturated aliphatic C | 06-30-2011 |
20110230417 | TREATMENT OF DISEASES AND CONDITIONS MEDIATED BY INCREASED PHOSPHORYLATION - The invention provides methods for the treatment of diseases and conditions mediated by increased phosphorylation, such as inflammation and cancer. The invention also provides methods for the inhibition of increased phosphorylation in cells, tissues and organs. The methods utilize a phosphate acceptor compound (PAC). The invention also provides products comprising a PAC. | 09-22-2011 |
20110263509 | PREPARATION AND USE OF HIGH-PURITY HEMOPARATIDE (HPTH-1-37) FOR THE TREATMENT OF INFLAMMATORY SCALING DISEASES OF THE SKIN - Use of hPTH-1-37 having the amino acid sequence SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL (SEQ ID No. 1) or one of its natural and pharmacologically compatible derivatives, especially amidated, acylated, phosphorylated and glycosylated derivatives, for preparing a medicament for the treatment of inflammatory scaling (erythematosquamous) diseases, especially psoriasis, wherein hPTH-1-37 (SEQ ID No. 1) is present in an amount of from 300 μg to 30 mg per gram of medicament. | 10-27-2011 |
20110306561 | COMPLEMENT C3a DERIVED DIMERIC PEPTIDES AND USES THEREOF - Peptide compositions comprising a dimeric peptide which combines two peptide monomers, each independently comprising the amino acid sequence: | 12-15-2011 |
20120058952 | HMG-COA REDUCTASE DERIVED PEPTIDE AND COSMETIC OR PHARMACEUTICAL COMPOSITION CONTAINING SAME - The present invention relates to a peptide of general formula (I):
| 03-08-2012 |
20120088734 | Cyclosporin Analogs - Disclosed herein are novel analogs of cyclosporin, pharmaceutical compositions containing them, and methods for their use in the treatment of dry eye and other conditions. | 04-12-2012 |
20120094917 | IAP INHIBITORS - The present invention describes compounds, processes for their preparation, pharmaceutical compositions containing them, and their use in therapy. | 04-19-2012 |
20120094918 | METHOD OF USING DIKETOPIPERAZINES AND COMPOSITION CONTAINING THEM - The invention provides a method of inhibiting the effects of platelet activating factor (PAF). For instance, a disease or condition mediated by PAF (particularly inflammation) can be treated or platelet aggregation can be inhibited. The invention also provides a method of inhibiting the production and/or release of interleukin 8 (IL-8) by cells. The effects of PAF and the production and/or release of IL-8 are inhibited according to the invention by a compound of the formula: | 04-19-2012 |
20120264696 | PREVENTION OF CELLULAR SENESCENCE IN MAMMALS BY NATURAL PEPTIDE COMPLEXES - Preventing skin aging by targeting multiple causes by a single bullet is of primal scientific and consumer interest. A treatment based on compositions of compound (I) for cellular senescence to control cellular degradation offers such a solution to multiple skin ailments including skin degradation from cancer, diabetes, radiation treatments, chemotherapy, and sun-burn; mitochondrial dysfunction, age spots, acne, loss of cellular antioxidants, collagen loss, loss of skin pliability, loss of skin suppleness, skin wrinkles including fine lines, oxidation, damage from radiation, damage from free radicals, damage from UV, dry skin, xerosis, ichthyosis, dandruff, brownish spots, keratoses, melasma, lentigines, liver spots, pigmented spots, dark circles under the eyes, skin pigmentation including darkened skin, blemishes, oily skin, warts, eczema, pruritic skin, psoriasis, inflammatory dermatoses, topical inflammation, disturbed keratinization, skin changes associated with aging, scalp dryness, skin depigmentation, intracellular dehydration, and combinations thereof; | 10-18-2012 |
20120270796 | Suspension Type Topical Formulations Comprising Cyclic Depsipeptide - The invention relates to novel topical pharmaceutical compositions in which the active agent is a cyclic depsipeptide of formula (II) | 10-25-2012 |
20130059791 | CRYSTALLINE D-ISOGLUTAMYL-D-TRYPTOPHAN AND THE MONO AMMONIUM SLAT OF D-ISOGLUTAMYL-D-TRYPTOPHAN - A process for making pure crystalline D-isoglutamyl-D-tryptophan is provided which includes the step of deprotecting essentially pure N-tert-butoxycarbonyl-D-isoglutamyl-D-tryptophan or its diester to yield essentially pure D-isoglutamyl-D-tryptophan. A process is also provided for the preparation of pure mono ammonium salt of D-isoglutamyl-D-tryptophan from essentially pure N-tert-butoxycarbonyl-D-isoglutamyl-D-tryptophan. D-isoglutamyl-D-tryptophan, ammonium salt (1:1) is a stable pharmaceutical solid. | 03-07-2013 |
