Patent application title: SYNTHETIC PLASMID DNA VACCINE EXPRESSING A CODON-OPTIMIZED SARS-COV-2 SPIKE PROTEIN AND METHODS FOR ITS USE
Inventors:
Anwar M. Hashem (Jeddah, SA)
Mohamed A. Alfaleh (Jeddah, SA)
Turki S. Abujamel (Jeddah, SA)
Sawsan S. Alamri (Jeddah, SA)
Abdullah Algaissi (Jeddah, SA)
Khalid A. Alluhaybi (Jeddah, SA)
IPC8 Class: AA61K39215FI
USPC Class:
1 1
Class name:
Publication date: 2022-09-22
Patent application number: 20220296701
Abstract:
A synthetic DNA vaccine against SARS-CoV-2 infection comprises a
codon-optimized coding sequence for optimal mammalian expression of a
pSARS2 spike glycoprotein (pSARS2-S). The signal peptide may be replaced
with the signal peptide from the human IgG2 heavy chain. Systemic
S1-specific IgG antibodies and neutralizing antibodies (nAbs) were
significantly induced in mice at 2 weeks-post three injections with 100
.mu.g of the pSARS2-S vaccine via intramuscular (IM) needle injection. IM
immunization induced Th1-skewed and long-lasting IgG response in BALB/c
mice. Immunogenicity and induction of nAbs were enhanced with a
needle-free delivery system, wherein two doses were sufficient to elicit
significant levels of systemic S1-specific IgG antibodies and nAbs via IM
or intradermal immunization.Claims:
1. A DNA vaccine able to induce an immune response against a SARS-CoV-2
coronavirus, comprising a DNA plasmid encoding a codon-optimized pSARS2
spike glycoprotein (pSARS2-S) as an immunogen from a SARS-CoV-2
coronavirus, wherein the pSARS2-S is codon-optimized for mammalian
expression, and wherein the pSARS2-S N-terminal signal peptide is
replaced with a signal peptide from a human IgG2 heavy chain.
2. The DNA vaccine of claim 1, wherein DNA sequences encoding the codon-optimized pSARS2-S and encoding the signal peptide from the human IgG2 heavy chain have the nucleotide sequence identity of SEQ ID NO:1.
4. The DNA vaccine of claim 1, wherein the DNA sequences of the signal peptide from the human IgG2 heavy chain encode an amino acid sequence having the identity of SEQ ID NO:2.
4. The DNA vaccine of claim 1, wherein the DNA sequences encoding the signal peptide from the human IgG2 heavy chain have the nucleotide sequence identity of SEQ ID NO:3.
5. The DNA vaccine of claim 1, wherein the DNA sequences encode a protein having the amino acid identity of SEQ ID NO:4.
6. A DNA vaccine able to induce an immune response to a SARS-CoV-2 coronavirus, wherein the immunogen is encoded by nucleotide sequences having the identity of SEQ ID NO:1.
7. The DNA vaccine of claim 6, wherein the nucleotide sequences encode a protein having the amino acid sequence identity of SEQ ID NO:4.
8. A method of inducing an immune response to a pSARS2 spike glycoprotein (pSARS2-S) from a SARS-CoV-2 coronavirus in a subject in need thereof, comprising the steps of administering to a subject a dose of a pharmaceutical composition comprising a DNA plasmid encoding a codon-optimized pSARS2 spike glycoprotein (pSARS2-S) from a SARS-CoV-2 coronavirus, wherein the pSARS2-S is codon-optimized for mammalian expression, wherein the pSARS2-S N-terminal signal peptide is replaced with a signal peptide from a human IgG2 heavy chain; allowing a suitable period of time to elapse; and administering at least one additional dose of the pharmaceutical composition.
9. The method of claim 8, wherein the DNA sequences encoding the codon-optimized pSARS2-S and the signal peptide from the human IgG2 heavy chain have the nucleotide identity of SEQ ID NO:1.
10. The method of claim 8, wherein the pharmaceutical composition is administered intramuscularly or intradermally.
11. The method of claim 8, wherein 10 to 150 .mu.g of the DNA plasmid is administered to the subject in each dose.
12. The method of claim 8, wherein at least 25 .mu.g of the DNA plasmid is administered to the subject in each dose.
13. The method of claim 8, wherein 50 to 100 .mu.g of the DNA plasmid is administered to the subject in each dose.
14. A method of inducing an immune response to a pSARS2 spike glycoprotein (pSARS2-S) from a SARS-CoV-2 coronavirus in a subject in need thereof, comprising the steps of administering to a subject a dose of a pharmaceutical composition comprising a DNA plasmid encoding a codon-optimized pSARS2 spike glycoprotein (pSARS2-S) from a SARS-CoV-2 coronavirus, wherein the pSARS2-S is codon-optimized for mammalian expression, wherein the pSARS2-S N-terminal signal peptide is replaced with a signal peptide from a human IgG2 heavy chain, wherein the pSARS2-S and signal peptide from the human IgG2 heavy chain nucleotide sequences have the identity of SEQ ID NO:1; allowing a suitable period of time to elapse; and administering at least one additional dose of the pharmaceutical composition.
15. The method of claim 14, wherein the pharmaceutical composition is administered intramuscularly or intradermally.
16. The method of claim 14, wherein 10 to 150 .mu.g of the DNA plasmid is administered to the subject in each dose.
17. The method of claim 14, wherein at least 25 .mu.g of the DNA plasmid is administered to the subject in each dose.
18. The method of claim 14, wherein 50 to 100 .mu.g of the DNA plasmid is administered to the subject in each dose.
Description:
SEQUENCE LISTING
[0001] This document incorporates by reference an electronic sequence listing text file, which was electronically submitted along with this document. The text file is named 2021-04-15_15440060AA_seqlisting.txt, is 17 kilobytes, and was created on Apr. 15, 2021.
BACKGROUND OF THE INVENTION
Field of the Invention
[0002] The invention generally relates vaccines against the SARS-CoV-2 beta-coronavirus. The invention further relates to a method of inducing an immune response to a codon-optimized SARS-CoV-2 spike protein to protect a subject from acquiring COVID-19.
Background
[0003] In December 2019, pneumonia of unknown origin reported in Wuhan, China before it spread globally causing a significant pandemic known as Coronavirus Disease 2019 (COVID-19) pandemic. The causative agent of COVID-19 was identified to be a novel beta-coronavirus (beta-CoV) now known as severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2). Similar to other human coronaviruses, such as the Middle East respiratory syndrome coronavirus MERS-CoV and SARS-CoV, SARS-CoV-2 may have a zoonotic origin. SARS-CoV-2 can infect individuals from different age groups and causes a wide spectrum of disease manifestations. The majority of COVID-19 patients are either asymptomatic or have mild symptoms such as fever, myalgia, and cough. However, some patients may suffer from moderate to severe life-threatening acute respiratory distress syndrome (ARDS) with possible fatal outcomes. The high human-to-human transmission of SARS-CoV-2 poses a significant obstacle toward controlling its spread.
[0004] The Coronaviridae family is comprised of enveloped viruses with a positive-sense single-stranded .about.30 kb RNA genome. The genome encodes four structural proteins including the surface Spike (S) glycoprotein, the envelope (E) protein, the membrane (M), and the nucleocapsid (N). It also encodes 16 nonstructural proteins (nsp1-16) as well as putative and known accessory proteins involved viral replication and pathogenesis. The viral spike (S) protein is capable of inducing a robust immune response. It is comprised of S1 and S2 subunits, with the former known to mediate binding to angiotensin-converting enzyme 2 (ACE2) receptor on host cells and the latter being involved in viral-host membranes fusion. As ACE2 is the main receptor, neutralizing antibodies (nAbs) mainly target the receptor binding domain (RBD) in the S1 subunit. Numerous studies have analyzed antibody responses and found a strong association between the magnitude of anti-S antibody response and patient survival in both MERS-CoV and SARS-CoV, suggesting that viral S protein could represent the main target for vaccine development. This is further supported by the isolation and development of several human nAbs against the SARS-CoV-2 S protein and their ability to neutralize and block viral entry and/or cell-cell spread at very low concentrations, and sometimes to confer prophylactic and therapeutic protection in animal models.
[0005] The ideal strategy to rapidly control existing and potential outbreaks of SARS-CoV-2 is to generate a safe and effective vaccine. A drawback of some vaccine platforms, such as protein-based subunit vaccines, is induction of the undesired Th2-skewed response in the case of coronaviruses. For example, see Tseng et al. PLoS One. 2012;7(4); and also Agrawal et al. Hum Vaccin Immunother. 2016 September;12(9):2351-6. Several vaccines candidates based on full-length or truncated S protein are being developed and investigated including DNA vaccines, RNA vaccines, replicating or non-replicating viral vectored vaccines, nanoparticle-based vaccine, whole inactivated MERS-CoV vaccine (WIV), and the S or RBD protein-based subunit vaccines. Many of these vaccines are late clinical trials and/or approved for limited use in different countries.
[0006] DNA vaccines against coronaviruses are known in the art. For example, Dong et al. (Signal Trans Targ Ther. (2020)5:237) is a review of SARS-CoV-2 vaccine candidates. The concept and development of nucleic acid vaccines, including DNA vaccines, are described. However, Dong suggests that DNA vaccines may be less effective in inducing nAbs than other vaccine types and that the need for transfer into the nucleus is a disadvantage. Dong teaches a vaccine comprising a codon-optimized SARS-CoV-2 S protein, however this is carried in an adenoviral vector. Epitope design is discussed, but no nucleotide sequences are disclosed. Smith et al (Nature Com. 2020;11:2601) teaches a DNA-based vaccine against consensus sequence encoding a SARS-CoV-2 S protein that neutralized infection in mice and guinea pigs. Muthumani et al. (Sci Transl Med. 2015; 7(301):301) teaches codon-optimized anti-spike protein DNA vaccines against MERS coronavirus, including one having an Ig heavy chain .epsilon.-1 signal peptide fused to the N terminus of each sequence replacing the N-terminal methionine. The vaccine insert was genetically optimized for improved expression, including codon and RNA optimization. Zakhartchouk et al. (DNA Cell Biol. 2007; 26(10):721-6) teaches DNA plasmid vaccines against SARS-CoV-1 spike protein. The four DNA vaccine constructs are four distinct fragments of a codon-optimized SARS-CoV S fused with a leader sequence derived from the human CDS gene. Wang et al. (J Virol. 2005; 79(3):1906-1910) teaches codon-optimized S DNA vaccines and two neutralizing domains on the S protein of SARS-CoV-1. U.S. Pat. No. 8,541,003 to Anderson teaches the use of DNA plasmids that express SARS S protein immunogens, antigens or epitopes as vaccine compositions, wherein a baculovirus signal peptide is used vaccines against SARS-CoV-1.
[0007] Despite these advancements, the ongoing global pandemic of COVID-19 requires urgent development of additional prophylactic measures that are safe and effective. There is still a need for additional vaccines that can be rapidly produced and conveniently stored, transported and deployed for mass vaccinations in any climate condition throughout the world.
SUMMARY OF THE INVENTION
[0008] The invention is a pharmaceutical composition comprising a vaccine and methods of use to evoke an immune response to the SARS-CoV-2 spike protein and protect an immunized subject from acquiring COVID-19. One embodiment of the invention is a DNA vaccine able to induce an immune response against a SARS-CoV-2 coronavirus, comprising a DNA plasmid encoding a codon-optimized pSARS2 spike glycoprotein (pSARS2-S) as an immunogen from a SARS-CoV-2 coronavirus, wherein the pSARS2-S is codon-optimized for mammalian expression, and wherein the pSARS2-S N-terminal signal peptide is replaced with a signal peptide from a human IgG2 heavy chain.
[0009] Another embodiment of the invention is a DNA vaccine able to induce an immune response to a SARS-CoV-2 coronavirus, wherein the immunogen is encoded by nucleotide sequences having the identity of SEQ ID NO:1. The nucleotide sequences of SEQ ID NO:1 encode a protein having the amino acid sequence identity of SEQ ID NO:4.
[0010] The DNA sequences encoding the codon-optimized pSARS2-S and encoding the signal peptide from the human IgG2 heavy chain have the nucleotide sequence identity of SEQ ID NO:1. The DNA sequences of the signal peptide from the human IgG2 heavy chain encode an amino acid sequence having the identity of SEQ ID NO:2 and the DNA sequences encoding the signal peptide from the human IgG2 heavy chain have the nucleotide sequence identity of SEQ ID NO:3. Furthermore, the DNA sequences encode a protein having the amino acid identity of SEQ ID NO:4.
[0011] Another embodiment of the invention is a method of inducing an immune response to a pSARS2 spike glycoprotein (pSARS2-S) from a SARS-CoV-2 coronavirus in a subject in need thereof, comprising the steps of 1) administering to a subject a dose of a pharmaceutical composition comprising a DNA plasmid encoding a codon-optimized pSARS2 spike glycoprotein (pSARS2-S) from a SARS-CoV-2 coronavirus, wherein the pSARS2-S is codon-optimized for mammalian expression, wherein the pSARS2-S N-terminal signal peptide is replaced with a signal peptide from a human IgG2 heavy chain; 2) allowing a suitable period of time to elapse; and 3) administering at least one additional dose of the pharmaceutical composition.
[0012] The pharmaceutical composition comprising the vaccine can be administered intramuscularly or intradermally with a hypodermic, transdermic or intradermal needle or with a needle-free device. In one embodiment, 10 to 150 .mu.g of the DNA plasmid is administered to the subject in each dose. In another embodiment, 25 .mu.g of the DNA plasmid is administered to the subject in each dose. In yet another embodiment, 50 to 100 .mu.g of the DNA plasmid is administered to the subject in each dose.
[0013] In another embodiment, the DNA sequences comprising the immunogen of the vaccine have the sequence identity of SEQ ID NO:1, and the invention is a method of inducing an immune response to a pSARS2 spike glycoprotein (pSARS2-S) from a SARS-CoV-2 coronavirus in a subject in need thereof, comprising the steps of 1) administering to a subject a dose of a pharmaceutical composition comprising a DNA plasmid encoding a codon-optimized pSARS2 spike glycoprotein (pSARS2-S) from a SARS-CoV-2 coronavirus, wherein the pSARS2-S is codon-optimized for mammalian expression, wherein the pSARS2-S N-terminal signal peptide is replaced with a signal peptide from a human IgG2 heavy chain; 2) allowing a suitable period of time to elapse; and 3) administering at least one additional dose of the pharmaceutical composition.
[0014] Other features and advantages of the present invention will be set forth in the description of invention that follows, and in part will be apparent from the description or may be learned by practice of the invention. The invention will be realized and attained by the compositions and methods particularly pointed out in the written description and claims hereof.
BRIEF DESCRIPTION OF THE DRAWINGS
[0015] The accompanying drawings, which are incorporated in and constitute a part of this specification, illustrate embodiments of the invention and, together with a general description of the invention given above and the detailed description given below serve to explain the invention.
[0016] FIGS. 1A-1C shows the design and expression of SARS-CoV-2 Spike protein from DNA vaccine. FIG. 1A is a schematic diagram of SARS-CoV-2 DNA vaccine construct (pSARS2-S); the SARS-CoV-2 spike gene is indicated by red color. FIG. 1B is an exemplary western blot showing expression of S protein at the expected size from HEK-293A cells transfected with pSARS2-S construct only but not cells only control or cells transfected with empty control plasmid. FIG. 1C immunofluorescent staining of cells transfected with pSARS2-S or empty control plasmid. Transfected cells were stained with anti-SARS-CoV-2 S mouse polyclonal antibodies (green), and nuclei were counterstained with DAPI (blue).
[0017] FIGS. 2A-2C show the antibody response against SARS-CoV-2 S1 in BALB/c mice. Mice were intramuscularly immunized with 3 doses of 100 .mu.g each at 2 weeks interval using either pSARS2-S or control plasmid. FIG. 2A shows binding of total IgG at 1:100 dilution from each mouse, determined by ELISA at 2, 4 and 8 weeks post first immunization at day 0. FIG. 2B shows end-point titers of total IgG, IgG1, IgG2a and IgG2b, which were determined by ELISA in samples collected on week 8 from immunized mice. FIG. 3 shows IgG2a:IgG1 and IgG2b:IgG ratios, which were calculated from samples collected from immunized mice on week 8. Data are shown as mean .+-.SD for each group from one experiment (n=10). P values were determined by Mann-Whitney test in FIG. 2A and one-way analysis of variance with Bonferroni post-hoc test in FIG. 2B.
[0018] FIGS. 3A-3C show the antibody response against SARS-CoV-2 S1 in C57BL/6J mice. Mice were intramuscularly immunized with 3 doses of 100 .mu.g each at 2 weeks interval using either pSARS2-S or control plasmid. FIG. 3A shows binding of total IgG at 1:100 dilution from each, which was determined by ELISA at 2, 4 and 8 weeks post first immunization at day 0. FIG. 3B shows the end-point titers of total IgG, IgG1, IgG2a and IgG2b, which were determined by ELISA in samples collected on week 8 from immunized mice. FIG. 3C shows IgG2a:IgG1 and IgG2b:IgG ratios, which were calculated from samples collected from immunized mice on week 8. Data are shown as mean .+-.SD for each group from one experiment (n=10). P values were determined by Mann-Whitney test in FIG. 3A and one-way analysis of variance with Bonferroni post-hoc test in FIG. 3B.
[0019] FIGS. 4A-4D show the neutralizing antibody (nAb) response after intramuscular immunization in BALB/c and C57BL/6J mice. BALB/c mice (shown in FIGS. 4A and 4B) or C57BL/6J mice (shown in FIG. 4C and 4D) were immunized with 3 doses of 100 .mu.g each at 2 weeks interval using either pSARS2-S (n=10) or control plasmid (n=3). Serum samples were collected at week 8 post first immunization and serially diluted and tested in duplicate for their neutralizing activity against rVSV-.DELTA.G/SARS-2-S*-luciferase pseudovirus as described in Materials and Methods. FIGS. 4A and 4C show the neutralizing activity from serum samples collected from each mouse, and FIGS. 4B and 4D show the IC50 nAb titers. Data are shown as mean .+-.SD in FIGS. 4A and 4C, and bars represent the mean in FIGS. 4B and 4D from one experiment. P values were determined by Mann-Whitney test in 4B and 4D.
[0020] FIGS. 5A-5C show the long-term IgG response in mice immunized with different routes. BALB/c mice were immunized with 3 doses of 100 .mu.g each at 2 weeks interval using either pSARS2-S or control plasmid via (5A) intramuscular, (5B) intradermal, or (5C) subcutaneous routes. S1-binding total IgG from each mouse was determined by ELISA at 1:100 dilution at 2, 4 and 8 weeks post first immunization at day 0. Data are shown as mean .+-.SD for each group from one experiment (n=5).
[0021] FIGS. 6A-6D show the antibody response against SARS-CoV-2 S1 in BALB/c mice immunized with needle-free Tropis system. Mice were immunized either (6A and 6B) intramuscularly or (6C and 6C) intradermally with 2 doses of 25, 50 or 100 .mu.g at 2 weeks interval using pSARS2-S plasmid. FIGS. 6A and 6C show binding of total IgG at 1:100 dilution from each mouse as determined by ELISA at 1, 2, 3 and 4 weeks post first immunization at day 0. FIGS. 6B and 6D show the end-point titer of total IgG as determined by ELISA in samples collected on week 4 from immunized mice. Data are shown as mean .+-.SD in FIGS. 6A and 6C and mean is shown in FIGS. 6B and 6D from an exemplary experiment (n=4-5).