20130079287 | CAFFEOYLALPHANEOENDORPHIN PEPTIDE DERIVATIVE AND USE THEREOF AS ANTI-ITCHING AND ANTI-ATOPIC AGENTS - Provided is a caffeoylalphaneoendrophin peptide derivative, and use thereof, as an anti-itching agent and an anti-atopic agent. More specifically, provided is a caffeoyl endorphin peptide derivative, which is applicable in a cosmetic material for anti-inflammatory use, such as for an atopic dermatitis treatment, and the like. The caffeoyl endorphin peptide derivative is safe for skin, has resistance to degradation by peptidases, and the like, and also has an excellent stability with respect to temperature change, and the like. | 03-28-2013 |
20130203679 | IMMUNOREGULATORY PEPTIDES AND METHODS OF USE - Peptides for the treatment of inflammation, and therapeutic uses and methods of using the same are disclosed. Peptides including a transducing sequence are effective for inhibiting cytokine activity and TNF-α secretion through interaction with toll-like receptors. Experiments are described illustrating the efficacy of the compounds in treating otitis media | 08-08-2013 |
20130210741 | IMMUNOREGULATORY PEPTIDES AND METHODS OF USE - Peptides for the treatment of inflammation, and therapeutic uses and methods of using the same are disclosed. Peptides including a transducing sequence are effective for inhibiting cytokine activity and TNF-α secretion through interaction with toll-like receptors. Experiments are described illustrating the efficacy of the compounds in treating otitis media | 08-15-2013 |
20130296250 | METHOD FOR TREATMENT OF PSORIASIS - The present disclosure provides a method and kit for treatment of psoriasis using PKC-alpha inhibitors. Exemplary inhibitors include peptide PKC-alpha inhibitors which specifically inhibit PKC-alpha activity leading to the attenuation and treatment of psoriasis. | 11-07-2013 |
20130316957 | SMOOTHENED POLYPEPTIDES AND METHODS OF USE - Disclosed is an isolated or purified polypeptide or peptidomimetic comprising an amino acid sequence of a portion of a Smoothened (SMO) protein, wherein the portion comprises an amino acid sequence of any of the intracellular loops of the SMO protein, a functional fragment thereof, or a functional variant of either the portion or the functional fragment, wherein the functional fragment comprises at least 7 contiguous amino acids of the intracellular loops, and wherein the functional fragment or functional variant inhibits proliferation of a diseased cell, or a fatty acid derivative thereof. Related conjugates, nucleic acids, recombinant expression vectors, host cells, and pharmaceutical compositions are further provided. Methods of inhibiting proliferation of a diseased cell, treating or preventing cancer, treating a neoplasm or psoriasis, and inhibiting the expression of genes involved in the Hedgehog signaling pathway, thereby inhibiting the Hedgehog signaling pathway, are furthermore provided by the invention. | 11-28-2013 |
20140051639 | Compositions and Methods which modulate G-Protein Signaling for the Treatment of Inflammatory Disorders such as Asthma and Allergic Conjunctivitis - Compositions and methods for the treatment of asthma and inflammatory ocular disorders are disclosed. | 02-20-2014 |
20140142042 | SKIN WOUND HEALING AND SCAR REDUCTION WITH PROSTAGLANDIN EP4 AGONIST COMBINATIONS - A combination of a prostaglandin EP4 agonist and an effective amount of: a prostaglandin EP2 agonist, a skin growth factor, a small peptide, a small inhibitory RNA targeting excess chronic inflammation or fibrosis, a cytokine with beneficial anti-inflammatory activity, an adenosine A2a receptor agonist, an anti-oxidant, or a combination thereof, may be used to treat skin wounds or scars. | 05-22-2014 |
20140162959 | SUSPENSION TYPE TOPICAL FORMULATIONS COMPRISING CYCLIC DEPDIPEPTIDE - The invention relates to novel topical pharmaceutical compositions in which the active agent is a cyclic depsipeptide of formula (II) | 06-12-2014 |
20140296154 | METHOD OF PREVENTING DEVELOPMENT OF PSORIATIC LESIONS - The present invention relates to a method of inhibiting onset of or preventing development of a psoriatic lesion in a patient having psoriasis. The method comprises administering to a patient having psoriasis an effective amount of an agent that inhibits NF-κB activity under conditions effective to inhibit onset of or prevent development of psoriatic lesions. Another aspect of the invention relates to a method of treating an early stage psoriatic lesion on a patient by contacting the early stage psoriatic lesion of a patient with an effective amount of an agent that inhibits NF-κB activity, whereby said contacting inhibits development of the early stage psoriatic lesion. Both transgenic and nontransgenic approaches are contemplated. | 10-02-2014 |