[0022] FIGS. 7A-7C show the antibody response against SARS-CoV-2 S1 in BALB/c mice immunized using either needle injection or needle-free Tropis system. BALB/c mice were immunized with 2 doses of (7A) 25, (7B) 50 or (7C) 100 .mu.g of pSARS2-S plasmid at 2 weeks interval using either needle injection or needle-free Tropis system. Binding of total IgG at 1:100 dilution from each mouse was determined by ELISA at 1, 2, 3 and 4 weeks post first immunization at day 0. Data are shown as mean .+-.SD from 4-5 mice from experiment in FIG. 6. P values were determined by Mann-Whitney test.
[0023] FIGS. 8A and 8B show the neutralizing antibody response after intramuscular immunization in BALB/c using either needle injection or needle-free Tropis system. BALB/c mice were immunized with 2 doses of 25, 50 or 100 .mu.g of pSARS2-S plasmid at 2 weeks interval using either needle injection or needle-free Tropis system. FIG. 8A shows serum samples collected at week 4 post first immunization that were serially diluted and tested in duplicate for their neutralizing activity against rVSV-.DELTA.G/SARS-2-S*-luciferase pseudovirus, as described in Materials and Methods. FIG. 8B shows IC.sub.50 nAb titers from immunized mice with doses of 25, 50 or 100 .mu.g of pSARS2-S plasmid using either needle injection or needle-free Tropis system. Data are shown as mean .+-.SD from 2 mice from experiment in FIGS. 6 and 7.
DETAILED DESCRIPTION
[0024] The following descriptions and examples illustrate some exemplary embodiments of the disclosed invention in detail. Those of the skill in the art will recognize that there are numerous variations and modifications of this invention that are encompassed by its scope. Accordingly, the description of a certain exemplary embodiment should not be deemed to limit the scope of the present invention.
[0025] There is an urgent need to develop a safe and protective vaccine against SARS-CoV-2 to control the COVID-19 pandemic. Synthetic DNA vaccines represent a promising vaccine platform to use in response to outbreaks, such as COVID-19. They can be quickly designed and synthesized based on viral sequences. Their manufacturing is easy and scalable, unlike other platforms such as viral vector or virus-based vaccines. In addition, they are very stable at different storage conditions. Use of consensus S glycoprotein is to induce broad immune response by using conserved sequences covers any possible variation in viral sequences. Therefore, here we analyzed all available SARS-CoV-2 S sequences from GISAID database until Mar. 10, 2020. Such sequence offers protection against broad range of SARS-CoV-2 stains, including emerging strains.
[0026] The invention is a pharmaceutical composition comprising a vaccine and methods of use to evoke an immune response to the SARS-CoV-2 spike protein and protect an immunized subject from acquiring COVID-19. In one embodiment, the invention is a DNA vaccine comprises a DNA plasmid encoding a codon-optimized pSARS2 spike glycoprotein (pSARS2-S) as an immunogen from a SARS-CoV-2 coronavirus, wherein the pSARS2-S is codon-optimized for mammalian expression, and wherein the pSARS2-S N-terminal signal peptide is replaced with a signal peptide from a human IgG2 heavy chain.
[0027] Another embodiment of the invention is a DNA vaccine comprises an immunogen carried within a plasmid vector. The immunogen is encoded by nucleotide sequences having the identity of SEQ ID NO:1. The nucleotide sequences of SEQ ID NO:1 encode a protein having the amino acid sequence identity of SEQ ID NO:4. A portion of the nucleotide sequences of SEQ ID NO:1 are the nucleotides sequences of SEQ ID NO:3, which encodes the signal peptide from the human IgG2 heavy chain. The nucleotide sequences of SEQ ID NO:3 encode the amino acid sequence of SEQ ID NO:4. In other words, the native signal peptide of the pSARS2-S can be altered or removed and replaced with the amino acid sequences of SEQ ID NO:4.
[0028] Another embodiment of the invention is a method of inducing an immune response to a pSARS2 spike glycoprotein (pSARS2-S) from a SARS-CoV-2 coronavirus in a subject in need thereof, comprising the steps of 1) administering to a subject a dose of a pharmaceutical composition comprising a DNA plasmid encoding a codon-optimized pSARS2 spike glycoprotein (pSARS2-S) from a SARS-CoV-2 coronavirus, wherein the pSARS2-S is codon-optimized for mammalian expression, wherein the pSARS2-S N-terminal signal peptide is replaced with a signal peptide from a human IgG2 heavy chain; 2) allowing a suitable period of time to elapse; and 3) administering at least one additional dose of the pharmaceutical composition.
[0029] The pharmaceutical composition comprising the vaccine can be administered intramuscularly or intradermally with a hypodermic, transdermic or intradermal needle or with a needle-free device. In one embodiment, 10 to 150 .mu.g of the DNA plasmid is administered to the subject in each dose. In another embodiment, 25 .mu.g of the DNA plasmid is administered to the subject in each dose. In yet another embodiment, 50 to 100 .mu.g of the DNA plasmid is administered to the subject in each dose. The plasmid may be in a circular conformation, or the DNA may be nicked or cleaved by one or more restriction enzymes prior to purification and preparation for administration. The prepared DNA may be suspended in a pharmaceutically acceptable carrier or pH-buffered solution, such as saline or any other physiologically-compatible solution.
[0030] In another embodiment, the DNA sequences comprising the immunogen of the vaccine have the sequence identity of SEQ ID NO:1, and the invention is a method of inducing an immune response to a pSARS2 spike glycoprotein (pSARS2-S) from a SARS-CoV-2 coronavirus in a subject in need thereof, comprising the steps of 1) administering to a subject a dose of a pharmaceutical composition comprising a DNA plasmid encoding a codon-optimized pSARS2 spike glycoprotein (pSARS2-S) from a SARS-CoV-2 coronavirus, wherein the pSARS2-S is codon-optimized for mammalian expression, wherein the pSARS2-S N-terminal signal peptide is replaced with a signal peptide from a human IgG2 heavy chain; 2) allowing a suitable period of time to elapse; and 3) administering at least one additional dose of the pharmaceutical composition.
[0031] The DNA sequences encoding the codon-optimized pSARS2-S and encoding the signal peptide from the human IgG2 heavy chain have the nucleotide sequence identity of SEQ ID NO:1. The DNA sequences of the signal peptide from the human IgG2 heavy chain encode an amino acid sequence having the identity of SEQ ID NO:2 and the DNA sequences encoding the signal peptide from the human IgG2 heavy chain have the nucleotide sequence identity of SEQ ID NO:3. Furthermore, the DNA sequences encode a protein having the amino acid identity of SEQ ID NO:4.
[0032] Synthetic DNA vaccines represent a fast and easy platform to manufacture vaccines compared to other technologies in vaccine development because of their easy design, production in a timely manner, manufacturing scalability and easy and well-established quality control in addition to their temperature stability. In addition, DNA vaccines can elicit Th1-biased immune response, which is a key benefit in mounting an appropriate immune response. The Th1-biased immune response was observed in both BALB/c and C57BL/6J mice. Furthermore, the vaccine of the invention addresses concerns associated with vaccine-induced immunopathology that have been raised for SARS and MERS vaccine candidates. Such immunopathology has been characterized by Th2-skewed immune response and eosinophilia and was reported for different vaccines developed for MERS-CoV and SARS-CoV after viral challenge.
[0033] Based on our previous work in developing a vaccine against MERS-CoV as well as other vaccines developed for other coronaviruses, we selected the SARS-CoV-2 S protein as a target because it is a major protein on the surface of the virus and a main target for nAbs (see Hashem et al. J Infect Diseases. 2019; 202:1558-67; and Al-Amri et al. Nature Sci Reports. 7:44875; DOI:10.1038/srep44875). We developed a DNA-based vaccine as they represent a fast and safe approach to develop vaccines. In vivo testing in mice showed intramuscular immunization with three doses of pSARS2-S via needle injection induced significant and long-lasting levels of Th1-skewed immune response S1-specific IgG in BALB/c and C57BL/6J mice as well as significant levels of nAbs compared to control group with mean IC.sub.50 titers of 1.times.10.sup.3 in both models. Importantly, needle-free immunization with only two doses of as low as 25 .mu.g of the pSARS2-S via either intramuscular or intradermal routes was able to elicit high levels of S1-specific IgG in a dose-dependent fashion in BALB/c mice. Two doses of 50 .mu.g and 100 .mu.g administered by the needle-free system elicited IgG and nAbs levels that are equivalent or higher than that induced by three doses of 100 .mu.g by needle injection in BALB/c mice. Interestingly, using needle-free system enhanced the immunogenicity of the pSARS2-S vaccine and induced significant levels of S1-specific IgG even at 50 .mu.g and 100 .mu.g when given intradermally albeit the inability of the vaccine to induce any levels of antibodies when administered intradermally via needle injection.
[0034] As used historically, the term "antigen" is used to designate an entity that is bound by an antibody, and also to designate the entity that induces the production of the antibody. More current usage limits the meaning of antigen to that entity bound by an antibody, while the term "immunogen" is used for the entity that induces antibody production. Where an entity discussed herein is both immunogenic and antigenic, reference to it as either an immunogen or antigen may be made according to its intended utility. The terms "antigen", "antigenic region" "immunogen" and "epitope" may be used interchangeably herein. As used herein, an antigen, immunogen or epitope is generally a portion of a protein (e.g. a peptide or polypeptide), which has an amino acid sequence that is encoded by a nucleotide sequence.
[0035] As used herein, the term "glycoprotein" is used to refer to the protein commonly known as the SARS-CoV-2 spike protein. The spike protein is a glycoprotein and is referred to interchangeably as a protein and a glycoprotein. Furthermore, the sequences encoding the SARS-CoV-2 glycoprotein may also be referred to as a peptide or amino acid sequence.
[0036] The invention provides nucleic acid sequences that encode chimeric proteins of the invention. Such nucleic acids include DNA, RNA, and hybrids thereof, and the like. Further, the invention comprehends vectors which contain or house such coding sequences. Examples of suitable vectors include but are not limited to plasmids, cosmids, expression vectors, etc. In a preferred embodiment, the vector will be a plasmid expression vector.
[0037] The present invention provides compositions for use in eliciting an immune response. The compositions may be utilized as vaccines to prevent or lessen the severity of COVID-19. By eliciting an immune response, we mean that administration of the immunogen causes the synthesis of specific antibodies and/or cellular proliferation, such as proliferation of immune cells. By "vaccine" we mean a DNA molecule that elicits an immune response which results in protection of an organicism against challenge with SARS-CoV-2. The protective response either wholly or partially prevents or arrests the development of symptoms related to SARS-CoV-2 infection (i.e. the symptoms of COVID-19), in comparison to a non-vaccinated (e.g. adjunct alone) control organisms, in which disease progression is not prevented. The compositions include one or more isolated and substantially purified DNA plasmids or other DNA molecules as described herein, and a pharmacologically suitable carrier. The DNA molecules in the composition may be the same or different, i.e. the composition may be a "cocktail" of different plasmids or molecules, or a composition containing only a single type of plasmid or molecule. The preparation of such compositions for use as vaccines is well known to those of skill in the art. Typically, such compositions are prepared either as liquid solutions or suspensions, however solid forms such as tablets, pills, powders and the like are also contemplated. Solid forms suitable for solution in, or suspension in, liquids prior to administration may also be prepared. The preparation may also be emulsified. The active ingredients may be mixed with excipients which are pharmaceutically acceptable and compatible with the active ingredients. Suitable excipients are, for example, water, saline, dextrose, glycerol, ethanol and the like, or combinations thereof. In addition, the composition may contain minor amounts of auxiliary substances such as wetting or emulsifying agents, pH buffering agents, and the like. The vaccine preparations of the present invention may further comprise an adjuvant, suitable examples of which include but are not limited to Seppic, Quil A, Alhydrogel, etc. If it is desired to administer an oral form of the composition, various thickeners, flavorings, diluents, emulsifiers, dispersing aids or binders and the like may be added. The composition of the present invention may contain any such additional ingredients so as to provide the composition in a form suitable for administration. The final amount of DNA in the formulations may vary. However, in general, the amount in the formulations will be from about 0.01-99%, weight/volume.
[0038] The methods involve administering a composition comprising the vaccine in a pharmacologically acceptable carrier to a mammal. The mammal may be a human, but this need not always be the case, as veterinary applications of this technology are also contemplated. The vaccine preparations of the present invention may be administered by any of the many suitable means which are well known to those of skill in the art, including but not limited to by injection, inhalation, orally, intranasally, by ingestion of a food product containing the vaccine, etc. In preferred embodiments, the mode of administration is intradermal, subcutaneous or intramuscular. In addition, the compositions may be administered in conjunction with other treatment modalities such as substances that boost the immune system, various anti-bacterial chemotherapeutic agents, antibiotics, and the like.
[0039] The present invention provides methods to elicit an immune response to SARS-CoV-2 and to vaccinate against SARS-CoV-2 infection in mammals In one embodiment, the mammal is a human However, those of skill in the art will recognize that other mammals exist for which such vaccinations would also be desirable, e.g. the preparations may also be used for veterinary purposes. Examples include but are not limited to companion "pets" such as dogs, cats, etc.; food source, work and recreational animals such as cattle, horses, oxen, sheep, pigs, goats, and the like; or even wild animals that serve as a reservoir of SARS-CoV-2, including but not limited to birds, bats, mice, deer, camelids and others.
[0040] Before exemplary embodiments of the present invention are described in greater detail, it is to be understood that this invention is not limited to any particular embodiments described herein and may vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present invention will be limited only by the appended claims.
[0041] Where a range of values is provided, it is understood that each intervening value between the upper and lower limit of that range (to a tenth of the unit of the lower limit) is included in the range and encompassed within the invention, unless the context or description clearly dictates otherwise. In addition, smaller ranges between any two values in the range are encompassed, unless the context or description clearly indicates otherwise.
[0042] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Representative illustrative methods and materials are herein described; methods and materials similar or equivalent to those described herein can also be used in the practice or testing of the present invention.
[0043] All publications and patents cited in this specification are herein incorporated by reference as if each individual publication or patent were specifically and individually indicated to be incorporated by reference, and are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited. The citation of any publication is for its disclosure prior to the filing date and should not be construed as an admission that the present invention is not entitled to antedate such publication by virtue of prior invention. Further, the dates of publication provided may be different from the actual dates of public availability and may need to be independently confirmed.
[0044] It is noted that, as used herein and in the appended claims, the singular forms "a", "an", and "the" include plural referents unless the context clearly dictates otherwise. It is further noted that the claims may be drafted to exclude any optional element. As such, this statement is intended to serve as support for the recitation in the claims of such exclusive terminology as "solely," "only" and the like in connection with the recitation of claim elements, or use of a "negative" limitations, such as "wherein [a particular feature or element] is absent", or "except for [a particular feature or element]", or "wherein [a particular feature or element] is not present (included, etc.) . . . ".
[0045] As will be apparent to those of skill in the art upon reading this disclosure, each of the individual embodiments described and illustrated herein has discrete components and features which may be readily separated from or combined with the features of any of the other several embodiments without departing from the scope or spirit of the present invention. Any recited method can be carried out in the order of events recited or in any other order which is logically possible.
EXAMPLES
[0046] The following Examples provide exemplary compositions comprising nucleotide sequences and methods for inducing an immune response to SARS-CoV-2. The Materials and Methods disclose reagents and assays that are useful in the Examples and embodiments illustrated in FIGS. 1-8. Additional details about the figures can be found in the section entitled "Brief Description of the Drawings".
Materials and Methods
In Silico Design Of Codon-Optimized Synthetic Consensus Secreted S Protein
[0047] All available SARS-CoV-2 full-length S protein sequences (399 sequences) as of Mar. 10, 2020, were downloaded from GISAID database and dataset was filtered by removing sequences containing ambiguous amino acid codes (BJOUXZ). The final dataset was multiply aligned using CLUSTALW and the Shannon entropy for each amino acid position were determined and the consensus protein sequence was then obtained for the full-length S glycoprotein. The coding sequence for the consensus protein sequence was then codon-optimized for mammalian expression (SEQ ID NO:1) in which the signal peptide (13 amino acid residues) coding sequence from SARS-CoV-2 was replaced with 19 amino acid residues (SEQ ID NO:2) signal peptide coding sequence from the human IgG2 heavy chain (SEQ ID NO:3) at the N-terminus resulting in a codon-optimized synthetic sequence to express secreted consensus full-length S protein (SEQ ID NO:4). Sequences are shown in Table 1.