20140349943 | TOPICAL FORMULATIONS OF CHEMERIN C15 PEPTIDES FOR THE TREATMENT OF DERMATOLOGICAL CONDITIONS - Described herein, are topical formulations for treating a dermatological disease, disorder, or condition. Topical formulation disclosed herein include a therapeutically-effective amount of a human chemerin C15 peptide formulated for dermal administration. | 11-27-2014 |
20150065433 | CYCLOSPORIN ANALOGS - Disclosed herein are novel analogs of cyclosporin, pharmaceutical compositions containing them, and methods for their use in the treatment of dry eye and other conditions. | 03-05-2015 |
20150352045 | SKIN ENHANCING BEVERAGE COMPOSITION - The invention provides a beverage composition comprising hydrolysed collagen and vitamin C, or a derivative thereof, which is particularly suitable for improving skin hydration and skin condition. Additional active ingredients may include methyl sulphonyl methane, a vitamin selected from the vitamin B complex, L-lysine, omega-3 and omega-6 fatty acids. The beverage composition is such that it promotes higher absorption and bioavailability of skin-nourishing ingredients. The beverage composition can improve the moisture content of the skin and can prevent fine lines and wrinkles. | 12-10-2015 |
20160000874 | Modulating Ischemic Injury - The invention is directed to methods of modulating ischemic injury in tissues and organs, including donor tissue and organs and intact tissue and organs. The invention is further directed to methods of increasing time to ischemic injury in such tissues and organs. The invention is further directed to storing and preserving donor tissues and organs. Such methods utilize compositions comprising Amnion-derived Cellular Cytokine Solution (herein referred to as ACCS). The ACCS compositions may be formulated for sustained-release, targeted-release, timed-release, extended-release, etc. and may be used alone or in combination with various suitable active agents. | 01-07-2016 |
20160039894 | PTD-SMAD7 THERAPEUTICS - The present technology provides methods and compositions for the treatment of inflammatory and/or tissue damage conditions. In particular, the use of Smad7 compositions delivered locally or systemically to a site of inflammation and/or tissue damage is described. Other specific embodiments concern treatment or prevention of side effects caused by radiation and/or chemotherapy, including but not limited to oral and gastric mucositis. Also provided are codon-optimized nucleic acids encoding for Smad7 fusion proteins. | 02-11-2016 |
20160136231 | TOPICAL FORMULATIONS OF CHEMERIN C15 PEPTIDES FOR THE TREATMENT OF DERMATOLOGICAL CONDITIONS - Described herein, are topical formulations for treating a dermatological disease, disorder, or condition. Topical formulations disclosed herein include a therapeutically-effective amount of a human chemerin C15 peptide formulated for dermal administration. | 05-19-2016 |
20160143990 | Topical Compositions Comprising OB-Fold Variants - The invention relates to a topical composition containing a variant of an OB-fold protein, and also to the process for preparing the same. | 05-26-2016 |
20160159872 | METHODS AND COMPOSITIONS FOR TREATING CANCER AND INFLAMMATORY DISEASES - The invention provides a peptide construct comprising a cell penetrating peptide and an inhibitory peptide that interferes with the interaction between E1A and CtBP. The invention also provides related pharmaceutical composition comprising such a peptide construct. Also provided is a conjugate comprising such a peptide construct and a carrier molecule. The invention also provides related pharmaceutical compositions. Also provided are related methods of inhibiting cell proliferation in an individual and methods of treating cancer in by such pharmaceutical compositions. The present application also provides methods of treating an inflammatory disease and inhibiting inflammation in an individual comprising administering to the individual an effective amount of a therapeutic agent comprising an inhibitory peptide that interferes with the interaction between E1A and CtBP. | 06-09-2016 |