TABLE-US-00001 TABLE 1 Nucleotide sequences used to synthesize a codon- optimized SARS-CoV-2 S construct, and amino acid sequences encoded by the nucleotide sequences. SEQ ID NO: 1 Codon-optimized consensus synthetic coding sequence for full-length SARS-CoV-2 S protein with human IgG2 heavy chain signal peptide ATGGGATGGAGCTGTATCATCCTCTTCTTGGTAGCAACAGCTACAGGTGTCCACTCCCA GTGCGTGAATCTGACTACTCGGACTCAGCTGCCTCCCGCCTATACCAATTCCTTCACCC GGGGCGTGTACTATCCTGACAAGGTGTTTAGAAGCTCCGTGCTGCACTCTACACAGGAT CTGTTTCTGCCATTCTTTAGCAACGTGACCTGGTTCCACGCCATCCACGTGAGCGGCAC CAATGGCACAAAGCGGTTCGACAATCCCGTGCTGCCTTTTAACGATGGCGTGTACTTCG CCTCTACCGAGAAGAGCAACATCATCAGAGGCTGGATCTTTGGCACCACACTGGACTCC AAGACACAGTCTCTGCTGATCGTGAACAATGCCACCAACGTGGTCATCAAGGTGTGCGA GTTCCAGTTTTGTAATGATCCCTTCCTGGGCGTGTACTATCACAAGAACAATAAGAGCT GGATGGAGTCCGAGTTTAGAGTGTATTCTAGCGCCAACAATTGCACATTTGAGTACGTG TCCCAGCCTTTCCTGATGGACCTGGAGGGCAAGCAGGGCAATTTCAAGAACCTGAGGGA GTTCGTGTTTAAGAATATCGACGGCTACTTCAAAATCTACAGCAAGCACACCCCCATCA ACCTGGTGCGCGACCTGCCTCAGGGCTTCAGCGCCCTGGAGCCCCTGGTGGATCTGCCT ATCGGCATCAACATCACCCGGTTTCAGACACTGCTGGCCCTGCACAGAAGCTACCTGAC ACCCGGCGACTCCTCTAGCGGATGGACCGCAGGAGCTGCCGCCTACTATGTGGGCTATC TGCAGCCCCGGACCTTCCTGCTGAAGTACAACGAGAATGGCACCATCACAGACGCAGTG GATTGCGCCCTGGACCCCCTGAGCGAGACAAAGTGTACACTGAAGTCCTTTACCGTGGA GAAGGGCATCTATCAGACATCCAATTTCAGGGTGCAGCCAACCGAGTCTATCGTGCGCT TTCCTAATATCACAAACCTGTGCCCATTTGGCGAGGTGTTCAACGCAACCAGGTTCGCC AGCGTGTACGCATGGAATAGGAAGCGCATCTCTAACTGCGTGGCCGACTATAGCGTGCT GTACAACTCCGCCTCTTTCAGCACCTTTAAGTGCTATGGCGTGTCCCCCACAAAGCTGA ATGACCTGTGCTTTACCAACGTGTACGCCGATTCTTTCGTGATCAGGGGCGACGAGGTG CGCCAGATCGCACCTGGACAGACAGGCAAGATCGCCGACTACAATTATAAGCTGCCAGA CGATTTCACCGGCTGCGTGATCGCCTGGAACAGCAACAATCTGGATTCCAAGGTCGGCG GCAACTACAATTATCTGTACCGGCTGTTTAGAAAGAGCAATCTGAAGCCCTTCGAGAGG GACATCTCTACAGAAATCTACCAGGCCGGCAGCACCCCTTGCAATGGCGTGGAGGGCTT TAACTGTTATTTCCCACTGCAGTCCTACGGCTTCCAGCCCACAAACGGCGTGGGCTATC AGCCTTACCGCGTGGTGGTGCTGAGCTTTGAGCTGCTGCACGCACCAGCAACAGTGTGC GGCCCCAAGAAGTCCACCAATCTGGTGAAGAACAAGTGCGTGAACTTCAACTTCAACGG CCTGACCGGCACAGGCGTGCTGACCGAGTCCAACAAGAAGTTCCTGCCATTTCAGCAGT TCGGCAGGGACATCGCAGATACCACAGACGCCGTGCGCGACCCACAGACCCTGGAGATC CTGGACATCACACCCTGCTCTTTCGGCGGCGTGAGCGTGATCACACCAGGCACCAATAC AAGCAACCAGGTGGCCGTGCTGTATCAGGACGTGAATTGTACCGAGGTGCCTGTGGCCA TCCACGCCGATCAGCTGACCCCAACATGGCGGGTGTACAGCACCGGCTCCAACGTGTTC CAGACAAGAGCCGGATGCCTGATCGGAGCAGAGCACGTGAACAATTCCTATGAGTGCGA CATCCCAATCGGCGCCGGCATCTGTGCCTCTTACCAGACCCAGACAAACTCTCCCAGAA GAGCCCGGAGCGTGGCCTCCCAGTCTATCATCGCCTATACCATGTCCCTGGGCGCCGAG AACAGCGTGGCCTACTCTAACAATAGCATCGCCATCCCAACCAACTTCACAATCTCTGT GACCACAGAGATCCTGCCCGTGTCCATGACCAAGACATCTGTGGACTGCACAATGTATA TCTGTGGCGATTCTACCGAGTGCAGCAACCTGCTGCTGCAGTACGGCAGCTTTTGTACC CAGCTGAATAGAGCCCTGACAGGCATCGCCGTGGAGCAGGATAAGAACACACAGGAGGT GTTCGCCCAGGTGAAGCAAATCTACAAGACCCCCCCTATCAAGGACTTTGGCGGCTTCA ATTTTTCCCAGATCCTGCCTGATCCATCCAAGCCTTCTAAGCGGAGCTTTATCGAGGAC CTGCTGTTCAACAAGGTGACCCTGGCCGATGCCGGCTTCATCAAGCAGTATGGCGATTG CCTGGGCGACATCGCAGCCCGGGACCTGATCTGCGCCCAGAAGTTTAATGGCCTGACCG TGCTGCCACCCCTGCTGACAGATGAGATGATCGCACAGTACACAAGCGCCCTGCTGGCC GGCACCATCACATCCGGATGGACCTTCGGCGCAGGAGCCGCCCTGCAGATCCCCTTTGC CATGCAGATGGCCTATAGGTTCAACGGCATCGGCGTGACCCAGAATGTGCTGTACGAGA ACCAGAAGCTGATCGCCAATCAGTTTAACTCCGCCATCGGCAAGATCCAGGACAGCCTG TCCTCTACAGCCTCCGCCCTGGGCAAGCTGCAGGATGTGGTGAATCAGAACGCCCAGGC CCTGAATACCCTGGTGAAGCAGCTGAGCAGCAACTTCGGCGCCATCTCTAGCGTGCTGA ATGACATCCTGAGCCGGCTGGACAAGGTGGAGGCAGAGGTGCAGATCGACCGGCTGATC ACAGGCAGACTGCAGTCTCTGCAGACCTATGTGACACAGCAGCTGATCAGGGCAGCAGA GATCAGGGCCAGCGCCAATCTGGCAGCAACCAAGATGTCCGAGTGCGTGCTGGGCCAGT CTAAGAGAGTGGACTTTTGTGGCAAGGGCTATCACCTGATGTCCTTCCCTCAGTCTGCC CCACACGGCGTGGTGTTTCTGCACGTGACCTACGTGCCCGCCCAGGAGAAGAACTTCAC CACAGCCCCTGCCATCTGCCACGATGGCAAGGCCCACTTTCCAAGGGAGGGCGTGTTCG TGTCCAACGGCACCCACTGGTTTGTGACACAGCGCAATTTCTACGAGCCCCAGATCATC ACCACAGACAATACCTTCGTGAGCGGCAACTGTGACGTGGTCATCGGCATCGTGAACAA TACCGTGTATGATCCACTGCAGCCCGAGCTGGACAGCTTTAAGGAGGAGCTGGATAAGT ACTTCAAGAATCACACCTCCCCTGACGTGGATCTGGGCGACATCAGCGGCATCAATGCC TCCGTGGTGAACATCCAGAAGGAGATCGACCGCCTGAACGAGGTGGCCAAGAATCTGAA CGAGAGCCTGATCGACCTGCAGGAGCTGGGCAAGTATGAGCAGTACATCAAGTGGCCCT GGTACATCTGGCTGGGCTTCATCGCCGGCCTGATCGCCATCGTGATGGTGACCATCATG CTGTGCTGTATGACATCCTGCTGTTCTTGCCTGAAGGGCTGCTGTAGCTGTGGCTCCTG CTGTAAATTCGATGAAGATGACTCCGAGCCCGTGCTGAAAGGCGTGAAACTGCAT TACACTTGA SEQ ID NO: 2 Amino acid sequence of the human IgG2 heavy chain signal peptide MGWSCIILFLVATATGVHS SEQ ID NO: 3 Coding sequence for the human IgG2 heavy chain signal peptide ATGGGATGGAGCTGTATCATCCTCTTCTTGGTAGCAACAGCTACAGGTGTCCACTCC SEQ ID NO: 4 Consensus synthetic SARS-CoV-2 full-length S protein sequence with human IgG2 heavy chain signal peptide expressed by codon-optimized nucleotide sequences MGWSCIILFLVATATGVHSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQD LFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDS KTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFENV SQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLP IGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAV DCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFA SVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEV RQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFER DISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVC GPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEI LDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVF QTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAE NSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCT QLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIED LLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLA GTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSL SSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLI TGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSA PHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQII TTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINA SVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIM LCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT
DNA Constructs
[0048] The designed full-length codon-optimized consensus coding sequence for SARS-CoV-2 S gene (SEQ ID NO: 1) was synthesized and cloned into the mammalian expression vector pVAX1 under the control of the cytomegalovirus immediate-early promoter. The resulting plasmid, shown in FIG. 1A, was named pSARS2-S. The coding sequence was cloned between NheI and KpnI restriction sites in the pVAX1 vector using the T4 DNA ligase. The construct was then confirmed by sequencing and restriction digestion analysis. Bulk endotoxin-free preparations of pSARS2-S and the empty pVAX1 plasmid (control) were prepared for animal studies using a plasmid Giga purification kit (Qiagen; Hilden, Germany).
Cells
[0049] Baby hamster kidney BHK-21/WI-2 cell line (Kerafast, EH1011) and African green monkey kidney-derived Vero E6 cell line (ATCC, 1586) were cultured in Dulbecco's modified essential medium (DMEM) contained 100 U/ml of penicillin, and 100 .mu.g/ml of streptomycin and supplemented with 5 and 10% fetal bovine serum (FBS) in a 5% CO.sub.2 environment at 37.degree. C.
Western Blot
[0050] 70-90% confluent HEK-293A cells in 6-well plates were transiently transfected with 2 .mu.g of pSARS2-S or empty control plasmid (pVAX1) using JetPRIME.RTM. Transient Transfection Protocol and Reagents (Polyplus-Transfection SA; New York) according to manufacturer's instructions. Transfected cells were incubated at 37.degree. C. in a 5% CO.sub.2 incubator for 48 h. Transfected cells were then washed with phosphate-buffered saline (PBS) and lysed with radioimmunoprecipitation assay buffer (RIPA buffer) (Sigma-Aldrich; St. Louis, Mo.). The lysates were subjected to western blot analysis for protein expression using mouse anti-S (SARS-CoV-2) polyclonal antibodies.
Immunofluorescence Analysis.
[0051] HEK-293A cells were seeded on an 8-well cell culture slide [growth area/well (cm.sup.2): 0.98 and working volume/well(ml): 0.20-0.60] to be 70% confluent by the next day and incubate at 37.degree. C., 5% CO.sub.2. The next day, cells were transfected with 0.2 .mu.g of pSARS2-S or empty control plasmids using JetPRIME.RTM. Transient Transfection Protocol and Reagents (Polyplus) according to manufacturer's instructions, followed by incubation at 37.degree. C. in a 5% CO.sub.2 incubator for 24 h. The media was removed, and then cells were washed with PBS and fixed with 4% formaldehyde at 4.degree. C. for 10 min. Cells were washed twice with PBS and permeabilized with 0.2% PBS-T (Triton 100) at 4.degree. C. for 20 min. Cells were then washed twice with PBS-T. Wells were blocked with blocking buffer (2% goat serum in PBS-T) at room temperature for 30 min and washed twice with PBS-T. Cells were then incubated with mouse anti-SARS-CoV-2 S polyclonal antibodies in blocking buffer at 1:1000 dilution at 4.degree. C. for 1 h. After three washes with PBS-T, Alexa Fluor-488 labeled goat anti-mouse IgG H&L secondary antibody at 1:500 dilution in blocking buffer and incubated in the dark at room temperature for 1 h. Cells were washed again for three times with PBS-T, and slides were mounted with VECTASHIELD.RTM. antifade mounting medium with DAPI counter stain (Vector Laboratories; Burlingame, Calif.). Images were captured using Olympus BX51 Fluorescence Microscope.
Animal Studies.
[0052] Six to 8-week-old female BALB/c or C57BL/6J mice were obtained from and housed in the animal facility in King Fand Medical Research Center (KFMRC), King Abdulaziz University (KAU), Jeddah, Saudi Arabia. All animal experiments were conducted in accordance with the guidelines and approval of the Animal Care and Use Committee (ACUC) at KFMRC and ethical approval (04-CEGMR-Bioeth-2020). In one experiment, two groups of BALB/c or C57BL/6J mice (10 per group) were intramuscularly immunized via needle injection with 3 doses of 100 .mu.g of either pSARS2-S or control plasmid at 2 weeks interval and blood samples were collected for serological testing every 2 weeks starting from day 0 pre-bleed until week 8. In another experiment, three groups of BALB/c mice (5 per group) were immunized intramuscularly, intradermally or subcutaneously via needle injection with 3 doses of 100 .mu.g of either pSARS2-S or control plasmid at 2 weeks interval and blood samples were collected every 2 weeks until week 17 post primary immunization. In a third experiment, BALB/c mice (4-5 per group) were intramuscularly or intradermally immunized with 2 doses of 25 .mu.g, 50 .mu.g or 100 .mu.g of pSARS2-S plasmid at 2 weeks interval using either needle injection or needle-free Tropis system (PharmaJet; Golden, Colo.) and blood samples were collected every week until week 4 post primary immunization.
Indirect ELISA.
[0053] The end-point titers or optical density (OD) readings at 1:100 dilution of total anti-S1 IgG or its isotypes (IgG1, IgG2a and IgG2b) from immunized mice were determined by enzyme-linked immunosorbent assay as described previously (ELISA) as previously described (Al-Amri et al. Sci Rep. 2017 Mar. 23;7:44875). Briefly, 96-well EU Immulon 2 HB plates (Thermo Fisher Scientific; Waltham, Mass.) were coated overnight at 4.degree. C. with the SARS-CoV-2 Si subunit (amino acids 1-685) (Sino Biological; China) at 0.5 .mu.g/ml in PBS (50 ul/well). Then, the plates were washed three times with washing buffer (PBS containing 0.1% Tween-20 (PBS-T)). This was followed by blocking with 200 ul/well of blocking buffer (5% skim milk in PBS-T) for 1 h at room temperature. Plates were washed three times and incubated with a 2-fold serial dilution of mouse sera (100 ul/well) starting from 1:100 dilution in blocking buffer and incubated for 1 h at 37.degree. C. Some samples collected at different time points were only tested at 1:100 dilution. After three washes, peroxidase-conjugated rabbit anti-mouse IgG secondary antibodies as well as anti-IgG1, IgG2a or IgG2b antibodies (Jackson Immunoresearch Laboratories; West Grove, Pa.) were added at dilutions recommended by the manufacturer and incubated for 1 h at 37.degree. C. as 100 ul/well. Excess secondary antibodies were removed by three washes and color was developed by adding 3,3',5,5'- tetramethylbenzidine (TMB) substrate (KPL, Gaithersburg, Md.) for 30 min. Finally, reactions were stopped with 0.16 M sulfuric acid and absorbance was read spectrophotometrically at 450 nm using the ELx808.TM. Absorbance Microplate Reader (BioTek; Winooski, Vt.). End-point titers were determined and expressed as the reciprocals of the highest dilution with OD reading above the cut-off value defined as the mean of the control group plus three standard deviations (SD).
SARS-CoV-2 Pseudovirus Neutralization Assay.
[0054] Pseudovirus microneutralization assay was performed as previously described (Almahboub et al. Front Microbiol. 2020 Sep. 4;11:2020). Briefly, rVSV-.DELTA.G/SARS-2-S*-luciferase pseudovirus was generated by transfecting BHK21/WI-2 cells with 46 .mu.g of pcDNA expressing codon-optimized full-length SARS-CoV-2 S protein (GenBank accession number: MN908947) using Lipofectamine.TM. 2000 transfection reagent (Invitrogen; Carlsbad, Calif.). 24 h later, transfected cells were infected with rVSV-.DELTA.G/G*-luciferase at a multiplicity of infection (moi) of 4 and the supernatant containing the generated rVSV-.DELTA.G/SARS-2-S*-luciferase pseudovirus was collected 24 h post-infection. The collected virus was titrated by measuring luciferase activity from serially diluted supernatant on Vero E6 cells and the titer was expressed as a relative luciferase unit (RLU). Neutralization assay was then conducted by incubating two-fold serial dilutions of heat-inactivated mouse sera from vaccinated and control groups starting at a 1:20 dilution (in duplicate) with DMEM were incubated with DMEM-5 containing 5.times.10.sup.4 RLU rVSV-.DELTA.G/SARS-2-S*-luciferase pseudovirus for 1 h at 37.degree. C. in a 5% CO.sub.2 incubator. Pseudovirus--serum mixtures were transferred onto confluent Vero E6 cell monolayers in white 96-well plates and incubated for 24 h at 37.degree. C. in a 5% CO2 incubator. 24 h later, cells were lysed, and luciferase activity was measured using Luciferase Assay System (Promega; Madison, Wis.) according to the manufacturer's instructions, and the luminescence was measured using a Biotek Synergy microplate luminometer (BioTek Instruments; Winooski, Vt.). Cell-only control (CC) and virus control (VC) were included with each assay run. The median inhibitory concentration (IC.sub.50) of neutralizing antibodies (nAbs) was determined using four-parameter logistic (4PL) curve in GraphPad Prism V8 software (GraphPad Software; San Diego, Calif.) and calculated as the reciprocal of the serum dilution at which RLU were reduced by 50% compared with the virus control wells after subtraction of the background RLUs in the control groups with cells only.
Statistical Analysis
[0055] Statistical analyses and graphical presentations were conducted with the GraphPad Prism V8 software. Statistical analysis was conducted using one-way analysis of variance with Bonferroni post-hoc test to adjust for multiple comparisons between groups, or Mann-Whitney test. All values are depicted as mean .+-.SD and statistical significance is reported as *, P.ltoreq.0.05 and **, P.ltoreq.0.01.
EXAMPLE 1
In Vitro Protein Expression From The Synthetic Dna Vaccine
[0056] Prior to animal experiments, protein expression from the DNA construct was confirmed in vitro in HEK-293A cells. Western blot analysis confirmed that the recombinant construct was able to express the spike protein indicated by the band observed at expected molecular weight, as shown in FIG. 1B. Immunofluorescence analysis was performed to visualize the expression of SARS-CoV-2 Spike protein in transfected HEK-293A cells. As shown in FIG. 1C, the S protein expression was only detected in cells transfected with pSARS2-S using mouse anti-SARS-CoV-2 S polyclonal antibodies but not in cells transfected with the control plasmid.
EXAMPLE 2
Intramuscular Immunization With The Synthetic Dna Vaccine Elicits Significant And Long Lasting Th1-Skewed Humoral Immune Response In Mice
[0057] The immunogenicity of the generated naked DNA vaccine candidate was evaluated in BALB/c and C57BL/6J mice. Mice intramuscularly immunized with three doses of the vaccine induced significant levels of S1-specific IgG. Specifically, while two doses elicited significant levels of S1-specific IgG in both BALB/c and C57BL/6J mice, samples collected 2 weeks post-third immunization (i.e. on week 8) showed higher significant levels compared to control groups immunized with the control plasmid (FIGS. 2A and 3A) Immunization with pSARS2-S significantly induced higher levels of S1-specific IgG2a and IgG2b compared to IgG1 in both animal models (FIGS. 2B and 3B), demonstrating a Th1-skewed immune response as shown by the high IgG2a/IgG1 or IgG2b/IgG1 ratios (FIGS. 2C and 3C).
[0058] To further investigate the ability of the developed vaccine to elicit nAbs, sera from immunized and control mice were tested in pseudovirus microneutralization assay. As shown in FIG. 4, sera collected on week 8 from pSARS2-S immunized group induced significant levels of nAbs compared to control group with mean IC50 titers of 1.times.10.sup.3 in both BALB/c and C57BL/6J mice. As expected, no neutralizing activity was observed from mice immunized with control plasmid. Interestingly, intradermal and subcutaneous immunization of BALB/c mice with three doses of pSARS2-S failed to induce any significant IgG levels (FIG. 5). On the other hand, such immunization via intramuscular route elicited long-lasting S1-specific IgG that lasted until week 17 post-primary immunization. These data demonstrate that intramuscular immunization with this synthetic codon-optimized DNA vaccine induced nAbs and long-lasting Th1-skewed antibody response in mice.
EXAMPLE 3
Needle Free Injection Enhances The Immunogenicity Of The Synthetic Dna Vaccine In Mice
[0059] To further improve the immunogenicity of the naked synthetic DNA vaccine, a needle-free Tropis system was used to deliver the vaccine. As shown in FIG. 6, immunization with only two doses of as low as 25 .mu.g of the vaccine via either intramuscular or intradermal routes was able to elicit high levels of S1-specific IgG. Specifically, two doses of intramuscular immunization with pSARS2-S were able to induce significant levels of S1-specific IgG in a dose-dependent fashion in BALB/c mice (FIGS. 6A and 6B), in which two doses of 50 .mu.g and 100 .mu.g administered by the needle-free system elicited IgG levels that are equivalent or higher (FIG. 6B) than that induced by three doses of 100 .mu.g by needle injection (FIG. 2B). This was further confirmed by comparing S1-specific IgG in sera collected from BALB/c mice administered with two doses of 25 .mu.g (FIG. 7A), 50 .mu.g (FIG. 7B) and 100 .mu.g (FIG. 7C) via either needle injection or needle-free system. Thus, needle-free administration of 50 .mu.g and 100 .mu.g induced significant levels of S1-specific IgG compared to needle injection in which all mice immunized with the needle-free system elicited S1-specific IgG compared to few from the group immunized using needle injection.
[0060] While intradermal needle injection of three doses of 100 .mu.g failed to induce significant levels of specific IgG, two doses of pSARS2-S administered via the needle-free system induced significant levels of S1-specific IgG in a dose-dependent fashion (FIG. 6C and 6D). Importantly, the levels of S1-specific IgG were equivalent or higher than those generated by three doses administered by intramuscular needle injection. We further investigated the neutralizing activity of the sera from BALB/c mice immunized with two doses opSARS2-S using either needle injection or needle-free system. As shown in FIG. 8, two doses of needle-free immunization delivered intramuscularly were sufficient to induce high levels, reaching 1.times.10.sup.3 of nAbs, that were statistically significant.
[0061] While the invention has been described in terms of its several exemplary embodiments, those skilled in the art will recognize that the invention can be practiced with modification within the spirit and scope of the appended claims. Accordingly, the present invention should not be limited to the embodiments as described above but should further include all modifications and equivalents thereof within the spirit and scope of the description provided herein.
[0062] This work was supported by King Abdulaziz City for Science and Technology (KACST), Riyadh, Saudi Arabia, through a research grant program (number 09-1), which is a part of the Targeted Research Program (TRP).
Sequence CWU
1
1
413840DNAArtificial SequenceSynthetic immunogen sequence 1atgggatgga
gctgtatcat cctcttcttg gtagcaacag ctacaggtgt ccactcccag 60tgcgtgaatc
tgactactcg gactcagctg cctcccgcct ataccaattc cttcacccgg 120ggcgtgtact
atcctgacaa ggtgtttaga agctccgtgc tgcactctac acaggatctg 180tttctgccat
tctttagcaa cgtgacctgg ttccacgcca tccacgtgag cggcaccaat 240ggcacaaagc
ggttcgacaa tcccgtgctg ccttttaacg atggcgtgta cttcgcctct 300accgagaaga
gcaacatcat cagaggctgg atctttggca ccacactgga ctccaagaca 360cagtctctgc
tgatcgtgaa caatgccacc aacgtggtca tcaaggtgtg cgagttccag 420ttttgtaatg
atcccttcct gggcgtgtac tatcacaaga acaataagag ctggatggag 480tccgagttta
gagtgtattc tagcgccaac aattgcacat ttgagtacgt gtcccagcct 540ttcctgatgg
acctggaggg caagcagggc aatttcaaga acctgaggga gttcgtgttt 600aagaatatcg
acggctactt caaaatctac agcaagcaca cccccatcaa cctggtgcgc 660gacctgcctc
agggcttcag cgccctggag cccctggtgg atctgcctat cggcatcaac 720atcacccggt
ttcagacact gctggccctg cacagaagct acctgacacc cggcgactcc 780tctagcggat
ggaccgcagg agctgccgcc tactatgtgg gctatctgca gccccggacc 840ttcctgctga
agtacaacga gaatggcacc atcacagacg cagtggattg cgccctggac 900cccctgagcg
agacaaagtg tacactgaag tcctttaccg tggagaaggg catctatcag 960acatccaatt
tcagggtgca gccaaccgag tctatcgtgc gctttcctaa tatcacaaac 1020ctgtgcccat
ttggcgaggt gttcaacgca accaggttcg ccagcgtgta cgcatggaat 1080aggaagcgca
tctctaactg cgtggccgac tatagcgtgc tgtacaactc cgcctctttc 1140agcaccttta
agtgctatgg cgtgtccccc acaaagctga atgacctgtg ctttaccaac 1200gtgtacgccg
attctttcgt gatcaggggc gacgaggtgc gccagatcgc acctggacag 1260acaggcaaga
tcgccgacta caattataag ctgccagacg atttcaccgg ctgcgtgatc 1320gcctggaaca
gcaacaatct ggattccaag gtcggcggca actacaatta tctgtaccgg 1380ctgtttagaa
agagcaatct gaagcccttc gagagggaca tctctacaga aatctaccag 1440gccggcagca
ccccttgcaa tggcgtggag ggctttaact gttatttccc actgcagtcc 1500tacggcttcc
agcccacaaa cggcgtgggc tatcagcctt accgcgtggt ggtgctgagc 1560tttgagctgc
tgcacgcacc agcaacagtg tgcggcccca agaagtccac caatctggtg 1620aagaacaagt
gcgtgaactt caacttcaac ggcctgaccg gcacaggcgt gctgaccgag 1680tccaacaaga
agttcctgcc atttcagcag ttcggcaggg acatcgcaga taccacagac 1740gccgtgcgcg
acccacagac cctggagatc ctggacatca caccctgctc tttcggcggc 1800gtgagcgtga
tcacaccagg caccaataca agcaaccagg tggccgtgct gtatcaggac 1860gtgaattgta
ccgaggtgcc tgtggccatc cacgccgatc agctgacccc aacatggcgg 1920gtgtacagca
ccggctccaa cgtgttccag acaagagccg gatgcctgat cggagcagag 1980cacgtgaaca
attcctatga gtgcgacatc ccaatcggcg ccggcatctg tgcctcttac 2040cagacccaga
caaactctcc cagaagagcc cggagcgtgg cctcccagtc tatcatcgcc 2100tataccatgt
ccctgggcgc cgagaacagc gtggcctact ctaacaatag catcgccatc 2160ccaaccaact
tcacaatctc tgtgaccaca gagatcctgc ccgtgtccat gaccaagaca 2220tctgtggact
gcacaatgta tatctgtggc gattctaccg agtgcagcaa cctgctgctg 2280cagtacggca
gcttttgtac ccagctgaat agagccctga caggcatcgc cgtggagcag 2340gataagaaca
cacaggaggt gttcgcccag gtgaagcaaa tctacaagac cccccctatc 2400aaggactttg
gcggcttcaa tttttcccag atcctgcctg atccatccaa gccttctaag 2460cggagcttta
tcgaggacct gctgttcaac aaggtgaccc tggccgatgc cggcttcatc 2520aagcagtatg
gcgattgcct gggcgacatc gcagcccggg acctgatctg cgcccagaag 2580tttaatggcc
tgaccgtgct gccacccctg ctgacagatg agatgatcgc acagtacaca 2640agcgccctgc
tggccggcac catcacatcc ggatggacct tcggcgcagg agccgccctg 2700cagatcccct
ttgccatgca gatggcctat aggttcaacg gcatcggcgt gacccagaat 2760gtgctgtacg
agaaccagaa gctgatcgcc aatcagttta actccgccat cggcaagatc 2820caggacagcc
tgtcctctac agcctccgcc ctgggcaagc tgcaggatgt ggtgaatcag 2880aacgcccagg
ccctgaatac cctggtgaag cagctgagca gcaacttcgg cgccatctct 2940agcgtgctga
atgacatcct gagccggctg gacaaggtgg aggcagaggt gcagatcgac 3000cggctgatca
caggcagact gcagtctctg cagacctatg tgacacagca gctgatcagg 3060gcagcagaga
tcagggccag cgccaatctg gcagcaacca agatgtccga gtgcgtgctg 3120ggccagtcta
agagagtgga cttttgtggc aagggctatc acctgatgtc cttccctcag 3180tctgccccac
acggcgtggt gtttctgcac gtgacctacg tgcccgccca ggagaagaac 3240ttcaccacag
cccctgccat ctgccacgat ggcaaggccc actttccaag ggagggcgtg 3300ttcgtgtcca
acggcaccca ctggtttgtg acacagcgca atttctacga gccccagatc 3360atcaccacag
acaatacctt cgtgagcggc aactgtgacg tggtcatcgg catcgtgaac 3420aataccgtgt
atgatccact gcagcccgag ctggacagct ttaaggagga gctggataag 3480tacttcaaga
atcacacctc ccctgacgtg gatctgggcg acatcagcgg catcaatgcc 3540tccgtggtga
acatccagaa ggagatcgac cgcctgaacg aggtggccaa gaatctgaac 3600gagagcctga
tcgacctgca ggagctgggc aagtatgagc agtacatcaa gtggccctgg 3660tacatctggc
tgggcttcat cgccggcctg atcgccatcg tgatggtgac catcatgctg 3720tgctgtatga
catcctgctg ttcttgcctg aagggctgct gtagctgtgg ctcctgctgt 3780aaattcgatg
aagatgactc cgagcccgtg ctgaaaggcg tgaaactgca ttacacttga 3840219PRThuman
2Met Gly Trp Ser Cys Ile Ile Leu Phe Leu Val Ala Thr Ala Thr Gly1
5 10 15Val His Ser357DNAhuman
3atgggatgga gctgtatcat cctcttcttg gtagcaacag ctacaggtgt ccactcc
5741279PRTArtificial SequenceSynthetic immunogen sequence 4Met Gly Trp
Ser Cys Ile Ile Leu Phe Leu Val Ala Thr Ala Thr Gly1 5
10 15Val His Ser Gln Cys Val Asn Leu Thr
Thr Arg Thr Gln Leu Pro Pro 20 25
30Ala Tyr Thr Asn Ser Phe Thr Arg Gly Val Tyr Tyr Pro Asp Lys Val
35 40 45Phe Arg Ser Ser Val Leu His
Ser Thr Gln Asp Leu Phe Leu Pro Phe 50 55
60Phe Ser Asn Val Thr Trp Phe His Ala Ile His Val Ser Gly Thr Asn65
70 75 80Gly Thr Lys Arg
Phe Asp Asn Pro Val Leu Pro Phe Asn Asp Gly Val 85
90 95Tyr Phe Ala Ser Thr Glu Lys Ser Asn Ile
Ile Arg Gly Trp Ile Phe 100 105
110Gly Thr Thr Leu Asp Ser Lys Thr Gln Ser Leu Leu Ile Val Asn Asn
115 120 125Ala Thr Asn Val Val Ile Lys
Val Cys Glu Phe Gln Phe Cys Asn Asp 130 135
140Pro Phe Leu Gly Val Tyr Tyr His Lys Asn Asn Lys Ser Trp Met
Glu145 150 155 160Ser Glu
Phe Arg Val Tyr Ser Ser Ala Asn Asn Cys Thr Phe Glu Tyr
165 170 175Val Ser Gln Pro Phe Leu Met
Asp Leu Glu Gly Lys Gln Gly Asn Phe 180 185
190Lys Asn Leu Arg Glu Phe Val Phe Lys Asn Ile Asp Gly Tyr
Phe Lys 195 200 205Ile Tyr Ser Lys
His Thr Pro Ile Asn Leu Val Arg Asp Leu Pro Gln 210
215 220Gly Phe Ser Ala Leu Glu Pro Leu Val Asp Leu Pro
Ile Gly Ile Asn225 230 235
240Ile Thr Arg Phe Gln Thr Leu Leu Ala Leu His Arg Ser Tyr Leu Thr
245 250 255Pro Gly Asp Ser Ser
Ser Gly Trp Thr Ala Gly Ala Ala Ala Tyr Tyr 260
265 270Val Gly Tyr Leu Gln Pro Arg Thr Phe Leu Leu Lys
Tyr Asn Glu Asn 275 280 285Gly Thr
Ile Thr Asp Ala Val Asp Cys Ala Leu Asp Pro Leu Ser Glu 290
295 300Thr Lys Cys Thr Leu Lys Ser Phe Thr Val Glu
Lys Gly Ile Tyr Gln305 310 315
320Thr Ser Asn Phe Arg Val Gln Pro Thr Glu Ser Ile Val Arg Phe Pro
325 330 335Asn Ile Thr Asn
Leu Cys Pro Phe Gly Glu Val Phe Asn Ala Thr Arg 340
345 350Phe Ala Ser Val Tyr Ala Trp Asn Arg Lys Arg
Ile Ser Asn Cys Val 355 360 365Ala
Asp Tyr Ser Val Leu Tyr Asn Ser Ala Ser Phe Ser Thr Phe Lys 370
375 380Cys Tyr Gly Val Ser Pro Thr Lys Leu Asn
Asp Leu Cys Phe Thr Asn385 390 395
400Val Tyr Ala Asp Ser Phe Val Ile Arg Gly Asp Glu Val Arg Gln
Ile 405 410 415Ala Pro Gly
Gln Thr Gly Lys Ile Ala Asp Tyr Asn Tyr Lys Leu Pro 420
425 430Asp Asp Phe Thr Gly Cys Val Ile Ala Trp
Asn Ser Asn Asn Leu Asp 435 440
445Ser Lys Val Gly Gly Asn Tyr Asn Tyr Leu Tyr Arg Leu Phe Arg Lys 450
455 460Ser Asn Leu Lys Pro Phe Glu Arg
Asp Ile Ser Thr Glu Ile Tyr Gln465 470
475 480Ala Gly Ser Thr Pro Cys Asn Gly Val Glu Gly Phe
Asn Cys Tyr Phe 485 490
495Pro Leu Gln Ser Tyr Gly Phe Gln Pro Thr Asn Gly Val Gly Tyr Gln
500 505 510Pro Tyr Arg Val Val Val
Leu Ser Phe Glu Leu Leu His Ala Pro Ala 515 520
525Thr Val Cys Gly Pro Lys Lys Ser Thr Asn Leu Val Lys Asn
Lys Cys 530 535 540Val Asn Phe Asn Phe
Asn Gly Leu Thr Gly Thr Gly Val Leu Thr Glu545 550
555 560Ser Asn Lys Lys Phe Leu Pro Phe Gln Gln
Phe Gly Arg Asp Ile Ala 565 570
575Asp Thr Thr Asp Ala Val Arg Asp Pro Gln Thr Leu Glu Ile Leu Asp
580 585 590Ile Thr Pro Cys Ser
Phe Gly Gly Val Ser Val Ile Thr Pro Gly Thr 595
600 605Asn Thr Ser Asn Gln Val Ala Val Leu Tyr Gln Asp
Val Asn Cys Thr 610 615 620Glu Val Pro
Val Ala Ile His Ala Asp Gln Leu Thr Pro Thr Trp Arg625
630 635 640Val Tyr Ser Thr Gly Ser Asn
Val Phe Gln Thr Arg Ala Gly Cys Leu 645
650 655Ile Gly Ala Glu His Val Asn Asn Ser Tyr Glu Cys
Asp Ile Pro Ile 660 665 670Gly
Ala Gly Ile Cys Ala Ser Tyr Gln Thr Gln Thr Asn Ser Pro Arg 675
680 685Arg Ala Arg Ser Val Ala Ser Gln Ser
Ile Ile Ala Tyr Thr Met Ser 690 695
700Leu Gly Ala Glu Asn Ser Val Ala Tyr Ser Asn Asn Ser Ile Ala Ile705
710 715 720Pro Thr Asn Phe
Thr Ile Ser Val Thr Thr Glu Ile Leu Pro Val Ser 725
730 735Met Thr Lys Thr Ser Val Asp Cys Thr Met
Tyr Ile Cys Gly Asp Ser 740 745
750Thr Glu Cys Ser Asn Leu Leu Leu Gln Tyr Gly Ser Phe Cys Thr Gln
755 760 765Leu Asn Arg Ala Leu Thr Gly
Ile Ala Val Glu Gln Asp Lys Asn Thr 770 775
780Gln Glu Val Phe Ala Gln Val Lys Gln Ile Tyr Lys Thr Pro Pro
Ile785 790 795 800Lys Asp
Phe Gly Gly Phe Asn Phe Ser Gln Ile Leu Pro Asp Pro Ser
805 810 815Lys Pro Ser Lys Arg Ser Phe
Ile Glu Asp Leu Leu Phe Asn Lys Val 820 825
830Thr Leu Ala Asp Ala Gly Phe Ile Lys Gln Tyr Gly Asp Cys
Leu Gly 835 840 845Asp Ile Ala Ala
Arg Asp Leu Ile Cys Ala Gln Lys Phe Asn Gly Leu 850
855 860Thr Val Leu Pro Pro Leu Leu Thr Asp Glu Met Ile
Ala Gln Tyr Thr865 870 875
880Ser Ala Leu Leu Ala Gly Thr Ile Thr Ser Gly Trp Thr Phe Gly Ala
885 890 895Gly Ala Ala Leu Gln
Ile Pro Phe Ala Met Gln Met Ala Tyr Arg Phe 900
905 910Asn Gly Ile Gly Val Thr Gln Asn Val Leu Tyr Glu
Asn Gln Lys Leu 915 920 925Ile Ala
Asn Gln Phe Asn Ser Ala Ile Gly Lys Ile Gln Asp Ser Leu 930
935 940Ser Ser Thr Ala Ser Ala Leu Gly Lys Leu Gln
Asp Val Val Asn Gln945 950 955
960Asn Ala Gln Ala Leu Asn Thr Leu Val Lys Gln Leu Ser Ser Asn Phe
965 970 975Gly Ala Ile Ser
Ser Val Leu Asn Asp Ile Leu Ser Arg Leu Asp Lys 980
985 990Val Glu Ala Glu Val Gln Ile Asp Arg Leu Ile
Thr Gly Arg Leu Gln 995 1000
1005Ser Leu Gln Thr Tyr Val Thr Gln Gln Leu Ile Arg Ala Ala Glu
1010 1015 1020Ile Arg Ala Ser Ala Asn
Leu Ala Ala Thr Lys Met Ser Glu Cys 1025 1030
1035Val Leu Gly Gln Ser Lys Arg Val Asp Phe Cys Gly Lys Gly
Tyr 1040 1045 1050His Leu Met Ser Phe
Pro Gln Ser Ala Pro His Gly Val Val Phe 1055 1060
1065Leu His Val Thr Tyr Val Pro Ala Gln Glu Lys Asn Phe
Thr Thr 1070 1075 1080Ala Pro Ala Ile
Cys His Asp Gly Lys Ala His Phe Pro Arg Glu 1085
1090 1095Gly Val Phe Val Ser Asn Gly Thr His Trp Phe
Val Thr Gln Arg 1100 1105 1110Asn Phe
Tyr Glu Pro Gln Ile Ile Thr Thr Asp Asn Thr Phe Val 1115
1120 1125Ser Gly Asn Cys Asp Val Val Ile Gly Ile
Val Asn Asn Thr Val 1130 1135 1140Tyr
Asp Pro Leu Gln Pro Glu Leu Asp Ser Phe Lys Glu Glu Leu 1145
1150 1155Asp Lys Tyr Phe Lys Asn His Thr Ser
Pro Asp Val Asp Leu Gly 1160 1165
1170Asp Ile Ser Gly Ile Asn Ala Ser Val Val Asn Ile Gln Lys Glu
1175 1180 1185Ile Asp Arg Leu Asn Glu
Val Ala Lys Asn Leu Asn Glu Ser Leu 1190 1195
1200Ile Asp Leu Gln Glu Leu Gly Lys Tyr Glu Gln Tyr Ile Lys
Trp 1205 1210 1215Pro Trp Tyr Ile Trp
Leu Gly Phe Ile Ala Gly Leu Ile Ala Ile 1220 1225
1230Val Met Val Thr Ile Met Leu Cys Cys Met Thr Ser Cys
Cys Ser 1235 1240 1245Cys Leu Lys Gly
Cys Cys Ser Cys Gly Ser Cys Cys Lys Phe Asp 1250
1255 1260Glu Asp Asp Ser Glu Pro Val Leu Lys Gly Val
Lys Leu His Tyr 1265 1270 1275Thr
User Contributions:
Comment about this patent or add new information about this topic: