Patent application title: DNA POLYMERASE MUTANTS HAVING ENHANCED TEMPLATE DISCRIMINATION ACTIVITY
Inventors:
Mark Aaron Behlke (Coralville, IA, US)
Mark Aaron Behlke (Coralville, IA, US)
Joseph A. Walder (Chicago, IL, US)
Joseph A. Walder (Chicago, IL, US)
Richard Owczarzy (Coralville, IA, US)
Richard Owczarzy (Coralville, IA, US)
Scott D. Rose (Coralville, IA, US)
Scott D. Rose (Coralville, IA, US)
Joseph R. Dobosy (Coralville, IA, US)
Susan M. Rupp (Marion, IA, US)
IPC8 Class: AC12P1934FI
USPC Class:
Class name:
Publication date: 2022-01-13
Patent application number: 20220010346
Abstract:
This invention relates to mutant Taq DNA polymerase having an enhanced
template discrimination activity compared with an unmodified Taq DNA
polymerase of SEQ ID NO.:1, wherein the amino acid sequence of the mutant
Taq DNA polymerase consists of substitutions at residue positions 783,
784, or a combination of 783 and 784 of the unmodified Taq DNA polymerase
of SEQ ID NO.:1.Claims:
1. A mutant Taq DNA polymerase having an enhanced template discrimination
activity compared with an unmodified Taq DNA polymerase of SEQ ID NO.:1,
wherein the amino acid sequence of the mutant Taq DNA polymerase consists
of substitutions at residue positions 783, 784, or a combination of 783
and 784 of the unmodified Taq DNA polymerase of SEQ ID NO.:1.
2. The mutant Taq DNA polymerase of claim 1, wherein the enhanced template discrimination activity comprises at least one property selected from the group consisting of enhanced 3'-mismatch discrimination and enhanced 3'-nucleotide discrimination.
3. The mutant Taq DNA polymerase of claim 1, further comprising polymerase activity at least comparable to about 0.01-fold the polymerase activity of unmodified Taq DNA polymerase.
4. The mutant Taq DNA polymerase of claim 1, wherein the enhanced template discrimination activity comprises enhanced 3'-mismatch discrimination, wherein an average .DELTA..DELTA.Cq is at least about 1.0 when the mutant Taq DNA polymerase is evaluated for enhanced 3'-mismatch discrimination by allele-specific PCR assay.
5. The mutant Taq DNA polymerase of claim 1, wherein the enhanced template discrimination activity comprises enhanced 3'-nucleotide discrimination, wherein an average .DELTA..DELTA.Cq is at least about 1.0 when the mutant Taq DNA polymerase is evaluated for enhanced 3'-nucleotide discrimination by quantitative PCR.
6. The mutant Taq DNA polymerase of claim 1, wherein the enhanced template discrimination activity comprises enhanced 3'-mismatch discrimination by rhPCR, wherein an average .DELTA..DELTA.Cq is at least about 1.0 when the mutant Taq DNA polymerase is evaluated for enhanced 3'-mismatch discrimination by rhPCR with an RDDDDx blocked-cleavable rhPCR primer.
7. The mutant Taq DNA polymerase of claim 1, wherein the enhanced template discrimination activity comprises enhanced 3'-mismatch discrimination by rhPCR, wherein an average .DELTA..DELTA.Cq is at least about 0.50 when the mutant Taq DNA polymerase is evaluated for enhanced 3'-mismatch discrimination by rhPCR with an RDxxD blocked-cleavable rhPCR primer.
8. The mutant Taq DNA polymerase of claim 1, wherein the enhanced template discrimination activity comprises enhanced 3'-mismatch discrimination by rhPCR SNP discrimination assay, wherein an average .DELTA..DELTA.Cq is at least about 1.0 when the mutant Taq DNA polymerase is evaluated for enhanced 3'-mismatch discrimination by rhPCR SNP discrimination assay of the SMAD7 gene NM_005904, C/T SNP, rs4939827) with RDDDDx blocked-cleavable rhPCR primers consisting of SEQ ID NOs:76 and 77.
9. The mutant Taq DNA polymerase of claim 1, wherein the enhanced template discrimination activity comprises enhanced 3'-mismatch discrimination by rhPCR SNP discrimination assay, wherein an average .DELTA..DELTA.Cq is at least about 1.0 when the mutant Taq DNA polymerase is evaluated for enhanced 3'-mismatch discrimination by rhPCR SNP discrimination assay of the SMAD7 gene NM_005904, C/T SNP, rs4939827) with RDxxD blocked-cleavable rhPCR primers consisting of SEQ ID NOs:78 and 79.
10. The mutant Taq DNA polymerase of claim 1, wherein the enhanced template discrimination activity comprises enhanced 3'-mismatch discrimination by rhPCR SNP discrimination assay, wherein an average .DELTA..DELTA.Cq is at least about 5.0 when the mutant Taq DNA polymerase is evaluated for enhanced 3'-mismatch discrimination by rhPCR SNP discrimination assay of the SMAD7 gene NM_005904, C/T SNP, rs4939827) with RDxxD blocked-cleavable rhPCR primers consisting of SEQ ID NOs:78 and 79.
11. The mutant Taq DNA polymerase of claim 1, wherein the enhanced template discrimination activity comprises enhanced rare allele discrimination, wherein the enhanced rare allele discrimination is at least 1:10,000 when the mutant Taq DNA polymerase is evaluated by rhPCR SNP discrimination assay of the SMAD7 gene NM_005904, C/T SNP, rs4939827) having a .DELTA.Cq of at least 3.0 with RDxxD blocked-cleavable rhPCR primers consisting of SEQ ID NOs:78 and 79.
12. A mutant Taq DNA polymerase having an enhanced template discrimination activity compared with an unmodified Taq DNA polymerase, wherein the amino acid sequence of the mutant Taq DNA polymerase is selected from the group of the following selected substitutions: V783F, H784Q, or a combination of V783L and H784Q.
13. The mutant Taq DNA polymerase of claim 12, wherein the mutant Taq DNA polymerase has at least 80% sequence identity to one of SEQ ID NOS: 83, 85, 87 or 89.
14. The mutant Taq DNA polymerase of claim 12, wherein the enhanced template discrimination activity comprises at least one property selected from the group consisting of enhanced 3'-mismatch discrimination and enhanced 3'-nucleotide discrimination.
15. The mutant Taq DNA polymerase of claim 12, further comprising polymerase activity at least comparable to about 0.02-fold the polymerase activity of unmodified Taq DNA polymerase.
16. The mutant Taq DNA polymerase of claim 12, wherein the enhanced template discrimination activity comprises enhanced 3'-mismatch discrimination, wherein an average .DELTA..DELTA.Cq is at least about 5.0 when the mutant Taq DNA polymerase is evaluated for enhanced 3'-mismatch discrimination by allele-specific PCR assay.
17. The mutant Taq DNA polymerase of claim 12, wherein the enhanced template discrimination activity comprises enhanced 3'-nucleotide discrimination, wherein an average .DELTA..DELTA.Cq is at least about 3.0 when the mutant Taq DNA polymerase is evaluated for enhanced 3'-nucleotide discrimination by quantitative PCR.
18. The mutant Taq DNA polymerase of claim 12, wherein the enhanced template discrimination activity comprises enhanced 3'-mismatch discrimination, wherein an average .DELTA..DELTA.Cq is at least about 1.0 when the mutant Taq DNA polymerase is evaluated for enhanced 3'-mismatch discrimination by rhPCR with an RDDDDx blocked-cleavable rhPCR primer.
19. The mutant Taq DNA polymerase of claim 12, wherein the enhanced template discrimination activity comprises enhanced 3'-mismatch discrimination, wherein an average .DELTA..DELTA.Cq is at least about 0.60 when the mutant Taq DNA polymerase is evaluated for enhanced 3'-mismatch discrimination by rhPCR with an RDxxD blocked-cleavable rhPCR primer.
20. The mutant Taq DNA polymerase of claim 12, wherein the enhanced template discrimination activity comprises enhanced 3'-mismatch discrimination by rhPCR SNP discrimination assay, wherein an average .DELTA..DELTA.Cq is at least about 1.0 when the mutant Taq DNA polymerase is evaluated for enhanced 3'-mismatch discrimination by rhPCR SNP discrimination assay of the SMAD7 gene NM_005904, C/T SNP, rs4939827) with RDDDDx blocked-cleavable rhPCR primers consisting of SEQ ID NOs:76 and 77.
21. The mutant Taq DNA polymerase of claim 12, wherein the enhanced template discrimination activity comprises enhanced 3'-mismatch discrimination by rhPCR SNP discrimination assay, wherein an .DELTA..DELTA.Cq is at least about 3.5 when the mutant Taq DNA polymerase is evaluated for enhanced 3'-mismatch discrimination by rhPCR SNP discrimination assay of the SMAD7 gene NM_005904, C/T SNP, rs4939827) with RDxxD blocked-cleavable rhPCR primers consisting of SEQ ID NOs:78 and 79.
22. The mutant Taq DNA polymerase of claim 12, wherein the enhanced template discrimination activity comprises enhanced 3'-mismatch discrimination by rhPCR SNP discrimination assay, wherein an .DELTA..DELTA.Cq is at least about 15.0 when the mutant Taq DNA polymerase is evaluated for enhanced 3'-mismatch discrimination by rhPCR SNP discrimination assay of the SMAD7 gene NM_005904, C/T SNP, rs4939827) with RDxxD blocked-cleavable rhPCR primers consisting of SEQ ID NOs:78 and 79.
23. The mutant Taq DNA polymerase of claim 12, wherein the enhanced template discrimination activity comprises enhanced rare allele discrimination, wherein the enhanced rare allele discrimination is at least 1:10,000 when the mutant Taq DNA polymerase is evaluated by rhPCR SNP discrimination assay of the SMAD7 gene NM_005904, C/T SNP, rs4939827) having a .DELTA.Cq of at least 3.0 with RDxxD blocked-cleavable rhPCR primers consisting of SEQ ID NOs:78 and 79.
24. A kit for producing an extended primer, comprising: at least one container providing a mutant DNA polymerase according to claim 1.
25. The kit according to claim 24, further comprising one or more additional containers selected from the group consisting of: (a) a container providing a primer hybridizable, under primer extension conditions, to a predetermined polynucleotide template; (b) a container providing nucleoside triphosphates; and (c) a container providing a buffer suitable for primer extension.
26. The kit according to claim 24, further comprising one or more additional containers selected from the group consisting of (a) a container containing a blocked-cleavable primer and (b) a container containing RNase H2.
27. A reaction mixture comprising a mutant DNA polymerase according to claim 1, at least one primer, a polynucleotide template, and nucleoside triphosphates.
28. The reaction mixture according to claim 27, wherein the at least one primer comprises a blocked-cleavable primer.
29. The reaction mixture according to claim 27, further comprising RNase H2.
30. A method for performing rhPCR, comprising performing primer extension with a mutant DNA polymerase of claim 1.
31. A method for performing rhPCR, comprising performing primer extension with a mutant Taq DNA polymerase of claim 12.
32. A mutant Taq DNA polymerase consisting of an amino acid sequence selected from a group consisting of SEQ ID NO:83, SEQ ID NO:85, SEQ ID NO:89, SEQ ID NO:147, SEQ ID NO:149, SEQ ID NO:155, SEQ ID NO:151, SEQ ID NO:153, SEQ ID NO:157, SEQ ID NO:159, SEQ ID NO:161, SEQ ID NO: 172, SEQ ID NO: 174, SEQ ID NO: 176, SEQ ID NO: 178, and SEQ ID NO: 180.
Description:
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a divisional of U.S. patent application Ser. No. 15/386,631, filed Dec. 21, 2016, which is a divisional of U.S. patent application Ser. No. 14/542,539, filed Nov. 14, 2014, which claims benefit of priority under 35 U.S.C. 119 to U.S. provisional patent application Ser. No. 61/904,335, filed Nov. 14, 2013, and entitled "DNA POLYMERASE MUTANTS HAVING ENHANCED TEMPLATE DISCRIMINATION ACTIVITY," the contents of which are herein incorporated by reference in its entirety.
FIELD
[0002] This invention relates to mutant DNA polymerases having enhanced primer and/or template discrimination activities and uses of the same for polymerase-based assays for genetic diagnostic analysis.
SEQUENCE LISTING
[0003] The instant application contains a Sequence Listing that has been submitted in ASCII format via EFS-Web and is hereby incorporated by reference in its entirety. The ASCII copy, created on Sep. 29, 2021, is named IDT01-003-US-DIV2_ST25.txt, and is 362,522 bytes in size.
BACKGROUND
[0004] The ability to accurately diagnose a given genetic condition and to predictably treat a genetically-based disorder requires reliable methods for accurately determining genetic sequence information. Many genetically-based disorders are associated with single nucleotide polymorphisms (SNP's) in protein coding genes. The presence of SNP's associated with a genetically-based disorder, such as a cancer, can be difficult to detect owing to the small numbers of genetically altered cells in the population that encode the allele(s) ("rare alleles").
[0005] Polymerase-based assays, such as the polymerase chain reaction (PCR), have important impact and widespread use in genetic diagnostics and molecular medicine. Polymerases synthesize DNA sequences by the addition of nucleotides to the 3' end of a short oligonucleotide (abbreviated to "primer" in the following). The primer is hybridized to the single stranded sequence that is going to be amplified ("template"). DNA polymerases catalyze formation of a phosphodiester bond between the 3'-oxygen at the 3'-terminus of the primer and the incoming deoxynucleoside triphosphate ("dNTP"). This chemical reaction ("primer extension") adds a nucleotide to the primer (e.g., to the nascent growing DNA chain). Primer extension is base specific, in that the deoxynucleoside triphosphate that is complementary to the base in the template is added to the primer. The fidelity of DNA polymerase enzymes is very high and the rate of mutations introduced into the replicated DNA strand is low; however, the precise error rate varies between different DNA polymerase enzymes and these rates have been well characterized. The extension reaction can be repeated until the end of the template is reached.
[0006] The majority of polymerase-based assays for detecting SNP's rely upon having the polymerase enzyme discriminate between at least two different substrates. The first substrate contains the desired SNP that is to be detected; the second substrate contains the normal nucleotide that is not to be detected. Polymerase-based discrimination can be achieved by providing the first substrate as the preferred polymerase-competent substrate for assay. This discrimination can be maximized to the extent that the first substrate is the only polymerase-competent substrate present for assay.
[0007] Many strategies are known in the art for establishing conditions that favor polymerase-based discrimination among substrates having minimal nucleotide differences, such as those containing only single nucleotide differences. One strategy relies on a polymerase's inability to efficiently initiate synthesis on substrates lacking a 3'-paired nucleotide on the primer. An allele-specific primer design is a primer in which the 3'-nucleotide forms a perfect match with the complementary base at the location containing the SNP-containing allele and forms a mismatched pairing when annealed to an allele lacking the SNP. The primer:template for the SNP-containing allele serves as the preferred polymerase-competent substrate since the polymerase can efficiently initiate primed synthesis from such substrates. Examples of these strategies are described in Chen et al., "Single nucleotide polymorphism genotyping: biochemistry, protocol, cost and throughput" Pharmacogenomics J. 3(2):77-96 (2003); Kwok et al., "Detection of single nucleotide polymorphisms" Curr. Issues Mol. Biol. 5(2):43-60 (April 2003); Shi, "Technologies for individual genotyping: detection of genetic polymorphisms in drug targets and disease genes" Am. J. Pharmacogenomics 2(3):197-205 (2002); and Kwok, "Methods for genotyping single nucleotide polymorphisms" Annu. Rev. Genomics Hum. Genet. 2:235-58 (2001). A strategy to improve selectivity for this class of allele-specific PCR primers is to introduce a second mutation at the penultimate base, next to the 3'-terminal nucleotide of the primer (i.e., next to the SNP site). As before, the 3'-terminal residue will either be a match or mismatch to the base under interrogation in the sample nucleic acid (SNP), but now the primer will either have two adjacent mismatches to the target (both 3'-terminal and penultimate base) or a single mismatch to the target (at only the penultimate base, with the 3'-terminal base being a match). See, for example, Newton et al., "Analysis of any point mutation in DNA. The amplification refractory mutation systems (ARMS)" Nucleic Acids Res. 17(7):2503-15 (1989). Yet another strategy to improve selectivity for this class of allele-specific PCR primers is to employ a chemically modified nucleic acid residue at the 3'-end of the primer, such as a locked nucleic acid (LNA), which reduces the ability of DNA polymerase to initiate DNA synthesis from a 3'-terminal mismatch. See, for example, Latorra et al., "SNP genotyping using 3' locked nucleic acid (LNA) primers" Human Mut. 22(1):79-85 (2003).
[0008] Template substrate discrimination can be enhanced in polymerase-based assays by requiring a second nucleic acid enzyme catalyze formation of one or more primers for use in the polymerase-based assay. In one such assay, the ligase chain reaction assay, a DNA ligase is used with a polymerase to detect a template containing a SNP. Since polymerase-based assays require primers having a minimum length to hybridize to the template substrate, a DNA ligase can be used to generate polymerase primers from sub-optimal length oligonucleotides. The assay relies upon hybridizing two probes directly over the SNP polymorphic site, whereby ligation can occur if the probes are identical to the target DNA. Two probes are designed; an allele-specific probe which hybridizes to the target DNA so that its 3' base is situated directly over the SNP nucleotide and a second probe that hybridizes the template downstream in the complementary strand of the SNP polymorphic site providing a 5' end for the ligation reaction. If the allele-specific probe matches the target DNA, it will fully hybridize to the target DNA and ligation can occur. Ligation does not generally occur in the presence of a mismatched 3'-base. Once the oligonucleotide product is formed, it can serve as a primer or as a template for polymerase-based assays. Examples of this strategy are described in Barany F. "Genetic disease detection and DNA amplification using cloned thermostable ligase." Proc Natl Acad Sci USA. 1991 Jan. 1; 88(1):189-93 and Wiedmann M., Wilson W. J., Czajka J., Luo J., Barany F., Batt C. A. "Ligase chain reaction (LCR)--overview and applications." PCR Methods and Applications 1994 Feb; 3(4):S51-64.
[0009] Since a polymerase-competent substrate requires a primer:template having an available 3'-hydroxyl group on the primer, another strategy known in the art, RNase H-based PCR (rhPCR), can be used for improving polymerase-based discrimination. The rhPCR method makes use of RNase H enzymes to convert a primer lacking a 3'-hydroxyl group ("blocked primer") or a primer that is otherwise disabled and cannot support PCR to a primer containing a 3'-hydroxyl group ("unblocked primer") that can support PCR. A blocked primer in rhPCR includes an oligonucleotide having a blocked 3'-end or other modification which prevents either priming or template function of the oligonucleotide and an internal RNA residue, which serves as a cleavage site. Type II RNase H recognizes annealed primer:template duplexes containing these blocked primers and cleaves the primer strand 5' of the RNA residue to generate a 3'-hydroxyl group at the adjacent DNA residue. Since RNase H enzymes do not cleave substrates containing an unpaired RNA reside at a mismatched site, allele-specific template discrimination can be achieved by placement of the RNA residue at the location complementary to the SNP on the selected allele template. The resultant Type II RNase H cleavage product can serve as a polymerase competent substrate. Examples of this enzyme cleaving strategy, similar RNase H strategies, and methods of blocking primer extension or inhibiting template function and thereby disabling PCR are described in U.S. Pat. No. 7,112,406 to Behlke et al., entitled POLYNOMIAL AMPLIFICATION OF NUCLEIC ACIDS, U.S. Pat. No. 5,763,181 to Han et al., entitled CONTINOUS FLUOROMETRIC ASSAY FOR DETECTING NUCLEIC ACID CLEAVAGE, U.S. Pat. No. 7,135,291 to Sagawa et al., entitled METHOD OF DETECTING NUCLEOTIDE POLYMORPHISM; U.S. Pat. App. No. 20090068643 to Behlke and Walder, entitled DUAL FUNCTION PRIMERS FOR AMPLIFYING DNA AND METHODS OF USE; and U.S. Pat. App. No. 20100167353 to Walder et al., entitled RNASE H-BASED ASSAYS UTILIZING MODIFIED RNA MONOMERS.
[0010] The field has focused on substrate-based approaches, such as those exemplified above, for improving detection of genetic differences and rare alleles. Yet the sensitivity of polymerase-based assays remains limited by the formation of non-specific amplification products that arise from ectopic or aberrant primer-related extension products independent of the desired templates. The inherent reactivity of the polymerase appears largely responsible for producing such artifacts during amplification.
[0011] Any further improvements in mismatch discrimination may therefore require a modified polymerase enzyme endowed with inherently better 3'-nucleotide discrimination when used with one or more of the described strategies. A modified polymerase enzyme having activity differing from the unmodified form can be prepared by chemical or enzymatic modification of the protein or mutagenesis of corresponding gene that encodes the protein. The latter approach is generally preferred owing to the fact that genetically altered genes encoding a given mutant protein can be stably maintained, expressed and purified to yield enzyme preparations having well-characterized properties.
[0012] While an unbiased mutagenesis strategy can be used to generate a library of mutant polymerase genes, this approach has certain disadvantages. Many millions of mutant enzymes must be screened for activity and success is often dependent upon the chance that effective mutations are present in the limited pool generated by random mutagenesis. Direct genetic selection methods are not sufficiently sensitive for identifying mutations that pertain to secondary functions falling outside of an essential polymerase activity. The vast majority of mutant polymerase genes in a positive selection assay will likely encode protein that retains the functional attributes of the normal polymerase enzyme. Thus, secondary screening procedures that use biochemical assays must be done to identify whether any mutant polymerases have the desired activity. Notwithstanding the technical difficulties of setting up the initial selection process, the attendant costs associated with performing the secondary screens using biochemical assays is prohibitive if more than one hundred clones need to be purified and assayed.
[0013] An alternative approach is to apply a biased mutagenesis strategy that is specifically targeted to a preselected region of a gene implicated in function. In this approach, one first identifies genetic regions by a selection method. One such selection method is a comparative phylogenetic analysis of a particular gene that is required for organisms of diverse origins. The principle of comparative phylogenetic analysis is premised on the hypothesis that diverse organisms will not share protein coding sequences in essential genes unless those sequences are evolutionary constrained for reasons related to essential protein function.
[0014] A phylogenetic comparative analysis of genes encoding DNA polymerases can provide insights about possible amino acid residues important to polymerase functions. The overall folding pattern of DNA polymerases resembles the human right hand and contains three distinct subdomains of palm, fingers, and thumb. (See, for example. Beese et al., Science 260:352-355, 1993; Patel et al., Biochemistry 34:5351-5363, 1995). While the structure of the fingers and thumb subdomains vary greatly between polymerases that differ in size and in cellular functions, the catalytic palm subdomains are all superimposable. For example, motif A, which interacts with the incoming dNTP and stabilizes the transition state during chemical catalysis, is superimposable with a root mean deviation of about one .ANG.ngstrom among mammalian pol .alpha. and prokaryotic pol I family DNA polymerases (Wang et al., Cell 89:1087-1099, 1997). Motif A begins structurally at an antiparallel .beta.-strand containing predominantly hydrophobic residues and continues to an .alpha.-helix. The primary amino acid sequence of DNA polymerase active sites is exceptionally conserved.
[0015] In addition to being well-conserved, the active site of DNA polymerases has also been shown to be relatively mutable, capable of accommodating certain amino acid substitutions without reducing DNA polymerase activity significantly. (See, e.g., U.S. Pat. No. 6,602,695). Such mutant DNA polymerases can offer various selective advantages in, e.g., diagnostic and research applications comprising nucleic acid synthesis reactions. We identify mutations in protein sequence using the single-letter amino acid codes and an integer number that indicates location of the mutation from the beginning of the protein sequence. The single-letter amino acids codes are well known in the art, e.g., Stryer et al., Biochemistry, 5.sup.th ed., Freeman and Company (2002). As an example, aspartic acid ("D") is changed to glycine ("G") in D580G mutant and the change is located 580 amino acids from the beginning of the protein sequence.
[0016] Reichert et al. conducted a comparative phylogenetic analysis of thermoactive DNA polymerases from thermophilic bacteria, wherein the protein coding sequences of DNA Polymerase I enzymes were aligned for thirteen phylogenetically distinct species. The analysis revealed that eight amino acid positions within a 15-amino acid long motif located at amino acid positions 645-685 (in reference to Thermus sp. Z05 DNA polymerase ("Z05 DNA Polymerase") might tolerate alterations without compromising core enzyme function.
[0017] Comparative phylogenetic analysis does not provide specific functional information pertaining non-conserved amino acids, other than to suggest that non-conserved amino acids are not likely critical to core enzyme functions. For that reason, specific mutations were introduced into a recombinant gene encoding a variant of the Z05 DNA Polymerase ("Z05 D580G polymerase") and the resultant Z05 D580G polymerase mutants were screened for their ability to provide a reduced ability to extend an oligonucleotide primer with a 3'-mismatch to a template. Reichert et al. found that one such mutant, Z05 D580G V667E polymerase, displayed better discrimination (.about.2-fold) than the parental Z05 D580G polymerase. See U.S. Pat. App. No. 2012/0015405 to Reichert et al., entitled DNA POLYMERASES WITH INCREASED 3'-MISMATCH DISCRIMINATION.
[0018] The comparative phylogenetic analysis has limitations with respect to identifying DNA polymerase activities that display improved 3'-nucleotide discrimination. This is due to the fact that all DNA polymerases of a given enzyme class are confronted with similar template substrates and nucleotide pools across the spectrum of phylogenetically diverse organisms. Given the fact that all DNA polymerases must display 3'-nucleotide mismatch discrimination to preserve high fidelity replication of daughter template strands, it is not surprising that one can apply comparative phylogenetic analysis to identify possible amino acid positions that might affect mismatch discrimination. For template substrates having different 3'-end modifications that are presented to a polymerase only in a biochemical assay, such as those used in several PCR-based assays for rare allele detection, there is a need for identifying DNA polymerases having improved 3'-nucleotide discrimination.
[0019] Taq DNA Polymerase is an enzyme that was discovered in Thermus aquaticus bacterium (Chien, A., et al., J Bacteriol. 1976, 127: 1550-1557). The enzyme is classified as deoxyribonucleic acid polymerase, class I (enzyme code, EC 2.7.7.7). Its catalytic activity is to amplify DNA sequences. The peptide and gene sequences of Taq DNA polymerase enzyme isolated from nature are well known in prior art and are listed in Table 1 (Lawyer, F. C., et al., J. Biol. Chem. 1989, 264: 6427-6437; Genbank database ID J04639.1).
TABLE-US-00001 TABLE 1 DNA and amino acid sequence of native Taq DNA polymerase. Type Sequence Protein MRGMLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKSLLKALKED sequence GDAVIVVFDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIKELVDLLGLARLEVPGY (N to C EADDVLASLAKKAEKEGYEVRILTADKDLYQLLSDRIHVLHPEGYLITPAWLWEKYGL terminus) RPDQWADYRALTGDESDNLPGVKGIGEKTARKLLEEWGSLEALLKNLDRLKPAIREKI [SEQ ID NO: 1] LAHMDDLKLSWDLAKVRTDLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLES PKALEEAPWPPPEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEA RGLLAKDLSVLALREGLGLPPGDDPMLLAYLLDPSNTTPEGVARRYGGEWTEEAGERA ALSERLFANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVRLDVAYLRALSLEVA EETARLEAEVERLAGHPFNLNSRDQLERVLFDELGLPAIGKTEKTGKRSTSAAVLEAL REAHPIVEKILQYRELTKLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPN LQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQIELRVLAHLSGDENLIRVFQEGRDI HTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQAFIERY FQSFPKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQ GTAADLMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYP LAVPLEVEVGIGEDWLSAKE DNA sequence aagctcagat ctacctgcct gagggcgtcc ggttccagct ggcccttccc (5' to 3') gagggggaga gggaggcgtt tctaaaagcc cttcaggacg ctacccgggg [SEQ ID NO: 2] gcgggtggtg gaagggtaac atgaggggga tgctgcccct ctttgagccc aagggccggg tcctcctggt ggacggccac cacctggcct accgcacctt ccacgccctg aagggcctca ccaccagccg gggggagccg gtgcaggcgg tctacggctt cgccaagagc ctcctcaagg ccctcaagga ggacggggac gcggtgatcg tggtctttga cgccaaggcc ccctccttcc gccacgaggc ctacgggggg tacaaggcgg gccgggcccc cacgccggag gactttcccc ggcaactcgc cctcatcaag gagctggtgg acctcctggg gctggcgcgc ctcgaggtcc cgggctacga ggcggacgac gtcctggcca gcctggccaa gaaggcggaa aaggagggct acgaggtccg catcctcacc gccgacaaag acctttacca gctcctttcc gaccgcatcc acgtcctcca ccccgagggg tacctcatca ccccggcctg gctttgggaa aagtacggcc tgaggcccga ccagtgggcc gactaccggg ccctgaccgg ggacgagtcc gacaaccttc ccggggtcaa gggcatcggg gagaagacgg cgaggaagct tctggaggag tgggggagcc tggaagccct cctcaagaac ctggaccggc tgaagcccgc catccgggag aagatcctgg cccacatgga cgatctgaag ctctcctggg acctggccaa ggtgcgcacc gacctgcccc tggaggtgga cttcgccaaa aggcgggagc ccgaccggga gaggcttagg gcctttctgg agaggcttga gtttggcagc ctcctccacg agttcggcct tctggaaagc cccaaggccc tggaggaggc cccctggccc ccgccggaag gggccttcgt gggctttgtg ctttcccgca aggagcccat gtgggccgat cttctggccc tggccgccgc cagggggggc cgggtccacc gggcccccga gccttataaa gccctcaggg acctgaagga ggcgcggggg cttctcgcca aagacctgag cgttctggcc ctgagggaag gccttggcct cccgcccggc gacgacccca tgctcctcgc ctacctcctg gacccttcca acaccacccc cgagggggtg gcccggcgct acggcgggga gtggacggag gaggcggggg agcgggccgc cctttccgag aggctcttcg ccaacctgtg ggggaggctt gagggggagg agaggctcct ttggctttac cgggaggtgg agaggcccct ttccgctgtc ctggcccaca tggaggccac gggggtgcgc ctggacgtgg cctatctcag ggccttgtcc ctggaggtgg ccgaggagat cgcccgcctc gaggccgagg tcttccgcct ggccggccac cccttcaacc tcaactcccg ggaccagctg gaaagggtcc tctttgacga gctagggctt cccgccatcg gcaagacgga gaagaccggc aagcgctcca ccagcgccgc cgtcctggag gccctccgcg aggcccaccc catcgtggag aagatcctgc agtaccggga gctcaccaag ctgaagagca cctacattga ccccttgccg gacctcatcc accccaggac gggccgcctc cacacccgct tcaaccagac ggccacggcc acgggcaggc taagtagctc cgatcccaac ctccagaaca tccccgtccg caccccgctt gggcagagga tccgccgggc cttcatcgcc gaggaggggt ggctattggt ggccctggac tatagccaga tagagctcag ggtgctggcc cacctctccg gcgacgagaa cctgatccgg gtcttccagg aggggcggga catccacacg gagaccgcca gctggatgtt cggcgtcccc cgggaggccg tggaccccct gatgcgccgg gcggccaaga ccatcaactt cggggtcctc tacggcatgt cggcccaccg cctctcccag gagctagcca tcccttacga ggaggcccag gccttcattg agcgctactt tcagagcttc cccaaggtgc gggcctggat tgagaagacc ctggaggagg gcaggaggcg ggggtacgtg gagaccctct tcggccgccg ccgctacgtg ccagacctag aggcccgggt gaagagcgtg cgggaggcgg ccgagcgcat ggccttcaac atgcccgtcc agggcaccgc cgccgacctc atgaagctgg ctatggtgaa gctcttcccc aggctggagg aaatgggggc caggatgctc cttcaggtcc acgacgagct ggtcctcgag gccccaaaag agagggcgga ggccgtggcc cggctggcca aggaggtcat ggagggggtg tatcccctgg ccgtgcccct ggaggtggag gtggggatag gggaggactg gctctccgcc aaggagtgat accacc
[0020] Taq DNA polymerase extends primers composed from deoxyribonucleotides, however, some chemical modifications of the primer are tolerated and do not decrease much the efficiency of primer extension reactions. For example, when the nucleotide at 3' primer terminus is ribonucleotide instead of deoxyribonucleotide, Taq DNA polymerase can extend such primer with significant efficiency and speed.
BRIEF SUMMARY OF THE INVENTION
[0021] In one aspect, a mutant Taq DNA polymerase having an enhanced template discrimination activity compared with an unmodified Taq DNA polymerase is provided. The amino acid sequence of the mutant Taq DNA polymerase includes at least one substitution at residue positions 783 or 784 of the unmodified Taq DNA polymerase.
[0022] In another aspect, a mutant thermostable DNA polymerase having an enhanced template discrimination activity compared with an unmodified thermostable DNA polymerase is provided. The amino acid sequence of the mutant thermostable DNA polymerase includes at least one substitution at residue positions orthologous to positions 783 or 784 of the unmodified Taq DNA polymerase.
[0023] In another aspect, a mutant DNA polymerase having an enhanced template discrimination activity compared with the corresponding unmodified DNA polymerase is provided, wherein the mutant DNA polymerase includes a thermostable polymerase. The amino acid sequence of the mutant DNA polymerase peptide includes at least one substitution at residue positions orthologous to positions 783 or 784 of the unmodified Taq DNA polymerase, wherein the mutant DNA polymerase is selected from the group of species consisting of E. coli, Eubacterium siraeum, Clostridium leptum, Enterococcus, Facklamia hominis, Bacillus anthracis and Bacillus cereus ATCC 10987.
[0024] In another aspect, a mutant non-VH-related DNA polymerase having an enhanced template discrimination activity compared with its unmodified non-VH-related DNA polymerase counterpart is provided, wherein the mutant non-VH-related DNA polymerase includes a thermostable polymerase. The amino acid sequence of the mutant non-VH-related DNA polymerase includes at least one substitution at residue positions orthologous to reside positions 783 and/or 784 of the unmodified Taq DNA polymerase.
[0025] In another aspect, recombinant nucleic acid encoding any of the mutant DNA polymerases of described above is provided.
[0026] In another aspect, a method for conducting primer extension is provided. The method includes the step of contacting a mutant DNA polymerase as described above with a primer, a polynucleotide template, and nucleoside triphosphates under conditions suitable for a primer extension method, thereby producing an extended primer.
[0027] In another aspect, a kit for producing an extended primer, comprising: at least one container providing a mutant DNA polymerase as described above.
[0028] In another aspect, a reaction mixture is provided that includes a mutant DNA polymerase as described above, at least one primer, a polynucleotide template, and nucleoside triphosphates.
[0029] In another aspect, a method for performing rhPCR is provided that includes the step of performing primer extension with a mutant DNA polymerase as described above.
[0030] In another aspect, a mutant Taq DNA polymerase having an enhanced template discrimination activity compared with an unmodified Taq DNA polymerase is provided. The amino acid sequence of the mutant Taq DNA polymerase comprises one of following selected substitutions: (1) A661E; I665W; F667L [SEQ ID NO:87]; (2) V783F [SEQ ID NO:83]; (3) H784Q [SEQ ID NO:85]; (4) V783L; H784Q [SEQ ID NO:89]; (5) H784A [SEQ ID NO:147]; (6) H784S [SEQ ID NO:149]; (7) H784I [SEQ ID NO:155]; (8) H784T [SEQ ID NO:151], (9) H784V [SEQ ID NO:153]; (10) H784M [SEQ ID NO:157]; (11) H784F [SEQ ID NO:159]; or (12) H784Y [SEQ ID NO:161].
[0031] In another aspect, a mutant Taq DNA polymerase having a deleted 5' exonuclease domain (KlenTaq) and containing additional mutations, having an enhanced template discrimination activity compared with an unmodified Taq DNA polymerase is provided. The amino acid sequence of the mutant Taq DNA polymerase comprises one of following selected substitutions: (1) A661E; 1665W; F667L [SEQ ID NO: 170]; (2) V783F [SEQ ID NO: 172]; (3) H784Q [SEQ ID NO: 174]; (4) V783L; H784Q [SEQ ID NO: 176]; (5) H784S [SEQ ID NO: 178]; or (6) H784Y [SEQ ID NO: 180].
BRIEF DESCRIPTION OF THE DRAWINGS
[0032] FIG. 1 depicts a model of the active site constructed from the known Taq DNA polymerase PDB ID 2KTQ crystal structure. The polymerase backbone is displayed using ribbons. The "C2'" label indicates the 2' carbon atom at the primer terminal nucleotide. The dNTP is binding in the pocket above the primer.
[0033] FIG. 2A shows gel images depicting purified protein for the Taq DNA polymerase mutants and wild type Taq DNA polymerase. Legend: Aliquots of purified recombinant proteins were separated by polyacrylamide gel electrophoresis (PAGE) and stained with Coomassie Brilliant Blue. The Marker lane (M) is indicated, showing protein size markers identified in kilodaltons (kDa).
[0034] FIG. 2B shows gel images depicting purified protein for the Taq DNA polymerase mutants and wild type Taq DNA polymerase. Legend as in FIG. 2A.
[0035] FIG. 2C shows gel images depicting purified protein for the Taq DNA polymerase mutants and wild type Taq DNA polymerase. Legend as in FIG. 2A.
[0036] FIG. 2D shows gel images depicting purified protein for the Taq DNA polymerase mutants and wild type Taq DNA polymerase. Legend as in FIG. 2A.
[0037] FIG. 3A shows graphical representations of the allele-specific PCR (AS-PCR) data from Tables 10 and 31 for wild type OptiTaq (sub-panel (i)), Mutant ID 2 (sub-panel (ii)) and Mutant ID 3 (sub-panel (iii)). Legend: Average .DELTA.Cq values obtained from AS-PCR reactions plus/minus standard deviation (error bars) are shown (.DELTA.Cq=Cq mismatch-Cq match) comparing mismatch discrimination of the wild-type OptiTaq with the mutant Taq DNA polymerases. All possible pairwise mismatch base combinations are included. The base identity of the SNP site in the target nucleic acid is indicated on the X-axis (A, G, C, T) along with the 3'-DNA residue of the AS-PCR reverse primer employed (dA, dG, dC, dT).
[0038] FIG. 3B shows graphical representations of the allele-specific PCR (AS-PCR) data from Tables 10 and 31 for wild type OptiTaq (sub-panel (i)), Mutant ID 10 (sub-panel (ii)) and Mutant ID 18 (sub-panel (iii)). Legend as in FIG. 3A.
[0039] FIG. 3C shows graphical representations of the allele-specific PCR (AS-PCR) data from Tables 10 and 31 for wild type OptiTaq (sub-panel (i)), Mutant ID 3 (sub-panel (ii)) and Mutant ID 20 (sub-panel (iii)). Legend as in FIG. 3A.
[0040] FIG. 3D shows graphical representations of the allele-specific PCR (AS-PCR) data from Tables 10 and 31 for wild type OptiTaq (sub-panel (i)), Mutant ID21 (sub-panel (ii)) and Mutant ID 22 (sub-panel (iii)). Legend as in FIG. 3A.
[0041] FIG. 3E. shows graphical representations of the allele-specific PCR (AS-PCR) data from Tables 10 and 31 for wild type OptiTaq (sub-panel (i)), Mutant ID 24 (sub-panel (ii)) and Mutant ID 26 (sub-panel (iii)). Legend as in FIG. 3A.
[0042] FIG. 3F shows graphical representations of the allele-specific PCR (AS-PCR) data from Tables 10 and 31 for wild type OptiTaq (sub-panel (i)), Mutant ID 27 (sub-panel (ii)) and Mutant ID 29 (sub-panel (iii)). Legend as in FIG. 3A.
[0043] FIG. 3G shows graphical representations of the allele-specific PCR (AS-PCR) data from Tables 10 and 31 for wild type OptiTaq (sub-panel (i)) and Mutant ID 30 (sub-panel (ii)). Legend as in FIG. 3A.
[0044] FIG. 4 shows a graphical representation of the .DELTA.Cq values (Table 13) obtained from comparing qPCR results using primers ending with a 3'-RNA residue and primers ending with a 3'-DNA residue for wild type OptiTaq with four mutant Taq DNA polymerases, where .DELTA.Cq=Cq 3'-RNA-Cq 3'-DNA; rA is compared with dA, rC is compared with dC, rG is compared with dG, and rU is compared with dT. Identity of each DNA polymerase studied is shown on the X-axis.
[0045] FIG. 5A shows graphical representations of the .DELTA.Cq values (Tables 20 and 34) obtained from comparing mismatch discrimination between wild type OptiTaq with Mutant ID 2, Mutant ID 3, Mutant ID 10, and Mutant ID 18 Taq DNA polymerases detecting a human genomic DNA SNP in the SMAD7 gene (NM_005904, C/T SNP, rs4939827) using Gen1 RDDDDx blocked-cleavable primers in a quantitative rhPCR assay. .DELTA.Cq=[Cq mismatch-Cq match]. Legend: Identity of each DNA polymerase studied is shown on the X-axis. The RDDDDx blocked-cleavable primer contained either a rC or rU residue as the cleavable base, specific for the "C" or "T" allele, as indicated.
[0046] FIG. 5B shows graphical representations of the .DELTA.Cq values (Tables 20 and 34) obtained from comparing mismatch discrimination between wild type OptiTaq with Mutant ID 3, Mutant ID 20, Mutant ID 21, Mutant ID 22, and Mutant ID 24 Taq DNA polymerases detecting a human genomic DNA SNP in the SMAD7 gene (NM_005904, C/T SNP, rs4939827) using Gen1 RDDDDx blocked-cleavable primers in a quantitative rhPCR assay. .DELTA.Cq=[Cq mismatch-Cq match]. Legend as in FIG. 5A.
[0047] FIG. 5C shows graphical representations of the .DELTA.Cq values (Tables 20 and 34) obtained from comparing mismatch discrimination between wild type OptiTaq with Mutant ID 3, Mutant ID 26, Mutant ID 27, Mutant ID 29, and Mutant ID 30 Taq DNA polymerases detecting a human genomic DNA SNP in the SMAD7 gene (NM_005904, C/T SNP, rs4939827) using Gen1 RDDDDx blocked-cleavable primers in a quantitative rhPCR assay. .DELTA.Cq=[Cq mismatch-Cq match]. Legend as in FIG. 5A.
[0048] FIG. 6A shows a graphical representation of the .DELTA.Cq values (Tables 21 and 35) obtained from comparing mismatch discrimination between wild type OptiTaq with Mutant ID 2, Mutant ID 3, Mutant ID 10, and Mutant ID 18 Taq DNA polymerases detecting a human genomic DNA SNP in the SMAD7 gene (NM_005904, C/T SNP, rs4939827) using Gen2 RDxxD blocked-cleavable primers in a quantitative rhPCR assay. .DELTA.Cq=[Cq mismatch-Cq match]. Legend: Identity of each DNA polymerase studied is shown on the X-axis. The RDxxD blocked-cleavable primer contained either a rC or rU residue as the cleavable base, specific for the "C" or "T" allele, as indicated.
[0049] FIG. 6B shows a graphical representation of the .DELTA.Cq values (Tables 21 and 35) obtained from comparing mismatch discrimination between wild type OptiTaq with Mutant ID 3, Mutant ID 20, Mutant ID 21, Mutant ID 22, and Mutant ID 24 Taq DNA polymerases detecting a human genomic DNA SNP in the SMAD7 gene (NM_005904, C/T SNP, rs4939827) using Gen2 RDxxD blocked-cleavable primers in a quantitative rhPCR assay. .DELTA.Cq=[Cq mismatch-Cq match]. Legend as in FIG. 6A.
[0050] FIG. 6C shows a graphical representation of the .DELTA.Cq values (Tables 21 and 35) obtained from comparing mismatch discrimination between wild type OptiTaq with Mutant ID 3, Mutant ID 26, Mutant ID 27, Mutant ID 29, and Mutant ID 30 Taq DNA polymerases detecting a human genomic DNA SNP in the SMAD7 gene (NM_005904, C/T SNP, rs4939827) using Gen2 RDxxD blocked-cleavable primers in a quantitative rhPCR assay. .DELTA.Cq=[Cq mismatch-Cq match]. Legend as in FIG. 6A.
[0051] FIG. 7A shows graphical representations of the allele-specific PCR (AS-PCR) data from Tables 10 and 31 for OptiTaq KlenTaq (Mutant ID 37) (sub-panel (i)), Mutant ID 38 (sub-panel (ii)) and Mutant ID 39 (sub-panel (iii)). Legend: Average .DELTA.Cq values obtained from AS-PCR reactions plus/minus standard deviation (error bars) are shown (.DELTA.Cq=Cq mismatch-Cq match) comparing mismatch discrimination of the wild-type OptiTaq with four mutant Taq DNA polymerases. All possible pairwise mismatch base combinations are included. The base identity of the SNP site in the target nucleic acid is indicated on the X-axis (A, G, C, T) along with the 3'-DNA residue of the AS-PCR reverse primer employed (dA, dG, dC, dT).
[0052] FIG. 7B. shows graphical representations of the allele-specific PCR (AS-PCR) data from Tables 10 and 31 for OptiTaq KlenTaq (Mutant ID 37) (sub-panel (i)), Mutant ID 40 (sub-panel (ii)) and Mutant ID 41 (sub-panel (iii)). Legend as in FIG. 7A.
[0053] FIG. 7C. shows graphical representations of the allele-specific PCR (AS-PCR) data from Tables 10 and 31 for OptiTaq KlenTaq (Mutant ID 37) (sub-panel (i)), Mutant ID 42 (sub-panel (ii)) and Mutant ID 43 (sub-panel (iii)). Legend as in FIG. 7A.
DETAILED DESCRIPTION
[0054] The current invention provides novel thermostable DNA polymerases, including specific examples derived from Thermus aquaticus (Taq) DNA polymerase. These polymerases offer improvements to existing methods for nucleic acid amplification, genotyping, and detection of rare alleles. New assay formats comprising the use of these novel thermostable DNA polymerases are also provided.
Definitions
[0055] To aid in understanding the invention, several terms are defined below.
[0056] Terms used herein are intended as "open" terms (for example, the term "including" should be interpreted as "including but not limited to," the term "having" should be interpreted as "having at least," the term "includes" should be interpreted as "includes but is not limited to," etc.).
[0057] The articles "a" and "an" refer to one or to more than one (for example, to at least one) of the grammatical object of the article.
[0058] The terms "about" and "approximately" shall generally mean an acceptable degree of error for the quantity measured given the nature or precision of the measurements. Exemplary degrees of error are within 20-25 percent (%), typically, within 10%, and more typically, within 5% of a given value or range of values.
[0059] Furthermore, in those instances where a convention analogous to "at least one of A,B and C, etc." is used, in general such a construction is intended in the sense of one having ordinary skill in the art would understand the convention (for example, "a system having at least one of A, B and C" would include but not be limited to systems that have A alone, B alone, C alone, A and B together, A and C together, B and C together, and/or A, B, and C together.). It will be further understood by those within the art that virtually any disjunctive word and/or phrase presenting two or more alternative terms, whether in the description or figures, should be understood to contemplate the possibilities of including one of the terms, either of the terms, or both terms. For example, the phrase "A or B" will be understood to include the possibilities of "A" or `B or "A and B."
[0060] All language such as "from," "to," "up to," "at least," "greater than," "less than," and the like, include the number recited and refer to ranges which can subsequently be broken down into sub-ranges.
[0061] A range includes each individual member. Thus, for example, a group having 1-3 members refers to groups having 1, 2, or 3 members. Similarly, a group having 6 members refers to groups having 1, 2, 3, 4, or 6 members, and so forth.
[0062] The modal verb "may" refers to the preferred use or selection of one or more options or choices among the several described embodiments or features contained within the same. Where no options or choices are disclosed regarding a particular embodiment or feature contained in the same, the modal verb "may" refers to an affirmative act regarding how to make or use and aspect of a described embodiment or feature contained in the same, or a definitive decision to use a specific skill regarding a described embodiment or feature contained in the same. In this latter context, the modal verb "may" has the same meaning and connotation as the auxiliary verb "can."
[0063] The term "conventional" or "natural" when referring to nucleic acid bases, nucleoside triphosphates, or nucleotides refers to those which occur naturally in the polynucleotide being described (i.e., for DNA these are dATP, dGTP, dCTP and dTTP). Additionally, dITP, and 7-deaza-dGTP are frequently utilized in place of dGTP and 7-deaza-dATP can be utilized in place of dATP in in vitro DNA synthesis reactions, such as sequencing. Collectively, these may be referred to as dNTPs.
[0064] The term "unconventional" or "modified" when referring to a nucleic acid base, nucleoside, or nucleotide includes modification, derivations, or analogues of conventional bases, nucleosides, or nucleotides that naturally occur in a particular polynucleotide. Certain unconventional nucleotides are modified at the 2' position of the ribose sugar in comparison to conventional dNTPs. Thus, although for RNA the naturally occurring nucleotides are ribonucleotides (i.e., ATP, GTP, CTP, UTP, collectively rNTPs), because these nucleotides have a hydroxyl group at the 2' position of the sugar, which, by comparison is absent in dNTPs, as used herein, ribonucleotides are unconventional nucleotides as substrates for DNA polymerases. As used herein, unconventional nucleotides include, but are not limited to, compounds used as terminators for nucleic acid sequencing. Exemplary terminator compounds include but are not limited to those compounds that have a 2',3' dideoxy structure and are referred to as dideoxynucleoside triphosphates. The dideoxynucleoside triphosphates ddATP, ddTTP, ddCTP and ddGTP are referred to collectively as ddNTPs.
[0065] The term "nucleotide," in addition to referring to the naturally occurring ribonucleotide or deoxyribonucleotide monomers, shall herein be understood to refer to related structural variants thereof, including derivatives and analogs, that are functionally equivalent with respect to the particular context in which the nucleotide is being used (e.g., hybridization to a complementary base), unless the context clearly indicates otherwise.
[0066] The terms "nucleic acid" and "oligonucleotide," as used herein, refer to polydeoxyribonucleotides (containing 2-deoxy-D-ribose), polyribonucleotides (containing D-ribose), and to any other type of polynucleotide which is an N glycoside of a purine or pyrimidine base. There is no intended distinction in length between the terms "nucleic acid", "oligonucleotide" and "polynucleotide", and these terms will be used interchangeably. These terms refer only to the primary structure of the molecule. Thus, these terms include double- and single-stranded DNA, as well as double- and single-stranded RNA. For use in the present invention, an oligonucleotide also can comprise nucleotide analogs in which the base, sugar or phosphate backbone is modified as well as non-purine or non-pyrimidine nucleotide analogs.
[0067] Oligonucleotides can be prepared by any suitable method, including direct chemical synthesis by a method such as the phosphotriester method of Narang et al., 1979, Meth. Enzymol. 68:90-99; the phosphodiester method of Brown et al., 1979, Meth. Enzymol. 68:109-151; the diethylphosphoramidite method of Beaucage et al., 1981, Tetrahedron Lett. 22:1859-1862; and the solid support method of U.S. Pat. No. 4,458,066, each incorporated herein by reference. A review of synthesis methods of conjugates of oligonucleotides and modified nucleotides is provided in Goodchild, 1990, Bioconjugate Chemistry 1(3): 165-187, incorporated herein by reference.
[0068] The term "primer," as used herein, refers to an oligonucleotide capable of acting as a point of initiation of DNA synthesis under suitable conditions. Such conditions include those in which synthesis of a primer extension product complementary to a nucleic acid strand is induced in the presence of four different nucleoside triphosphates and an agent for extension (e.g., a DNA polymerase or reverse transcriptase) in an appropriate buffer and at a suitable temperature. Primer extension can also be carried out in the absence of one or more of the nucleoside triphosphates in which case an extension product of limited length is produced. As used herein, the term "primer" is intended to encompass the oligonucleotides used in ligation-mediated reactions, in which one oligonucleotide is "extended" by ligation to a second oligonucleotide which hybridizes at an adjacent position. Thus, the term "primer extension", as used herein, refers to both the polymerization of individual nucleoside triphosphates using the primer as a point of initiation of DNA synthesis and to the ligation of two oligonucleotides to form an extended product.
[0069] A primer is preferably a single-stranded DNA. The appropriate length of a primer depends on the intended use of the primer but typically ranges from 6 to 50 nucleotides, preferably from 15-35 nucleotides. Short primer molecules generally require cooler temperatures to form sufficiently stable hybrid complexes with the template. A primer need not reflect the exact sequence of the template nucleic acid, but must be sufficiently complementary to hybridize with the template. The design of suitable primers for the amplification of a given target sequence is well known in the art and described in the literature cited herein.
[0070] Primers can incorporate additional features which allow for the detection or immobilization of the primer but do not alter the basic property of the primer, that of acting as a point of initiation of DNA synthesis. For example, primers may contain an additional nucleic acid sequence at the 5' end which does not hybridize to the target nucleic acid, but which facilitates cloning or detection of the amplified product. The region of the primer which is sufficiently complementary to the template to hybridize is referred to herein as the hybridizing region. Primers may incorporate modified residues other than DNA, so long as these alternations do not impede priming or template functionality.
[0071] The phrase "3'-nucleotide discrimination" refers to a property of a DNA polymerase to catalyze a primer extension reaction with greater specificity for deoxyribonucleotides and less efficiently when the nucleotide at the primer 3' terminus was chemically modified. For example, a mutated Taq DNA polymerase that displays 3'-nucleotide discrimination exhibits selectivity for deoxyribonucleotide primer and suppressed catalytic activity when the primer is for example modified with ribonucleotides.
[0072] The term "3'-mismatch discrimination" refers to a property of a DNA polymerase to distinguish a fully complementary sequence from a mismatch-containing (nearly complementary) sequence where the nucleic acid to be extended (for example, a primer or other oligonucleotide) has a mismatch at the 3' terminus of the nucleic acid compared to the template to which the nucleic acid hybridizes. In some embodiments, the nucleic acid to be extended comprises a mismatch at the 3' end relative to the fully complementary sequence.
[0073] The term "rare allele discrimination" refers to a property of a DNA polymerase to preferentially replicate a first nucleic acid in a population of nucleic acids that includes a plurality of a second nucleic acid, wherein the first nucleic acid is under-represented in the population of nucleic acids relative to the plurality of a second nucleic acid. Typically, the first nucleic acid may be under-represented in the population of nucleic acids that contain a plurality of a second nucleic acids by a ratio of the first nucleic acid to the second nucleic acid in the range from about 1:10 to about 1:1,000,000, including 1:100, 1:1,000; 1:10,000 and 1:100,000, among other ratios. Typically, though not exclusively, a polymerase having rare allele discrimination can be used to detect a SNP difference between a first nucleic acid and a second nucleic acid, as further elaborated herein.
[0074] The phrase "template discrimination activity" refers to a DNA polymerase having at least one of 3'-nucleotide discrimination, 3'-mismatch discrimination, rare allele discrimination and combinations thereof.
[0075] The phrase "enhanced template discrimination activity" refers to a DNA polymerase having at least one of 3'-nucleotide discrimination, 3'-mismatch discrimination and rare allele discrimination, or combinations thereof, wherein the DNA polymerase displays greater activity than a reference DNA polymerase. For example, a DNA polymerase mutant having "enhanced template discrimination activity" displays at least one of 3'-nucleotide discrimination, 3'-mismatch discrimination, rare allele discrimination and combinations thereof that is greater than the corresponding activity of the naturally-occurring, wild-type DNA polymerase from which the DNA polymerase mutant was derived.
[0076] A "template discrimination activity assay" refers to an assay for assessing the ability of a polymerase to discriminate between two templates that differ in one or more variables. Assays designed to reveal 3'-nucleotide discrimination, 3'-mismatch discrimination or rare allele discrimination are examples of template discrimination activity assays.
[0077] The term "quantification cycle value," denoted as Cq, refers to the amplification cycle number at which positive signal is first detected.
[0078] The term "discrimination quantification cycle value," denoted as .DELTA.Cq, refers to a calculated difference between a first reference state and a second reference state, wherein both the first and second reference states differ in terms of only one variable. For examples, a first and second reference states can refer to identical polymerase reactions that differ in polymerases, such as a wild-type polymerase and a polymerase mutant, that differ in primer template nucleotide sequence, such as a mismatched primer template and a matched primer template, or that differ in primer template 3'-nucleotide ribose structure, such as a primer template containing a 3'-deoxyribose moiety and a primer template containing a 3'-ribose moiety.
[0079] The term "differential discrimination quantification cycle value," denoted as .DELTA..DELTA.Cq, refers to a calculated difference between a first discrimination quantification cycle value and a second discrimination quantification cycle value for polymerase reactions that differ in two variables. In the context of the present disclosure, the .DELTA..DELTA.Cq value is a measure of the improvement that a given polymerase mutant displays relative to the wild-type polymerase in a template discrimination activity assay. A preferred .DELTA..DELTA.Cq value depends upon the nature of the assay, but generally a preferred .DELTA..DELTA.Cq value is at least 1.0 and is typically greater than 1.0.
[0080] The terms "target, "target sequence", "target region", and "target nucleic acid," as used herein, are synonymous and refer to a region or sequence of a nucleic acid which is to be amplified, sequenced or detected.
[0081] The term "template" refers to a nucleic acid that includes at least one single stranded region. The term "template" as it modifies "substrate" refers to a nucleic acid that is used in a hybridization reaction to anneal with a primer and/or an extension reaction with a polymerase.
[0082] The term "hybridization," as used herein, refers to the formation of a duplex structure by two single-stranded nucleic acids due to complementary base pairing. Hybridization can occur between fully complementary nucleic acid strands or between "substantially complementary" nucleic acid strands that contain minor regions of mismatch. Conditions under which hybridization of fully complementary nucleic acid strands is strongly preferred are referred to as "stringent hybridization conditions" or "sequence-specific hybridization conditions". Stable duplexes of substantially complementary sequences can be achieved under less stringent hybridization conditions; the degree of mismatch tolerated can be controlled by suitable adjustment of the hybridization conditions. Those skilled in the art of nucleic acid technology can determine duplex stability empirically considering a number of variables including, for example, the length and base pair composition of the oligonucleotides, ionic strength, and incidence of mismatched base pairs, following the guidance provided by the art (see, e.g., Sambrook et al., 1989, Molecular Cloning--A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y.; Wetmur, 1991, Critical Review in Biochem. and Mol. Biol. 26(3/4):227-259; and Owczarzy et al., 2008, Biochemistry, 47: 5336-5353, which are incorporated herein by reference).
[0083] The term "amplification reaction" refers to any chemical reaction, including an enzymatic reaction, which results in increased copies of a template nucleic acid sequence or results in transcription of a template nucleic acid. Amplification reactions include reverse transcription, the polymerase chain reaction (PCR), including Real Time PCR (see U.S. Pat. Nos. 4,683,195 and 4,683,202; PCR Protocols: A Guide to Methods and Applications (Innis et al., eds, 1990)), and the ligase chain reaction (LCR) (see Barany et al., U.S. Pat. No. 5,494,810). Exemplary "amplification reactions conditions" or "amplification conditions" typically comprise either two or three step cycles. Two step cycles have a high temperature denaturation step followed by a hybridization/elongation (or ligation) step. Three step cycles comprise a denaturation step followed by a hybridization step followed by a separate elongation or ligation step.
[0084] An "amino acid" refers to any monomer unit that can be incorporated into a peptide, polypeptide, or protein. As used herein, the term "amino acid" includes the following twenty natural or genetically encoded alpha-amino acids: alanine (Ala or A), arginine (Arg or R), asparagine (Asn or N), aspartic acid (Asp or D), cysteine (Cys or C), glutamine (Gln or Q), glutamic acid (Glu or E), glycine (Gly or G), histidine (His or H), isoleucine (Ile or I), leucine (Leu or L), lysine (Lys or K), methionine (Met or M), phenylalanine (Phe or F), proline (Pro or P), serine (Ser or S), threonine (Thr or T), tryptophan (Trp or W), tyrosine (Tyr or Y), and valine (Val or V). In cases where "X" residues are undefined, these should be defined as "any amino acid." The structures of these twenty natural amino acids are shown in, e.g., Stryer et al., Biochemistry, 5.sup.th ed., Freeman and Company (2002), which is incorporated by reference. Additional amino acids, such as selenocysteine and pyrrolysine, can also be genetically coded for (Stadtman (1996) "Selenocysteine," Annu Rev Biochem. 65:83-100 and Ibba et al. (2002) "Genetic code: introducing pyrrolysine," Curr Biol. 12(13):R464-R466, which are both incorporated by reference). The term "amino acid" also includes unnatural amino acids, modified amino acids (e.g., having modified side chains and/or backbones), and amino acid analogs. See, e.g., Zhang et al. (2004) "Selective incorporation of 5-hydroxytryptophan into proteins in mammalian cells," Proc. Natl. Acad. Sci. U.S.A. 101(24):8882-8887, Anderson et al. (2004) "An expanded genetic code with a functional quadruplet codon" Proc. Natl. Acad. Sci. U.S.A. 101(20):7566-7571, Ikeda et al. (2003) "Synthesis of a novel histidine analogue and its efficient incorporation into a protein in vivo," Protein Eng. Des. Sel. 16(9):699-706, Chin et al. (2003) "An Expanded Eukaryotic Genetic Code," Science 301(5635):964-967, James et al. (2001) "Kinetic characterization of ribonuclease S mutants containing photoisomerizable phenylazophenylalanine residues," Protein Eng. Des. Sel. 14(12):983-991, Kohrer et al. (2001) "Import of amber and ochre suppressor tRNAs into mammalian cells: A general approach to site-specific insertion of amino acid analogues into proteins," Proc. Natl. Acad. Sci. U.S.A. 98(25):14310-14315, Bacher et al. (2001) "Selection and Characterization of Escherichia coli Variants Capable of Growth on an Otherwise Toxic Tryptophan Analogue," J. Bacteriol. 183(18):5414-5425, Hamano-Takaku et al. (2000) "A Mutant Escherichia coli Tyrosyl-tRNA Synthetase Utilizes the Unnatural Amino Acid Azatyrosine More Efficiently than Tyrosine," J. Biol. Chem. 275(51):40324-40328, and Budisa et al. (2001) "Proteins with {beta}-(thienopyrrolyl)alanines as alternative chromophores and pharmaceutically active amino acids," Protein Sci. 10(7):1281-1292, which are each incorporated by reference.
[0085] The term "residue" is synonymous and interchangeable with "amino acid" or "nucleotide" depending upon context.
[0086] As used herein, a "polymerase" refers to an enzyme that catalyzes the polymerization of nucleotides. Generally, the enzyme will initiate synthesis at the 3'-end of the primer annealed to a nucleic acid template sequence. "DNA polymerase" catalyzes the polymerization of deoxyribonucleotides. Known DNA polymerases include, for example, Pyrococcus furiosus (Pfu) DNA polymerase (Lundberg et al., 1991, Gene, 108:1), E. coli DNA polymerase I (Lecomte and Doubleday, 1983, Nucleic Acids Res. 11:7505), T7 DNA polymerase (Nordstrom et al., 1981, J. Biol. Chem. 256:3112), Thermus thermophilus (Tth) DNA polymerase (Myers and Gelfand 1991, Biochemistry 30:7661), Bacillus stearothermophilus DNA polymerase (Stenesh and McGowan, 1977, Biochim Biophys Acta 475:32), Thermococcus litoralis (Tli) DNA polymerase (also referred to as Vent DNA polymerase, Cariello et al., 1991, Nucleic Acids Res, 19: 4193), Thermotoga maritima (Tma) DNA polymerase (Diaz and Sabino, 1998 Braz J. Med. Res, 31:1239), Thermus aquaticus (Taq) DNA polymerase (Chien et al., 1976, J. Bacteoriol, 127: 1550), Pyrococcus kodakaraensis KOD DNA polymerase (Takagi et al., 1997, Appl. Environ. Microbiol. 63:4504), JDF-3 DNA polymerase (Patent application WO 0132887), and Pyrococcus GB-D (PGB-D) DNA polymerase (Juncosa-Ginesta et al., 1994, Biotechniques, 16:820). The polymerase activity of any of the above enzymes can be determined by means well known in the art.
[0087] The term "thermostable polymerase," refers to an enzyme that is stable to heat, is heat resistant, and retains sufficient activity to effect subsequent polynucleotide extension reactions and does not become irreversibly denatured (inactivated) when subjected to the elevated temperatures for the time necessary to effect denaturation of double-stranded nucleic acids. The heating conditions necessary for nucleic acid denaturation are well known in the art and are exemplified in, e.g., U.S. Pat. Nos. 4,683,202, 4,683,195, and 4,965,188, which are incorporated herein by reference. As used herein, a thermostable polymerase is suitable for use in a temperature cycling reaction such as the polymerase chain reaction ("PCR"). Irreversible denaturation for purposes herein refers to permanent and complete loss of enzymatic activity. For a thermostable polymerase, enzymatic activity refers to the catalysis of the combination of the nucleotides in the proper manner to form polynucleotide extension products that are complementary to a template nucleic acid strand. Thermostable DNA polymerases from thermophilic bacteria include, e.g., DNA polymerases from Thermus aquaticus, among others.
[0088] The term "thermoactive" refers to an enzyme that maintains catalytic properties at temperatures commonly used for reverse transcription or anneal/extension steps in RT-PCR and/or PCR reactions (i.e., 45-80.degree. C.). Thermostable enzymes are those which are not irreversibly inactivated or denatured when subjected to elevated temperatures necessary for nucleic acid denaturation. Thermoactive enzymes may or may not be thermostable. Thermoactive DNA polymerases can be DNA or RNA dependent from thermophilic species or from mesophilic species including, but not limited to, Escherichia coli, Moloney murine leukemia viruses, and Avian myoblastosis virus.
[0089] As used herein, a primer is "specific," for a target sequence if, when used in an amplification reaction under sufficiently stringent conditions, the primer hybridizes primarily to the target nucleic acid. Typically, a primer is specific for a target sequence if the primer-target duplex stability is greater than the stability of a duplex formed between the primer and any other sequence found in the sample. One of skill in the art will recognize that various factors, such as salt conditions as well as base composition of the primer and the location of the mismatches, will affect the specificity of the primer, and that routine experimental confirmation of the primer specificity will be needed in many cases. Hybridization conditions can be chosen under which the primer can form stable duplexes only with a target sequence. Thus, the use of target-specific primers under suitably stringent amplification conditions enables the selective amplification of those target sequences which contain the target primer binding sites.
[0090] The term "non-specific amplification," as used herein, refers to the amplification of nucleic acid sequences other than the target sequence which results from primers hybridizing to sequences other than the target sequence and then serving as a substrate for primer extension. The hybridization of a primer to a non-target sequence is referred to as "non-specific hybridization" and is apt to occur especially during the lower temperature, reduced stringency, pre-amplification conditions, or in situations where there is a variant allele in the sample having a very closely related sequence to the true target as in the case of a single nucleotide polymorphism (SNP).
[0091] The term "primer dimer," as used herein, refers to a template-independent non-specific amplification product, which is believed to result from primer extensions wherein another primer serves as a template. Although primer dimers frequently appear to be a concatamer of two primers, i.e., a dimer, concatamers of more than two primers also occur. The term "primer dimer" is used herein generically to encompass a template-independent non-specific amplification product.
[0092] The term "reaction mixture," as used herein, refers to a solution containing reagents necessary to carry out a given reaction. An "amplification reaction mixture", which refers to a solution containing reagents necessary to carry out an amplification reaction, typically contains oligonucleotide primers and a DNA polymerase or ligase in a suitable buffer. A "PCR reaction mixture" typically contains oligonucleotide primers, a DNA polymerase (most typically a thermostable DNA polymerase), dNTPs, and a divalent metal cation in a suitable buffer. A reaction mixture is referred to as complete if it contains all reagents necessary to enable the reaction, and incomplete if it contains only a subset of the necessary reagents. It will be understood by one of skill in the art that reaction components are routinely stored as separate solutions, each containing a subset of the total components, for reasons of convenience, storage stability, or to allow for application-dependent adjustment of the component concentrations, and that reaction components are combined prior to the reaction to create a complete reaction mixture. Furthermore, it will be understood by one of skill in the art that reaction components are packaged separately for commercialization and that useful commercial kits may contain any subset of the reaction components which includes the blocked primers of the invention.
[0093] The terms "non-activated" or "inactivated," as used herein, refer to a primer or other oligonucleotide that is incapable of participating in a primer extension reaction or a ligation reaction because either DNA polymerase or DNA ligase cannot interact with the oligonucleotide for their intended purposes. In some embodiments when the oligonucleotide is a primer, the non-activated state occurs because the primer is blocked at or near the 3'-end so as to prevent primer extension. When specific groups are bound at or near the 3'-end of the primer, DNA polymerase cannot bind to the primer and extension cannot occur. A non-activated primer is, however, capable of hybridizing to a substantially complementary nucleotide sequence.
[0094] The term "activated," as used herein, refers to a primer or other oligonucleotide that is capable of participating in a reaction with DNA polymerase or DNA ligase. A primer or other oligonucleotide becomes activated after it hybridizes to a substantially complementary nucleic acid sequence and is cleaved to generate a functional 3'- or 5'-end so that it can interact with a DNA polymerase or a DNA ligase. For example, when the oligonucleotide is a primer, and the primer is hybridized to a template, a 3'-blocking group can be removed from the primer by, for example, a cleaving enzyme such that DNA polymerase can bind to the 3' end of the primer and promote primer extension.
[0095] The term "cleavage domain" or "cleaving domain," as used herein, are synonymous and refer to a region located between the 5' and 3' end of a primer or other oligonucleotide that is recognized by a cleavage compound, for example a cleavage enzyme, that will cleave the primer or other oligonucleotide. For the purposes of this invention, the cleavage domain is designed such that the primer or other oligonucleotide is cleaved only when it is hybridized to a complementary nucleic acid sequence, but will not be cleaved when it is single-stranded. The cleavage domain or sequences flanking it may include a moiety that a) prevents or inhibits the extension or ligation of a primer or other oligonucleotide by a polymerase or a ligase, b) enhances discrimination to detect variant alleles, or c) suppresses undesired cleavage reactions. One or more such moieties may be included in the cleavage domain or the sequences flanking it.
[0096] The term "RNase H cleavage domain," as used herein, is a type of cleavage domain that contains one or more ribonucleic acid residue or an alternative analog which provides a substrate for an RNase H. An RNase H cleavage domain can be located anywhere within a primer or oligonucleotide, and is preferably located at or near the 3'-end or the 5'-end of the molecule.
[0097] An "RNase H1 cleavage domain" generally contains at least three consecutive RNA residues. An "RNase H2 cleavage domain" may contain one RNA residue, a sequence of contiguously linked RNA residues or RNA residues separated by DNA residues or other chemical groups. For example, an RNase H2 cleavage domain may include a 2'-fluoronucleoside residue, among others.
[0098] The terms "cleavage compound," or "cleaving agent" as used herein, refers to any compound that can recognize a cleavage domain within a primer or other oligonucleotide, and selectively cleave the oligonucleotide based on the presence of the cleavage domain. The cleavage compounds utilized in the invention selectively cleave the primer or other oligonucleotide comprising the cleavage domain only when it is hybridized to a substantially complementary nucleic acid sequence, but will not cleave the primer or other oligonucleotide when it is single stranded. The cleavage compound cleaves the primer or other oligonucleotide within or adjacent to the cleavage domain. The term "adjacent," as used herein, means that the cleavage compound cleaves the primer or other oligonucleotide at either the 5'-end or the 3' end of the cleavage domain. Cleavage reactions preferred in the invention yield a 5'-phosphate group and a 3'-OH group.
[0099] In a preferred embodiment, the cleavage compound is a "cleaving enzyme." A cleaving enzyme is a protein or a ribozyme that is capable of recognizing the cleaving domain when a primer or other nucleotide is hybridized to a substantially complementary nucleic acid sequence, but that will not cleave the complementary nucleic acid sequence (i.e., it provides a single strand break in the duplex). The cleaving enzyme will also not cleave the primer or other oligonucleotide comprising the cleavage domain when it is single stranded. Examples of cleaving enzymes are RNase H enzymes and other nicking enzymes.
[0100] The term "nicking," as used herein, refers to the cleavage of only one strand of the double-stranded portion of a fully or partially double-stranded nucleic acid. The position where the nucleic acid is nicked is referred to as the "nicking site" (NS). A "nicking agent" (NA) is an agent that nicks a partially or fully double-stranded nucleic acid. It may be an enzyme or any other chemical compound or composition. In certain embodiments, a nicking agent may recognize a particular nucleotide sequence of a fully or partially double-stranded nucleic acid and cleave only one strand of the fully or partially double-stranded nucleic acid at a specific position (i.e., the NS) relative to the location of the recognition sequence. Such nicking agents (referred to as "sequence specific nicking agents") include, but are not limited to, nicking endonucleases (e.g., Nt.BstNBI).
[0101] A "nicking endonuclease" (NE), as used herein, thus refers to an endonuclease that recognizes a nucleotide sequence of a completely or partially double-stranded nucleic acid molecule and cleaves only one strand of the nucleic acid molecule at a specific location relative to the recognition sequence. In such a case the entire sequence from the recognition site to the point of cleavage constitutes the "cleavage domain".
[0102] The term "blocking group," as used herein, refers to a chemical moiety that is bound to the primer or other oligonucleotide such that an amplification reaction does not occur. For example, primer extension and/or DNA ligation does not occur. Once the blocking group is removed from the primer or other oligonucleotide, the oligonucleotide is capable of participating in the assay for which it was designed (PCR, ligation, sequencing, etc.). Thus, the "blocking group" can be any chemical moiety that inhibits recognition by a polymerase or DNA ligase. The blocking group may be incorporated into the cleavage domain but is generally located on either the 5'- or 3'-side of the cleavage domain. The blocking group can be comprised of more than one chemical moiety. In the present invention the "blocking group" is typically removed after hybridization of the oligonucleotide to its target sequence.
[0103] The term "blocked-cleavable primer" refers to a primer that is inactive or inactivated for priming DNA synthesis from a polymerase owing to the presence of a blocking group at or near the 3'-terminus of the primer. A blocked-cleavable primer can be converted into a competent primer by removing the blocking group at or near the 3'-terminus of the primer by a cleavage compound or a cleaving agent (for example, a cleaving enzyme) resulting in an active or activated primer.
[0104] An RDDDDx blocked-cleavable primer (also known as "generation 1" or "Gen 1" blocked-cleavable primer) refers to a blocked-cleavable primer having at its 3'-terminus the sequence RDDDDx, wherein R is an RNA base, D is a DNA base and x is a C3 spacer group.
[0105] An RDxxD blocked-cleavable primer (also known as "generation 2" or "Gen 2" blocked-cleavable primer) refers to a blocked-cleavable primer having at its 3'-terminus the sequence RDxxD, wherein R is an RNA base, D is a DNA base and x is a C3 spacer group.
[0106] The term "fluorescent generation probe" refers either to a) an oligonucleotide having an attached fluorophore and quencher, and optionally a minor groove binder or to b) a DNA binding reagent such as SYBR.TM. Green dye.
[0107] The terms "fluorescent label" or "fluorophore" refers to compounds with a fluorescent emission maximum between about 350 and 900 nm. A wide variety of fluorophores can be used, including but not limited to: 5-FAM (also called 5-carboxyfluorescein; also called Spiro(isobenzofuran-1(3H), 9'-(9H)xanthene)-5-carboxylic acid,3',6'-dihydroxy-3-oxo-6-carboxyfluorescein); 5-Hexachloro-Fluorescein; ([4,7,2',4',5',7'-hexachloro-(3',6'-dipivaloyl-fluoresceinyl)-6-carboxyli- -c acid]); 6-Hexachloro-Fluorescein; ([4,7,2',4',5',7'-hexachloro-(3',6'-dipivaloylfluoresceinyl)-5-carboxylic acid]); 5-Tetrachloro-Fluorescein; ([4,7,2',7'-tetra-chloro-(3',6'-dipivaloylfluoresceinyl)-5-carboxylic acid]); 6-Tetrachloro-Fluorescein; ([4,7,2',7'-tetrachloro-(3',6'-dipivaloylfluoresceinyl)-6-carboxylic acid]); 5-TAMRA (5-carboxytetramethylrhodamine); Xanthylium, 9-(2,4-dicarboxyphenyl)-3,6-bis(dimethyl-amino); 6-TAMRA (6-carboxytetramethylrhodamine); 9-(2,5-dicarboxyphenyl)-3,6-bis(dimethylamino); EDANS (5-((2-aminoethyl)amino)naphthalene-1-sulfonic acid); 1,5-IAEDANS (5-((((2-iodoacetyl)amino)ethyl)amino)naphthalene-1-sulfonic acid); Cy5 (Indodicarbocyanine-5); Cy3 (Indo-dicarbocyanine-3); and BODIPY FL (2,6-dibromo-4,4-difluoro-5,7-dimethyl-4-bora-3a,4a-diaza-s-indacene-3-pr- oprionic acid); Quasar.RTM.-670 dye (Biosearch Technologies); Cal Fluor.RTM. Orange dye (Biosearch Technologies); Rox dyes; Max dyes (Integrated DNA Technologies), as well as suitable derivatives thereof.
[0108] As used herein, the term "quencher" refers to a molecule or part of a compound, which is capable of reducing the emission from a fluorescent donor when attached to or in proximity to the donor. Quenching may occur by any of several mechanisms including fluorescence resonance energy transfer, photo-induced electron transfer, paramagnetic enhancement of intersystem crossing, Dexter exchange coupling, and exciton coupling such as the formation of dark complexes. Fluorescence is "quenched" when the fluorescence emitted by the fluorophore is reduced as compared with the fluorescence in the absence of the quencher by at least 10%, for example, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, 99.9% or more. A number of commercially available quenchers are known in the art, and include but are not limited to DABCYL, Black Hole.TM. Quenchers (BHQ-1, BHQ-2, and BHQ-3), Iowa Black.RTM. FQ and Iowa Black.RTM. RQ. These are so-called dark quenchers. They have no intrinsic fluorescence in the wavelength range from 300 to 900 nm, virtually eliminating background problems seen with other quenchers such as TAMRA which is intrinsically fluorescent.
[0109] The term "ligation" as used herein refers to the covalent joining of two polynucleotide ends. In various embodiments, ligation involves the covalent joining of a 3' end of a first polynucleotide (the acceptor) to a 5' end of a second polynucleotide (the donor). Ligation results in a phosphodiester bond being formed between the polynucleotide ends. In various embodiments, ligation may be mediated by any enzyme, chemical, or process that results in a covalent joining of the polynucleotide ends. In certain embodiments, ligation is mediated by a ligase enzyme.
[0110] As used herein, "ligase" refers to an enzyme that is capable of covalently linking the 3'-hydroxyl group of one polynucleotide to the 5' phosphate group of a second polynucleotide. Examples of ligases include E. coli DNA ligase, T4 DNA ligase, etc.
[0111] The ligation reaction can be employed in DNA amplification methods such as the "ligase chain reaction" (LCR), also referred to as the "ligase amplification reaction" (LAR), see Barany, Proc. Natl. Acad. Sci., 88:189 (1991); and Wu and Wallace, Genomics 4:560 (1989) incorporated herein by reference. In LCR, four oligonucleotides, two adjacent oligonucleotides which uniquely hybridize to one strand of the target DNA, and a complementary set of adjacent oligonucleotides, that hybridize to the opposite strand are mixed and DNA ligase is added to the mixture. In the presence of the target sequence, DNA ligase will covalently link each set of hybridized molecules. Importantly, in LCR, two oligonucleotides are ligated together only when they base-pair with sequences without gaps. Repeated cycles of denaturation, hybridization and ligation amplify a short segment of DNA. A mismatch at the junction between adjacent oligonucleotides inhibits ligation. As in other oligonucleotide ligation assays this property allows LCR to be used to distinguish between variant alleles such as SNPs. LCR has also been used in combination with PCR to achieve enhanced detection of single-base changes, see Segev, PCT Public. No. WO9001069 (1990).
[0112] The term "unmodified form," in the context of the Taq DNA polymerase, is a term used herein for purposes of defining a host cell-specific, codon-optimized Taq DNA polymerase gene that expresses Taq DNA polymerase in the host cell. The term "unmodified form" refers to a functional DNA polymerase that has the amino acid sequence of the naturally occurring polymerase. The term "unmodified form" includes a functional DNA polymerase in a recombinant form.
[0113] The term "mutant", in the context of DNA polymerases disclosed, means a polypeptide, typically recombinant, that comprises one or more amino acid substitutions relative to a corresponding, naturally-occurring form or unmodified form of DNA polymerase.
[0114] "Recombinant", as used herein, refers to an amino acid sequence or a nucleotide sequence that has been intentionally modified by recombinant methods. By the term "recombinant nucleic acid" herein is meant a nucleic acid, originally formed in vitro, in general, by the manipulation of a nucleic acid by endonucleases, in a form not normally found in nature. Thus an isolated, mutant DNA polymerase nucleic acid, in a linear form, or an expression vector formed in vitro by ligating DNA molecules that are not normally joined, are both considered recombinant for the purposes of this invention. It is understood that once a recombinant nucleic acid is made and reintroduced into a host cell, it will replicate non-recombinantly, i.e., using the in vivo cellular machinery of the host cell rather than in vitro manipulations; however, such nucleic acids, once produced recombinantly, although subsequently replicated non-recombinantly, are still considered recombinant for the purposes of the invention. A "recombinant protein" is a protein made using recombinant techniques, i.e., through the expression of a recombinant nucleic acid as depicted above.
[0115] A nucleic acid is "operably linked" when it is placed into a functional relationship with another nucleic acid sequence. For example, a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation.
[0116] The term "vector" refers to a piece of DNA, typically double-stranded, which may have inserted into it a piece of foreign DNA. The vector may be, for example, of plasmid origin. Vectors contain "replicon" polynucleotide sequences that facilitate the autonomous replication of the vector in a host cell. Foreign DNA is defined as heterologous DNA, which is DNA not naturally found in the host cell, which, for example, replicates the vector molecule, encodes a selectable or screenable marker, or encodes a transgene. The vector is used to transport the foreign or heterologous DNA into a suitable host cell. Once in the host cell, the vector can replicate independently of or coincidental with the host chromosomal DNA, and several copies of the vector and its inserted DNA can be generated. In addition, the vector can also contain the necessary elements that permit transcription of the inserted DNA into an mRNA molecule or otherwise cause replication of the inserted DNA into multiple copies of RNA. Some expression vectors additionally contain sequence elements adjacent to the inserted DNA that increase the half-life of the expressed mRNA and/or allow translation of the mRNA into a protein molecule. Many molecules of mRNA and polypeptide encoded by the inserted DNA can thus be rapidly synthesized.
[0117] The term "affinity tag" refers to a short polypeptide sequence that permits detection and/or selection of the polypeptide sequence. For the purposes of this disclosure, a recombinant gene that encodes a recombinant DNA polymerase may include an affinity tag. In particular, the affinity tag is positioned typically at either the N-terminus or C-terminus of the coding sequence for a DNA polymerase through the use of recombination technology. Exemplary affinity tags include polyhistine (for example,(His6),), glutathione-S-transferase (GST), HaloTag.RTM., AviTag, Calmodulin-tag, polyglutamate tag, FLAG-tag, HA-tag, Myc-tag, S-tag, SBP-tag, Softag 3, V5 tag, Xpress tag, among others.
[0118] The term "host cell" refers to both single-cellular prokaryote and eukaryote organisms (e.g., bacteria, yeast, and actinomycetes) and single cells from higher order plants or animals when being grown in cell culture. Exemplary suitable host cells include E. coli, S. cerevisiae and S. frugiperda.
[0119] As used herein, "percentage of sequence identity" is determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the sequence in the comparison window can comprise additions or deletions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity.
[0120] The terms "identical" or "identity", in the context of two or more nucleic acids or polypeptide sequences, refer to two or more sequences or subsequences that are the same. Sequences are "substantially identical" to each other if they have a specified percentage of nucleotides or amino acid residues that are the same (e.g., at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% identity over a specified region), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. These definitions also refer to the complement of a test sequence. Optionally, the identity exists over a region that is at least about 50 nucleotides in length, or more typically over a region that is 100 to 500 or 1000 or more nucleotides in length.
[0121] The terms "similarity" or "percent similarity", in the context of two or more polypeptide sequences, refer to two or more sequences or subsequences that have a specified percentage of amino acid residues that are either the same or similar as defined by a conservative amino acid substitutions (e.g., 60% similarity, optionally 65%, 70%, 75%, 80%, 85%, 90%, or 95% similar over a specified region), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. Sequences are "substantially similar" to each other if they are at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, or at least 55% similar to each other. Optionally, this similarly exists over a region that is at least about 50 amino acids in length, or more typically over a region that is at least about 100 to 500 or 1000 or more amino acids in length.
[0122] For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters are commonly used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities or similarities for the test sequences relative to the reference sequence, based on the program parameters.
[0123] A "comparison window", as used herein, includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. Methods of alignment of sequences for comparison are well known in the art. Optimal alignment of sequences for comparison can be conducted, for example, by the local homology algorithm of Smith and Waterman (Adv. Appl. Math. 2:482, 1970), by the homology alignment algorithm of Needleman and Wunsch (J. Mol. Biol. 48:443, 1970), by the search for similarity method of Pearson and Lipman (Proc. Natl. Acad. Sci. USA 85:2444, 1988), by computerized implementations of these algorithms (e.g., GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by manual alignment and visual inspection (see, e.g., Ausubel et al., Current Protocols in Molecular Biology (1995 supplement)).
[0124] Algorithms suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al. (Nuc. Acids Res. 25:3389-402, 1977), and Altschul et al. (J. Mol. Biol. 215:403-10, 1990), respectively. Software for performing BLAST analyses is publicly available through publicly available online and internet databases and the National Center for Biotechnology Information within the National Library of Medicine of the U.S. National Institutes of Health (http://www.ncbi.nlm.nih.gov/).
Rational Design of Taq DNA Polymerase Mutants
[0125] As outlined above, many strategies have been developed to improve discrimination of the polymerase chain reaction to selectively amplify a specific nucleic acid sequence based on the identity of a single nucleotide polymorphism, which in the past most often involved modifications introduced into the primer while using a naturally occurring DNA polymerase. The ability of DNA polymerases to discriminate between match and mismatch at the 3'-end of the primer nucleic acid is limited and varies greatly with the identity of the specific base pairs present. An alternative strategy to improve the selectivity of PCR amplification is to alter the properties of the DNA polymerase to improve discrimination between a primer that is a match versus one which has a terminal mismatch to the template nucleic acid. The present invention provides for DNA polymerase mutants having improved mismatch discrimination for base pairing at the 3'-terminus of the primer, leading to improved specificity of the ensuing amplification reaction.
[0126] The rhPCR method employs blocked-cleavable primers which must be unblocked by the action of RNase H2 before amplification can commence. The enzymatic unblocking step requires cleavage at a single internal RNA base within the primer, which is typically positioned at the SNP site. RNase H2 cleaves the RNA at the 5'-side, leaving a primer with a 3'-hydroxyl which is capable of priming PCR. Cleavage by RNase H2 occurs with high efficiency when the primer matches the template and with low efficiency when a mismatch is present due to a SNP. Therefore match templates are amplified with greater efficiency than mismatch templates. It is thought that the primary mechanism that permits amplification of mismatched templates begins with alternative cleavage of the substrate (i.e., the blocked-cleavable primer) at the 3'-side of the RNA residue, leading to inappropriate priming when a mismatch is present, retention of the RNA base in the primer, and conversion of the PCR product to primer sequence, which then faithfully replicates as a match in subsequent PCR cycles. Fidelity of the rhPCR process could be improved through improvements in the DNA polymerase which limit its ability to initiate DNA synthesis from a primer having a 3'-RNA residue. The present invention provides for DNA polymerase mutants having a reduced ability to initiate DNA synthesis from 3'-RNA containing primers, leading to improved specificity of the ensuing amplification reaction.
[0127] The present invention includes novel DNA polymerase mutants having improved discrimination for base identity at the 3'-end of the primer nucleic acid and/or DNA polymerase mutants having decreased priming efficiency from a 3'-RNA residue.
[0128] A novel design strategy was developed to rationally design DNA polymerase mutants having improved discrimination at the 3'-terminal base of the primer compared to discrimination of the native DNA polymerase, limiting the ability to initiate DNA synthesis if a mismatch is present or if an RNA residue is present. The process described herein employed the Taq DNA polymerase as the parent enzyme; the approach can be applied to other DNA polymerases, especially if crystal structure is known. The design strategy includes a first component based upon theoretical analyses of biophysical, biochemical and genetic information relating to the native DNA polymerase and, to a lesser extent, related polymerases which differ in amino acid sequence. The design strategy includes a second component based upon molecular biological and biochemical analyses of known genetically-engineered mutant polymerases to assist as a guide in predicting the effects of novel mutations in an attempt to rationally engineer new properties into the mutant polymerase, in this case to improve 3'-nucleotide discrimination.
[0129] In the first stage, the mechanism of Taq DNA polymerase enzymatic reaction based upon published mutational structure-activity-relationship (SAR) studies was analyzed and correlated with protein structure, when known, and predicted using molecular dynamic simulations when not known. The mechanism of enzyme catalysis has been described in the prior art (Patel, P. H., et al., J. Mol. Biol. 2001, 308:823-837; Li, Y. & Waksman, G., Protein Sci 2001, 10:1225-1233). Amino acid residues located at the C-terminus, from positions 424 to 832, are responsible for the primer extension catalytic activity of the protein. Taq DNA polymerase binds the primer-template duplex to form a binary complex. This allows an incoming substrate dNTP to bind in the pocket at the 3'-end of the primer to form an open ternary complex. If the dNTP is complementary to the template nucleotide, the active site changes conformation where the .alpha.-helix made from residues 659 to 671 rotates towards the site, and template base rotates towards the incoming dNTP, encouraging formation of a Watson-Crick base pair. This event "closes" the ternary complex, and brings the .alpha.-phosphate group of the dNTP close to the primer 3'-OH group. The oxygen of this hydroxyl group makes a nucleophilic attack on the phosphorus, forms a covalent bond and pyrophosphate is released. Taq DNA polymerase catalytic activity requires the presence of magnesium ions, which are assumed to facilitate deprotonation of the attacking hydroxyl group.
[0130] One criteria for rational design of Taq DNA polymerase mutants having improved 3'-nucleotide discrimination is to provide for novel polymerase enzyme variants having normal or near-normal polymerase processivity compared with the native DNA polymerase. For this reason, the first step of analysis serves to narrow the sequence space of amino acids that are available for alteration that should not compromise core enzymatic functions. For example, residues D610, D785, and E786 form the catalytic core. Their carboxylate groups are assumed to bind divalent metal ions, which in turn bind and stabilize the incoming dNTP and the terminal nucleotide of the primer. Mutations of these three essential residues are likely to render the polymerase inactive. Mutant polymerases which include alterations of residues D610, D785 and E786 were therefore excluded from consideration. Likewise, mutations that affect fidelity of complementary base recognition, such as residues that facilitate open to closed ternary complex formation at a complementary dNTP and the template base, were excluded from consideration.
[0131] Additional criteria of the first stage of analysis were to identify the polymerase amino acid residues in the vicinity of the 3' terminal nucleotide of the primer. For this purpose, the atomic three-dimensional structures of Taq DNA polymerase that are available from prior art (Eom, S. H., et al., Nature 1996, 382:278-281; Li, Y., et al., EMBO J. 1998, 17: 7514-7525; Doublie, S., et al., Structure 1999, 7:R31-R35; Li, Y., et al., Protein Sci 1998, 7:1116-1123) were selected for analyses. The structures were downloaded from the Protein Data Bank (H. M. Berman, et al., Nucleic Acids Research 2000, 28: 235-242). The structures of PDB ID 2KTQ and 3KTQ were thoroughly analyzed because they show the open and closed ternary complex of the large fragment of Taq DNA polymerase co-crystalized with primer and template nucleic acids (Li, Y., et al., EMBO J. 1998, 17: 7514-7525). This structure shows the location of the primer 3'-terminus at the active site and its interaction with key amino acid residues (FIG. 1).
[0132] For structure visualization, the hydrogen atom attached to the 2' carbon is replaced with a hydroxyl group for primers modified with a 3'-ribonucleotide. Those amino acid residues that are in close proximity to the 2' carbon of the nucleotide at the 3' terminus of the primer were selected for additional analysis. These amino acid residues are listed in the Table 2 and are most likely to interact with the primer 3'-terminal nucleotide. Mutation at these sites may affect catalytic activity of the polymerase when primer modifications, like OH, are attached to the 2' carbon atom of the ribose.
TABLE-US-00002 TABLE 2 Chemical groups in close vicinity to the 2' carbon of the terminal 3' primer nucleotide. Distance from C2' of the primer terminal residue.sup.1 Chemical group .ltoreq.0.35 nm dNTP to be added to primer 0.35-0.40 nm D785.sup.2 0.40-0.45 nm H784, V783 0.45-0.50 nm R573 0.50-0.60 nm E786.sup.2 .sup.1The distances were measured in the PDB ID 2KTQ structure. .sup.2Residues D785 and E786 are catalytic core residues.
[0133] A further aspect of this criterion relates to approaches to increase specificity while retaining catalytic activity of the polymerase. One approach to increasing specificity of Taq DNA polymerase would be to decrease the size of the binding pocket, so that a modified primer would not fit within it. Any additional chemical group will increases the volume of space occupied by the 3' nucleotide. To align atoms for effective catalysis and nucleophilic attack, the active site pocket must be flexible to accommodate additional atom(s), for example, the oxygen of the OH group of an RNA residue. The size of the active site can be decreased by substitution of neighboring amino acids with larger amino acids. Additional consideration is given to the amino acid properties and abilities of their side chains to engage in electrostatic and van der Waals interactions. Amino acid can be categorized into groups of positively charged (R, H, K), negatively charged (D, E), uncharged polar (S, T, N, Q), hydrophobic (A, V, I, L, M, F, Y, W), and special (C, G, P) side chains. Mutations within a group are conservative and are more likely to maintain existing properties while mutations across groups or within the special group amino acids are more likely to result in substantial changes of enzyme activity and/or specificity.
[0134] Another approach to increasing 3'-nucleotide discrimination of Taq DNA polymerase is to employ residue substitutions that decrease the flexibility of the binding pocket. Examples include substitution of amino acid aliphatic side chains with aromatic side chains, which lead to a higher energetic barrier to change rotamer conformations. As explained above, the residues of the catalytic core are preferably unaltered, residues spatially near the catalytic core are given the greatest attention for change. For example, three non-catalytic core residues of Table 2, H784, V783, and R573 are herein proposed to be substituted for larger or less flexible amino acids while the maintaining the general physical characteristics of their side chains. These residues exhibit key interactions with the ribose moiety of the primer through a water-mediated hydrogen-bonding network. R573 also binds to the primer base in the minor groove of primer-template duplex. Mutants ID 1 to ID 4 were designed using this strategy (Table 3). The next mutant, ID 5, Q582K, was designed to alter interactions with and the position of the important H784 residue. It is seen from the known crystal structure that Q582 is situated on the opposite side of H784 from the oligonucleotide primer. Substitution of Q582H may shift H784 towards the terminal primer nucleotide, leading to a more constrained binding pocket. The interactions of residue 582 with the next-to-terminal nucleotide may also be affected.
[0135] Residues that stack above the incoming dNTP molecule can also influence the size of the binding pocket in the polymerase active site. For example, substitutions at F667, which is located at this position, are known to change selectivity towards the incoming dNTP. For example, the F667Y substitution significantly improves incorporation of dideoxynucleoside triphosphates by Taq DNA polymerase (Tabor, S. & Richardson, C. C., Proc. Nat. Acad. Sci. USA 1995, 92:6339-6343), a useful property for DNA polymerases employed in Sanger method terminator DNA sequencing. Mutant ID 6 increases the size of the aromatic side chain of F667 from phenylalanine to tryptophan, in an attempt to push the dNTP against the primer terminal ribonucleotide and decrease ability of binding pocket to accommodate a 2' hydroxyl group, thereby biasing this mutant against primers containing a 3'-RNA residue. Mutant ID7 was designed based on similar conceptual framework. The H639 interacts with F667 amino acid and H639W mutant might also push F667 towards the incoming dNTP.
[0136] Additional mutations were considered that can effectively reduce the binding pocket size of the polymerase. Mutants IDs 8 to 16 were designed from a negative inferential analysis based on published studies of "relaxed specificity" mutant polymerases. Mutations have been reported that can modify polymerase specificity towards the ribose of the incoming dNTP. The prior art Taq DNA polymerase variants described were evolved from large random libraries either through selection or screening. Chen et al. described mutations that allow Taq DNA polymerase to incorporate a dNTP with large substituents on the ribose 3' carbon atom (Chen, F., et al., Proc. Nat. Acad. Sci. USA 2010, 107:1948-1953). This residue was found to be important because it also interacts with F667. The substitution L616A decreases specificity by giving more space to the phenylalanine residue. Mutant ID 8 (L616M) was designed to produce the opposite effect. The methionine substitution may subtly increase the steric constraints at this site compared to leucine. This restriction may make the active site less likely to accommodate extra substituents in a dNTP or in a primer nucleotide, which could reduce activity of 3'-RNA containing primers or those having a mismatch to template, which presumably occupies more space than primers having a perfect match to the template nucleic acid.
[0137] A similar conceptual framework was applied to design Taq DNA polymerase mutant ID 9. Mutations I614E, E615G were reported to relax the active site pocket, so that the polymerase could extend a primer using 2'-O-methyl ribonucleoside triphosphates (Fa, M., et al., J. Am. Chem. Soc. 2004, 126:1748-1754). The nature of these mutations is essentially the shift of glutamic acid from residue 615 to 614. A shift in the opposing direction, E615L, L616E may therefore impose constraints on the active site and produce a Taq DNA polymerase mutant that will not accept ribonucleotide residues.
[0138] Another approach to increasing 3'-nucleotide discrimination is to focus on sites of interest identified in Taq DNA polymerase studies that reported amino acid substitutions which increased base selection fidelity and decreased incorporation of mispaired base pairs (i.e., those mutation that improve replication fidelity). These changes could potentially affect selectivity of Taq DNA polymerase regarding to modifications of terminal primer nucleotide as well. One location that was reported to improve fidelity involves the F667 residue and neighboring amino acids (Suzuki, M., et al., J. Biol. Chem. 2000, 275:32728-32735). Another site of potential interest includes residues 782 to 784, adjacent to an essential aspartic acid residue (Strerath, M., et al., ChemBioChem 2007, 8:395-401). Mutants ID 10 to ID 13 were designed to alter amino acid character at these positions. F667 affects specificity as it interacts with the terminal base of the primer and stacks on the base of the incoming dNTP; this residue resides in the O-helix. Residues I665 and A661 are located on the opposite side of the helix. Mutation here to larger amino acids (A661E,I665W) may move the O-helix towards the active site, restricting the size of the active pocket and limiting ability of the polymerase to accept mispaired bases or RNA residues (Mutant ID 10: A661E,I665W,F667L).
[0139] Data derived from mutagenesis studies of different polymerases can also be used to help select positions for modification, but use of this data is more difficult in the absence of crystal structure or due to possible differences in effects between the polymerases. Polymerase I from Escherichia coli ("E. coli Pol") shows a somewhat similar structure at the active site when compared to Taq DNA polymerase and maintains identical essential catalytic residues. Both protein sequences exhibit high degree of homology (Li, Y., et al., EMBO J. 1998, 17: 7514-7525). Thus, mutations reported for Escherichia coli DNA polymerase were also considered, by extrapolating amino acid position to the corresponding positions in the Taq DNA polymerase. For example, the triplet amino acid substitutions, Q879P, V880L, H881Q, improved base fidelity of E. coli DNA polymerase (Summerer, D., et al., Angew. Chem. Int. Ed. 2005, 44:4712 -4715). Substitutions in mutant ID 14 includes substitutions at Q782, V783, H784 in the Taq DNA polymerase active site, which appear to correspond to this E. coli residue triplet.
[0140] A number of additional substitutions in the E. coli DNA polymerase are known which decrease or increase the specificity of primer extension (Minnick, D. T., et al., J. Biol. Chem. 1999, 274:3067-3075). Mutants Q849A and R754A improved fidelity. These have locations equivalent to Q754 and R659 in the Taq DNA polymerase active site, respectively. Arginine 659 has a significant impact on selection of the base complementary to the template base. This appears to be general feature in the polymerase A family. For example, in Thermotoga neapolitana polymerase I, the equivalent residue is R722. Mutation of this residue to histidine increases fidelity of this polymerase (Yang, S. W., et al., Nucleic Acids Res. 2002, 30:4314-4320). These two residues were also selected for study (mutants ID 15 and 16 of Table 3). Mutant ID 17 represents combination of the mutations studied in Mutants ID 2 and 3. Mutant ID 18 represents a modification of triple mutant ID 14 (Q782P, V783L, H784Q) reduced to a double mutant (V783L, H784Q) by eliminating the Q782P mutation; the substitution of a less flexible P for Q residue will likely cause significant structural perturbation which would alter function, and Mut ID 18 may avoid this problem. Initial testing indicated that more than one mutant at position H784 showed improved mismatch discrimination, suggesting that this position was generally important for determining primer specifcity. Therefore a comprehensive study of amino acid substitutions at this site was performed, comprising Mut IDs 19-36.
TABLE-US-00003 TABLE 3 Novel Taq DNA polymerase mutants selected for study. Specific amino acid changes from Mutant ID sequence in Table I 1 V783I 2 V783F 3 H784Q 4 R573H 5 Q582K 6 F667W 7 H639W 8 L616M 9 E615L, L616E 10 A661E, I665W, F667L 11 Q782I, H784F 12 Q782I, V783L, H784L 13 Q782S, V783F, H784N 14 Q782P, V783L, H784Q 15 Q754A 16 R659H 17 V783F, H784Q 18 V783L, H784Q 19 H784G 20 H784A 21 H784S 22 H784T 23 H784C 24 H784V 25 H784L 26 H784I 27 H784M 28 H784P 29 H784F 30 H784Y 31 H784W 32 H784D 33 H784E 34 H784N 35 H784K 36 H784R
[0141] The second component of the design strategy includes molecular biological and biochemical analyses of genetically-engineered Taq DNA polymerase mutants to identify novel enzymes having improved 3'-nucleotide discrimination. This requires expression of native Taq DNA polymerase and the series of designed mutants in a suitable host, such as the bacterium E. coli. To maximize expression, the codons of the native gene sequence encoding Taq DNA polymerase were altered and optimized for expression in E. coli using standard codon usage tables for this organism (see: Codon usage tabulated from the international DNA sequence databases: status for the year 2000. Nakamura, Y., Gojobori, T. and Ikemura, T. (2000) Nucleic Acids Res. 28:292). Codon optimization does not alter the amino acid sequence of the expressed protein. A recombinant form of a codon-optimized gene encoding the unaltered Taq DNA polymerase peptide was assembled and cloned into a plasmid vector as an artificial gene made from synthetic oligonucleotides using standard methods (Example 1). The plasmid vector for this purpose can be any plasmid vector routinely available in the art. Synthetic recombinant forms of the series of identified desired Taq DNA polymerase mutants (Table 3, Mutant IDs 1-36) were prepared by site directed mutagenesis of the previously assembled codon-optimized recombinant native Taq DNA polymerase as the substrate for site directed mutagenesis (SDM), using techniques well known to those with skill in the art (Example 1). The unmodified and mutant Taq DNA polymerases were prepared from E. coli host cells following introduction of expression vectors that contain the corresponding recombinant forms of the genes operably linked to suitable transcriptional and translational control elements.
[0142] The enzymatic properties of the unmodified Taq DNA polymerase and mutant Taq DNA polymerases were evaluated for primer extension assays, thermostability, PCR assays, allele-specific PCR assays, ability to employ primers having a 3'-ribonucleotide, as well as their suitability for use in rhPCR assays. The mutant Taq DNA polymerases displayed one of four categories of enzymatic properties: (1) inactivated polymerase activity; (2) normal polymerase activity; (3) improved 3'-nucleotide discrimination activity, but having reduced activity (for example, reduced processivity); and (4) improved 3'-nucleotide discrimination and having normal or near normal polymerase activity (for example, processivity comparable to the native polymerase).
[0143] Mutant Taq DNA polymerases having the fourth category of enzymatic properties displayed comparable or enhanced 3'-mismatch discrimination (that is, comparable or improved performance in standard primer extension assays and allele-specific PCR assays when compared to the wild-type Taq DNA polymerase); enhanced 3'-nucleotide discrimination (that is, reduced primer extension activity from templates containing RNA-containing primers when compared to the wild-type Taq DNA polymerase) and enhanced rare allele discrimination (for example, improved specificity in rhPCR assay when compared to the wild-type Taq DNA polymerase). These mutant Taq DNA polymerases include mutations at one of the following residue position(s): (1) A661E; I665W; F667L triple substitution mutant peptide (Mutant ID 10 of Table 3); (2) V783F single substitution mutant peptide (Mutant ID 2 of Table 3); H784Q single substitution mutant peptide (Mutant ID 3 of Table 3); and V783L; H784Q double substitution mutant peptide (Mutant ID 18 of Table 3), H784A, single substitution mutant peptide (Mutant ID 20 of Table 3); H784S, single substitution mutant peptide (Mutant ID 21 of Table 3); H784T, single substitution mutant peptide (Mutant ID 22 of Table 3); H784V, single substitution mutant peptide (Mutant ID 24 of Table 3); H784I, single substitution mutant peptide (Mutant ID 26 of Table 3); H784M, single substitution mutant peptide (Mutant ID 27 of Table 3); H784F, single substitution mutant peptide (Mutant ID 29 of Table 3); and H784Y single substitution mutant peptide (Mutant ID 30 of Table 3).
[0144] Thus, the novel design algorithm provides a robust approach to predict mutant DNA polymerases having improved 3'-nucleotide discrimination, as adjudged by their activity in allele-specific PCR, rare allele detection assays and rhPCR assays that utilize templates with or without a 3'-RNA residue in the primer. Specifically, residues V783 and H784 were identified as critical residues which influence the ability of the polymerase to interrogate the status of the 3'-base of the primer oligonucleotide (e.g., whether this residue is matched or mismatched with template and/or whether this residue is DNA or RNA). The significance of these residues in polymerase function was heretofore not appreciated. In addition to the mutations directly testing in the example, the present invention also contemplates other amino acid substitutions at these two positions, or double-mutants affecting both the V783 and H784 sites.
[0145] The properties of these mutants are further described in the Examples presented herein. Importantly, however, the design strategy employed herein enables access to functional space for novel Taq DNA polymerase mutants that were previously unrecognized or predicted or otherwise not obtained using other approaches (for example, phylogenetic comparative analysis or earlier attempts using random mutagenesis).
Evaluation of Taq DNA Polymerase Mutants at Residue Positions 783 and 784
[0146] The present disclosure demonstrates that mutation at residue positions 783 and/or 784 results in active Taq DNA polymerase mutants having enhanced template discrimination activity, as compared to unmodified Taq DNA polymerase. Thus, the entirety of the sequence space that includes every conceivable single amino acid substitution at the individual positions 783 or 784 as well as every conceivable double amino acid substitution at both positions 783 and 784 fall within the scope of the present disclosure as related to Taq DNA polymerase. Accordingly, those active Taq DNA polymerase mutants selected from the mutant sets of 19 single residue 783 mutants, 19 single residue 784 mutants (Table 3 Mut IDs 19-30) and 361 double residue 783/784 mutants that also possess enhanced template discrimination activity fall within the scope of the present disclosure.
[0147] Because Taq DNA polymerase is a thermostable enzyme, one facile approach to screening the candidate collection of 399 single- and double-substitution mutants at residue positions 783 and 784 is to perform a PCR assay with a pre-treated sample encoding a candidate Taq DNA polymerase mutant enzyme. The sample can be a selected individual colony or corresponding micro-cultures (for example, 50 .mu.L to 1.0 mL cultures) obtained from the individual colony transformed with recombinant DNA that expresses a desired recombinant Taq DNA polymerase mutant gene. The pre-treatment regimen can include the step of pre-incubating the sample at 70-95.degree. C., followed by the step of clarifying the supernatant to remove the denatured cellular debris. For samples that express thermostable polymerase activity under standard PCR assay conditions, the corresponding recombination DNA can be further characterized to confirm the sequence of the desired recombinant Taq DNA polymerase mutant genotype and the polymerase protein purified for additional biochemical analysis. For the purposes of this disclosure, a Taq DNA polymerase mutant that expresses thermostable polymerase activity at a level of at least 0.01 of that expressed by wild-type Taq DNA polymerase under comparable PCR assay conditions can be adjudged as possessing thermostable polymerase activity.
Evaluation of Other Select Polymerase Candidate Mutants Functionally Homologous to Taq DNA Polymerase at Residue Positions 783 and 784
[0148] Comparative phylogenetic analysis tools can be used to identify the sequence space of other thermoactive polymerases having homologous sequence information relative to the unmodified Taq DNA polymerase at residue positions corresponding to V783 and H784. As explained supra, a strong prediction of the comparative phylogenetic analysis is that structural sequences shared among DNA polymerases across phylogenetically diverse species are conserved for functional reasons. If the identified V783/H784 residues of Taq DNA polymerase are invariant in sequence identity among wild-type polymerases from diverse species, that observation strongly supports the conclusion that nature selected against the specific variation of amino acid substitutions at those positions that result the observed enhanced template discrimination activity of the engineered Taq DNA polymerase mutants disclosed herein.
[0149] Example 11 provides an exemplary BLAST search using Taq DNA polymerase sequences encompassing positions V783 and H784 as a comparison window to identify candidate wild-type DNA polymerases from other species sharing extensive sequence identity with Taq DNA polymerase. As further elaborated in Example 11, the BLAST results revealed that virtually every identified DNA polymerase from diverse species has maintained Val and His at positions orthologous to V783 and H784 of Taq DNA polymerase. Thus, the BLAST results confirm a natural counter-selection against DNA polymerases having enhanced template discrimination activity and provide strong evidence that the disclosed engineered Taq DNA polymerase mutants having these properties are novel and non-obvious. Like that observed with the engineered Taq DNA polymerase mutants, each of the identified non-Taq DNA polymerases represent a sequence space from which engineered mutant enzymes can be generated having enhanced template discrimination activity, as compared to their respective unmodified counterparts.
[0150] In those cases where comparative phylogenetic analysis cannot access the sequence space of more evolutionary distant organisms, a comparative biophysical crystallographic analysis can provide clues to the relevant sequence residues having functional homology to Taq DNA polymerase resides V783 and H784. As explained supra, the Q782, V783 and H784 residue triplet of Taq DNA polymerase was selected for analysis based upon the corresponding triplet amino acid substitutions Q879P, V880L and H881Q of E. coli DNA polymerase having improved base fidelity and a similar active site architecture to that of Taq DNA polymerase. Conversely, based upon the noted enhanced template discrimination activity of V783 and H784 Taq DNA polymerase mutants relative to wild-type Taq DNA polymerase, the present disclosure contemplates that the corresponding substitutions at V880 and H881 of the E. coli DNA polymerase will possess enhanced template discrimination activity relative to wild-type E. coli DNA polymerase.
Identification and Characterization of Non-VH-Related Polymerase Mutants having Enhanced Template Discrimination Activity.
[0151] The foregoing collection of DNA polymerases share extensively conserved sequences in the region corresponding to V783 and H784 of Taq DNA polymerase ("VH-related polymerases"). Comparative biophysical analysis is useful for identifying wild-type DNA polymerases having different amino acid sequences in the functionally homologous positions as V783 and H784 of Taq DNA polymerase ("non-VH-related DNA polymerases"). The instant disclosure contemplates engineering mutant polymerases having enhanced template discrimination activity from these non-VH-related DNA polymerases in the same manner as disclosed for the VH-related DNA polymerases. Candidate non-VH resides for directed mutagenesis and analysis by enhanced template discrimination activity assays include those resides within 0.40-0.45 nm of the C2' of the primer terminal residue, as revealed in the polymerase:template co-crystal structure.
Combination of Site-Specific Taq DNA Mutants with Deletion of the 5'-Exonuclease Domain.
[0152] The present invention discloses novel Taq DNA Polymerase mutants that show improved discrimination of mismatches positioned at the 3'-residue of the primer oligonucleotide and/or discrimination against the presence of an RNA residue at the 3'-end of the primer oligonucleotide. Improved mismatch discrimination has been described for the "KlenTaq" deletion mutant of Taq DNA Polymerase, which entirely removes the domain having 5'-exonuclease activity (Barnes, W. M., Gene 112:29-35, 1992). Combination of the novel mutants of the present invention with the KlenTaq 5'-exonuclease domain deletion led to further improvements in mismatch discrimination (Examples 18-22), however this comination led to decreases in enzymatic activity which may reduce utility of this family of double-mutants. In some circumstances, particularly when amplicon size is small and limited processivity could be tolerated, the enhanced decrimination of these mutants will have benefit.
Reaction Mixtures
[0153] In another aspect, reaction mixtures are provided comprising the polymerases with increased 3'-nucleotide discrimination activity. The reaction mixtures can further comprise reagents for use in, for example, nucleic acid amplification procedures (for example, PCR, RT-PCR, rhPCR), DNA sequencing procedures, or DNA labeling procedures. For example, in certain embodiments, the reaction mixtures comprise a buffer suitable for a primer extension reaction. The reaction mixtures can also contain a template nucleic acid (DNA and/or RNA), one or more primer or probe polynucleotides, nucleoside triphosphates (including, for example, deoxyribonucleotides, ribonucleotides, labeled nucleotides, unconventional nucleotides), salts (for example, Mn.sup.2+, Mg.sup.2+), and labels (for example, fluorophores). In some embodiments, the reaction mixture further comprises double stranded DNA binding dyes, such as SYBR green, or double stranded DNA intercalating dyes, such as ethidium bromide. In some embodiments, the reaction mixtures contain a 5'-sense primer hybridizable, under primer extension conditions, to a predetermined polynucleotide template, or a primer pair comprising the 5'-sense primer and a corresponding 3'-antisense primer. In certain embodiments, the reaction mixture further comprises a fluorogenic FRET hydrolysis probe for detection of amplified template nucleic acids, for example a Taqman.RTM. or PrimeTime.RTM. probe. In some embodiments, the reaction mixture contains two or more primers that are fully complementary to single nucleotide polymorphisms or multiple nucleotide polymorphisms. In some embodiments, the reaction mixtures contain alpha-phosphorothioate dNTPs, dUTP, dITP, and/or labeled dNTPs such as, for example, fluorescein- or cyanin-dye family dNTPs. In some embodiments, the reaction mixtures contain blocked-cleavable primers and RNase H2.
Kits
[0154] In another aspect, kits are provided for use in primer extension methods described herein. In some embodiments, the kit is compartmentalized for ease of use and contains at least one container providing a DNA polymerase of the invention having increased 3'-nucleotide discrimination in accordance with the present disclosure. One or more additional containers providing additional reagent(s) can also be included. Such additional containers can include any reagents or other elements recognized by the skilled artisan for use in primer extension procedures in accordance with the methods described above, including reagents for use in, for example, nucleic acid amplification procedures (for example, PCR, RT-PCR, rhPCR), DNA sequencing procedures, or DNA labeling procedures. For example, in certain embodiments, the kit further includes a container providing a 5'-sense primer hybridizable, under primer extension conditions, to a predetermined polynucleotide template, or a primer pair comprising the 5'-sense primer and a corresponding 3'-antisense primer. In some embodiments, the kit includes one or more containers containing one or more primers that are fully complementary to single nucleotide polymorphisms or multiple nucleotide polymorphisms, wherein the primers are useful for multiplex reactions, as described above. In some embodiments, the reaction mixtures contain one or more containers containing blocked-cleavable primers. In some embodiments, the reaction mixtures contain one or more containers containing RNase H2. In other, non-mutually exclusive variations, the kit includes one or more containers providing nucleoside triphosphates (conventional and/or unconventional). In specific embodiments, the kit includes alpha-phosphorothioate dNTPs, dUTP, dITP, and/or labeled dNTPs such as, for example, fluorescein- or cyanine-dye family dNTPs. In still other, non-mutually exclusive embodiments, the kit includes one or more containers providing a buffer suitable for a primer extension reaction. In some embodiments, the kit includes one or more labeled or unlabeled probes. Examples of probes include dual-labeled FRET (fluorescence resonance energy transfer) probes and molecular beacon probes. In another embodiment, the kit contains an aptamer, for example, for hot start PCR assays.
[0155] The present disclosure contemplates kits that provide novel DNA polymerases having enhanced template discrimination activity. As demonstrated in more detail in the examples, each DNA polymerase can display a unique signature of enhanced template discrimination activity. Certain DNA polymerases can display a relatively greater 3'-nucleotide discrimination, as compared to its other activities (3'-mismatch discrimination and rare allele discrimination), while other DNA polymerases can display a relatively greater 3'-mismatch discrimination, as compared to its other activities (3'-nucleotide discrimination and rare allele discrimination), and yet other DNA polymerases can display a relatively greater rare allele discrimination, as compared to its other activities (3'-nucleotide discrimination and 3'-mismatch discrimination). Accordingly, kits can include individual containers of specific DNA polymerases having an activity profile optimally tailored to a specific enhanced template discrimination activity for a specific assay platform. Alternatively, kits can include a single container that includes a plurality of DNA polymerases having an activity profile optimally tailored to accommodate enhanced template discrimination activity as may be needed for a plurality of assay platforms.
EXAMPLES
[0156] The present invention is further illustrated by reference to the following Examples. However, it should be noted that these Examples, like the embodiments described above, are illustrative and are not to be construed as restricting the enabled scope of the invention in any way.
Example 1
Cloning and Expression of a Codon Optimized DNA Polymerase from Thermus aquaticus
[0157] The amino acid and gene sequences for Taq DNA polymerase are known (Table 1, SEQ ID NOs. 1 and 2). Because codon usage differs among organisms, the codons of the native gene sequence encoding Taq DNA polymerase were optimized for expression in E. coli using standard codon usage tables (see: Codon usage tabulated from the international DNA sequence databases: status for the year 2000. Nakamura, Y., Gojobori, T. and Ikemura, T. (2000) Nucleic Acids Res. 28:292); synonymous codon changes were introduced to avoid repeated use of identical codons over a 20 amino acid stretch. A recombinant codon-optimized gene encoding the Taq DNA polymerase unmodified peptide was assembled from synthetic oligonucleotides using standard methods. The gene was made in three fragments, each of which was subcloned in a plasmid vector; sequences are shown in Table 4 (SEQ ID NOs. 3-5). Sequence identity was verified by Sanger DNA sequencing. The three Taq DNA polymerase subfragments were assembled together using the Gibson assembly method (Gibson, D. G. et al. Nature Methods, 343-345 (2009)) and cloned into a the plasmid expression vector pET-27b(+) using terminal Nde I and Not I restrictions sites to create a final, full-length codon optimized Taq DNA polymerase gene (designated "OptiTaq"). Sequence was verified by Sanger DNA sequencing; sequence is shown in Table 4 (SEQ ID NO. 6). The translated amino acid sequence of the new codon optimized gene is identical to native Taq DNA polymerase (Table 1, SEQ ID NO. 1).
TABLE-US-00004 TABLE 4 DNA sequence of Tag DNA Polymerase codon-optimized for expression in E. coli. Name Sequence SEQ ID NO. 3 CATATGCGTGGTATGCTGCCGTTGTTCGAGCCTAAAGGCCGCGTACTGTTAGTCGATGGTCA Taq subfragment TCACTTGGCCTATCGGACGTTCCATGCACTCAAAGGTCTGACGACCAGTCGTGGCGAACCGG #1 TCCAGGCTGTTTATGGTTTCGCTAAGTCTTTGCTCAAAGCACTGAAAGAAGACGGGGACGCG GTAATTGTTGTATTTGATGCCAAAGCACCGAGCTTCCGCCACGAAGCTTATGGTGGCTACAA GGCAGGACGCGCCCCTACCCCAGAAGATTTCCCCCGTCAGCTGGCATTAATTAAGGAGTTAG TAGACCTTCTCGGCTTAGCGCGTCTGGAAGTTCCGGGTTATGAGGCGGACGATGTCCTTGCA TCCTTGGCTAAAAAGGCCGAAAAAGAGGGCTACGAAGTCCGCATCTTGACGGCAGACAAAGA TCTGTACCAGCTTCTGTCTGACCGTATTCATGTTTTGCACCCTGAAGGCTACTTAATCACTC CGGCCTGGCTCTGGGAAAAGTACGGTCTGCGTCCCGATCAGTGGGCGGATTATCGGGCTTTG ACGGGAGATGAGAGCGACAACCTGCCAGGAGTTAAGGGCATTGGTGAAAAAACCGCACGTAA GCTGCTTGAAGAGTGGGGTTCCCTGGAAGCCTTGTTAAAAAATCTGGATCGTCTCAAGCCCG CAATTCGTGAAAAGATCCTGGCTCATATGGACGATCTTAAATTAAGTTGGGACCTGGCCAAG GTGCGCACCGATTTACCGCTTGAAGTGGATTTTGCAAAACGCCGTGAGCCGGACCGGGAACG TTTACGCGCTTTCTTAGAGCGTCTGGAATTCGGTTCACTGCTTCATGAATTCGGTCTGT SEQ ID NO. 4 TCGGTTCACTGCTTCATGAATTCGGTCTGTTAGAGTCTCCTAAAGCACTCGAAGAGGCACCG Taq subfragment TGGCCGCCCCCAGAAGGTGCTTTTGTTGGCTTCGTACTTTCCCGTAAGGAGCCTATGTGGGC #2 AGATCTTCTGGCTTTAGCGGCTGCACGCGGTGGCCGTGTTCACCGGGCCCCTGAGCCATACA AAGCGTTACGTGATCTGAAGGAAGCACGTGGCTTGCTGGCAAAAGACCTTTCTGTTTTGGCC CTGCGCGAGGGTCTTGGACTGCCGCCAGGCGACGATCCCATGTTATTGGCCTATCTGTTAGA CCCTAGCAATACCACACCTGAAGGGGTCGCTCGTCGGTATGGCGGTGAATGGACTGAGGAAG CCGGAGAGCGCGCCGCATTGTCCGAACGGCTCTTTGCAAACTTATGGGGTCGTCTGGAAGGG GAGGAACGTCTGTTATGGTTGTATCGGGAAGTCGAACGTCCTCTTTCGGCCGTATTAGCGCA TATGGAGGCAACAGGTGTGCGTTTAGATGTCGCGTACCTTCGGGCCTTATCACTGGAAGTTG CAGAGGAAATCGCCCGTCTCGAGGCTGAAGTGTTCCGGTTGGCCGGTCACCCGTTTAACCTC AACTCCCGTGACCAGCTGGAACGCGTTTTATTCGATGAGCTTGGGCTTCCCGCAATTGGCAA AACCGAAAAGACTGGCAAACGCAGTACGAGCGCTGCCGTCCTTGAGGCACTCCGCGAGGCTC ACCCTATTGTAGAAAAGATCCTGCAATACCGTGAGTTGACGAAGCTTAAAAGCACTTATATT GATCCTCTCCCGGATCTGATCCATCCTCGTACCGGCCGCTTGCACACACGTTTCAACCAGAC GGCGACTGCAAC SEQ ID NO. 5 CACACGTTTCAACCAGACGGCGACTGCAACCGGCCGTCTGTCTAGCTCGGATCCAAATCTCC Taq subfragment AGAACATTCCGGTCCGTACACCCTTGGGCCAACGTATCCGCCGGGCGTTTATCGCTGAGGAA #3 GGATGGTTACTGGTCGCATTGGACTACTCGCAGATTGAGCTGCGCGTCCTCGCACATCTCTC TGGTGACGAAAATTTAATCCGCGTGTTTCAAGAGGGGCGTGATATTCACACAGAAACTGCCT CATGGATGTTCGGTGTCCCACGTGAAGCAGTGGATCCTTTGATGCGCCGTGCAGCTAAAACA ATTAATTTTGGAGTGCTGTACGGAATGAGCGCTCATCGCTTGAGTCAGGAACTGGCAATCCC CTACGAGGAAGCGCAGGCATTCATCGAACGTTACTTTCAATCGTTTCCGAAAGTTCGCGCAT GGATCGAGAAGACGCTCGAGGAAGGTCGTCGTCGGGGCTATGTCGAAACTCTGTTTGGTCGC CGTCGGTACGTACCAGATCTTGAAGCCCGCGTCAAATCGGTACGGGAGGCTGCGGAGCGTAT GGCATTTAATATGCCTGTACAGGGTACTGCAGCTGACCTCATGAAACTGGCAATGGTCAAGC TTTTCCCGCGCTTGGAGGAAATGGGCGCACGTATGCTTCTGCAGGTCCATGACGAGCTGGTG TTAGAAGCCCCTAAGGAGCGCGCCGAAGCTGTCGCGCGCCTCGCTAAAGAAGTGATGGAGGG CGTTTACCCATTGGCCGTACCCCTCGAAGTGGAGGTCGGTATTGGAGAAGATTGGTTATCTG CAAAGGAAGCGGCCGC SEQ ID NO. 6 CATATGCGTGGTATGCTGCCGTTGTTCGAGCCTAAAGGCCGCGTACTGTTAGTCGATGGTCA Complete codon- TCACTTGGCCTATCGGACGTTCCATGCACTCAAAGGTCTGACGACCAGTCGTGGCGAACCGG optimized Taq TCCAGGCTGTTTATGGTTTCGCTAAGTCTTTGCTCAAAGCACTGAAAGAAGACGGGGACGCG DNA polymerase GTAATTGTTGTATTTGATGCCAAAGCACCGAGCTTCCGCCACGAAGCTTATGGTGGCTACAA "OptiTaq" GGCAGGACGCGCCCCTACCCCAGAAGATTTCCCCCGTCAGCTGGCATTAATTAAGGAGTTAG TAGACCTTCTCGGCTTAGCGCGTCTGGAAGTTCCGGGTTATGAGGCGGACGATGTCCTTGCA TCCTTGGCTAAAAAGGCCGAAAAAGAGGGCTACGAAGTCCGCATCTTGACGGCAGACAAAGA TCTGTACCAGCTTCTGTCTGACCGTATTCATGTTTTGCACCCTGAAGGCTACTTAATCACTC CGGCCTGGCTCTGGGAAAAGTACGGTCTGCGTCCCGATCAGTGGGCGGATTATCGGGCTTTG ACGGGAGATGAGAGCGACAACCTGCCAGGAGTTAAGGGCATTGGTGAAAAAACCGCACGTAA GCTGCTTGAAGAGTGGGGTTCCCTGGAAGCCTTGTTAAAAAATCTGGATCGTCTCAAGCCCG CAATTCGTGAAAAGATCCTGGCTCATATGGACGATCTTAAATTAAGTTGGGACCTGGCCAAG GTGCGCACCGATTTACCGCTTGAAGTGGATTTTGCAAAACGCCGTGAGCCGGACCGGGAACG TTTACGCGCTTTCTTAGAGCGTCTGGAATTCGGTTCACTGCTTCATGAATTCGGTCTGTTAG AGTCTCCTAAAGCACTCGAAGAGGCACCGTGGCCGCCCCCAGAAGGTGCTTTTGTTGGCTTC GTACTTTCCCGTAAGGAGCCTATGTGGGCAGATCTTCTGGCTTTAGCGGCTGCACGCGGTGG CCGTGTTCACCGGGCCCCTGAGCCATACAAAGCGTTACGTGATCTGAAGGAAGCACGTGGCT TGCTGGCAAAAGACCTTTCTGTTTTGGCCCTGCGCGAGGGTCTTGGACTGCCGCCAGGCGAC GATCCCATGTTATTGGCCTATCTGTTAGACCCTAGCAATACCACACCTGAAGGGGTCGCTCG TCGGTATGGCGGTGAATGGACTGAGGAAGCCGGAGAGCGCGCCGCATTGTCCGAACGGCTCT TTGCAAACTTATGGGGTCGTCTGGAAGGGGAGGAACGTCTGTTATGGTTGTATCGGGAAGTC GAACGTCCTCTTTCGGCCGTATTAGCGCATATGGAGGCAACAGGTGTGCGTTTAGATGTCGC GTACCTTCGGGCCTTATCACTGGAAGTTGCAGAGGAAATCGCCCGTCTCGAGGCTGAAGTGT TCCGGTTGGCCGGTCACCCGTTTAACCTCAACTCCCGTGACCAGCTGGAACGCGTTTTATTC GATGAGCTTGGGCTTCCCGCAATTGGCAAAACCGAAAAGACTGGCAAACGCAGTACGAGCGC TGCCGTCCTTGAGGCACTCCGCGAGGCTCACCCTATTGTAGAAAAGATCCTGCAATACCGTG AGTTGACGAAGCTTAAAAGCACTTATATTGATCCTCTCCCGGATCTGATCCATCCTCGTACC GGCCGCTTGCACACACGTTTCAACCAGACGGCGACTGCAACCGGCCGTCTGTCTAGCTCGGA TCCAAATCTCCAGAACATTCCGGTCCGTACACCCTTGGGCCAACGTATCCGCCGGGCGTTTA TCGCTGAGGAAGGATGGTTACTGGTCGCATTGGACTACTCGCAGATTGAGCTGCGCGTCCTC GCACATCTCTCTGGTGACGAAAATTTAATCCGCGTGTTTCAAGAGGGGCGTGATATTCACAC AGAAACTGCCTCATGGATGTTCGGTGTCCCACGTGAAGCAGTGGATCCTTTGATGCGCCGTG CAGCTAAAACAATTAATTTTGGAGTGCTGTACGGAATGAGCGCTCATCGCTTGAGTCAGGAA CTGGCAATCCCCTACGAGGAAGCGCAGGCATTCATCGAACGTTACTTTCAATCGTTTCCGAA AGTTCGCGCATGGATCGAGAAGACGCTCGAGGAAGGTCGTCGTCGGGGCTATGTCGAAACTC TGTTTGGTCGCCGTCGGTACGTACCAGATCTTGAAGCCCGCGTCAAATCGGTACGGGAGGCT GCGGAGCGTATGGCATTTAATATGCCTGTACAGGGTACTGCAGCTGACCTCATGAAACTGGC AATGGTCAAGCTTTTCCCGCGCTTGGAGGAAATGGGCGCACGTATGCTTCTGCAGGTCCATG ACGAGCTGGTGTTAGAAGCCCCTAAGGAGCGCGCCGAAGCTGTCGCGCGCCTCGCTAAAGAA GTGATGGAGGGCGTTTACCCATTGGCCGTACCCCTCGAAGTGGAGGTCGGTATTGGAGAAGA TTGGTTATCTGCAAAGGAAGCGGCCGC For the final completed "OptiTaq" clone, Nde I and Not I restrictions sites are underlined. The ATG start codon is identified in bold font.
Example 2
Production of Codon Optimized Taq DNA Polymerase Mutants
[0158] Eighteen mutant versions of Taq DNA polymerase (Table 3, Mut IDs 1-18) were made by site directed mutagenesis of the cloned OptiTaq codon-optimized Taq DNA polymerase. Specific mutations were introduced into the OptiTaq sequence using the method of PCR site-directed mutagenesis (Weiner M P, et al., Gene. 151(1-2):119-23 (1994)). Each mutagenesis reaction employed 10 pmoles of two complementary oligonucleotides (Table 5) containing the desired base changes, annealed to the double-stranded OptiTaq plasmid (20 ng), 5 U KOD DNA polymerase (Novagen-EMD Chemicals, San Diego, Calif.), 1.5 mM MgSO.sub.4, in 1.times. KOD PCR buffer. Thermal cycling parameters were 95.degree. C. for 3 minutes (95.degree. C. for 20 sec-55.degree. C. for 20 sec-70.degree. C. for 2.5 minutes) for 16 cycles followed by a 70.degree. C. soak for 4 minutes. After PCR site-directed mutagenesis, the amplified product was treated with 10 U of Dpn I (NEB, Ipswich, Mass.), at 37.degree. C. for 1 hour, followed by inactivation at 80.degree. C. for 20 minutes. 1/110.sup.th of the digestion material was transformed into XL-1 Blue competent bacteria. Bacterial clones were isolated, plasmid DNA prepared, and individual mutations were confirmed by Sanger DNA sequencing. All mutants remained in the pET-27b(+) expression vector, which is suitable for expressing the recombinant proteins in E. coli.
TABLE-US-00005 TABLE 5 Oligonucleotides used for site-directed mutagenesis to produce 18 Tag DNA Polymerase mutants. Amino Sequence'' Sequence'' Mutant acid Sense mutagenesis SEQ Antisense mutagenesis SEQ ID changes oligonucleotide ID No. oligonucleotide ID No. 1 V783I aatgggcgcacgtatgcttct 7 gggcttctaacaccagctcgtca 8 gcagATTcatgacgagctggt tgAATctgcagaagcatacgtgc gttagaagccc gcccatt 2 V783F aatgggcgcacgtatgcttct 9 gggcttctaacaccagctcgtca 10 gcagTTCcatgacgagctggt tgGAActgcagaagcatacgtgc gttagaagccc gcccatt 3 H784Q gggcgcacgtatgcttctgca 11 taggggcttctaacaccagctcg 12 ggtcCAGgacgagctggtgtt tcCTGgacctgcagaagcatacg agaagccccta tgcgccc 4 R573H caaccagacggcgactgcaac 13 ggagatttggatccgagctagac 14 cggcCATctgtctagctcgga agATGgccggttgcagtcgccgt tccaaatctcc ctggttg 5 Q582K tctgtctagctcggatccaaa 15 ccaagggtgtacggaccggaatg 16 tctcAAAaacattccggtccg ttTTTgagatttggatccgagct tacacccttgg agacaga 6 F667W gcgccgtgcagctaaaacaat 17 gagcgctcattccgtacagcact 18 taatTGGggagtgctgtacgg ccCCAattaattgttttagctgc aatgagcgctc acggcgc 7 H639W cgtgtttcaagaggggcgtga 19 cgaacatccatgaggcagtttct 20 tattTGGacagaaactgcctc gtCCAaatatcacgcccctcttg atggatgttcg aaacacg 8 L616M cgcattggactactcgcagat 21 caccagagagatgtgcgaggacg 22 tgagATGcgcgtcctcgcaca cgCATctcaatctgcgagtagtc tctctctggtg caatgcg 9 E615L ggtcgcattggactactcgca 23 caccagagagatgtgcgaggacg 24 L616E gattCTGGAGcgcgtcctcgc cgCTCCAGaatctgcgagtagtc acatctctctggtg caatgcgacc 10 A661E cgtgaagcagtggatcctttg 25 gcgatgagcgctcattccgtaca 26 I665W atgcgccgtGAAgctaaaaca gcactccCAAattCCAtgtttta F667L TGGaatTTGggagtgctgtac gcTTCacggcgcatcaaaggatc ggaatgagcgctcatcgc cactgcttcacg 28 11 Q782I ggaaatgggcgcacgtatgct 27 taggggcttctaacaccagctcg H784F tctgATCgtcTTCgacgagct tcGAAgacGATcagaagcatacg ggtgttagaagccccta tgcgcccatttcc 12 Q782I ggaaatgggcgcacgtatgct 29 taggggcttctaacaccagctcg 30 V783L tctgATTTTGCTGgacgagct tcCAGCAAAATcagaagcatacg H784L ggtgttagaagccccta tgcgcccatttcc 13 Q782S ggaaatgggcgcacgtatgct 31 taggggcttctaacaccagctcg 32 V783F tctgTCCTTCAACgacgagct tcGTTGAAGGAcagaagcatacg H784N ggtgttagaagccccta tgcgcccatttcc 14 Q782P ggaaatgggcgcacgtatgct 33 taggggcttctaacaccagctcg 34 V783L tctgCCGTTACAGgacgagct tcCTGTAACGGcagaagcatacg H784Q ggtgttagaagccccta tgcgcccatttcc 15 Q754A gcgtatggcatttaatatgcc 35 gtttcatgaggtcagctgcagta 36 tgtaGCGggtactgcagctga ccCGCtacaggcatattaaatgc cctcatgaaac catacgc 16 R659H acgtgaagcagtggatccttt 37 caaaattaattgttttagctgca 38 gatgCACcgtgcagctaaaac cgGTGcatcaaaggatccactgc aattaattttg ttcacgt 17 V783F aatgggcgcacgtatgcttct 39 GcttctaacaccagctcgtcCTG 40 H784Q gcagTTCCAGgacgagctggt GAActgcagaagcatacgtgcgc gttagaagc ccatt 18 V783L aatgggcgcacgtatgcttct 41 gggcttctaacaccagctcgtcC 42 H784Q gcagCTGCAGgacgagctggt TGCAGctgcagaagcatacgtgc gttagaagccc gcccatt DNA bases identical to codon optimized OptiTaq are shown in lower case; those specific for the mutations introduced by site-directed mutagenesis are shown in upper case.
Example 3
Expression of Recombinant Taq DNA Polymerases
[0159] The following example demonstrates the expression of recombinant Taq DNA polymerase unmodified and mutant peptides. The synthetic gene sequences from Examples 1, 2 and 12 were cloned in the pET-27b(+) expression vector (Novagen, EMD Biosciences, La Jolla, Calif.). This vector places six histidine residues (which together comprise a "His-tag") at the carboxy terminus of the expressed peptide, followed by a stop codon. A "His-tag" permits use of rapid, simple purification of recombinant proteins using Ni.sup.2+ affinity chromatography methods which are well known to those with skill in the art. Alternatively, the synthetic genes could be expressed in native form without the His-tag and purified using size exclusion chromatography, anion-exchange chromatography, or other such methods, which are also well known to a person of ordinary skill in the art.
[0160] BL21(DE3) competent E. coli cells (Novagen) were transformed with .about.1 ng of each plasmid. Briefly, plasmids were added to the cells on ice and gently stirred. After a 5 minute incubation on ice, cells were heat shocked at 42.degree. C. for 30 seconds, then returned to ice for 2 minutes. Room temperature SOC (80 .mu.L) was added to the transformed cells, followed by a 1 hour outgrow period at 37.degree. C., with agitation at 250 rpm. Cells were plated (20 .mu.L) on 37.degree. C. pre-warmed LB/Kan plates (Luria Broth agar plates supplemented with 50 .mu.g/mL kanamycin) and were placed at 37.degree. C. overnight. The next morning, one colony was picked and grown (37.degree. C., 250 rpm) in 10 mL LB/Kan broth (50 .mu.g/mL) to log phase (OD600 0.3-0.9). Cells were then induced with Overnight Express.TM. Autoinduction System 1 (Novagen) in Terrific Broth at 37.degree. C., 250 rpm following the protocol recommended by the manufacturer. Culture volumes were 100 mL for wild type OptiTaq and 200 mL for mutants. Growth saturation was reached after 18 hours, and the culture was pelleted at 10,000.times.g for 10 minutes in a Beckman Avanti.TM. J-25 Centrifuge. The pellet (.about.6 g) was lysed using 30 mL BugBuster.RTM. Protein Extraction Reagent (Novagen), 30 kU rLysozyme.TM. Solution (Novagen) and 1500 U DNase I (Life Technologies, Grand Island, N.Y.) to release soluble proteins and degrade nucleic acids according to the manufacturer's instructions. Following centrifugation at 15,000.times.g for 20 minutes to remove cell debris, the lysates were heated at 75.degree. C. for 15 minutes to inactive DNase I and other cellular nucleases. The lysates were then spun at 15,000.times.g for 20 minutes to sediment denatured protein. The heat denaturation and centrifugation steps provide significant purity enrichment of the recombinant enzymes. Both "total" and "soluble" fractions of the bacterial lysates were analyzed using SDS 4-20% polyacrylamide gel electrophoresis for 1 hour at 125 V. Proteins were visualized with Coomassie Blue staining for 1 hour, followed by 3-4 rounds of destaining until protein bands were clear.
[0161] The recovered soluble protein was passed over a Ni.sup.2+ affinity column containing His Bind Resin (Novagen) and eluted with a buffer containing 200 mM imidazole (200 mM imidazole, 500 mM NaCl, 20 mM Tris-HCl, pH 7.9). The purified protein (.about.6 mL) was then concentrated at 3210.times.g in a Beckman Coulter 6R tabletop centrifuge swinging bucket rotor using an Amicon Ultra-15, PLGC Ultracel-PL Membrane, 10 KDa concentrator (EMD Millipore, Billerica, Mass.) to .about.200 .mu.L and stored at -20.degree. C. until dialysis. The concentrated protein was then dialyzed against storage buffer (20 mM Tris pH 7.5, 100 mM NaCl, 1 mM DTT, 0.1 mM EDTA, 50% glycerol, 0.1% Triton X-100) at 4.degree. C. overnight, followed by 3.times.2 hours (at 1000 fold ratio of protein solution to dialysis buffer each time). The final purified protein was stored at -20.degree. C. Using this protocol, 100 mL of an autoinduced culture yielded .about.1.2 mg/67.6 .mu.M/12,168 pmol of purified soluble protein for OptiTaq. Similar yields were obtained for the mutant DNA polymerases.
[0162] To determine protein concentration, samples were examined alongside known quantities of BSA (bovine serum albumin) using SDS 4-20% polyacrylamide gel electrophoresis for 1 hour. Proteins were visualized with Coomassie Blue staining for 1 hour, followed by 3-4 rounds of destaining until protein bands were clear. Band intensity was analyzed using ImageJ software (National Institutes of Health, Bethesda, Md.).
[0163] To evaluate purity and quality of the recombinant protein preparations, 500 ng of each recombinant protein (wild type OptiTaq and each mutant) were separated on a 4-20% SDS-PAGE gel, stained with Coomassie Blue, and visualized. The recombinant proteins all migrate at the appropriate position on the gel for proteins having a molecular weight of 97.1 kDa. The preparations show relatively high purity with few additional species detected. Gel images are shown in FIGS. 2A, 2B, 2C, and 2D. Similar gels were run for MUT IDs 22 (H784T), 24 (H784V), 30 (H784Y), 31 (H784W), and 35 (H784K), and single bands corresponding to the desired recombinant protein were visualized (data not shown).
[0164] The purified enzymes were tested for nuclease contamination using DNaseAlert.TM. and RNaseAlert.RTM. nuclease detection kits (Integrated DNA Technologies, Coralville, Iowa) following protocols recommended by the manufacturer. All enzyme preparations were determined to be free of contaminating nucleases.
Example 4
Characterization of Properties of 18 Mutant Taq DNA Polymerases in PCR
[0165] The 18 mutant Taq DNA polymerase enzymes described in Example 3 were characterized for polymerase activity and the ability to discriminate a 3'-RNA residue in the primer oligonucleotide.
[0166] The unit activity of the purified wild-type protein was determined by comparing performance in qPCR of known quantities of OptiTaq and each mutant compared to a commercial non-hot-start Taq DNA polymerase, Taq-B DNA Polymerase (Enzymatics, Beverly, Mass.). Quantification cycle values (Cq, the amplification cycle number at which positive signal is first detected) and amplification curve shapes were analyzed to determine the nanogram amounts at which both enzymes performed similarly in the suboptimal range for each. Using these nanogram amounts and known unit values of Taq-B DNA polymerase, relative activity unit values could be extrapolated for all of the mutant DNA polymerase enzymes having sufficient activity to support PCR.
[0167] The following reaction conditions were employed: 1.times. qPCR buffer (20 mM Tris pH 8.4, 50 mM KCl, 3 mM MgCl.sub.2, 0.01% Triton-X100), 800 .mu.M dNTPs (200 .mu.M each), 500 nM For primer (Hs HPRT F517, SEQ ID NO. 43), 500 nM Rev primer (Hs HPRT R591, SEQ ID NO. 44), 250 nM probe (Hs HPRT P554, SEQ ID NO. 45), 2.times.10.sup.3 copies of linearized cloned plasmid template (HPRT-targ, SEQ ID NO. 46), in 10 .mu.L final volume. The amount of DNA polymerase added to each reaction was varied as follows: for wild type (OptiTaq), reactions were set using 10, 1, 0.1, 0.01, and 0.001 U/.mu.L (220, 22, 2.2, 0.22, or 0.022 ng of protein per 10 .mu.L reaction). Mutant polymerases were run in similar concentrations. In addition, those mutant enzymes showing polymerase activity were more finely titrated testing 220, 22, 10.6, 4.8, 2.2, 1.1, 0.48, and 0.22 ng of protein per 10 .mu.L reaction. Enzyme dilutions were made in enzyme dilution buffer (20 mM Tris pH 7.5, 100 mM NaCl, 1 mM DTT, 0.1% Triton-X100, 1 mg/mL BSA, 10% glycerol). Reactions were run in 384 well format on a BIO-RAD CFX384.TM. Real-Time System (BIO-RAD, Hercules, Calif.) using cycling parameters 95.degree. C. for 30 seconds followed by 60 cycles of [95.degree. C. for 15 seconds followed by 60.degree. C. for 1 minutes]. Detection was achieved using a fluorescence-quenched probe (5'-nuclease assay format, note that the mutations introduced into the present series of Taq mutants do not lie in the 5'-nuclease domain). Sequences of the primers, probe, and template (plasmid insert) are shown in Table 6.
TABLE-US-00006 TABLE 6 Sequence of oligonucleotides employed in Taq DNA polymerase activity assay. Name Sequence SEQ ID NO. Hs HPRT GACTTTGCTTTCCTTGGTCAG SEQ ID NO. 43 F517 Hs HPRT GGCTTATATCCAACACTTCGTG SEQ ID NO. 44 R591 Hs HPRT FAM-ATGGTCAAG(ZEN)GTCGCAAGCTTGCTGGT-IBFQ SEQ ID NO. 45 P554 HPRT- GACTTTGCTTTCCTTGGTCAGGCAGTATAATCCAAAGATG SEQ ID NO. 46 targ GTCAAGGTCGCAAGCTTGCTGGTGAAAAGGACCCCACGAA GTGTTGGATATAAGCC Nucleic acid sequences are shown 5'-3'. FAM = 6-carboxyfluorescein, IBFQ = Iowa Black FQ (fluorescence quencher), and ZEN = ZEN internal fluorescence quencher.
[0168] These 18 Taq DNA polymerase mutants were characterized as outlined above. Results are summarized in Table 7. Six mutants, including Mutant IDs 4, 5, 9 12, 13, and 17, did not show detectable DNA polymerase activity and were not studied further. Six mutants, Mutant IDs 6, 7, 11, 14, 15, and 16 had DNA polymerase activity; however, processivity was reduced from 4-50 fold relative to the wild type enzyme. Six mutants, Mutant IDs 1, 2, 3, 8, 10, and 18, showed DNA polymerase activity similar to wild type OptiTaq.
TABLE-US-00007 TABLE 7 Novel Taq DNA polymerase mutants selected for initial study. Amino acid .DELTA.Cq Delay in Mutant changes from Polymerase Relative priming from ID wild-type Taq Activity activity* an RNA base** 1 V783I Yes 1 0 2 V783F Yes 1 1 3 H784Q Yes 1 1 4 R573H No -- -- 5 Q582K No -- -- 6 F667W Yes 0.25 9 7 H639W Yes 0.02 20 8 L616M Yes 1 0 9 E615L, L616E No -- -- 10 A661E, I665W, Yes 1 2.9 F667L 11 Q782I, H784F Yes 0.20 2 12 Q782I, V783L, No -- -- H784L 13 Q782S, V783F, No -- -- H784N 14 Q782P, V783L, Yes 0.02 2.5 H784Q 15 Q754A Yes 0.2 >35 16 R659H Yes 0.1 >35 17 V783F, H784Q No -- -- 18 V783L, H784Q Yes 1 1 *Wild-type OptiTaq was set to "1" and the relative activity of each of the mutant polymerases was normalized to this amplification efficiency, with 1 as the maximum. **.DELTA.Cq = [Cq Mutant ID X] - [Cq OptiTaq] when qPCR reactions are run using primers having a 3'-RNA residue.
[0169] The subset of these mutant Taq DNA polymerases which showed DNA polymerase activity were studied for their ability to discriminate between primers having a 3'-DNA versus a 3'-RNA residue relative to the wild type OptiTaq enzyme. Real-time PCR was performed as before, employing in the reactions the amount of each mutant DNA polymerase equal to 0.5 units of wild-type OptiTaq per 10 .mu.L reaction. The following reaction conditions were employed: 1.times. qPCR buffer (20 mM Tris pH 8.4, 50 mM KCl, 3 mM MgCl.sub.2, 0.01% Triton-X100), 800 .mu.M dNTPs (200 .mu.M each), 500 nM For primer (Hs SFRS9 F569 rU, SEQ ID NO. 47), 500 nM Rev primer (Hs SFRS9 R712 rA, SEQ ID NO. 48), 250 nM probe (Hs SFRS9 P644, SEQ ID NO. 49), 2.times.10.sup.3 copies of linearized cloned plasmid template (SFRS9-targ, SEQ ID NO. 50), in 10 .mu.L final volume. Reactions were run in 384 well format on a BIO-RAD CFX384.TM. Real-Time System (BIO-RAD, Hercules, Calif.) using cycling parameters 95.degree. C. for 30 seconds followed by 60 cycles of [95.degree. C. for 15 seconds followed by 60.degree. C. for 1 minutes]. Detection was achieved using a fluorescence-quenched probe (5'-nuclease assay format). Sequences of the primers, probe, and template (plasmid insert) are shown in Table 8.
TABLE-US-00008 TABLE 8 Sequence of oligonucleotides employed in the primer 3'-RNA discrimination assay. Name Sequence SEQ ID NO. Hs SFRS9 TGTGCAGAAGGATGGAGu SEQ ID NO. 47 F569 rU Hs SFRS9 CTGGTGCTTCTCTCAGGATa SEQ ID NO. 48 R712 rA Hs SFRS9 HEX-TGGAATATG(ZEN)CCCTGCGTAAACTGGA-IBFQ SEQ ID NO. 48 P644 SFRS9- TGTGCAGAAGGATGGAGTGGGGATGGTCGAGTATCTCAG SEQ ID NO. 50 targ AAAAGAAGACATGGAATATGCCCTGCGTAAACTGGATGA CACCAAATTCCGCTCTCATGAGGGTGAAACTTCCTACAT CCGAGTTTATCCTGAGAGAAGCACCAG Nucleic acid sequences are shown 5'-3' with DNA uppercase and RNA lowercase. HEX = hexachlorofluorescein, IBFQ = Iowa Black FQ (fluorescence quencher), and ZEN = ZEN fluorescence quencher.
[0170] The 12 Taq DNA polymerase mutants that supported PCR were tested for the ability to use a 3'-RNA modified primer as outlined above. Results are summarized in Table 7. Mutant IDs 1 and 8 did not show any difference between primers having a 3'-DNA versus a 3'-RNA residue. Mutant IDs 2, 3, 6, 7, 10, 11, 14, 15, 16, and 18 showed an amplification delay using 3'-RNA primers. Thus the rational design strategy employed herein was successful and Taq DNA polymerase mutants were identified which discriminated against priming from a 3'-RNA residue. Those mutants which showed some delay with RNA priming and showed high processivity were studied for improvements in primer 3'-residue mismatch discrimination.
Example 5
Improved Mismatch Discrimination in Allele-Specific PCR Using Mutant Taq DNA Polymerases
[0171] Of the 18 mutant enzymes studied in Example 4, Mutant IDs 2, 3, 10, and 18 showed the ability to discriminate against a 3'-RNA residue in the primer and retained high enzymatic activity/processivity. These four mutants were studied for the ability to discriminate against a 3'-terminal DNA mismatch compared with wild type OptiTaq DNA polymerase using an allele-specific qPCR assay. Amplification reactions were performed against a synthetic oligonucleotide template where a single base was varied (SNP) which was positioned to lie at the 3'-end of the reverse primer. Synthetic templates were employed having each of the 4 possible bases at this position. Reverse primers were employed having each of the 4 possible bases at the 3'-end. Relative amplification efficiency for all pairwise combinations was assessed using qPCR.
[0172] Quantitative allele-specific real-time PCR (AS-qPCR) was performed in 10 .mu.L reaction volumes in 384 well format with 2.times.10.sup.3 copies of a 103 bp synthetic template (SEQ ID NOs. 51-4). Final reaction conditions used were 20 mM Tris-HCL (pH 8.4 at 25.degree. C.), 50 mM KCL, and 3 mM MgCl.sub.2, 0.01% Triton X-100, 800 .mu.M total dNTPs, and 200 nM of the universal forward primer (SEQ ID NO. 60), 200 nM of a reverse primer (separate reactions were set up for each of the allele-specific primers SEQ ID NOs. 55-58 or the control universal primer SEQ ID NO. 59) and 200 nM of the 5' nuclease detection probe (SEQ ID NO. 61). Each allele-specific primer was tested on each SNP template. Reactions utilized either 0.5 U (10.8 ng/11.1 nM/111 fmol) of the wild type OptiTaq DNA polymerase or 0.5 U of one of the 4 Taq DNA polymerase mutants studied (MUT ID No. 2 V783F, MUT ID NO. 3 H784Q, MUT ID NO. 10 A661E I665W F667L, or MUT ID NO. 18 V783L H784Q). Amplification was performed on a CFX384.TM. C1000.TM. Thermo Cycler system (Bio-Rad, Hercules, Calif.) using the following cycling parameters: 95.degree. C. for 30 seconds initial denaturation followed by 60 cycles of 95.degree. C. for 10 seconds, then 60.degree. C. for 30 seconds. Oligonucleotide reagents used in this example are shown in Table 9.
TABLE-US-00009 TABLE 9 Synthetic oligonucleotides employed in Example 5. Name Sequence (5'-3') SEQ ID NO. A Template AGCTCTGCCCAAAGATTACCCTGACAGCTAAGTGGCAGTGGAA SEQ ID NO. 51 GTTGGCCTCAGAAGTAGTGGCCAGCTGTGTGTCGGGGAACAGT AAAGGCATGAAGCTCAG C Template AGCTCTGCCCAAAGATTACCCTGACAGCTAAGTGGCAGTGGAA SEQ ID NO. 52 GTTGGCCTCAGAAGTAGTGGCCAGCTGTGTGTCGGGGCACAGT AAAGGCATGAAGCTCAG G Template AGCTCTGCCCAAAGATTACCCTGACAGCTAAGTGGCAGTGGAA SEQ ID NO. 53 GTTGGCCTCAGAAGTAGTGGCCAGCTGTGTGTCGGGGGACAGT AAAGGCATGAAGCTCAG T Template AGCTCTGCCCAAAGATTACCCTGACAGCTAAGTGGCAGTGGAA SEQ ID NO. 54 GTTGGCCTCAGAAGTAGTGGCCAGCTGTGTGTCGGGGTACAGT AAAGGCATGAAGCTCAG Syn Rev T CTGAGCTTCATGCCTTTACTGTT SEQ ID NO. 55 Syn Rev C CTGAGCTTCATGCCTTTACTGTC SEQ ID NO. 56 Syn Rev A CTGAGCTTCATGCCTTTACTGTA SEQ ID NO. 57 Syn Rev G CTGAGCTTCATGCCTTTACTGTG SEQ ID NO. 58 Syn Rev CTGAGCTTCATGCCTTTACTGT SEQ ID NO. 59 Syn For AGCTCTGCCCAAAGATTACCCTG SEQ ID NO. 60 Syn Probe FAM-TTCTGAGGC(ZEN)CAACTTCCACTGCCACTTA-IBFQ SEQ ID NO. 61 DNA bases are uppercase; FAM = 6-carboxyfluorescein; IBFQ = Iowa Black.TM. FQ fluorescence quencher; ZEN = internal ZEN fluorescence quencher; underlined base indicates the SNP site in the synthetic template DNA.
[0173] Initially all reactions were run in triplicate. Similar results were obtained for all replicates when using the wild type OptiTaq. However, results showed greater variation for the mutant polymerases. To obtain statistically meaningful results, each reaction was therefore performed 96 times for the mutant polymerases and 81 times for the wild type enzyme. .DELTA.Cq values were calculated as the Cq value obtained for each mismatched base pair minus the Cq value obtained for the matched base pair (.DELTA.Cq=Cq mismatch-Cq match). The .DELTA.Cq values for all 96 replicates were averaged and standard deviations were calculated. Results are shown in Table 10 and are graphically summarized in FIGS. 3A and 3B. Note that the reverse primer is the allele-specific primer, so the "Syn Rev T" primer (SEQ ID NO. 55) is the perfect match to the Template A (SEQ ID NO. 51), etc.
TABLE-US-00010 TABLE 10 .DELTA.Cq values for AS-qPCR reactions using WT OptiTaq and mutant Taq DNA polymerases. Reverse Primer Template SEQ A C G T DNA ID SEQ ID SEQ ID SEQ ID SEQ ID Polymerase Name NO. NO. 51 NO. 52 NO. 53 NO. 54 OptiTaq Syn Rev T 55 -- 2.3 +/- 0.2 1.4 +/- 0.2 3.8 +/- 0.2 Syn Rev G 58 7.6 +/- 0.6 -- 5.6 +/- 0.3 1.9 +/- 0.2 Syn Rev C 56 1.8 +/- 0.2 7.6 +/- 0.6 -- 2.0 +/- 0.2 Syn Rev A 57 6.6 +/- 0.4 1.5 +/- 0.2 8.0 +/- 0.6 -- MUT ID 2 Syn Rev T 55 -- 7.3 +/- 2.9 4.5 +/- 0.5 9.5 +/- 1.8 V783F Syn Rev G 58 17.9 +/- 8.3 -- 16.4 +/- 7.5 4.1 +/- 0.2 Syn Rev C 56 6.5 +/- 1.2 15.0 +/- 8.9 -- 5.3 +/- 0.5 Syn Rev A 57 7.8 +/- 4.0 3.5 +/- 0.4 14.6 +/- 9.7 -- MUT ID 3 Syn Rev T 55 -- 7.5 +/- 0.8 7.0 +/- 0.6 10.4 +/- 2.3 H784Q Syn Rev G 58 13.3 +/- 7.6 -- 10.1 +/- 4.8 4.6 +/- 0.2 Syn Rev C 56 6.9 +/- 0.5 8.6 +/- 2.6 -- 5.6 +/- 0.4 Syn Rev A 57 17.1 +/- 7.2 6.3 +/- 0.5 21.2 +/- 8.7 -- MUT ID 10 Syn Rev T 55 -- 9.0 +/- 0.9 5.7 +/- 0.3 11.2 +/- 2.6 A661E Syn Rev G 58 19.9 +/- 8.4 -- 13.9 +/- 5.3 3.9 +/- 0.3 I665W Syn Rev C 56 8.7 +/- 4.3 19.2 +/- 9.7 -- 7.4 +/- 0.8 F667L Syn Rev A 57 13.3 +/- 8.2 6.1 +/- 0.8 13.1 +/- 8.6 -- MUT ID 18 Syn Rev T 55 -- 5.8 +/- 1.3 6.0 +/- 0.4 9.4 +/- 1.2 V783L Syn Rev G 58 22.7 +/- 8.0 -- 18.9 +/- 8.4 4.9 +/- 0.3 H784Q Syn Rev C 56 6.8 +/- 0.5 17.6 +/- 9.6 -- 4.8 +/- 0.4 Syn Rev A 57 19.3 +/- 8.2 6.1 +/- 0.4 26.6 +/- 6.4 -- Average .DELTA.Cq values are shown, where .DELTA.Cq = [Cq mismatch - Cq match], +/- standard deviation calculated from 96 replicates.
[0174] The wild type OptiTaq showed an average .DELTA.Cq for AS-qPCR in this synthetic amplicon system of 4.2 with a range of 1.4 to 8.0. Mutant ID 2 (V783F) showed an average .DELTA.Cq of 9.4 with a range of 3.5 to 17.9. Mutant ID 3 (H784Q) showed an average .DELTA.Cq of 9.9 with a range of 4.6 to 21.2. Mutant ID 10 (A661E, I665W, F667L) showed an average .DELTA.Cq of 10.9 with a range of 3.9 to 19.9. Mutant ID 18 (V783L, H784Q) showed an average .DELTA.Cq of 12.4 with a range of 4.9 to 26.6. Therefore in all pairwise combinations of 4 template bases and 4 3'-terminal primer bases the mutant Taq DNA polymerases of the present invention showed greater discrimination to mismatch than did the wild type OptiTaq DNA polymerase. The magnitude of improvement for each mismatch pair is defined by the .DELTA..DELTA.Cq, which is the difference of discrimination between the mutant and wild type enzymes (.DELTA..DELTA.Cq=.DELTA.Cq mutant-.DELTA.Cq wild type). The .DELTA..DELTA.Cq values were calculated and are shown in Table 11.
TABLE-US-00011 TABLE 11 .DELTA..DELTA.Cq values for AS-qPCR reactions for the mutant Taq DNA polymerases compared with wild type OptiTaq. Reverse Primer Template SEQ A C G T DNA ID SEQ ID SEQ ID SEQ ID SEQ ID Polymerase Name NO. NO. 51 NO. 52 NO. 53 NO. 54 MUT ID Syn Rev T 55 -- 5.0 3.1 5.7 NO. 2 Syn Rev G 58 10.3 -- 10.8 2.2 V783F Syn Rev C 56 4.7 7.4 -- 3.3 Syn Rev A 57 1.2 2.0 6.6 -- MUT ID Syn Rev T 55 -- 5.2 5.6 6.6 NO. 3 Syn Rev G 58 5.7 -- 4.5 2.7 H784Q Syn Rev C 56 5.1 1.0 -- 3.6 Syn Rev A 57 10.5 4.8 13.2 -- MUT ID Syn Rev T 55 -- 6.7 4.3 7.4 NO. 10 Syn Rev G 58 12.3 -- 8.3 2.0 A661E Syn Rev C 56 6.9 11.6 -- 5.4 I665W Syn Rev A 57 6.7 4.6 5.1 -- F667L MUT ID Syn Rev T 55 -- 3.5 4.6 5.6 NO. 18 Syn Rev G 58 15.1 -- 13.3 3.0 V783L Syn Rev C 56 5.0 10.0 -- 2.8 H784Q Syn Rev A 57 12.7 4.6 18.6 -- Average .DELTA..DELTA.Cq values are shown, where .DELTA..DELTA.Cq = [.DELTA.Cq mutant - .DELTA.Cq wild type], from data in Table 10.
[0175] Mutant ID 2 (V783F) showed an average .DELTA..DELTA.Cq of 5.2 compared to wild type OptiTaq. Mutant ID 3 (H784Q) showed an average .DELTA..DELTA.Cq of 5.7 compared to wild type OptiTaq. Mutant ID 10 (A661E, 1665W, F667L) showed an average .DELTA..DELTA.Cq of 6.7 compared to wild type OptiTaq. Mutant ID 18 (V783L, H784Q) showed an average .DELTA..DELTA.Cq of 8.2 compared to wild type OptiTaq. Therefore each of the mutant Taq DNA polymerases of the present invention showed a significant improvement over wild type OptiTaq in mismatch discrimination, and, importantly, mismatch discrimination was improved for every possible mismatch base pair combination. Overall, mutant ID 18 (V783L, H784Q) showed the best SNP discrimination within the set of 4 mutant enzymes studied in this example using an AS-PCR assay.
Example 6
Discrimination Against a Primer 3'-RNA Residue by Taq DNA Polymerase Mutants
[0176] All 18 Taq DNA polymerase mutants were screened for the ability to discriminate against priming from a 3'-RNA residue in Example 4. The four mutants studied in AS-PCR in Example 5 (MUT IDs 2, 3, 10, and 18) which showed good 3'-mismatch discrimination were studied in greater detail in the present example for the ability to discriminate against the presence of a 3'-terminal RNA residue in the primer, examining for possible base-specific effects. Amplification reactions were performed against a synthetic oligonucleotide template where a single base was varied (SNP) which was positioned to lie at the 3'-end of the reverse primer. Synthetic templates were employed having each of the 4 possible bases at this position. Reverse primers were employed having each of the 4 possible RNA bases at the 3'-end and results were compared to control reactions using primers having each of the 4 possible DNA bases at the 3'-end. Relative amplification efficiency was assessed using qPCR.
[0177] Quantitative real-time PCR (qPCR) was performed in 10 .mu.L reaction volumes in 384 well format with 2.times.10.sup.3 copies of a 103 bp synthetic template (SEQ ID NOs. 51-54). Final reaction conditions used were 20 mM Tris-HCL (pH 8.4 at 25.degree. C.), 50 mM KCL, and 3 mM MgCl.sub.2, 0.01% Triton X-100, 800 .mu.M total dNTPs, and 200 nM of the universal forward primer (SEQ ID NO. 60), 200 nM of a reverse primer (separate reactions were set up for each of the four 3'-RNA primers SEQ ID NOs. 62-65, each of the four 3'DNA primers SEQ ID NOs. 55-58, or the control universal primer SEQ ID NO. 59) and 200 nM of the 5' nuclease detection probe (SEQ ID NO. 61). Each primer was tested only on the complementary template (mismatch conditions were not tested). Reactions utilized either 0.5 U (10.8 ng/11.1 nM/111 fmol) of the wild type OptiTaq DNA polymerase or 0.5 U of one of the 4 Taq DNA polymerase mutants studied (MUT ID No. 2 V783F, MUT ID NO. 3 H784Q, MUT ID NO. 10 A661E I665W F667L, or MUT ID NO. 18 V783L H784Q). Amplification was performed on a CFX384.TM. C1000.TM. Thermo Cycler system (Bio-Rad, Hercules, Calif.) using the following cycling parameters: 95.degree. C. for 30 seconds initial denaturation followed by 60 cycles of 95.degree. C. for 10 seconds, then 60.degree. C. for 30 seconds. Oligonucleotide reagents used in this example are shown in Table 12. A total of 96 replicates were performed for each pairwise combination.
TABLE-US-00012 TABLE 12 Synthetic oligonucleotides employed in Example 6. Name Sequence (5'-3') SEQ ID NO. A Template AGCTCTGCCCAAAGATTACCCTGACAGCTAAGTGGCAGTGGAA SEQ ID NO. 51 GTTGGCCTCAGAAGTAGTGGCCAGCTGTGTGTCGGGGAACAGT AAAGGCATGAAGCTCAG C Template AGCTCTGCCCAAAGATTACCCTGACAGCTAAGTGGCAGTGGAA SEQ ID NO. 52 GTTGGCCTCAGAAGTAGTGGCCAGCTGTGTGTCGGGGCACAGT AAAGGCATGAAGCTCAG G Template AGCTCTGCCCAAAGATTACCCTGACAGCTAAGTGGCAGTGGAA SEQ ID NO. 53 GTTGGCCTCAGAAGTAGTGGCCAGCTGTGTGTCGGGGGACAGT AAAGGCATGAAGCTCAG T Template AGCTCTGCCCAAAGATTACCCTGACAGCTAAGTGGCAGTGGAA SEQ ID NO. 54 GTTGGCCTCAGAAGTAGTGGCCAGCTGTGTGTCGGGGTACAGT AAAGGCATGAAGCTCAG Syn Rev T CTGAGCTTCATGCCTTTACTGTT SEQ ID NO. 55 Syn Rev C CTGAGCTTCATGCCTTTACTGTC SEQ ID NO. 56 Syn Rev A CTGAGCTTCATGCCTTTACTGTA SEQ ID NO. 57 Syn Rev G CTGAGCTTCATGCCTTTACTGTG SEQ ID NO. 58 Syn Rev rU CTGAGCTTCATGCCTTTACTGTu SEQ ID NO. 62 Syn Rev rC CTGAGCTTCATGCCTTTACTGTc SEQ ID NO. 63 Syn Rev TA CTGAGCTTCATGCCTTTACTGTa SEQ ID NO. 64 Syn Rev rG CTGAGCTTCATGCCTTTACTGTg SEQ ID NO. 65 Syn Rev CTGAGCTTCATGCCTTTACTGT SEQ ID NO. 59 Syn For AGCTCTGCCCAAAGATTACCCTG SEQ ID NO. 60 Syn Probe FAM-TTCTGAGGC(ZEN)CAACTTCCACTGCCACTTA-IBFQ SEQ ID NO. 61 DNA bases are uppercase and RNA bases are lowercase; FAM = 6-carboxyfluorescein; IBFQ = Iowa Black.TM. FQ fluorescence quencher; ZEN = internal ZEN fluorescence quencher; underlined base indicates the SNP site in the synthetic template DNA.
[0178] Average Cq values were calculated for the 96-replicate sets. .DELTA.Cq values were calculated as the difference between the average Cq values for the 3'-RNA primer reactions from the average Cq values for the 3'-DNA primer reactions (.DELTA.Cq=Cq 3'-RNA-Cq 3'-DNA). Higher .DELTA.Cq values indicate a greater degree of discrimination against priming from a 3'-RNA primer. Results are shown in Table 13 and are graphically summarized in FIG. 4.
TABLE-US-00013 TABLE 13 .DELTA.Cq values for qPCR reactions using WT OptiTaq and mutant Taq DNA polymerases comparing 3'-DNA vs. 3'-RNA primers. DNA Reverse Primers compared Polymerase Name SEQ ID NO. Template .DELTA.Cq OptiTaq Syn Rev T 55 A 0.1 Syn Rev rU 62 SEQ ID NO. 51 Syn Rev G 58 C 0.2 Syn Rev rG 65 SEQ ID NO. 52 Syn Rev C 56 G 0.0 Syn Rev rC 63 SEQ ID NO. 53 Syn Rev A 57 T 0.1 Syn Rev rA 64 SEQ ID NO. 54 MUT ID 2 Syn Rev T 55 A 5.4 V783F Syn Rev rU 62 SEQ ID NO. 51 Syn Rev G 58 C 1.5 Syn Rev rG 65 SEQ ID NO. 52 Syn Rev C 56 G 4.8 Syn Rev rC 63 SEQ ID NO. 53 Syn Rev A 57 T 2.2 Syn Rev rA 64 SEQ ID NO. 54 MUT ID 3 Syn Rev T 55 A 6.9 H784Q Syn Rev rU 62 SEQ ID NO. 51 Syn Rev G 58 C 2.0 Syn Rev rG 65 SEQ ID NO. 52 Syn Rev C 56 G 9.8 Syn Rev rC 63 SEQ ID NO. 53 Syn Rev A 57 T 1.4 Syn Rev rA 64 SEQ ID NO. 54 MUT ID 10 Syn Rev T 55 A 5.5 A661E Syn Rev rU 62 SEQ ID NO. 51 I665W Syn Rev G 58 C 1.3 F667L Syn Rev rG 65 SEQ ID NO. 52 Syn Rev C 56 G 4.2 Syn Rev rC 63 SEQ ID NO. 53 Syn Rev A 57 T 0.8 Syn Rev rA 64 SEQ ID NO. 54 MUT ID 18 Syn Rev T 55 A 9.3 V783L Syn Rev rU 62 SEQ ID NO. 51 H784Q Syn Rev G 58 C 2.4 Syn Rev rG 65 SEQ ID NO. 52 Syn Rev C 56 G 9.5 Syn Rev rC 63 SEQ ID NO. 53 Syn Rev A 57 T 2.3 Syn Rev rA 64 SEQ ID NO. 54 Average .DELTA.Cq values are shown, where .DELTA.Cq = Cq 3'-RNA primer - Cq 3'-DNA primer.
[0179] Wild type OptiTaq did not show any significant discrimination between a 3'-DNA and a 3'-RNA primer. All four mutant Taq DNA polymerases, however, showed reduced priming efficiency when using a 3'-RNA primer. Thus the goal of creating novel polymerases which discriminate against a 3'-RNA residue in a primer was achieved using the intelligent mutagenesis design strategy described herein. Interestingly, the magnitude of discrimination was much greater for RNA pyrimidine residues (rC or rU) than for RNA purine residues (rA or rG).
Example 7
Improved Mismatch Discrimination in rhPCR using Mutant Taq DNA Polymerases
[0180] RNase H-based PCR (rhPCR) employs the enzyme RNase H2 to convert a blocked-cleavable oligonucleotide which cannot prime DNA synthesis into a form that can prime DNA synthesis and initiate PCR. The blocked-cleavable oligonucleotide, or blocked-cleavable primer, contains a single RNA residue near the 3'-end of the oligonucleotide (which comprises the cleavage site) and is modified at or near the 3'-end so that the primer cannot prime DNA synthesis and/or has lost template function and so is incompetent to support PCR even if primer extension can occur. This method can be used for genotyping (SNP discrimination) and relies on the ability of RNase H2 to distinguish between base-pair match vs. mismatch at the RNA base cleavage site when hybridized to the target nucleic acid. In rhPCR, SNP discrimination occurs at the primer unblocking step, not at the primer extension step (in AS-PCR, discrimination occurs at the primer extension step). Examples of this enzyme cleaving strategy, similar RNase H strategies, and methods of blocking primer extension or inhibiting template function and thereby disabling PCR are described in U.S. Pat. No. 7,112,406 to Behlke et al., entitled POLYNOMIAL AMPLIFICATION OF NUCLEIC ACIDS, U.S. Pat. No. 5,763,181 to Han et al., entitled CONTINOUS FLUOROMETRIC ASSAY FOR DETECTING NUCLEIC ACID CLEAVAGE, U.S. Pat. No. 7,135,291 to Sagawa et al., entitled METHOD OF DETECTING NUCLEOTIDE POLYMORPHISM; U.S. Pat. App. No. 20090068643 to Behlke and Walder, entitled DUAL FUNCTION PRIMERS FOR AMPLIFYING DNA AND METHODS OF USE; and U.S. Pat. App. No. 20100167353 to Walder et al., entitled RNASE H-BASED ASSAYS UTILIZING MODIFIED RNA MONOMERS and in Dobosy et al., RNase H-dependent PCR (rhPCR): improved specificity and single nucleotide polymorphism detection using blocked cleavable primers, BMC Biotechnology., 11:e80 (2011).
[0181] In AS-PCR the SNP is positioned at the 3'-end of the primer. In this configuration, a mispriming event (where DNA synthesis is initiated in the presence of a 3'-terminal mismatch) leads to incorporation of the base present in the primer into the nascent DNA strand and thereby into the PCR amplicon. This event converts the PCR product to the primer sequence so that the amplified DNA now matches primer and no longer matches the original input sample nucleic acid sequence. Since the amplicon sequence now matches the primer and not the input sample, amplification proceeds at high efficiency.
[0182] In rhPCR, cleavage of the blocked-cleavable primer by RNase H2 occurs at the 5'-side of the RNA residue; if the SNP is positioned at the RNA residue (e.g., the RNA base pairs with the SNP), then the first base incorporated by DNA polymerase during primer extension and PCR is the SNP site and results in daughter products which remain identical to the input nucleic acid sequence. Rarely, non-canonical RNase H2 cleavage occurs at the 3'-side of the RNA base, which leaves the RNA residue at the 3'-end of the primer positioned overlying the SNP. In this case, the rhPCR reaction proceeds like AS-PCR, where the 3'-end of the primer is positioned at the SNP site and is either a match or mismatch to the target nucleic acid. Like AS-PCR, in the case of a mismatch, the sequence of the DNA extension product and PCR amplicon converts to the sequence of the primer and thus might not faithfully replicate the sequence of the sample during amplification. Any method which reduces the frequency of this undesired mispriming event will improve mismatch discrimination in the rhPCR assay. Therefore, although base discrimination in rhPCR is primarily mediated by RNase H2 at the primer cleavage stage, use of a DNA polymerase that has an improved ability to discriminate against a 3'-terminal mismatch and/or a 3'-terminal RNA residue may improve the overall mismatch discrimination capacity of rhPCR by preventing extension when undesired 3'-cleavage events occur. The DNA polymerase mutants described herein both reduce priming efficiency when a 3'-mismatch is present (improve mismatch discrimination) and reduce priming efficiency when a 3'-terminal RNA residue is present in the primer (discriminate against a primer 3'-RNA residue) compared with wild type Taq DNA polymerase. The present example demonstrates that the novel mutant Taq DNA polymerases of the present invention improve specificity and SNP discrimination of rhPCR.
[0183] Quantitative real-time rhPCR was performed comparing performance of wild type OptiTaq DNA polymerase with mutant Taq DNA polymerases Mutant IDs 2, 3, 10, and 18. Two different blocked-cleavable primer designs were tested, including the generation 1 (Gen1) "RDDDDx" primers and the generation 2 (Gen2) "RDxxD" primers (see: US Patent Application 2012/0258455 by Behlke et al., entitled, RNASE H-BASED ASSAYS UTILIZING MODIFIED RNA MONOMERS). Amplification reactions were performed using the same synthetic oligonucleotide template employed in Example 5 where a single base was varied (the SNP site) which was positioned to lie at the RNA residue in both Gen1 and Gen2 blocked-cleavable (rhPCR) primers. Synthetic templates were employed having each of the 4 possible bases at this position. Reverse primers were employed having each of the 4 possible complementary bases at this position (the RNA base). The same forward primer was used for all reactions. Relative amplification efficiency was assessed using real-time PCR.
[0184] Quantitative rhPCR was performed in 10 .mu.L reaction volumes in 384 well format with 2.times.10.sup.6 copies of a 103 bp synthetic template (SEQ ID NOs. 51-4). Final reaction conditions used were 20 mM Tris-HCL (pH 8.4 at 25.degree. C.), 50 mM KCL, 3 mM MgCl.sub.2, 0.01% Triton X-100, 800 .mu.M total dNTPs, 200 nM of the universal forward primer (SEQ ID NO. 60), 200 nM of a reverse primer, and 200 nM of the 5' nuclease detection probe (SEQ ID NO. 61). Reverse primers included Gen1 RDDDDx configuration allele-specific rhPCR primers (SEQ ID NOs. 66-69), Gen2 RDxxD configuration allele-specific rhPCR primers (SEQ ID NOs. 70-73) and a control universal reverse primer (SEQ ID NO.59). Each of the rhPCR blocked-cleavable reverse primers were tested on each of the four SNP templates. Reactions utilized either 0.5 U (10.8 ng/11.1 nM/111 fmol) of the wild type OptiTaq DNA polymerase or 0.5 U of one of the four Taq DNA polymerase mutants (MUT ID 2, V783F; MUT ID 3, H784Q; MUT ID 10, A661E I665W F667L; or MUT ID 18, V783L H784Q). P. abyssi RNase H2 was added to each reaction in 1 .mu.L volume. Reactions using the control and Gen1 blocked-cleavable RDDDDx rhPCR primers employed 2.6 mU RNase H2 per 10 .mu.L reaction (5 fmoles, 0.5 nM enzyme). Reactions using the Gen2 blocked-cleavable RDxxD rhPCR primers employed 25 mU RNase H2 10 .mu.L reaction (48 fmoles, 4.8 nM enzyme) for the rC and rA primers (SEQ ID NOs. 71 and 72) and 200 mU RNase H2 per 10 .mu.L reaction (384 fmoles, 38 nM enzyme) for the rG and rU primers (SEQ ID NOs. 70 and 73). Cycling was performed on a Roche LightCycler.RTM. 480 (Roche Applied Science, Indianapolis, Ind., USA) as follows: 95.degree. C. for 3 minutes followed by 75 cycles of 95.degree. C. for 10 seconds and 60.degree. C. for 30 seconds. All reactions were performed in triplicate. Oligonucleotide reagents used in this example are shown in Table 14.
TABLE-US-00014 TABLE 14 Synthetic oligonucleotides employed in Example 7. Name Sequence (5'-3') SEQ ID NO. A Template AGCTCTGCCCAAAGATTACCCTGACAGCTAAGTGGCAGTGGAA SEQ ID NO. 51 GTTGGCCTCAGAAGTAGTGGCCAGCTGTGTGTCGGGGAACAGT AAAGGCATGAAGCTCAG C Template AGCTCTGCCCAAAGATTACCCTGACAGCTAAGTGGCAGTGGAA SEQ ID NO. 52 GTTGGCCTCAGAAGTAGTGGCCAGCTGTGTGTCGGGGCACAGT AAAGGCATGAAGCTCAG G Template AGCTCTGCCCAAAGATTACCCTGACAGCTAAGTGGCAGTGGAA SEQ ID NO. 53 GTTGGCCTCAGAAGTAGTGGCCAGCTGTGTGTCGGGGGACAGT AAAGGCATGAAGCTCAG T Template AGCTCTGCCCAAAGATTACCCTGACAGCTAAGTGGCAGTGGAA SEQ ID NO. 54 GTTGGCCTCAGAAGTAGTGGCCAGCTGTGTGTCGGGGTACAGT AAAGGCATGAAGCTCAG Syn Rev CTGAGCTTCATGCCTTTACTGT SEQ ID NO. 59 Syn For AGCTCTGCCCAAAGATTACCCTG SEQ ID NO. 60 Syn Probe FAM-TTCTGAGGC(ZEN)CAACTTCCACTGCCACTTA-IBFQ SEQ ID NO. 61 Syn Rev rU CTGAGCTTCATGCCTTTACTGTuCCCCx SEQ ID NO. 66 DDDDx Syn Rev rC CTGAGCTTCATGCCTTTACTGTcCCCCx SEQ ID NO. 67 DDDDx Syn Rev rA CTGAGCTTCATGCCTTTACTGTaCCCCx SEQ ID NO. 68 DDDDx Syn Rev rG CTGAGCTTCATGCCTTTACTGTgCCCCx SEQ ID NO. 69 DDDDx Syn Rev rU CTGAGCTTCATGCCTTTACTGTuCxxC SEQ ID NO. 70 DxxD Syn Rev rC CTGAGCTTCATGCCTTTACTGTcCxxC SEQ ID NO. 71 DxxD Syn Rev rA CTGAGCTTCATGCCTTTACTGTaCxxC SEQ ID NO. 72 DxxD Syn Rev rG CTGAGCTTCATGCCTTTACTGTgCxxC SEQ ID NO. 73 DxxD DNA bases are uppercase and RNA bases are lowercase; FAM = 6-carboxyfluorescein; IBFQ = Iowa Black.TM. FQ fluorescence quencher; ZEN = internal ZEN fluorescence quencher; underlined base indicates the SNP site in the synthetic template DNA; "x" = C3 Spacer (propanediol).
[0185] MUT ID 10 (A661E, 1665W, F667L) unexpectedly showed large amplification delays when the primers matched the SNP site in the target in the rhPCR reactions using this synthetic amplicon system. This polymerase, however, did not show any delays when using a human genomic DNA system for rhPCR (see Examples 8 and 9). MUT ID 10 was therefore excluded from analysis in the synthetic system experiments. Data generated using the other three mutant polymerases were analyzed and .DELTA.Cq values were calculated comparing matched versus mismatched primer/template pairs, where .DELTA.Cq=Cq mismatch-Cq match. Results are shown in Table 15 for the Gen1 RDDDDx blocked-cleavable rhPCR primers and in Table 16 for the Gen2 RDxxD blocked-cleavable rhPCR primers.
TABLE-US-00015 TABLE 15 .DELTA.Cq values for rhPCR reactions using WT OptiTaq and mutant Taq DNA polymerases with Gen1 RDDDDx blocked-cleavable rhPCR primers. Reverse Primer Template SEQ A G T C DNA ID SEQ ID SEQ ID SEQ ID SEQ ID Polymerase Name NO. NO. 51 NO. 53 NO. 54 NO. 52 OptiTaq Syn Rev 66 -- 10.5 3.4 6.6 rU DDDDx Syn Rev 67 3.3 -- 1.3 2.2 rC DDDDx Syn Rev 68 9.5 10.5 -- 3.5 rA DDDDx Syn Rev 69 9.5 10.8 11.8 -- rG DDDDx MUT ID 2 Syn Rev 66 -- 11.1 5.1 9.0 V783F rU DDDDx Syn Rev 67 4.0 -- 1.9 3.6 rC DDDDx Syn Rev 68 10.4 11.1 -- 5.6 rA DDDDx Syn Rev 69 10.2 10.5 10.7 -- rG DDDDx MUT ID 3 Syn Rev 66 -- 11.3 5.0 10.0 H784Q rU DDDDx Syn Rev 67 7.6 -- 4.3 5.9 rC DDDDx Syn Rev 68 10.8 11.3 -- 7.6 rA DDDDx Syn Rev 69 10.9 10.9 11.0 -- rG DDDDx MUT ID 18 Syn Rev 66 -- 12.3 6.7 11.5 V783L rU DDDDx H784Q Syn Rev 67 9.9 -- 8.3 10.4 rC DDDDx Syn Rev 68 11.5 13.2 -- 6.8 rA DDDDx Syn Rev 69 11.3 12.0 12.6 -- rG DDDDx Average .DELTA.Cq values are shown, where .DELTA.Cq = [Cq mismatch - Cq match].
TABLE-US-00016 TABLE 16 .DELTA.Cq values for rhPCR reactions using WT OptiTaq and mutant Taq DNA polymerases with Gen2 RDxxD blocked-cleavable rhPCR primers. Reverse Primer Template SEQ A G T C DNA ID SEQ ID SEQ ID SEQ ID SEQ ID Polymerase Name NO. NO. 51 NO. 53 NO. 54 NO. 52 OptiTaq Syn Rev 70 -- 11.6 15.1 12.8 rU DxxD Syn Rev 71 6.3 -- 6.7 4.6 rC DxxD Syn Rev 72 13.7 15.6 -- 14.3 rA DxxD Syn Rev 73 13.2 11.4 10.2 -- rG DxxD MUT ID 2 Syn Rev 70 -- 12.2 15.0 14.0 V783F rU DxxD Syn Rev 71 8.3 -- 6.5 4.4 rC DxxD Syn Rev 72 14.1 15.9 -- 14.2 rA DxxD Syn Rev 73 13.8 12.2 11.6 -- rG DxxD MUT ID 3 Syn Rev 70 -- 12.4 15.0 14.1 H784Q rU DxxD Syn Rev 71 9.5 -- 7.8 6.4 rC DxxD Syn Rev 72 16.9 19.1 -- 18.4 rA DxxD Syn Rev 73 15.0 13.0 12.7 -- rG DxxD MUT ID 18 Syn Rev 70 -- 13.0 15.3 14.3 V783L rU DxxD H784Q Syn Rev 71 6.9 -- 9.6 3.6 rC DxxD Syn Rev 72 15.8 15.3 -- 14.5 rA DxxD Syn Rev 73 15.0 13.4 13.7 -- rG DxxD Average .DELTA.Cq values are shown, where .DELTA.Cq = [Cq mismatch - Cq match].
[0186] In almost all cases, mismatch discrimination was superior for rhPCR reactions run using the mutant Taq DNA polymerases than wild type OptiTaq. The magnitude of improvement is best seen by examining the .DELTA..DELTA.Cq values, which is the difference of discrimination seen using wild type OptiTaq and the mutants (.DELTA..DELTA.Cq=.DELTA.Cq mutant-.DELTA.Cq wild type). These results are shown in Table 17 for the Gen1 RDDDDx primers and in Table 18 for the Gen2 RDxxD primers. When using the Gen1 RDDDDx primers, the overall greatest benefit was seen when the mismatched base was a "C" in the target nucleic acid and least benefit was seen when the blocked-cleavable primer contained a rG paired with a mismatched T in the target. The greatest improvements were obtained using the mutant Taq DNA polymerase MUT ID 18 (V783L H784Q). The average .DELTA..DELTA.Cq for MUT ID 2 (V783F) was 1.0. The average .DELTA..DELTA.Cq for MUT ID 3 (H784Q) was 2.0. The average .DELTA..DELTA.Cq for MUT ID 18 (V783L, H784Q) was 3.6. Benefits obtained using mutant Taq DNA polymerases was lower for the Gen2 RDxxD primers, which already showed high .DELTA.Cq values using wild type OptiTaq. Average .DELTA..DELTA.Cq for the three mutant polymerases studied in the Example were 0.6, 2.1, and 1.2. Therefore greatest benefit when using the Gen2 RDxxD primers was seen with MUT ID 3 (H784Q).
TABLE-US-00017 TABLE 17 .DELTA..DELTA.Cq values for rhPCR reactions using mutant Taq DNA polymerases compared with wild type OptiTaq for Gen1 RDDDDx blocked-cleavable rhPCR primers. Reverse Primer Template SEQ A G T C DNA ID SEQ ID SEQ ID SEQ ID SEQ ID Polymerase Name NO. NO. 51 NO. 53 NO. 54 NO. 52 MUT ID 2 Syn Rev 66 -- 0.6 1.7 2.4 V783F rU DDDDx Syn Rev 67 0.7 -- 0.6 1.4 rC DDDDx Syn Rev 68 0.9 0.6 -- 2.1 rA DDDDx Syn Rev 69 0.7 -0.3 1.1 -- rG DDDDx MUT ID 3 Syn Rev 66 -- 0.8 1.6 3.4 H784Q rU DDDDx Syn Rev 67 4.3 -- 3.0 3.7 rC DDDDx Syn Rev 68 1.3 0.8 -- 4.1 rA DDDDx Syn Rev 69 1.4 0.1 -0.8 -- rG DDDDx MUT ID 18 Syn Rev 66 -- 1.8 3.3 4.9 V783L rU DDDDx H784Q Syn Rev 67 6.6 -- 7.0 8.2 rC DDDDx Syn Rev 68 2.0 2.7 -- 3.3 rA DDDDx Syn Rev 69 1.8 1.2 0.8 -- rG DDDDx .DELTA..DELTA.Cq values are shown, where .DELTA..DELTA.Cq = [.DELTA.Cq mutant - .DELTA.Cq wild type polymerase].
TABLE-US-00018 TABLE 18 .DELTA..DELTA.Cq values for rhPCR reactions using mutant Taq DNA polymerases compared with wild type OptiTaq for Gen2 RDxxD blocked-cleavable rhPCR primers. Reverse Primer Template SEQ A G T C DNA ID SEQ ID SEQ ID SEQ ID SEQ ID Polymerase Name NO. NO. 51 NO. 53 NO. 54 NO. 52 MUT ID 2 Syn Rev 70 -- 0.6 -0.1 1.2 V783F rU DxxD Syn Rev 71 2.0 -- -0.2 -0.2 rC DxxD Syn Rev 72 0.4 0.3 -- -0.1 rA DxxD Syn Rev 73 0.6 0.8 1.4 -- rG DxxD MUT ID 3 Syn Rev 70 -- 0.8 -0.1 1.3 H784Q rU DxxD Syn Rev 71 3.2 -- 1.1 1.8 rC DxxD Syn Rev 72 3.2 3.5 -- 4.1 rA DxxD Syn Rev 73 2.8 1.6 2.5 -- rG DxxD MUT ID 18 Syn Rev 70 -- 1.4 0.2 1.5 V783L rU DxxD H784Q Syn Rev 71 0.6 -- 2.9 -1.0 rC DxxD Syn Rev 72 2.1 -0.3 -- 0.2 rA DxxD Syn Rev 73 1.8 2.0 3.5 -- rG DxxD .DELTA..DELTA.Cq values are shown, where .DELTA..DELTA.Cq = [.DELTA.Cq mutant - .DELTA.Cq wild type polymerase].
Example 8
Improved Mismatch Discrimination in rhPCR using Mutant Taq DNA Polymerases in a Human Genomic DNA SNP Assay
[0187] Example 7 demonstrated utility of the novel mutant Taq DNA polymerases of the present invention in a synthetic amplicon rhPCR SNP discrimination assay system. The present Example demonstrates utility of the novel mutant Taq DNA polymerases in a human genomic DNA rhPCR SNP discrimination assays system, examining a SNP site in the SMAD7 gene (NM_005904, C/T SNP, rs4939827). The assays employed target DNAs GM18562 (homozygous C/C) and GM18537 (homozygous T/T) from the Coriell Institute for Medical Research (Camden, N.J., USA). Two different blocked-cleavable primer designs were tested, including the generation 1 (Gen1) "RDDDDx" primers and the generation 2 (Gen2) "RDxxD" primers (see: US Patent Application 2012/0258455 by Behlke et al., entitled, RNASE H-BASED ASSAYS UTILIZING MODIFIED RNA MONOMERS).
[0188] Quantitative real-time rhPCR was performed in 10 .mu.L reaction volumes in 384 well format with 20 ng (the equivalent of 6600 copies of target) of human genomic DNA (GM18562 or GM18537). Reactions utilized either 0.5 U (10.8 ng/11.1 nM/111 fmol) of wild type OptiTaq DNA polymerase or 0.5 U of one of the four Taq DNA polymerase mutants (MUT ID 2, V783F; MUT ID 3, H784Q; MUT ID 10, A661E I665W F667L; or MUT ID 18, V783L H784Q). Final reaction conditions used were 20 mM Tris-HCL (pH 8.4 at 25.degree. C.), 50 mM KCL, 3 mM MgCl.sub.2, 0.01% Triton X-100, 800 .mu.M total dNTPs, 200 nM of a forward primer (SEQ ID NOs. 75-79), 200 nM of the universal reverse primer (SEQ ID NO. 74), and 200 nM of the SMAD7 probe (SEQ ID NO. 80). Sequence of the 85 bp SMAD7 amplicon is shown as SEQ ID NO. 81. Forward primers included RDDDDx configuration Gen1 allele-specific rhPCR primers (SEQ ID NOs. 76 and 77), RDxxD configuration Gen2 allele-specific rhPCR primers (SEQ ID NOs. 78 and 79) and the control universal forward primer (SEQ ID NO.75) which is not allele specific. Oligonucleotide reagents employed in this Example are shown in Table 19. Reactions included 1 .mu.L of P.a. RNase H2 at a concentration of 2.6 mU per 10 .mu.L reaction (5 fmoles, 0.5 nM) for the Gen1 RDDDDx primers and control primer (SEQ ID NOs. 75-77) or 200 mU per 10 .mu.L reaction (384 fmoles, 38.4 nM) for the Gen2 RDxxD primers (SEQ ID NOs. 78 and 79). Amplification was performed on a Roche LightCycler.RTM. 480 (Roche Applied Science, Indianapolis, Ind., USA) as follows: 95.degree. C. for 3 minutes followed by 75 cycles of 95.degree. C. for 10 seconds and 60.degree. C. for 30 seconds. All reactions were performed in triplicate.
TABLE-US-00019 TABLE 19 Synthetic oligonucleotides employed in Example 8. SEQ ID Name Sequence (5'-3') NO. SMAD7 Rev CTCACTCTAAACCCCAGCATT 74 SMAD7 For CAGCCTCATCCAAAAGAGGAAA 75 SMAD7 For rC CAGCCTCATCCAAAAGAGGAAAcAGGAx 76 DDDDx SMAD7 For rU CAGCCTCATCCAAAAGAGGAAAuAGGAx 77 DDDDx SMAD7 For rC CAGCCTCATCCAAAAGAGGAAAcAxxA 78 DxxD SMAD7 For rU CAGCCTCATCCAAAAGAGGAAAuAxxA 79 DxxD SMAD7 probe FAM-CCCAGAGCTCCCTCAGACTCCT-IBFQ 80 SMAD7 target CAGCCTCATCCAAAAGAGGAAATAGGACCCC 81 AGAGCTCCCTCAGACTCCTCAGGAAACACAG ACAATGCTGGGGTTTAGAGTGAG DNA bases are uppercase and RNA bases are lowercase; FAM = 6-carboxyfluorescein; IBFQ = Iowa Black.TM. FQ fluorescence quencher; "x" = C3 Spacer (propanediol). Primer and probe binding sites in the SMAD7 target are underlined.
[0189] Results using the Gen1 RDDDDx rhPCR primers are shown in Table 20 and using the Gen2 RDxxD rhPCR primers are shown in Table 21. Overall, use of the mutant Taq DNA polymerases showed small but real improvements in SNP discrimination in this human genomic DNA rhPCR assay using the Gen1 RDDDDx primers. However, large improvements in discrimination were seen using the Gen2 RDxxD primers. The Gen2 RDxxD primers inherently show greater SNP discrimination and these levels were increased so that .DELTA.Cq values are in some cases were greater than 40 amplification cycles between match and mismatch; this level of discrimination would be "greater than assay" for most users, as qPCR reactions are seldom run for over 45-50 cycles and positive signal was not detected in these cases until after 70 cycles (Table 21). Therefore use of the new mutant Taq DNA polymerases improves SNP discrimination in rhPCR genotyping assays.
TABLE-US-00020 TABLE 20 SNP discrimination of a site in the SMAD7 gene using Gen1 RDDDDx primers comparing wild type OptiTaq with four mutant Taq DNA polymerases. Cq Cq SEQ mU RNase Value Value DNA ID H2 per C/C T/T Polymerase For Primer NO. 10 .mu.L rxn DNA DNA .DELTA.Cq Wild type SMAD7 For 75 2.6 24.3 25.3 -- OptiTaq SMAD7 For 76 2.6 26.1 38.1 11.9 rC DDDDx SMAD7 For 77 2.6 36.6 26.8 9.8 rU DDDDx MUT ID 2 SMAD7 For 75 2.6 24.7 25.5 -- V783F SMAD7 For 76 2.6 26.2 40.3 14.1 rC DDDDx SMAD7 For 77 2.6 37.8 27.6 10.1 rU DDDDx MUT ID 3 SMAD7 For 75 2.6 25.3 27.1 -- H784Q SMAD7 For 76 2.6 26.2 46.1 19.9 rC DDDDx SMAD7 For 77 2.6 38.9 32.4 6.5 rU DDDDx MUT ID 10 SMAD7 For 75 2.6 24.3 25.8 -- A661E SMAD7 For 76 2.6 25.6 43.9 18.3 I665W rC DDDDx F667L SMAD7 For 77 2.6 42.6 28.5 14.1 rU DDDDx MUT ID 18 SMAD7 For 75 50 24.6 25.6 -- V783L SMAD7 For 76 50 25.2 35.7 10.5 H784Q rC DDDDx SMAD7 For 77 50 37.9 26.4 11.5 rU DDDDx DNA targets included GM18562 (homozygous C/C) and GM18537 (homozygous T/T) from the Coriell Institute for Medical Research. .DELTA.Cq = [Cq mismatch - Cq match].
TABLE-US-00021 TABLE 21 SNP discrimination of a site in the SMAD7 gene using Gen2 RDxxD primers comparing wild type OptiTaq with four mutant Taq DNA polymerases. Cq Cq SEQ mU RNase Value Value DNA ID H2 per C/C T/T Polymerase For Primer NO. 10 .mu.L rxn DNA DNA .DELTA.Cq Wild type SMAD7 For 75 2.6 24.3 25.3 -- OptiTaq SMAD7 For 78 200 25.9 40.4 14.5 rC DxxD SMAD7 For 79 200 47.9 26.6 21.3 rU DxxD MUT ID 2 SMAD7 For 75 2.6 24.7 25.5 -- V783F SMAD7 For 78 200 26.6 64.4 37.7 rC DxxD SMAD7 For 79 200 59.7 28.0 31.6 rU DxxD MUT ID 3 SMAD7 For 75 2.6 25.3 27.1 -- H784Q SMAD7 For 78 200 26.7 71.7 45.0 rC DxxD SMAD7 For 79 200 62.5 28.9 33.7 rU DxxD MUT ID 10 SMAD7 For 75 2.6 24.3 25.8 -- A661E SMAD7 For 78 200 25.6 74.4 48.8 I665W rC DxxD F667L SMAD7 For 79 200 54.3 28.2 26.0 rU DxxD MUT ID 18 SMAD7 For 75 50 24.6 25.6 -- V783L SMAD7 For 78 200 25.1 52.7 27.6 H784Q rC DxxD SMAD7 For 79 200 43.0 27.6 15.3 rU DxxD DNA targets included GM18562 (homozygous C/C) and GM18537 (homozygous T/T) from the Coriell Institute for Medical Research. .DELTA.Cq = [Cq mismatch - Cq match].
[0190] The .DELTA.Cq values for the SMAD7 SNP genotyping assays are graphically summarized in FIG. 5A for the Gen1 RDDDDx primers and in FIG. 6A for the Gen2 RDxxD primers. It is interesting to note that, for the rhPCR genotyping assays studied in Example 8, MUT ID 10 (A661E I665W F667L) showed the greatest improvement compare with wild type OptiTaq, especially when using the Gen2 RDxxD primers. Example 5 demonstrated utility of the mutant Taq DNA polymerases in AS-PCR, and in this case use of MUT ID 18 (V783L H784Q) showed the greatest benefit and MUT ID 3 (H784Q) showed the next greatest relative benefit. It is clear that not only do the different mutant Taq DNA polymerases of the present invention have utility in different amplification assays but that the different mutants show varying levels of benefit depending on the nature of the assay used. It is therefore useful to have a collection of mutant polymerases whose properties can be matched to different assays/applications so that maximal benefit is obtained.
Example 9
Improved Discrimination of Rare Alleles in Genomic DNA using rhPCR with Mutant Taq DNA Polymerases
[0191] Use of the Gen2 RDxxD blocked-cleavable primers in rhPCR can detect the presence of a SNP at a level of 1:1,000 to 1:10,000 in the background of wild type genomic DNA using native (wild type) Taq DNA polymerase (see: US Patent Application 2012/0258455 by Behlke et al., entitled, RNASE H-BASED ASSAYS UTILIZING MODIFIED RNA MONOMERS). The present example demonstrates that the mutant Taq DNA polymerases of the present invention improve rare allele discrimination in the rhPCR assay.
[0192] Rare allele detection experiments were designed to detect the base identity of a SNP site in the SMAD7 gene (NM_005904, C/T SNP, rs4939827) and employed target DNAs GM18562 (homozygous C/C) and GM18537 (homozygous T/T) (Coriell Institute for Medical Research, Camden, N.J., USA). Control reactions were set up using 2 ng (660 copies), 0.2 ng (66 copies), or 0.02 ng (6.6 copies) of input matched target DNA. Rare allele detection reactions were set up using 2 ng (660 copies), 0.2 ng (66 copies), or 0.02 ng (6.6 copies) of input matched target DNA of one allele plus 200 ng (66,000 copies) of the other (mismatched) allele. Background was established in reactions that contained 0 copies of matched target DNA plus 200 ng (66,000 copies) of the mismatched target DNA. Both combinations were tested: GM18562 (C/C) as the rare allele in the presence of excess GM18537 (T/T) and GM18537 (T/T) as the rare allele in the presence of excess GM18562 (C/C).
[0193] Quantitative real-time rhPCR was performed in 10 .mu.L reaction volumes in 384 well format. Final reaction conditions used were 10 mM Tris-HCL (pH 8.4 at 25.degree. C.), 50 mM KCL, 3.5 mM MgCl.sub.2, 0.01% Triton-X100, 0.8 mM dNTPs, 200 nM of one of the SMAD7 forward primers (SEQ ID NOs. 75, 78, and 79), 200 nM of the SMAD7 reverse primer (SEQ ID NO. 74), and 200 nM of the SMAD7 probe (SEQ ID NO. 80). The 85 bp SMAD7 amplicon defined by these primers is shown as SEQ ID NO. 81. Note that the forward primers were either unmodified (control, SEQ ID NO. 75) or were specific for the SMAD7 C-allele (SEQ ID NO. 78) or the SMAD7 T-allele (SEQ ID NO. 79) using blocked-cleavable rhPCR Gen2 RDxxD design. Reactions utilized either 0.5 U of the wild type OptiTaq DNA polymerase or 0.5 U of one of the four Taq DNA polymerase mutants studied (MUT ID No. 2, V783F; MUT ID NO. 3, H784Q; MUT ID NO. 10, A661E I665W F667L; or MUT ID NO. 18, V783L H784Q). Reactions included P. abyssi RNase H2 at a concentration of 200 mU per 10 .mu.L reaction (384 fmoles) when using the SMAD7 For rC DxxD (SEQ ID NO. 78) primer and control reactions or 500-600 mU per 10 .mu.L reaction (960-1152 fmoles) when using the SMAD7 For rU DxxD (SEQ ID NO. 79) primer. Oligonucleotide reagents used in this Example are shown in Table 22. Cycling was performed on a Roche LightCycler.RTM. 480 (Roche Applied Science, Indianapolis, Ind., USA) as follows: 95.degree. C. for 3 minutes followed by 65 cycles of 95.degree. C. for 10 seconds and 60.degree. C. for 30 seconds. All reactions were performed in triplicate.
TABLE-US-00022 TABLE 22 Synthetic oligonucleotides employed in Example 9. SEQ ID Name Sequence (5'-3') NO. SMAD7 Rev CTCACTCTAAACCCCAGCATT 74 SMAD7 For CAGCCTCATCCAAAAGAGGAAA 75 SMAD7 For rC CAGCCTCATCCAAAAGAGGAAAcAxxA 78 DxxD SMAD7 For rU CAGCCTCATCCAAAAGAGGAAAuAxxA 79 DxxD SMAD7 probe FAM-CCCAGAGCTCCCTCAGACTCCT-IBFQ 80 SMAD7 target CAGCCTCATCCAAAAGAGGAAATAGGACCCC 81 AGAGCTCCCTCAGACTCCTCAGGAAACACAG ACAATGCTGGGGTTTAGAGTGAG DNA bases are uppercase and RNA bases are lowercase; FAM = 6-carboxyfluorescein; IBFQ = Iowa Black.TM. FQ fluorescence quencher; "x" = C3 Spacer (propanediol). Primer and probe binding sites in the SMAD7 target are underlined.
[0194] Results were analyzed and are shown in Table 23. The control columns show Cq values for matched primer/target reactions with no mismatched target present and establish a quantification standard curve. The rare allele detection columns show Cq values for detection of 660, 66, 6, or 0 (background control) copies of matched primer/target in the presence of 66,000 copies of mismatched target. It is generally assumed that at least a 3 cycle difference (.DELTA.Cq=3.0 or greater) between background and positive signal is needed to call a reaction "positive" for rare allele detection; a 5 cycle difference (.DELTA.Cq=5.0 or greater) is preferred. In this system, background is the signal observed when amplification is done using no input target that is matched to the primer, so signal arises solely from amplification originating off the mismatched target.
[0195] Using wild type OptiTaq DNA polymerase, detection of the "C" allele in an excess of "T" background and detection of the "T" allele in an excess of "C" background both met the .DELTA.Cq 3.0 and .DELTA.Cq 5.0 levels of stringency to call a 1:1000 rare allele detection event (66 copies of match target in the presence of 66,000 copies of mismatch target). The 1:10,000 reactions (6 copies of match target in the presence of 66,000 copies of mismatch target) did not meet either of these criteria. Thus rhPCR had a 1:1000 rare allele detection limit using wild type OptiTaq in this genomic DNA SNP system.
[0196] In contrast, rhPCR using each of the four mutants showed a 1:10,000 rare allele detection limit for both the "C" and "T" allele targets with a .DELTA.Cq stringency cutoff of 3.0. MUT ID 3 (H784Q) showed a 1:10,000 rare allele detection limit for both the "C" and "T" targets in this genomic SNP system for the higher .DELTA.Cq stringency cutoff of 5.0. The other three mutant Taq DNA polymerases (MUT ID No. 2, V783F; MUT ID NO. 10, A661E I665W F667L; and MUT ID NO. 18, V783L H784Q) showed a 1:10,000 rare allele detection limit for the "C" allele target with a .DELTA.Cq stringency cutoff of 5.0 and a 1:10,000 rare allele detection limit for the "T" allele target with a .DELTA.Cq stringency cutoff of 3.0. We therefore conclude that the new mutant Taq DNA polymerases of the present invention provide for improved rare allele detection reactions using blocked-cleavable primers in rhPCR compared with use of the wild type DNA polymerase.
TABLE-US-00023 TABLE 23 Rare allele detection using Gen2 RDxxD rhPCR primers comparing wild type OptiTaq with new mutant Taq DNA polymerases 200 ng mismatched template RNase H2 (66,000 copies of "wild type") Control DNA SEQ ID per 10 660 Match 66 Match 6 Match 0 Match (No mismatched template) Polymerase For Primer NO. .mu.L rxn (1:100) (1:1,000) (1:10,000) (background) 660 Match 66 Match 6 Match 0 Match Wild type SMAD7 For 75 200 mU 22.1 21.2 21.2 21.8 27.9 31.3 34.4 >65 OptiTaq SMAD7 For 78 200 mU 28.2 31.5 35.1 37.0 28.8 33.3 37.3 >65 rC DxxD SMAD7 For 79 500 mU 31.0 34.7 37.7 39.7 31.2 34.6 41.0 >65 rU DxxD MUT ID 2 SMAD7 For 75 200 mU 22.2 22.2 22.1 22.2 28.9 32.7 35.7 >65 (V783F) SMAD7 For 78 200 mU 28.2 31.7 35.4 45.4 29.0 33.3 37.5 >65 rC DxxD SMAD7 For 79 500 mU 28.6 32.5 36.7 41.3 28.2 34.0 42.0 >65 rU DxxD MUT ID 3 SMAD7 For 75 200 mU 23.5 23.6 24.5 24.1 30.5 33.4 38.0 >65 (H784Q) SMAD7 For 78 200 mU 29.8 33.8 37.6 >65 30.5 35.5 39.6 >65 rC DxxD SMAD7 For 79 500 mU 32.9 37.7 44.0 52.3 30.1 35.9 44.9 >65 rU DxxD MUT ID 10 SMAD7 For 75 200 mU 22.2 22.4 22.5 22.8 28.3 31.9 35.5 >65 (A661E SMAD7 For 78 200 mU 31.8 34.7 38.5 59.3 30.0 33.9 37.8 >65 I665W rC DxxD F667L) SMAD7 For 79 600 mU 33.5 38.4 43.2 46.2 31.9 36.5 41.0 >65 rU DxxD MUT ID 18 SMAD7 For 75 200 mU 22.4 22.4 22.7 22.5 27.8 31.5 34.8 >65 (V783L SMAD7 For 78 200 mU 28.8 32.9 37.5 46.5 29.5 33.4 37.8 >65 H784Q) rC DxxD SMAD7 For 79 500 mU 30.1 34.0 38.4 41.8 29.4 36.0 44.7 >65 rU DxxD Cq values are shown. For the rare allele detection series (selective detection of 6-660 copes one genotype in the presence of 66,000 copies of the other genotype), those reactions having a .DELTA.Cq of 3.0 or better are highlighted in bold font and those having a .DELTA.Cq of 5.0 or better are highlighted in bold font with underline. .DELTA.Cq = [(Cq 0 copies match) - (Cq 6 copies match)], or .DELTA.Cq = [(Cq 0 copies match) - (Cq 66 copies match)], or .DELTA.Cq = [(Cq 0 copies match) - (Cq 660 copies match)].
Example 10
Sequence of Taq DNA Polymerase Mutants Showing Improved Discrimination for Mismatch or the Presence of an RNA Residue at the 3'-End of the Primer
[0197] The complete amino acid and nucleotide sequences of the codon optimized mutant enzymes employed in Examples 5-9 are shown below. Although these sequences are easily derived from information provided in Tables 1, 3, 4 and 5 by one with skill in the art, the final assembled sequences are provided below for clarity. Base changes are identified in bold underlined font for the nucleic acid and amino acid substitutions.
TABLE-US-00024 SEQ ID NO. 82, nucleotide sequence of Mutant ID 2 (V783F) CATATGCGTGGTATGCTGCCGTTGTTCGAGCCTAAAGGCCGCGTACTGTTAGTCGATGGTCATCACTTGGCCTA- TCG GACGTTCCATGCACTCAAAGGTCTGACGACCAGTCGTGGCGAACCGGTCCAGGCTGTTTATGGTTTCGCTAAGT- CTT TGCTCAAAGCACTGAAAGAAGACGGGGACGCGGTAATTGTTGTATTTGATGCCAAAGCACCGAGCTTCCGCCAC- GAA GCTTATGGTGGCTACAAGGCAGGACGCGCCCCTACCCCAGAAGATTTCCCCCGTCAGCTGGCATTAATTAAGGA- GTT AGTAGACCTTCTCGGCTTAGCGCGTCTGGAAGTTCCGGGTTATGAGGCGGACGATGTCCTTGCATCCTTGGCTA- AAA AGGCCGAAAAAGAGGGCTACGAAGTCCGCATCTTGACGGCAGACAAAGATCTGTACCAGCTTCTGTCTGACCGT- ATT CATGTTTTGCACCCTGAAGGCTACTTAATCACTCCGGCCTGGCTCTGGGAAAAGTACGGTCTGCGTCCCGATCA- GTG GGCGGATTATCGGGCTTTGACGGGAGATGAGAGCGACAACCTGCCAGGAGTTAAGGGCATTGGTGAAAAAACCG- CAC GTAAGCTGCTTGAAGAGTGGGGTTCCCTGGAAGCCTTGTTAAAAAATCTGGATCGTCTCAAGCCCGCAATTCGT- GAA AAGATCCTGGCTCATATGGACGATCTTAAATTAAGTTGGGACCTGGCCAAGGTGCGCACCGATTTACCGCTTGA- AGT GGATTTTGCAAAACGCCGTGAGCCGGACCGGGAACGTTTACGCGCTTTCTTAGAGCGTCTGGAATTCGGTTCAC- TGC TTCATGAATTCGGTCTGTTAGAGTCTCCTAAAGCACTCGAAGAGGCACCGTGGCCGCCCCCAGAAGGTGCTTTT- GTT GGCTTCGTACTTTCCCGTAAGGAGCCTATGTGGGCAGATCTTCTGGCTTTAGCGGCTGCACGCGGTGGCCGTGT- TCA CCGGGCCCCTGAGCCATACAAAGCGTTACGTGATCTGAAGGAAGCACGTGGCTTGCTGGCAAAAGACCTTTCTG- TTT TGGCCCTGCGCGAGGGTCTTGGACTGCCGCCAGGCGACGATCCCATGTTATTGGCCTATCTGTTAGACCCTAGC- AAT ACCACACCTGAAGGGGTCGCTCGTCGGTATGGCGGTGAATGGACTGAGGAAGCCGGAGAGCGCGCCGCATTGTC- CGA ACGGCTCTTTGCAAACTTATGGGGTCGTCTGGAAGGGGAGGAACGTCTGTTATGGTTGTATCGGGAAGTCGAAC- GTC CTCTTTCGGCCGTATTAGCGCATATGGAGGCAACAGGTGTGCGTTTAGATGTCGCGTACCTTCGGGCCTTATCA- CTG GAAGTTGCAGAGGAAATCGCCCGTCTCGAGGCTGAAGTGTTCCGGTTGGCCGGTCACCCGTTTAACCTCAACTC- CCG TGACCAGCTGGAACGCGTTTTATTCGATGAGCTTGGGCTTCCCGCAATTGGCAAAACCGAAAAGACTGGCAAAC- GCA GTACGAGCGCTGCCGTCCTTGAGGCACTCCGCGAGGCTCACCCTATTGTAGAAAAGATCCTGCAATACCGTGAG- TTG ACGAAGCTTAAAAGCACTTATATTGATCCTCTCCCGGATCTGATCCATCCTCGTACCGGCCGCTTGCACACACG- TTT CAACCAGACGGCGACTGCAACCGGCCGTCTGTCTAGCTCGGATCCAAATCTCCAGAACATTCCGGTCCGTACAC- CCT TGGGCCAACGTATCCGCCGGGCGTTTATCGCTGAGGAAGGATGGTTACTGGTCGCATTGGACTACTCGCAGATT- GAG CTGCGCGTCCTCGCACATCTCTCTGGTGACGAAAATTTAATCCGCGTGTTTCAAGAGGGGCGTGATATTCACAC- AGA AACTGCCTCATGGATGTTCGGTGTCCCACGTGAAGCAGTGGATCCTTTGATGCGCCGTGCAGCTAAAACAATTA- ATT TTGGAGTGCTGTACGGAATGAGCGCTCATCGCTTGAGTCAGGAACTGGCAATCCCCTACGAGGAAGCGCAGGCA- TTC ATCGAACGTTACTTTCAATCGTTTCCGAAAGTTCGCGCATGGATCGAGAAGACGCTCGAGGAAGGTCGTCGTCG- GGG CTATGTCGAAACTCTGTTTGGTCGCCGTCGGTACGTACCAGATCTTGAAGCCCGCGTCAAATCGGTACGGGAGG- CTG CGGAGCGTATGGCATTTAATATGCCTGTACAGGGTACTGCAGCTGACCTCATGAAACTGGCAATGGTCAAGCTT- TTC CCGCGCTTGGAGGAAATGGGCGCACGTATGCTTCTGCAGTTCCATGACGAGCTGGTGTTAGAAGCCCCTAAGGA- GCG CGCCGAAGCTGTCGCGCGCCTCGCTAAAGAAGTGATGGAGGGCGTTTACCCATTGGCCGTACCCCTCGAAGTGG- AGG TCGGTATTGGAGAAGATTGGTTATCTGCAAAGGAAGCGGCCGC. SEQ ID NO. 83, amino acid sequence of Mutant ID 2 (V783F) MRGMLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKSLLKALKEDGDAVIVVFDAKAPSFR- HEA YGGYKAGRAPTPEDFPRQLALIKELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLSD- RIH VLHPEGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIGEKTARKLLEEWGSLEALLKNLDRLKPAI- REK ILAHMDDLKLSWDLAKVRTDLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLESPKALEEAPWPPPEGA- FVG FVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARGLLAKDLSVLALREGLGLPPGDDPMLLAYLLDP- SNT TPEGVARRYGGEWTEEAGERAALSERLFANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVRLDVAYLRAL- SLE VAEETARLEAEVERLAGHPFNLNSRDQLERVLEDELGLPAIGKTEKTGKRSTSAAVLEALREAHPIVEKILQYR- ELT KLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQ- IEL RVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQ- AFI ERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQGTAADLMKLAMVK- LFP RLEEMGARMLLQFHDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDWLSAKEAA. SEQ ID NO. 84, nucleotide sequence of Mutant ID 3 (H784Q) CATATGCGTGGTATGCTGCCGTTGTTCGAGCCTAAAGGCCGCGTACTGTTAGTCGATGGTCATCACTTGGCCTA- TCG GACGTTCCATGCACTCAAAGGTCTGACGACCAGTCGTGGCGAACCGGTCCAGGCTGTTTATGGTTTCGCTAAGT- CTT TGCTCAAAGCACTGAAAGAAGACGGGGACGCGGTAATTGTTGTATTTGATGCCAAAGCACCGAGCTTCCGCCAC- GAA GCTTATGGTGGCTACAAGGCAGGACGCGCCCCTACCCCAGAAGATTTCCCCCGTCAGCTGGCATTAATTAAGGA- GTT AGTAGACCTTCTCGGCTTAGCGCGTCTGGAAGTTCCGGGTTATGAGGCGGACGATGTCCTTGCATCCTTGGCTA- AAA AGGCCGAAAAAGAGGGCTACGAAGTCCGCATCTTGACGGCAGACAAAGATCTGTACCAGCTTCTGTCTGACCGT- ATT CATGTTTTGCACCCTGAAGGCTACTTAATCACTCCGGCCTGGCTCTGGGAAAAGTACGGTCTGCGTCCCGATCA- GTG GGCGGATTATCGGGCTTTGACGGGAGATGAGAGCGACAACCTGCCAGGAGTTAAGGGCATTGGTGAAAAAACCG- CAC GTAAGCTGCTTGAAGAGTGGGGTTCCCTGGAAGCCTTGTTAAAAAATCTGGATCGTCTCAAGCCCGCAATTCGT- GAA AAGATCCTGGCTCATATGGACGATCTTAAATTAAGTTGGGACCTGGCCAAGGTGCGCACCGATTTACCGCTTGA- AGT GGATTTTGCAAAACGCCGTGAGCCGGACCGGGAACGTTTACGCGCTTTCTTAGAGCGTCTGGAATTCGGTTCAC- TGC TTCATGAATTCGGTCTGTTAGAGTCTCCTAAAGCACTCGAAGAGGCACCGTGGCCGCCCCCAGAAGGTGCTTTT- GTT GGCTTCGTACTTTCCCGTAAGGAGCCTATGTGGGCAGATCTTCTGGCTTTAGCGGCTGCACGCGGTGGCCGTGT- TCA CCGGGCCCCTGAGCCATACAAAGCGTTACGTGATCTGAAGGAAGCACGTGGCTTGCTGGCAAAAGACCTTTCTG- TTT TGGCCCTGCGCGAGGGTCTTGGACTGCCGCCAGGCGACGATCCCATGTTATTGGCCTATCTGTTAGACCCTAGC- AAT ACCACACCTGAAGGGGTCGCTCGTCGGTATGGCGGTGAATGGACTGAGGAAGCCGGAGAGCGCGCCGCATTGTC- CGA ACGGCTCTTTGCAAACTTATGGGGTCGTCTGGAAGGGGAGGAACGTCTGTTATGGTTGTATCGGGAAGTCGAAC- GTC CTCTTTCGGCCGTATTAGCGCATATGGAGGCAACAGGTGTGCGTTTAGATGTCGCGTACCTTCGGGCCTTATCA- CTG GAAGTTGCAGAGGAAATCGCCCGTCTCGAGGCTGAAGTGTTCCGGTTGGCCGGTCACCCGTTTAACCTCAACTC- CCG TGACCAGCTGGAACGCGTTTTATTCGATGAGCTTGGGCTTCCCGCAATTGGCAAAACCGAAAAGACTGGCAAAC- GCA GTACGAGCGCTGCCGTCCTTGAGGCACTCCGCGAGGCTCACCCTATTGTAGAAAAGATCCTGCAATACCGTGAG- TTG ACGAAGCTTAAAAGCACTTATATTGATCCTCTCCCGGATCTGATCCATCCTCGTACCGGCCGCTTGCACACACG- TTT CAACCAGACGGCGACTGCAACCGGCCGTCTGTCTAGCTCGGATCCAAATCTCCAGAACATTCCGGTCCGTACAC- CCT TGGGCCAACGTATCCGCCGGGCGTTTATCGCTGAGGAAGGATGGTTACTGGTCGCATTGGACTACTCGCAGATT- GAG CTGCGCGTCCTCGCACATCTCTCTGGTGACGAAAATTTAATCCGCGTGTTTCAAGAGGGGCGTGATATTCACAC- AGA AACTGCCTCATGGATGTTCGGTGTCCCACGTGAAGCAGTGGATCCTTTGATGCGCCGTGCAGCTAAAACAATTA- ATT TTGGAGTGCTGTACGGAATGAGCGCTCATCGCTTGAGTCAGGAACTGGCAATCCCCTACGAGGAAGCGCAGGCA- TTC ATCGAACGTTACTTTCAATCGTTTCCGAAAGTTCGCGCATGGATCGAGAAGACGCTCGAGGAAGGTCGTCGTCG- GGG CTATGTCGAAACTCTGTTTGGTCGCCGTCGGTACGTACCAGATCTTGAAGCCCGCGTCAAATCGGTACGGGAGG- CTG CGGAGCGTATGGCATTTAATATGCCTGTACAGGGTACTGCAGCTGACCTCATGAAACTGGCAATGGTCAAGCTT- TTC CCGCGCTTGGAGGAAATGGGCGCACGTATGCTTCTGCAGGTCCAGGACGAGCTGGTGTTAGAAGCCCCTAAGGA- GCG CGCCGAAGCTGTCGCGCGCCTCGCTAAAGAAGTGATGGAGGGCGTTTACCCATTGGCCGTACCCCTCGAAGTGG- AGG TCGGTATTGGAGAAGATTGGTTATCTGCAAAGGAAGCGGCCGC. SEQ ID NO. 85, amino acid sequence of Mutant ID3 (H784Q) MRGMLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKSLLKALKEDGDAVIVVFDAKAPSFR- HEA YGGYKAGRAPTPEDFPRQLALIKELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLSD- RIH VLHPEGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIGEKTARKLLEEWGSLEALLKNLDRLKPAI- REK ILAHMDDLKLSWDLAKVRTDLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLESPKALEEAPWPPPEGA- FVG FVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARGLLAKDLSVLALREGLGLPPGDDPMLLAYLLDP- SNT TPEGVARRYGGEWTEEAGERAALSERLFANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVRLDVAYLRAL- SLE
VAEETARLEAEVERLAGHPFNLNSRDQLERVLEDELGLPAIGKTEKTGKRSTSAAVLEALREAHPIVEKILQYR- ELT KLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQ- IEL RVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQ- AFI ERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQGTAADLMKLAMVK- LFP RLEEMGARMLLQVQDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDWLSAKEAA. SEQ ID NO. 86, nucleotide sequence of Mutant ID 10 (A661E, I665W, F667L) CATATGCGTGGTATGCTGCCGTTGTTCGAGCCTAAAGGCCGCGTACTGTTAGTCGATGGTCATCACTTGGCCTA- TCG GACGTTCCATGCACTCAAAGGTCTGACGACCAGTCGTGGCGAACCGGTCCAGGCTGTTTATGGTTTCGCTAAGT- CTT TGCTCAAAGCACTGAAAGAAGACGGGGACGCGGTAATTGTTGTATTTGATGCCAAAGCACCGAGCTTCCGCCAC- GAA GCTTATGGTGGCTACAAGGCAGGACGCGCCCCTACCCCAGAAGATTTCCCCCGTCAGCTGGCATTAATTAAGGA- GTT AGTAGACCTTCTCGGCTTAGCGCGTCTGGAAGTTCCGGGTTATGAGGCGGACGATGTCCTTGCATCCTTGGCTA- AAA AGGCCGAAAAAGAGGGCTACGAAGTCCGCATCTTGACGGCAGACAAAGATCTGTACCAGCTTCTGTCTGACCGT- ATT CATGTTTTGCACCCTGAAGGCTACTTAATCACTCCGGCCTGGCTCTGGGAAAAGTACGGTCTGCGTCCCGATCA- GTG GGCGGATTATCGGGCTTTGACGGGAGATGAGAGCGACAACCTGCCAGGAGTTAAGGGCATTGGTGAAAAAACCG- CAC GTAAGCTGCTTGAAGAGTGGGGTTCCCTGGAAGCCTTGTTAAAAAATCTGGATCGTCTCAAGCCCGCAATTCGT- GAA AAGATCCTGGCTCATATGGACGATCTTAAATTAAGTTGGGACCTGGCCAAGGTGCGCACCGATTTACCGCTTGA- AGT GGATTTTGCAAAACGCCGTGAGCCGGACCGGGAACGTTTACGCGCTTTCTTAGAGCGTCTGGAATTCGGTTCAC- TGC TTCATGAATTCGGTCTGTTAGAGTCTCCTAAAGCACTCGAAGAGGCACCGTGGCCGCCCCCAGAAGGTGCTTTT- GTT GGCTTCGTACTTTCCCGTAAGGAGCCTATGTGGGCAGATCTTCTGGCTTTAGCGGCTGCACGCGGTGGCCGTGT- TCA CCGGGCCCCTGAGCCATACAAAGCGTTACGTGATCTGAAGGAAGCACGTGGCTTGCTGGCAAAAGACCTTTCTG- TTT TGGCCCTGCGCGAGGGTCTTGGACTGCCGCCAGGCGACGATCCCATGTTATTGGCCTATCTGTTAGACCCTAGC- AAT ACCACACCTGAAGGGGTCGCTCGTCGGTATGGCGGTGAATGGACTGAGGAAGCCGGAGAGCGCGCCGCATTGTC- CGA ACGGCTCTTTGCAAACTTATGGGGTCGTCTGGAAGGGGAGGAACGTCTGTTATGGTTGTATCGGGAAGTCGAAC- GTC CTCTTTCGGCCGTATTAGCGCATATGGAGGCAACAGGTGTGCGTTTAGATGTCGCGTACCTTCGGGCCTTATCA- CTG GAAGTTGCAGAGGAAATCGCCCGTCTCGAGGCTGAAGTGTTCCGGTTGGCCGGTCACCCGTTTAACCTCAACTC- CCG TGACCAGCTGGAACGCGTTTTATTCGATGAGCTTGGGCTTCCCGCAATTGGCAAAACCGAAAAGACTGGCAAAC- GCA GTACGAGCGCTGCCGTCCTTGAGGCACTCCGCGAGGCTCACCCTATTGTAGAAAAGATCCTGCAATACCGTGAG- TTG ACGAAGCTTAAAAGCACTTATATTGATCCTCTCCCGGATCTGATCCATCCTCGTACCGGCCGCTTGCACACACG- TTT CAACCAGACGGCGACTGCAACCGGCCGTCTGTCTAGCTCGGATCCAAATCTCCAGAACATTCCGGTCCGTACAC- CCT TGGGCCAACGTATCCGCCGGGCGTTTATCGCTGAGGAAGGATGGTTACTGGTCGCATTGGACTACTCGCAGATT- GAG CTGCGCGTCCTCGCACATCTCTCTGGTGACGAAAATTTAATCCGCGTGTTTCAAGAGGGGCGTGATATTCACAC- AGA AACTGCCTCATGGATGTTCGGTGTCCCACGTGAAGCAGTGGATCCTTTGATGCGCCGTGAAGCTAAAACATGGA- ATT TGGGAGTGCTGTACGGAATGAGCGCTCATCGCTTGAGTCAGGAACTGGCAATCCCCTACGAGGAAGCGCAGGCA- TTC ATCGAACGTTACTTTCAATCGTTTCCGAAAGTTCGCGCATGGATCGAGAAGACGCTCGAGGAAGGTCGTCGTCG- GGG CTATGTCGAAACTCTGTTTGGTCGCCGTCGGTACGTACCAGATCTTGAAGCCCGCGTCAAATCGGTACGGGAGG- CTG CGGAGCGTATGGCATTTAATATGCCTGTACAGGGTACTGCAGCTGACCTCATGAAACTGGCAATGGTCAAGCTT- TTC CCGCGCTTGGAGGAAATGGGCGCACGTATGCTTCTGCAGGTCCATGACGAGCTGGTGTTAGAAGCCCCTAAGGA- GCG CGCCGAAGCTGTCGCGCGCCTCGCTAAAGAAGTGATGGAGGGCGTTTACCCATTGGCCGTACCCCTCGAAGTGG- AGG TCGGTATTGGAGAAGATTGGTTATCTGCAAAGGAAGCGGCCGC. SEQ ID NO. 87, amino acid sequence of Mutant ID 10 (A661E, I665W, F667L) MRGMLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKSLLKALKEDGDAVIVVFDAKAPSFR- HEA YGGYKAGRAPTPEDFPRQLALIKELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLSD- RIH VLHPEGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIGEKTARKLLEEWGSLEALLKNLDRLKPAI- REK ILAHMDDLKLSWDLAKVRTDLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLESPKALEEAPWPPPEGA- FVG FVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARGLLAKDLSVLALREGLGLPPGDDPMLLAYLLDP- SNT TPEGVARRYGGEWTEEAGERAALSERLFANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVRLDVAYLRAL- SLE VAEETARLEAEVERLAGHPFNLNSRDQLERVLEDELGLPAIGKTEKTGKRSTSAAVLEALREAHPIVEKILQYR- ELT KLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQ- IEL RVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPREAVDPLMRREAKTWNLGVLYGMSAHRLSQELAIPYEEAQ- AFI ERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQGTAADLMKLAMVK- LFP RLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDWLSAKEAA. SEQ ID NO. 88, nucleotide sequence of Mutant ID 18 (V783L, H784Q) CATATGCGTGGTATGCTGCCGTTGTTCGAGCCTAAAGGCCGCGTACTGTTAGTCGATGGTCATCACTTGGCCTA- TCG GACGTTCCATGCACTCAAAGGTCTGACGACCAGTCGTGGCGAACCGGTCCAGGCTGTTTATGGTTTCGCTAAGT- CTT TGCTCAAAGCACTGAAAGAAGACGGGGACGCGGTAATTGTTGTATTTGATGCCAAAGCACCGAGCTTCCGCCAC- GAA GCTTATGGTGGCTACAAGGCAGGACGCGCCCCTACCCCAGAAGATTTCCCCCGTCAGCTGGCATTAATTAAGGA- GTT AGTAGACCTTCTCGGCTTAGCGCGTCTGGAAGTTCCGGGTTATGAGGCGGACGATGTCCTTGCATCCTTGGCTA- AAA AGGCCGAAAAAGAGGGCTACGAAGTCCGCATCTTGACGGCAGACAAAGATCTGTACCAGCTTCTGTCTGACCGT- ATT CATGTTTTGCACCCTGAAGGCTACTTAATCACTCCGGCCTGGCTCTGGGAAAAGTACGGTCTGCGTCCCGATCA- GTG GGCGGATTATCGGGCTTTGACGGGAGATGAGAGCGACAACCTGCCAGGAGTTAAGGGCATTGGTGAAAAAACCG- CAC GTAAGCTGCTTGAAGAGTGGGGTTCCCTGGAAGCCTTGTTAAAAAATCTGGATCGTCTCAAGCCCGCAATTCGT- GAA AAGATCCTGGCTCATATGGACGATCTTAAATTAAGTTGGGACCTGGCCAAGGTGCGCACCGATTTACCGCTTGA- AGT GGATTTTGCAAAACGCCGTGAGCCGGACCGGGAACGTTTACGCGCTTTCTTAGAGCGTCTGGAATTCGGTTCAC- TGC TTCATGAATTCGGTCTGTTAGAGTCTCCTAAAGCACTCGAAGAGGCACCGTGGCCGCCCCCAGAAGGTGCTTTT- GTT GGCTTCGTACTTTCCCGTAAGGAGCCTATGTGGGCAGATCTTCTGGCTTTAGCGGCTGCACGCGGTGGCCGTGT- TCA CCGGGCCCCTGAGCCATACAAAGCGTTACGTGATCTGAAGGAAGCACGTGGCTTGCTGGCAAAAGACCTTTCTG- TTT TGGCCCTGCGCGAGGGTCTTGGACTGCCGCCAGGCGACGATCCCATGTTATTGGCCTATCTGTTAGACCCTAGC- AAT ACCACACCTGAAGGGGTCGCTCGTCGGTATGGCGGTGAATGGACTGAGGAAGCCGGAGAGCGCGCCGCATTGTC- CGA ACGGCTCTTTGCAAACTTATGGGGTCGTCTGGAAGGGGAGGAACGTCTGTTATGGTTGTATCGGGAAGTCGAAC- GTC CTCTTTCGGCCGTATTAGCGCATATGGAGGCAACAGGTGTGCGTTTAGATGTCGCGTACCTTCGGGCCTTATCA- CTG GAAGTTGCAGAGGAAATCGCCCGTCTCGAGGCTGAAGTGTTCCGGTTGGCCGGTCACCCGTTTAACCTCAACTC- CCG TGACCAGCTGGAACGCGTTTTATTCGATGAGCTTGGGCTTCCCGCAATTGGCAAAACCGAAAAGACTGGCAAAC- GCA GTACGAGCGCTGCCGTCCTTGAGGCACTCCGCGAGGCTCACCCTATTGTAGAAAAGATCCTGCAATACCGTGAG- TTG ACGAAGCTTAAAAGCACTTATATTGATCCTCTCCCGGATCTGATCCATCCTCGTACCGGCCGCTTGCACACACG- TTT CAACCAGACGGCGACTGCAACCGGCCGTCTGTCTAGCTCGGATCCAAATCTCCAGAACATTCCGGTCCGTACAC- CCT TGGGCCAACGTATCCGCCGGGCGTTTATCGCTGAGGAAGGATGGTTACTGGTCGCATTGGACTACTCGCAGATT- GAG CTGCGCGTCCTCGCACATCTCTCTGGTGACGAAAATTTAATCCGCGTGTTTCAAGAGGGGCGTGATATTCACAC- AGA AACTGCCTCATGGATGTTCGGTGTCCCACGTGAAGCAGTGGATCCTTTGATGCGCCGTGCAGCTAAAACAATTA- ATT TTGGAGTGCTGTACGGAATGAGCGCTCATCGCTTGAGTCAGGAACTGGCAATCCCCTACGAGGAAGCGCAGGCA- TTC ATCGAACGTTACTTTCAATCGTTTCCGAAAGTTCGCGCATGGATCGAGAAGACGCTCGAGGAAGGTCGTCGTCG- GGG CTATGTCGAAACTCTGTTTGGTCGCCGTCGGTACGTACCAGATCTTGAAGCCCGCGTCAAATCGGTACGGGAGG- CTG CGGAGCGTATGGCATTTAATATGCCTGTACAGGGTACTGCAGCTGACCTCATGAAACTGGCAATGGTCAAGCTT- TTC CCGCGCTTGGAGGAAATGGGCGCACGTATGCTTCTGCAGCTGCAGGACGAGCTGGTGTTAGAAGCCCCTAAGGA- GCG CGCCGAAGCTGTCGCGCGCCTCGCTAAAGAAGTGATGGAGGGCGTTTACCCATTGGCCGTACCCCTCGAAGTGG- AGG TCGGTATTGGAGAAGATTGGTTATCTGCAAAGGAAGCGGCCGC. SEQ ID NO. 89, amino acid sequence of Mutant ID 18 (V783L, H784Q) MRGMLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKSLLKALKEDGDAVIVVFDAKAPSFR- HEA YGGYKAGRAPTPEDFPRQLALIKELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLSD- RIH
VLHPEGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIGEKTARKLLEEWGSLEALLKNLDRLKPAI- REK ILAHMDDLKLSWDLAKVRTDLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLESPKALEEAPWPPPEGA- FVG FVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARGLLAKDLSVLALREGLGLPPGDDPMLLAYLLDP- SNT TPEGVARRYGGEWTEEAGERAALSERLFANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVRLDVAYLRAL- SLE VAEETARLEAEVERLAGHPFNLNSRDQLERVLFDELGLPAIGKTEKTGKRSTSAAVLEALREAHPIVEKILQYR- ELT KLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQ- IEL RVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQ- AFI ERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQGTAADLMKLAMVK- LFP RLEEMGARMLLQLQDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDWLSAKEAA.
Example 11
BLAST Search for Additional Wild-Type VH-Related DNA Polymerases
[0198] A BLAST search using Taq DNA polymerase sequences G755 through P812 (SEQ ID NO. 90) as a comparison window was performed using available on-line databases through the National Center for Biotechnology Information of the National Library of Medicine of the National Institutes of Health (http://www.ncbi.nlm.nih.gov). The BLAST search revealed numerous wild-type DNA polymerase from other species sharing extensive sequence identity with Taq DNA polymerase, including identity at positions V783 and H784 of Taq DNA polymerase ("VH-related DNA polymerases"). An exemplary listing of these thermostable polymerases is illustrated in Table 24 and similar listing of putatively thermosenstive polymerases is illustrated in Table 25. In all the identified wild-type polymerase genes except one (Facklamia hominis), the amino acids corresponding to V783 and H784 of Taq DNA polymerase are preserved. In the exceptional case, however, namely, Facklamia hominis, an Ile naturally occurs at the residue position of the Taq DNA polymerase corresponding to V783. However, the Taq DNA polymerase mutant corresponding to Mutant ID 1 that includes this particular substitution behaves like the wild-type Taq DNA polymerase. Thus, the DNA polymerase of Facklamia hominis apparently deviates from the strong selection of Val at this position is postulated to maintain wild-type activity if either a Val or Ile residue is present. These BLAST results confirm a natural counter-selection against DNA polymerases having enhanced template discrimination activity and provide strong evidence that the disclosed engineered Taq DNA polymerase mutants having these properties are novel and non-obvious.
[0199] These identified DNA polymerases share extensive sequence homology with Taq DNA polymerase in the region that includes residues V783 and V784 of Taq DNA polymerase. Like that observed with the engineered Taq DNA polymerase mutants, each of the identified non-Taq DNA polymerases represent a sequence space from which engineered mutant enzymes can be generated having enhanced template discrimination activity, as compared to their respective unmodified counterparts. The magnitude of the enhanced template discrimination activity obtained for identical amino acid substitutions for non-Taq DNA polymerases may not be identical when compared to the respective unmodified non-Taq DNA polymerases or even when compared to the magnitude of enhanced template discrimination activity observed for the corresponding Taq DNA polymerase mutant. Nevertheless, a strong prediction of this disclosure is that at least some amino acid substitutions in non-Taq DNA polymerases having homology to residues V783 and/or H784 of Taq DNA polymerase will display enhanced template discrimination activity relative to their respective unmodified counterparts.
TABLE-US-00025 TABLE 24 Non-Taq thermostable DNA polymerases having homology to Taq sequences in region of V783 and H784 SEQ Accession No. Species Alignment (Query: Taq; Sbjct: Species) Identity* ref|WP 018111631.1| Thermus Query 1 GTAADLMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYP 58 88% SEQ ID NO. 91 igniterrae GTAADLMKLAMV + LFPRL + E + GARMLLQVHDELVLEAPK + RAE VA LAKEVMEGV + P Sbjct 752 GTAADLMKLAMVRLFPRLQELGARMLLQVHDELVLEAPKDRAERVAALAKEVMEGVVVP 809 ref|WP_022798807.1| Thermus Query 1 GTAADLMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYP 58 90% SEQ ID NO 92 islandicus GTAADLMKLAMVKLFPRL E GARMLLQVHDEL + LEAPK + RAE VA LAKEVMEGVYP Sbjct 752 GTAADLMKLAMVKLFPRLREAGARMLLQVHDELLLEAPKDRAEEVAALAKEVMEGVYP 809 ref|YP 005654546.1| Thermus sp. Query 1 GTAADLMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYP 58 84% SEQ ID NO. 93 CCB_US3_UF1 GTAADLMKLAMV + LFP L + GARMLLQVHDEL + LEAPKERAE VARLA + EVMEGV + P Sbjct 756 GTAADLMKLAMVRLFPLLPGVGARMLLQVHDELLLEAPKERAEEVARLAREVMEGVVVP 813 ref|WP 018461567.1| Thermus Query 1 GTAADLMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYP 58 83% SEQ ID NO. 94 oshimai GTAADLMKLAMVKLFPRL + G R + LLQVHDELVLEAPK RAE A + LAKE MEGVYP Sbjct 753 GTAADLMKLAMVKLFPRLRPLGVRILLQVHDELVLEAPKARAEEAAQLAKETMEGVYP 810 ref|WP 008632471.1| Thermus sp. RL Query 1 GTAADLMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYP 58 84% SEQ ID NO. 95 GTAADLMKLAMVKLFPRL EMGARMLLQVHDEL + LEAP + RAE VA LAKE ME YP Sbjct 754 GTAADLMKLAMVKLFPRLREMGARMLLQVHDELLLEAPQARAEEVAALAKEAMEKAYP 811 ref|YP 005640602.1| Thermus Query 1 GTAADLMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYP 58 84% SEQ ID NO: 96 thermophilus SG0.5JP17-16 GTAADLMKLAMVKLFPRL EMGARMLLQVHDEL + LEAP + RAE VA LAKE ME YP Sbjct 754 GTAADLMKLAMVKLFPRLREMGARMLLQVHDELLLEAPQARAEEVAALAKEAMEKAYP 811 ref|WP 019550117.1|\ Thermus Query 1 GTAADLMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYP 58 83% SEQ ID NO. 97 scotoductus GTAADLMKLAMVKLFPRL + E + GARMLLQVHDELVLEAPKE + AE VA + AK ME V + P Sbjct 753 GTAADLMKLAMVKLFPRLQELGARMLLQVHDELVLEAPKEQAEEVAQEAKRTMEEVVVP 810 gb|AAB81398.1| Thermus Query 1 GTAADLMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYP 58 83% SEQ ID NO. 98 caldophilus GTAADLMKLAMVKLFPRL EMGARMLLQVHDEL + LEAP + AE VA LAKE ME YP Sbjct 757 GTAADLMKLAMVKLFPRLREMGARMLLQVHDELLLEAPQAGAEEVAALAKEAMEKAYP 814 ref|YP 004367987.1| Marini-thermus Query 1 GTAADLMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVY 57 75% SEQ ID NO. 99 hydro-thermalis DSM 14884 GTAADLMKLAMVKL P + + GAR + + LQVHDELVLEAP + ERAEAVAR + + EVMEG + Sbjct 758 GTAADLMKLAMVKLAPEIRSLGARLILQVHDELVLEAPQERAEAVARVVREVMEGAW 814 gb|AAR11876..1| Thermus Query 1 GTAADLMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYP 58 72% SEQ ID NO. 100 filiformis GTAADLMK + AMVKLFPRL + + GA + LLQVHDELVLE P + + RAE L KEVME YP Sbjct 755 GTAADLMKIAMVKLFPRLKPLGAHLLLQVHDELVLEVPEDRAEEAKALVKEVMENTYP 812 ref|WP 0184.65880.1| Meiothermus Query 1 GTAADLMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVY 57 68% SEQ ID NO. 101 timidus GTAADLMKLAMVKL P+ LE + A + + LQVHDELV + EAP + ERAE VA LA + E M Sbjct 774 GTAADLMKLAMVKLGPKLEPLDAHLVLQVHDELVIEAPRERAEEVAELARETMRTAW 830 ref|WP 013637959.1| Desulfuro-bacterium Query 1 GTAADLMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGV 56 61% SEQ ID NO. 102 thermolithot rophum GTAAD+MKLAMVKL + + LE + + GA M + LQVHDE + V + EA + E + E + + + KE ME V Sbjct 765 GTAADIMKLAMVKLYKKLEKLGAYMVLQVHDEIVIEALEEKTEEIMKIVKETMENV 820 ref|YP 005442159.1| Caldilinea Query 1 GTAADLMKLAMVKLFPRLEEMG--ARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVY 57 54% SEQ ID NO. 103 aerophila GTAAD + MK + AM + + L + RL + G R + L + QVHDELVLEAP E E + L + E M Y Sbjct 875 GTAADIMKIAMIRLYERLQNDGYRTRLLIQVHDELVLEAPPEELESATHLVRETMANAY 933 *Sequence identity refers to the percent identity of the query sequence with wild type Taq DNA polymerase.
TABLE-US-00026 TABLE 25 Non-Taq putatively thermosensitive DNA polymerasess having homology to Taq sequence in the region of V783 and H784 Acces- SEQ sion Iden- No. Species Alignment (Query: Taq; Sbjct: Species) tity* ref| Eubacterium Query 1 GTAADLMKLAMVKLFPRLEEMG--ARMLLQVHDELVLEAPKERAEAVARLAKEVMEG 55 60% WP siraeum GTAAD + + K + AM + K + + RLEE G AR + + LQVHDEL + + 015519 EA + + AE VA L KE ME 435.1| Sbjct 751 GTAADIIKIAMIKVYNRLEESGLDARLILQVHDELIVEAKEDCAEKVALLLKEEMEN 807 SEQ ID NO: 104 ref| Clostridium Query 1 GTAADLMKLAMVKLFPRL--EEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEG 55 58% WP leptum GTAAD + + K + AMV + + RL E M AR + + LQVHDEL + + EAP + + 022236 AE AR + E MEG 670.1| Sbjct 320 GTAADIIKIAMVRVDRRLKRENMRARLILQVHDELIVEAPEDEAEQAARILTEEMEG 376 SEQ ID NO: 105 ref| Entero- Query 1 GTAADLMKLAMVKLFPRLEEMG--ARMLLQVHDELVLEAPKERAEAVARLAKEVME 54 59% WP coccus G + AAD + + K + AM + + L RL + E G A MLLQVHDELV E PK + 002333 E + + + L KEVME 048.1| Sbjct 803 GSAADILKIAMIELDKRLKETGLQATMLLQVHDELVFEVPKKELESLDKLVKEVME 858 SEQ ID NO: 106 ref| Facklamia Query 1 GTAADLMKLAMVKLFPRLEEMG--ARMLLQVHDELVLEAPKERAEAVARLAKEVMEG 55 60% WP hominis GTAAD + + KLAMV + L RLEE G + R + LLQ + HDEL + LE PKE + + 016648 L EVME 372.1| Sbjct 803 GTAADIIKLAMVRLQARLEEAGLSSRLLLQIHDELILEGPKEEMPQLQKLVVEVMES 859 SEQ ID NO: 107 Ref| Bacillus Query 1 GTAADLMKLAMVKLFPRLEEMG--ARMLLQVHDELVLEAPKERAEAVARLAKEVME 54 61% WP anthmcis GTAAD + + K AM + + RLEE G AR + LLQVHDEL + EAPKE E + + L 00041 EVME 2792| Sbjct 799 GTAADIIKKAMIIMADRLEEEGLQARLLLQVHDELIFEAPKEEVEKLEKLVPEVME 854 SEQ ID NO: 108 ref| Bacillus Query 1 GTAADLMKLAMVKLFPRLEEMG--ARMLLQVHDELVLEAPKERAEAVARLAKEVME 54 61% NP 9810 cereus GTAAD + + K AM + + RLEE G AR + LLQVHDEL + EAPKE E + + L 11.1| ATCC EVME SEQ ID 10987 Sbjct 799 GTAADIIKKAMIIMADRLEEEGLQARLLLQVHDELIFEAPKEEIEKLEKLVPEVME 854 NO: 109 *Sequence identity refers to the percent identity of the query sequence with wild type Taq DNA polymerase.
Example 12
Production of Additional Codon Optimized Taq DNA Polymerase Mutants at Position H784
[0200] After determining the properties of the first eighteen mutant versions of the Taq polymerase (Table 3, Mut IDs 1-18), an additional eighteen mutant versions of Taq DNA polymerase (Table 3, Mut IDs 19-30) were made by site directed mutagenesis of the cloned OptiTaq codon-optimized WT Taq DNA polymerase. The full set represents all possible amino acid variations at position 784 in Taq polymerase. Specific mutations were introduced into the OptiTaq sequence using the method of PCR site-directed mutagenesis (Weiner M P, et al., Gene. 151(1-2):119-23 (1994)). Each mutagenesis reaction employed 10 pmoles of two complementary oligonucleotides (Table 26) containing the desired base changes, annealed to the double-stranded OptiTaq plasmid (20 ng), 5 U KOD DNA polymerase (Novagen-EMD Chemicals, San Diego, Calif.), 1.5 mM MgSO.sub.4, in 1.times. KOD PCR buffer. Thermal cycling parameters were 95.degree. C. for 3 minutes (95.degree. C. for 20 sec-55.degree. C. for 20 sec-70.degree. C. for 2.5 minutes) for 16 cycles followed by a 70.degree. C. soak for 4 minutes. After PCR site-directed mutagenesis, the amplified product was treated with 10 U of Dpn I (NEB, Ipswich, Mass.), at 37.degree. C. for 1 hour, followed by inactivation at 80.degree. C. for 20 minutes. 1/110.sup.th of the digestion material was transformed into XL-1 Blue competent bacteria. Bacterial clones were isolated, plasmid DNA prepared, and individual mutations were confirmed by Sanger DNA sequencing. All mutants remained in the pET-27b(+) expression vector, which is suitable for expressing the recombinant proteins in E. coli. Expression and purification of the recombinant mutants of the Taq polymerase were performed as described in Example 3.
TABLE-US-00027 TABLE 26 Oligonucleotides used for site-directed mutagenesis to produce 18 Taq DNA Polymerase mutants at position 784. Amino Sequence'' SEQ Sequence'' SEQ Mutant acid Sense mutagenesis ID Antisense mutagenesis ID ID changes oligonucleotide No. oligonucleotide No. 19 H784G gggcgcacgtatgcttctgca 110 taggggcttctaacaccagctcg 111 ggtcGGTgacgagctggtgtt tcACCgacctgcagaagcatacg agaagccccta tgcgccc 20 H784A gggcgcacgtatgcttctgca 112 taggggcttctaacaccagctcg 113 ggtcGCGgacgagctggtgtt tcCGCgacctgcagaagcatacg agaagccccta tgcgccc 21 H784S gggcgcacgtatgcttctgca 114 taggggcttctaacaccagctcg 115 ggtcAGCgacgagctggtgtt tcGCTgacctgcagaagcatacg agaagccccta tgcgccc 22 H784T gggcgcacgtatgcttctgca 116 taggggcttctaacaccagctcg 117 ggtcACGgacgagctggtgtt tcCGTgacctgcagaagcatacg agaagccccta tgcgccc 23 H784C gggcgcacgtatgcttctgca 118 taggggcttctaacaccagctcg 119 ggtcTGCgacgagctggtgtt tcGCAgacctgcagaagcatacg agaagccccta tgcgccc 24 H784V gggcgcacgtatgcttctgca 120 taggggcttctaacaccagctcg 121 ggtcGTAgacgagctggtgtt tcTACgacctgcagaagcatacg agaagccccta tgcgccc 25 H784L gggcgcacgtatgcttctgca 122 taggggcttctaacaccagctcg 123 ggtcTTGgacgagctggtgtt tcCAAgacctgcagaagcatacg agaagccccta tgcgccc 26 H784I gggcgcacgtatgcttctgca 124 taggggcttctaacaccagctcg 125 ggtcATTgacgagctggtgtt tcAATgacctgcagaagcatacg agaagccccta tgcgccc 27 H784M gggcgcacgtatgcttctgca 126 taggggcttctaacaccagctcg 127 ggtcATGgacgagctggtgtt tcCATgacctgcagaagcatacg agaagccccta tgcgccc 28 H784P gggcgcacgtatgcttctgca 128 taggggcttctaacaccagctcg 129 ggtcCCAgacgagctggtgtt tcTGGgacctgcagaagcatacg agaagccccta tgcgccc 29 H784F gggcgcacgtatgcttctgca 130 taggggcttctaacaccagctcg 131 ggtcTTTgacgagctggtgtt tcAAAgacctgcagaagcatacg agaagccccta tgcgccc 30 H784Y gggcgcacgtatgcttctgca 132 taggggcttctaacaccagctcg 133 ggtcTATgacgagctggtgtt tcATAgacctgcagaagcatacg agaagccccta tgcgccc 31 H784W gggcgcacgtatgcttctgca 134 taggggcttctaacaccagctcg 135 ggtcTGGgacgagctggtgtt tcCCAgacctgcagaagcatacg agaagccccta tgcgccc 32 H784D gggcgcacgtatgcttctgca 136 taggggcttctaacaccagctcg 137 ggtcGATgacgagctggtgtt tcATCgacctgcagaagcatacg agaagccccta tgcgccc 33 H784E gggcgcacgtatgcttctg 138 taggggcttctaacaccagctcg 139 caggtcGAAgacgagctgg tcTTCgacctgcagaagcatacg tgttagaagccccta tgcgccc 34 H784N gggcgcacgtatgcttctgca 140 taggggcttctaacaccagctcg 141 ggtcAACgacgagctggtgtt tcGTTgacctgcagaagcatacg agaagccccta tgcgccc 35 H784K gggcgcacgtatgcttctgca 142 taggggcttctaacaccagctcg 143 ggtcAAAgacgagctggtgtt tcTTTgacctgcagaagcatacg agaagccccta tgcgccc 36 H784R gggcgcacgtatgcttctgca 144 taggggcttctaacaccagctcg 145 ggtcCGGgacgagctggtgtt tcCCGgacctgcagaagcatacg agaagccccta tgcgccc DNA bases identical to codon optimized OptiTaq are shown in lower case; those specific for the mutations introduced by site-directed mutagenesis are shown in upper case.
Example 13
Characterization of Properties of 18 Mutant Taq DNA Polymerases Altered at Position H784 in PCR
[0201] The 18 mutant Taq DNA polymerase enzymes described in Example 12 were characterized for polymerase activity and ability to discriminate a 3'-RNA residue in the primer oligonucleotide.
[0202] The unit activity of the purified wild-type protein was determined by comparing performance in qPCR of known quantities of OptiTaq and each mutant compared to a commercial native non-hot-start Taq DNA polymerase, Taq-B DNA Polymerase (Enzymatics, Beverly, Mass.). Quantification cycle values (Cq, the amplification cycle number at which positive signal is first detected) and amplification curve shapes were analyzed to determine the nanogram amounts at which both enzymes performed similarly in the suboptimal range for each. Using these nanogram amounts and known unit values of Taq-B DNA polymerase, relative activity unit values could be extrapolated for all of the mutant DNA polymerase enzymes having sufficient activity to support PCR.
[0203] The following reaction conditions were employed: 1.times. qPCR buffer (20 mM Tris pH 8.4, 50 mM KCl, 3 mM MgCl.sub.2, 0.01% Triton-X100), 800 .mu.M dNTPs (200 .mu.M each), 500 nM For primer (Hs HPRT F517, SEQ ID NO. 43), 500 nM Rev primer (Hs HPRT R591, SEQ ID NO. 44), 250 nM probe (Hs HPRT P554, SEQ ID NO. 45), 2.times.10.sup.3 copies of linearized cloned plasmid template (HPRT-targ, SEQ ID NO. 46), in 10 .mu.L final volume. The amount of DNA polymerase added to each reaction was varied as follows: for wild type (OptiTaq), reactions were set using 10, 1, 0.1, 0.01, and 0.001 U/.mu.L (220, 22, 2.2, 0.22, or 0.022 ng of protein per 10 .mu.L reaction). Mutant polymerases were run in similar concentrations. In addition, those mutant enzymes showing polymerase activity were more finely titrated testing 220, 22, 10.6, 4.8, 2.2, 1.1, 0.48, and 0.22 ng of protein per 10 .mu.L reaction. Enzyme dilutions were made in enzyme dilution buffer (20 mM Tris pH7.5, 100 mM NaCl, 1 mM DTT, 0.1% Triton-X100, 1 mg/mL BSA, 10% glycerol). Reactions were run in 384 well format on a BIO-RAD CFX384.TM. Real-Time System (BIO-RAD, Hercules, Calif.) using cycling parameters 95.degree. C. for 30 seconds followed by 60 cycles of [95.degree. C. for 15 seconds followed by 60.degree. C. for 1 minutes]. Detection was achieved using a fluorescence-quenched probe (5'-nuclease assay format, note that the mutations introduced into the present series of Taq mutants do not lie in the 5'-nuclease domain). Sequences of the primers, probe, and template (plasmid insert) are shown in Table 27.
TABLE-US-00028 TABLE 27 Sequence of oligonucleotides employed in Taq DNA polymerase activity assay. Name Sequence SEQ ID NO. Hs HPRT GACTTTGCTTTCCTTGGTCAG SEQ ID NO. 43 F517 Hs HPRT GGCTTATATCCAACACTTCGTG SEQ ID NO. 44 R591 Hs HPRT FAM-ATGGTCAAG(ZEN)GTCG SEQ ID NO. 45 P554 CAAGCTTGCTGGT-IBFQ HPRT- GACTTTGCTTTCCTTGGTCAGGCAG SEQ ID NO. 46 targ TATAATCCAAAGATGGTCAAGGTCG CAAGCTTGCTGGTGAAAAGGACCCC ACGAAGTGTTGGATATAAGCC Nucleic acid sequences are shown 5'-3'. FAM = 6-carboxyfluorescein, IBFQ = Iowa Black FQ (fluorescence quencher), and ZEN = ZEN internal fluorescence quencher.
[0204] These 18 Taq DNA polymerase mutants were characterized as outlined above. Results are summarized in Table 28. Ten mutants, including Mutant IDs 19, 23, 25, 28, and 31 to 36, did not show detectable DNA polymerase activity and were not studied further. Four mutants, Mutant IDs 20, 21, 27 and 29 had DNA polymerase activity; however, processivity was reduced from 4-6 fold relative to the wild type enzyme. Three mutants, Mutant IDs 24, 26, and 30, showed DNA polymerase activity similar to wild type OptiTaq.
TABLE-US-00029 TABLE 28 Activity of novel Taq DNA polymerase mutants. Amino acid .DELTA.Cq Delay in Mutant changes from Polymerase Relative priming from ID wild-type Taq Activity activity* an RNA base** 19 H784G No -- -- 20 H784A Yes 0.2 1 21 H784S Yes 0.16 2 22 H784T Yes 1 0 23 H784C No -- -- 24 H784V Yes 0.45 >35 25 H784L No -- -- 26 H784I Yes 0.5 6 27 H784M Yes 0.22 >35 28 H784P No -- -- 29 H784F Yes 0.22 3 30 H784Y Yes 0.45 5 31 H784W No -- -- 32 H784D No -- -- 33 H784E No -- -- 34 H784N No -- -- 35 H784K No -- -- 36 H784R No -- -- *Wild-type OptiTaq was set to "1" and the relative activity of each of the mutant polymerases was normalized to this amplification efficiency, with 1 as the maximum. **.DELTA.Cq = [Cq Mutant ID X] - [Cq OptiTaq] when qPCR reactions are run using primers having a 3'-RNA residue.
[0205] The subset of these mutant Taq DNA polymerases which showed suitable levels of DNA polymerase activity were studied for their ability to discriminate between primers have a 3'-DNA versus a 3'-RNA residue relative to the wild type OptiTaq enzyme. Real-time PCR was performed as before, employing in the reactions the amount of each mutant DNA polymerase equal to 0.5 units of wild-type OptiTaq per 10 .mu.L reaction. The following reaction conditions were employed: 1.times. qPCR buffer (20 mM Tris pH 8.4, 50 mM KCl, 3 mM MgCl.sub.2, 0.01% Triton-X100), 800 .mu.M dNTPs (200 .mu.M each), 500 nM For primer (Hs SFRS9 F569 rU, SEQ ID NO. 47), 500 nM Rev primer (Hs SFRS9 R712 rA, SEQ ID NO. 48), 250 nM probe (Hs SFRS9 P644, SEQ ID NO. 49), 2.times.10.sup.3 copies of linearized cloned plasmid template (SFRS9-targ, SEQ ID NO. 50), in 10 .mu.L final volume. Reactions were run in 384 well format on a BIO-RAD CFX384.TM. Real-Time System (BIO-RAD, Hercules, Calif.) using cycling parameters 95.degree. C. for 30 seconds followed by 60 cycles of [95.degree. C. for 15 seconds followed by 60.degree. C. for 1 minutes]. Detection was achieved using a fluorescence-quenched probe (5'-nuclease assay format). Sequences of the primers, probe, and template (plasmid insert) are shown in Table 29.
TABLE-US-00030 TABLE 29 Sequence of oligonucleotides employed in the primer 3'-RNA discrimination assay. Name Sequence SEQ ID NO. Hs SFRS9 TGTGCAGAAGGATGGAGu SEQ ID NO. 47 F569 rU Hs SFRS9 CTGGTGCTTCTCTCAGGATa SEQ ID NO. 48 R712 rA Hs SFRS9 HEX-TGGAATATG(ZEN)CC SEQ ID NO. 48 P644 CTGCGTAAACTGGA-IBFQ SFRS9- TGTGCAGAAGGATGGAGTGG SEQ ID NO. 50 targ GGATGGTCGAGTATCTCAGA AAAGAAGACATGGAATATGC CCTGCGTAAACTGGATGACA CCAAATTCCGCTCTCATGAG GGTGAAACTTCCTACATCCG AGTTTATCCTGAGAGAAGCA CCAG Nucleic acid sequences are shown 5'-3' with DNA uppercase and RNA lowercase. HEX = hexachlorofluorescein, IBFQ = Iowa Black FQ (fluorescence quencher), and ZEN = ZEN fluorescence quencher.
[0206] The eight Taq DNA polymerase mutants that supported PCR were tested for the ability to use a 3'-RNA modified primer as outlined above. Results are summarized in Table 28. Mutant IDs 20 and 22 did not show any significant difference between primers having a 3'-DNA versus a 3'-RNA residue. Mutant IDs 21, 24, 26, 27, 29, and 30 showed an amplification delay using 3'-RNA primers. Thus, additional Taq DNA polymerase mutants were identified which discriminate against priming from a 3'-RNA residue. Those mutants which showed some delay with RNA priming and showed high processivity were further studied for improvements in primer 3'-residue mismatch discrimination.
Example 14
Improved Mismatch Discrimination in Allele-Specific PCR using Mutant Taq DNA Polymerases Altered at Position H784
[0207] Of the 18 mutant enzymes studied in Example 12 and 13, Mutant IDs 21, 24, 26, 27, 29, and 30 showed the ability to discriminate against a 3'-RNA residue in the primer and retained high enzymatic activity/processivity. These six mutants and additionally Mutant IDs 20 and 22 were studied for the ability to discriminate against a 3'-terminal DNA mismatch compared with wild type OptiTaq DNA polymerase using an allele-specific qPCR assay. Amplification reactions were performed against a synthetic oligonucleotide template where a single base was varied (SNP) which was positioned to lie at the 3'-end of the reverse primer. Synthetic templates were employed having each of the 4 possible bases at this position. Reverse primers were employed having each of the 4 possible bases at the 3'-end. Relative amplification efficiencies of all pairwise primer/template combinations were assessed using qPCR.
[0208] Quantitative allele-specific real-time PCR (AS-qPCR) was performed in 10 .mu.L reaction volumes in 384 well format with 2.times.10.sup.5 copies of a 103 bp synthetic template (SEQ ID NOs. 51-4). Final reaction conditions used were 20 mM Tris-HCL (pH 8.4 at 25.degree. C.), 50 mM KCL, and 3 mM MgCl.sub.2, 0.01% Triton X-100, 800 .mu.M total dNTPs, and 200 nM of the universal forward primer (SEQ ID NO. 60), 200 nM of a reverse primer (separate reactions were set up for each of the allele-specific primers SEQ ID NOs. 55-58 or the control universal primer SEQ ID NO. 59) and 200 nM of the 5' nuclease detection probe (SEQ ID NO. 61). Each allele-specific primer was tested on each SNP template. Reactions utilized either 0.5 U (10.8 ng/11.1 nM/111 fmol) of the wild type OptiTaq DNA polymerase or 0.5 U of one of the nine Taq DNA polymerase mutants studied (Mutant ID 3 (H784Q) (10.8 ng/11.1 nM/111 fmol); Mutant ID 20 H784A (54 ng/55.5 nM/555 fmol); Mutant ID22 H784T (10.8 ng/11.1 nM/111 fmol); Mutant ID 24 H784V (24 ng/24.7 nM/246.7 fmol); Mutant ID 26 H784I (21.6 ng/22.2 nM/222 fmol); Mutant ID 27 H784M (10.8 ng/11.1 nM/111 fmol); Mutant ID 29 H784F (49.1 ng/49.4 nM/494.5 fmol); Mutant ID 30 H784Y) (24 ng/24.7 nM/246.7 fmol). Amplification was performed on a CFX384.TM. C1000.TM. Thermo Cycler system (Bio-Rad, Hercules, Calif.) using the following cycling parameters: 95.degree. C. for 30 seconds initial denaturation followed by 60 cycles of 95.degree. C. for 10 seconds, then 60.degree. C. for 30 seconds. Oligonucleotide reagents used in this example are shown in Table 30.
TABLE-US-00031 TABLE 30 Synthetic oligonucleotides employed in Example 13. Name Sequence (5'-3') SEQ ID NO. A AGCTCTGCCCAAAGATTACC SEQ ID NO. 51 Template CTGACAGCTAAGTGGCAGTG GAAGTTGGCCTCAGAAGTAG TGGCCAGCTGTGTGTCGGGG AACAGTAAAGGCATGAAGCT CAG C AGCTCTGCCCAAAGATTACC SEQ ID NO. 52 Template CTGACAGCTAAGTGGCAGTG GAAGTTGGCCTCAGAAGTAG TGGCCAGCTGTGTGTCGGGG CACAGTAAAGGCATGAAGCT CAG G AGCTCTGCCCAAAGATTACC SEQ ID NO. 53 Template CTGACAGCTAAGTGGCAGTG GAAGTTGGCCTCAGAAGTAG TGGCCAGCTGTGTGTCGGGG GACAGTAAAGGCATGAAGCT CAG T AGCTCTGCCCAAAGATTACC SEQ ID NO. 54 Template CTGACAGCTAAGTGGCAGTG GAAGTTGGCCTCAGAAGTAG TGGCCAGCTGTGTGTCGGGG TACAGTAAAGGCATGAAGCT CAG Syn Rev T CTGAGCTTCATGCCTTTACT SEQ ID NO. 55 GTT Syn Rev C CTGAGCTTCATGCCTTTACT SEQ ID NO. 56 GTC Syn Rev A CTGAGCTTCATGCCTTTACT SEQ ID NO. 57 GTA Syn Rev G CTGAGCTTCATGCCTTTACT SEQ ID NO. 58 GTG Syn Rev CTGAGCTTCATGCCTTTACT SEQ ID NO. 59 GT Syn For AGCTCTGCCCAAAGATTACC SEQ ID NO. 60 CTG Syn Probe FAM-TTCTGAGGC(ZEN)CA SEQ ID NO. 61 ACTTCCACTGCCACTTA- IBFQ DNA bases are uppercase; FAM = 6-carboxyfluorescein; IBFQ = Iowa Black .TM. FQ fluorescence quencher; ZEN = internal ZEN fluorescence quencher; underlined base indicates the SNP site in the synthetic template DNA.
[0209] Initially all reactions were run in triplicate. Similar results were obtained for all replicates when using the wild type OptiTaq. However, results showed greater variation for the mutant polymerases. To obtain statistically meaningful results, each reaction was therefore performed 24 times for the mutant polymerases and 21 times for the wild type enzyme. .DELTA.Cq values were calculated as the Cq value obtained for each mismatched base pair minus the Cq value obtained for the matched base pair (.DELTA.Cq=Cq mismatch-Cq match). The .DELTA.Cq values for all 24 replicates were averaged and standard deviations were calculated. Results are shown in Table 31 and are graphically summarized in FIGS. 3C, 3D, 3E, 3F, and 3G. Note that the reverse primer is the allele-specific primer, so the "Syn Rev T" primer (SEQ ID NO. 55) is the perfect match to the Template A (SEQ ID NO. 51), etc.
TABLE-US-00032 TABLE 31 .DELTA.Cq values for AS-qPCR reactions using WT OptiTaq and H784 mutant Taq DNA polymerases. Reverse Primer Template SEQ A C G T DNA ID SEQ ID SEQ ID SEQ ID SEQ ID Polymerase Name NO. NO. 51 NO. 52 NO. 53 NO. 54 OptiTaq Syn Rev T 55 -- 1.4 +/- 0.1 0.6 +/- 0.2 4.8 +/- 0.2 Syn Rev G 58 8.5 +/- 0.2 -- 5.9 +/- 0.2 3.5 +/- 0.2 Syn Rev C 56 2.8 +/- 0.2 7.7 +/- 0.1 -- 3.9 +/- 0.1 Syn Rev A 57 5.3 +/- 0.2 -0.8 +/- 0.1 6.1 +/- 0.1 -- MUT ID 3 Syn Rev T 55 -- 5.7 +/- 0.2 5.7 +/- 0.3 10.8 +/- 0.4 H784Q Syn Rev G 58 14.5 +/- 0.6 -- 12.5 +/- 0.5 6.8 +/- 0.2 Syn Rev C 56 8.5 +/- 1.5 10.6 +/- 0.2 -- 7.7 +/- 0.3 Syn Rev A 57 10.3 +/- 0.5 4.1 +/- 0.1 11.0 +/- 0.7 -- MUT ID 20 Syn Rev T 55 -- 7.6 +/- 0.3 7.7 +/- 0.4 12.3 +/- 0.8 H784A Syn Rev G 58 19.1 +/- 6.0 -- 14.8 +/- 1.4 6.3 +/- 0.5 Syn Rev C 56 9.6 +/- 0.5 12.4 +/- 4.7 -- 8.2 +/- 0.4 Syn Rev A 57 14.9 +/- 4.4 7.6 +/- 0.2 14.2 +/- 1.9 -- MUT ID 21 Syn Rev T 55 -- 7.9 +/- 0.5 19.6 +/- 8.5 8.6 +/- 0.8 H784S Syn Rev G 58 25.8 +/- 9.2 -- 23.9 +/- 9.6 6.6 +/- 0.3 Syn Rev C 56 11.4 +/- 4.0 16.4 +/- 9.2 -- 9.1 +/- 1.5 Syn Rev A 57 23.1 +/- 8.2 8.4 +/- 0.4 22.9 +/- 8.6 -- MUT ID 22 Syn Rev T 55 -- 1.5 +/- 0.3 3.7 +/- 0.3 5.6 +/- 0.3 H784T Syn Rev G 58 13.3 +/- 0.6 -- 10.7 +/- 0.5 3.9 +/- 0.2 Syn Rev C 56 5.2 +/- 0.3 9.3 +/- 0.5 -- 3.3 +/- 0.3 Syn Rev A 57 9.8 +/- 0.3 2.4 +/- 0.2 11.0 +/- 0.4 -- MUT ID 24 Syn Rev T 55 -- -0.3 +/- 0.2 1.8 +/- 0.2 2.6 +/- 0.2 H784V Syn Rev G 58 10.2 +/- 0.2 -- 8.4 +/- 0.1 2.8 +/- 0.2 Syn Rev C 56 2.8 +/- 0.1 4.6 +/- 0.1 -- 1.8 +/- 0.1 Syn Rev A 57 5.4 +/- 0.1 0.2 +/- 0.1 9.2 +/- 0.2 -- MUT ID 26 Syn Rev T 55 -- 0.3 +/- 0.2 3.1 +/- 0.1 2.4 +/- 0.2 H784I Syn Rev G 58 11.3 +/- 0.2 -- 9.0 +/- 0.2 3.4 +/- 0.2 Syn Rev C 56 4.3 +/- 0.2 6.7 +/- 0.1 -- 2.5 +/- 0.2 Syn Rev A 57 6.3 +/- 0.1 0.7 +/- 0.1 10.0 +/- 0.2 -- MUT ID 27 Syn Rev T 55 -- 4.5 +/- 0.2 6.9 +/- 0.2 9.6 +/- 0.5 H784M Syn Rev G 58 16.7 +/- 3.9 -- 13.7 +/- 0.7 6.5 +/- 0.3 Syn Rev C 56 9.5 +/- 0.3 11.0 +/- 0.4 -- 7.4 +/- 0.3 Syn Rev A 57 12.7 +/- 0.1 5.1 +/- 0.1 14.0 +/- 2.0 -- MUT ID 29 Syn Rev T 55 -- 5.6 +/- 0.2 3.5 +/- 0.1 7.0 +/- 0.2 H784F Syn Rev G 58 13.3 +/- 0.6 -- 10.3 +/- 0.3 3.0 +/- 0.2 Syn Rev C 56 8.1 +/- 0.2 9.7 +/- 0.3 -- 5.7 +/- 0.2 Syn Rev A 57 10.9 +/- 0.3 4.6 +/- 0.2 11.3 +/- 0.4 -- MUT ID 30 Syn Rev T 55 -- 5.3 +/- 0.2 4.9 +/- 0.2 8.8 +/- 0.2 H784Y Syn Rev G 58 15.7 +/- 4.6 -- 11.8 +/- 0.5 5.5 +/- 0.3 Syn Rev C 56 7.3 +/- 0.2 9.9 +/- 0.3 -- 6.0 +/- 0.2 Syn Rev A 57 10.2 +/- 0.2 4.5 +/- 0.2 10.5 +/- 0.3 -- Average .DELTA.Cq values are shown, where .DELTA.Cq = [Cq mismatch - Cq match], +/- standard deviation calculated from 96 replicates.
[0210] The wild type OptiTaq showed an average .DELTA.Cq for AS-qPCR in this synthetic amplicon system of 4.1 with a range of -0.8 to 8.5. Mutant ID 3 (H784Q) showed an average .DELTA.Cq of 9.9 with a range of 4.6 to 21.2. Mutant ID 20 (H784A) showed an average .DELTA.Cq of 11.2 with a range of 6.3 to 14.9. Mutant ID 21 (H784S) showed an average .DELTA.Cq of 15.3 with a range of 6.6 to 25.8. Mutant ID 22 (H784T) showed an average .DELTA.Cq of 6.6 with a range of 1.5 to 13.3. Mutant ID 24 (H784V) showed an average .DELTA.Cq of 4.1 with a range of -0.3 to 10.2. Mutant ID 26 (H7841) showed an average .DELTA.Cq of 5.0 with a range of 0.3 to 11.3. Mutant ID 27 (H784M) showed an average .DELTA.Cq of 9.8 with a range of 4.5 to 16.7. Mutant ID 29 (H784F) showed an average .DELTA.Cq of 7.8 with a range of 3.5 to 13.3. Mutant ID 30 (H784Y) showed an average .DELTA.Cq of 8.3 with a range of 5.3 to 15.7. Therefore, in nearly all pairwise combinations of 4 template bases and 4 3'-terminal primer bases, the mutant Taq DNA polymerases of the present invention showed greater discrimination to mismatch than did the wild type OptiTaq DNA polymerase. The magnitude of improvement for each mismatch pair is defined by the .DELTA..DELTA.Cq, which is the difference of discrimination between the mutant and wild type enzymes (.DELTA..DELTA.Cq=.DELTA.Cq mutant-.DELTA.Cq wild type). The .DELTA..DELTA.Cq values were calculated and are shown in Table 32.
TABLE-US-00033 TABLE 32 .DELTA..DELTA.Cq values for AS-qPCR reactions for the H784 mutant Taq DNA polymerases compared with wild type OptiTaq Reverse Primer Template SEQ A C G T DNA ID SEQ ID SEQ ID SEQ ID SEQ ID Polymerase Name NO. NO. 51 NO. 52 NO. 53 NO. 54 MUT ID Syn Rev T 55 -- 4.3 5.1 6.0 NO. 3 Syn Rev G 58 6.0 -- 6.6 3.3 H784Q Syn Rev C 56 5.7 2.9 -- 3.8 Syn Rev A 57 5.0 4.9 4.9 -- MUT ID 20 Syn Rev T 55 -- 6.2 7.1 7.5 H784A Syn Rev G 58 10.6 -- 8.9 2.8 Syn Rev C 56 6.8 4.7 -- 4.3 Syn Rev A 57 9.6 8.4 8.1 -- MUT ID 21 Syn Rev T 55 -- 6.5 19.0 3.8 H784S Syn Rev G 58 17.3 -- 18.0 3.1 Syn Rev C 56 8.6 8.7 -- 5.2 Syn Rev A 57 17.8 9.2 16.8 -- MUT ID 22 Syn Rev T 55 -- 0.1 3.1 0.8 H784T Syn Rev G 58 4.8 -- 4.8 0.4 Syn Rev C 56 2.4 1.6 -- -0.6 Syn Rev A 57 4.5 3.2 4.9 -- MUT ID 24 Syn Rev T 55 -- -1.7 1.2 -2.2 H784V Syn Rev G 58 1.7 -- 2.5 -0.7 Syn Rev C 56 0.0 -3.1 -- -2.1 Syn Rev A 57 0.1 1.0 3.1 -- MUT ID 26 Syn Rev T 55 -- -1.1 2.5 -2.4 H784I Syn Rev G 58 2.8 -- 3.1 -0.1 Syn Rev C 56 1.5 -1.0 -- -1.4 Syn Rev A 57 1.0 1.5 3.9 -- MUT ID 27 Syn Rev T 55 -- 3.1 6.3 4.8 H784M Syn Rev G 58 8.2 -- 7.8 3.0 Syn Rev C 56 6.7 3.3 -- 3.5 Syn Rev A 57 7.4 5.9 7.9 -- MUT ID 29 Syn Rev T 55 -- 4.2 2.9 2.2 H784F Syn Rev G 58 4.8 -- 4.4 -0.5 Syn Rev C 56 5.3 2.0 -- 1.8 Syn Rev A 57 5.6 5.4 5.2 -- MUT ID 30 Syn Rev T 55 -- 3.9 4.3 4.0 H784Y Syn Rev G 58 7.2 -- 5.9 2.0 Syn Rev C 56 4.5 2.2 -- 2.1 Syn Rev A 57 4.9 5.3 4.4 -- Average .DELTA..DELTA.Cq values are shown, where .DELTA..DELTA.Cq = [.DELTA.Cq mutant - .DELTA.Cq wild type], from data in Table 17.
[0211] Mutant ID 3 (H784Q) showed an average .DELTA..DELTA.Cq of 4.9 compared to wild type OptiTaq. Mutant ID 20 (H784A) showed an average .DELTA..DELTA.Cq of 7.1 compared to wild type OptiTaq. Mutant ID 21 (H784S) showed an average .DELTA..DELTA.Cq of 11.2 compared to wild type OptiTaq. Mutant ID 22 (H784T) showed an average .DELTA..DELTA.Cq of 2.5 compared to wild type OptiTaq. Mutant ID 24 (H784V) showed an average .DELTA..DELTA.Cq of -0.2 compared to wild type OptiTaq. Mutant ID 26 (H7841) showed an average .DELTA..DELTA.Cq of 1.0 compared to wild type OptiTaq. Mutant ID 27 (H784M) showed an average .DELTA..DELTA.Cq of 5.7 compared to wild type OptiTaq. Mutant ID 29 (H784F) showed an average .DELTA..DELTA.Cq of 3.6 compared to wild type OptiTaq. Mutant ID 30 (H784Y) showed an average .DELTA..DELTA.Cq of 4.2 compared to wild type OptiTaq. Therefore, with the exception of Mutant ID 24 (H784V), each of the mutant Taq DNA polymerases of the present invention showed a significant improvement over wild type OptiTaq in mismatch discrimination. Overall, mutant ID 21 (H784S) showed the best SNP discrimination within the set of 9 mutant enzymes studied in this example using this AS-PCR assay.
Example 15
Improved Mismatch Discrimination in rhPCR using Mutant Taq DNA Polymerases in a Human Genomic DNA SNP Assay
[0212] Example 14 demonstrated utility of the novel mutant Taq DNA polymerases of the present invention in a synthetic amplicon rhPCR SNP discrimination assay system. The present Example demonstrates utility of the novel mutant Taq DNA polymerases in a human genomic DNA rhPCR SNP discrimination assays system, examining a SNP site in the SMAD7 gene (NM_005904, C/T SNP, rs4939827). The assays employed target DNAs GM18562 (homozygous C/C) and GM18537 (homozygous T/T) from the Coriell Institute for Medical Research (Camden, N.J., USA). Two different blocked-cleavable primer designs were tested, including the generation 1 (Gen1) "RDDDDx" primers and the generation 2 (Gen2) "RDxxD" primers (see: US Patent Application 2012/0258455 by Behlke et al., entitled, RNASE H-BASED ASSAYS UTILIZING MODIFIED RNA MONOMERS).
[0213] Quantitative real-time rhPCR was performed in 10 .mu.L reaction volumes in 384 well format with 20 ng (the equivalent of 6600 copies of target) of human genomic DNA (GM18562 or GM18537). Reactions utilized either 0.5 U (10.8 ng/11.1 nM/111 fmol) of wild type OptiTaq DNA polymerase or 0.5 U of one of the nine Taq DNA polymerase mutants (MUT ID 3, H784Q; MUT ID 20, H784A; MUT ID 21, H784S; MUT ID 22, H784T; MUT ID 24, H784V; MUT ID 26, H784I; MUT ID 27 H784M MUT ID 29, H784F; MUT ID 30, H784Y). Final reaction conditions used were 20 mM Tris-HCL (pH 8.4 at 25.degree. C.), 50 mM KCL, 3 mM MgCl2, 0.01% Triton X-100, 800 .mu.M total dNTPs, 200 nM of a forward primer (SEQ ID NOs. 75-79), 200 nM of the universal reverse primer (SEQ ID NO. 74), and 200 nM of the SMAD7 probe (SEQ ID NO. 80). Sequence of the 85 bp SMAD7 amplicon is shown as SEQ ID NO. 81. Forward primers included RDDDDx configuration Gen1 allele-specific rhPCR primers (SEQ ID NOs. 76 and 77), RDxxD configuration Gen2 allele-specific rhPCR primers (SEQ ID NOs. 78 and 79) and the control universal forward primer (SEQ ID NO.75) which is not allele specific. Oligonucleotide reagents employed in this Example are shown in Table 33. Reactions included 1 .mu.L of P.a. RNase H2 at a concentration of 2.6 mU per 10 .mu.L reaction (5 fmoles, 0.5 nM) with the exception of MUT ID 21 (H784S) for which 200 mU per 10 .mu.L (384 fmoles, 38.4 nM) was used for the Gen1 RDDDDx primers and control primer (SEQ ID NOs. 75-77) or 200 mU per 10 .mu.L reaction (384 fmoles, 38.4 nM) for the Gen2 RDxxD primers (SEQ ID NOs. 78 and 79). Amplification was performed on a Roche LightCycler.RTM. 480 (Roche Applied Science, Indianapolis, Ind., USA) as follows: 95.degree. C. for 3 minutes followed by 95 cycles of 95.degree. C. for 10 seconds and 60.degree. C. for 30 seconds. All reactions were performed in triplicate.
TABLE-US-00034 TABLE 33 Synthetic oligonucleotides employed in Example 14. Name Sequence (5'-3') SEQ ID NO. SMAD7 Rev CTCACTCTAAACCCCAGCATT 74 SMAD7 For CAGCCTCATCCAAAAGAGGAAA 75 SMAD7 For CAGCCTCATCCAAAAGAGGAAAc 76 rC DDDDx AGGAx SMAD7 For CAGCCTCATCCAAAAGAGGAAAu 77 rU DDDDx AGGAx SMAD7 For CAGCCTCATCCAAAAGAGGAAAc 78 rC DxxD AxxA SMAD7 For CAGCCTCATCCAAAAGAGGAAAu 79 rU DxxD AxxA SMAD7 FAM-CCCAGAGCTCCCTCAGACT 80 probe CCT-IBFQ SMAD7 CAGCCTCATCCAAAAGAGGAAAT 81 target AGGACCCCAGAGCTCCCTCAGAC TCCTCAGGAAACACAGACAATGC TGGGGTTTAGAGTGAG DNA bases are uppercase and RNA bases are lowercase; FAM = 6-carboxyfluorescein; IBFQ = Iowa Black .TM. FQ fluorescence quencher; "x" = C3 Spacer (propanediol). Primer and probe binding sites in the SMAD7 target are underlined.
[0214] Results using the Gen1 RDDDDx rhPCR primers are shown in Table 34 using the Gen2 RDxxD rhPCR primers are shown in Table 35. Use of the mutant Taq DNA polymerases showed significant improvements in SNP discrimination in this human genomic DNA rhPCR assay using the Gen1 RDDDDx primers, although amplification efficiency was often reduced, as shown by the increases in the match Cqs. Large improvements in discrimination were seen using the Gen2 RDxxD primers, although amplification efficiency was often lost here as well. The Gen2 RDxxD primers inherently show greater SNP discrimination and these levels were increased so that .DELTA.Cq values are in some cases were greater than 40 amplification cycles between match and mismatch; this level of discrimination would be "greater than assay" for most users, as qPCR reactions are seldom run for over 45-50 cycles and positive signal was not detected in these cases until after 70 cycles (Table 35). Therefore use of the new mutant Taq DNA polymerases improves SNP discrimination in rhPCR genotyping assays.
TABLE-US-00035 TABLE 34 SNP discrimination of a site in the SMAD7 gene using Gen1 RDDDDx primers comparing wild type OptiTaq with four mutant Taq DNA polymerases. Cq Cq SEQ mU RNase Value Value DNA ID H2 per C/C T/T Polymerase For Primer NO. 10 .mu.L rxn DNA DNA .DELTA.Cq Wild type SMAD7 For 75 2.6 24.1 24.9 -- OptiTaq SMAD7 For 76 2.6 24.3 36.3 11.9 rC DDDDx SMAD7 For 77 2.6 35.1 27.5 7.6 rU DDDDx MUT ID 3 SMAD7 For 75 2.6 26.0 28.1 -- H784Q SMAD7 For 76 2.6 29.4 49.1 19.7 rC DDDDx SMAD7 For 77 2.6 48.1 37.6 10.4 rU DDDDx MUT ID 20 SMAD7 For 75 2.6 31.4 33.9 -- H784A SMAD7 For 76 2.6 37.4 75.9 38.4 rC DDDDx SMAD7 For 77 2.6 65.4 46.2 19.3 rU DDDDx MUT ID 21 SMAD7 For 75 200 29.7 30.4 -- H784S SMAD7 For 76 200 32.0 46.1 14.1 rC DDDDx SMAD7 For 77 200 47.1 32.8 14.3 rU DDDDx MUT ID 22 SMAD7 For 75 2.6 24.2 24.9 -- H784T SMAD7 For 76 2.6 25.8 39.0 13.3 rC DDDDx SMAD7 For 77 2.6 37.6 28.8 8.8 rU DDDDx MUT ID 24 SMAD7 For 75 2.6 24.4 24.1 H784V SMAD7 For 76 2.6 24.7 34.5 9.8 rC DDDDx SMAD7 For 77 2.6 36.0 25.6 10.4 rU DDDDx MUT ID 26 SMAD7 For 75 2.6 24.4 24.9 H784I SMAD7 For 76 2.6 28.5 40.5 12.0 rC DDDDx SMAD7 For 77 2.6 42.5 30.6 11.8 rU DDDDx MUT ID 27 SMAD7 For 75 2.6 30.9 30.5 H784M SMAD7 For 76 2.6 36.1 58.8 22.7 rC DDDDx SMAD7 For 77 2.6 51.7 37.7 14.0 rU DDDDx MUT ID 29 SMAD7 For 75 2.6 25.8 26.5 H784F SMAD7 For 76 2.6 30.9 50.9 19.9 rC DDDDx SMAD7 For 77 2.6 46.9 36.2 10.7 rU DDDDx MUT ID 29 SMAD7 For 75 2.6 27.3 26.7 H784Y SMAD7 For 76 2.6 31.4 46.6 15.3 rC DDDDx SMAD7 For 77 2.6 50.2 37.1 13.1 rU DDDDx DNA targets included GM18562 (homozygous C/C) and GM18537 (homozygous T/T) from the Coriell Institute for Medical Research. .DELTA.Cq = [Cq mismatch - Cq match].
TABLE-US-00036 TABLE 35 SNP discrimination of a site in the SMAD7 gene using Gen2 RDxxD primers comparing wild type OptiTaq with four mutant Taq DNA polymerases. Cq Cq SEQ mU RNase Value Value DNA ID H2 per C/C T/T Polymerase For Primer NO. 10 .mu.L rxn DNA DNA .DELTA.Cq Wild type SMAD7 For 75 200 24.7 25.1 -- OptiTaq SMAD7 For 78 200 24.9 39.6 14.7 rC DxxD SMAD7 For 79 200 43.4 26.0 17.4 rU DxxD MUT ID 3 SMAD7 For 75 200 26.5 27.5 -- H784Q SMAD7 For 78 200 27.2 56.0 28.8 rC DxxD SMAD7 For 79 200 73.4 37.1 36.3 rU DxxD MUT ID 20 SMAD7 For 75 200 26.0 26.7 -- H784A SMAD7 For 78 200 26.1 58.7 32.6 rC DxxD SMAD7 For 79 200 64.1 33.2 31.2 rU DxxD MUT ID 21 SMAD7 For 75 200 27.0 27.3 -- H784S SMAD7 For 78 200 29.9 69.1 39.3 rC DxxD SMAD7 For 79 200 >95 62.6 >32.4 rU DxxD MUT ID 22 SMAD7 For 75 200 24.8 25.2 -- H784T SMAD7 For 78 200 24.8 45.2 20.4 rC DxxD SMAD7 For 79 200 57.5 26.8 30.8 rU DxxD MUT ID 24 SMAD7 For 75 200 25.3 24.8 H784V SMAD7 For 78 200 25.3 39.9 14.6 rC DxxD SMAD7 For 79 200 39.3 24.8 39.3 rU DxxD MUT ID 26 SMAD7 For 75 200 24.6 24.8 H784I SMAD7 For 78 200 24.8 44.0 19.2 rC DxxD SMAD7 For 79 200 46.2 26.9 46.2 rU DxxD MUT ID 27 SMAD7 For 75 200 30.0 29.7 H784M SMAD7 For 78 200 31.9 80.1 48.2 rC DxxD SMAD7 For 79 200 83.1 40.6 83.1 rU DxxD MUT ID 29 SMAD7 For 75 200 27.3 26.1 H784F SMAD7 For 78 200 27.8 51.3 23.6 rC DxxD SMAD7 For 79 200 56.3 29.1 56.3 rU DxxD MUT ID 30 SMAD7 For 75 200 29.0 28.7 H784Y SMAD7 For 78 200 29.2 71.8 42.5 rC DxxD SMAD7 For 79 200 73.5 30.4 73.5 rU DxxD DNA targets included GM18562 (homozygous C/C) and GM18537 (homozygous T/T) from the Coriell Institute for Medical Research. .DELTA.Cq = [Cq mismatch - Cq match].
[0215] The .DELTA.Cq values for the SMAD7 SNP genotyping assays are graphically summarized in FIG. 5B and 5C for the Gen1 RDDDDx primers and in FIG. 6B and 6C for the Gen2 RDxxD primers. It is clear that not only do the different mutant Taq DNA polymerases of the present invention have utility in different amplification assays but that the different mutants show varying levels of benefit depending on the nature of the assay used. It is therefore useful to have a collection of mutant polymerases whose properties can be matched to different assays/applications so that maximal benefit is obtained.
Example 16
Improved Discrimination of Rare Alleles in Genomic DNA using rhPCR with Mutant Taq DNA Polymerases
[0216] Use of the Gen2 RDxxD blocked-cleavable primers in rhPCR can detect the presence of a SNP at a level of 1:1,000 to 1:10,000 in the background of wild type genomic DNA using native (wild type) Taq DNA polymerase (see: US Patent Application 2012/0258455 by Behlke et al., entitled, RNASE H-BASED ASSAYS UTILIZING MODIFIED RNA MONOMERS). The present example demonstrates that the mutant Taq DNA polymerases of the present invention improve rare allele discrimination in the rhPCR assay.
[0217] Rare allele detection experiments were designed to detect the base identity of a SNP site in the SMAD7 gene (NM_005904, C/T SNP, rs4939827) and employed target DNAs GM18562 (homozygous C/C) and GM18537 (homozygous T/T) (Coriell Institute for Medical Research, Camden, N.J., USA). Control reactions were set up using 2 ng (660 copies), 0.2 ng (66 copies), or 0.02 ng (6.6 copies) of input matched target DNA. Rare allele detection reactions were set up using 2 ng (660 copies), 0.2 ng (66 copies), or 0.02 ng (6.6 copies) of input matched target DNA of one allele plus 200 ng (66,000 copies) of the other (mismatched) allele. Background was established in reactions that contained 0 copies of matched target DNA plus 200 ng (66,000 copies) of the mismatched target DNA. Both combinations were tested: GM18562 (C/C) as the rare allele in the presence of excess GM18537 (T/T) and GM18537 (T/T) as the rare allele in the presence of excess GM18562 (C/C).
[0218] Quantitative real-time rhPCR was performed in 10 .mu.L reaction volumes in 384 well format. Final reaction conditions used were 10 mM Tris-HCL (pH 8.4 at 25.degree. C.), 50 mM KCL, 3.5 mM MgCl.sub.2, 0.01% Triton-X100, 0.8 mM dNTPs, 200 nM of one of the SMAD7 forward primers (SEQ ID NOs. 75, 78, and 79), 200 nM of the SMAD7 reverse primer (SEQ ID NO. 74), and 200 nM of the SMAD7 probe (SEQ ID NO. 80). The 85 bp SMAD7 amplicon defined by these primers is shown as SEQ ID NO. 81. Note that the forward primers were either unmodified (control, SEQ ID NO. 75) or were specific for the SMAD7 C-allele (SEQ ID NO. 78) or the SMAD7 T-allele (SEQ ID NO. 79) using blocked-cleavable rhPCR Gen2 RDxxD design. Reactions utilized either 0.5 U of the wild type OptiTaq DNA polymerase or 0.5 U of one of three example Taq DNA polymerase mutants studied (MUT ID 20(H784A); MUT ID 27(H784M); MUT ID 30(H784Y)). Reactions included P. abyssi RNase H2 at a concentration of 200 mU per 10 .mu.L reaction (384 fmoles) when using the SMAD7 For rC DxxD (SEQ ID NO. 78) primer and control reactions or 500-600 mU per 10 .mu.L reaction (960-1152 fmoles) when using the SMAD7 For rU DxxD (SEQ ID NO. 79) primer. Oligonucleotide reagents used in this Example are shown in Table 36. Cycling was performed on a Roche LightCycler.RTM. 480 (Roche Applied Science, Indianapolis, Ind., USA) as follows: 95.degree. C. for 3 minutes followed by 65 cycles of 95.degree. C. for 10 seconds and 60.degree. C. for 30 seconds. All reactions were performed in triplicate.
TABLE-US-00037 TABLE 36 Synthetic oligonucleotides employed in Example 16. Name Sequence (5'-3') SEQ ID NO. SMAD7 Rev CTCACTCTAAACCCCAGCATT 74 SMAD7 For CAGCCTCATCCAAAAGAGGAAA 75 SMAD7 For CAGCCTCATCCAAAAGAGGAAAc 78 rC DxxD AxxA SMAD7 For CAGCCTCATCCAAAAGAGGAAAu 79 rU DxxD AxxA SMAD7 FAM-CCCAGAGCTCCCTCAGACT 80 probe CCT-IBFQ SMAD7 CAGCCTCATCCAAAAGAGGAAAT 81 target AGGACCCCAGAGCTCCCTCAGAC TCCTCAGGAAACACAGACAATGC TGGGGTTTAGAGTGAG DNA bases are uppercase and RNA bases are lowercase; FAM = 6-carboxyfluorescein; IBFQ = Iowa Black .TM. FQ fluorescence quencher; "x" = C3 Spacer (propanediol). Primer and probe binding sites in the SMAD7 target are underlined.
[0219] Results were analyzed and are shown in Table 37. The control columns show Cq values for matched primer/target reactions with no mismatched target present and establish a quantification standard curve. MUT ID NO. 3, H784Q is included in data analysis for comparison. The rare allele detection columns show Cq values for detection of 660, 66, 6, or 0 (background control) copies of matched primer/target in the presence of 66,000 copies of mismatched target. It is generally assumed that at least a 3 cycle difference (.DELTA.Cq=3.0 or greater) between background and positive signal is needed to call a reaction "positive" for rare allele detection; a 5 cycle difference (.DELTA.Cq=5.0 or greater) is preferred. In this system, background is the signal observed when amplification is done using no input target that is matched to the primer, so signal arises solely from amplification originating off the mismatched target.
[0220] Using wild type OptiTaq DNA polymerase, detection of the "C" allele in an excess of "T" background and detection of the "T" allele in an excess of "C" background both met the .DELTA.Cq 3.0 and .DELTA.Cq 5.0 levels of stringency to call a 1:1000 rare allele detection event (66 copies of match target in the presence of 66,000 copies of mismatch target). The 1:10,000 reactions (6 copies of match target in the presence of 66,000 copies of mismatch target) did not meet either of these criteria. Thus rhPCR had a 1:1000 rare allele detection limit using wild type OptiTaq in this genomic DNA SNP system.
[0221] In contrast, rhPCR using each of the four mutants showed a 1:10,000 rare allele detection limit for both the "C" and "T" allele targets with a .DELTA.Cq stringency cutoff of 3.0. MUT ID 3 (H784Q) showed a 1:10,000 rare allele detection limit for both the "C" and "T" targets in this genomic SNP system for the higher .DELTA.Cq stringency cutoff of 5.0. The other three mutant Taq DNA polymerases (MUT ID 20(H784A); MUT ID 27(H784M); MUT ID 30(H784Y)) showed a 1:10,000 rare allele detection limit for the "C" allele target with a .DELTA.Cq stringency cutoff of 5.0 and a 1:10,000 rare allele detection limit for the "T" allele target with a .DELTA.Cq stringency cutoff of 3.0. We therefore conclude that the new mutant Taq DNA polymerases of the present invention provide for improved rare allele detection reactions using blocked-cleavable primers in rhPCR compared with use of the wild type DNA polymerase.
TABLE-US-00038 TABLE 37 Rare allele detection using Gen2 RDxxD rhPCR primers comparing wild type OptiTaq with new mutant Taq DNA polymerases 200 ng mismatched template RNase H2 (66,000 copies of "wild type") Control DNA SEQ ID per 10 660 Match 66 Match 6 Match 0 Match (No mismatched template) Polymerase For Primer NO. .mu.L rxn (1:100) (1:1,000) (1:10,000) (background) 660 Match 66 Match 6 Match 0 Match Wild type SMAD7 For 75 200 mU 22.1 21.2 21.2 21.8 27.9 31.3 34.4 >65 OptiTaq SMAD7 For 78 200 mU 28.2 31.5 35.1 37.0 28.8 33.3 37.3 >65 rC DxxD SMAD7 For 79 500 mU 31.0 34.7 37.7 39.7 31.2 34.6 41.0 >65 rU DxxD MUT ID 3 SMAD7 For 75 200 mU 23.5 23.6 24.5 24.1 30.5 33.4 38.0 >65 (H784Q) SMAD7 For 78 200 mU 29.8 33.8 37.6 >65 30.5 35.5 39.6 >65 rC DxxD SMAD7 For 79 500 mU 32.9 37.7 44.0 52.3 30.1 35.9 44.9 >65 rU DxxD MUT ID 20 SMAD7 For 75 200 mU 23.5 24.1 24.7 24.9 31.6 36.1 40.2 >65 (H784A) SMAD7 For 78 200 mU 31.3 36.7 43.2 55.3 33.5 39.5 44.7 >65 rC DxxD SMAD7 For 79 500 mU 35.7 40.0 43.8 54.7 33.3 38.8 41.5 >65 rU DxxD MUT ID 27 SMAD7 For 75 200 mU 24.2 24.8 25.4 26.4 31.6 36.2 40.2 >65 (H784M) SMAD7 For 78 200 mU 33.7 38.5 42.0 54.4 33.6 37.8 41.7 >65 rC DxxD SMAD7 For 79 600 mU 39.7 43.2 45.8 50.0 31.9 36.5 41.0 >65 rU DxxD MUT ID 30 SMAD7 For 75 200 mU 24.8 24.9 24.8 26.3 38.6 38.9 46.9 >65 (H784Y) SMAD7 For 78 200 mU 28.8 32.9 37.5 46.5 29.5 33.4 37.8 >65 rC DxxD SMAD7 For 79 500 mU 39.9 45.8 54.6 57.0 37.7 44.6 53.1 >65 rU DxxD Cq values are shown. For the rare allele detection series (selective detection of 6-660 copes one genotype in the presence of 66,000 copies of the other genotype), those reactions having a .DELTA.Cq of 3.0 or better are highlighted in bold font and those having a .DELTA.Cq of 5.0 or better are highlighted in bold font with underline. .DELTA.Cq = [(Cq 0 copies match) - (Cq 6 copies match)], or .DELTA.Cq = [(Cq 0 copies match) - (Cq 66 copies match)], or .DELTA.Cq = [(Cq 0 copies match) - (Cq 660 copies match)].
Example 17
Sequence of Taq DNA Polymerase Mutants Showing Improved Discrimination for Mismatch or the Presence of an RNA Residue at the 3'-End of the Primer
[0222] The complete amino acid and nucleotide sequences of the codon optimized mutant enzymes employed in Examples 11-15 are shown below. Although these sequences are easily derived from information provided in Tables 1, 3, 4 and 26 by one with skill in the art, the final assembled sequences are provided below for clarity. Base changes are identified in bold underlined font for the nucleic acid and amino acid substitutions.
TABLE-US-00039 SEQ ID NO. 146, nucleotide sequence of Mutant ID 20 (H784A) CATATGCGTGGTATGCTGCCGTTGTTCGAGCCTAAAGGCCGCGTACTGTT AGTCGATGGTCATCACTTGGCCTATCGGACGTTCCATGCACTCAAAGGTC TGACGACCAGTCGTGGCGAACCGGTCCAGGCTGTTTATGGTTTCGCTAAG TCTTTGCTCAAAGCACTGAAAGAAGACGGGGACGCGGTAATTGTTGTATT TGATGCCAAAGCACCGAGCTTCCGCCACGAAGCTTATGGTGGCTACAAGG CAGGACGCGCCCCTACCCCAGAAGATTTCCCCCGTCAGCTGGCATTAATT AAGGAGTTAGTAGACCTTCTCGGCTTAGCGCGTCTGGAAGTTCCGGGTTA TGAGGCGGACGATGTCCTTGCATCCTTGGCTAAAAAGGCCGAAAAAGAGG GCTACGAAGTCCGCATCTTGACGGCAGACAAAGATCTGTACCAGCTTCTG TCTGACCGTATTCATGTTTTGCACCCTGAAGGCTACTTAATCACTCCGGC CTGGCTCTGGGAAAAGTACGGTCTGCGTCCCGATCAGTGGGCGGATTATC GGGCTTTGACGGGAGATGAGAGCGACAACCTGCCAGGAGTTAAGGGCATT GGTGAAAAAACCGCACGTAAGCTGCTTGAAGAGTGGGGTTCCCTGGAAGC CTTGTTAAAAAATCTGGATCGTCTCAAGCCCGCAATTCGTGAAAAGATCC TGGCTCATATGGACGATCTTAAATTAAGTTGGGACCTGGCCAAGGTGCGC ACCGATTTACCGCTTGAAGTGGATTTTGCAAAACGCCGTGAGCCGGACCG GGAACGTTTACGCGCTTTCTTAGAGCGTCTGGAATTCGGTTCACTGCTTC ATGAATTCGGTCTGTTAGAGTCTCCTAAAGCACTCGAAGAGGCACCGTGG CCGCCCCCAGAAGGTGCTTTTGTTGGCTTCGTACTTTCCCGTAAGGAGCC TATGTGGGCAGATCTTCTGGCTTTAGCGGCTGCACGCGGTGGCCGTGTTC ACCGGGCCCCTGAGCCATACAAAGCGTTACGTGATCTGAAGGAAGCACGT GGCTTGCTGGCAAAAGACCTTTCTGTTTTGGCCCTGCGCGAGGGTCTTGG ACTGCCGCCAGGCGACGATCCCATGTTATTGGCCTATCTGTTAGACCCTA GCAATACCACACCTGAAGGGGTCGCTCGTCGGTATGGCGGTGAATGGACT GAGGAAGCCGGAGAGCGCGCCGCATTGTCCGAACGGCTCTTTGCAAACTT ATGGGGTCGTCTGGAAGGGGAGGAACGTCTGTTATGGTTGTATCGGGAAG TCGAACGTCCTCTTTCGGCCGTATTAGCGCATATGGAGGCAACAGGTGTG CGTTTAGATGTCGCGTACCTTCGGGCCTTATCACTGGAAGTTGCAGAGGA AATCGCCCGTCTCGAGGCTGAAGTGTTCCGGTTGGCCGGTCACCCGTTTA ACCTCAACTCCCGTGACCAGCTGGAACGCGTTTTATTCGATGAGCTTGGG CTTCCCGCAATTGGCAAAACCGAAAAGACTGGCAAACGCAGTACGAGCGC TGCCGTCCTTGAGGCACTCCGCGAGGCTCACCCTATTGTAGAAAAGATCC TGCAATACCGTGAGTTGACGAAGCTTAAAAGCACTTATATTGATCCTCTC CCGGATCTGATCCATCCTCGTACCGGCCGCTTGCACACACGTTTCAACCA GACGGCGACTGCAACCGGCCGTCTGTCTAGCTCGGATCCAAATCTCCAGA ACATTCCGGTCCGTACACCCTTGGGCCAACGTATCCGCCGGGCGTTTATC GCTGAGGAAGGATGGTTACTGGTCGCATTGGACTACTCGCAGATTGAGCT GCGCGTCCTCGCACATCTCTCTGGTGACGAAAATTTAATCCGCGTGTTTC AAGAGGGGCGTGATATTCACACAGAAACTGCCTCATGGATGTTCGGTGTC CCACGTGAAGCAGTGGATCCTTTGATGCGCCGTGCAGCTAAAACAATTAA TTTTGGAGTGCTGTACGGAATGAGCGCTCATCGCTTGAGTCAGGAACTGG CAATCCCCTACGAGGAAGCGCAGGCATTCATCGAACGTTACTTTCAATCG TTTCCGAAAGTTCGCGCATGGATCGAGAAGACGCTCGAGGAAGGTCGTCG TCGGGGCTATGTCGAAACTCTGTTTGGTCGCCGTCGGTACGTACCAGATC TTGAAGCCCGCGTCAAATCGGTACGGGAGGCTGCGGAGCGTATGGCATTT AATATGCCTGTACAGGGTACTGCAGCTGACCTCATGAAACTGGCAATGGT CAAGCTTTTCCCGCGCTTGGAGGAAATGGGCGCACGTATGCTTCTGCAGG TCGCGGACGAGCTGGTGTTAGAAGCCCCTAAGGAGCGCGCCGAAGCTGTC GCGCGCCTCGCTAAAGAAGTGATGGAGGGCGTTTACCCATTGGCCGTACC CCTCGAAGTGGAGGTCGGTATTGGAGAAGATTGGTTATCTGCAAAGGAAG CGGCCGC. SEQ ID NO. 147, amino acid sequence of Mutant ID 20 (H784A) MRGMLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKS LLKALKEDGDAVIVVFDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIK ELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLS DRIHVLHPEGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIG EKTARKLLEEWGSLEALLKNLDRLKPAIREKILAHMDDLKLSWDLAKVRT DLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLESPKALEEAPWP PPEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARG LLAKDLSVLALREGLGLPPGDDPMLLAYLLDPSNTTPEGVARRYGGEWTE EAGERAALSERLFANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVR LDVAYLRALSLEVAEETARLEAEVERLAGHPFNLNSRDQLERVLEDELGL PAIGKTEKTGKRSTSAAVLEALREAHPIVEKILQYRELTKLKSTYIDPLP DLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIA EEGWLLVALDYSQIELRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVP REAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQAFIERYFQSF PKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFN MPVQGTAADLMKLAMVKLFPRLEEMGARMLLQVADELVLEAPKERAEAVA RLAKEVMEGVYPLAVPLEVEVGIGEDWLSAKEAA. SEQ ID NO. 148, nucleotide sequence of Mutant ID 21 (H784S) CATATGCGTGGTATGCTGCCGTTGTTCGAGCCTAAAGGCCGCGTACTGTT AGTCGATGGTCATCACTTGGCCTATCGGACGTTCCATGCACTCAAAGGTC TGACGACCAGTCGTGGCGAACCGGTCCAGGCTGTTTATGGTTTCGCTAAG TCTTTGCTCAAAGCACTGAAAGAAGACGGGGACGCGGTAATTGTTGTATT TGATGCCAAAGCACCGAGCTTCCGCCACGAAGCTTATGGTGGCTACAAGG CAGGACGCGCCCCTACCCCAGAAGATTTCCCCCGTCAGCTGGCATTAATT AAGGAGTTAGTAGACCTTCTCGGCTTAGCGCGTCTGGAAGTTCCGGGTTA TGAGGCGGACGATGTCCTTGCATCCTTGGCTAAAAAGGCCGAAAAAGAGG GCTACGAAGTCCGCATCTTGACGGCAGACAAAGATCTGTACCAGCTTCTG TCTGACCGTATTCATGTTTTGCACCCTGAAGGCTACTTAATCACTCCGGC CTGGCTCTGGGAAAAGTACGGTCTGCGTCCCGATCAGTGGGCGGATTATC GGGCTTTGACGGGAGATGAGAGCGACAACCTGCCAGGAGTTAAGGGCATT GGTGAAAAAACCGCACGTAAGCTGCTTGAAGAGTGGGGTTCCCTGGAAGC CTTGTTAAAAAATCTGGATCGTCTCAAGCCCGCAATTCGTGAAAAGATCC TGGCTCATATGGACGATCTTAAATTAAGTTGGGACCTGGCCAAGGTGCGC ACCGATTTACCGCTTGAAGTGGATTTTGCAAAACGCCGTGAGCCGGACCG GGAACGTTTACGCGCTTTCTTAGAGCGTCTGGAATTCGGTTCACTGCTTC ATGAATTCGGTCTGTTAGAGTCTCCTAAAGCACTCGAAGAGGCACCGTGG CCGCCCCCAGAAGGTGCTTTTGTTGGCTTCGTACTTTCCCGTAAGGAGCC TATGTGGGCAGATCTTCTGGCTTTAGCGGCTGCACGCGGTGGCCGTGTTC ACCGGGCCCCTGAGCCATACAAAGCGTTACGTGATCTGAAGGAAGCACGT GGCTTGCTGGCAAAAGACCTTTCTGTTTTGGCCCTGCGCGAGGGTCTTGG ACTGCCGCCAGGCGACGATCCCATGTTATTGGCCTATCTGTTAGACCCTA GCAATACCACACCTGAAGGGGTCGCTCGTCGGTATGGCGGTGAATGGACT GAGGAAGCCGGAGAGCGCGCCGCATTGTCCGAACGGCTCTTTGCAAACTT ATGGGGTCGTCTGGAAGGGGAGGAACGTCTGTTATGGTTGTATCGGGAAG TCGAACGTCCTCTTTCGGCCGTATTAGCGCATATGGAGGCAACAGGTGTG CGTTTAGATGTCGCGTACCTTCGGGCCTTATCACTGGAAGTTGCAGAGGA AATCGCCCGTCTCGAGGCTGAAGTGTTCCGGTTGGCCGGTCACCCGTTTA ACCTCAACTCCCGTGACCAGCTGGAACGCGTTTTATTCGATGAGCTTGGG CTTCCCGCAATTGGCAAAACCGAAAAGACTGGCAAACGCAGTACGAGCGC TGCCGTCCTTGAGGCACTCCGCGAGGCTCACCCTATTGTAGAAAAGATCC TGCAATACCGTGAGTTGACGAAGCTTAAAAGCACTTATATTGATCCTCTC CCGGATCTGATCCATCCTCGTACCGGCCGCTTGCACACACGTTTCAACCA GACGGCGACTGCAACCGGCCGTCTGTCTAGCTCGGATCCAAATCTCCAGA ACATTCCGGTCCGTACACCCTTGGGCCAACGTATCCGCCGGGCGTTTATC GCTGAGGAAGGATGGTTACTGGTCGCATTGGACTACTCGCAGATTGAGCT GCGCGTCCTCGCACATCTCTCTGGTGACGAAAATTTAATCCGCGTGTTTC AAGAGGGGCGTGATATTCACACAGAAACTGCCTCATGGATGTTCGGTGTC CCACGTGAAGCAGTGGATCCTTTGATGCGCCGTGCAGCTAAAACAATTAA TTTTGGAGTGCTGTACGGAATGAGCGCTCATCGCTTGAGTCAGGAACTGG CAATCCCCTACGAGGAAGCGCAGGCATTCATCGAACGTTACTTTCAATCG TTTCCGAAAGTTCGCGCATGGATCGAGAAGACGCTCGAGGAAGGTCGTCG TCGGGGCTATGTCGAAACTCTGTTTGGTCGCCGTCGGTACGTACCAGATC TTGAAGCCCGCGTCAAATCGGTACGGGAGGCTGCGGAGCGTATGGCATTT AATATGCCTGTACAGGGTACTGCAGCTGACCTCATGAAACTGGCAATGGT CAAGCTTTTCCCGCGCTTGGAGGAAATGGGCGCACGTATGCTTCTGCAGG TCAGCGACGAGCTGGTGTTAGAAGCCCCTAAGGAGCGCGCCGAAGCTGTC GCGCGCCTCGCTAAAGAAGTGATGGAGGGCGTTTACCCATTGGCCGTACC CCTCGAAGTGGAGGTCGGTATTGGAGAAGATTGGTTATCTGCAAAGGAAG CGGCCGC. SEQ ID NO. 149, amino acid sequence of Mutant ID 21 (H784S) MRGMLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKS LLKALKEDGDAVIVVFDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIK
ELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLS DRIHVLHPEGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIG EKTARKLLEEWGSLEALLKNLDRLKPAIREKILAHMDDLKLSWDLAKVRT DLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLESPKALEEAPWP PPEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARG LLAKDLSVLALREGLGLPPGDDPMLLAYLLDPSNTTPEGVARRYGGEWTE EAGERAALSERLFANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVR LDVAYLRALSLEVAEETARLEAEVERLAGHPFNLNSRDQLERVLEDELGL PAIGKTEKTGKRSTSAAVLEALREAHPIVEKILQYRELTKLKSTYIDPLP DLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIA EEGWLLVALDYSQIELRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVP REAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQAFIERYFQSF PKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFN MPVQGTAADLMKLAMVKLFPRLEEMGARMLLQVSDELVLEAPKERAEAVA RLAKEVMEGVYPLAVPLEVEVGIGEDWLSAKEAA. SEQ ID NO. 150, nucleotide sequence of Mutant ID 22 (H784T) CATATGCGTGGTATGCTGCCGTTGTTCGAGCCTAAAGGCCGCGTACTGTT AGTCGATGGTCATCACTTGGCCTATCGGACGTTCCATGCACTCAAAGGTC TGACGACCAGTCGTGGCGAACCGGTCCAGGCTGTTTATGGTTTCGCTAAG TCTTTGCTCAAAGCACTGAAAGAAGACGGGGACGCGGTAATTGTTGTATT TGATGCCAAAGCACCGAGCTTCCGCCACGAAGCTTATGGTGGCTACAAGG CAGGACGCGCCCCTACCCCAGAAGATTTCCCCCGTCAGCTGGCATTAATT AAGGAGTTAGTAGACCTTCTCGGCTTAGCGCGTCTGGAAGTTCCGGGTTA TGAGGCGGACGATGTCCTTGCATCCTTGGCTAAAAAGGCCGAAAAAGAGG GCTACGAAGTCCGCATCTTGACGGCAGACAAAGATCTGTACCAGCTTCTG TCTGACCGTATTCATGTTTTGCACCCTGAAGGCTACTTAATCACTCCGGC CTGGCTCTGGGAAAAGTACGGTCTGCGTCCCGATCAGTGGGCGGATTATC GGGCTTTGACGGGAGATGAGAGCGACAACCTGCCAGGAGTTAAGGGCATT GGTGAAAAAACCGCACGTAAGCTGCTTGAAGAGTGGGGTTCCCTGGAAGC CTTGTTAAAAAATCTGGATCGTCTCAAGCCCGCAATTCGTGAAAAGATCC TGGCTCATATGGACGATCTTAAATTAAGTTGGGACCTGGCCAAGGTGCGC ACCGATTTACCGCTTGAAGTGGATTTTGCAAAACGCCGTGAGCCGGACCG GGAACGTTTACGCGCTTTCTTAGAGCGTCTGGAATTCGGTTCACTGCTTC ATGAATTCGGTCTGTTAGAGTCTCCTAAAGCACTCGAAGAGGCACCGTGG CCGCCCCCAGAAGGTGCTTTTGTTGGCTTCGTACTTTCCCGTAAGGAGCC TATGTGGGCAGATCTTCTGGCTTTAGCGGCTGCACGCGGTGGCCGTGTTC ACCGGGCCCCTGAGCCATACAAAGCGTTACGTGATCTGAAGGAAGCACGT GGCTTGCTGGCAAAAGACCTTTCTGTTTTGGCCCTGCGCGAGGGTCTTGG ACTGCCGCCAGGCGACGATCCCATGTTATTGGCCTATCTGTTAGACCCTA GCAATACCACACCTGAAGGGGTCGCTCGTCGGTATGGCGGTGAATGGACT GAGGAAGCCGGAGAGCGCGCCGCATTGTCCGAACGGCTCTTTGCAAACTT ATGGGGTCGTCTGGAAGGGGAGGAACGTCTGTTATGGTTGTATCGGGAAG TCGAACGTCCTCTTTCGGCCGTATTAGCGCATATGGAGGCAACAGGTGTG CGTTTAGATGTCGCGTACCTTCGGGCCTTATCACTGGAAGTTGCAGAGGA AATCGCCCGTCTCGAGGCTGAAGTGTTCCGGTTGGCCGGTCACCCGTTTA ACCTCAACTCCCGTGACCAGCTGGAACGCGTTTTATTCGATGAGCTTGGG CTTCCCGCAATTGGCAAAACCGAAAAGACTGGCAAACGCAGTACGAGCGC TGCCGTCCTTGAGGCACTCCGCGAGGCTCACCCTATTGTAGAAAAGATCC TGCAATACCGTGAGTTGACGAAGCTTAAAAGCACTTATATTGATCCTCTC CCGGATCTGATCCATCCTCGTACCGGCCGCTTGCACACACGTTTCAACCA GACGGCGACTGCAACCGGCCGTCTGTCTAGCTCGGATCCAAATCTCCAGA ACATTCCGGTCCGTACACCCTTGGGCCAACGTATCCGCCGGGCGTTTATC GCTGAGGAAGGATGGTTACTGGTCGCATTGGACTACTCGCAGATTGAGCT GCGCGTCCTCGCACATCTCTCTGGTGACGAAAATTTAATCCGCGTGTTTC AAGAGGGGCGTGATATTCACACAGAAACTGCCTCATGGATGTTCGGTGTC CCACGTGAAGCAGTGGATCCTTTGATGCGCCGTGCAGCTAAAACAATTAA TTTTGGAGTGCTGTACGGAATGAGCGCTCATCGCTTGAGTCAGGAACTGG CAATCCCCTACGAGGAAGCGCAGGCATTCATCGAACGTTACTTTCAATCG TTTCCGAAAGTTCGCGCATGGATCGAGAAGACGCTCGAGGAAGGTCGTCG TCGGGGCTATGTCGAAACTCTGTTTGGTCGCCGTCGGTACGTACCAGATC TTGAAGCCCGCGTCAAATCGGTACGGGAGGCTGCGGAGCGTATGGCATTT AATATGCCTGTACAGGGTACTGCAGCTGACCTCATGAAACTGGCAATGGT CAAGCTTTTCCCGCGCTTGGAGGAAATGGGCGCACGTATGCTTCTGCAGG TCACGGACGAGCTGGTGTTAGAAGCCCCTAAGGAGCGCGCCGAAGCTGTC GCGCGCCTCGCTAAAGAAGTGATGGAGGGCGTTTACCCATTGGCCGTACC CCTCGAAGTGGAGGTCGGTATTGGAGAAGATTGGTTATCTGCAAAGGAAG CGGCCGC. SEQ ID NO. 151, amino acid sequence of Mutant ID 22 (H784T) MRGMLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKS LLKALKEDGDAVIVVFDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIK ELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLS DRIHVLHPEGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIG EKTARKLLEEWGSLEALLKNLDRLKPAIREKILAHMDDLKLSWDLAKVRT DLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLESPKALEEAPWP PPEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARG LLAKDLSVLALREGLGLPPGDDPMLLAYLLDPSNTTPEGVARRYGGEWTE EAGERAALSERLFANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVR LDVAYLRALSLEVAEETARLEAEVERLAGHPFNLNSRDQLERVLEDELGL PAIGKTEKTGKRSTSAAVLEALREAHPIVEKILQYRELTKLKSTYIDPLP DLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIA EEGWLLVALDYSQIELRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVP REAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQAFIERYFQSF PKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFN MPVQGTAADLMKLAMVKLFPRLEEMGARMLLQVTDELVLEAPKERAEAVA RLAKEVMEGVYPLAVPLEVEVGIGEDWLSAKEAA. SEQ ID NO. 152, nucleotide sequence of Mutant ID 24 (H784V) CATATGCGTGGTATGCTGCCGTTGTTCGAGCCTAAAGGCCGCGTACTGTT AGTCGATGGTCATCACTTGGCCTATCGGACGTTCCATGCACTCAAAGGTC TGACGACCAGTCGTGGCGAACCGGTCCAGGCTGTTTATGGTTTCGCTAAG TCTTTGCTCAAAGCACTGAAAGAAGACGGGGACGCGGTAATTGTTGTATT TGATGCCAAAGCACCGAGCTTCCGCCACGAAGCTTATGGTGGCTACAAGG CAGGACGCGCCCCTACCCCAGAAGATTTCCCCCGTCAGCTGGCATTAATT AAGGAGTTAGTAGACCTTCTCGGCTTAGCGCGTCTGGAAGTTCCGGGTTA TGAGGCGGACGATGTCCTTGCATCCTTGGCTAAAAAGGCCGAAAAAGAGG GCTACGAAGTCCGCATCTTGACGGCAGACAAAGATCTGTACCAGCTTCTG TCTGACCGTATTCATGTTTTGCACCCTGAAGGCTACTTAATCACTCCGGC CTGGCTCTGGGAAAAGTACGGTCTGCGTCCCGATCAGTGGGCGGATTATC GGGCTTTGACGGGAGATGAGAGCGACAACCTGCCAGGAGTTAAGGGCATT GGTGAAAAAACCGCACGTAAGCTGCTTGAAGAGTGGGGTTCCCTGGAAGC CTTGTTAAAAAATCTGGATCGTCTCAAGCCCGCAATTCGTGAAAAGATCC TGGCTCATATGGACGATCTTAAATTAAGTTGGGACCTGGCCAAGGTGCGC ACCGATTTACCGCTTGAAGTGGATTTTGCAAAACGCCGTGAGCCGGACCG GGAACGTTTACGCGCTTTCTTAGAGCGTCTGGAATTCGGTTCACTGCTTC ATGAATTCGGTCTGTTAGAGTCTCCTAAAGCACTCGAAGAGGCACCGTGG CCGCCCCCAGAAGGTGCTTTTGTTGGCTTCGTACTTTCCCGTAAGGAGCC TATGTGGGCAGATCTTCTGGCTTTAGCGGCTGCACGCGGTGGCCGTGTTC ACCGGGCCCCTGAGCCATACAAAGCGTTACGTGATCTGAAGGAAGCACGT GGCTTGCTGGCAAAAGACCTTTCTGTTTTGGCCCTGCGCGAGGGTCTTGG ACTGCCGCCAGGCGACGATCCCATGTTATTGGCCTATCTGTTAGACCCTA GCAATACCACACCTGAAGGGGTCGCTCGTCGGTATGGCGGTGAATGGACT GAGGAAGCCGGAGAGCGCGCCGCATTGTCCGAACGGCTCTTTGCAAACTT ATGGGGTCGTCTGGAAGGGGAGGAACGTCTGTTATGGTTGTATCGGGAAG TCGAACGTCCTCTTTCGGCCGTATTAGCGCATATGGAGGCAACAGGTGTG CGTTTAGATGTCGCGTACCTTCGGGCCTTATCACTGGAAGTTGCAGAGGA AATCGCCCGTCTCGAGGCTGAAGTGTTCCGGTTGGCCGGTCACCCGTTTA ACCTCAACTCCCGTGACCAGCTGGAACGCGTTTTATTCGATGAGCTTGGG CTTCCCGCAATTGGCAAAACCGAAAAGACTGGCAAACGCAGTACGAGCGC TGCCGTCCTTGAGGCACTCCGCGAGGCTCACCCTATTGTAGAAAAGATCC TGCAATACCGTGAGTTGACGAAGCTTAAAAGCACTTATATTGATCCTCTC CCGGATCTGATCCATCCTCGTACCGGCCGCTTGCACACACGTTTCAACCA GACGGCGACTGCAACCGGCCGTCTGTCTAGCTCGGATCCAAATCTCCAGA ACATTCCGGTCCGTACACCCTTGGGCCAACGTATCCGCCGGGCGTTTATC GCTGAGGAAGGATGGTTACTGGTCGCATTGGACTACTCGCAGATTGAGCT GCGCGTCCTCGCACATCTCTCTGGTGACGAAAATTTAATCCGCGTGTTTC AAGAGGGGCGTGATATTCACACAGAAACTGCCTCATGGATGTTCGGTGTC CCACGTGAAGCAGTGGATCCTTTGATGCGCCGTGCAGCTAAAACAATTAA
TTTTGGAGTGCTGTACGGAATGAGCGCTCATCGCTTGAGTCAGGAACTGG CAATCCCCTACGAGGAAGCGCAGGCATTCATCGAACGTTACTTTCAATCG TTTCCGAAAGTTCGCGCATGGATCGAGAAGACGCTCGAGGAAGGTCGTCG TCGGGGCTATGTCGAAACTCTGTTTGGTCGCCGTCGGTACGTACCAGATC TTGAAGCCCGCGTCAAATCGGTACGGGAGGCTGCGGAGCGTATGGCATTT AATATGCCTGTACAGGGTACTGCAGCTGACCTCATGAAACTGGCAATGGT CAAGCTTTTCCCGCGCTTGGAGGAAATGGGCGCACGTATGCTTCTGCAGG TCGTAGACGAGCTGGTGTTAGAAGCCCCTAAGGAGCGCGCCGAAGCTGTC GCGCGCCTCGCTAAAGAAGTGATGGAGGGCGTTTACCCATTGGCCGTACC CCTCGAAGTGGAGGTCGGTATTGGAGAAGATTGGTTATCTGCAAAGGAAG CGGCCGC. SEQ ID NO. 153, amino acid sequence of Mutant ID 24 (H784V) MRGMLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKS LLKALKEDGDAVIVVFDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIK ELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLS DRIHVLHPEGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIG EKTARKLLEEWGSLEALLKNLDRLKPAIREKILAHMDDLKLSWDLAKVRT DLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLESPKALEEAPWP PPEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARG LLAKDLSVLALREGLGLPPGDDPMLLAYLLDPSNTTPEGVARRYGGEWTE EAGERAALSERLFANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVR LDVAYLRALSLEVAEETARLEAEVERLAGHPFNLNSRDQLERVLEDELGL PAIGKTEKTGKRSTSAAVLEALREAHPIVEKILQYRELTKLKSTYIDPLP DLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIA EEGWLLVALDYSQIELRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVP REAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQAFIERYFQSF PKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFN MPVQGTAADLMKLAMVKLFPRLEEMGARMLLQVVDELVLEAPKERAEAVA RLAKEVMEGVYPLAVPLEVEVGIGEDWLSAKEAA. SEQ ID NO. 154, nucleotide sequence of Mutant ID 26 (H784I) CATATGCGTGGTATGCTGCCGTTGTTCGAGCCTAAAGGCCGCGTACTGTT AGTCGATGGTCATCACTTGGCCTATCGGACGTTCCATGCACTCAAAGGTC TGACGACCAGTCGTGGCGAACCGGTCCAGGCTGTTTATGGTTTCGCTAAG TCTTTGCTCAAAGCACTGAAAGAAGACGGGGACGCGGTAATTGTTGTATT TGATGCCAAAGCACCGAGCTTCCGCCACGAAGCTTATGGTGGCTACAAGG CAGGACGCGCCCCTACCCCAGAAGATTTCCCCCGTCAGCTGGCATTAATT AAGGAGTTAGTAGACCTTCTCGGCTTAGCGCGTCTGGAAGTTCCGGGTTA TGAGGCGGACGATGTCCTTGCATCCTTGGCTAAAAAGGCCGAAAAAGAGG GCTACGAAGTCCGCATCTTGACGGCAGACAAAGATCTGTACCAGCTTCTG TCTGACCGTATTCATGTTTTGCACCCTGAAGGCTACTTAATCACTCCGGC CTGGCTCTGGGAAAAGTACGGTCTGCGTCCCGATCAGTGGGCGGATTATC GGGCTTTGACGGGAGATGAGAGCGACAACCTGCCAGGAGTTAAGGGCATT GGTGAAAAAACCGCACGTAAGCTGCTTGAAGAGTGGGGTTCCCTGGAAGC CTTGTTAAAAAATCTGGATCGTCTCAAGCCCGCAATTCGTGAAAAGATCC TGGCTCATATGGACGATCTTAAATTAAGTTGGGACCTGGCCAAGGTGCGC ACCGATTTACCGCTTGAAGTGGATTTTGCAAAACGCCGTGAGCCGGACCG GGAACGTTTACGCGCTTTCTTAGAGCGTCTGGAATTCGGTTCACTGCTTC ATGAATTCGGTCTGTTAGAGTCTCCTAAAGCACTCGAAGAGGCACCGTGG CCGCCCCCAGAAGGTGCTTTTGTTGGCTTCGTACTTTCCCGTAAGGAGCC TATGTGGGCAGATCTTCTGGCTTTAGCGGCTGCACGCGGTGGCCGTGTTC ACCGGGCCCCTGAGCCATACAAAGCGTTACGTGATCTGAAGGAAGCACGT GGCTTGCTGGCAAAAGACCTTTCTGTTTTGGCCCTGCGCGAGGGTCTTGG ACTGCCGCCAGGCGACGATCCCATGTTATTGGCCTATCTGTTAGACCCTA GCAATACCACACCTGAAGGGGTCGCTCGTCGGTATGGCGGTGAATGGACT GAGGAAGCCGGAGAGCGCGCCGCATTGTCCGAACGGCTCTTTGCAAACTT ATGGGGTCGTCTGGAAGGGGAGGAACGTCTGTTATGGTTGTATCGGGAAG TCGAACGTCCTCTTTCGGCCGTATTAGCGCATATGGAGGCAACAGGTGTG CGTTTAGATGTCGCGTACCTTCGGGCCTTATCACTGGAAGTTGCAGAGGA AATCGCCCGTCTCGAGGCTGAAGTGTTCCGGTTGGCCGGTCACCCGTTTA ACCTCAACTCCCGTGACCAGCTGGAACGCGTTTTATTCGATGAGCTTGGG CTTCCCGCAATTGGCAAAACCGAAAAGACTGGCAAACGCAGTACGAGCGC TGCCGTCCTTGAGGCACTCCGCGAGGCTCACCCTATTGTAGAAAAGATCC TGCAATACCGTGAGTTGACGAAGCTTAAAAGCACTTATATTGATCCTCTC CCGGATCTGATCCATCCTCGTACCGGCCGCTTGCACACACGTTTCAACCA GACGGCGACTGCAACCGGCCGTCTGTCTAGCTCGGATCCAAATCTCCAGA ACATTCCGGTCCGTACACCCTTGGGCCAACGTATCCGCCGGGCGTTTATC GCTGAGGAAGGATGGTTACTGGTCGCATTGGACTACTCGCAGATTGAGCT GCGCGTCCTCGCACATCTCTCTGGTGACGAAAATTTAATCCGCGTGTTTC AAGAGGGGCGTGATATTCACACAGAAACTGCCTCATGGATGTTCGGTGTC CCACGTGAAGCAGTGGATCCTTTGATGCGCCGTGCAGCTAAAACAATTAA TTTTGGAGTGCTGTACGGAATGAGCGCTCATCGCTTGAGTCAGGAACTGG CAATCCCCTACGAGGAAGCGCAGGCATTCATCGAACGTTACTTTCAATCG TTTCCGAAAGTTCGCGCATGGATCGAGAAGACGCTCGAGGAAGGTCGTCG TCGGGGCTATGTCGAAACTCTGTTTGGTCGCCGTCGGTACGTACCAGATC TTGAAGCCCGCGTCAAATCGGTACGGGAGGCTGCGGAGCGTATGGCATTT AATATGCCTGTACAGGGTACTGCAGCTGACCTCATGAAACTGGCAATGGT CAAGCTTTTCCCGCGCTTGGAGGAAATGGGCGCACGTATGCTTCTGCAGG TCATTGACGAGCTGGTGTTAGAAGCCCCTAAGGAGCGCGCCGAAGCTGTC GCGCGCCTCGCTAAAGAAGTGATGGAGGGCGTTTACCCATTGGCCGTACC CCTCGAAGTGGAGGTCGGTATTGGAGAAGATTGGTTATCTGCAAAGGAAG CGGCCGC. SEQ ID NO. 155, amino acid sequence of Mutant ID 26 (H784I) MRGMLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKS LLKALKEDGDAVIVVFDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIK ELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLS DRIHVLHPEGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIG EKTARKLLEEWGSLEALLKNLDRLKPAIREKILAHMDDLKLSWDLAKVRT DLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLESPKALEEAPWP PPEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARG LLAKDLSVLALREGLGLPPGDDPMLLAYLLDPSNTTPEGVARRYGGEWTE EAGERAALSERLFANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVR LDVAYLRALSLEVAEETARLEAEVERLAGHPFNLNSRDQLERVLEDELGL PAIGKTEKTGKRSTSAAVLEALREAHPIVEKILQYRELTKLKSTYIDPLP DLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIA EEGWLLVALDYSQIELRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVP REAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQAFIERYFQSF PKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFN MPVQGTAADLMKLAMVKLFPRLEEMGARMLLQVVDELVLEAPKERAEAVA RLAKEVMEGVYPLAVPLEVEVGIGEDWLSAKEAA. SEQ ID NO. 156, nucleotide sequence of Mutant ID 27 (H784M) CATATGCGTGGTATGCTGCCGTTGTTCGAGCCTAAAGGCCGCGTACTGTT AGTCGATGGTCATCACTTGGCCTATCGGACGTTCCATGCACTCAAAGGTC TGACGACCAGTCGTGGCGAACCGGTCCAGGCTGTTTATGGTTTCGCTAAG TCTTTGCTCAAAGCACTGAAAGAAGACGGGGACGCGGTAATTGTTGTATT TGATGCCAAAGCACCGAGCTTCCGCCACGAAGCTTATGGTGGCTACAAGG CAGGACGCGCCCCTACCCCAGAAGATTTCCCCCGTCAGCTGGCATTAATT AAGGAGTTAGTAGACCTTCTCGGCTTAGCGCGTCTGGAAGTTCCGGGTTA TGAGGCGGACGATGTCCTTGCATCCTTGGCTAAAAAGGCCGAAAAAGAGG GCTACGAAGTCCGCATCTTGACGGCAGACAAAGATCTGTACCAGCTTCTG TCTGACCGTATTCATGTTTTGCACCCTGAAGGCTACTTAATCACTCCGGC CTGGCTCTGGGAAAAGTACGGTCTGCGTCCCGATCAGTGGGCGGATTATC GGGCTTTGACGGGAGATGAGAGCGACAACCTGCCAGGAGTTAAGGGCATT GGTGAAAAAACCGCACGTAAGCTGCTTGAAGAGTGGGGTTCCCTGGAAGC CTTGTTAAAAAATCTGGATCGTCTCAAGCCCGCAATTCGTGAAAAGATCC TGGCTCATATGGACGATCTTAAATTAAGTTGGGACCTGGCCAAGGTGCGC ACCGATTTACCGCTTGAAGTGGATTTTGCAAAACGCCGTGAGCCGGACCG GGAACGTTTACGCGCTTTCTTAGAGCGTCTGGAATTCGGTTCACTGCTTC ATGAATTCGGTCTGTTAGAGTCTCCTAAAGCACTCGAAGAGGCACCGTGG CCGCCCCCAGAAGGTGCTTTTGTTGGCTTCGTACTTTCCCGTAAGGAGCC TATGTGGGCAGATCTTCTGGCTTTAGCGGCTGCACGCGGTGGCCGTGTTC ACCGGGCCCCTGAGCCATACAAAGCGTTACGTGATCTGAAGGAAGCACGT GGCTTGCTGGCAAAAGACCTTTCTGTTTTGGCCCTGCGCGAGGGTCTTGG ACTGCCGCCAGGCGACGATCCCATGTTATTGGCCTATCTGTTAGACCCTA GCAATACCACACCTGAAGGGGTCGCTCGTCGGTATGGCGGTGAATGGACT GAGGAAGCCGGAGAGCGCGCCGCATTGTCCGAACGGCTCTTTGCAAACTT
ATGGGGTCGTCTGGAAGGGGAGGAACGTCTGTTATGGTTGTATCGGGAAG TCGAACGTCCTCTTTCGGCCGTATTAGCGCATATGGAGGCAACAGGTGTG CGTTTAGATGTCGCGTACCTTCGGGCCTTATCACTGGAAGTTGCAGAGGA AATCGCCCGTCTCGAGGCTGAAGTGTTCCGGTTGGCCGGTCACCCGTTTA ACCTCAACTCCCGTGACCAGCTGGAACGCGTTTTATTCGATGAGCTTGGG CTTCCCGCAATTGGCAAAACCGAAAAGACTGGCAAACGCAGTACGAGCGC TGCCGTCCTTGAGGCACTCCGCGAGGCTCACCCTATTGTAGAAAAGATCC TGCAATACCGTGAGTTGACGAAGCTTAAAAGCACTTATATTGATCCTCTC CCGGATCTGATCCATCCTCGTACCGGCCGCTTGCACACACGTTTCAACCA GACGGCGACTGCAACCGGCCGTCTGTCTAGCTCGGATCCAAATCTCCAGA ACATTCCGGTCCGTACACCCTTGGGCCAACGTATCCGCCGGGCGTTTATC GCTGAGGAAGGATGGTTACTGGTCGCATTGGACTACTCGCAGATTGAGCT GCGCGTCCTCGCACATCTCTCTGGTGACGAAAATTTAATCCGCGTGTTTC AAGAGGGGCGTGATATTCACACAGAAACTGCCTCATGGATGTTCGGTGTC CCACGTGAAGCAGTGGATCCTTTGATGCGCCGTGCAGCTAAAACAATTAA TTTTGGAGTGCTGTACGGAATGAGCGCTCATCGCTTGAGTCAGGAACTGG CAATCCCCTACGAGGAAGCGCAGGCATTCATCGAACGTTACTTTCAATCG TTTCCGAAAGTTCGCGCATGGATCGAGAAGACGCTCGAGGAAGGTCGTCG TCGGGGCTATGTCGAAACTCTGTTTGGTCGCCGTCGGTACGTACCAGATC TTGAAGCCCGCGTCAAATCGGTACGGGAGGCTGCGGAGCGTATGGCATTT AATATGCCTGTACAGGGTACTGCAGCTGACCTCATGAAACTGGCAATGGT CAAGCTTTTCCCGCGCTTGGAGGAAATGGGCGCACGTATGCTTCTGCAGG TCATGGACGAGCTGGTGTTAGAAGCCCCTAAGGAGCGCGCCGAAGCTGTC GCGCGCCTCGCTAAAGAAGTGATGGAGGGCGTTTACCCATTGGCCGTACC CCTCGAAGTGGAGGTCGGTATTGGAGAAGATTGGTTATCTGCAAAGGAAG CGGCCGC. SEQ ID NO. 157, amino acid sequence of Mutant ID 27 (H784M) MRGMLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKS LLKALKEDGDAVIVVFDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIK ELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLS DRIHVLHPEGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIG EKTARKLLEEWGSLEALLKNLDRLKPAIREKILAHMDDLKLSWDLAKVRT DLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLESPKALEEAPWP PPEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARG LLAKDLSVLALREGLGLPPGDDPMLLAYLLDPSNTTPEGVARRYGGEWTE EAGERAALSERLFANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVR LDVAYLRALSLEVAEETARLEAEVERLAGHPFNLNSRDQLERVLEDELGL PAIGKTEKTGKRSTSAAVLEALREAHPIVEKILQYRELTKLKSTYIDPLP DLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIA EEGWLLVALDYSQIELRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVP REAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQAFIERYFQSF PKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFN MPVQGTAADLMKLAMVKLFPRLEEMGARMLLQVMDELVLEAPKERAEAVA RLAKEVMEGVYPLAVPLEVEVGIGEDWLSAKEAA. SEQ ID NO. 158, nucleotide sequence of Mutant ID 29 (H784F) CATATGCGTGGTATGCTGCCGTTGTTCGAGCCTAAAGGCCGCGTACTGTT AGTCGATGGTCATCACTTGGCCTATCGGACGTTCCATGCACTCAAAGGTC TGACGACCAGTCGTGGCGAACCGGTCCAGGCTGTTTATGGTTTCGCTAAG TCTTTGCTCAAAGCACTGAAAGAAGACGGGGACGCGGTAATTGTTGTATT TGATGCCAAAGCACCGAGCTTCCGCCACGAAGCTTATGGTGGCTACAAGG CAGGACGCGCCCCTACCCCAGAAGATTTCCCCCGTCAGCTGGCATTAATT AAGGAGTTAGTAGACCTTCTCGGCTTAGCGCGTCTGGAAGTTCCGGGTTA TGAGGCGGACGATGTCCTTGCATCCTTGGCTAAAAAGGCCGAAAAAGAGG GCTACGAAGTCCGCATCTTGACGGCAGACAAAGATCTGTACCAGCTTCTG TCTGACCGTATTCATGTTTTGCACCCTGAAGGCTACTTAATCACTCCGGC CTGGCTCTGGGAAAAGTACGGTCTGCGTCCCGATCAGTGGGCGGATTATC GGGCTTTGACGGGAGATGAGAGCGACAACCTGCCAGGAGTTAAGGGCATT GGTGAAAAAACCGCACGTAAGCTGCTTGAAGAGTGGGGTTCCCTGGAAGC CTTGTTAAAAAATCTGGATCGTCTCAAGCCCGCAATTCGTGAAAAGATCC TGGCTCATATGGACGATCTTAAATTAAGTTGGGACCTGGCCAAGGTGCGC ACCGATTTACCGCTTGAAGTGGATTTTGCAAAACGCCGTGAGCCGGACCG GGAACGTTTACGCGCTTTCTTAGAGCGTCTGGAATTCGGTTCACTGCTTC ATGAATTCGGTCTGTTAGAGTCTCCTAAAGCACTCGAAGAGGCACCGTGG CCGCCCCCAGAAGGTGCTTTTGTTGGCTTCGTACTTTCCCGTAAGGAGCC TATGTGGGCAGATCTTCTGGCTTTAGCGGCTGCACGCGGTGGCCGTGTTC ACCGGGCCCCTGAGCCATACAAAGCGTTACGTGATCTGAAGGAAGCACGT GGCTTGCTGGCAAAAGACCTTTCTGTTTTGGCCCTGCGCGAGGGTCTTGG ACTGCCGCCAGGCGACGATCCCATGTTATTGGCCTATCTGTTAGACCCTA GCAATACCACACCTGAAGGGGTCGCTCGTCGGTATGGCGGTGAATGGACT GAGGAAGCCGGAGAGCGCGCCGCATTGTCCGAACGGCTCTTTGCAAACTT ATGGGGTCGTCTGGAAGGGGAGGAACGTCTGTTATGGTTGTATCGGGAAG TCGAACGTCCTCTTTCGGCCGTATTAGCGCATATGGAGGCAACAGGTGTG CGTTTAGATGTCGCGTACCTTCGGGCCTTATCACTGGAAGTTGCAGAGGA AATCGCCCGTCTCGAGGCTGAAGTGTTCCGGTTGGCCGGTCACCCGTTTA ACCTCAACTCCCGTGACCAGCTGGAACGCGTTTTATTCGATGAGCTTGGG CTTCCCGCAATTGGCAAAACCGAAAAGACTGGCAAACGCAGTACGAGCGC TGCCGTCCTTGAGGCACTCCGCGAGGCTCACCCTATTGTAGAAAAGATCC TGCAATACCGTGAGTTGACGAAGCTTAAAAGCACTTATATTGATCCTCTC CCGGATCTGATCCATCCTCGTACCGGCCGCTTGCACACACGTTTCAACCA GACGGCGACTGCAACCGGCCGTCTGTCTAGCTCGGATCCAAATCTCCAGA ACATTCCGGTCCGTACACCCTTGGGCCAACGTATCCGCCGGGCGTTTATC GCTGAGGAAGGATGGTTACTGGTCGCATTGGACTACTCGCAGATTGAGCT GCGCGTCCTCGCACATCTCTCTGGTGACGAAAATTTAATCCGCGTGTTTC AAGAGGGGCGTGATATTCACACAGAAACTGCCTCATGGATGTTCGGTGTC CCACGTGAAGCAGTGGATCCTTTGATGCGCCGTGCAGCTAAAACAATTAA TTTTGGAGTGCTGTACGGAATGAGCGCTCATCGCTTGAGTCAGGAACTGG CAATCCCCTACGAGGAAGCGCAGGCATTCATCGAACGTTACTTTCAATCG TTTCCGAAAGTTCGCGCATGGATCGAGAAGACGCTCGAGGAAGGTCGTCG TCGGGGCTATGTCGAAACTCTGTTTGGTCGCCGTCGGTACGTACCAGATC TTGAAGCCCGCGTCAAATCGGTACGGGAGGCTGCGGAGCGTATGGCATTT AATATGCCTGTACAGGGTACTGCAGCTGACCTCATGAAACTGGCAATGGT CAAGCTTTTCCCGCGCTTGGAGGAAATGGGCGCACGTATGCTTCTGCAGG TCTTTGACGAGCTGGTGTTAGAAGCCCCTAAGGAGCGCGCCGAAGCTGTC GCGCGCCTCGCTAAAGAAGTGATGGAGGGCGTTTACCCATTGGCCGTACC CCTCGAAGTGGAGGTCGGTATTGGAGAAGATTGGTTATCTGCAAAGGAAG CGGCCGC. SEQ ID NO. 159, amino acid sequence of Mutant ID 29 (H784F) MRGMLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKS LLKALKEDGDAVIVVFDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIK ELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLS DRIHVLHPEGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIG EKTARKLLEEWGSLEALLKNLDRLKPAIREKILAHMDDLKLSWDLAKVRT DLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLESPKALEEAPWP PPEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARG LLAKDLSVLALREGLGLPPGDDPMLLAYLLDPSNTTPEGVARRYGGEWTE EAGERAALSERLFANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVR LDVAYLRALSLEVAEETARLEAEVERLAGHPFNLNSRDQLERVLEDELGL PAIGKTEKTGKRSTSAAVLEALREAHPIVEKILQYRELTKLKSTYIDPLP DLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIA EEGWLLVALDYSQIELRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVP REAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQAFIERYFQSF PKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFN MPVQGTAADLMKLAMVKLFPRLEEMGARMLLQVFDELVLEAPKERAEAVA RLAKEVMEGVYPLAVPLEVEVGIGEDWLSAKEAA. SEQ ID NO. 160, nucleotide sequence of Mutant ID 30 (H784Y) CATATGCGTGGTATGCTGCCGTTGTTCGAGCCTAAAGGCCGCGTACTGTT AGTCGATGGTCATCACTTGGCCTATCGGACGTTCCATGCACTCAAAGGTC TGACGACCAGTCGTGGCGAACCGGTCCAGGCTGTTTATGGTTTCGCTAAG TCTTTGCTCAAAGCACTGAAAGAAGACGGGGACGCGGTAATTGTTGTATT TGATGCCAAAGCACCGAGCTTCCGCCACGAAGCTTATGGTGGCTACAAGG CAGGACGCGCCCCTACCCCAGAAGATTTCCCCCGTCAGCTGGCATTAATT AAGGAGTTAGTAGACCTTCTCGGCTTAGCGCGTCTGGAAGTTCCGGGTTA TGAGGCGGACGATGTCCTTGCATCCTTGGCTAAAAAGGCCGAAAAAGAGG GCTACGAAGTCCGCATCTTGACGGCAGACAAAGATCTGTACCAGCTTCTG TCTGACCGTATTCATGTTTTGCACCCTGAAGGCTACTTAATCACTCCGGC CTGGCTCTGGGAAAAGTACGGTCTGCGTCCCGATCAGTGGGCGGATTATC
GGGCTTTGACGGGAGATGAGAGCGACAACCTGCCAGGAGTTAAGGGCATT GGTGAAAAAACCGCACGTAAGCTGCTTGAAGAGTGGGGTTCCCTGGAAGC CTTGTTAAAAAATCTGGATCGTCTCAAGCCCGCAATTCGTGAAAAGATCC TGGCTCATATGGACGATCTTAAATTAAGTTGGGACCTGGCCAAGGTGCGC ACCGATTTACCGCTTGAAGTGGATTTTGCAAAACGCCGTGAGCCGGACCG GGAACGTTTACGCGCTTTCTTAGAGCGTCTGGAATTCGGTTCACTGCTTC ATGAATTCGGTCTGTTAGAGTCTCCTAAAGCACTCGAAGAGGCACCGTGG CCGCCCCCAGAAGGTGCTTTTGTTGGCTTCGTACTTTCCCGTAAGGAGCC TATGTGGGCAGATCTTCTGGCTTTAGCGGCTGCACGCGGTGGCCGTGTTC ACCGGGCCCCTGAGCCATACAAAGCGTTACGTGATCTGAAGGAAGCACGT GGCTTGCTGGCAAAAGACCTTTCTGTTTTGGCCCTGCGCGAGGGTCTTGG ACTGCCGCCAGGCGACGATCCCATGTTATTGGCCTATCTGTTAGACCCTA GCAATACCACACCTGAAGGGGTCGCTCGTCGGTATGGCGGTGAATGGACT GAGGAAGCCGGAGAGCGCGCCGCATTGTCCGAACGGCTCTTTGCAAACTT ATGGGGTCGTCTGGAAGGGGAGGAACGTCTGTTATGGTTGTATCGGGAAG TCGAACGTCCTCTTTCGGCCGTATTAGCGCATATGGAGGCAACAGGTGTG CGTTTAGATGTCGCGTACCTTCGGGCCTTATCACTGGAAGTTGCAGAGGA AATCGCCCGTCTCGAGGCTGAAGTGTTCCGGTTGGCCGGTCACCCGTTTA ACCTCAACTCCCGTGACCAGCTGGAACGCGTTTTATTCGATGAGCTTGGG CTTCCCGCAATTGGCAAAACCGAAAAGACTGGCAAACGCAGTACGAGCGC TGCCGTCCTTGAGGCACTCCGCGAGGCTCACCCTATTGTAGAAAAGATCC TGCAATACCGTGAGTTGACGAAGCTTAAAAGCACTTATATTGATCCTCTC CCGGATCTGATCCATCCTCGTACCGGCCGCTTGCACACACGTTTCAACCA GACGGCGACTGCAACCGGCCGTCTGTCTAGCTCGGATCCAAATCTCCAGA ACATTCCGGTCCGTACACCCTTGGGCCAACGTATCCGCCGGGCGTTTATC GCTGAGGAAGGATGGTTACTGGTCGCATTGGACTACTCGCAGATTGAGCT GCGCGTCCTCGCACATCTCTCTGGTGACGAAAATTTAATCCGCGTGTTTC AAGAGGGGCGTGATATTCACACAGAAACTGCCTCATGGATGTTCGGTGTC CCACGTGAAGCAGTGGATCCTTTGATGCGCCGTGCAGCTAAAACAATTAA TTTTGGAGTGCTGTACGGAATGAGCGCTCATCGCTTGAGTCAGGAACTGG CAATCCCCTACGAGGAAGCGCAGGCATTCATCGAACGTTACTTTCAATCG TTTCCGAAAGTTCGCGCATGGATCGAGAAGACGCTCGAGGAAGGTCGTCG TCGGGGCTATGTCGAAACTCTGTTTGGTCGCCGTCGGTACGTACCAGATC TTGAAGCCCGCGTCAAATCGGTACGGGAGGCTGCGGAGCGTATGGCATTT AATATGCCTGTACAGGGTACTGCAGCTGACCTCATGAAACTGGCAATGGT CAAGCTTTTCCCGCGCTTGGAGGAAATGGGCGCACGTATGCTTCTGCAGG TCTATGACGAGCTGGTGTTAGAAGCCCCTAAGGAGCGCGCCGAAGCTGTC GCGCGCCTCGCTAAAGAAGTGATGGAGGGCGTTTACCCATTGGCCGTACC CCTCGAAGTGGAGGTCGGTATTGGAGAAGATTGGTTATCTGCAAAGGAAG CGGCCGC. SEQ ID NO. 161, amino acid sequence of Mutant ID 30 (H784Y) MRGMLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKS LLKALKEDGDAVIVVFDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIK ELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLS DRIHVLHPEGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIG EKTARKLLEEWGSLEALLKNLDRLKPAIREKILAHMDDLKLSWDLAKVRT DLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLESPKALEEAPWP PPEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARG LLAKDLSVLALREGLGLPPGDDPMLLAYLLDPSNTTPEGVARRYGGEWTE EAGERAALSERLFANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVR LDVAYLRALSLEVAEETARLEAEVERLAGHPFNLNSRDQLERVLFDELGL PAIGKTEKTGKRSTSAAVLEALREAHPIVEKILQYRELTKLKSTYIDPLP DLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIA EEGWLLVALDYSQIELRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVP REAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQAFIERYFQSF PKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFN MPVQGTAADLMKLAMVKLFPRLEEMGARMLLQVYDELVLEAPKERAEAVA RLAKEVMEGVYPLAVPLEVEVGIGEDWLSAKEAA.
Example 18
Production of Codon Optimized Taq DNA Polymerase Mutants Modified to Eliminate 5'Exonuclease Activity
[0223] Additional Taq DNA Polymerase mutants were made that eliminated the 5' exonuclease activity of several of the mutants from Table 3. Taq DNA Polymerase missing the 5'-exonuclease activity was previously named "KlenTaq" (Barnes, W. M., Gene 112:29-35, 1992). Deletion of the N-terminal 5' exonuclease domain of Taq polymerase improves the mismatch discrimination properties of the enzyme (Barnes, W. M., Gene 112:29-35, 1992). The present study characterized whether specificity improvements seen in the Taq DNA Polymerase mutants of the present invention were combined with mutations which eliminated 5'-exonuclease activity. The examples shown here are meant to be exemplary, and in no way limit the range of the claims. Specific mutations were introduced into the OptiTaq sequence using the method of PCR site-directed mutagenesis (Weiner MP, et al., Gene. 151(1-2):119-23 (1994)). Each mutagenesis reaction employed 10 pmoles of two oligonucleotides (Table 38) to amplify around the plasmid containing the DNA polymerase, excluding the 5' exonuclease domain. These primers were manufactured to contain a 5' phosphate, which allowed for re-ligation after amplification. Briefly, these primers were annealed to the double-stranded plasmid containing previously characterized mutant DNA polymerases (MUT IDs 2, 3, 10, 18, 21, and 30) (20 ng each), 5 U KOD DNA polymerase (Novagen-EMD Chemicals, San Diego, Calif.), 1.5 mM MgSO.sub.4, in 1.times. KOD PCR buffer. Thermal cycling parameters were 95.degree. C. for 3 minutes (95.degree. C. for 20 sec-55.degree. C. for 20 sec-70.degree. C. for 2 minutes) for 25 cycles followed by a 70.degree. C. soak for 4 minutes. After PCR site-directed mutagenesis, the amplified product was treated with 10 U of Dpn I (NEB, Ipswich, Mass.), at 37.degree. C. for 1 hour, followed by inactivation at 80.degree. C. for 20 minutes. 1/6.sup.th of the digestion material was ligated together with T4 DNA ligase (NEB, Ipswich, Mass.) at 16.degree. C. for 20 minutes, followed by inactivation at 65.degree. C. for 10 minutes. 1/15.sup.th of the ligated material was transformed into XL-1 Blue competent bacteria. Bacterial clones were isolated, plasmid DNA prepared, and deletion of the 5' exonuclease domains were confirmed by Sanger DNA sequencing. All mutants remained in the pET-27b(+) expression vector, which is suitable for expressing the recombinant proteins in E. coli. Expression and purification of the recombinant mutants of the Taq polymerase were performed as described in Example 3.
TABLE-US-00040 TABLE 38 Oligonucleotides used for site-directed mutagenesis to produce 18 Taq DNA Polymerase mutants. Sequence'' SEQ Sequence'' SEQ Mutant Mutant Sense mutagenesis ID Antisense mutagenesis ID ID name oligonucleotide No. oligonucleotide No. 37 OptiTaq Phos- 162 Phos- 163 KlenTaq ggttcactgcttcatgaattc catatgtattctccttcttaa ggtc agttaaacaaa 38 A661E, Phos- 162 Phos- 163 I665W, ggttcactgcttcatgaattc catatgtattctccttcttaa F667L ggtc agttaaacaaa KlenTaq 39 V783F Phos- 162 Phos- 163 KlenTaq ggttcactgcttcatgaattc catatgtattctccttcttaa ggtc agttaaacaaa 40 H784Q Phos- 162 Phos- 163 KlenTaq ggttcactgcttcatgaattc catatgtattctccttcttaa ggtc agttaaacaaa 41 V783L Phos- 162 Phos- 163 H784Q ggttcactgcttcatgaattc catatgtattctccttcttaa KlenTaq ggtc agttaaacaaa 42 H784S Phos- 162 Phos- 163 KlenTaq ggttcactgcttcatgaattc catatgtattctccttcttaa ggtc agttaaacaaa 43 H784Y Phos- 162 Phos- 163 KlenTaq ggttcactgcttcatgaattc catatgtattctccttcttaa ggtc agttaaacaaa DNA bases identical to codon optimized OptiTaq are shown in lower case; those specific for the mutations introduced by site-directed mutagenesis are shown in upper case.
Example 19
Characterization of Properties of 7 5'-Exonuclease-Deficient Mutant Taq DNA Polymerases in PCR
[0224] The 7 mutant Taq DNA polymerase enzymes described in Example 18 were characterized for polymerase activity.
[0225] The unit activity of the purified wild-type protein was determined by comparing performance in qPCR of known quantities of OptiTaq and each mutant compared to a commercial non-hot-start Taq DNA polymerase, Taq-B DNA Polymerase (Enzymatics, Beverly, Mass.). Quantification cycle values (Cq, the amplification cycle number at which positive signal is first detected) and amplification curve shapes were analyzed to determine the nanogram amounts at which both enzymes performed similarly in the suboptimal range for each. Using these nanogram amounts and known unit values of Taq-B DNA polymerase, relative activity unit values could be extrapolated for all of the mutant DNA polymerase enzymes having sufficient activity to support PCR. Testing was also done to determine the MgCl.sub.2 concentrations at which the polymerases would show optimal activity.
[0226] The following reaction conditions were employed: 1.times. qPCR buffer (20 mM Tris pH 8.4, 50 mM KCl, 0.01% Triton-X100), 800 .mu.M dNTPs (200 .mu.M each), 500 nM For primer (Hs HPRT F517, SEQ ID NO. 43), 500 nM Rev primer (Hs HPRT R591, SEQ ID NO. 44), 250 nM RNase H2 cleavable probe (Hs HPRT RN2 Probe, SEQ ID NO. 164), 20 mU Pyrococcus abyssi RNase H2, 2.times.10.sup.3 copies of linearized cloned plasmid template (HPRT-targ, SEQ ID NO. 46), in 10 .mu.L final volume. MgC.sub.2 was tested at 3, 4, or 5 mM in each case. The amount of DNA polymerase added to each reaction was varied as follows: for wild type (OptiTaq), reactions were set using 10, 1, 0.1, 0.01, and 0.001 U/.mu.L (220, 22, 2.2, 0.22, or 0.022 ng of protein per 10 .mu.L reaction). Mutant polymerases were run in similar concentrations. In addition, those mutant enzymes showing polymerase activity were more finely titrated testing 220, 22, 10.6, 4.8, 2.2, 1.1, 0.48, and 0.22 ng of protein per 10 .mu.L reaction. Polymerase dilutions were made in enzyme dilution buffer (20 mM Tris pH 7.5, 100 mM NaCl, 1 mM DTT, 0.1% Triton-X100, 1 mg/mL BSA, 10% glycerol). Reactions were run in 384 well format on a BIO-RAD CFX384.TM. Real-Time System (BIO-RAD, Hercules, Calif.) using cycling parameters 95.degree. C. for 30 seconds followed by 60 cycles of [95.degree. C. for 15 seconds followed by 60.degree. C. for 1 minutes]. Detection was achieved using a fluorescence-quenched probe (cleaved by the action of the P.a. RNase H2 enzyme). Sequences of the primers, probe, and template (plasmid insert) are shown in Table 39.
TABLE-US-00041 TABLE 39 Sequence of oligonucleotides employed in Taq DNA polymerase activity assay. Name Sequence SEQ ID NO. Hs HPRT GACTTTGCTTTCCTTGGTCAG SEQ ID NO. 43 F517 Hs HPRT GGCTTATATCCAACACTTCGTG SEQ ID NO. 44 R591 Hs HPRT FAM-ATGGTCAAGGTCGCAAGc SEQ ID NO. RN2 TTGCTGGT-IBFQ 164 Probe HPRT- GACTTTGCTTTCCTTGGTCAGGCAG SEQ ID NO. 46 targ TATAATCCAAAGATGGTCAAGGTCG CAAGCTTGCTGGTGAAAAGGACCCC ACGAAGTGTTGGATATAAGCC DNA bases are uppercase and RNA bases are lowercase; Nucleic acid sequences are shown 5'-3'. FAM = 6-carboxyfluorescein, IBFQ = Iowa Black FQ (fluorescence quencher), and ZEN = ZEN internal fluorescence quencher.
These 7 Taq DNA polymerase 5'-exonuclease-deficient mutants were characterized as outlined above. Results are summarized in Table 40. All seven mutants had DNA polymerase activity; however, processivity in Mutant IDs 38, 39, 40, 41, 42, and 43 was reduced from 10-50 fold relative to the wild type enzyme. One mutant, Mutant ID 37 (OptiTaq KlenTaq), showed DNA polymerase activity nearly identical to wild type OptiTaq. Therefore the combination of complete deletion of the 5'-exonuclease domain of Taq DNA Polymerase coupled with point mutations that improve polymerase specificity all significantly compromised enzyme activity and processivity.
TABLE-US-00042 TABLE 40 Novel Taq DNA polymerase mutants selected for initial study. Optimal Amino acid MgCl.sub.2 Mutant changes from Polymerase Relative concentration ID wild-type Taq Activity activity* (mM) 37 OptiTaq KlenTaq Yes 1 3 38 A661E, I665W, Yes 0.1 5 F667L KlenTaq 39 V783F KlenTaq Yes 0.05 4 40 H784Q KlenTaq Yes 0.03 4 41 V783L H784Q Yes 0.02 5 KlenTaq 42 H784S KlenTaq Yes 0.02 5 43 H784Y KlenTaq Yes 0.05 5 *Wild-type OptiTaq was set to "1" and the relative activity of each of the mutant polymerases was normalized to this amplification efficiency, with 1 as the maximum.
Example 20
Improved Mismatch Discrimination in Allele-Specific PCR using Mutant Taq DNA Polymerases also having Deletion of the 5'-Exonuclease Domain
[0227] Of the 7 mutant enzymes studied in Example 18 and 19, Mutant IDs 37, 38, 39, 40, 41, 42, and 43 retained sufficient enzymatic activity/processivity to characterize. These seven mutants were studied for the ability to discriminate against a 3'-terminal DNA mismatch compared with wild type OptiTaq DNA polymerase using an allele-specific qPCR assay. Amplification reactions were performed against a synthetic oligonucleotide template where a single base was varied (SNP) which was positioned to lie at the 3'-end of the reverse primer. Synthetic templates were employed having each of the 4 possible bases at this position. Reverse primers were employed having each of the 4 possible bases at the 3'-end. Relative amplification efficiency was assessed using qPCR.
[0228] Quantitative allele-specific real-time PCR (AS-qPCR) was performed in 10 .mu.L reaction volumes in 384 well format with 2.times.10.sup.5 copies of a 103 bp synthetic template (SEQ ID NOs. 51-4). Final reaction conditions used were 20 mM Tris-HCL (pH 8.4 at 25.degree. C.), 50 mM KCL, the amount of MgCl.sub.2 which was determined to be optimal for each polymerase in Example 19, 0.01% Triton X-100, 800 .mu.M total dNTPs, and 200 nM of the universal forward primer (SEQ ID NO. 60), 200 nM of a reverse primer (separate reactions were set up for each of the allele-specific primers SEQ ID NOs. 55-58 or the control universal primer SEQ ID NO. 59) and 200 nM of the RNase H2 cleavable probe (SEQ ID NO. 165). 20 mU Pyrococcus abyssi RNase H2 was also include in each reaction. Each allele-specific primer was tested on each SNP template. Reactions utilized either 0.5 U (10.8 ng/11.1 nM/111 fmol) of the OptiTaq KlenTaq DNA polymerase (Mutant ID 37) or 0.5 U of one of the six Taq DNA polymerase mutants studied (Mutant ID 38 (108 ng/111 nM/1110 fmol); Mutant ID 39 (216 ng/222 nM/2220 fmol); Mutant ID 40 (360 ng/370 nM/3700 fmol); Mutant ID 41 (1060 ng/555 nM/5550 fmol); Mutant ID 42 (1060 ng/555 nM/5550 fmol); Mutant ID 43 (216 ng/222 nM/2220 fmol)). Amplification was performed on a CFX384.TM. C1000.TM. Thermo Cycler system (Bio-Rad, Hercules, Calif.) using the following cycling parameters: 95.degree. C. for 30 seconds initial denaturation followed by 60 cycles of 95.degree. C. for 10 seconds, then 60.degree. C. for 30 seconds. Oligonucleotide reagents used in this example are shown in Table 41.
TABLE-US-00043 TABLE 41 Synthetic oligonucleotides employed in Example 20. Name Sequence (5'-3') SEQ ID NO. A AGCTCTGCCCAAAGATTACC SEQ ID NO. 51 Template CTGACAGCTAAGTGGCAGTG GAAGTTGGCCTCAGAAGTAG TGGCCAGCTGTGTGTCGGGG AACAGTAAAGGCATGAAGCT CAG C AGCTCTGCCCAAAGATTACC SEQ ID NO. 52 Template CTGACAGCTAAGTGGCAGTG GAAGTTGGCCTCAGAAGTAG TGGCCAGCTGTGTGTCGGGG CACAGTAAAGGCATGAAGCT CAG G AGCTCTGCCCAAAGATTACC SEQ ID NO. 53 Template CTGACAGCTAAGTGGCAGTG GAAGTTGGCCTCAGAAGTAG TGGCCAGCTGTGTGTCGGGG GACAGTAAAGGCATGAAGCT CAG T AGCTCTGCCCAAAGATTACC SEQ ID NO. 54 Template CTGACAGCTAAGTGGCAGTG GAAGTTGGCCTCAGAAGTAG TGGCCAGCTGTGTGTCGGGG TACAGTAAAGGCATGAAGCT CAG Syn Rev T CTGAGCTTCATGCCTTTACT SEQ ID NO. 55 GTT Syn Rev C CTGAGCTTCATGCCTTTACT SEQ ID NO. 56 GTC Syn Rev A CTGAGCTTCATGCCTTTACT SEQ ID NO. 57 GTA Syn Rev G CTGAGCTTCATGCCTTTACT SEQ ID NO. 58 GTG Syn Rev CTGAGCTTCATGCCTTTACT SEQ ID NO. 59 GT Syn For AGCTCTGCCCAAAGATTACC SEQ ID NO. 60 CTG RN2 Probe FAM-TTCTGAGGCCAACuCC SEQ ID NO. ACTGCCACTTA-IBFQ 165 DNA bases are uppercase and RNA bases are lowercase; FAM = 6-carboxyfluorescein; IBFQ = Iowa Black .TM. FQ fluorescence quencher; ZEN = internal ZEN fluorescence quencher; underlined base indicates the SNP site in the synthetic template DNA.
[0229] Initially all reactions were run in triplicate. Similar results were obtained for all replicates when using the wild type OptiTaq. However, results showed greater variation for the mutant polymerases. To obtain statistically meaningful results, each reaction was therefore performed 24 times for the mutant polymerases and 21 times for the wild type enzyme. .DELTA.Cq values were calculated as the Cq value obtained for each mismatched base pair minus the Cq value obtained for the matched base pair (.DELTA.Cq=Cq mismatch-Cq match). The .DELTA.Cq values for all 24 replicates were averaged and standard deviations were calculated. Results are shown in Table 42 and are graphically summarized in FIGS. 7A, 7B, and 7C. Note that the reverse primer is the allele-specific primer, so the "Syn Rev T" primer (SEQ ID NO. 55) is the perfect match to the Template A (SEQ ID NO. 51), etc.
TABLE-US-00044 TABLE 42 .DELTA.Cq values for AS-qPCR reactions using KlenTaq mutant Taq DNA polymerases. Reverse Primer Template SEQ A C G T DNA ID SEQ ID SEQ ID SEQ ID SEQ ID Polymerase Name NO. NO. 51 NO. 52 NO. 53 NO. 54 Mutant ID 37 Syn Rev T 55 -- 9.2 +/- 0.3 6.9 +/- 0.4 10.0 +/- 0.4 OptiTaq Syn Rev G 58 14.7 +/- 1.2 -- 11.3 +/- 0.5 3.9 +/- 0.3 KlenTaq Syn Rev C 56 9.4 +/- 0.2 10.4 +/- 0.2 -- 7.5 +/- 0.2 Syn Rev A 57 13.3 +/- 0.4 8.7 +/- 0.2 12.4 +/- 0.4 -- Mutant ID 38 Syn Rev T 55 -- 11.8 +/- 0.5 9.9 +/- 0.6 11.7 +/- 0.7 A661E, Syn Rev G 58 17.4 +/- 5.8 -- 13.1 +/- 1.5 7.9 +/- 2.9 I665W, Syn Rev C 56 10.8 +/- 0.4 11.0 +/- 0.5 -- 10.5 +/- 0.2 F667L Syn Rev A 57 13.8 +/- 0.6 11.5 +/- 0.4 13.6 +/- 0.8 -- KlenTaq Mutant ID 39 Syn Rev T 55 -- 10.9 +/- 0.3 8.7 +/- 0.3 11.3 +/- 0.4 V783F Syn Rev G 58 17.1 +/- 6.7 -- 12.9 +/- 0.7 6.9 +/- 0.3 KlenTaq Syn Rev C 56 10.5 +/- 0.2 10.5 +/- 0.6 -- 10.0 +/- 0.2 Syn Rev A 57 13.4 +/- 0.6 10.6 +/- 0.2 13.0 +/- 0.4 -- Mutant ID 40 Syn Rev T 55 -- 11.5 +/- 0.4 10.1 +/- 0.3 12.0 +/- 0.9 H784Q Syn Rev G 58 18.2 +/- 6.4 -- 13.2 +/- 0.5 7.9 +/- 0.3 KlenTaq Syn Rev C 56 10.7 +/- 0.4 10.5 +/- 0.6 -- 10.2 +/- 0.3 Syn Rev A 57 13.8 +/- 0.7 11.3 +/- 0.3 13.5 +/- 0.6 -- Mutant ID 41 Syn Rev T 55 -- 8.9 +/- 0.3 7.8 +/- 0.3 10.5 +/- 0.4 V783L Syn Rev G 58 15.8 +/- 4.3 -- 12.4 +/- 0.5 5.8 +/- 0.3 H784Q Syn Rev C 56 10.1 +/- 0.5 10.2 +/- 0.2 -- 8.5 +/- 0.4 KlenTaq Syn Rev A 57 13.3 +/- 0.8 9.5 +/- 0.3 12.6 +/- 0.4 -- Mutant ID 42 Syn Rev T 55 -- 12.1 +/- 0.7 10.2 +/- 0.4 11.4 +/- 0.6 H784S Syn Rev G 58 15.8 +/- 1.0 -- 13.3 +/- 0.6 8.3 +/- 0.5 KlenTaq Syn Rev C 56 10.3 +/- 0.3 10.6 +/- 0.5 -- 10.1 +/- 0.4 Syn Rev A 57 14.1 +/- 0.4 12.0 +/- 0.4 14.1 +/- 0.3 -- Mutant ID 43 Syn Rev T 55 -- 11.3 +/- 0.4 8.5 +/- 0.4 11.0 +/- 0.4 H784Y Syn Rev G 58 15.5 +/- 1.2 -- 12.4 +/- 0.7 6.5 +/- 0.3 KlenTaq Syn Rev C 56 9.9 +/- 0.3 10.3 +/- 0.5 -- 9.3 +/- 0.4 Syn Rev A 57 13.7 +/- 1.2 11.6 +/- 1.2 13.9 +/- 1.5 -- Average .DELTA.Cq values are shown, where .DELTA.Cq = [Cq mismatch - Cq match], +/- standard deviation calculated from 24 replicates.
[0230] The OptiTaq KlenTaq Mutant ID 37 showed an average .DELTA.Cq for AS-qPCR in this synthetic amplicon system of 9.8 with a range of 3.9 to 14.7. Mutant ID 38 (A661E, 1665W, F667L KlenTaq) showed an average .DELTA.Cq of 11.9 with a range of 7.9 to 17.4. Mutant ID 39 (V783F KlenTaq) showed an average .DELTA.Cq of 11.3 with a range of 6.9 to 17.1. Mutant ID 40 (H784Q KlenTaq) showed an average .DELTA.Cq of 11.9 with a range of 7.9 to 18.2. Mutant ID 41 (V783L H784Q KlenTaq) showed an average .DELTA.Cq of 10.5 with a range of 5.8 to 15.8. Mutant ID 42 (H784S KlenTaq) showed an average .DELTA.Cq of 11.9 with a range of 8.3 to 15.8. Mutant ID 43 (H784Y KlenTaq) showed an average .DELTA.Cq of 11.2 with a range of 6.5 to 15.5. Therefore, in all pairwise combinations of 4 template bases and 4 3'-terminal primer bases the mutant Taq DNA polymerases of the present invention showed greater discrimination to mismatch than did the OptiTaq or OptiTaq KlenTaq DNA polymerases. The magnitude of improvement for each mismatch pair is defined by the .DELTA..DELTA.Cq, which is the difference of discrimination between the mutant and wild type KlenTaq enzymes (.DELTA..DELTA.Cq=.DELTA.Cq mutant KlenTaq-.DELTA.Cq OptiTaq KlenTaq). The .DELTA..DELTA.Cq values were calculated and are shown in Table 43.
TABLE-US-00045 TABLE 43 .DELTA..DELTA.Cq values for AS-qPCR reactions for the mutant KlenTaq DNA polymerases compared with OptiTaq KlenTaq. Reverse Primer Template SEQ A C G T DNA ID SEQ ID SEQ ID SEQ ID SEQ ID Polymerase Name NO. NO. 51 NO. 52 NO. 53 NO. 54 Mutant Syn Rev T 55 -- 2.6 3 1.7 ID 38 Syn Rev G 58 2.7 -- 1.8 4 A661E, Syn Rev C 56 1.4 0.6 -- 3 I665W, Syn Rev A 57 0.7 2.8 1.2 -- F667L KlenTaq Mutant Syn Rev T 55 -- 1.7 1.8 1.3 ID 39 Syn Rev G 58 2.4 -- 1.6 3 V783F Syn Rev C 56 1.1 0.1 -- 2.5 KlenTaq Syn Rev A 57 0.3 1.9 0.6 -- Mutant Syn Rev T 55 -- 2.3 3.2 2 ID 40 Syn Rev G 58 3.5 -- 1.9 4 H784Q Syn Rev C 56 1.3 0.4 -- 2.7 KlenTaq Syn Rev A 57 0.7 2.6 1.1 Mutant Syn Rev T 55 -- -0.3 0.9 0.5 ID 41 Syn Rev G 58 1.1 -- 1.1 1.9 V783L Syn Rev C 56 0.7 -0.2 -- 1 H784Q Syn Rev A 57 0.2 0.8 0.2 -- KlenTaq Mutant Syn Rev T 55 -- 2.9 3.3 1.4 ID 42 Syn Rev G 58 1.1 -- 2 4.4 H784S Syn Rev C 56 0.9 0.2 -- 2.6 KlenTaq Syn Rev A 57 1 3.3 1.7 -- Mutant Syn Rev T 55 -- 2.1 1.6 1 ID 43 Syn Rev G 58 0.8 -- 1.1 2.6 H784Y Syn Rev C 56 0.5 -0.1 -- 1.8 KlenTaq Syn Rev A 57 0.6 2.9 1.5 -- Average .DELTA..DELTA.Cq values are shown, where .DELTA..DELTA.Cq = [.DELTA.Cq mutant KlenTaq - .DELTA.Cq OptiTaq KlenTaq], from data in Table 42.
[0231] Mutant ID 38 (A661E, I665W, F667L KlenTaq) showed an average .DELTA..DELTA.Cq of 1.7 compared to OptiTaq KlenTaq. Mutant ID 39 (V783F KlenTaq) showed an average .DELTA..DELTA.Cq of 2.0 compared to OptiTaq KlenTaq. Mutant ID 40 (H784Q KlenTaq) showed an average .DELTA..DELTA.Cq of 2.1 compared to OptiTaq KlenTaq. Mutant ID 41 (V783L H784Q KlenTaq) showed an average .DELTA..DELTA.Cq of 0.7 compared to OptiTaq KlenTaq. Mutant ID 42 (H784S KlenTaq) showed an average .DELTA..DELTA.Cq of 2.1 compared to OptiTaq KlenTaq. Mutant ID 43 (H784Y KlenTaq) showed an average .DELTA..DELTA.Cq of 2.0 compared to OptiTaq KlenTaq. Therefore, each of the mutant Taq DNA polymerases of the present invention showed a significant improvement in mismatch discrimination over OptiTaq KlenTaq which had complete deletion of the 5'-exonuclease domain but contained no other secondary mutations. Overall, mutant IDs 40 and 42 (H784Q KlenTaq and H784S KlenTaq) showed the best SNP discrimination within the set of mutant enzymes studied in this example using an AS-PCR assay.
Example 21
Improved Mismatch Discrimination in rhPCR using Mutant KlenTaq DNA Polymerases in a Human Genomic DNA SNP Assay
[0232] Example 20 demonstrated utility of the novel mutant Taq DNA polymerases of the present invention in a synthetic amplicon rhPCR SNP discrimination assay system. The present Example demonstrates utility of the novel mutant Taq DNA polymerases in a human genomic DNA rhPCR SNP discrimination assays system, examining a SNP site in the SMAD7 gene (NM_005904, C/T SNP, rs4939827). The assays employed target DNAs GM18562 (homozygous C/C) and GM18537 (homozygous T/T) from the Coriell Institute for Medical Research (Camden, N.J., USA). One blocked-cleavable primer design was tested, the generation 1 (Gen1) "RDDDDx" primers (see: US Patent Application 2012/0258455 by Behlke et al., entitled, RNASE H-BASED ASSAYS UTILIZING MODIFIED RNA MONOMERS).
[0233] Quantitative real-time rhPCR was performed in 10 .mu.L reaction volumes in 384 well format with 20 ng (the equivalent of 6600 copies of target) of human genomic DNA (GM18562 or GM18537). Reactions utilized either 0.5 U (10.8 ng/11.1 nM/111 fmol) of OptiTaq KlenTaq DNA polymerase or 0.5 U of one of the three Taq DNA polymerase mutants (Mutant ID 40 (360 ng/370 nM/3700 fmol); Mutant ID 41 (1060 ng/555 nM/5550 fmol); Mutant ID 43 (216 ng/222 nM/2220 fmol)). Final reaction conditions used were 20 mM Tris-HCL (pH 8.4 at 25.degree. C.), 50 mM KCL, 3 mM MgCl.sub.2, 0.01% Triton X-100, 800 .mu.M total dNTPs, 200 nM of a forward primer (SEQ ID NOs. 75-79), 200 nM of the universal reverse primer (SEQ ID NO. 74), and 200 nM of the RNase H2 cleavable SMAD7 probe (SEQ ID NO. 166). Sequence of the 85 bp SMAD7 amplicon is shown as SEQ ID NO. 81. Forward primers included RDDDDx configuration Gen1 allele-specific rhPCR primers (SEQ ID NOs. 76 and 77), and the control universal forward primer (SEQ ID NO.75) which is not allele specific. Oligonucleotide reagents employed in this Example are shown in Table 44. Reactions included 1 .mu.L of P.a. RNase H2 at a concentration of 2.6 mU per 10 .mu.L reaction (5 fmoles, 0.5 nM). Amplification was performed on a Roche LightCycler.RTM. 480 (Roche Applied Science, Indianapolis, Ind., USA) as follows: 95.degree. C. for 3 minutes followed by 95 cycles of 95.degree. C. for 10 seconds and 60.degree. C. for 30 seconds. All reactions were performed in triplicate.
TABLE-US-00046 TABLE 44 Synthetic oligonucleotides employed in Example 21. Name Sequence (5'-3') SEQ ID NO. SMAD7 Rev CTCACTCTAAACCCCAGCATT 74 SMAD7 For CAGCCTCATCCAAAAGAGGAAA 75 SMAD7 For CAGCCTCATCCAAAAGAGGAAA 76 rC DDDDx cAGGAx SMAD7 For CAGCCTCATCCAAAAGAGGAAA 77 rU DDDDx uAGGAx SMAD7 RN2 FAM-CCCAGAGCTCcCTCAGAC 166 probe TCCT-IBFQ SMAD7 CAGCCTCATCCAAAAGAGGAAA 81 target TAGGACCCCAGAGCTCCCTCAG ACTCCTCAGGAAACACAGACAA TGCTGGGGTTTAGAGTGAG DNA bases are uppercase and RNA bases are lowercase; FAM = 6-carboxyfluorescein; IBFQ = Iowa Black .TM. FQ fluorescence quencher; "x" = C3 Spacer (propanediol). Primer and probe binding sites in the SMAD7 target are underlined.
[0234] Results using the Gen1 RDDDDx rhPCR primers are shown in Table 45. Use of the mutant Taq DNA polymerases showed significant improvements in SNP discrimination in this human genomic DNA rhPCR assay using the Gen1 RDDDDx primers, although amplification efficiency was often reduced, as shown by the increases in the match Cqs. Therefore use of the new mutant KlenTaq DNA polymerases improves SNP discrimination in rhPCR genotyping assays.
TABLE-US-00047 TABLE 45 SNP discrimination of a site in the SMAD7 gene using Gen1 RDDDDx primers comparing wild type OptiTaq with four mutant Taq DNA polymerases. Cq Cq SEQ mU RNase Value Value DNA ID H2 per C/C T/T Polymerase For Primer NO. 10 .mu.L rxn DNA DNA .DELTA.Cq MUT ID 37 SMAD7 For 75 2.6 24.4 23.5 OptiTaq SMAD7 For 76 2.6 31.1 38.4 7.3 KlenTaq rC DDDDx SMAD7 For 77 2.6 46.1 33.0 13.1 rU DDDDx MUT ID 40 SMAD7 For 75 2.6 24.6 24.5 H784Q SMAD7 For 76 2.6 28.1 38.8 10.7 KlenTaq rC DDDDx SMAD7 For 77 2.6 42.1 28.8 13.3 rU DDDDx MUT ID 41 SMAD7 For 75 2.6 24.5 24.3 V783L SMAD7 For 76 2.6 26.2 37.6 11.4 H784Q rC DDDDx KlenTaq SMAD7 For 77 2.6 41.2 27.8 13.4 rU DDDDx MUT ID 43 SMAD7 For 75 2.6 24.7 24.8 H784Y SMAD7 For 76 2.6 33.8 45.1 11.2 KlenTaq rC DDDDx SMAD7 For 77 2.6 50.4 35.2 15.2 rU DDDDx DNA targets included GM18562 (homozygous C/C) and GM18537 (homozygous T/T) from the Coriell Institute for Medical Research. .DELTA.Cq = [Cq mismatch - Cq match].
Example 22
Sequence of Taq DNA Polymerase Mutants Showing Improved Discrimination for Mismatch or the Presence of an RNA Residue at the 3'-End of the Primer
[0235] The complete amino acid and nucleotide sequences of the codon optimized mutant enzymes employed in Examples 18-21 are shown below. Although these sequences are easily derived from information provided in Tables 1, 3, 4 26 and 38 by one with skill in the art, the final assembled sequences are provided below for clarity. Base changes are identified in bold underlined font for the nucleic acid and amino acid substitutions.
TABLE-US-00048 SEQ ID NO. 167, nucleotide sequence of Mutant ID 37 (OptiTaq KlenTaq) CATATGGGTTCACTGCTTCATGAATTCGGTCTGTTAGAGTCTCCTAAAGC ACTCGAAGAGGCACCGTGGCCGCCCCCAGAAGGTGCTTTTGTTGGCTTCG TACTTTCCCGTAAGGAGCCTATGTGGGCAGATCTTCTGGCTTTAGCGGCT GCACGCGGTGGCCGTGTTCACCGGGCCCCTGAGCCATACAAAGCGTTACG TGATCTGAAGGAAGCACGTGGCTTGCTGGCAAAAGACCTTTCTGTTTTGG CCCTGCGCGAGGGTCTTGGACTGCCGCCAGGCGACGATCCCATGTTATTG GCCTATCTGTTAGACCCTAGCAATACCACACCTGAAGGGGTCGCTCGTCG GTATGGCGGTGAATGGACTGAGGAAGCCGGAGAGCGCGCCGCATTGTCCG AACGGCTCTTTGCAAACTTATGGGGTCGTCTGGAAGGGGAGGAACGTCTG TTATGGTTGTATCGGGAAGTCGAACGTCCTCTTTCGGCCGTATTAGCGCA TATGGAGGCAACAGGTGTGCGTTTAGATGTCGCGTACCTTCGGGCCTTAT CACTGGAAGTTGCAGAGGAAATCGCCCGTCTCGAGGCTGAAGTGTTCCGG TTGGCCGGTCACCCGTTTAACCTCAACTCCCGTGACCAGCTGGAACGCGT TTTATTCGATGAGCTTGGGCTTCCCGCAATTGGCAAAACCGAAAAGACTG GCAAACGCAGTACGAGCGCTGCCGTCCTTGAGGCACTCCGCGAGGCTCAC CCTATTGTAGAAAAGATCCTGCAATACCGTGAGTTGACGAAGCTTAAAAG CACTTATATTGATCCTCTCCCGGATCTGATCCATCCTCGTACCGGCCGCT TGCACACACGTTTCAACCAGACGGCGACTGCAACCGGCCGTCTGTCTAGC TCGGATCCAAATCTCCAGAACATTCCGGTCCGTACACCCTTGGGCCAACG TATCCGCCGGGCGTTTATCGCTGAGGAAGGATGGTTACTGGTCGCATTGG ACTACTCGCAGATTGAGCTGCGCGTCCTCGCACATCTCTCTGGTGACGAA AATTTAATCCGCGTGTTTCAAGAGGGGCGTGATATTCACACAGAAACTGC CTCATGGATGTTCGGTGTCCCACGTGAAGCAGTGGATCCTTTGATGCGCC GTGCAGCTAAAACAATTAATTTTGGAGTGCTGTACGGAATGAGCGCTCAT CGCTTGAGTCAGGAACTGGCAATCCCCTACGAGGAAGCGCAGGCATTCAT CGAACGTTACTTTCAATCGTTTCCGAAAGTTCGCGCATGGATCGAGAAGA CGCTCGAGGAAGGTCGTCGTCGGGGCTATGTCGAAACTCTGTTTGGTCGC CGTCGGTACGTACCAGATCTTGAAGCCCGCGTCAAATCGGTACGGGAGGC TGCGGAGCGTATGGCATTTAATATGCCTGTACAGGGTACTGCAGCTGACC TCATGAAACTGGCAATGGTCAAGCTTTTCCCGCGCTTGGAGGAAATGGGC GCACGTATGCTTCTGCAGGTCCATGACGAGCTGGTGTTAGAAGCCCCTAA GGAGCGCGCCGAAGCTGTCGCGCGCCTCGCTAAAGAAGTGATGGAGGGCG TTTACCCATTGGCCGTACCCCTCGAAGTGGAGGTCGGTATTGGAGAAGAT TGGTTATCTGCAAAGGAAGCGGCCGC. SEQ ID NO. 168, amino acid sequence of Mutant ID 37 (OptiTaq KlenTaq) MGSLLHEFGLLESPKALEEAPWPPPEGAFVGFVLSRKEPMWADLLALAAA RGGRVHRAPEPYKALRDLKEARGLLAKDLSVLALREGLGLPPGDDPMLLA YLLDPSNTTPEGVARRYGGEWTEEAGERAALSERLFANLWGRLEGEERLL WLYREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEETARLEAEVERL AGHPFNLNSRDQLERVLEDELGLPAIGKTEKTGKRSTSAAVLEALREAHP IVEKILQYRELTKLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSS DPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQIELRVLAHLSGDEN LIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHR LSQELAIPYEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRR RYVPDLEARVKSVREAAERMAFNMPVQGTAADLMKLAMVKLFPRLEEMGA RMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDW LSAKEAA. SEQ ID NO. 169, nucleotide sequence of Mutant ID 38 (A661E, I665W, F667L KlenTaq) CATATGGGTTCACTGCTTCATGAATTCGGTCTGTTAGAGTCTCCTAAAGC ACTCGAAGAGGCACCGTGGCCGCCCCCAGAAGGTGCTTTTGTTGGCTTCG TACTTTCCCGTAAGGAGCCTATGTGGGCAGATCTTCTGGCTTTAGCGGCT GCACGCGGTGGCCGTGTTCACCGGGCCCCTGAGCCATACAAAGCGTTACG TGATCTGAAGGAAGCACGTGGCTTGCTGGCAAAAGACCTTTCTGTTTTGG CCCTGCGCGAGGGTCTTGGACTGCCGCCAGGCGACGATCCCATGTTATTG GCCTATCTGTTAGACCCTAGCAATACCACACCTGAAGGGGTCGCTCGTCG GTATGGCGGTGAATGGACTGAGGAAGCCGGAGAGCGCGCCGCATTGTCCG AACGGCTCTTTGCAAACTTATGGGGTCGTCTGGAAGGGGAGGAACGTCTG TTATGGTTGTATCGGGAAGTCGAACGTCCTCTTTCGGCCGTATTAGCGCA TATGGAGGCAACAGGTGTGCGTTTAGATGTCGCGTACCTTCGGGCCTTAT CACTGGAAGTTGCAGAGGAAATCGCCCGTCTCGAGGCTGAAGTGTTCCGG TTGGCCGGTCACCCGTTTAACCTCAACTCCCGTGACCAGCTGGAACGCGT TTTATTCGATGAGCTTGGGCTTCCCGCAATTGGCAAAACCGAAAAGACTG GCAAACGCAGTACGAGCGCTGCCGTCCTTGAGGCACTCCGCGAGGCTCAC CCTATTGTAGAAAAGATCCTGCAATACCGTGAGTTGACGAAGCTTAAAAG CACTTATATTGATCCTCTCCCGGATCTGATCCATCCTCGTACCGGCCGCT TGCACACACGTTTCAACCAGACGGCGACTGCAACCGGCCGTCTGTCTAGC TCGGATCCAAATCTCCAGAACATTCCGGTCCGTACACCCTTGGGCCAACG TATCCGCCGGGCGTTTATCGCTGAGGAAGGATGGTTACTGGTCGCATTGG ACTACTCGCAGATTGAGCTGCGCGTCCTCGCACATCTCTCTGGTGACGAA AATTTAATCCGCGTGTTTCAAGAGGGGCGTGATATTCACACAGAAACTGC CTCATGGATGTTCGGTGTCCCACGTGAAGCAGTGGATCCTTTGATGCGCC GTGAAGCTAAAACATGGAATTTGGGAGTGCTGTACGGAATGAGCGCTCAT CGCTTGAGTCAGGAACTGGCAATCCCCTACGAGGAAGCGCAGGCATTCAT CGAACGTTACTTTCAATCGTTTCCGAAAGTTCGCGCATGGATCGAGAAGA CGCTCGAGGAAGGTCGTCGTCGGGGCTATGTCGAAACTCTGTTTGGTCGC CGTCGGTACGTACCAGATCTTGAAGCCCGCGTCAAATCGGTACGGGAGGC TGCGGAGCGTATGGCATTTAATATGCCTGTACAGGGTACTGCAGCTGACC TCATGAAACTGGCAATGGTCAAGCTTTTCCCGCGCTTGGAGGAAATGGGC GCACGTATGCTTCTGCAGGTCCATGACGAGCTGGTGTTAGAAGCCCCTAA GGAGCGCGCCGAAGCTGTCGCGCGCCTCGCTAAAGAAGTGATGGAGGGCG TTTACCCATTGGCCGTACCCCTCGAAGTGGAGGTCGGTATTGGAGAAGAT TGGTTATCTGCAAAGGAAGCGGCCGC. SEQ ID NO. 170, amino acid sequence of Mutant ID 38 (A661E, I665W, F667L KlenTaq) MGSLLHEFGLLESPKALEEAPWPPPEGAFVGFVLSRKEPMWADLLALAAA RGGRVHRAPEPYKALRDLKEARGLLAKDLSVLALREGLGLPPGDDPMLLA YLLDPSNTTPEGVARRYGGEWTEEAGERAALSERLFANLWGRLEGEERLL WLYREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEETARLEAEVERL AGHPFNLNSRDQLERVLEDELGLPAIGKTEKTGKRSTSAAVLEALREAHP IVEKILQYRELTKLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSS DPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQIELRVLAHLSGDEN LIRVFQEGRDIHTETASWMFGVPREAVDPLMRREAKTWNLGVLYGMSAHR LSQELAIPYEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRR RYVPDLEARVKSVREAAERMAFNMPVQGTAADLMKLAMVKLFPRLEEMGA RMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDW LSAKEAA. SEQ ID NO. 171, nucleotide sequence of Mutant ID 39 (V783F KlenTaq) CATATGGGTTCACTGCTTCATGAATTCGGTCTGTTAGAGTCTCCTAAAGC ACTCGAAGAGGCACCGTGGCCGCCCCCAGAAGGTGCTTTTGTTGGCTTCG TACTTTCCCGTAAGGAGCCTATGTGGGCAGATCTTCTGGCTTTAGCGGCT GCACGCGGTGGCCGTGTTCACCGGGCCCCTGAGCCATACAAAGCGTTACG TGATCTGAAGGAAGCACGTGGCTTGCTGGCAAAAGACCTTTCTGTTTTGG CCCTGCGCGAGGGTCTTGGACTGCCGCCAGGCGACGATCCCATGTTATTG GCCTATCTGTTAGACCCTAGCAATACCACACCTGAAGGGGTCGCTCGTCG GTATGGCGGTGAATGGACTGAGGAAGCCGGAGAGCGCGCCGCATTGTCCG AACGGCTCTTTGCAAACTTATGGGGTCGTCTGGAAGGGGAGGAACGTCTG TTATGGTTGTATCGGGAAGTCGAACGTCCTCTTTCGGCCGTATTAGCGCA TATGGAGGCAACAGGTGTGCGTTTAGATGTCGCGTACCTTCGGGCCTTAT CACTGGAAGTTGCAGAGGAAATCGCCCGTCTCGAGGCTGAAGTGTTCCGG TTGGCCGGTCACCCGTTTAACCTCAACTCCCGTGACCAGCTGGAACGCGT TTTATTCGATGAGCTTGGGCTTCCCGCAATTGGCAAAACCGAAAAGACTG GCAAACGCAGTACGAGCGCTGCCGTCCTTGAGGCACTCCGCGAGGCTCAC CCTATTGTAGAAAAGATCCTGCAATACCGTGAGTTGACGAAGCTTAAAAG CACTTATATTGATCCTCTCCCGGATCTGATCCATCCTCGTACCGGCCGCT TGCACACACGTTTCAACCAGACGGCGACTGCAACCGGCCGTCTGTCTAGC TCGGATCCAAATCTCCAGAACATTCCGGTCCGTACACCCTTGGGCCAACG TATCCGCCGGGCGTTTATCGCTGAGGAAGGATGGTTACTGGTCGCATTGG ACTACTCGCAGATTGAGCTGCGCGTCCTCGCACATCTCTCTGGTGACGAA AATTTAATCCGCGTGTTTCAAGAGGGGCGTGATATTCACACAGAAACTGC CTCATGGATGTTCGGTGTCCCACGTGAAGCAGTGGATCCTTTGATGCGCC GTGCAGCTAAAACAATTAATTTTGGAGTGCTGTACGGAATGAGCGCTCAT CGCTTGAGTCAGGAACTGGCAATCCCCTACGAGGAAGCGCAGGCATTCAT CGAACGTTACTTTCAATCGTTTCCGAAAGTTCGCGCATGGATCGAGAAGA CGCTCGAGGAAGGTCGTCGTCGGGGCTATGTCGAAACTCTGTTTGGTCGC CGTCGGTACGTACCAGATCTTGAAGCCCGCGTCAAATCGGTACGGGAGGC
TGCGGAGCGTATGGCATTTAATATGCCTGTACAGGGTACTGCAGCTGACC TCATGAAACTGGCAATGGTCAAGCTTTTCCCGCGCTTGGAGGAAATGGGC GCACGTATGCTTCTGCAGTTCCATGACGAGCTGGTGTTAGAAGCCCCTAA GGAGCGCGCCGAAGCTGTCGCGCGCCTCGCTAAAGAAGTGATGGAGGGCG TTTACCCATTGGCCGTACCCCTCGAAGTGGAGGTCGGTATTGGAGAAGAT TGGTTATCTGCAAAGGAAGCGGCCGC. SEQ ID NO. 172, amino acid sequence of Mutant ID 39 (V783F KlenTaq) MGSLLHEFGLLESPKALEEAPWPPPEGAFVGFVLSRKEPMWADLLALAAA RGGRVHRAPEPYKALRDLKEARGLLAKDLSVLALREGLGLPPGDDPMLLA YLLDPSNTTPEGVARRYGGEWTEEAGERAALSERLFANLWGRLEGEERLL WLYREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEEIARLEAEVERL AGHPFNLNSRDQLERVLFDELGLPAIGKTEKTGKRSTSAAVLEALREAHP IVEKILQYRELTKLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSS DPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQIELRVLAHLSGDEN LIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHR LSQELAIPYEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRR RYVPDLEARVKSVREAAERMAFNMPVQGTAADLMKLAMVKLFPRLEEMGA RMLLQLHDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDW LSAKEAA. SEQ ID NO. 173, nucleotide sequence of Mutant ID 40 (H784Q KlenTaq) CATATGGGTTCACTGCTTCATGAATTCGGTCTGTTAGAGTCTCCTAAAGC ACTCGAAGAGGCACCGTGGCCGCCCCCAGAAGGTGCTTTTGTTGGCTTCG TACTTTCCCGTAAGGAGCCTATGTGGGCAGATCTTCTGGCTTTAGCGGCT GCACGCGGTGGCCGTGTTCACCGGGCCCCTGAGCCATACAAAGCGTTACG TGATCTGAAGGAAGCACGTGGCTTGCTGGCAAAAGACCTTTCTGTTTTGG CCCTGCGCGAGGGTCTTGGACTGCCGCCAGGCGACGATCCCATGTTATTG GCCTATCTGTTAGACCCTAGCAATACCACACCTGAAGGGGTCGCTCGTCG GTATGGCGGTGAATGGACTGAGGAAGCCGGAGAGCGCGCCGCATTGTCCG AACGGCTCTTTGCAAACTTATGGGGTCGTCTGGAAGGGGAGGAACGTCTG TTATGGTTGTATCGGGAAGTCGAACGTCCTCTTTCGGCCGTATTAGCGCA TATGGAGGCAACAGGTGTGCGTTTAGATGTCGCGTACCTTCGGGCCTTAT CACTGGAAGTTGCAGAGGAAATCGCCCGTCTCGAGGCTGAAGTGTTCCGG TTGGCCGGTCACCCGTTTAACCTCAACTCCCGTGACCAGCTGGAACGCGT TTTATTCGATGAGCTTGGGCTTCCCGCAATTGGCAAAACCGAAAAGACTG GCAAACGCAGTACGAGCGCTGCCGTCCTTGAGGCACTCCGCGAGGCTCAC CCTATTGTAGAAAAGATCCTGCAATACCGTGAGTTGACGAAGCTTAAAAG CACTTATATTGATCCTCTCCCGGATCTGATCCATCCTCGTACCGGCCGCT TGCACACACGTTTCAACCAGACGGCGACTGCAACCGGCCGTCTGTCTAGC TCGGATCCAAATCTCCAGAACATTCCGGTCCGTACACCCTTGGGCCAACG TATCCGCCGGGCGTTTATCGCTGAGGAAGGATGGTTACTGGTCGCATTGG ACTACTCGCAGATTGAGCTGCGCGTCCTCGCACATCTCTCTGGTGACGAA AATTTAATCCGCGTGTTTCAAGAGGGGCGTGATATTCACACAGAAACTGC CTCATGGATGTTCGGTGTCCCACGTGAAGCAGTGGATCCTTTGATGCGCC GTGCAGCTAAAACAATTAATTTTGGAGTGCTGTACGGAATGAGCGCTCAT CGCTTGAGTCAGGAACTGGCAATCCCCTACGAGGAAGCGCAGGCATTCAT CGAACGTTACTTTCAATCGTTTCCGAAAGTTCGCGCATGGATCGAGAAGA CGCTCGAGGAAGGTCGTCGTCGGGGCTATGTCGAAACTCTGTTTGGTCGC CGTCGGTACGTACCAGATCTTGAAGCCCGCGTCAAATCGGTACGGGAGGC TGCGGAGCGTATGGCATTTAATATGCCTGTACAGGGTACTGCAGCTGACC TCATGAAACTGGCAATGGTCAAGCTTTTCCCGCGCTTGGAGGAAATGGGC GCACGTATGCTTCTGCAGGTCCAGGACGAGCTGGTGTTAGAAGCCCCTAA GGAGCGCGCCGAAGCTGTCGCGCGCCTCGCTAAAGAAGTGATGGAGGGCG TTTACCCATTGGCCGTACCCCTCGAAGTGGAGGTCGGTATTGGAGAAGAT TGGTTATCTGCAAAGGAAGCGGCCGC. SEQ ID NO. 174, amino acid sequence of Mutant ID 40 (H784Q KlenTaq) MGSLLHEFGLLESPKALEEAPWPPPEGAFVGFVLSRKEPMWADLLALAAA RGGRVHRAPEPYKALRDLKEARGLLAKDLSVLALREGLGLPPGDDPMLLA YLLDPSNTTPEGVARRYGGEWTEEAGERAALSERLFANLWGRLEGEERLL WLYREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEETARLEAEVERL AGHPFNLNSRDQLERVLEDELGLPAIGKTEKTGKRSTSAAVLEALREAHP IVEKILQYRELTKLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSS DPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQIELRVLAHLSGDEN LIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHR LSQELAIPYEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRR RYVPDLEARVKSVREAAERMAFNMPVQGTAADLMKLAMVKLFPRLEEMGA RMLLQVQDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDW LSAKEAA. SEQ ID NO. 175, nucleotide sequence of Mutant ID 41 (V783L H784Q KlenTaq) CATATGGGTTCACTGCTTCATGAATTCGGTCTGTTAGAGTCTCCTAAAGC ACTCGAAGAGGCACCGTGGCCGCCCCCAGAAGGTGCTTTTGTTGGCTTCG TACTTTCCCGTAAGGAGCCTATGTGGGCAGATCTTCTGGCTTTAGCGGCT GCACGCGGTGGCCGTGTTCACCGGGCCCCTGAGCCATACAAAGCGTTACG TGATCTGAAGGAAGCACGTGGCTTGCTGGCAAAAGACCTTTCTGTTTTGG CCCTGCGCGAGGGTCTTGGACTGCCGCCAGGCGACGATCCCATGTTATTG GCCTATCTGTTAGACCCTAGCAATACCACACCTGAAGGGGTCGCTCGTCG GTATGGCGGTGAATGGACTGAGGAAGCCGGAGAGCGCGCCGCATTGTCCG AACGGCTCTTTGCAAACTTATGGGGTCGTCTGGAAGGGGAGGAACGTCTG TTATGGTTGTATCGGGAAGTCGAACGTCCTCTTTCGGCCGTATTAGCGCA TATGGAGGCAACAGGTGTGCGTTTAGATGTCGCGTACCTTCGGGCCTTAT CACTGGAAGTTGCAGAGGAAATCGCCCGTCTCGAGGCTGAAGTGTTCCGG TTGGCCGGTCACCCGTTTAACCTCAACTCCCGTGACCAGCTGGAACGCGT TTTATTCGATGAGCTTGGGCTTCCCGCAATTGGCAAAACCGAAAAGACTG GCAAACGCAGTACGAGCGCTGCCGTCCTTGAGGCACTCCGCGAGGCTCAC CCTATTGTAGAAAAGATCCTGCAATACCGTGAGTTGACGAAGCTTAAAAG CACTTATATTGATCCTCTCCCGGATCTGATCCATCCTCGTACCGGCCGCT TGCACACACGTTTCAACCAGACGGCGACTGCAACCGGCCGTCTGTCTAGC TCGGATCCAAATCTCCAGAACATTCCGGTCCGTACACCCTTGGGCCAACG TATCCGCCGGGCGTTTATCGCTGAGGAAGGATGGTTACTGGTCGCATTGG ACTACTCGCAGATTGAGCTGCGCGTCCTCGCACATCTCTCTGGTGACGAA AATTTAATCCGCGTGTTTCAAGAGGGGCGTGATATTCACACAGAAACTGC CTCATGGATGTTCGGTGTCCCACGTGAAGCAGTGGATCCTTTGATGCGCC GTGCAGCTAAAACAATTAATTTTGGAGTGCTGTACGGAATGAGCGCTCAT CGCTTGAGTCAGGAACTGGCAATCCCCTACGAGGAAGCGCAGGCATTCAT CGAACGTTACTTTCAATCGTTTCCGAAAGTTCGCGCATGGATCGAGAAGA CGCTCGAGGAAGGTCGTCGTCGGGGCTATGTCGAAACTCTGTTTGGTCGC CGTCGGTACGTACCAGATCTTGAAGCCCGCGTCAAATCGGTACGGGAGGC TGCGGAGCGTATGGCATTTAATATGCCTGTACAGGGTACTGCAGCTGACC TCATGAAACTGGCAATGGTCAAGCTTTTCCCGCGCTTGGAGGAAATGGGC GCACGTATGCTTCTGCAGCTGCAGGACGAGCTGGTGTTAGAAGCCCCTAA GGAGCGCGCCGAAGCTGTCGCGCGCCTCGCTAAAGAAGTGATGGAGGGCG TTTACCCATTGGCCGTACCCCTCGAAGTGGAGGTCGGTATTGGAGAAGAT TGGTTATCTGCAAAGGAAGCGGCCGC. SEQ ID NO. 176, amino acid sequence of Mutant ID 41 (V783L H784Q KlenTaq) MGSLLHEFGLLESPKALEEAPWPPPEGAFVGFVLSRKEPMWADLLALAAA RGGRVHRAPEPYKALRDLKEARGLLAKDLSVLALREGLGLPPGDDPMLLA YLLDPSNTTPEGVARRYGGEWTEEAGERAALSERLFANLWGRLEGEERLL WLYREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEETARLEAEVERL AGHPFNLNSRDQLERVLEDELGLPAIGKTEKTGKRSTSAAVLEALREAHP IVEKILQYRELTKLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSS DPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQIELRVLAHLSGDEN LIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHR LSQELAIPYEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRR RYVPDLEARVKSVREAAERMAFNMPVQGTAADLMKLAMVKLFPRLEEMGA RMLLQLHDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDW LSAKEAA. SEQ ID NO. 177, nucleotide sequence of Mutant ID 42 (H784S KlenTaq) CATATGGGTTCACTGCTTCATGAATTCGGTCTGTTAGAGTCTCCTAAAGC ACTCGAAGAGGCACCGTGGCCGCCCCCAGAAGGTGCTTTTGTTGGCTTCG TACTTTCCCGTAAGGAGCCTATGTGGGCAGATCTTCTGGCTTTAGCGGCT GCACGCGGTGGCCGTGTTCACCGGGCCCCTGAGCCATACAAAGCGTTACG TGATCTGAAGGAAGCACGTGGCTTGCTGGCAAAAGACCTTTCTGTTTTGG CCCTGCGCGAGGGTCTTGGACTGCCGCCAGGCGACGATCCCATGTTATTG GCCTATCTGTTAGACCCTAGCAATACCACACCTGAAGGGGTCGCTCGTCG GTATGGCGGTGAATGGACTGAGGAAGCCGGAGAGCGCGCCGCATTGTCCG AACGGCTCTTTGCAAACTTATGGGGTCGTCTGGAAGGGGAGGAACGTCTG TTATGGTTGTATCGGGAAGTCGAACGTCCTCTTTCGGCCGTATTAGCGCA
TATGGAGGCAACAGGTGTGCGTTTAGATGTCGCGTACCTTCGGGCCTTAT CACTGGAAGTTGCAGAGGAAATCGCCCGTCTCGAGGCTGAAGTGTTCCGG TTGGCCGGTCACCCGTTTAACCTCAACTCCCGTGACCAGCTGGAACGCGT TTTATTCGATGAGCTTGGGCTTCCCGCAATTGGCAAAACCGAAAAGACTG GCAAACGCAGTACGAGCGCTGCCGTCCTTGAGGCACTCCGCGAGGCTCAC CCTATTGTAGAAAAGATCCTGCAATACCGTGAGTTGACGAAGCTTAAAAG CACTTATATTGATCCTCTCCCGGATCTGATCCATCCTCGTACCGGCCGCT TGCACACACGTTTCAACCAGACGGCGACTGCAACCGGCCGTCTGTCTAGC TCGGATCCAAATCTCCAGAACATTCCGGTCCGTACACCCTTGGGCCAACG TATCCGCCGGGCGTTTATCGCTGAGGAAGGATGGTTACTGGTCGCATTGG ACTACTCGCAGATTGAGCTGCGCGTCCTCGCACATCTCTCTGGTGACGAA AATTTAATCCGCGTGTTTCAAGAGGGGCGTGATATTCACACAGAAACTGC CTCATGGATGTTCGGTGTCCCACGTGAAGCAGTGGATCCTTTGATGCGCC GTGCAGCTAAAACAATTAATTTTGGAGTGCTGTACGGAATGAGCGCTCAT CGCTTGAGTCAGGAACTGGCAATCCCCTACGAGGAAGCGCAGGCATTCAT CGAACGTTACTTTCAATCGTTTCCGAAAGTTCGCGCATGGATCGAGAAGA CGCTCGAGGAAGGTCGTCGTCGGGGCTATGTCGAAACTCTGTTTGGTCGC CGTCGGTACGTACCAGATCTTGAAGCCCGCGTCAAATCGGTACGGGAGGC TGCGGAGCGTATGGCATTTAATATGCCTGTACAGGGTACTGCAGCTGACC TCATGAAACTGGCAATGGTCAAGCTTTTCCCGCGCTTGGAGGAAATGGGC GCACGTATGCTTCTGCAGGTCAGCGACGAGCTGGTGTTAGAAGCCCCTAA GGAGCGCGCCGAAGCTGTCGCGCGCCTCGCTAAAGAAGTGATGGAGGGCG TTTACCCATTGGCCGTACCCCTCGAAGTGGAGGTCGGTATTGGAGAAGAT TGGTTATCTGCAAAGGAAGCGGCCGC. SEQ ID NO. 178, amino acid sequence of Mutant ID 42 (H784S KlenTaq) MGSLLHEFGLLESPKALEEAPWPPPEGAFVGFVLSRKEPMWADLLALAAA RGGRVHRAPEPYKALRDLKEARGLLAKDLSVLALREGLGLPPGDDPMLLA YLLDPSNTTPEGVARRYGGEWTEEAGERAALSERLFANLWGRLEGEERLL WLYREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEETARLEAEVERL AGHPFNLNSRDQLERVLEDELGLPAIGKTEKTGKRSTSAAVLEALREAHP IVEKILQYRELTKLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSS DPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQIELRVLAHLSGDEN LIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHR LSQELAIPYEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRR RYVPDLEARVKSVREAAERMAFNMPVQGTAADLMKLAMVKLFPRLEEMGA RMLLQVSDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDW LSAKEAA. SEQ ID NO. 179, nucleotide sequence of Mutant ID 43 (H784Y KlenTaq) CATATGGGTTCACTGCTTCATGAATTCGGTCTGTTAGAGTCTCCTAAAGC ACTCGAAGAGGCACCGTGGCCGCCCCCAGAAGGTGCTTTTGTTGGCTTCG TACTTTCCCGTAAGGAGCCTATGTGGGCAGATCTTCTGGCTTTAGCGGCT GCACGCGGTGGCCGTGTTCACCGGGCCCCTGAGCCATACAAAGCGTTACG TGATCTGAAGGAAGCACGTGGCTTGCTGGCAAAAGACCTTTCTGTTTTGG CCCTGCGCGAGGGTCTTGGACTGCCGCCAGGCGACGATCCCATGTTATTG GCCTATCTGTTAGACCCTAGCAATACCACACCTGAAGGGGTCGCTCGTCG GTATGGCGGTGAATGGACTGAGGAAGCCGGAGAGCGCGCCGCATTGTCCG AACGGCTCTTTGCAAACTTATGGGGTCGTCTGGAAGGGGAGGAACGTCTG TTATGGTTGTATCGGGAAGTCGAACGTCCTCTTTCGGCCGTATTAGCGCA TATGGAGGCAACAGGTGTGCGTTTAGATGTCGCGTACCTTCGGGCCTTAT CACTGGAAGTTGCAGAGGAAATCGCCCGTCTCGAGGCTGAAGTGTTCCGG TTGGCCGGTCACCCGTTTAACCTCAACTCCCGTGACCAGCTGGAACGCGT TTTATTCGATGAGCTTGGGCTTCCCGCAATTGGCAAAACCGAAAAGACTG GCAAACGCAGTACGAGCGCTGCCGTCCTTGAGGCACTCCGCGAGGCTCAC CCTATTGTAGAAAAGATCCTGCAATACCGTGAGTTGACGAAGCTTAAAAG CACTTATATTGATCCTCTCCCGGATCTGATCCATCCTCGTACCGGCCGCT TGCACACACGTTTCAACCAGACGGCGACTGCAACCGGCCGTCTGTCTAGC TCGGATCCAAATCTCCAGAACATTCCGGTCCGTACACCCTTGGGCCAACG TATCCGCCGGGCGTTTATCGCTGAGGAAGGATGGTTACTGGTCGCATTGG ACTACTCGCAGATTGAGCTGCGCGTCCTCGCACATCTCTCTGGTGACGAA AATTTAATCCGCGTGTTTCAAGAGGGGCGTGATATTCACACAGAAACTGC CTCATGGATGTTCGGTGTCCCACGTGAAGCAGTGGATCCTTTGATGCGCC GTGCAGCTAAAACAATTAATTTTGGAGTGCTGTACGGAATGAGCGCTCAT CGCTTGAGTCAGGAACTGGCAATCCCCTACGAGGAAGCGCAGGCATTCAT CGAACGTTACTTTCAATCGTTTCCGAAAGTTCGCGCATGGATCGAGAAGA CGCTCGAGGAAGGTCGTCGTCGGGGCTATGTCGAAACTCTGTTTGGTCGC CGTCGGTACGTACCAGATCTTGAAGCCCGCGTCAAATCGGTACGGGAGGC TGCGGAGCGTATGGCATTTAATATGCCTGTACAGGGTACTGCAGCTGACC TCATGAAACTGGCAATGGTCAAGCTTTTCCCGCGCTTGGAGGAAATGGGC GCACGTATGCTTCTGCAGGTCTATGACGAGCTGGTGTTAGAAGCCCCTAA GGAGCGCGCCGAAGCTGTCGCGCGCCTCGCTAAAGAAGTGATGGAGGGCG TTTACCCATTGGCCGTACCCCTCGAAGTGGAGGTCGGTATTGGAGAAGAT TGGTTATCTGCAAAGGAAGCGGCCGC. SEQ ID NO. 180, amino acid sequence of Mutant ID 43 (H784Y KlenTaq) MGSLLHEFGLLESPKALEEAPWPPPEGAFVGFVLSRKEPMWADLLALAAA RGGRVHRAPEPYKALRDLKEARGLLAKDLSVLALREGLGLPPGDDPMLLA YLLDPSNTTPEGVARRYGGEWTEEAGERAALSERLFANLWGRLEGEERLL WLYREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEETARLEAEVERL AGHPFNLNSRDQLERVLEDELGLPAIGKTEKTGKRSTSAAVLEALREAHP IVEKILQYRELTKLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSS DPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQIELRVLAHLSGDEN LIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHR LSQELAIPYEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRR RYVPDLEARVKSVREAAERMAFNMPVQGTAADLMKLAMVKLFPRLEEMGA RMLLQVYDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDW LSAKEAA.
INCORPORATION BY REFERENCE
[0236] All publications, patents, patent applications, Accession No. data mentioned herein are hereby incorporated by reference in their entirety as if each individual publication, patent, patent application or Accession No. data was specifically and individually indicated to be incorporated by reference. In the case of Accession No. data citations and references, the corresponding DNA polymerase amino acid and nucleotide sequences are incorporated herein by reference as if such sequences are disclosed by way of a SEQ ID NO. In case of conflict, the present application, including any definitions herein, will control.
[0237] The terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting. With respect to the use of substantially, any plural and/or singular terms herein, those having skill in the art can translate from the plural as is appropriate to the context and/or application. The various singular/plural permutations may be expressly set forth herein for the sake of clarity.
[0238] While the present invention has been described with reference to certain embodiments, it will be understood by those skilled in the art that various changes may be made and equivalents may be substituted without departing from the scope of the present invention. In addition, many modifications may be made to adapt a particular situation or material to the teachings of the present invention without departing from its scope. Therefore, it is intended that the present invention not be limited to the particular embodiments or examples disclosed, but that the present invention will include all embodiments falling within the scope of the appended claims.
Sequence CWU
1
1
1801832PRTArtificial SequenceTAQ DNA POLYMERASE PROTEIN SEQUENCE 1Met Arg
Gly Met Leu Pro Leu Phe Glu Pro Lys Gly Arg Val Leu Leu1 5
10 15Val Asp Gly His His Leu Ala Tyr
Arg Thr Phe His Ala Leu Lys Gly 20 25
30Leu Thr Thr Ser Arg Gly Glu Pro Val Gln Ala Val Tyr Gly Phe
Ala 35 40 45Lys Ser Leu Leu Lys
Ala Leu Lys Glu Asp Gly Asp Ala Val Ile Val 50 55
60Val Phe Asp Ala Lys Ala Pro Ser Phe Arg His Glu Ala Tyr
Gly Gly65 70 75 80Tyr
Lys Ala Gly Arg Ala Pro Thr Pro Glu Asp Phe Pro Arg Gln Leu
85 90 95Ala Leu Ile Lys Glu Leu Val
Asp Leu Leu Gly Leu Ala Arg Leu Glu 100 105
110Val Pro Gly Tyr Glu Ala Asp Asp Val Leu Ala Ser Leu Ala
Lys Lys 115 120 125Ala Glu Lys Glu
Gly Tyr Glu Val Arg Ile Leu Thr Ala Asp Lys Asp 130
135 140Leu Tyr Gln Leu Leu Ser Asp Arg Ile His Val Leu
His Pro Glu Gly145 150 155
160Tyr Leu Ile Thr Pro Ala Trp Leu Trp Glu Lys Tyr Gly Leu Arg Pro
165 170 175Asp Gln Trp Ala Asp
Tyr Arg Ala Leu Thr Gly Asp Glu Ser Asp Asn 180
185 190Leu Pro Gly Val Lys Gly Ile Gly Glu Lys Thr Ala
Arg Lys Leu Leu 195 200 205Glu Glu
Trp Gly Ser Leu Glu Ala Leu Leu Lys Asn Leu Asp Arg Leu 210
215 220Lys Pro Ala Ile Arg Glu Lys Ile Leu Ala His
Met Asp Asp Leu Lys225 230 235
240Leu Ser Trp Asp Leu Ala Lys Val Arg Thr Asp Leu Pro Leu Glu Val
245 250 255Asp Phe Ala Lys
Arg Arg Glu Pro Asp Arg Glu Arg Leu Arg Ala Phe 260
265 270Leu Glu Arg Leu Glu Phe Gly Ser Leu Leu His
Glu Phe Gly Leu Leu 275 280 285Glu
Ser Pro Lys Ala Leu Glu Glu Ala Pro Trp Pro Pro Pro Glu Gly 290
295 300Ala Phe Val Gly Phe Val Leu Ser Arg Lys
Glu Pro Met Trp Ala Asp305 310 315
320Leu Leu Ala Leu Ala Ala Ala Arg Gly Gly Arg Val His Arg Ala
Pro 325 330 335Glu Pro Tyr
Lys Ala Leu Arg Asp Leu Lys Glu Ala Arg Gly Leu Leu 340
345 350Ala Lys Asp Leu Ser Val Leu Ala Leu Arg
Glu Gly Leu Gly Leu Pro 355 360
365Pro Gly Asp Asp Pro Met Leu Leu Ala Tyr Leu Leu Asp Pro Ser Asn 370
375 380Thr Thr Pro Glu Gly Val Ala Arg
Arg Tyr Gly Gly Glu Trp Thr Glu385 390
395 400Glu Ala Gly Glu Arg Ala Ala Leu Ser Glu Arg Leu
Phe Ala Asn Leu 405 410
415Trp Gly Arg Leu Glu Gly Glu Glu Arg Leu Leu Trp Leu Tyr Arg Glu
420 425 430Val Glu Arg Pro Leu Ser
Ala Val Leu Ala His Met Glu Ala Thr Gly 435 440
445Val Arg Leu Asp Val Ala Tyr Leu Arg Ala Leu Ser Leu Glu
Val Ala 450 455 460Glu Glu Ile Ala Arg
Leu Glu Ala Glu Val Phe Arg Leu Ala Gly His465 470
475 480Pro Phe Asn Leu Asn Ser Arg Asp Gln Leu
Glu Arg Val Leu Phe Asp 485 490
495Glu Leu Gly Leu Pro Ala Ile Gly Lys Thr Glu Lys Thr Gly Lys Arg
500 505 510Ser Thr Ser Ala Ala
Val Leu Glu Ala Leu Arg Glu Ala His Pro Ile 515
520 525Val Glu Lys Ile Leu Gln Tyr Arg Glu Leu Thr Lys
Leu Lys Ser Thr 530 535 540Tyr Ile Asp
Pro Leu Pro Asp Leu Ile His Pro Arg Thr Gly Arg Leu545
550 555 560His Thr Arg Phe Asn Gln Thr
Ala Thr Ala Thr Gly Arg Leu Ser Ser 565
570 575Ser Asp Pro Asn Leu Gln Asn Ile Pro Val Arg Thr
Pro Leu Gly Gln 580 585 590Arg
Ile Arg Arg Ala Phe Ile Ala Glu Glu Gly Trp Leu Leu Val Ala 595
600 605Leu Asp Tyr Ser Gln Ile Glu Leu Arg
Val Leu Ala His Leu Ser Gly 610 615
620Asp Glu Asn Leu Ile Arg Val Phe Gln Glu Gly Arg Asp Ile His Thr625
630 635 640Glu Thr Ala Ser
Trp Met Phe Gly Val Pro Arg Glu Ala Val Asp Pro 645
650 655Leu Met Arg Arg Ala Ala Lys Thr Ile Asn
Phe Gly Val Leu Tyr Gly 660 665
670Met Ser Ala His Arg Leu Ser Gln Glu Leu Ala Ile Pro Tyr Glu Glu
675 680 685Ala Gln Ala Phe Ile Glu Arg
Tyr Phe Gln Ser Phe Pro Lys Val Arg 690 695
700Ala Trp Ile Glu Lys Thr Leu Glu Glu Gly Arg Arg Arg Gly Tyr
Val705 710 715 720Glu Thr
Leu Phe Gly Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala Arg
725 730 735Val Lys Ser Val Arg Glu Ala
Ala Glu Arg Met Ala Phe Asn Met Pro 740 745
750Val Gln Gly Thr Ala Ala Asp Leu Met Lys Leu Ala Met Val
Lys Leu 755 760 765Phe Pro Arg Leu
Glu Glu Met Gly Ala Arg Met Leu Leu Gln Val His 770
775 780Asp Glu Leu Val Leu Glu Ala Pro Lys Glu Arg Ala
Glu Ala Val Ala785 790 795
800Arg Leu Ala Lys Glu Val Met Glu Gly Val Tyr Pro Leu Ala Val Pro
805 810 815Leu Glu Val Glu Val
Gly Ile Gly Glu Asp Trp Leu Ser Ala Lys Glu 820
825 83022626DNAArtificial SequenceTAQ DNA POLYMERASE DNA
SEQUENCE 2aagctcagat ctacctgcct gagggcgtcc ggttccagct ggcccttccc
gagggggaga 60gggaggcgtt tctaaaagcc cttcaggacg ctacccgggg gcgggtggtg
gaagggtaac 120atgaggggga tgctgcccct ctttgagccc aagggccggg tcctcctggt
ggacggccac 180cacctggcct accgcacctt ccacgccctg aagggcctca ccaccagccg
gggggagccg 240gtgcaggcgg tctacggctt cgccaagagc ctcctcaagg ccctcaagga
ggacggggac 300gcggtgatcg tggtctttga cgccaaggcc ccctccttcc gccacgaggc
ctacgggggg 360tacaaggcgg gccgggcccc cacgccggag gactttcccc ggcaactcgc
cctcatcaag 420gagctggtgg acctcctggg gctggcgcgc ctcgaggtcc cgggctacga
ggcggacgac 480gtcctggcca gcctggccaa gaaggcggaa aaggagggct acgaggtccg
catcctcacc 540gccgacaaag acctttacca gctcctttcc gaccgcatcc acgtcctcca
ccccgagggg 600tacctcatca ccccggcctg gctttgggaa aagtacggcc tgaggcccga
ccagtgggcc 660gactaccggg ccctgaccgg ggacgagtcc gacaaccttc ccggggtcaa
gggcatcggg 720gagaagacgg cgaggaagct tctggaggag tgggggagcc tggaagccct
cctcaagaac 780ctggaccggc tgaagcccgc catccgggag aagatcctgg cccacatgga
cgatctgaag 840ctctcctggg acctggccaa ggtgcgcacc gacctgcccc tggaggtgga
cttcgccaaa 900aggcgggagc ccgaccggga gaggcttagg gcctttctgg agaggcttga
gtttggcagc 960ctcctccacg agttcggcct tctggaaagc cccaaggccc tggaggaggc
cccctggccc 1020ccgccggaag gggccttcgt gggctttgtg ctttcccgca aggagcccat
gtgggccgat 1080cttctggccc tggccgccgc cagggggggc cgggtccacc gggcccccga
gccttataaa 1140gccctcaggg acctgaagga ggcgcggggg cttctcgcca aagacctgag
cgttctggcc 1200ctgagggaag gccttggcct cccgcccggc gacgacccca tgctcctcgc
ctacctcctg 1260gacccttcca acaccacccc cgagggggtg gcccggcgct acggcgggga
gtggacggag 1320gaggcggggg agcgggccgc cctttccgag aggctcttcg ccaacctgtg
ggggaggctt 1380gagggggagg agaggctcct ttggctttac cgggaggtgg agaggcccct
ttccgctgtc 1440ctggcccaca tggaggccac gggggtgcgc ctggacgtgg cctatctcag
ggccttgtcc 1500ctggaggtgg ccgaggagat cgcccgcctc gaggccgagg tcttccgcct
ggccggccac 1560cccttcaacc tcaactcccg ggaccagctg gaaagggtcc tctttgacga
gctagggctt 1620cccgccatcg gcaagacgga gaagaccggc aagcgctcca ccagcgccgc
cgtcctggag 1680gccctccgcg aggcccaccc catcgtggag aagatcctgc agtaccggga
gctcaccaag 1740ctgaagagca cctacattga ccccttgccg gacctcatcc accccaggac
gggccgcctc 1800cacacccgct tcaaccagac ggccacggcc acgggcaggc taagtagctc
cgatcccaac 1860ctccagaaca tccccgtccg caccccgctt gggcagagga tccgccgggc
cttcatcgcc 1920gaggaggggt ggctattggt ggccctggac tatagccaga tagagctcag
ggtgctggcc 1980cacctctccg gcgacgagaa cctgatccgg gtcttccagg aggggcggga
catccacacg 2040gagaccgcca gctggatgtt cggcgtcccc cgggaggccg tggaccccct
gatgcgccgg 2100gcggccaaga ccatcaactt cggggtcctc tacggcatgt cggcccaccg
cctctcccag 2160gagctagcca tcccttacga ggaggcccag gccttcattg agcgctactt
tcagagcttc 2220cccaaggtgc gggcctggat tgagaagacc ctggaggagg gcaggaggcg
ggggtacgtg 2280gagaccctct tcggccgccg ccgctacgtg ccagacctag aggcccgggt
gaagagcgtg 2340cgggaggcgg ccgagcgcat ggccttcaac atgcccgtcc agggcaccgc
cgccgacctc 2400atgaagctgg ctatggtgaa gctcttcccc aggctggagg aaatgggggc
caggatgctc 2460cttcaggtcc acgacgagct ggtcctcgag gccccaaaag agagggcgga
ggccgtggcc 2520cggctggcca aggaggtcat ggagggggtg tatcccctgg ccgtgcccct
ggaggtggag 2580gtggggatag gggaggactg gctctccgcc aaggagtgat accacc
26263865DNAArtificial SequenceTAQ DNA POLYMERASE
CODON-OPTIMIZED SUB-FRAGMENT 1 3catatgcgtg gtatgctgcc gttgttcgag
cctaaaggcc gcgtactgtt agtcgatggt 60catcacttgg cctatcggac gttccatgca
ctcaaaggtc tgacgaccag tcgtggcgaa 120ccggtccagg ctgtttatgg tttcgctaag
tctttgctca aagcactgaa agaagacggg 180gacgcggtaa ttgttgtatt tgatgccaaa
gcaccgagct tccgccacga agcttatggt 240ggctacaagg caggacgcgc ccctacccca
gaagatttcc cccgtcagct ggcattaatt 300aaggagttag tagaccttct cggcttagcg
cgtctggaag ttccgggtta tgaggcggac 360gatgtccttg catccttggc taaaaaggcc
gaaaaagagg gctacgaagt ccgcatcttg 420acggcagaca aagatctgta ccagcttctg
tctgaccgta ttcatgtttt gcaccctgaa 480ggctacttaa tcactccggc ctggctctgg
gaaaagtacg gtctgcgtcc cgatcagtgg 540gcggattatc gggctttgac gggagatgag
agcgacaacc tgccaggagt taagggcatt 600ggtgaaaaaa ccgcacgtaa gctgcttgaa
gagtggggtt ccctggaagc cttgttaaaa 660aatctggatc gtctcaagcc cgcaattcgt
gaaaagatcc tggctcatat ggacgatctt 720aaattaagtt gggacctggc caaggtgcgc
accgatttac cgcttgaagt ggattttgca 780aaacgccgtg agccggaccg ggaacgttta
cgcgctttct tagagcgtct ggaattcggt 840tcactgcttc atgaattcgg tctgt
8654880DNAArtificial SequenceTAQ DNA
POLYMERASE CODON-OPTIMIZED SUB-FRAGMENT 2 4tcggttcact gcttcatgaa
ttcggtctgt tagagtctcc taaagcactc gaagaggcac 60cgtggccgcc cccagaaggt
gcttttgttg gcttcgtact ttcccgtaag gagcctatgt 120gggcagatct tctggcttta
gcggctgcac gcggtggccg tgttcaccgg gcccctgagc 180catacaaagc gttacgtgat
ctgaaggaag cacgtggctt gctggcaaaa gacctttctg 240ttttggccct gcgcgagggt
cttggactgc cgccaggcga cgatcccatg ttattggcct 300atctgttaga ccctagcaat
accacacctg aaggggtcgc tcgtcggtat ggcggtgaat 360ggactgagga agccggagag
cgcgccgcat tgtccgaacg gctctttgca aacttatggg 420gtcgtctgga aggggaggaa
cgtctgttat ggttgtatcg ggaagtcgaa cgtcctcttt 480cggccgtatt agcgcatatg
gaggcaacag gtgtgcgttt agatgtcgcg taccttcggg 540ccttatcact ggaagttgca
gaggaaatcg cccgtctcga ggctgaagtg ttccggttgg 600ccggtcaccc gtttaacctc
aactcccgtg accagctgga acgcgtttta ttcgatgagc 660ttgggcttcc cgcaattggc
aaaaccgaaa agactggcaa acgcagtacg agcgctgccg 720tccttgaggc actccgcgag
gctcacccta ttgtagaaaa gatcctgcaa taccgtgagt 780tgacgaagct taaaagcact
tatattgatc ctctcccgga tctgatccat cctcgtaccg 840gccgcttgca cacacgtttc
aaccagacgg cgactgcaac 8805822DNAArtificial
SequenceTAQ DNA POLYMERASE CODON-OPTIMIZED SUB-FRAGMENT 3
5cacacgtttc aaccagacgg cgactgcaac cggccgtctg tctagctcgg atccaaatct
60ccagaacatt ccggtccgta cacccttggg ccaacgtatc cgccgggcgt ttatcgctga
120ggaaggatgg ttactggtcg cattggacta ctcgcagatt gagctgcgcg tcctcgcaca
180tctctctggt gacgaaaatt taatccgcgt gtttcaagag gggcgtgata ttcacacaga
240aactgcctca tggatgttcg gtgtcccacg tgaagcagtg gatcctttga tgcgccgtgc
300agctaaaaca attaattttg gagtgctgta cggaatgagc gctcatcgct tgagtcagga
360actggcaatc ccctacgagg aagcgcaggc attcatcgaa cgttactttc aatcgtttcc
420gaaagttcgc gcatggatcg agaagacgct cgaggaaggt cgtcgtcggg gctatgtcga
480aactctgttt ggtcgccgtc ggtacgtacc agatcttgaa gcccgcgtca aatcggtacg
540ggaggctgcg gagcgtatgg catttaatat gcctgtacag ggtactgcag ctgacctcat
600gaaactggca atggtcaagc ttttcccgcg cttggaggaa atgggcgcac gtatgcttct
660gcaggtccat gacgagctgg tgttagaagc ccctaaggag cgcgccgaag ctgtcgcgcg
720cctcgctaaa gaagtgatgg agggcgttta cccattggcc gtacccctcg aagtggaggt
780cggtattgga gaagattggt tatctgcaaa ggaagcggcc gc
82262507DNAArtificial SequenceComplete codon-optimized Taq DNA polymerase
DNA Sequence ("OptiTaq") 6catatgcgtg gtatgctgcc gttgttcgag
cctaaaggcc gcgtactgtt agtcgatggt 60catcacttgg cctatcggac gttccatgca
ctcaaaggtc tgacgaccag tcgtggcgaa 120ccggtccagg ctgtttatgg tttcgctaag
tctttgctca aagcactgaa agaagacggg 180gacgcggtaa ttgttgtatt tgatgccaaa
gcaccgagct tccgccacga agcttatggt 240ggctacaagg caggacgcgc ccctacccca
gaagatttcc cccgtcagct ggcattaatt 300aaggagttag tagaccttct cggcttagcg
cgtctggaag ttccgggtta tgaggcggac 360gatgtccttg catccttggc taaaaaggcc
gaaaaagagg gctacgaagt ccgcatcttg 420acggcagaca aagatctgta ccagcttctg
tctgaccgta ttcatgtttt gcaccctgaa 480ggctacttaa tcactccggc ctggctctgg
gaaaagtacg gtctgcgtcc cgatcagtgg 540gcggattatc gggctttgac gggagatgag
agcgacaacc tgccaggagt taagggcatt 600ggtgaaaaaa ccgcacgtaa gctgcttgaa
gagtggggtt ccctggaagc cttgttaaaa 660aatctggatc gtctcaagcc cgcaattcgt
gaaaagatcc tggctcatat ggacgatctt 720aaattaagtt gggacctggc caaggtgcgc
accgatttac cgcttgaagt ggattttgca 780aaacgccgtg agccggaccg ggaacgttta
cgcgctttct tagagcgtct ggaattcggt 840tcactgcttc atgaattcgg tctgttagag
tctcctaaag cactcgaaga ggcaccgtgg 900ccgcccccag aaggtgcttt tgttggcttc
gtactttccc gtaaggagcc tatgtgggca 960gatcttctgg ctttagcggc tgcacgcggt
ggccgtgttc accgggcccc tgagccatac 1020aaagcgttac gtgatctgaa ggaagcacgt
ggcttgctgg caaaagacct ttctgttttg 1080gccctgcgcg agggtcttgg actgccgcca
ggcgacgatc ccatgttatt ggcctatctg 1140ttagacccta gcaataccac acctgaaggg
gtcgctcgtc ggtatggcgg tgaatggact 1200gaggaagccg gagagcgcgc cgcattgtcc
gaacggctct ttgcaaactt atggggtcgt 1260ctggaagggg aggaacgtct gttatggttg
tatcgggaag tcgaacgtcc tctttcggcc 1320gtattagcgc atatggaggc aacaggtgtg
cgtttagatg tcgcgtacct tcgggcctta 1380tcactggaag ttgcagagga aatcgcccgt
ctcgaggctg aagtgttccg gttggccggt 1440cacccgttta acctcaactc ccgtgaccag
ctggaacgcg ttttattcga tgagcttggg 1500cttcccgcaa ttggcaaaac cgaaaagact
ggcaaacgca gtacgagcgc tgccgtcctt 1560gaggcactcc gcgaggctca ccctattgta
gaaaagatcc tgcaataccg tgagttgacg 1620aagcttaaaa gcacttatat tgatcctctc
ccggatctga tccatcctcg taccggccgc 1680ttgcacacac gtttcaacca gacggcgact
gcaaccggcc gtctgtctag ctcggatcca 1740aatctccaga acattccggt ccgtacaccc
ttgggccaac gtatccgccg ggcgtttatc 1800gctgaggaag gatggttact ggtcgcattg
gactactcgc agattgagct gcgcgtcctc 1860gcacatctct ctggtgacga aaatttaatc
cgcgtgtttc aagaggggcg tgatattcac 1920acagaaactg cctcatggat gttcggtgtc
ccacgtgaag cagtggatcc tttgatgcgc 1980cgtgcagcta aaacaattaa ttttggagtg
ctgtacggaa tgagcgctca tcgcttgagt 2040caggaactgg caatccccta cgaggaagcg
caggcattca tcgaacgtta ctttcaatcg 2100tttccgaaag ttcgcgcatg gatcgagaag
acgctcgagg aaggtcgtcg tcggggctat 2160gtcgaaactc tgtttggtcg ccgtcggtac
gtaccagatc ttgaagcccg cgtcaaatcg 2220gtacgggagg ctgcggagcg tatggcattt
aatatgcctg tacagggtac tgcagctgac 2280ctcatgaaac tggcaatggt caagcttttc
ccgcgcttgg aggaaatggg cgcacgtatg 2340cttctgcagg tccatgacga gctggtgtta
gaagccccta aggagcgcgc cgaagctgtc 2400gcgcgcctcg ctaaagaagt gatggagggc
gtttacccat tggccgtacc cctcgaagtg 2460gaggtcggta ttggagaaga ttggttatct
gcaaaggaag cggccgc 2507753DNAArtificial SequenceSYNTHETIC
DNA OLIGONUCLEOTIDE 7aatgggcgca cgtatgcttc tgcagattca tgacgagctg
gtgttagaag ccc 53853DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 8gggcttctaa caccagctcg tcatgaatct gcagaagcat acgtgcgccc
att 53953DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE
9aatgggcgca cgtatgcttc tgcagttcca tgacgagctg gtgttagaag ccc
531053DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 10gggcttctaa
caccagctcg tcatggaact gcagaagcat acgtgcgccc att
531153DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 11gggcgcacgt
atgcttctgc aggtccagga cgagctggtg ttagaagccc cta
531253DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 12taggggcttc
taacaccagc tcgtcctgga cctgcagaag catacgtgcg ccc
531353DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 13caaccagacg
gcgactgcaa ccggccatct gtctagctcg gatccaaatc tcc
531453DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 14ggagatttgg
atccgagcta gacagatggc cggttgcagt cgccgtctgg ttg
531553DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 15tctgtctagc
tcggatccaa atctcaaaaa cattccggtc cgtacaccct tgg
531653DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 16ccaagggtgt
acggaccgga atgtttttga gatttggatc cgagctagac aga
531753DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 17gcgccgtgca
gctaaaacaa ttaattgggg agtgctgtac ggaatgagcg ctc
531853DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 18gagcgctcat
tccgtacagc actccccaat taattgtttt agctgcacgg cgc
531953DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 19cgtgtttcaa
gaggggcgtg atatttggac agaaactgcc tcatggatgt tcg
532053DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 20cgaacatcca
tgaggcagtt tctgtccaaa tatcacgccc ctcttgaaac acg
532153DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 21cgcattggac
tactcgcaga ttgagatgcg cgtcctcgca catctctctg gtg
532253DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 22caccagagag
atgtgcgagg acgcgcatct caatctgcga gtagtccaat gcg
532356DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 23ggtcgcattg
gactactcgc agattctgga gcgcgtcctc gcacatctct ctggtg
562456DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 24caccagagag
atgtgcgagg acgcgctcca gaatctgcga gtagtccaat gcgacc
562581DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 25cgtgaagcag
tggatccttt gatgcgccgt gaagctaaaa catggaattt gggagtgctg 60tacggaatga
gcgctcatcg c
812681DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 26gcgatgagcg
ctcattccgt acagcactcc caaattccat gttttagctt cacggcgcat 60caaaggatcc
actgcttcac g
812759DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 27ggaaatgggc
gcacgtatgc ttctgatcgt cttcgacgag ctggtgttag aagccccta
592859DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 28taggggcttc
taacaccagc tcgtcgaaga cgatcagaag catacgtgcg cccatttcc
592959DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 29ggaaatgggc
gcacgtatgc ttctgatttt gctggacgag ctggtgttag aagccccta
593059DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 30taggggcttc
taacaccagc tcgtccagca aaatcagaag catacgtgcg cccatttcc
593159DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 31ggaaatgggc
gcacgtatgc ttctgtcctt caacgacgag ctggtgttag aagccccta
593259DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 32taggggcttc
taacaccagc tcgtcgttga aggacagaag catacgtgcg cccatttcc
593359DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 33ggaaatgggc
gcacgtatgc ttctgccgtt acaggacgag ctggtgttag aagccccta
593459DNAArtificial Sequence
ggaaatgggcgcacgtatgcttctgCCGTTACAGgacgagctggtgttagaagccccta 34taggggcttc
taacaccagc tcgtcctgta acggcagaag catacgtgcg cccatttcc
593553DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 35gcgtatggca
tttaatatgc ctgtagcggg tactgcagct gacctcatga aac
533653DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 36gtttcatgag
gtcagctgca gtacccgcta caggcatatt aaatgccata cgc
533753DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 37acgtgaagca
gtggatcctt tgatgcaccg tgcagctaaa acaattaatt ttg
533853DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 38caaaattaat
tgttttagct gcacggtgca tcaaaggatc cactgcttca cgt
533951DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 39aatgggcgca
cgtatgcttc tgcagttcca ggacgagctg gtgttagaag c
514051DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 40gcttctaaca
ccagctcgtc ctggaactgc agaagcatac gtgcgcccat t
514153DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 41aatgggcgca
cgtatgcttc tgcagctgca ggacgagctg gtgttagaag ccc
534253DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 42gggcttctaa
caccagctcg tcctgcagct gcagaagcat acgtgcgccc att
534321DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 43gactttgctt
tccttggtca g
214422DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 44ggcttatatc
caacacttcg tg
224526DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(1)..(1)5'-FAM
(6-carboxyfluorescein)misc_feature(9)..(10)ZEN INTERNAL FLUORESCENCE
QUENCHER BETWEEN RESIDUES 9 AND 10.misc_feature(26)..(26)3'-IBFQ (
Iowa Black FQ (fluorescence quencher)) 45atggtcaagg tcgcaagctt
gctggt 264696DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 46gactttgctt tccttggtca ggcagtataa
tccaaagatg gtcaaggtcg caagcttgct 60ggtgaaaagg accccacgaa gtgttggata
taagcc 964718DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDEmisc_feature(18)..(18)RNA RESIDUE
47tgtgcagaag gatggagu
184820DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(20)..(20)RNA RESIDUE 48ctggtgcttc tctcaggata
204925DNAArtificial
SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(1)..(1)5'-hexachlorofluoresceinmisc_feature(9-
)..(10)ZEN INTERNAL FLUORESCENCE QUENCHER BETWEEN RESIDUES 9 AND
10.misc_feature(25)..(25)3'-IBFQ (Iowa Black FQ (fluorescence quencher))
49tggaatatgc cctgcgtaaa ctgga
2550144DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 50tgtgcagaag
gatggagtgg ggatggtcga gtatctcaga aaagaagaca tggaatatgc 60cctgcgtaaa
ctggatgaca ccaaattccg ctctcatgag ggtgaaactt cctacatccg 120agtttatcct
gagagaagca ccag
14451103DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 51agctctgccc
aaagattacc ctgacagcta agtggcagtg gaagttggcc tcagaagtag 60tggccagctg
tgtgtcgggg aacagtaaag gcatgaagct cag
10352103DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 52agctctgccc
aaagattacc ctgacagcta agtggcagtg gaagttggcc tcagaagtag 60tggccagctg
tgtgtcgggg cacagtaaag gcatgaagct cag
10353103DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 53agctctgccc
aaagattacc ctgacagcta agtggcagtg gaagttggcc tcagaagtag 60tggccagctg
tgtgtcgggg gacagtaaag gcatgaagct cag
10354103DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 54agctctgccc
aaagattacc ctgacagcta agtggcagtg gaagttggcc tcagaagtag 60tggccagctg
tgtgtcgggg tacagtaaag gcatgaagct cag
1035523DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 55ctgagcttca
tgcctttact gtt
235623DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 56ctgagcttca
tgcctttact gtc
235723DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 57ctgagcttca
tgcctttact gta
235823DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 58ctgagcttca
tgcctttact gtg
235922DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 59ctgagcttca
tgcctttact gt
226023DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 60agctctgccc
aaagattacc ctg
236128DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(1)..(1)5'-FAM
(6-carboxyfluorescein)misc_feature(9)..(10)ZEN INTERNAL FLUORESCENCE
QUENCHER BETWEEN RESIDUES 9 AND 10.misc_feature(28)..(28)3'-IBFQ
(Iowa Black FQ fluorescence quencher)) 61ttctgaggcc aacttccact gccactta
286223DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDEmisc_feature(23)..(23)RNA RESIDUE
62ctgagcttca tgcctttact gtu
236323DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(23)..(23)RNA RESIDUE 63ctgagcttca tgcctttact
gtc 236423DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDEmisc_feature(23)..(23)RNA RESIDUE
64ctgagcttca tgcctttact gta
236523DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(23)..(23)RNA RESIDUE 65ctgagcttca tgcctttact
gtg 236627DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDEmisc_feature(23)..(23)RNA
RESIDUEmisc_feature(27)..(27)3'-C3 SPACER (propanediol) 66ctgagcttca
tgcctttact gtucccc
276727DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(23)..(23)RNA
RESIDUEmisc_feature(27)..(27)3'-C3 SPACER (PROPANEDIOL) 67ctgagcttca
tgcctttact gtccccc
276827DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(23)..(23)RNA
RESIDUEmisc_feature(27)..(27)3'-C3 SPACER (PROPANEDIOL) 68ctgagcttca
tgcctttact gtacccc
276927DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(23)..(23)RNA
RESIDUEmisc_feature(27)..(27)3'-C3 SPACER (PROPANEDIOL) 69ctgagcttca
tgcctttact gtgcccc
277025DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(23)..(23)RNA RESIDUEmisc_feature(24)..(25)TWO
INTERNAL C3 SPACERS (PROPANEDIOL) BETWEEN RESIDUES 24 AND 25.
70ctgagcttca tgcctttact gtucc
257125DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(23)..(23)RNA RESIDUEmisc_feature(24)..(25)TWO
INTERNAL C3 SPACERS (PROPANEDIOL) BETWEEN RESIDUES 24 AND 25.
71ctgagcttca tgcctttact gtccc
257225DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(23)..(23)RNA RESIDUEmisc_feature(24)..(25)TWO
INTERNAL C3 SPACERS (PROPANEDIOL) BETWEEN RESIDUES 24 AND 25.
72ctgagcttca tgcctttact gtacc
257325DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(23)..(23)RNA RESIDUEmisc_feature(24)..(25)TWO
INTERNAL C3 SPACERS (PROPANEDIOL) BETWEEN RESIDUES 24 AND 25.
73ctgagcttca tgcctttact gtgcc
257421DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 74ctcactctaa
accccagcat t
217522DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 75cagcctcatc
caaaagagga aa
227627DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(23)..(23)RNA
RESIDUEmisc_feature(27)..(27)3'-C3 SPACER (PROPANEDIOL) 76cagcctcatc
caaaagagga aacagga
277727DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(23)..(23)RNA
RESIDUEmisc_feature(27)..(27)3'-C3 SPACER (PROPANEDIOL) 77cagcctcatc
caaaagagga aauagga
277825DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(23)..(23)RNA RESIDUEmisc_feature(24)..(25)TWO
INTERNAL C3 SPACERS (PROPANEDIOL) BETWEEN RESIDUES 24 AND 25.
78cagcctcatc caaaagagga aacaa
257925DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(23)..(23)RNA RESIDUEmisc_feature(24)..(25)TWO
INTERNAL C3 SPACERS (PROPANEDIOL) BETWEEN RESIDUES 24 AND 25.
79cagcctcatc caaaagagga aauaa
258022DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(1)..(1)5'-FAM
(6-carboxyfluorescein)misc_feature(22)..(22)3'-IBFQ (Iowa Black FQ
(fluorescence quencher)) 80cccagagctc cctcagactc ct
228185DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 81cagcctcatc caaaagagga aataggaccc cagagctccc tcagactcct
caggaaacac 60agacaatgct ggggtttaga gtgag
85822507DNAArtificial SequenceNUCLEOTIDE SEQUENCE OF MUTANT
ID 2 (V783F) 82catatgcgtg gtatgctgcc gttgttcgag cctaaaggcc gcgtactgtt
agtcgatggt 60catcacttgg cctatcggac gttccatgca ctcaaaggtc tgacgaccag
tcgtggcgaa 120ccggtccagg ctgtttatgg tttcgctaag tctttgctca aagcactgaa
agaagacggg 180gacgcggtaa ttgttgtatt tgatgccaaa gcaccgagct tccgccacga
agcttatggt 240ggctacaagg caggacgcgc ccctacccca gaagatttcc cccgtcagct
ggcattaatt 300aaggagttag tagaccttct cggcttagcg cgtctggaag ttccgggtta
tgaggcggac 360gatgtccttg catccttggc taaaaaggcc gaaaaagagg gctacgaagt
ccgcatcttg 420acggcagaca aagatctgta ccagcttctg tctgaccgta ttcatgtttt
gcaccctgaa 480ggctacttaa tcactccggc ctggctctgg gaaaagtacg gtctgcgtcc
cgatcagtgg 540gcggattatc gggctttgac gggagatgag agcgacaacc tgccaggagt
taagggcatt 600ggtgaaaaaa ccgcacgtaa gctgcttgaa gagtggggtt ccctggaagc
cttgttaaaa 660aatctggatc gtctcaagcc cgcaattcgt gaaaagatcc tggctcatat
ggacgatctt 720aaattaagtt gggacctggc caaggtgcgc accgatttac cgcttgaagt
ggattttgca 780aaacgccgtg agccggaccg ggaacgttta cgcgctttct tagagcgtct
ggaattcggt 840tcactgcttc atgaattcgg tctgttagag tctcctaaag cactcgaaga
ggcaccgtgg 900ccgcccccag aaggtgcttt tgttggcttc gtactttccc gtaaggagcc
tatgtgggca 960gatcttctgg ctttagcggc tgcacgcggt ggccgtgttc accgggcccc
tgagccatac 1020aaagcgttac gtgatctgaa ggaagcacgt ggcttgctgg caaaagacct
ttctgttttg 1080gccctgcgcg agggtcttgg actgccgcca ggcgacgatc ccatgttatt
ggcctatctg 1140ttagacccta gcaataccac acctgaaggg gtcgctcgtc ggtatggcgg
tgaatggact 1200gaggaagccg gagagcgcgc cgcattgtcc gaacggctct ttgcaaactt
atggggtcgt 1260ctggaagggg aggaacgtct gttatggttg tatcgggaag tcgaacgtcc
tctttcggcc 1320gtattagcgc atatggaggc aacaggtgtg cgtttagatg tcgcgtacct
tcgggcctta 1380tcactggaag ttgcagagga aatcgcccgt ctcgaggctg aagtgttccg
gttggccggt 1440cacccgttta acctcaactc ccgtgaccag ctggaacgcg ttttattcga
tgagcttggg 1500cttcccgcaa ttggcaaaac cgaaaagact ggcaaacgca gtacgagcgc
tgccgtcctt 1560gaggcactcc gcgaggctca ccctattgta gaaaagatcc tgcaataccg
tgagttgacg 1620aagcttaaaa gcacttatat tgatcctctc ccggatctga tccatcctcg
taccggccgc 1680ttgcacacac gtttcaacca gacggcgact gcaaccggcc gtctgtctag
ctcggatcca 1740aatctccaga acattccggt ccgtacaccc ttgggccaac gtatccgccg
ggcgtttatc 1800gctgaggaag gatggttact ggtcgcattg gactactcgc agattgagct
gcgcgtcctc 1860gcacatctct ctggtgacga aaatttaatc cgcgtgtttc aagaggggcg
tgatattcac 1920acagaaactg cctcatggat gttcggtgtc ccacgtgaag cagtggatcc
tttgatgcgc 1980cgtgcagcta aaacaattaa ttttggagtg ctgtacggaa tgagcgctca
tcgcttgagt 2040caggaactgg caatccccta cgaggaagcg caggcattca tcgaacgtta
ctttcaatcg 2100tttccgaaag ttcgcgcatg gatcgagaag acgctcgagg aaggtcgtcg
tcggggctat 2160gtcgaaactc tgtttggtcg ccgtcggtac gtaccagatc ttgaagcccg
cgtcaaatcg 2220gtacgggagg ctgcggagcg tatggcattt aatatgcctg tacagggtac
tgcagctgac 2280ctcatgaaac tggcaatggt caagcttttc ccgcgcttgg aggaaatggg
cgcacgtatg 2340cttctgcagt tccatgacga gctggtgtta gaagccccta aggagcgcgc
cgaagctgtc 2400gcgcgcctcg ctaaagaagt gatggagggc gtttacccat tggccgtacc
cctcgaagtg 2460gaggtcggta ttggagaaga ttggttatct gcaaaggaag cggccgc
250783834PRTArtificial SequenceAMINO ACID SEQUENCE OF MUTANT
ID 2 (V783F) 83Met Arg Gly Met Leu Pro Leu Phe Glu Pro Lys Gly Arg Val
Leu Leu1 5 10 15Val Asp
Gly His His Leu Ala Tyr Arg Thr Phe His Ala Leu Lys Gly 20
25 30Leu Thr Thr Ser Arg Gly Glu Pro Val
Gln Ala Val Tyr Gly Phe Ala 35 40
45Lys Ser Leu Leu Lys Ala Leu Lys Glu Asp Gly Asp Ala Val Ile Val 50
55 60Val Phe Asp Ala Lys Ala Pro Ser Phe
Arg His Glu Ala Tyr Gly Gly65 70 75
80Tyr Lys Ala Gly Arg Ala Pro Thr Pro Glu Asp Phe Pro Arg
Gln Leu 85 90 95Ala Leu
Ile Lys Glu Leu Val Asp Leu Leu Gly Leu Ala Arg Leu Glu 100
105 110Val Pro Gly Tyr Glu Ala Asp Asp Val
Leu Ala Ser Leu Ala Lys Lys 115 120
125Ala Glu Lys Glu Gly Tyr Glu Val Arg Ile Leu Thr Ala Asp Lys Asp
130 135 140Leu Tyr Gln Leu Leu Ser Asp
Arg Ile His Val Leu His Pro Glu Gly145 150
155 160Tyr Leu Ile Thr Pro Ala Trp Leu Trp Glu Lys Tyr
Gly Leu Arg Pro 165 170
175Asp Gln Trp Ala Asp Tyr Arg Ala Leu Thr Gly Asp Glu Ser Asp Asn
180 185 190Leu Pro Gly Val Lys Gly
Ile Gly Glu Lys Thr Ala Arg Lys Leu Leu 195 200
205Glu Glu Trp Gly Ser Leu Glu Ala Leu Leu Lys Asn Leu Asp
Arg Leu 210 215 220Lys Pro Ala Ile Arg
Glu Lys Ile Leu Ala His Met Asp Asp Leu Lys225 230
235 240Leu Ser Trp Asp Leu Ala Lys Val Arg Thr
Asp Leu Pro Leu Glu Val 245 250
255Asp Phe Ala Lys Arg Arg Glu Pro Asp Arg Glu Arg Leu Arg Ala Phe
260 265 270Leu Glu Arg Leu Glu
Phe Gly Ser Leu Leu His Glu Phe Gly Leu Leu 275
280 285Glu Ser Pro Lys Ala Leu Glu Glu Ala Pro Trp Pro
Pro Pro Glu Gly 290 295 300Ala Phe Val
Gly Phe Val Leu Ser Arg Lys Glu Pro Met Trp Ala Asp305
310 315 320Leu Leu Ala Leu Ala Ala Ala
Arg Gly Gly Arg Val His Arg Ala Pro 325
330 335Glu Pro Tyr Lys Ala Leu Arg Asp Leu Lys Glu Ala
Arg Gly Leu Leu 340 345 350Ala
Lys Asp Leu Ser Val Leu Ala Leu Arg Glu Gly Leu Gly Leu Pro 355
360 365Pro Gly Asp Asp Pro Met Leu Leu Ala
Tyr Leu Leu Asp Pro Ser Asn 370 375
380Thr Thr Pro Glu Gly Val Ala Arg Arg Tyr Gly Gly Glu Trp Thr Glu385
390 395 400Glu Ala Gly Glu
Arg Ala Ala Leu Ser Glu Arg Leu Phe Ala Asn Leu 405
410 415Trp Gly Arg Leu Glu Gly Glu Glu Arg Leu
Leu Trp Leu Tyr Arg Glu 420 425
430Val Glu Arg Pro Leu Ser Ala Val Leu Ala His Met Glu Ala Thr Gly
435 440 445Val Arg Leu Asp Val Ala Tyr
Leu Arg Ala Leu Ser Leu Glu Val Ala 450 455
460Glu Glu Ile Ala Arg Leu Glu Ala Glu Val Phe Arg Leu Ala Gly
His465 470 475 480Pro Phe
Asn Leu Asn Ser Arg Asp Gln Leu Glu Arg Val Leu Phe Asp
485 490 495Glu Leu Gly Leu Pro Ala Ile
Gly Lys Thr Glu Lys Thr Gly Lys Arg 500 505
510Ser Thr Ser Ala Ala Val Leu Glu Ala Leu Arg Glu Ala His
Pro Ile 515 520 525Val Glu Lys Ile
Leu Gln Tyr Arg Glu Leu Thr Lys Leu Lys Ser Thr 530
535 540Tyr Ile Asp Pro Leu Pro Asp Leu Ile His Pro Arg
Thr Gly Arg Leu545 550 555
560His Thr Arg Phe Asn Gln Thr Ala Thr Ala Thr Gly Arg Leu Ser Ser
565 570 575Ser Asp Pro Asn Leu
Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln 580
585 590Arg Ile Arg Arg Ala Phe Ile Ala Glu Glu Gly Trp
Leu Leu Val Ala 595 600 605Leu Asp
Tyr Ser Gln Ile Glu Leu Arg Val Leu Ala His Leu Ser Gly 610
615 620Asp Glu Asn Leu Ile Arg Val Phe Gln Glu Gly
Arg Asp Ile His Thr625 630 635
640Glu Thr Ala Ser Trp Met Phe Gly Val Pro Arg Glu Ala Val Asp Pro
645 650 655Leu Met Arg Arg
Ala Ala Lys Thr Ile Asn Phe Gly Val Leu Tyr Gly 660
665 670Met Ser Ala His Arg Leu Ser Gln Glu Leu Ala
Ile Pro Tyr Glu Glu 675 680 685Ala
Gln Ala Phe Ile Glu Arg Tyr Phe Gln Ser Phe Pro Lys Val Arg 690
695 700Ala Trp Ile Glu Lys Thr Leu Glu Glu Gly
Arg Arg Arg Gly Tyr Val705 710 715
720Glu Thr Leu Phe Gly Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala
Arg 725 730 735Val Lys Ser
Val Arg Glu Ala Ala Glu Arg Met Ala Phe Asn Met Pro 740
745 750Val Gln Gly Thr Ala Ala Asp Leu Met Lys
Leu Ala Met Val Lys Leu 755 760
765Phe Pro Arg Leu Glu Glu Met Gly Ala Arg Met Leu Leu Gln Phe His 770
775 780Asp Glu Leu Val Leu Glu Ala Pro
Lys Glu Arg Ala Glu Ala Val Ala785 790
795 800Arg Leu Ala Lys Glu Val Met Glu Gly Val Tyr Pro
Leu Ala Val Pro 805 810
815Leu Glu Val Glu Val Gly Ile Gly Glu Asp Trp Leu Ser Ala Lys Glu
820 825 830Ala Ala842507DNAArtificial
SequenceNUCLEOTIDE SEQUENCE OF MUTANT ID 3 (H784Q) 84catatgcgtg
gtatgctgcc gttgttcgag cctaaaggcc gcgtactgtt agtcgatggt 60catcacttgg
cctatcggac gttccatgca ctcaaaggtc tgacgaccag tcgtggcgaa 120ccggtccagg
ctgtttatgg tttcgctaag tctttgctca aagcactgaa agaagacggg 180gacgcggtaa
ttgttgtatt tgatgccaaa gcaccgagct tccgccacga agcttatggt 240ggctacaagg
caggacgcgc ccctacccca gaagatttcc cccgtcagct ggcattaatt 300aaggagttag
tagaccttct cggcttagcg cgtctggaag ttccgggtta tgaggcggac 360gatgtccttg
catccttggc taaaaaggcc gaaaaagagg gctacgaagt ccgcatcttg 420acggcagaca
aagatctgta ccagcttctg tctgaccgta ttcatgtttt gcaccctgaa 480ggctacttaa
tcactccggc ctggctctgg gaaaagtacg gtctgcgtcc cgatcagtgg 540gcggattatc
gggctttgac gggagatgag agcgacaacc tgccaggagt taagggcatt 600ggtgaaaaaa
ccgcacgtaa gctgcttgaa gagtggggtt ccctggaagc cttgttaaaa 660aatctggatc
gtctcaagcc cgcaattcgt gaaaagatcc tggctcatat ggacgatctt 720aaattaagtt
gggacctggc caaggtgcgc accgatttac cgcttgaagt ggattttgca 780aaacgccgtg
agccggaccg ggaacgttta cgcgctttct tagagcgtct ggaattcggt 840tcactgcttc
atgaattcgg tctgttagag tctcctaaag cactcgaaga ggcaccgtgg 900ccgcccccag
aaggtgcttt tgttggcttc gtactttccc gtaaggagcc tatgtgggca 960gatcttctgg
ctttagcggc tgcacgcggt ggccgtgttc accgggcccc tgagccatac 1020aaagcgttac
gtgatctgaa ggaagcacgt ggcttgctgg caaaagacct ttctgttttg 1080gccctgcgcg
agggtcttgg actgccgcca ggcgacgatc ccatgttatt ggcctatctg 1140ttagacccta
gcaataccac acctgaaggg gtcgctcgtc ggtatggcgg tgaatggact 1200gaggaagccg
gagagcgcgc cgcattgtcc gaacggctct ttgcaaactt atggggtcgt 1260ctggaagggg
aggaacgtct gttatggttg tatcgggaag tcgaacgtcc tctttcggcc 1320gtattagcgc
atatggaggc aacaggtgtg cgtttagatg tcgcgtacct tcgggcctta 1380tcactggaag
ttgcagagga aatcgcccgt ctcgaggctg aagtgttccg gttggccggt 1440cacccgttta
acctcaactc ccgtgaccag ctggaacgcg ttttattcga tgagcttggg 1500cttcccgcaa
ttggcaaaac cgaaaagact ggcaaacgca gtacgagcgc tgccgtcctt 1560gaggcactcc
gcgaggctca ccctattgta gaaaagatcc tgcaataccg tgagttgacg 1620aagcttaaaa
gcacttatat tgatcctctc ccggatctga tccatcctcg taccggccgc 1680ttgcacacac
gtttcaacca gacggcgact gcaaccggcc gtctgtctag ctcggatcca 1740aatctccaga
acattccggt ccgtacaccc ttgggccaac gtatccgccg ggcgtttatc 1800gctgaggaag
gatggttact ggtcgcattg gactactcgc agattgagct gcgcgtcctc 1860gcacatctct
ctggtgacga aaatttaatc cgcgtgtttc aagaggggcg tgatattcac 1920acagaaactg
cctcatggat gttcggtgtc ccacgtgaag cagtggatcc tttgatgcgc 1980cgtgcagcta
aaacaattaa ttttggagtg ctgtacggaa tgagcgctca tcgcttgagt 2040caggaactgg
caatccccta cgaggaagcg caggcattca tcgaacgtta ctttcaatcg 2100tttccgaaag
ttcgcgcatg gatcgagaag acgctcgagg aaggtcgtcg tcggggctat 2160gtcgaaactc
tgtttggtcg ccgtcggtac gtaccagatc ttgaagcccg cgtcaaatcg 2220gtacgggagg
ctgcggagcg tatggcattt aatatgcctg tacagggtac tgcagctgac 2280ctcatgaaac
tggcaatggt caagcttttc ccgcgcttgg aggaaatggg cgcacgtatg 2340cttctgcagg
tccaggacga gctggtgtta gaagccccta aggagcgcgc cgaagctgtc 2400gcgcgcctcg
ctaaagaagt gatggagggc gtttacccat tggccgtacc cctcgaagtg 2460gaggtcggta
ttggagaaga ttggttatct gcaaaggaag cggccgc
250785834PRTArtificial SequenceAMINO ACID SEQUENCE OF MUTANT ID 3 (H784Q)
85Met Arg Gly Met Leu Pro Leu Phe Glu Pro Lys Gly Arg Val Leu Leu1
5 10 15Val Asp Gly His His Leu
Ala Tyr Arg Thr Phe His Ala Leu Lys Gly 20 25
30Leu Thr Thr Ser Arg Gly Glu Pro Val Gln Ala Val Tyr
Gly Phe Ala 35 40 45Lys Ser Leu
Leu Lys Ala Leu Lys Glu Asp Gly Asp Ala Val Ile Val 50
55 60Val Phe Asp Ala Lys Ala Pro Ser Phe Arg His Glu
Ala Tyr Gly Gly65 70 75
80Tyr Lys Ala Gly Arg Ala Pro Thr Pro Glu Asp Phe Pro Arg Gln Leu
85 90 95Ala Leu Ile Lys Glu Leu
Val Asp Leu Leu Gly Leu Ala Arg Leu Glu 100
105 110Val Pro Gly Tyr Glu Ala Asp Asp Val Leu Ala Ser
Leu Ala Lys Lys 115 120 125Ala Glu
Lys Glu Gly Tyr Glu Val Arg Ile Leu Thr Ala Asp Lys Asp 130
135 140Leu Tyr Gln Leu Leu Ser Asp Arg Ile His Val
Leu His Pro Glu Gly145 150 155
160Tyr Leu Ile Thr Pro Ala Trp Leu Trp Glu Lys Tyr Gly Leu Arg Pro
165 170 175Asp Gln Trp Ala
Asp Tyr Arg Ala Leu Thr Gly Asp Glu Ser Asp Asn 180
185 190Leu Pro Gly Val Lys Gly Ile Gly Glu Lys Thr
Ala Arg Lys Leu Leu 195 200 205Glu
Glu Trp Gly Ser Leu Glu Ala Leu Leu Lys Asn Leu Asp Arg Leu 210
215 220Lys Pro Ala Ile Arg Glu Lys Ile Leu Ala
His Met Asp Asp Leu Lys225 230 235
240Leu Ser Trp Asp Leu Ala Lys Val Arg Thr Asp Leu Pro Leu Glu
Val 245 250 255Asp Phe Ala
Lys Arg Arg Glu Pro Asp Arg Glu Arg Leu Arg Ala Phe 260
265 270Leu Glu Arg Leu Glu Phe Gly Ser Leu Leu
His Glu Phe Gly Leu Leu 275 280
285Glu Ser Pro Lys Ala Leu Glu Glu Ala Pro Trp Pro Pro Pro Glu Gly 290
295 300Ala Phe Val Gly Phe Val Leu Ser
Arg Lys Glu Pro Met Trp Ala Asp305 310
315 320Leu Leu Ala Leu Ala Ala Ala Arg Gly Gly Arg Val
His Arg Ala Pro 325 330
335Glu Pro Tyr Lys Ala Leu Arg Asp Leu Lys Glu Ala Arg Gly Leu Leu
340 345 350Ala Lys Asp Leu Ser Val
Leu Ala Leu Arg Glu Gly Leu Gly Leu Pro 355 360
365Pro Gly Asp Asp Pro Met Leu Leu Ala Tyr Leu Leu Asp Pro
Ser Asn 370 375 380Thr Thr Pro Glu Gly
Val Ala Arg Arg Tyr Gly Gly Glu Trp Thr Glu385 390
395 400Glu Ala Gly Glu Arg Ala Ala Leu Ser Glu
Arg Leu Phe Ala Asn Leu 405 410
415Trp Gly Arg Leu Glu Gly Glu Glu Arg Leu Leu Trp Leu Tyr Arg Glu
420 425 430Val Glu Arg Pro Leu
Ser Ala Val Leu Ala His Met Glu Ala Thr Gly 435
440 445Val Arg Leu Asp Val Ala Tyr Leu Arg Ala Leu Ser
Leu Glu Val Ala 450 455 460Glu Glu Ile
Ala Arg Leu Glu Ala Glu Val Phe Arg Leu Ala Gly His465
470 475 480Pro Phe Asn Leu Asn Ser Arg
Asp Gln Leu Glu Arg Val Leu Phe Asp 485
490 495Glu Leu Gly Leu Pro Ala Ile Gly Lys Thr Glu Lys
Thr Gly Lys Arg 500 505 510Ser
Thr Ser Ala Ala Val Leu Glu Ala Leu Arg Glu Ala His Pro Ile 515
520 525Val Glu Lys Ile Leu Gln Tyr Arg Glu
Leu Thr Lys Leu Lys Ser Thr 530 535
540Tyr Ile Asp Pro Leu Pro Asp Leu Ile His Pro Arg Thr Gly Arg Leu545
550 555 560His Thr Arg Phe
Asn Gln Thr Ala Thr Ala Thr Gly Arg Leu Ser Ser 565
570 575Ser Asp Pro Asn Leu Gln Asn Ile Pro Val
Arg Thr Pro Leu Gly Gln 580 585
590Arg Ile Arg Arg Ala Phe Ile Ala Glu Glu Gly Trp Leu Leu Val Ala
595 600 605Leu Asp Tyr Ser Gln Ile Glu
Leu Arg Val Leu Ala His Leu Ser Gly 610 615
620Asp Glu Asn Leu Ile Arg Val Phe Gln Glu Gly Arg Asp Ile His
Thr625 630 635 640Glu Thr
Ala Ser Trp Met Phe Gly Val Pro Arg Glu Ala Val Asp Pro
645 650 655Leu Met Arg Arg Ala Ala Lys
Thr Ile Asn Phe Gly Val Leu Tyr Gly 660 665
670Met Ser Ala His Arg Leu Ser Gln Glu Leu Ala Ile Pro Tyr
Glu Glu 675 680 685Ala Gln Ala Phe
Ile Glu Arg Tyr Phe Gln Ser Phe Pro Lys Val Arg 690
695 700Ala Trp Ile Glu Lys Thr Leu Glu Glu Gly Arg Arg
Arg Gly Tyr Val705 710 715
720Glu Thr Leu Phe Gly Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala Arg
725 730 735Val Lys Ser Val Arg
Glu Ala Ala Glu Arg Met Ala Phe Asn Met Pro 740
745 750Val Gln Gly Thr Ala Ala Asp Leu Met Lys Leu Ala
Met Val Lys Leu 755 760 765Phe Pro
Arg Leu Glu Glu Met Gly Ala Arg Met Leu Leu Gln Val Gln 770
775 780Asp Glu Leu Val Leu Glu Ala Pro Lys Glu Arg
Ala Glu Ala Val Ala785 790 795
800Arg Leu Ala Lys Glu Val Met Glu Gly Val Tyr Pro Leu Ala Val Pro
805 810 815Leu Glu Val Glu
Val Gly Ile Gly Glu Asp Trp Leu Ser Ala Lys Glu 820
825 830Ala Ala862507DNAArtificial SequenceNUCLEOTIDE
SEQUENCE OF MUTANT ID 10 (A661E, I665W, F667L) 86catatgcgtg
gtatgctgcc gttgttcgag cctaaaggcc gcgtactgtt agtcgatggt 60catcacttgg
cctatcggac gttccatgca ctcaaaggtc tgacgaccag tcgtggcgaa 120ccggtccagg
ctgtttatgg tttcgctaag tctttgctca aagcactgaa agaagacggg 180gacgcggtaa
ttgttgtatt tgatgccaaa gcaccgagct tccgccacga agcttatggt 240ggctacaagg
caggacgcgc ccctacccca gaagatttcc cccgtcagct ggcattaatt 300aaggagttag
tagaccttct cggcttagcg cgtctggaag ttccgggtta tgaggcggac 360gatgtccttg
catccttggc taaaaaggcc gaaaaagagg gctacgaagt ccgcatcttg 420acggcagaca
aagatctgta ccagcttctg tctgaccgta ttcatgtttt gcaccctgaa 480ggctacttaa
tcactccggc ctggctctgg gaaaagtacg gtctgcgtcc cgatcagtgg 540gcggattatc
gggctttgac gggagatgag agcgacaacc tgccaggagt taagggcatt 600ggtgaaaaaa
ccgcacgtaa gctgcttgaa gagtggggtt ccctggaagc cttgttaaaa 660aatctggatc
gtctcaagcc cgcaattcgt gaaaagatcc tggctcatat ggacgatctt 720aaattaagtt
gggacctggc caaggtgcgc accgatttac cgcttgaagt ggattttgca 780aaacgccgtg
agccggaccg ggaacgttta cgcgctttct tagagcgtct ggaattcggt 840tcactgcttc
atgaattcgg tctgttagag tctcctaaag cactcgaaga ggcaccgtgg 900ccgcccccag
aaggtgcttt tgttggcttc gtactttccc gtaaggagcc tatgtgggca 960gatcttctgg
ctttagcggc tgcacgcggt ggccgtgttc accgggcccc tgagccatac 1020aaagcgttac
gtgatctgaa ggaagcacgt ggcttgctgg caaaagacct ttctgttttg 1080gccctgcgcg
agggtcttgg actgccgcca ggcgacgatc ccatgttatt ggcctatctg 1140ttagacccta
gcaataccac acctgaaggg gtcgctcgtc ggtatggcgg tgaatggact 1200gaggaagccg
gagagcgcgc cgcattgtcc gaacggctct ttgcaaactt atggggtcgt 1260ctggaagggg
aggaacgtct gttatggttg tatcgggaag tcgaacgtcc tctttcggcc 1320gtattagcgc
atatggaggc aacaggtgtg cgtttagatg tcgcgtacct tcgggcctta 1380tcactggaag
ttgcagagga aatcgcccgt ctcgaggctg aagtgttccg gttggccggt 1440cacccgttta
acctcaactc ccgtgaccag ctggaacgcg ttttattcga tgagcttggg 1500cttcccgcaa
ttggcaaaac cgaaaagact ggcaaacgca gtacgagcgc tgccgtcctt 1560gaggcactcc
gcgaggctca ccctattgta gaaaagatcc tgcaataccg tgagttgacg 1620aagcttaaaa
gcacttatat tgatcctctc ccggatctga tccatcctcg taccggccgc 1680ttgcacacac
gtttcaacca gacggcgact gcaaccggcc gtctgtctag ctcggatcca 1740aatctccaga
acattccggt ccgtacaccc ttgggccaac gtatccgccg ggcgtttatc 1800gctgaggaag
gatggttact ggtcgcattg gactactcgc agattgagct gcgcgtcctc 1860gcacatctct
ctggtgacga aaatttaatc cgcgtgtttc aagaggggcg tgatattcac 1920acagaaactg
cctcatggat gttcggtgtc ccacgtgaag cagtggatcc tttgatgcgc 1980cgtgaagcta
aaacatggaa tttgggagtg ctgtacggaa tgagcgctca tcgcttgagt 2040caggaactgg
caatccccta cgaggaagcg caggcattca tcgaacgtta ctttcaatcg 2100tttccgaaag
ttcgcgcatg gatcgagaag acgctcgagg aaggtcgtcg tcggggctat 2160gtcgaaactc
tgtttggtcg ccgtcggtac gtaccagatc ttgaagcccg cgtcaaatcg 2220gtacgggagg
ctgcggagcg tatggcattt aatatgcctg tacagggtac tgcagctgac 2280ctcatgaaac
tggcaatggt caagcttttc ccgcgcttgg aggaaatggg cgcacgtatg 2340cttctgcagg
tccatgacga gctggtgtta gaagccccta aggagcgcgc cgaagctgtc 2400gcgcgcctcg
ctaaagaagt gatggagggc gtttacccat tggccgtacc cctcgaagtg 2460gaggtcggta
ttggagaaga ttggttatct gcaaaggaag cggccgc
250787834PRTArtificial SequenceAMINO ACID SEQUENCE OF MUTANT ID 10
(A661E, I665W, F667L) 87Met Arg Gly Met Leu Pro Leu Phe Glu Pro Lys
Gly Arg Val Leu Leu1 5 10
15Val Asp Gly His His Leu Ala Tyr Arg Thr Phe His Ala Leu Lys Gly
20 25 30Leu Thr Thr Ser Arg Gly Glu
Pro Val Gln Ala Val Tyr Gly Phe Ala 35 40
45Lys Ser Leu Leu Lys Ala Leu Lys Glu Asp Gly Asp Ala Val Ile
Val 50 55 60Val Phe Asp Ala Lys Ala
Pro Ser Phe Arg His Glu Ala Tyr Gly Gly65 70
75 80Tyr Lys Ala Gly Arg Ala Pro Thr Pro Glu Asp
Phe Pro Arg Gln Leu 85 90
95Ala Leu Ile Lys Glu Leu Val Asp Leu Leu Gly Leu Ala Arg Leu Glu
100 105 110Val Pro Gly Tyr Glu Ala
Asp Asp Val Leu Ala Ser Leu Ala Lys Lys 115 120
125Ala Glu Lys Glu Gly Tyr Glu Val Arg Ile Leu Thr Ala Asp
Lys Asp 130 135 140Leu Tyr Gln Leu Leu
Ser Asp Arg Ile His Val Leu His Pro Glu Gly145 150
155 160Tyr Leu Ile Thr Pro Ala Trp Leu Trp Glu
Lys Tyr Gly Leu Arg Pro 165 170
175Asp Gln Trp Ala Asp Tyr Arg Ala Leu Thr Gly Asp Glu Ser Asp Asn
180 185 190Leu Pro Gly Val Lys
Gly Ile Gly Glu Lys Thr Ala Arg Lys Leu Leu 195
200 205Glu Glu Trp Gly Ser Leu Glu Ala Leu Leu Lys Asn
Leu Asp Arg Leu 210 215 220Lys Pro Ala
Ile Arg Glu Lys Ile Leu Ala His Met Asp Asp Leu Lys225
230 235 240Leu Ser Trp Asp Leu Ala Lys
Val Arg Thr Asp Leu Pro Leu Glu Val 245
250 255Asp Phe Ala Lys Arg Arg Glu Pro Asp Arg Glu Arg
Leu Arg Ala Phe 260 265 270Leu
Glu Arg Leu Glu Phe Gly Ser Leu Leu His Glu Phe Gly Leu Leu 275
280 285Glu Ser Pro Lys Ala Leu Glu Glu Ala
Pro Trp Pro Pro Pro Glu Gly 290 295
300Ala Phe Val Gly Phe Val Leu Ser Arg Lys Glu Pro Met Trp Ala Asp305
310 315 320Leu Leu Ala Leu
Ala Ala Ala Arg Gly Gly Arg Val His Arg Ala Pro 325
330 335Glu Pro Tyr Lys Ala Leu Arg Asp Leu Lys
Glu Ala Arg Gly Leu Leu 340 345
350Ala Lys Asp Leu Ser Val Leu Ala Leu Arg Glu Gly Leu Gly Leu Pro
355 360 365Pro Gly Asp Asp Pro Met Leu
Leu Ala Tyr Leu Leu Asp Pro Ser Asn 370 375
380Thr Thr Pro Glu Gly Val Ala Arg Arg Tyr Gly Gly Glu Trp Thr
Glu385 390 395 400Glu Ala
Gly Glu Arg Ala Ala Leu Ser Glu Arg Leu Phe Ala Asn Leu
405 410 415Trp Gly Arg Leu Glu Gly Glu
Glu Arg Leu Leu Trp Leu Tyr Arg Glu 420 425
430Val Glu Arg Pro Leu Ser Ala Val Leu Ala His Met Glu Ala
Thr Gly 435 440 445Val Arg Leu Asp
Val Ala Tyr Leu Arg Ala Leu Ser Leu Glu Val Ala 450
455 460Glu Glu Ile Ala Arg Leu Glu Ala Glu Val Phe Arg
Leu Ala Gly His465 470 475
480Pro Phe Asn Leu Asn Ser Arg Asp Gln Leu Glu Arg Val Leu Phe Asp
485 490 495Glu Leu Gly Leu Pro
Ala Ile Gly Lys Thr Glu Lys Thr Gly Lys Arg 500
505 510Ser Thr Ser Ala Ala Val Leu Glu Ala Leu Arg Glu
Ala His Pro Ile 515 520 525Val Glu
Lys Ile Leu Gln Tyr Arg Glu Leu Thr Lys Leu Lys Ser Thr 530
535 540Tyr Ile Asp Pro Leu Pro Asp Leu Ile His Pro
Arg Thr Gly Arg Leu545 550 555
560His Thr Arg Phe Asn Gln Thr Ala Thr Ala Thr Gly Arg Leu Ser Ser
565 570 575Ser Asp Pro Asn
Leu Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln 580
585 590Arg Ile Arg Arg Ala Phe Ile Ala Glu Glu Gly
Trp Leu Leu Val Ala 595 600 605Leu
Asp Tyr Ser Gln Ile Glu Leu Arg Val Leu Ala His Leu Ser Gly 610
615 620Asp Glu Asn Leu Ile Arg Val Phe Gln Glu
Gly Arg Asp Ile His Thr625 630 635
640Glu Thr Ala Ser Trp Met Phe Gly Val Pro Arg Glu Ala Val Asp
Pro 645 650 655Leu Met Arg
Arg Glu Ala Lys Thr Trp Asn Leu Gly Val Leu Tyr Gly 660
665 670Met Ser Ala His Arg Leu Ser Gln Glu Leu
Ala Ile Pro Tyr Glu Glu 675 680
685Ala Gln Ala Phe Ile Glu Arg Tyr Phe Gln Ser Phe Pro Lys Val Arg 690
695 700Ala Trp Ile Glu Lys Thr Leu Glu
Glu Gly Arg Arg Arg Gly Tyr Val705 710
715 720Glu Thr Leu Phe Gly Arg Arg Arg Tyr Val Pro Asp
Leu Glu Ala Arg 725 730
735Val Lys Ser Val Arg Glu Ala Ala Glu Arg Met Ala Phe Asn Met Pro
740 745 750Val Gln Gly Thr Ala Ala
Asp Leu Met Lys Leu Ala Met Val Lys Leu 755 760
765Phe Pro Arg Leu Glu Glu Met Gly Ala Arg Met Leu Leu Gln
Val His 770 775 780Asp Glu Leu Val Leu
Glu Ala Pro Lys Glu Arg Ala Glu Ala Val Ala785 790
795 800Arg Leu Ala Lys Glu Val Met Glu Gly Val
Tyr Pro Leu Ala Val Pro 805 810
815Leu Glu Val Glu Val Gly Ile Gly Glu Asp Trp Leu Ser Ala Lys Glu
820 825 830Ala
Ala882507DNAArtificial SequenceNUCLEOTIDE SEQUENCE OF MUTANT ID 18
(V783L, H784Q) 88catatgcgtg gtatgctgcc gttgttcgag cctaaaggcc
gcgtactgtt agtcgatggt 60catcacttgg cctatcggac gttccatgca ctcaaaggtc
tgacgaccag tcgtggcgaa 120ccggtccagg ctgtttatgg tttcgctaag tctttgctca
aagcactgaa agaagacggg 180gacgcggtaa ttgttgtatt tgatgccaaa gcaccgagct
tccgccacga agcttatggt 240ggctacaagg caggacgcgc ccctacccca gaagatttcc
cccgtcagct ggcattaatt 300aaggagttag tagaccttct cggcttagcg cgtctggaag
ttccgggtta tgaggcggac 360gatgtccttg catccttggc taaaaaggcc gaaaaagagg
gctacgaagt ccgcatcttg 420acggcagaca aagatctgta ccagcttctg tctgaccgta
ttcatgtttt gcaccctgaa 480ggctacttaa tcactccggc ctggctctgg gaaaagtacg
gtctgcgtcc cgatcagtgg 540gcggattatc gggctttgac gggagatgag agcgacaacc
tgccaggagt taagggcatt 600ggtgaaaaaa ccgcacgtaa gctgcttgaa gagtggggtt
ccctggaagc cttgttaaaa 660aatctggatc gtctcaagcc cgcaattcgt gaaaagatcc
tggctcatat ggacgatctt 720aaattaagtt gggacctggc caaggtgcgc accgatttac
cgcttgaagt ggattttgca 780aaacgccgtg agccggaccg ggaacgttta cgcgctttct
tagagcgtct ggaattcggt 840tcactgcttc atgaattcgg tctgttagag tctcctaaag
cactcgaaga ggcaccgtgg 900ccgcccccag aaggtgcttt tgttggcttc gtactttccc
gtaaggagcc tatgtgggca 960gatcttctgg ctttagcggc tgcacgcggt ggccgtgttc
accgggcccc tgagccatac 1020aaagcgttac gtgatctgaa ggaagcacgt ggcttgctgg
caaaagacct ttctgttttg 1080gccctgcgcg agggtcttgg actgccgcca ggcgacgatc
ccatgttatt ggcctatctg 1140ttagacccta gcaataccac acctgaaggg gtcgctcgtc
ggtatggcgg tgaatggact 1200gaggaagccg gagagcgcgc cgcattgtcc gaacggctct
ttgcaaactt atggggtcgt 1260ctggaagggg aggaacgtct gttatggttg tatcgggaag
tcgaacgtcc tctttcggcc 1320gtattagcgc atatggaggc aacaggtgtg cgtttagatg
tcgcgtacct tcgggcctta 1380tcactggaag ttgcagagga aatcgcccgt ctcgaggctg
aagtgttccg gttggccggt 1440cacccgttta acctcaactc ccgtgaccag ctggaacgcg
ttttattcga tgagcttggg 1500cttcccgcaa ttggcaaaac cgaaaagact ggcaaacgca
gtacgagcgc tgccgtcctt 1560gaggcactcc gcgaggctca ccctattgta gaaaagatcc
tgcaataccg tgagttgacg 1620aagcttaaaa gcacttatat tgatcctctc ccggatctga
tccatcctcg taccggccgc 1680ttgcacacac gtttcaacca gacggcgact gcaaccggcc
gtctgtctag ctcggatcca 1740aatctccaga acattccggt ccgtacaccc ttgggccaac
gtatccgccg ggcgtttatc 1800gctgaggaag gatggttact ggtcgcattg gactactcgc
agattgagct gcgcgtcctc 1860gcacatctct ctggtgacga aaatttaatc cgcgtgtttc
aagaggggcg tgatattcac 1920acagaaactg cctcatggat gttcggtgtc ccacgtgaag
cagtggatcc tttgatgcgc 1980cgtgcagcta aaacaattaa ttttggagtg ctgtacggaa
tgagcgctca tcgcttgagt 2040caggaactgg caatccccta cgaggaagcg caggcattca
tcgaacgtta ctttcaatcg 2100tttccgaaag ttcgcgcatg gatcgagaag acgctcgagg
aaggtcgtcg tcggggctat 2160gtcgaaactc tgtttggtcg ccgtcggtac gtaccagatc
ttgaagcccg cgtcaaatcg 2220gtacgggagg ctgcggagcg tatggcattt aatatgcctg
tacagggtac tgcagctgac 2280ctcatgaaac tggcaatggt caagcttttc ccgcgcttgg
aggaaatggg cgcacgtatg 2340cttctgcagc tgcaggacga gctggtgtta gaagccccta
aggagcgcgc cgaagctgtc 2400gcgcgcctcg ctaaagaagt gatggagggc gtttacccat
tggccgtacc cctcgaagtg 2460gaggtcggta ttggagaaga ttggttatct gcaaaggaag
cggccgc 250789834PRTArtificial SequenceAMINO ACID
SEQUENCE OF MUTANT ID 18 (V783L, H784Q). 89Met Arg Gly Met Leu Pro
Leu Phe Glu Pro Lys Gly Arg Val Leu Leu1 5
10 15Val Asp Gly His His Leu Ala Tyr Arg Thr Phe His
Ala Leu Lys Gly 20 25 30Leu
Thr Thr Ser Arg Gly Glu Pro Val Gln Ala Val Tyr Gly Phe Ala 35
40 45Lys Ser Leu Leu Lys Ala Leu Lys Glu
Asp Gly Asp Ala Val Ile Val 50 55
60Val Phe Asp Ala Lys Ala Pro Ser Phe Arg His Glu Ala Tyr Gly Gly65
70 75 80Tyr Lys Ala Gly Arg
Ala Pro Thr Pro Glu Asp Phe Pro Arg Gln Leu 85
90 95Ala Leu Ile Lys Glu Leu Val Asp Leu Leu Gly
Leu Ala Arg Leu Glu 100 105
110Val Pro Gly Tyr Glu Ala Asp Asp Val Leu Ala Ser Leu Ala Lys Lys
115 120 125Ala Glu Lys Glu Gly Tyr Glu
Val Arg Ile Leu Thr Ala Asp Lys Asp 130 135
140Leu Tyr Gln Leu Leu Ser Asp Arg Ile His Val Leu His Pro Glu
Gly145 150 155 160Tyr Leu
Ile Thr Pro Ala Trp Leu Trp Glu Lys Tyr Gly Leu Arg Pro
165 170 175Asp Gln Trp Ala Asp Tyr Arg
Ala Leu Thr Gly Asp Glu Ser Asp Asn 180 185
190Leu Pro Gly Val Lys Gly Ile Gly Glu Lys Thr Ala Arg Lys
Leu Leu 195 200 205Glu Glu Trp Gly
Ser Leu Glu Ala Leu Leu Lys Asn Leu Asp Arg Leu 210
215 220Lys Pro Ala Ile Arg Glu Lys Ile Leu Ala His Met
Asp Asp Leu Lys225 230 235
240Leu Ser Trp Asp Leu Ala Lys Val Arg Thr Asp Leu Pro Leu Glu Val
245 250 255Asp Phe Ala Lys Arg
Arg Glu Pro Asp Arg Glu Arg Leu Arg Ala Phe 260
265 270Leu Glu Arg Leu Glu Phe Gly Ser Leu Leu His Glu
Phe Gly Leu Leu 275 280 285Glu Ser
Pro Lys Ala Leu Glu Glu Ala Pro Trp Pro Pro Pro Glu Gly 290
295 300Ala Phe Val Gly Phe Val Leu Ser Arg Lys Glu
Pro Met Trp Ala Asp305 310 315
320Leu Leu Ala Leu Ala Ala Ala Arg Gly Gly Arg Val His Arg Ala Pro
325 330 335Glu Pro Tyr Lys
Ala Leu Arg Asp Leu Lys Glu Ala Arg Gly Leu Leu 340
345 350Ala Lys Asp Leu Ser Val Leu Ala Leu Arg Glu
Gly Leu Gly Leu Pro 355 360 365Pro
Gly Asp Asp Pro Met Leu Leu Ala Tyr Leu Leu Asp Pro Ser Asn 370
375 380Thr Thr Pro Glu Gly Val Ala Arg Arg Tyr
Gly Gly Glu Trp Thr Glu385 390 395
400Glu Ala Gly Glu Arg Ala Ala Leu Ser Glu Arg Leu Phe Ala Asn
Leu 405 410 415Trp Gly Arg
Leu Glu Gly Glu Glu Arg Leu Leu Trp Leu Tyr Arg Glu 420
425 430Val Glu Arg Pro Leu Ser Ala Val Leu Ala
His Met Glu Ala Thr Gly 435 440
445Val Arg Leu Asp Val Ala Tyr Leu Arg Ala Leu Ser Leu Glu Val Ala 450
455 460Glu Glu Ile Ala Arg Leu Glu Ala
Glu Val Phe Arg Leu Ala Gly His465 470
475 480Pro Phe Asn Leu Asn Ser Arg Asp Gln Leu Glu Arg
Val Leu Phe Asp 485 490
495Glu Leu Gly Leu Pro Ala Ile Gly Lys Thr Glu Lys Thr Gly Lys Arg
500 505 510Ser Thr Ser Ala Ala Val
Leu Glu Ala Leu Arg Glu Ala His Pro Ile 515 520
525Val Glu Lys Ile Leu Gln Tyr Arg Glu Leu Thr Lys Leu Lys
Ser Thr 530 535 540Tyr Ile Asp Pro Leu
Pro Asp Leu Ile His Pro Arg Thr Gly Arg Leu545 550
555 560His Thr Arg Phe Asn Gln Thr Ala Thr Ala
Thr Gly Arg Leu Ser Ser 565 570
575Ser Asp Pro Asn Leu Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln
580 585 590Arg Ile Arg Arg Ala
Phe Ile Ala Glu Glu Gly Trp Leu Leu Val Ala 595
600 605Leu Asp Tyr Ser Gln Ile Glu Leu Arg Val Leu Ala
His Leu Ser Gly 610 615 620Asp Glu Asn
Leu Ile Arg Val Phe Gln Glu Gly Arg Asp Ile His Thr625
630 635 640Glu Thr Ala Ser Trp Met Phe
Gly Val Pro Arg Glu Ala Val Asp Pro 645
650 655Leu Met Arg Arg Ala Ala Lys Thr Ile Asn Phe Gly
Val Leu Tyr Gly 660 665 670Met
Ser Ala His Arg Leu Ser Gln Glu Leu Ala Ile Pro Tyr Glu Glu 675
680 685Ala Gln Ala Phe Ile Glu Arg Tyr Phe
Gln Ser Phe Pro Lys Val Arg 690 695
700Ala Trp Ile Glu Lys Thr Leu Glu Glu Gly Arg Arg Arg Gly Tyr Val705
710 715 720Glu Thr Leu Phe
Gly Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala Arg 725
730 735Val Lys Ser Val Arg Glu Ala Ala Glu Arg
Met Ala Phe Asn Met Pro 740 745
750Val Gln Gly Thr Ala Ala Asp Leu Met Lys Leu Ala Met Val Lys Leu
755 760 765Phe Pro Arg Leu Glu Glu Met
Gly Ala Arg Met Leu Leu Gln Leu Gln 770 775
780Asp Glu Leu Val Leu Glu Ala Pro Lys Glu Arg Ala Glu Ala Val
Ala785 790 795 800Arg Leu
Ala Lys Glu Val Met Glu Gly Val Tyr Pro Leu Ala Val Pro
805 810 815Leu Glu Val Glu Val Gly Ile
Gly Glu Asp Trp Leu Ser Ala Lys Glu 820 825
830Ala Ala9058PRTArtificial SequenceAMINO ACID SEQUENCE OF
RESIDUES 755-812 OF TAQ DNA POLYMERASE 90Gly Thr Ala Ala Asp Leu Met
Lys Leu Ala Met Val Lys Leu Phe Pro1 5 10
15Arg Leu Glu Glu Met Gly Ala Arg Met Leu Leu Gln Val
His Asp Glu 20 25 30Leu Val
Leu Glu Ala Pro Lys Glu Arg Ala Glu Ala Val Ala Arg Leu 35
40 45Ala Lys Glu Val Met Glu Gly Val Tyr Pro
50 5591829PRTArtificial SequenceAMINO ACID SEQUENCE OF
DNA polymerase I [Thermus igniterrae] 91Met Leu Pro Leu Phe Glu Pro
Lys Gly Arg Val Leu Leu Val Asp Gly1 5 10
15His His Leu Ala Tyr Arg Thr Phe Phe Ala Leu Lys Gly
Leu Thr Thr 20 25 30Ser Arg
Gly Glu Pro Val Gln Ala Val Tyr Gly Phe Ala Lys Ser Leu 35
40 45Leu Lys Ala Leu Lys Glu Asp Gly Asp Val
Val Val Val Val Phe Asp 50 55 60Ala
Lys Ala Pro Ser Phe Arg His Glu Ala Tyr Glu Ala Tyr Lys Ala65
70 75 80Gly Arg Ala Pro Thr Pro
Glu Asp Phe Pro Arg Gln Leu Ala Leu Ile 85
90 95Lys Glu Leu Val Asp Leu Leu Gly Leu Val Arg Leu
Glu Val Pro Gly 100 105 110Phe
Glu Ala Asp Asp Val Leu Ala Thr Leu Ala Lys Arg Ala Glu Lys 115
120 125Glu Gly Tyr Glu Val Arg Ile Leu Thr
Ala Asp Arg Asp Leu Tyr Gln 130 135
140Leu Leu Ser Glu Arg Ile Ala Ile Leu His Pro Glu Gly Tyr Leu Ile145
150 155 160Thr Pro Ala Trp
Leu Tyr Glu Lys Tyr Gly Leu Arg Pro Glu Gln Trp 165
170 175Val Asp Tyr Arg Ala Leu Ala Gly Asp Pro
Ser Asp Asn Ile Pro Gly 180 185
190Val Lys Gly Ile Gly Glu Lys Thr Ala Gln Arg Leu Ile Arg Glu Trp
195 200 205Gly Ser Leu Glu Asn Leu Phe
Gln His Leu Asp Gln Val Lys Pro Ser 210 215
220Leu Arg Glu Lys Leu Gln Ala Gly Met Glu Ala Leu Ala Leu Ser
Arg225 230 235 240Lys Leu
Ser Gln Val His Thr Asp Leu Pro Leu Glu Val Asp Phe Gly
245 250 255Arg Arg Arg Thr Pro Asn Leu
Glu Gly Leu Arg Ala Phe Leu Glu Arg 260 265
270Leu Glu Phe Gly Ser Leu Leu His Glu Phe Gly Leu Leu Glu
Gly Pro 275 280 285Lys Ala Ala Glu
Glu Ala Pro Trp Pro Pro Pro Glu Gly Ala Phe Leu 290
295 300Gly Phe Ser Phe Ser Arg Pro Glu Pro Met Trp Ala
Glu Leu Leu Ala305 310 315
320Leu Ala Gly Ala Trp Glu Gly Arg Leu His Arg Ala Gln Asp Pro Leu
325 330 335Arg Gly Leu Arg Asp
Leu Lys Gly Val Arg Gly Ile Leu Ala Lys Asp 340
345 350Leu Ala Val Leu Ala Leu Arg Glu Gly Leu Asp Leu
Phe Pro Glu Asp 355 360 365Asp Pro
Met Leu Leu Ala Tyr Leu Leu Asp Pro Ser Asn Thr Thr Pro 370
375 380Glu Gly Val Ala Arg Arg Tyr Gly Gly Glu Trp
Thr Glu Asp Ala Gly385 390 395
400Glu Arg Ala Leu Leu Ala Glu Arg Leu Phe Gln Thr Leu Lys Glu Arg
405 410 415Leu Lys Gly Glu
Glu Arg Leu Leu Trp Leu Tyr Glu Glu Val Glu Lys 420
425 430Pro Leu Ser Arg Val Leu Ala Arg Met Glu Ala
Thr Gly Val Arg Leu 435 440 445Asp
Val Ala Tyr Leu Gln Ala Leu Ser Leu Glu Val Glu Ala Glu Val 450
455 460Arg Gln Leu Glu Glu Glu Val Phe Arg Leu
Ala Gly His Pro Phe Asn465 470 475
480Leu Asn Ser Arg Asp Gln Leu Glu Arg Val Leu Phe Asp Glu Leu
Gly 485 490 495Leu Pro Ala
Ile Gly Lys Thr Glu Lys Thr Gly Lys Arg Ser Thr Ser 500
505 510Ala Ala Val Leu Glu Ala Leu Arg Glu Ala
His Pro Ile Val Asp Arg 515 520
525Ile Leu Gln Tyr Arg Glu Leu Thr Lys Leu Lys Asn Thr Tyr Ile Asp 530
535 540Pro Leu Pro Ala Leu Val His Pro
Lys Thr Gly Arg Leu His Thr Arg545 550
555 560Phe Asn Gln Thr Ala Thr Ala Thr Gly Arg Leu Ser
Ser Ser Asp Pro 565 570
575Asn Leu Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln Arg Ile Arg
580 585 590Arg Ala Phe Val Ala Glu
Glu Gly Trp Val Leu Val Val Leu Asp Tyr 595 600
605Ser Gln Ile Glu Leu Arg Val Leu Ala His Leu Ser Gly Asp
Glu Asn 610 615 620Leu Ile Arg Val Phe
Gln Glu Gly Arg Asp Ile His Thr Gln Thr Ala625 630
635 640Ser Trp Met Phe Gly Val Ser Pro Glu Gly
Val Asp Pro Leu Met Arg 645 650
655Arg Ala Ala Lys Thr Ile Asn Phe Gly Val Leu Tyr Gly Met Ser Ala
660 665 670His Arg Leu Ser Gly
Glu Leu Ser Ile Pro Tyr Glu Glu Ala Val Ala 675
680 685Phe Ile Glu Arg Tyr Phe Gln Ser Tyr Pro Lys Val
Arg Ala Trp Ile 690 695 700Glu Gly Thr
Leu Glu Glu Gly Arg Arg Arg Gly Tyr Val Glu Thr Leu705
710 715 720Phe Gly Arg Arg Arg Tyr Val
Pro Asp Leu Asn Ala Arg Val Lys Ser 725
730 735Val Arg Glu Ala Ala Glu Arg Met Ala Phe Asn Met
Pro Val Gln Gly 740 745 750Thr
Ala Ala Asp Leu Met Lys Leu Ala Met Val Arg Leu Phe Pro Arg 755
760 765Leu Gln Glu Leu Gly Ala Arg Met Leu
Leu Gln Val His Asp Glu Leu 770 775
780Val Leu Glu Ala Pro Lys Asp Arg Ala Glu Arg Val Ala Ala Leu Ala785
790 795 800Lys Glu Val Met
Glu Gly Val Trp Pro Leu Arg Val Pro Leu Glu Val 805
810 815Glu Val Gly Leu Gly Glu Asp Trp Leu Ser
Ala Lys Glu 820 82592829PRTArtificial
SequenceAMINO ACID SEQUENCE OF DNA polymerase I [Thermus islandicus]
92Met Leu Pro Leu Phe Ala Pro Lys Gly Arg Val Leu Leu Val Asp Gly1
5 10 15His His Leu Ala Tyr Arg
Thr Phe Phe Ala Leu Lys Gly Leu Thr Thr 20 25
30Ser Arg Gly Glu Pro Val Gln Ala Val Tyr Gly Phe Ala
Lys Ser Leu 35 40 45Leu Lys Ala
Leu Lys Glu Asp Gly Asp Ala Val Val Val Val Phe Asp 50
55 60Ala Lys Ala Pro Ser Phe Arg His Glu Ala Tyr Glu
Gly Tyr Lys Ala65 70 75
80Gly Arg Ala Pro Thr Pro Glu Asp Phe Pro Arg Gln Leu Ala Leu Ile
85 90 95Lys Glu Phe Val Asp Leu
Leu Gly Leu Thr Arg Leu Glu Val Pro Gly 100
105 110Tyr Glu Ala Asp Asp Val Leu Ala Thr Leu Ala Lys
Lys Ala Glu Arg 115 120 125Glu Gly
Tyr Glu Val Arg Ile Leu Thr Ala Asp Arg Asp Leu Tyr Gln 130
135 140Leu Val Ser Asp Arg Ile Ala Ile Leu His Pro
Glu Gly Tyr Leu Ile145 150 155
160Thr Pro Glu Trp Leu Met Glu Arg Tyr Gly Leu Arg Pro Glu Gln Trp
165 170 175Val Asp Tyr Arg
Ala Leu Ala Gly Asp Pro Ser Asp Asn Ile Pro Gly 180
185 190Val Lys Gly Ile Gly Glu Lys Arg Ala Ala Gly
Leu Ile Arg Glu Trp 195 200 205Gly
Ser Leu Glu Asn Leu Leu Lys His Leu Asp Gln Val Lys Pro Ser 210
215 220Leu Arg Glu Ala Ile Leu Ala His Met Glu
Asp Leu Arg Leu Ser Gln225 230 235
240Asp Leu Ser Arg Val Arg Thr Asp Leu Pro Leu Glu Val Asp Phe
Ala 245 250 255Arg Arg Gln
Glu Pro Asp Arg Glu Ala Leu Lys Ala Phe Leu Glu Arg 260
265 270Leu Glu Phe Gly Ser Leu Leu His Glu Phe
Gly Leu Leu Glu Gly Pro 275 280
285Lys Ala Leu Glu Glu Ala Pro Trp Pro Pro Pro Glu Gly Ala Phe Val 290
295 300Gly Tyr Leu Leu Ser Arg Pro Glu
Pro Met Trp Ala Glu Leu Glu Ala305 310
315 320Leu Ala Ala Ser Lys Glu Gly Arg Val His Arg Ala
Leu Asp Pro Leu 325 330
335Ala Gly Leu Arg Asp Leu Lys Glu Ile Gln Ala Leu Leu Ala Lys Asp
340 345 350Leu Ala Val Leu Ala Leu
Arg Glu Gly Leu Asp Leu Ser Pro Ser His 355 360
365Asp Pro Met Leu Leu Ala Tyr Leu Leu Asp Pro Ala Asn Thr
Thr Pro 370 375 380Glu Gly Val Ala Arg
Arg Tyr Gly Gly Glu Trp Thr Ala Glu Ala Gly385 390
395 400Glu Arg Ala Ala Leu Ala Glu Arg Leu Tyr
Gly Arg Leu Arg Glu Arg 405 410
415Leu Glu Gly Glu Glu Lys Leu Leu Trp Leu Tyr Glu Glu Leu Glu Arg
420 425 430Pro Leu Ser Arg Val
Leu Ala His Met Glu Ala Thr Gly Val Arg Leu 435
440 445Asp Val Pro Tyr Leu Lys Ala Leu Ser Leu Glu Val
Glu Ala Glu Val 450 455 460Arg Arg Val
Glu Glu Glu Ala Phe Arg Leu Ala Gly His Pro Phe Asn465
470 475 480Leu Asn Ser Arg Asp Gln Leu
Glu Arg Val Leu Phe Asp Glu Leu Lys 485
490 495Leu Pro Ala Ile Gly Lys Thr Glu Lys Thr Gly Lys
Arg Ser Thr Ser 500 505 510Ala
Ala Val Leu Glu Ala Leu Arg Glu Ala His Pro Ile Val Gly Lys 515
520 525Ile Leu Glu Tyr Arg Glu Leu Thr Lys
Leu Lys Ser Thr Tyr Ile Asp 530 535
540Pro Leu Pro Gly Leu Val His Pro Lys Thr Gly Arg Leu His Thr Arg545
550 555 560Phe Asn Gln Thr
Ala Thr Ala Thr Gly Arg Leu Ser Ser Ser Asp Pro 565
570 575Asn Leu Gln Asn Ile Pro Val Arg Thr Pro
Leu Gly Gln Arg Ile Arg 580 585
590Arg Ala Phe Val Ala Glu Glu Arg Trp Leu Leu Leu Ala Leu Asp Tyr
595 600 605Ser Gln Ile Glu Leu Arg Val
Leu Ala His Leu Ser Gly Asp Glu Asn 610 615
620Leu Ile Arg Val Phe Gln Glu Gly Gln Asp Ile His Thr Glu Thr
Ala625 630 635 640Ser Trp
Met Phe Ala Val Pro Lys Glu Ala Val Asp Ser Leu Met Arg
645 650 655Arg Ala Ala Lys Thr Val Asn
Phe Gly Val Leu Tyr Gly Met Ser Ala 660 665
670His Arg Leu Ser Gln Glu Leu Ser Ile Pro Tyr Glu Glu Ala
Ala Ala 675 680 685Phe Ile Glu Arg
Tyr Phe Gln Thr Phe Pro Lys Val Arg Ala Trp Ile 690
695 700Glu Arg Thr Leu Glu Glu Gly Arg Lys Arg Gly Tyr
Val Glu Thr Leu705 710 715
720Phe Gly Arg Arg Arg Tyr Val Pro Asp Leu Thr Ala Arg Val Lys Ser
725 730 735Val Arg Glu Ala Ala
Glu Arg Met Ala Phe Asn Met Pro Val Gln Gly 740
745 750Thr Ala Ala Asp Leu Met Lys Leu Ala Met Val Lys
Leu Phe Pro Arg 755 760 765Leu Arg
Glu Ala Gly Ala Arg Met Leu Leu Gln Val His Asp Glu Leu 770
775 780Leu Leu Glu Ala Pro Lys Asp Arg Ala Glu Glu
Val Ala Ala Leu Ala785 790 795
800Lys Glu Val Met Glu Gly Val Tyr Pro Leu Ala Val Pro Leu Val Val
805 810 815Glu Val Gly Met
Gly Glu Asp Trp Leu Ser Ala Lys Gly 820
82593833PRTArtificial SequenceAMINO ACID SEQUENCE OF DNA polymerase I,
thermostable [Thermus sp. CCB_US3_UF1] 93Met Leu Pro Leu Phe Ala Pro
Lys Gly Arg Ile Leu Leu Val Asp Gly1 5 10
15His His Leu Ala Tyr Arg Thr Phe Phe Ala Leu Lys Gly
Leu Thr Thr 20 25 30Ser Arg
Gly Glu Pro Val Gln Gly Val Tyr Gly Phe Ala Lys Ala Leu 35
40 45Leu Lys Ala Leu Lys Glu Val Lys Gly Asp
Gly Asp Gly Val Ile Val 50 55 60Val
Phe Asp Ala Lys Ala Pro Ser Phe Arg His Gln Ala Tyr Gly Ala65
70 75 80Tyr Lys Ala Gly Arg Ala
Pro Thr Pro Glu Asp Phe Pro Arg Gln Leu 85
90 95Ser Leu Ile Lys Glu Leu Val Asp Leu Leu Gly Leu
Val Arg Leu Glu 100 105 110Val
Pro Gly Tyr Glu Ala Asp Asp Val Leu Ala Thr Leu Ala Arg Arg 115
120 125Ala Glu Gly Glu Gly Tyr Glu Val Arg
Ile Leu Thr Ala Asp Arg Asp 130 135
140Leu Tyr Gln Leu Leu Ser Glu Arg Val Ser Ile Leu His Pro Glu Gly145
150 155 160His Thr Ile Thr
Pro Gln Trp Leu Trp Glu Lys Tyr Gly Leu Arg Pro 165
170 175Glu Gln Trp Val Asp Tyr Arg Ala Leu Ser
Gly Asp Pro Ser Asp Asn 180 185
190Leu Pro Gly Val Lys Gly Ile Gly Glu Lys Thr Ala Ala Lys Leu Leu
195 200 205Gln Glu Trp Gly Ser Leu Glu
Asn Leu Leu Lys Asn Leu Asp Arg Val 210 215
220Lys Pro Pro Ser Ile Arg Glu Lys Ile Gln Ala His Leu Glu Asp
Leu225 230 235 240Arg Leu
Ser Gln Asp Leu Ala Arg Val Arg Thr Asp Leu Pro Leu Glu
245 250 255Val Asp Phe Ala Gly Arg Arg
Glu Pro Asp Arg Glu Gly Leu Arg Ala 260 265
270Phe Leu Glu Arg Leu Glu Phe Gly Ser Leu Leu His Glu Phe
Gly Leu 275 280 285Leu Glu Gly Pro
Lys Ala Ala Glu Glu Ala Pro Trp Pro Pro Pro Pro 290
295 300Gly Ala Phe Val Gly Tyr Val Leu Ser Arg Pro Glu
Pro Met Trp Ala305 310 315
320Asp Leu Leu Ala Leu Ala Ala Ala Gln Glu Gly Arg Val His Arg Ala
325 330 335Pro Glu Ala Leu Ala
Gly Leu Arg Ala Leu Gly Glu Val Arg Gly Leu 340
345 350Leu Ala Lys Asp Leu Ala Val Leu Ala Leu Arg Glu
Gly Leu Glu Ile 355 360 365Pro Pro
Gly Asp Asp Pro Met Leu Leu Ala Tyr Leu Leu Asp Pro Ser 370
375 380Asn Thr Ser Pro Glu Gly Val Ala Arg Arg Tyr
Gly Gly Glu Trp Ala385 390 395
400Glu Glu Ala Gly Glu Arg Ala Leu Leu Ala Glu Arg Leu Gln Ala Ala
405 410 415Leu Trp Ala Arg
Leu Glu Gly Glu Glu Arg Leu Arg Trp Leu Tyr Glu 420
425 430Glu Val Glu Lys Pro Leu Ser Arg Val Leu Ala
Arg Met Glu Ala Thr 435 440 445Gly
Val Arg Leu Asp Val Ala Tyr Leu Gln Ala Leu Ala Leu Glu Val 450
455 460Glu Gly Glu Val Arg Arg Leu Glu Glu Glu
Val Phe Arg Leu Ala Gly465 470 475
480His Pro Phe Asn Leu Asn Ser Arg Asp Gln Leu Glu Lys Val Leu
Phe 485 490 495Asp Glu Leu
Gly Leu Pro Ala Ile Gly Lys Thr Glu Lys Thr Gly Lys 500
505 510Arg Ser Thr Ser Ala Gln Val Leu Glu Leu
Leu Arg Glu Ala His Pro 515 520
525Ile Val Ala Arg Ile Leu Glu Tyr Arg Glu Leu Thr Lys Leu Lys Ser 530
535 540Thr Tyr Ile Asp Pro Leu Pro Ala
Leu Val His Pro Arg Thr Gly Arg545 550
555 560Leu His Thr Arg Phe Asn Gln Thr Ala Thr Ala Thr
Gly Arg Leu Ser 565 570
575Ser Ser Asp Pro Asn Leu Gln Asn Ile Pro Val Arg Thr Pro Leu Gly
580 585 590Gln Arg Ile Arg Arg Ala
Phe Val Ala Glu Glu Gly Trp Val Leu Val 595 600
605Ala Leu Asp Tyr Ser Gln Ile Glu Leu Arg Val Leu Ala His
Leu Ser 610 615 620Gly Asp Glu Asn Leu
Ile Arg Val Phe Gln Glu Gly Arg Asp Ile His625 630
635 640Thr Gln Thr Ala Ser Trp Met Phe Gly Val
Pro Pro Glu Ala Val Asp 645 650
655Pro Leu Met Arg Arg Ala Ala Lys Thr Ile Asn Phe Gly Val Leu Tyr
660 665 670Gly Met Ser Ala His
Arg Leu Ser Gly Glu Leu Ala Ile Pro Tyr Glu 675
680 685Glu Ala Val Ala Phe Ile Glu Arg Tyr Phe Gln Ser
Tyr Pro Lys Val 690 695 700Arg Ala Trp
Ile Glu Lys Thr Leu Glu Glu Gly Arg Arg Arg Gly Tyr705
710 715 720Val Glu Thr Leu Phe Gly Arg
Arg Arg Tyr Val Pro Asp Leu Asn Ala 725
730 735Arg Val Lys Ser Val Arg Glu Ala Ala Glu Arg Met
Ala Phe Asn Met 740 745 750Pro
Val Gln Gly Thr Ala Ala Asp Leu Met Lys Leu Ala Met Val Arg 755
760 765Leu Phe Pro Leu Leu Pro Gly Val Gly
Ala Arg Met Leu Leu Gln Val 770 775
780His Asp Glu Leu Leu Leu Glu Ala Pro Lys Glu Arg Ala Glu Glu Val785
790 795 800Ala Arg Leu Ala
Arg Glu Val Met Glu Gly Val Trp Pro Leu Ala Val 805
810 815Pro Leu Glu Val Glu Val Gly Ile Gly Glu
Asp Trp Leu Ala Ala Lys 820 825
830Gly94830PRTArtificial SequenceAMINO ACID SEQUENCE OF DNA polymerase I
[Thermus oshimai] 94Met Leu Pro Leu Phe Glu Pro Lys Gly Arg Val Leu
Leu Val Asp Gly1 5 10
15His His Leu Ala Tyr Arg Thr Phe Phe Ala Leu Lys Gly Leu Thr Thr
20 25 30Ser Arg Gly Glu Pro Val Gln
Ala Val Tyr Gly Phe Ala Lys Ser Leu 35 40
45Leu Lys Ala Leu Lys Glu Asp Gly Glu Val Ala Ile Val Val Phe
Asp 50 55 60Ala Lys Ala Pro Ser Phe
Arg His Glu Ala Tyr Glu Ala Tyr Lys Ala65 70
75 80Gly Arg Ala Pro Thr Pro Glu Asp Phe Pro Arg
Gln Leu Ala Leu Ile 85 90
95Lys Glu Leu Val Asp Leu Leu Gly Leu Val Arg Leu Glu Val Pro Gly
100 105 110Phe Glu Ala Asp Asp Val
Leu Ala Thr Leu Ala Lys Lys Ala Glu Arg 115 120
125Glu Gly Tyr Glu Val Arg Ile Leu Ser Ala Asp Arg Asp Leu
Tyr Gln 130 135 140Leu Leu Ser Asp Arg
Ile His Leu Leu His Pro Glu Gly Glu Val Leu145 150
155 160Thr Pro Gly Trp Leu Gln Glu Arg Tyr Gly
Leu Ser Pro Glu Arg Trp 165 170
175Val Glu Tyr Arg Ala Leu Val Gly Asp Pro Ser Asp Asn Leu Pro Gly
180 185 190Val Pro Gly Ile Gly
Glu Lys Thr Ala Leu Lys Leu Leu Lys Glu Trp 195
200 205Gly Ser Leu Glu Ala Ile Leu Lys Asn Leu Asp Gln
Val Lys Pro Glu 210 215 220Arg Val Arg
Glu Ala Ile Arg Asn Asn Leu Asp Lys Leu Gln Met Ser225
230 235 240Leu Glu Leu Ser Arg Leu Arg
Thr Asp Leu Pro Leu Glu Val Asp Phe 245
250 255Ala Lys Arg Arg Glu Pro Asp Trp Glu Gly Leu Lys
Ala Phe Leu Glu 260 265 270Arg
Leu Glu Phe Gly Ser Leu Leu His Glu Phe Gly Leu Leu Glu Ala 275
280 285Pro Lys Glu Ala Glu Glu Ala Pro Trp
Pro Pro Pro Gly Gly Ala Phe 290 295
300Leu Gly Phe Leu Leu Ser Arg Pro Glu Pro Met Trp Ala Glu Leu Leu305
310 315 320Ala Leu Ala Gly
Ala Lys Glu Gly Arg Val His Arg Ala Glu Asp Pro 325
330 335Val Gly Ala Leu Lys Asp Leu Lys Glu Ile
Arg Gly Leu Leu Ala Lys 340 345
350Asp Leu Ser Val Leu Ala Leu Arg Glu Gly Arg Glu Ile Pro Pro Gly
355 360 365Asp Asp Pro Met Leu Leu Ala
Tyr Leu Leu Asp Pro Gly Asn Thr Asn 370 375
380Pro Glu Gly Val Ala Arg Arg Tyr Gly Gly Glu Trp Lys Glu Asp
Ala385 390 395 400Ala Ala
Arg Ala Leu Leu Ser Glu Arg Leu Trp Gln Ala Leu Tyr Pro
405 410 415Arg Val Ala Glu Glu Glu Arg
Leu Leu Trp Leu Tyr Arg Glu Val Glu 420 425
430Arg Pro Leu Ala Gln Val Leu Ala His Met Glu Ala Thr Gly
Val Arg 435 440 445Leu Asp Val Pro
Tyr Leu Glu Ala Leu Ser Gln Glu Val Ala Phe Glu 450
455 460Leu Glu Arg Leu Glu Ala Glu Val His Arg Leu Ala
Gly His Pro Phe465 470 475
480Asn Leu Asn Ser Arg Asp Gln Leu Glu Arg Val Leu Phe Asp Glu Leu
485 490 495Gly Leu Pro Pro Ile
Gly Lys Thr Glu Lys Thr Gly Lys Arg Ser Thr 500
505 510Ser Ala Ala Val Leu Glu Leu Leu Arg Glu Ala His
Pro Ile Val Gly 515 520 525Arg Ile
Leu Glu Tyr Arg Glu Leu Met Lys Leu Lys Ser Thr Tyr Ile 530
535 540Asp Pro Leu Pro Arg Leu Val His Pro Lys Thr
Gly Arg Leu His Thr545 550 555
560Arg Phe Asn Gln Thr Ala Thr Ala Thr Gly Arg Leu Ser Ser Ser Asp
565 570 575Pro Asn Leu Gln
Asn Ile Pro Val Arg Thr Pro Leu Gly Gln Arg Ile 580
585 590Arg Lys Ala Phe Ile Ala Glu Glu Gly His Leu
Leu Val Ala Leu Asp 595 600 605Tyr
Ser Gln Ile Glu Leu Arg Val Leu Ala His Leu Ser Gly Asp Glu 610
615 620Asn Leu Ile Arg Val Phe Arg Glu Gly Lys
Asp Ile His Thr Glu Thr625 630 635
640Ala Ala Trp Met Phe Gly Val Pro Pro Glu Gly Val Asp Gly Ala
Met 645 650 655Arg Arg Ala
Ala Lys Thr Val Asn Phe Gly Val Leu Tyr Gly Met Ser 660
665 670Ala His Arg Leu Ser Gln Glu Leu Ser Ile
Pro Tyr Glu Glu Ala Ala 675 680
685Ala Phe Ile Glu Arg Tyr Phe Gln Ser Phe Pro Lys Val Arg Ala Trp 690
695 700Ile Ala Lys Thr Leu Glu Glu Gly
Arg Lys Lys Gly Tyr Val Glu Thr705 710
715 720Leu Phe Gly Arg Arg Arg Tyr Val Pro Asp Leu Asn
Ala Arg Val Lys 725 730
735Ser Val Arg Glu Ala Ala Glu Arg Met Ala Phe Asn Met Pro Val Gln
740 745 750Gly Thr Ala Ala Asp Leu
Met Lys Leu Ala Met Val Lys Leu Phe Pro 755 760
765Arg Leu Arg Pro Leu Gly Val Arg Ile Leu Leu Gln Val His
Asp Glu 770 775 780Leu Val Leu Glu Ala
Pro Lys Ala Arg Ala Glu Glu Ala Ala Gln Leu785 790
795 800Ala Lys Glu Thr Met Glu Gly Val Tyr Pro
Leu Ser Val Pro Leu Glu 805 810
815Val Glu Val Gly Met Gly Glu Asp Trp Leu Ser Ala Lys Ala
820 825 83095831PRTArtificial
SequenceAMINO ACID SEQUENCE OF DNA polymerase I [Thermus sp. RL]
95Met Leu Pro Leu Phe Glu Pro Lys Gly Arg Val Leu Leu Val Asp Gly1
5 10 15His His Leu Ala Tyr Arg
Thr Phe Phe Ala Leu Lys Gly Leu Thr Thr 20 25
30Ser Arg Gly Glu Pro Val Gln Ala Val Tyr Gly Phe Ala
Lys Ser Leu 35 40 45Leu Lys Ala
Leu Lys Glu Asp Gly Tyr Lys Ala Val Phe Val Val Phe 50
55 60Asp Ala Lys Ala Pro Ser Phe Arg His Glu Ala Tyr
Glu Ala Tyr Lys65 70 75
80Ala Gly Arg Ala Pro Thr Pro Glu Asp Phe Pro Arg Gln Leu Ala Leu
85 90 95Ile Lys Glu Leu Val Asp
Leu Leu Gly Phe Thr Arg Leu Glu Val Gln 100
105 110Gly Tyr Glu Ala Asp Asp Val Leu Ala Thr Leu Ala
Lys Lys Ala Glu 115 120 125Lys Glu
Gly Tyr Glu Val Arg Ile Leu Thr Ala Asp Arg Asp Leu Tyr 130
135 140Gln Leu Val Ser Asp Arg Val Ala Val Leu His
Pro Glu Gly His Leu145 150 155
160Ile Thr Pro Glu Trp Leu Trp Glu Lys Tyr Gly Leu Arg Pro Glu Gln
165 170 175Trp Val Asp Phe
Arg Ala Leu Val Gly Asp Pro Ser Asp Asn Leu Pro 180
185 190Gly Val Lys Gly Ile Gly Glu Lys Thr Ala Leu
Lys Leu Leu Lys Glu 195 200 205Trp
Gly Ser Leu Glu Asn Ile Leu Lys Asn Leu Asp Arg Val Lys Pro 210
215 220Glu Ser Val Arg Glu Arg Ile Lys Ala His
Leu Glu Asp Leu Lys Leu225 230 235
240Ser Leu Glu Leu Ser Arg Val Arg Ala Asp Leu Pro Leu Glu Val
Asp 245 250 255Phe Ala Arg
Arg Arg Glu Pro Asp Arg Glu Gly Leu Arg Ala Phe Leu 260
265 270Glu Arg Leu Glu Phe Gly Ser Leu Leu His
Glu Phe Gly Leu Leu Glu 275 280
285Ala Pro Ala Pro Leu Glu Glu Ala Pro Trp Pro Pro Pro Glu Gly Ala 290
295 300Phe Val Gly Phe Val Leu Ser Arg
Pro Glu Pro Met Trp Ala Glu Leu305 310
315 320Lys Ala Leu Ala Ala Cys Lys Glu Gly Arg Val His
Arg Ala Lys Asp 325 330
335Pro Leu Ala Gly Leu Lys Asp Leu Lys Glu Val Arg Gly Leu Leu Ala
340 345 350Lys Asp Leu Ala Val Leu
Ala Leu Arg Glu Gly Leu Asp Leu Ala Pro 355 360
365Ser Asp Asp Pro Met Leu Leu Ala Tyr Leu Leu Asp Pro Ser
Asn Thr 370 375 380Thr Pro Glu Gly Val
Ala Arg Arg Tyr Gly Gly Glu Trp Thr Glu Asp385 390
395 400Ala Ala His Arg Ala Leu Leu Ala Glu Arg
Leu Gln Gln Asn Leu Leu 405 410
415Glu Arg Leu Lys Gly Glu Glu Lys Leu Leu Trp Leu Tyr Gln Glu Val
420 425 430Glu Lys Pro Leu Ser
Arg Val Leu Ala His Met Glu Ala Thr Gly Val 435
440 445Arg Leu Asp Val Ala Tyr Leu Lys Ala Leu Ser Leu
Glu Leu Ala Glu 450 455 460Glu Ile Arg
Arg Leu Glu Glu Glu Val Phe Arg Leu Ala Gly His Pro465
470 475 480Phe Asn Leu Asn Ser Arg Asp
Gln Leu Glu Lys Val Leu Phe Asp Glu 485
490 495Leu Arg Leu Pro Ala Leu Gly Lys Thr Gln Lys Thr
Gly Lys Arg Ser 500 505 510Thr
Ser Ala Ala Val Leu Glu Ala Leu Arg Glu Ala His Pro Ile Val 515
520 525Glu Lys Ile Leu Gln His Arg Glu Leu
Thr Lys Leu Lys Asn Thr Tyr 530 535
540Val Asp Pro Leu Pro Gly Leu Val His Pro Arg Thr Gly Arg Leu His545
550 555 560Thr Arg Phe Asn
Gln Thr Ala Thr Ala Thr Gly Arg Leu Ser Ser Ser 565
570 575Asp Pro Asn Leu Gln Asn Ile Pro Val Arg
Thr Pro Leu Gly Gln Arg 580 585
590Ile Arg Arg Ala Phe Val Ala Glu Ala Gly Trp Ala Leu Val Ala Leu
595 600 605Asp Tyr Ser Gln Ile Glu Leu
Arg Val Leu Ala His Leu Ser Gly Asp 610 615
620Glu Asn Leu Ile Arg Val Phe Gln Glu Gly Lys Asp Ile His Thr
Gln625 630 635 640Thr Ala
Ser Trp Met Phe Gly Val Pro Pro Glu Ala Val Asp Pro Leu
645 650 655Met Arg Arg Ala Ala Lys Thr
Val Asn Phe Gly Val Leu Tyr Gly Met 660 665
670Ser Ala His Arg Leu Ser Gln Glu Leu Ser Ile Pro Tyr Glu
Glu Ala 675 680 685Val Ala Phe Ile
Asp Arg Tyr Phe Lys Ser Phe Pro Lys Val Lys Ala 690
695 700Trp Ile Glu Arg Thr Leu Glu Glu Gly Arg Gln Arg
Gly Tyr Val Glu705 710 715
720Thr Leu Phe Gly Arg Arg Arg Tyr Val Pro Asp Leu Asn Ala Arg Val
725 730 735Lys Ser Val Arg Glu
Ala Ala Glu Arg Met Ala Phe Asn Met Pro Val 740
745 750Gln Gly Thr Ala Ala Asp Leu Met Lys Leu Ala Met
Val Lys Leu Phe 755 760 765Pro Arg
Leu Arg Glu Met Gly Ala Arg Met Leu Leu Gln Val His Asp 770
775 780Glu Leu Leu Leu Glu Ala Pro Gln Ala Arg Ala
Glu Glu Val Ala Ala785 790 795
800Leu Ala Lys Glu Ala Met Glu Lys Ala Tyr Pro Leu Ala Val Pro Leu
805 810 815Glu Val Glu Val
Gly Ile Gly Glu Asp Trp Leu Ser Ala Lys Gly 820
825 83096831PRTArtificial SequenceAMINO ACID SEQUENCE OF
DNA polymerase I [Thermus thermophilus SG0.5JP17-16] 96Met Leu Pro
Leu Phe Glu Pro Lys Gly Arg Val Leu Leu Val Asp Gly1 5
10 15His His Leu Ala Tyr Arg Thr Phe Phe
Ala Leu Lys Gly Leu Thr Thr 20 25
30Ser Arg Gly Glu Pro Val Gln Ala Val Tyr Gly Phe Ala Lys Ser Leu
35 40 45Leu Lys Ala Leu Lys Glu Asp
Gly Tyr Lys Ala Val Phe Val Val Phe 50 55
60Asp Ala Lys Ala Pro Ser Phe Arg His Glu Ala Tyr Glu Ala Tyr Lys65
70 75 80Ala Gly Arg Ala
Pro Thr Pro Glu Asp Phe Pro Arg Gln Leu Ala Leu 85
90 95Ile Lys Glu Leu Val Asp Leu Leu Gly Phe
Thr Arg Leu Glu Val Gln 100 105
110Gly Tyr Glu Ala Asp Asp Val Leu Ala Thr Leu Ala Lys Lys Ala Glu
115 120 125Lys Glu Gly Tyr Glu Val Arg
Ile Leu Thr Ala Asp Arg Asp Leu Tyr 130 135
140Gln Leu Val Ser Asp Arg Val Ala Val Leu His Pro Glu Gly His
Leu145 150 155 160Ile Thr
Pro Glu Trp Leu Trp Glu Lys Tyr Gly Leu Arg Pro Glu Gln
165 170 175Trp Val Asp Phe Arg Ala Leu
Val Gly Asp Pro Ser Asp Asn Leu Pro 180 185
190Gly Val Lys Gly Ile Gly Glu Lys Thr Ala Leu Lys Leu Leu
Lys Glu 195 200 205Trp Gly Ser Leu
Glu Asn Leu Leu Lys Asn Leu Asp Arg Val Lys Pro 210
215 220Glu Asn Val Arg Glu Lys Ile Lys Ala His Leu Glu
Asp Leu Arg Leu225 230 235
240Ser Met Glu Leu Ser Arg Val Arg Thr Asp Leu Pro Leu Glu Val Asp
245 250 255Leu Ala Gln Gly Arg
Glu Pro Asp Arg Glu Gly Leu Arg Ala Phe Leu 260
265 270Glu Arg Leu Glu Phe Gly Ser Leu Leu His Glu Phe
Gly Leu Leu Glu 275 280 285Ala Pro
Ala Pro Leu Glu Glu Ala Pro Trp Pro Pro Pro Glu Gly Ala 290
295 300Phe Val Gly Phe Val Leu Ser Arg Pro Glu Pro
Met Trp Ala Glu Leu305 310 315
320Lys Ala Leu Ala Ala Cys Arg Asp Gly Arg Val His Arg Ala Ala Asp
325 330 335Pro Leu Ala Gly
Leu Lys Asp Leu Lys Glu Val Arg Gly Leu Leu Ala 340
345 350Lys Asp Leu Ala Val Leu Ala Ser Arg Glu Gly
Leu Asp Leu Val Pro 355 360 365Gly
Asp Asp Pro Met Leu Leu Ala Tyr Leu Leu Asp Pro Ser Asn Thr 370
375 380Thr Pro Glu Gly Val Ala Arg Arg Tyr Gly
Gly Glu Trp Thr Glu Asp385 390 395
400Ala Ala His Arg Ala Leu Leu Ser Glu Arg Leu His Arg Asn Leu
Leu 405 410 415Lys Arg Leu
Glu Gly Glu Glu Lys Leu Leu Trp Leu Tyr His Glu Val 420
425 430Glu Lys Pro Leu Ser Arg Val Leu Ala His
Met Glu Ala Thr Gly Val 435 440
445Arg Leu Asp Val Ala Tyr Leu Lys Ala Leu Ser Leu Glu Leu Ala Glu 450
455 460Glu Ile Arg Arg Leu Glu Glu Glu
Val Phe Arg Leu Ala Gly His Pro465 470
475 480Phe Asn Leu Asn Ser Arg Asp Gln Leu Glu Lys Val
Leu Phe Asp Glu 485 490
495Leu Arg Leu Pro Ala Leu Gly Lys Thr Gln Lys Thr Gly Lys Arg Ser
500 505 510Thr Ser Ala Ala Val Leu
Glu Ala Leu Arg Glu Ala His Pro Ile Val 515 520
525Glu Lys Ile Leu Gln His Arg Glu Leu Thr Lys Leu Lys Asn
Thr Tyr 530 535 540Val Asp Pro Leu Pro
Gly Leu Val His Pro Arg Thr Gly Arg Leu His545 550
555 560Thr Arg Phe Asn Gln Thr Ala Thr Ala Thr
Gly Arg Leu Ser Ser Ser 565 570
575Asp Pro Asn Leu Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln Arg
580 585 590Ile Arg Arg Ala Phe
Val Ala Glu Ala Gly Trp Ala Leu Val Ala Leu 595
600 605Asp Tyr Ser Gln Ile Glu Leu Arg Val Leu Ala His
Leu Ser Gly Asp 610 615 620Glu Asn Leu
Ile Arg Val Phe Gln Glu Gly Lys Asp Ile His Thr Gln625
630 635 640Thr Ala Ser Trp Met Phe Gly
Val Pro Pro Glu Ala Val Asp Pro Leu 645
650 655Met Arg Arg Ala Ala Lys Thr Val Asn Phe Gly Val
Leu Tyr Gly Met 660 665 670Ser
Ala His Arg Leu Ser Gln Glu Leu Ala Ile Pro Tyr Glu Glu Ala 675
680 685Ser Ala Phe Ile Glu Arg Tyr Phe Gln
Ser Phe Pro Lys Val Arg Ala 690 695
700Trp Ile Glu Lys Thr Leu Glu Glu Gly Arg Lys Arg Gly Tyr Val Glu705
710 715 720Thr Leu Phe Gly
Arg Arg Arg Tyr Val Pro Asp Leu Asn Ala Arg Val 725
730 735Lys Ser Val Arg Glu Ala Ala Glu Arg Met
Ala Phe Asn Met Pro Val 740 745
750Gln Gly Thr Ala Ala Asp Leu Met Lys Leu Ala Met Val Lys Leu Phe
755 760 765Pro Arg Leu Arg Glu Met Gly
Ala Arg Met Leu Leu Gln Val His Asp 770 775
780Glu Leu Leu Leu Glu Ala Pro Gln Ala Arg Ala Glu Glu Val Ala
Ala785 790 795 800Leu Ala
Lys Glu Ala Met Glu Lys Ala Tyr Pro Leu Ala Val Pro Leu
805 810 815Glu Val Glu Val Gly Ile Gly
Glu Asp Trp Leu Ser Ala Lys Gly 820 825
83097830PRTArtificial SequenceAMINO ACID SEQUENCE OF DNA
polymerase I [Thermus scotoductus] 97Met Leu Pro Leu Phe Glu Pro Lys
Gly Arg Val Leu Leu Val Asp Gly1 5 10
15His His Leu Ala Tyr Arg Thr Phe Phe Ala Leu Lys Gly Leu
Thr Thr 20 25 30Ser Arg Gly
Glu Pro Val Gln Ala Val Tyr Gly Phe Ala Lys Ser Leu 35
40 45Leu Lys Ala Leu Arg Glu Asp Gly Asp Val Val
Ile Val Val Phe Asp 50 55 60Ala Lys
Ala Pro Ser Phe Arg His Gln Thr Tyr Glu Ala Tyr Lys Ala65
70 75 80Gly Arg Ala Pro Thr Pro Glu
Asp Phe Pro Arg Gln Leu Ala Leu Ile 85 90
95Lys Glu Met Val Asp Leu Leu Gly Leu Glu Arg Leu Glu
Val Pro Gly 100 105 110Phe Glu
Ala Asp Asp Val Leu Ala Thr Leu Ala Lys Lys Ala Glu Lys 115
120 125Glu Gly Tyr Glu Val Arg Ile Leu Thr Ala
Asp Arg Asp Leu Tyr Gln 130 135 140Leu
Leu Ser Glu Arg Ile Ser Ile Leu His Pro Glu Gly Tyr Leu Ile145
150 155 160Thr Pro Glu Trp Leu Trp
Glu Lys Tyr Gly Leu Lys Pro Ser Gln Trp 165
170 175Val Asp Tyr Arg Ala Leu Ala Gly Asp Pro Ser Asp
Asn Ile Pro Gly 180 185 190Val
Lys Gly Ile Gly Glu Lys Thr Ala Ala Lys Leu Ile Arg Glu Trp 195
200 205Gly Ser Leu Glu Asn Leu Leu Lys His
Leu Glu Gln Val Lys Pro Ala 210 215
220Ser Val Arg Glu Lys Ile Leu Ser His Met Glu Asp Leu Lys Leu Ser225
230 235 240Leu Glu Leu Ser
Arg Val His Thr Asp Leu Leu Leu Gln Val Asp Phe 245
250 255Ala Arg Arg Arg Glu Pro Asp Arg Glu Gly
Leu Lys Ala Phe Leu Glu 260 265
270Arg Leu Glu Phe Gly Ser Leu Leu His Glu Phe Gly Leu Leu Glu Ser
275 280 285Pro Val Ala Ala Glu Glu Ala
Pro Trp Pro Pro Pro Glu Gly Ala Phe 290 295
300Val Gly Tyr Val Leu Ser Arg Pro Glu Pro Met Trp Ala Glu Leu
Asn305 310 315 320Ala Leu
Ala Ala Ala Trp Glu Gly Arg Val Tyr Arg Ala Glu Asp Pro
325 330 335Leu Glu Ala Leu Arg Gly Leu
Gly Glu Val Arg Gly Leu Leu Ala Lys 340 345
350Asp Leu Ala Val Leu Ala Leu Arg Glu Gly Ile Ala Leu Ala
Pro Gly 355 360 365Asp Asp Pro Met
Leu Leu Ala Tyr Leu Leu Asp Pro Ser Asn Thr Ala 370
375 380Pro Glu Gly Val Ala Arg Arg Tyr Gly Gly Glu Trp
Thr Glu Glu Ala385 390 395
400Gly Glu Arg Ala Leu Leu Ser Glu Arg Leu Tyr Ala Ala Leu Leu Glu
405 410 415Arg Leu Lys Gly Glu
Glu Arg Leu Leu Trp Leu Tyr Glu Glu Val Glu 420
425 430Lys Pro Leu Ser Arg Val Leu Ala His Met Glu Ala
Thr Gly Val Arg 435 440 445Leu Asp
Val Ala Tyr Leu Lys Ala Leu Ser Leu Glu Val Glu Ala Glu 450
455 460Leu Arg Arg Leu Glu Glu Glu Val His Arg Leu
Ala Gly His Pro Phe465 470 475
480Asn Leu Asn Ser Arg Asp Gln Leu Glu Arg Val Leu Phe Asp Glu Leu
485 490 495Gly Leu Pro Ala
Ile Gly Lys Thr Glu Lys Thr Gly Lys Arg Ser Thr 500
505 510Ser Ala Ala Val Leu Glu Ala Leu Arg Glu Ala
His Pro Ile Val Asp 515 520 525Arg
Ile Leu Gln Tyr Arg Glu Leu Ser Lys Leu Lys Gly Thr Tyr Ile 530
535 540Asp Pro Leu Pro Ala Leu Val His Pro Lys
Thr Asn Arg Leu His Thr545 550 555
560Arg Phe Asn Gln Thr Ala Thr Ala Thr Gly Arg Leu Ser Ser Ser
Asp 565 570 575Pro Asn Leu
Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln Arg Ile 580
585 590Arg Arg Ala Phe Val Ala Glu Glu Gly Trp
Arg Leu Val Val Leu Asp 595 600
605Tyr Ser Gln Ile Glu Leu Arg Val Leu Ala His Leu Ser Gly Asp Glu 610
615 620Asn Leu Ile Arg Val Phe Gln Glu
Gly Gln Asp Ile His Thr Gln Thr625 630
635 640Ala Ser Trp Met Phe Gly Val Pro Pro Glu Ala Val
Asp Ser Leu Met 645 650
655Arg Arg Ala Ala Lys Thr Ile Asn Phe Gly Val Leu Tyr Gly Met Ser
660 665 670Ala His Arg Leu Ser Gly
Glu Leu Ala Ile Pro Tyr Glu Glu Ala Val 675 680
685Ala Phe Ile Glu Arg Tyr Phe Gln Ser Tyr Pro Lys Val Arg
Ala Trp 690 695 700Ile Glu Lys Thr Leu
Ala Glu Gly Arg Glu Arg Gly Tyr Val Glu Thr705 710
715 720Leu Phe Gly Arg Arg Arg Tyr Val Pro Asp
Leu Ala Ser Arg Val Lys 725 730
735Ser Ile Arg Glu Ala Ala Glu Arg Met Ala Phe Asn Met Pro Val Gln
740 745 750Gly Thr Ala Ala Asp
Leu Met Lys Leu Ala Met Val Lys Leu Phe Pro 755
760 765Arg Leu Gln Glu Leu Gly Ala Arg Met Leu Leu Gln
Val His Asp Glu 770 775 780Leu Val Leu
Glu Ala Pro Lys Glu Gln Ala Glu Glu Val Ala Gln Glu785
790 795 800Ala Lys Arg Thr Met Glu Glu
Val Trp Pro Leu Lys Val Pro Leu Glu 805
810 815Val Glu Val Gly Ile Gly Glu Asp Trp Leu Ser Ala
Lys Ala 820 825
83098834PRTArtificial SequenceAMINO ACID SEQUENCE OF Thermostable DNA
Polymerase [Thermus caldophilus] 98Met Glu Ala Met Leu Pro Leu Phe Glu
Pro Lys Gly Arg Val Leu Leu1 5 10
15Val Asp Gly His His Leu Ala Tyr Arg Thr Phe Phe Ala Leu Lys
Gly 20 25 30Leu Thr Thr Ser
Arg Gly Glu Pro Val Gln Ala Val Tyr Gly Phe Ala 35
40 45Lys Ser Leu Leu Lys Ala Leu Lys Glu Asp Gly Tyr
Lys Ala Val Phe 50 55 60Val Val Phe
Asp Ala Lys Ala Pro Ser Phe Arg His Glu Ala Tyr Glu65 70
75 80Ala Tyr Lys Ala Gly Arg Ala Pro
Thr Pro Glu Asp Phe Pro Arg Gln 85 90
95Leu Ala Leu Ile Lys Glu Leu Val Asp Leu Leu Gly Phe Thr
Arg Leu 100 105 110Glu Val Pro
Gly Tyr Glu Ala Asp Asp Val Leu Ala Thr Leu Ala Lys 115
120 125Asn Pro Glu Lys Glu Gly Tyr Glu Val Arg Ile
Leu Thr Ala Asp Arg 130 135 140Asp Leu
Asp Gln Leu Val Ser Asp Arg Val Ala Val Leu His Pro Glu145
150 155 160Gly His Leu Ile Thr Pro Glu
Trp Leu Trp Gln Lys Tyr Gly Leu Lys 165
170 175Pro Glu Gln Trp Val Asp Phe Arg Ala Leu Val Gly
Asp Pro Ser Asp 180 185 190Asn
Leu Pro Gly Val Lys Gly Ile Gly Glu Lys Thr Ala Leu Lys Leu 195
200 205Leu Lys Glu Trp Gly Ser Leu Glu Asn
Leu Leu Lys Asn Leu Asp Arg 210 215
220Val Lys Pro Glu Asn Val Arg Glu Lys Ile Lys Ala His Leu Glu Asp225
230 235 240Leu Arg Leu Ser
Leu Glu Leu Ser Arg Val Arg Thr Asp Leu Pro Leu 245
250 255Glu Val Asp Leu Ala Gln Gly Arg Glu Pro
Asp Arg Glu Gly Leu Arg 260 265
270Ala Phe Leu Glu Arg Leu Glu Phe Gly Ser Leu Leu His Glu Phe Gly
275 280 285Leu Leu Glu Ala Pro Ala Pro
Leu Glu Glu Ala Pro Trp Pro Pro Pro 290 295
300Glu Gly Ala Phe Val Gly Phe Val Leu Ser Arg Pro Glu Pro Met
Trp305 310 315 320Ala Glu
Leu Lys Ala Leu Ala Ala Cys Arg Asp Gly Arg Val His Arg
325 330 335Ala Ala Asp Pro Leu Ala Gly
Leu Lys Asp Leu Lys Glu Val Arg Gly 340 345
350Leu Leu Ala Lys Asp Leu Ala Val Leu Ala Ser Arg Glu Gly
Leu Asp 355 360 365Leu Val Pro Gly
Asp Asp Pro Met Leu Leu Ala Tyr Leu Leu Asp Pro 370
375 380Ser Asn Thr Thr Pro Glu Gly Val Ala Arg Arg Tyr
Gly Gly Glu Trp385 390 395
400Thr Glu Asp Ala Ala His Arg Ala Leu Leu Ser Glu Arg Leu His Arg
405 410 415Asn Leu Leu Lys Arg
Leu Gln Gly Glu Glu Lys Leu Leu Trp Leu Tyr 420
425 430His Glu Val Glu Lys Pro Leu Ser Arg Val Leu Ala
His Met Glu Ala 435 440 445Thr Gly
Val Arg Leu Asp Val Ala Tyr Leu Gln Ala Leu Ser Leu Glu 450
455 460Leu Ala Glu Glu Ile Arg Arg Leu Glu Glu Glu
Val Phe Arg Leu Ala465 470 475
480Gly His Pro Phe Asn Leu Asn Ser Arg Asp Gln Leu Glu Arg Val Leu
485 490 495Phe Asp Glu Leu
Arg Leu Pro Ala Leu Gly Lys Thr Gln Lys Thr Gly 500
505 510Lys Arg Ser Thr Ser Ala Ala Val Leu Glu Ala
Leu Arg Glu Ala His 515 520 525Pro
Ile Val Glu Lys Ile Leu Gln His Arg Glu Leu Thr Lys Leu Lys 530
535 540Asn Thr Tyr Val Asp Pro Leu Pro Ser Leu
Val His Pro Asn Thr Gly545 550 555
560Arg Leu His Thr Arg Phe Asn Gln Thr Ala Thr Ala Thr Gly Arg
Leu 565 570 575Ser Ser Ser
Asp Pro Asn Leu Gln Asn Ile Pro Val Arg Thr Pro Leu 580
585 590Gly Gln Arg Ile Arg Arg Ala Phe Val Ala
Glu Ala Gly Trp Ala Leu 595 600
605Val Ala Leu Asp Tyr Ser Gln Ile Glu Leu Arg Val Leu Ala His Leu 610
615 620Ser Gly Asp Glu Asn Leu Ile Arg
Val Phe Gln Glu Gly Lys Asp Ile625 630
635 640His Thr Gln Thr Ala Ser Trp Met Phe Gly Val Pro
Pro Glu Ala Val 645 650
655Asp Pro Leu Met Arg Arg Ala Ala Lys Thr Val Asn Phe Gly Val Leu
660 665 670Tyr Gly Met Ser Ala His
Arg Leu Ser Gln Glu Leu Ala Ile Pro Tyr 675 680
685Glu Glu Ala Val Ala Phe Ile Glu Arg Tyr Phe Gln Ser Phe
Pro Lys 690 695 700Val Arg Ala Trp Ile
Glu Lys Thr Leu Glu Glu Gly Arg Lys Arg Gly705 710
715 720Tyr Val Glu Thr Leu Phe Gly Arg Arg Arg
Tyr Val Pro Asp Leu Asn 725 730
735Ala Arg Val Lys Ser Val Arg Glu Ala Ala Glu Arg Met Ala Phe Asn
740 745 750Met Pro Val Gln Gly
Thr Ala Ala Asp Leu Met Lys Leu Ala Met Val 755
760 765Lys Leu Phe Pro Arg Leu Arg Glu Met Gly Ala Arg
Met Leu Leu Gln 770 775 780Val His Asp
Glu Leu Leu Leu Glu Ala Pro Gln Ala Gly Ala Glu Glu785
790 795 800Val Ala Ala Leu Ala Lys Glu
Ala Met Glu Lys Ala Tyr Pro Leu Ala 805
810 815Val Pro Leu Glu Val Glu Val Gly Met Gly Glu Asp
Trp Leu Ser Ala 820 825 830Lys
Gly99834PRTArtificial SequenceAMINO ACID SEQUENCE OF DNA polymerase I
[Marinithermus hydrothermalis DSM 14884] 99Met Gln Gln Pro Ser Leu Phe
Asp His Arg Pro Glu Arg Ile Leu Ile1 5 10
15Val Asp Gly His His Leu Ala Tyr Arg Asn Tyr Phe Ala
Leu Gly Glu 20 25 30Leu Thr
Thr Ser Arg Gly Glu Pro Val Gln Ala Val Tyr Gly Phe Ala 35
40 45Arg Thr Leu Leu Lys Leu Leu Lys Glu Asp
Gly Asp Cys Val Ile Val 50 55 60Val
Phe Asp Ala Pro Gln Pro Ser Phe Arg His Glu Gln Phe Ala Ala65
70 75 80Tyr Lys Ala Gln Arg Ala
Pro Thr Pro Glu Asp Phe Lys Pro Gln Leu 85
90 95Glu Lys Ile Lys Gln Leu Val Asp Leu Leu Gly Leu
Ala Arg Phe Glu 100 105 110Leu
Ala Gly Tyr Glu Ala Asp Asp Val Ile Gly Ser Leu Ala Lys Lys 115
120 125Ala Glu Ala Glu Gly Tyr Glu Val Arg
Ile Val Thr Ser Asp Arg Asp 130 135
140Ser Tyr Gln Leu Leu Ser Asp Lys Val Arg Val Leu Lys Pro Asp Gly145
150 155 160Glu Glu Val Thr
Pro Glu Thr Val Arg Glu Lys Tyr Gly Val Thr Val 165
170 175Ala Gln Trp Val Asp Phe Arg Ala Leu Thr
Gly Asp Ala Ser Asp Asn 180 185
190Ile Pro Gly Val Arg Gly Ile Gly Ala Lys Thr Ala Ala Lys Leu Leu
195 200 205Ala Glu Trp Gly Ser Leu Glu
Asn Leu Tyr Ala His Leu Ala Glu Val 210 215
220Thr Pro Pro Ser Val Arg Lys Lys Leu Glu Ala Gly Arg Glu Lys
Ala225 230 235 240Ala Leu
Ser Arg Ala Leu Ser Glu Ile His Thr Asp Leu Ala Ile Glu
245 250 255Val Asp Phe Ala Ala Cys His
Arg Arg Pro Val Asp Arg Glu Ala Leu 260 265
270Arg Ala Phe Leu Glu Ala Leu Glu Phe Gly Ser Ile Leu Arg
Glu Leu 275 280 285Gly Leu Ile Glu
Ala Arg Ser Ala Glu Glu Ala Pro Trp Pro Pro Pro 290
295 300Pro Glu Ala Phe Leu Gly Tyr Val Leu Asp Arg Pro
Gln Pro Met Trp305 310 315
320Ala Glu Leu Lys Gly Leu Ala Gly Ala Trp Glu Gly Arg Val Ala Arg
325 330 335Gly Pro Ala Arg Ala
Lys Glu Leu Ala Arg Phe Glu Ala Val His Ala 340
345 350Leu Gln Ala Lys Asp Leu Thr Val Trp Ala Arg Arg
Glu Gly Val Arg 355 360 365Val Gln
Pro Gly Glu Asp Pro Leu Leu Leu Ala Tyr Leu Tyr Asp Pro 370
375 380Thr Asn Ser Asp Pro Ala Ala Thr Val Arg Arg
Tyr Gly Ala Gly Asp385 390 395
400Trp Ser Glu Asp Pro Ala Ala Arg Ala Leu Ala Ala Ala Glu Leu Trp
405 410 415Arg Ile Leu Gly
Glu Arg Leu Ala Gly Glu Glu Ala Leu Trp Trp Leu 420
425 430Tyr Arg Glu Val Glu Arg Pro Leu Ala Gly Val
Leu Ala Glu Met Glu 435 440 445His
Ala Gly Val Arg Val Asp Val Ala Tyr Leu Glu Ala Leu Ser Ala 450
455 460Glu Leu Gly Arg Glu Ile Ala Ala Ile Glu
Ala Glu Val His Arg Leu465 470 475
480Ala Gly Arg Ala Phe Asn Leu Asn Ser Arg Asp Gln Leu Glu Val
Ile 485 490 495Leu Tyr Asp
Glu Leu Gly Leu Thr Pro Thr Arg Arg Thr Gln Lys Thr 500
505 510Gly Arg Arg Ser Thr Ser Ala Ala Ala Leu
Glu Ala Leu Val Gly Ala 515 520
525His Pro Ile Val Glu Arg Ile Leu Ala Tyr Arg Glu Leu Ser Lys Leu 530
535 540Lys Gly Thr Tyr Leu Asp Pro Leu
Pro Arg Leu Val His Pro Ala Thr545 550
555 560Gly Arg Ile His Thr Arg Tyr His Gln Thr Gly Thr
Ala Thr Gly Arg 565 570
575Leu Ser Ser Ser Asp Pro Asn Leu Gln Asn Ile Pro Val Arg Thr Glu
580 585 590Val Gly Arg Arg Ile Arg
Arg Ala Phe Val Ala Glu Pro Gly Tyr Val 595 600
605Leu Val Ala Ala Asp Tyr Ser Gln Ile Glu Leu Arg Val Leu
Ala His 610 615 620Leu Ser Gly Asp Glu
Asn Leu Lys Arg Val Phe Gln Glu Arg Arg Asp625 630
635 640Ile His Thr Gln Thr Ala Ser Trp Met Phe
Gly Val Pro Pro Glu Ala 645 650
655Val Asp Pro Phe Arg Arg Arg Ala Ala Lys Thr Val Asn Phe Gly Val
660 665 670Leu Tyr Gly Met Ser
Pro His Arg Leu Ser Arg Glu Leu Gly Ile Glu 675
680 685Tyr Ala Glu Ala Glu Arg Phe Ile Gln Arg Tyr Phe
Glu Ser Tyr Pro 690 695 700Arg Val Gln
Ala Tyr Ile Glu Arg Thr Leu Glu Gln Ala Arg Glu Lys705
710 715 720Gly Tyr Val Glu Thr Leu Phe
Gly Arg Arg Arg Tyr Ile Pro Asp Ile 725
730 735Arg Ser Arg Asn Arg Asn Val Arg Glu Ala Ala Glu
Arg Met Ala Phe 740 745 750Asn
Met Pro Val Gln Gly Thr Ala Ala Asp Leu Met Lys Leu Ala Met 755
760 765Val Lys Leu Ala Pro Glu Ile Arg Ser
Leu Gly Ala Arg Leu Ile Leu 770 775
780Gln Val His Asp Glu Leu Val Leu Glu Ala Pro Gln Glu Arg Ala Glu785
790 795 800Ala Val Ala Arg
Val Val Arg Glu Val Met Glu Gly Ala Trp Ala Leu 805
810 815Asp Val Pro Leu Glu Val Glu Val Gly Ile
Gly Glu Asn Trp Leu Glu 820 825
830Ala Lys100833PRTArtificial SequenceAMINO ACID SEQUENCE OF DNA
polymerase I [Thermus filiformis] 100Met Thr Pro Leu Phe Asp Leu Glu
Glu Pro Pro Lys Arg Val Leu Leu1 5 10
15Val Asp Gly His His Leu Ala Tyr Arg Thr Phe Tyr Ala Leu
Ser Leu 20 25 30Thr Thr Ser
Arg Gly Glu Pro Val Gln Met Val Tyr Gly Phe Ala Arg 35
40 45Ser Leu Leu Lys Ala Leu Lys Glu Asp Gly Gln
Ala Val Val Val Val 50 55 60Phe Asp
Ala Lys Ala Pro Ser Phe Arg His Glu Ala Tyr Glu Ala Tyr65
70 75 80Lys Ala Gly Arg Ala Pro Thr
Pro Glu Asp Phe Pro Arg Gln Leu Ala 85 90
95Leu Val Lys Arg Leu Val Asp Leu Leu Gly Leu Val Arg
Leu Glu Ala 100 105 110Pro Gly
Tyr Glu Ala Asp Asp Val Leu Gly Thr Leu Ala Lys Lys Ala 115
120 125Glu Arg Glu Gly Met Glu Val Arg Ile Leu
Thr Gly Asp Arg Asp Phe 130 135 140Phe
Gln Leu Leu Ser Glu Lys Val Ser Val Leu Leu Pro Asp Gly Thr145
150 155 160Leu Val Thr Pro Lys Asp
Val Gln Glu Lys Tyr Gly Val Pro Pro Glu 165
170 175Arg Trp Val Asp Phe Arg Ala Leu Thr Gly Asp Arg
Ser Asp Asn Ile 180 185 190Pro
Gly Val Ala Gly Ile Gly Glu Lys Thr Ala Leu Arg Leu Leu Ala 195
200 205Glu Trp Gly Ser Val Glu Asn Leu Leu
Lys Asn Leu Asp Arg Val Lys 210 215
220Pro Asp Ser Val Arg Arg Lys Ile Glu Ala His Leu Glu Asp Leu Arg225
230 235 240Leu Ser Leu Asp
Leu Ala Arg Ile Arg Thr Asp Leu Pro Leu Glu Val 245
250 255Asp Phe Lys Ala Leu Arg Arg Arg Thr Pro
Asp Leu Glu Gly Leu Arg 260 265
270Ala Phe Leu Glu Glu Leu Glu Phe Gly Ser Leu Leu His Glu Phe Gly
275 280 285Leu Leu Gly Gly Glu Lys Pro
Arg Glu Glu Ala Pro Trp Pro Pro Pro 290 295
300Glu Gly Ala Phe Val Gly Phe Leu Leu Ser Arg Lys Glu Pro Met
Trp305 310 315 320Ala Glu
Leu Leu Ala Leu Ala Ala Ala Ala Glu Gly Arg Val His Arg
325 330 335Ala Thr Ser Pro Val Glu Ala
Leu Ala Asp Leu Lys Glu Ala Arg Gly 340 345
350Phe Leu Ala Lys Asp Leu Ala Val Leu Ala Leu Arg Glu Gly
Val Ala 355 360 365Leu Asp Pro Thr
Asp Asp Pro Leu Leu Val Ala Tyr Leu Leu Asp Pro 370
375 380Ala Asn Thr Asn Pro Glu Gly Val Ala Arg Arg Tyr
Gly Gly Glu Phe385 390 395
400Thr Glu Asp Ala Ala Glu Arg Ala Leu Leu Ser Glu Arg Leu Phe Gln
405 410 415Asn Leu Phe Pro Arg
Leu Ser Glu Lys Leu Leu Trp Leu Tyr Gln Glu 420
425 430Val Glu Arg Pro Leu Ser Arg Val Leu Ala His Met
Glu Ala Arg Gly 435 440 445Val Arg
Leu Asp Val Pro Leu Leu Glu Ala Leu Ser Phe Glu Leu Glu 450
455 460Lys Glu Met Glu Arg Leu Glu Gly Glu Val Phe
Arg Leu Ala Gly His465 470 475
480Pro Phe Asn Leu Asn Ser Arg Asp Gln Leu Glu Arg Val Leu Phe Asp
485 490 495Glu Leu Gly Leu
Thr Pro Val Gly Arg Thr Glu Lys Thr Gly Lys Arg 500
505 510Ser Thr Ala Gln Gly Ala Leu Glu Ala Leu Arg
Gly Ala His Pro Ile 515 520 525Val
Glu Leu Ile Leu Gln Tyr Arg Glu Leu Ser Lys Leu Lys Ser Thr 530
535 540Tyr Leu Asp Pro Leu Pro Arg Leu Val His
Pro Arg Thr Gly Arg Leu545 550 555
560His Thr Arg Phe Asn Gln Thr Ala Thr Ala Thr Gly Arg Leu Ser
Ser 565 570 575Ser Asp Pro
Asn Leu Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln 580
585 590Arg Ile Arg Lys Ala Phe Val Ala Glu Glu
Gly Trp Leu Leu Leu Ala 595 600
605Ala Asp Tyr Ser Gln Ile Glu Leu Arg Val Leu Ala His Leu Ser Gly 610
615 620Asp Glu Asn Leu Lys Arg Val Phe
Arg Glu Gly Lys Asp Ile His Thr625 630
635 640Glu Thr Ala Ala Trp Met Phe Gly Leu Asp Pro Ala
Leu Val Asp Pro 645 650
655Lys Met Arg Arg Ala Ala Lys Thr Val Asn Phe Gly Val Leu Tyr Gly
660 665 670Met Ser Ala His Arg Leu
Ser Gln Glu Leu Gly Ile Asp Tyr Lys Glu 675 680
685Ala Glu Ala Phe Ile Glu Arg Tyr Phe Gln Ser Phe Pro Lys
Val Arg 690 695 700Ala Trp Ile Glu Arg
Thr Leu Glu Glu Gly Arg Thr Arg Gly Tyr Val705 710
715 720Glu Thr Leu Phe Gly Arg Arg Arg Tyr Val
Pro Asp Leu Ala Ser Arg 725 730
735Val Arg Ser Val Arg Glu Ala Ala Glu Arg Met Ala Phe Asn Met Pro
740 745 750Val Gln Gly Thr Ala
Ala Asp Leu Met Lys Ile Ala Met Val Lys Leu 755
760 765Phe Pro Arg Leu Lys Pro Leu Gly Ala His Leu Leu
Leu Gln Val His 770 775 780Asp Glu Leu
Val Leu Glu Val Pro Glu Asp Arg Ala Glu Glu Ala Lys785
790 795 800Ala Leu Val Lys Glu Val Met
Glu Asn Thr Tyr Pro Leu Asp Val Pro 805
810 815Leu Glu Val Glu Val Gly Val Gly Arg Asp Trp Leu
Glu Ala Lys Gly 820 825
830Asp101850PRTArtificial SequenceAMINO ACID SEQUENCE OF DNA polymerase I
[Meiothermus timidus] 101Met Gln Gln Arg Ser Leu Phe Asp Pro Glu Pro
Glu Thr Gln Pro Lys1 5 10
15Pro Ala Pro Ala Pro Arg Ala Glu Arg Val Ile Leu Ile Asp Gly His
20 25 30His Leu Ala Tyr Arg Thr Tyr
Phe Ala Phe Glu Lys Leu Thr Thr Ser 35 40
45Thr Gly Glu Pro Val Gln Ala Ile Phe Gly Phe Leu Arg Thr Leu
Leu 50 55 60Lys Tyr Leu Lys Glu Asn
Ser Ser Cys Val Ile Val Val Phe Asp Ala65 70
75 80Pro Ala Arg Thr Phe Arg His Asp Asn Phe Glu
Ala Tyr Lys Ala Gly 85 90
95Arg Ala Pro Thr Pro Glu Asp Leu Pro Glu Gln Ile Arg Lys Ile Lys
100 105 110Gln Leu Val Glu Leu Leu
Gly Leu Val Cys Leu Glu Val Pro Gly Tyr 115 120
125Glu Ala Asp Asp Val Ile Gly Thr Leu Ala Lys Lys Ala Glu
Ala Glu 130 135 140Gly Tyr Gln Val Arg
Ile Leu Thr Gly Asp Arg Asp Ala Tyr Gln Leu145 150
155 160Leu Ser Glu Asn Ile Trp Ile Phe His Pro
Asp Gly Ser Ile Ile Gly 165 170
175Pro Ser Gln Val Arg Glu Lys Tyr Gly Val Ser Val Glu Gln Trp Val
180 185 190Asp Tyr Arg Ala Leu
Thr Gly Asp Ala Ser Asp Asn Ile Pro Gly Ala 195
200 205Lys Gly Ile Gly Pro Lys Gly Ala Ser Lys Leu Leu
Glu Glu Trp Lys 210 215 220Ser Leu Asp
Asn Leu Leu Thr His Leu Glu Glu Val Arg Pro Glu Arg225
230 235 240Thr Arg Glu Leu Ile Arg Ala
Ser Leu Glu Asp Ile Lys Leu Ser Arg 245
250 255Glu Leu Ser Gln Ile His Thr Asp Val Pro Leu Glu
Pro Glu Leu Cys 260 265 270Asp
Phe Ser Lys Ala His Arg Arg Glu Pro Lys Thr Ala Glu Leu Arg 275
280 285Glu Met Leu Glu Arg Leu Glu Phe Gly
Ser Ile Leu Arg Asp Leu Gly 290 295
300Leu Leu Glu Ala His Arg Pro Thr Thr Glu Ala Pro Trp Pro Pro Pro305
310 315 320Pro Gly Ala Phe
Leu Gly Phe Thr Leu Asp Arg Ala Gln Pro Met Trp 325
330 335Ala Glu Leu Thr Gly Leu Ala Ala Ala Lys
Gly Asp Thr Leu Tyr Arg 340 345
350Gly Pro Thr Asp Leu Ala Asp Leu Lys Thr Leu Gly Arg Leu Asn Ser
355 360 365Leu Glu Ala Lys Asp Leu Ser
Val Leu Leu Leu Arg Glu Gly Tyr Trp 370 375
380Val Pro Pro Gly Asp Asp Pro Met Leu Leu Ala Tyr Leu Tyr Asp
Pro385 390 395 400Ala Asn
Ser Glu Pro Ala Gly Thr Val Arg Arg Tyr Gly Ala Gly Asp
405 410 415Trp Thr Thr Asp Pro Ala Gln
Arg Ala Leu Ala Ala Gln Thr Leu Trp 420 425
430Glu Thr Leu Gly Arg Arg Thr Glu Lys Asp Glu Arg Leu Trp
Trp Leu 435 440 445Tyr Arg Glu Val
Glu Gln Pro Leu Ser Gly Ile Leu Ala Arg Met Glu 450
455 460Val Gln Gly Val Ala Leu Asp Val Pro Tyr Leu Arg
Glu Leu Ser Glu465 470 475
480Glu Leu Gly Lys Glu Leu Gly Tyr Leu Glu Ala Glu Ile His Arg Leu
485 490 495Ala Gly Arg Pro Phe
Asn Val Asn Ser Arg Asp Gln Leu Glu Ala Ile 500
505 510Leu Tyr Asp Glu Leu Lys Leu Gln Ala Gly Gly Lys
Lys Thr Ala Thr 515 520 525Gly Lys
Arg Ser Thr Ala Ala Ser Val Leu Glu Glu Met Arg Ser Leu 530
535 540His Pro Ile Val Asp Lys Ile Leu Asp Tyr Arg
Glu Leu Ser Lys Leu545 550 555
560Lys Ser Thr Tyr Leu Asp Pro Leu Pro Lys Leu Ile His Pro Lys Thr
565 570 575Gly Arg Leu His
Thr Arg Phe Asn Gln Thr Ala Thr Ala Thr Gly Arg 580
585 590Leu Ser Ser Ser Asp Pro Asn Leu Gln Asn Ile
Pro Val Arg Thr Glu 595 600 605Val
Gly Arg Lys Ile Arg Lys Ala Phe Val Ala Arg Pro Gly Tyr Cys 610
615 620Leu Val Ala Ala Asp Tyr Ser Gln Ile Glu
Leu Arg Leu Leu Ala His625 630 635
640Leu Ser Gly Asp Glu Asn Leu Lys Gln Val Phe Leu Glu Gly Arg
Asp 645 650 655Ile His Thr
Gln Thr Ala Ala Trp Met Phe Gly Ile Ala Pro Glu Thr 660
665 670Val Asp Ser Tyr Arg Arg Arg Ala Ala Lys
Thr Val Val Phe Gly Val 675 680
685Leu Tyr Gly Met Ser Ala His Arg Leu Ser Ser Glu Leu Ser Ile Pro 690
695 700Tyr Ala Glu Ala Glu Gly Phe Ile
Glu Arg Tyr Phe Ala Thr Tyr Pro705 710
715 720Lys Val Arg Ser Trp Ile Asp Arg Thr Leu Ala Glu
Ala Arg Glu Arg 725 730
735Gly Tyr Val Glu Thr Leu Phe Gly Arg Lys Arg Phe Val Ser Glu Leu
740 745 750Ser Ala Lys Val Ser Ser
Val Arg Gln Ala Ala Glu Arg Met Ala Phe 755 760
765Asn Met Pro Val Gln Gly Thr Ala Ala Asp Leu Met Lys Leu
Ala Met 770 775 780Val Lys Leu Gly Pro
Lys Leu Glu Pro Leu Asp Ala His Leu Val Leu785 790
795 800Gln Val His Asp Glu Leu Val Ile Glu Ala
Pro Arg Glu Arg Ala Glu 805 810
815Glu Val Ala Glu Leu Ala Arg Glu Thr Met Arg Thr Ala Trp Glu Phe
820 825 830Glu Val Pro Leu Glu
Val Gly Thr Gly Val Gly Glu Asn Trp Leu Glu 835
840 845Ala Lys 850102838PRTArtificial SequenceAMINO
ACID SEQUENCE OF DNA polymerase I [Desulfurobacterium
thermolithotrophum] 102Met Ser Lys Lys Thr Ile Tyr Leu Phe Asp Gly Thr
Ser Leu Ala Tyr1 5 10
15Arg Ala Tyr Tyr Ala Ile Lys Asp Leu Thr Thr Ser Lys Gly Phe Pro
20 25 30Thr Asn Ala Ile Tyr Gly Phe
Ile Arg Met Phe Leu Lys Leu Tyr Lys 35 40
45Asp Phe Lys Pro Asn Tyr Ile Ala Val Ala Phe Asp Val Gly Lys
Lys 50 55 60Thr Phe Arg Ser Lys Leu
Leu Lys Glu Tyr Lys Ala Asn Arg Lys Pro65 70
75 80Thr Pro Asp Ser Phe Lys Leu Gln Leu Pro Tyr
Ile Lys Lys Phe Leu 85 90
95Glu Cys Leu Gly Ile Thr Ile Leu Glu Lys Glu Gly Phe Glu Ala Asp
100 105 110Asp Ile Leu Gly Thr Ala
Ala Lys Lys Phe Ala Ser Glu Gly Tyr Arg 115 120
125Val Phe Val Val Thr Pro Asp Lys Asp Met Arg Gln Leu Ile
Asp Gly 130 135 140Lys Ile Ser Val Ile
Ala Ile Asn Lys Thr Gly Gln Lys Glu Ile Tyr145 150
155 160Asp Leu Val Ser Phe Lys Glu Lys Tyr Gly
Ile Glu Pro Glu Gln Ile 165 170
175Pro Asp Phe Phe Gly Leu Val Gly Asp Ser Val Asp Asn Ile Pro Gly
180 185 190Val Pro Ser Ile Gly
Glu Lys Thr Ala Gln Lys Leu Ile Ala Glu Phe 195
200 205Gly Asn Leu Glu Asn Leu Tyr Lys Asn Leu Ser Lys
Leu Thr Ser Lys 210 215 220Arg Arg Glu
Val Leu Glu Lys Phe Lys Glu Gln Ala Phe Leu Ser Arg225
230 235 240Glu Leu Ala Lys Ile Lys Lys
Asn Val Pro Ile Glu Ile Ser Leu Glu 245
250 255Asn Leu Lys Val Lys Glu Pro Gln Gly Lys Cys Leu
Gly Glu Phe Leu 260 265 270Lys
Glu Leu Glu Met Arg Ser Ile Val Ser Glu Leu Lys Lys Leu Phe 275
280 285Pro Ser Ile Asp Phe Gly Glu Phe Asp
Lys Phe Lys Lys Ser Lys Lys 290 295
300Leu Ser Lys Glu Glu Phe Lys Arg Lys Ile Gln Pro Ala Asp Leu Phe305
310 315 320Ser Thr Pro Glu
Val Ala Val Ile His Asp Phe Glu Arg Val Ile Ala 325
330 335Ile Asn Glu Gly Tyr Val Glu Val Asp Phe
Lys Glu Ile Glu Glu Phe 340 345
350Leu Pro Glu Lys Gly Lys Ile Tyr Thr Phe Asp Leu Lys Ser Leu Tyr
355 360 365His Lys Val Gly Glu Lys Leu
Arg Asn Phe Ser Phe Ile Asp Leu Ser 370 375
380Val Cys Glu Tyr Leu Leu Asn Pro Leu Gln Lys Asp Tyr Ser Ser
Lys385 390 395 400Asp Ile
Leu Lys Lys Arg Leu Gly Val Val Ser Leu Glu Glu Val Lys
405 410 415Asp Tyr Val His Tyr Thr Leu
Asp Ile Gly Lys Glu Ile Leu Asn Glu 420 425
430Leu Lys Lys Glu Gly Leu Glu Asn Leu Tyr Glu Ser Ile Glu
His Pro 435 440 445Leu Thr Phe Val
Leu Tyr Lys Met Glu Lys Arg Gly Val Leu Phe Asp 450
455 460Lys Glu Tyr Leu Glu Asn Phe Gly Lys Glu Leu Asp
Arg Lys Ser Lys465 470 475
480Glu Ile Glu Lys Lys Ile Phe Glu Ile Ala Gly Glu Lys Phe Asn Leu
485 490 495Asn Ser Pro Lys Gln
Leu Ser Lys Ile Leu Phe Glu Lys Leu Lys Leu 500
505 510Lys Pro Leu Lys Lys Thr Lys Ser Gly Tyr Ser Thr
Asp Val Glu Thr 515 520 525Leu Thr
Ala Leu Ala Leu Lys Gly His Lys Ile Ala Glu Leu Leu Leu 530
535 540Glu Tyr Arg Lys Leu Thr Lys Leu Asn Ser Thr
Phe Val Lys Gly Ile545 550 555
560Leu Lys His Met Asp Glu Asp Gly Arg Val Arg Thr Thr Phe Ile Gln
565 570 575Thr Gly Thr Ala
Thr Gly Arg Leu Ser Ser Ala Glu Pro Asn Leu Gln 580
585 590Asn Leu Pro Val Ser Asp Glu Ile Ser Lys Lys
Ile Arg Tyr Ala Val 595 600 605Thr
Ala Pro Ala Gly Tyr Asn Leu Val Trp Ala Asp Tyr Ser Gln Ile 610
615 620Glu Leu Arg Ile Leu Ala His Leu Ser Gln
Asp Glu Lys Leu Leu Glu625 630 635
640Ala Tyr Arg Lys Gly Arg Asp Ile His Thr Glu Thr Ala Ser Tyr
Leu 645 650 655Phe Gly Ile
Ser Ala Glu Glu Val Asp Glu Arg Leu Arg Arg Ile Ala 660
665 670Lys Thr Val Asn Phe Gly Ile Ile Tyr Gly
Met Ser Pro His Gly Leu 675 680
685Ser Glu Arg Leu Gly Ile Ser Val Glu Glu Ala Glu Lys Tyr Ile Asp 690
695 700Arg Tyr Phe Glu Lys Phe Pro Lys
Val Lys Glu Tyr Ile Glu Asn Thr705 710
715 720Leu Arg Glu Ala Tyr Glu Lys Gly Tyr Val Lys Thr
Ile Phe Gly Arg 725 730
735Lys Arg Pro Leu Pro Glu Leu Lys Ser Ser Asn Lys Asn Ile Arg Ser
740 745 750Phe Gly Glu Arg Ala Ala
Val Asn Ala Thr Ile Gln Gly Thr Ala Ala 755 760
765Asp Ile Met Lys Leu Ala Met Val Lys Leu Tyr Lys Lys Leu
Glu Lys 770 775 780Leu Gly Ala Tyr Met
Val Leu Gln Val His Asp Glu Ile Val Ile Glu785 790
795 800Ala Leu Glu Glu Lys Thr Glu Glu Ile Met
Lys Ile Val Lys Glu Thr 805 810
815Met Glu Asn Val Val Glu Phe Ser Val Pro Leu Thr Val Asp Val Lys
820 825 830Val Gly Lys His Trp
Ser 835103955PRTArtificial SequenceAMINO ACID SEQUENCE OF DNA
polymerase I [Caldilinea aerophila DSM 14535 = NBRC 104270] 103Met
Pro Gly Arg Val Val Ser Ala Ser Ile Val Ala Pro Pro Arg Asn1
5 10 15Gly Ala Ser Thr Met Ala Leu
Leu Leu Leu Ile Asp Gly His Ser Gln 20 25
30Ala Tyr Arg Ala Tyr Phe Gly Ile Lys Thr Pro Leu Ser Thr
Arg Ala 35 40 45Gly Glu Pro Thr
Ser Ala Val Tyr Gly Phe Thr Arg Lys Leu Leu Ala 50 55
60Ala Leu Arg Asp Tyr His Pro Asp Cys Ile Ala Val Ala
Phe Asp Ala65 70 75
80Gly Asp Thr Trp Arg His Ala Glu Phe Pro Asp Tyr Lys Ala Thr Arg
85 90 95Asp Val Met Pro Asp Asp
Met Arg Thr Gln Met Glu Arg Ile Glu Ser 100
105 110Leu Leu Arg Ala Phe Asn Ile Pro Ile Ile Thr Tyr
Pro Asn Phe Glu 115 120 125Ala Asp
Asp Val Leu Gly Thr Leu Ala Arg Lys Ala Ala Ala Gln Gly 130
135 140His Asp Val Leu Val Met Thr Gly Asp Arg Asp
Met Phe Gln Leu Val145 150 155
160Asp Glu Arg Val Lys Ile Leu Tyr Thr Ser Gly Gly Pro Asn Pro Val
165 170 175Thr Ser Val Tyr
Gly Ile Glu Gln Ile Gln Glu Arg Tyr Gly Leu Thr 180
185 190Pro Gln Gln Phe Ile Asp Phe Lys Ala Leu Thr
Gly Asp Ser Ser Asp 195 200 205Asn
Ile Pro Gly Val Pro Gly Val Gly Glu Lys Thr Ala Ile Lys Leu 210
215 220Leu Gln Gln Tyr Gly Ser Ile Glu Gly Ile
Tyr Glu His Leu Asp Glu225 230 235
240Ile Gly Gly Pro Lys Leu Arg Gln Ala Leu Ser Asp Ala Arg Glu
Gln 245 250 255Val Met Arg
Asn Arg Arg Leu Val Thr Ile His Thr Asp Leu Asp Ile 260
265 270Ser Phe Asp Leu Ala Gln Cys Ala Val His
Asp Tyr Asn Pro Asp Ala 275 280
285Val Leu Glu Leu Phe Asn Glu Leu Glu Phe Arg Ser Leu Leu Lys Glu 290
295 300Leu Pro Ala Ser Thr Arg Asn Ala
Ala Glu Ala Leu Ala Thr Glu Pro305 310
315 320Gln Gln Ala Gly Gln Met Thr Leu Phe Ser Ala Ala
Pro Thr Pro Leu 325 330
335Thr Ser Leu Thr Ile Asp Gly Glu Arg Thr Val Leu Ile Val Gln Asp
340 345 350Arg Thr Thr Leu Ala Gln
Leu Val Glu Ser Leu Arg Ala Ala Glu Arg 355 360
365Leu Ser Phe Asp Val Glu Thr Thr Ala Thr Asp Ala Met Gln
Ala Ala 370 375 380Leu Val Gly Leu Gly
Ile Ala Trp Ala Pro Gly Gln Thr Ala Tyr Ile385 390
395 400Pro Val Thr His Thr Ile Gly Glu Gln Leu
Asp Trp Ser His Ala Met 405 410
415Glu Ala Ile Arg Pro Phe Phe Ala Asp Ala Ala Leu Pro Lys Val Ala
420 425 430His Asn Ala Lys Tyr
Asp Leu Ile Val Leu Arg Arg His Gly Leu Asp 435
440 445Val Met Gly Val Leu Asp Asp Thr Leu Leu Met Ala
Trp Leu Leu Asp 450 455 460Pro Ala Ser
Arg Ser Leu Gly Leu Lys Ala Leu Ala Glu Thr Glu Leu465
470 475 480Gly Trp Lys Met Thr Glu Leu
Ser Glu Leu Ile Gly Ser Gly Arg Lys 485
490 495Gln Ile Thr Ile Asp Gln Val Pro Leu Glu Gln Ala
Ala Ala Tyr Cys 500 505 510Gly
Ala Asp Val Asp Ala Thr Ile Arg Leu Tyr Ala Thr Leu Glu Pro 515
520 525Arg Leu Arg Glu Ala Gly Leu Glu Glu
Leu Tyr Arg Thr Ile Glu Arg 530 535
540Pro Leu Leu Pro Val Leu Thr Ala Met Glu Met Ala Gly Val Leu Leu545
550 555 560Asp Val Glu Phe
Leu Lys Gln Met Ser Ala Glu Leu Ser Lys Arg Leu 565
570 575Tyr Glu Leu Glu Gln Ser Leu Tyr Glu Val
Val Gly His Ala Phe Asn 580 585
590Leu Arg Ser Thr Gln Gln Leu Ser Gln Val Leu Phe Asp Glu Met Gly
595 600 605Phe Pro Ser Lys Gly Leu Lys
Lys Thr Ala Ser Gly His Tyr Ser Thr 610 615
620Ala Ala Asp Val Leu Glu Thr Leu Ala Ala Tyr Gly Asp Val Leu
Ser625 630 635 640Pro Thr
Gln Gln Arg Leu Ile Glu Leu Ile Leu Glu His Arg Gln Leu
645 650 655Glu Lys Leu Arg Ser Thr Tyr
Val Asp Ala Leu Pro Ala Leu Val Asn 660 665
670Pro Gln Thr Gly Arg Val His Thr Ser Phe Ser Gln Thr Gly
Ala Val 675 680 685Thr Gly Arg Leu
Ser Ser Ser Asn Pro Asn Leu Gln Asn Ile Pro Ile 690
695 700Arg Thr Glu Ile Gly Arg Glu Ile Arg Arg Ala Ile
Val Ala Pro Pro705 710 715
720Gly Trp Gln Leu Ile Ser Ala Asp Tyr Ser Gln Val Glu Leu Arg Val
725 730 735Leu Ala His Met Ala
Asn Glu Pro Leu Leu Ile Glu Ala Phe Gln Ala 740
745 750Asp Gln Asp Ile His Ala Val Thr Ala Ser Lys Leu
Phe Gly Val Pro 755 760 765Val Glu
Ala Val Thr Arg Asp Gln Arg Ser Leu Gly Lys Thr Ile Asn 770
775 780Phe Ala Thr Ile Tyr Gly Val Ser Glu Phe Gly
Leu Ser Ser Arg Thr785 790 795
800Glu Leu Thr Arg Glu Gln Ala Arg Gln Phe Leu Glu Gln Tyr Phe Gln
805 810 815Thr Tyr Pro Arg
Ile Arg Ala Phe Leu Asp His Ile Leu Glu Glu Ala 820
825 830Arg Glu Lys Gly Tyr Val Gln Thr Leu Leu Gly
Arg Lys Arg Phe Phe 835 840 845Pro
Glu Leu Lys Ser Gly Lys Leu Pro Pro Asn Gln Arg Ala Ala Val 850
855 860Glu Arg Ala Ala Ile Asn Ala Pro Ile Gln
Gly Thr Ala Ala Asp Ile865 870 875
880Met Lys Ile Ala Met Ile Arg Leu Tyr Glu Arg Leu Gln Asn Asp
Gly 885 890 895Tyr Arg Thr
Arg Leu Leu Ile Gln Val His Asp Glu Leu Val Leu Glu 900
905 910Ala Pro Pro Glu Glu Leu Glu Ser Ala Thr
His Leu Val Arg Glu Thr 915 920
925Met Ala Asn Ala Tyr Gln Leu Thr Val Pro Leu Lys Val Asp Val Glu 930
935 940Ile Gly Pro Asn Trp Arg Asp Met
Thr Lys Ala945 950 955104829PRTArtificial
SequenceAMINO ACID SEQUENCE OF DNA polymerase I [[Eubacterium]
siraeum] 104Met Gly Phe Leu Ile Ile Asp Gly Asn Ser Ile Leu Asn Arg Ala
Phe1 5 10 15Tyr Gly Ile
Arg Val Leu Thr Asn Ser Arg Gly Val Ala Thr Asn Ala 20
25 30Val Thr Gly Phe Met Asn Thr Leu Leu Met
Leu Glu Lys Asp Val Asp 35 40
45Pro Asp Met Ile Ala Val Ala Phe Asp Leu Lys Ala Pro Thr Phe Arg 50
55 60His Lys Met Tyr Asp Gly Tyr Lys Ala
Asn Arg Lys Gly Met Pro Glu65 70 75
80Asp Leu Ala Gln Gln Leu Pro Tyr Met Lys Lys Ile Ile Thr
Ala Met 85 90 95Gly Ile
Thr Ile Ile Glu Lys Glu Gly Phe Glu Ala Asp Asp Ile Ile 100
105 110Gly Thr Val Ser Ala Ala Cys Ala Asp
Lys Lys Ile Pro Cys Thr Val 115 120
125Ser Thr Gly Asp Arg Asp Ser Phe Gln Leu Val Asn Asp Tyr Val Thr
130 135 140Val Arg Leu Ala Lys Thr Lys
Gly Asp Ile Tyr Tyr Thr Pro Asp Val145 150
155 160Ile Met Glu Glu Tyr Gly Val Thr Pro Lys Gln Met
Ile Glu Val Lys 165 170
175Ala Leu Met Gly Asp Ser Ser Asp Asn Ile Pro Gly Val Pro Gly Ile
180 185 190Gly Glu Lys Thr Ala Leu
Ser Leu Ile Lys Glu Phe Ala Ser Val Asp 195 200
205Gly Val Tyr Glu Asn Ile Gly Ser Thr Leu Ile Thr Lys Gly
Val Arg 210 215 220Thr Lys Leu Glu Asn
Gly Lys Glu Ser Cys Tyr Met Ser Arg Gln Leu225 230
235 240Ala Glu Ile Cys Leu Thr Ala Pro Ile Asp
Thr Glu Leu Ser His Tyr 245 250
255Val Pro Lys Glu Arg Asp Asp Thr Glu Leu Ala Arg Leu Leu Ser Glu
260 265 270Leu Glu Met Tyr Lys
Met Leu Gln Lys Leu Lys Leu His Pro Thr Ser 275
280 285Ala Pro Ala Gly Ser Lys Glu Ala Leu Glu Glu Ser
Ala Ala Lys Gln 290 295 300Ile Pro Ala
Met Pro Ala Gly Asp Ile Val Leu Thr Gln Glu Gly Ser305
310 315 320Val Tyr Ala Gly Thr Val Gly
Ala Pro Val Glu Leu Ser Asp Gly Glu 325
330 335Leu Lys Ala Tyr Ala Asp Ser Asp Ser Thr Lys Tyr
Thr Phe Asp Ile 340 345 350Lys
Glu Thr Leu Thr Val Thr Gly Cys Glu Arg Leu Lys Asn Asn Arg 355
360 365Phe Asp Thr Thr Leu Ala Ala Tyr Leu
Ala Asp Pro Asp Ser Asn Asp 370 375
380Tyr Ser Leu Ser Arg Leu Cys Ala Gln Tyr Gly Val Pro Glu Gly Asn385
390 395 400Ser Ile Gln Glu
Lys Ser Ile Thr Val Ala Ala Leu Asn Asp Ile Leu 405
410 415Asn Cys Lys Ile Ser Glu Thr Gly Ser Ala
Ala Val Leu Thr Asp Ile 420 425
430Glu Ile Pro Leu Ala Thr Val Leu Val Ala Met Glu Arg Glu Gly Val
435 440 445Ser Ile Asp Ala Asp Gly Ile
Lys Ala Phe Gly Lys Glu Val Cys Glu 450 455
460Lys Ala Glu Lys Ile Ser Arg Glu Ile Tyr Glu Tyr Ala Gly Tyr
Glu465 470 475 480Phe Asn
Ile Gly Ser Pro Lys Gln Leu Gly Ser Val Leu Phe Glu Lys
485 490 495Leu Ala Leu Pro Ser Ala Lys
Lys Thr Lys Thr Gly Tyr Ser Thr Asn 500 505
510Ala Asp Val Leu Glu Ser Leu Met Asp Lys His Pro Ile Val
Pro Leu 515 520 525Ile Thr Glu Tyr
Arg Ala Leu Thr Lys Leu Gln Asn Thr Tyr Val Thr 530
535 540Gly Leu Leu Lys Val Val Gly Glu Asp Gly Arg Ile
His Ser Thr Phe545 550 555
560Lys Gln Thr Glu Thr Arg Thr Gly Arg Ile Ser Ser Ala Glu Pro Asn
565 570 575Ile Gln Asn Ile Pro
Val Arg Thr Pro Leu Gly Arg Glu Met Arg Arg 580
585 590Phe Phe Thr Ala Lys Asp Gly Tyr Leu Leu Val Asp
Ala Asp Tyr Ser 595 600 605Gln Ile
Glu Leu Arg Val Leu Ala His Ile Ser Gly Asp Glu Ile Met 610
615 620Lys Lys Ala Phe Leu Asp Gly Val Asp Ile His
Thr Val Thr Ala Ser625 630 635
640Gln Val Phe Asn Gln Pro Ile Glu Trp Val Thr Pro Asp Leu Arg Ser
645 650 655Lys Ala Lys Ala
Val Asn Phe Gly Ile Val Tyr Gly Ile Gly Ala Phe 660
665 670Ser Leu Ser Lys Asp Ile Gly Val Ser Val Pro
Lys Ala Ser Glu Tyr 675 680 685Ile
Arg Ser Tyr Leu Ser Lys Tyr Ser Gly Ile Ala His Tyr Met Glu 690
695 700Gln Thr Val Ala Lys Ala Lys Arg Asp Gly
Tyr Val Glu Thr Met Phe705 710 715
720Gly Arg Arg Arg Tyr Ile Lys Glu Leu Ala Ala Lys Asn Lys Asn
Leu 725 730 735Gln Ala Phe
Gly Glu Arg Val Ala Lys Asn Thr Pro Ile Gln Gly Thr 740
745 750Ala Ala Asp Ile Ile Lys Ile Ala Met Ile
Lys Val Tyr Asn Arg Leu 755 760
765Glu Glu Ser Gly Leu Asp Ala Arg Leu Ile Leu Gln Val His Asp Glu 770
775 780Leu Ile Val Glu Ala Lys Glu Asp
Cys Ala Glu Lys Val Ala Leu Leu785 790
795 800Leu Lys Glu Glu Met Glu Asn Ala Val Lys Leu Thr
Val Pro Met Thr 805 810
815Val Asp Val Asn Ile Gly Lys Thr Trp Tyr Asp Thr His 820
825105399PRTArtificial SequenceAMINO ACID SEQUENCE OF DNA
polymerase [Clostridium leptum CAG27] 105Met Glu Ile Pro Leu Ala Gln
Val Leu Ala Arg Met Glu Asn Ile Gly1 5 10
15Phe Leu Val Asp Gly Glu Ser Ile Arg Val Tyr Gly Glu
Arg Leu Glu 20 25 30Thr Glu
Ile Glu Ala Leu Gln Lys Gln Ile Tyr Glu Glu Val Gly Tyr 35
40 45Glu Phe Asn Ile Asn Ser Pro Lys Gln Leu
Gly Asp Ala Leu Phe Val 50 55 60Lys
Leu Gly Leu Pro Ser Gly Lys Lys Thr Lys Thr Gly Tyr Ser Thr65
70 75 80Asn Ala Glu Ile Leu Glu
Lys Leu Arg Tyr Asp His Pro Ala Val Glu 85
90 95Leu Val Leu His Tyr Arg Thr Leu Thr Lys Leu Lys
Ser Thr Tyr Cys 100 105 110Glu
Gly Met Leu Lys Val Ile Gly Pro Asp Gly Arg Ile His Ser Asn 115
120 125Phe Asn Gln Thr Glu Thr Arg Thr Gly
Arg Ile Ser Ser Thr Glu Pro 130 135
140Asn Leu Gln Asn Ile Pro Val Arg Thr Glu Leu Gly Arg Glu Leu Arg145
150 155 160Lys Phe Phe Leu
Ala Lys Glu Gly Trp Val Leu Val Asp Ala Asp Tyr 165
170 175Ser Gln Ile Glu Leu Arg Val Leu Ala His
Ile Ala His Asp Glu Asn 180 185
190Met Ile Lys Ala Phe Gln Asp Lys Glu Asp Ile His Thr Ile Thr Ala
195 200 205Ser Gln Val Phe Gly Met Pro
Pro Glu Met Val Thr Pro Leu Met Arg 210 215
220Ser Arg Ala Lys Ala Val Asn Phe Gly Ile Val Tyr Gly Ile Gly
Ala225 230 235 240Phe Ser
Leu Ser Lys Asp Ile Asn Val Ser Arg Lys Glu Ala Gln Arg
245 250 255Tyr Ile Asp Asp Tyr Leu Thr
Leu Tyr Ser Gly Val Asp Arg Tyr Met 260 265
270Lys Glu Val Val Glu Lys Ala Lys Glu Asp Gly Tyr Val Glu
Thr Leu 275 280 285Phe His Arg Arg
Arg Tyr Leu Pro Glu Leu Thr Ala Ser Asn Phe Asn 290
295 300Leu Arg Ala Phe Gly Glu Arg Val Ala Arg Asn Met
Pro Ile Gln Gly305 310 315
320Thr Ala Ala Asp Ile Ile Lys Ile Ala Met Val Arg Val Asp Arg Arg
325 330 335Leu Lys Arg Glu Asn
Met Arg Ala Arg Leu Ile Leu Gln Val His Asp 340
345 350Glu Leu Ile Val Glu Ala Pro Glu Asp Glu Ala Glu
Gln Ala Ala Arg 355 360 365Ile Leu
Thr Glu Glu Met Glu Gly Ala Val Ser Leu Thr Val Pro Met 370
375 380Val Ala Glu Ala Ser Val Gly Lys Thr Trp Tyr
Asp Ala Lys Gly385 390
395106881PRTArtificial SequenceAMINO ACID SEQUENCE OF DNA polymerase I
[Enterococcus faecium] 106Met Thr Lys Asn Lys Leu Leu Leu Val Asp Gly
Asn Ser Val Ala Phe1 5 10
15Arg Ala Phe Phe Ala Leu His Asn Ser Leu Glu Arg Phe Lys Asn Arg
20 25 30Asn Gly Leu His Thr Asn Ala
Ile Tyr Ala Phe Asn Thr Met Phe Glu 35 40
45Asn Val Met Gln Lys Glu Gln Pro Thr His Val Leu Val Ala Phe
Asp 50 55 60Ala Gly Lys Thr Thr Phe
Arg Thr Glu Met Tyr Ala Glu Tyr Lys Gly65 70
75 80Gly Arg Ser Lys Thr Pro Gly Glu Phe Lys Glu
Gln Met Pro Tyr Ile 85 90
95Arg Asp Leu Leu Thr Gly Leu Gly Val Gln Tyr Tyr Glu Leu Pro Asn
100 105 110Tyr Glu Ala Asp Asp Ile
Ile Gly Thr Leu Ala Glu Lys Val Asp Lys 115 120
125Asp Gln Phe Asp Val Val Val Leu Ser Gly Asp Arg Asp Leu
Thr Gln 130 135 140Leu Ala Ser Lys Glu
Val Lys Val Asp Ile Thr Val Lys Gly Val Ser145 150
155 160Asp Ile Glu Ser Tyr Thr Pro Glu His Val
Ala Glu Lys Tyr Asp Gly 165 170
175Leu Thr Pro Lys Gln Ile Ile Asp Met Lys Gly Leu Ala Gly Asp Ala
180 185 190Ser Asp Asn Ile Pro
Gly Val Thr Lys Ile Gly Glu Lys Thr Ala Ile 195
200 205Lys Leu Leu Lys Gln Tyr Gly Ser Val Glu Gly Ile
Tyr Glu His Ile 210 215 220Asp Glu Met
Lys Gln Ser Lys Met Lys Glu Asn Leu Ile Asn Asp Lys225
230 235 240Glu Gln Ala Phe Leu Ser Lys
Lys Leu Ala Thr Ile Asn Thr Ser Ala 245
250 255Pro Val Asp Val Ser Ile Asp Ser Leu Lys Tyr Glu
Gly Lys Asn Leu 260 265 270Asp
Lys Leu Val Pro Phe Tyr Lys Glu Met Asp Phe Asn Gln Phe Leu 275
280 285Ser Lys Leu Asn Ile Val Glu Glu Glu
Val Lys Met Asp Asp Ile Leu 290 295
300Phe Glu Val Val His Glu Phe Lys Glu Glu Met Phe Thr Thr Asp Met305
310 315 320Ala Leu Tyr Val
Glu Met Met Gly Asp Asn Tyr His Thr Glu Glu Ile 325
330 335Val Gly Val Ala Trp Gly Thr Glu Lys Lys
Ile Tyr Val Thr Asn Asp 340 345
350Leu Ser Val Phe Glu Asn Arg Ala Phe His Ser Trp Ile Thr Asp Pro
355 360 365Thr Arg Leu Lys Lys Val Tyr
Asp Ala Lys Arg Thr Tyr Val Ala Leu 370 375
380Asn Arg Tyr Thr Gly Lys Thr Lys Gly Ile Asp Phe Asp Val Leu
Leu385 390 395 400Gly Ala
Tyr Leu Leu Asp Thr Asn Glu Lys Ser Thr Asp Ile Glu Gly
405 410 415Ile Ala Ala His Tyr Gly Tyr
Asn Asp Ile Gln Ser Asp Glu Ala Val 420 425
430Tyr Gly Lys Gly Ala Lys Lys Gly Leu Pro Glu Glu Glu Glu
Leu Phe 435 440 445Phe Ala His Leu
Ala Arg Lys Val Ala Ala Ile Asn Ala Leu Thr Pro 450
455 460Lys Leu Ser Gln Glu Leu Ala Asp Lys Asn Gln Glu
Asp Leu Phe Arg465 470 475
480Lys Met Glu Leu Pro Leu Ser Ile Ile Leu Ala Glu Met Glu Ile Ser
485 490 495Gly Ile Lys Val Asp
Ala Thr Arg Leu Gln Glu Met Lys Gly Glu Phe 500
505 510Ser Ala Arg Leu Arg Glu Ile Glu Gln Lys Ile Tyr
Glu Glu Ala Gly 515 520 525Glu Glu
Phe Asn Leu Asn Ser Pro Lys Gln Leu Gly Val Ile Leu Phe 530
535 540Glu Lys Met Gly Leu Pro Val Ile Lys Lys Thr
Lys Thr Gly Tyr Ser545 550 555
560Thr Ala Val Asp Val Leu Glu Gln Leu Arg Glu Gln Ala Pro Ile Val
565 570 575Glu Asp Ile Leu
Thr Tyr Arg Gln Ile Ala Lys Ile Gln Ser Thr Tyr 580
585 590Val Glu Gly Leu Leu Lys Val Ile Gln Ser Asp
Gly Lys Val His Thr 595 600 605Arg
Tyr Val Gln Thr Leu Thr Gln Thr Gly Arg Leu Ser Ser Val Asp 610
615 620Pro Asn Leu Gln Asn Ile Pro Ile Arg Leu
Asp Glu Gly Arg Lys Ile625 630 635
640Arg Gln Ala Phe Val Pro Arg Glu Lys Asp Trp Leu Ile Tyr Ser
Ser 645 650 655Asp Tyr Ser
Gln Ile Glu Leu Arg Val Leu Ala His Ile Ser Asn Asp 660
665 670Glu His Leu Lys Ala Ala Phe Leu Glu Gly
Gln Asp Ile His Ala Ser 675 680
685Thr Ala Met Arg Val Phe Gly Ile Glu Lys Ala Glu Asp Val Thr Pro 690
695 700Asn Met Arg Arg Gln Ala Lys Ala
Val Asn Phe Gly Ile Val Tyr Gly705 710
715 720Ile Ser Asp Tyr Gly Leu Ser Gln Asn Leu Gly Ile
Ser Arg Lys Ala 725 730
735Ala Gln Gln Tyr Ile Asp Thr Tyr Phe Glu Lys Tyr Pro Gly Val Lys
740 745 750Glu Tyr Met Glu Arg Ile
Val Arg Glu Ala Lys Asp Gln Gly Tyr Val 755 760
765Glu Thr Leu Tyr His Arg Arg Arg Tyr Leu Pro Asp Ile Asn
Ser Arg 770 775 780Asn Tyr Asn Ile Arg
Ser Phe Ala Glu Arg Thr Ala Ile Asn Thr Pro785 790
795 800Ile Gln Gly Ser Ala Ala Asp Ile Leu Lys
Ile Ala Met Ile Glu Leu 805 810
815Asp Lys Arg Leu Lys Glu Thr Gly Leu Gln Ala Thr Met Leu Leu Gln
820 825 830Val His Asp Glu Leu
Val Phe Glu Val Pro Lys Lys Glu Leu Glu Ser 835
840 845Leu Asp Lys Leu Val Lys Glu Val Met Glu Gln Ala
Val Ser Leu His 850 855 860Val Pro Leu
Ile Thr Asp Ser Ser Trp Gly Lys Thr Trp Tyr Glu Ala865
870 875 880Lys107881PRTArtificial
SequenceAMINO ACID SEQUENCE OF DNA polymerase I [Facklamia hominis]
107Met Leu Ile Asp Gly Ser Ser Leu Ala Phe Arg Ala Phe Tyr Ser Ile1
5 10 15Leu Asp Ile Asp Arg Phe
Thr Asn Arg Gln Gly Leu His Thr Asn Ala 20 25
30Ile Tyr Ser Phe Lys Arg Met Leu Asp Asn Val Leu Ala
Glu Phe Glu 35 40 45Pro Ser His
Val Leu Val Val Phe Asp Lys Ser Pro Asn Thr Ile Arg 50
55 60Lys Glu Lys Phe Asp Gln Tyr Lys Gly Gly Arg Ser
Lys Thr Pro Ala65 70 75
80Glu Phe Thr Glu Gln Met Pro Tyr Phe Ala Pro Leu Leu Glu Gly Tyr
85 90 95Gly Ile Arg His Tyr Ala
Met Asp Tyr Tyr Glu Ala Asp Asp Ile Ile 100
105 110Gly Thr Leu Ser Arg Leu Ala Asp Pro Lys Asp Gln
Val Val Val Leu 115 120 125Ser Gly
Asp Lys Asp Leu Thr Gln Leu Ala Ser Asp Gln Val Thr Val 130
135 140Tyr Ile Thr Arg Lys Gly Val Ser Asp Leu Val
Val Tyr Ser Pro Thr145 150 155
160Thr Ile Gln Glu Lys Trp Gly Ile Arg Pro Glu Gln Ile Ile Asp Met
165 170 175Lys Gly Leu Met
Gly Asp Ser Ser Asp Asn Tyr Pro Gly Ile Thr Arg 180
185 190Val Gly Glu Lys Thr Ala Leu Lys Leu Leu His
Gln Phe Gly Ser Val 195 200 205Glu
Gly Leu Tyr Gln Ser Leu Asp Gln Leu Lys Ala Ser Lys Leu Lys 210
215 220Glu Asn Ile Ile Lys Asp Lys Asp Gln Ala
Phe Leu Ser Lys Asp Leu225 230 235
240Ala Arg Ile Leu Leu Asp Val Pro Leu Glu Ile Asp Leu Ala Asp
Ile 245 250 255Glu Arg Gly
Glu Met Asp Thr Gln Ala Leu Asn Asp Leu Tyr Arg Gln 260
265 270Leu Asp Phe Gln Ser Phe Leu Gln Glu Leu
Asp Ala Lys Ser Val Leu 275 280
285Asp Asp Pro Ser Ala Ser Leu Ala Asp Phe Asp Leu Leu Val Leu Glu 290
295 300Asp Gln Ala Asp Phe Asp Gly Leu
Ala Trp Pro Asp Arg Gly Ile Tyr305 310
315 320His Thr Glu Gln Leu Asp Glu Asn Tyr His Phe Ala
Lys Val Glu Ala 325 330
335Val Cys Trp Ala Asp Pro Glu Thr Lys Lys Ala Tyr Val Thr Ser Ala
340 345 350Asp Leu Ala Phe Thr Asn
Pro Ala Phe Lys Ala Trp Leu Glu Asp Ser 355 360
365Ser Lys Leu Lys Asp Cys Leu Asp Phe Lys Lys Glu Ala Val
Ile Ala 370 375 380Ala Arg Tyr Gly Leu
Asp Leu Ala Gly Met Gly Glu Asp Val Ser Ile385 390
395 400Met Ala Tyr Leu Val Asp Thr Leu Gln Thr
His Glu Leu Ala Asp Leu 405 410
415Ser Gln Ser Phe Gly Leu Gly Gln Val Ile Pro Tyr Asp Val Glu Val
420 425 430Tyr Gly Lys Gly Val
Lys Lys Gly Val Pro Glu Asp Glu Ala Val Phe 435
440 445Gln Gly His Leu Val Leu Lys Leu Gln Cys Leu His
Ala Leu Met Glu 450 455 460Pro Leu Leu
Ala Lys Leu Glu Glu Leu Asp Met Val Gly Leu Tyr Arg465
470 475 480Glu Met Glu Gln Pro Leu Ala
Arg Cys Leu Ala Lys Met Glu Ile Thr 485
490 495Gly Ile Lys Val Asn Gln Glu Val Leu Glu Ala Lys
Asn Gln Glu Val 500 505 510Leu
Ala Arg Leu Ala Gln Met Glu Lys Ser Ile Tyr Asp Leu Ala Gly 515
520 525His Ser Phe Asn Val Asn Ser Pro Lys
Gln Leu Gly Gln Val Leu Phe 530 535
540Glu Glu Leu Lys Leu Pro Val Ile Lys Lys Thr Lys Thr Gly Tyr Ser545
550 555 560Thr Ala Ala Asp
Val Leu Asp Lys Leu Val Gln Val His Pro Ile Ile 565
570 575Gln Ala Ile Leu Asp Tyr Arg Gln Ile Ala
Lys Leu Gln Ser Thr Tyr 580 585
590Leu Ala Gly Leu Gln Pro Phe Ile Lys Glu Asp Gly Lys Ile His Thr
595 600 605Arg Tyr Thr Gln Thr Leu Thr
Gln Thr Gly Arg Leu Ser Ser Thr Asp 610 615
620Pro Asn Leu Gln Asn Ile Pro Ile Arg Ile Glu Glu Gly Arg Leu
Val625 630 635 640Arg Ala
Ala Phe Val Pro Ser Gln Pro Gly Trp Gln Met Leu Gly Ala
645 650 655Asp Tyr Ser Gln Ile Glu Leu
Arg Val Leu Ala His Ile Ser Gly Asp 660 665
670Glu His Met Lys Arg Ala Phe Gln Asn Gly Glu Asp Ile His
Ser Ala 675 680 685Thr Ala Arg Arg
Val Phe Gln Leu Asp Glu Asp Gln Glu Val Asp Ala 690
695 700Asp His Arg Arg Gln Ala Lys Ala Val Asn Phe Gly
Ile Val Tyr Gly705 710 715
720Ile Ser Asp Tyr Gly Leu Ser Gln Asn Leu Asn Ile Ser Arg Gln Ala
725 730 735Ala Lys Thr Phe Ile
Asp Arg Tyr Phe Glu Glu Phe Pro Lys Ile Arg 740
745 750Gln Tyr Met Asp Glu Ile Val Glu Gln Ala Lys Ser
Asp Gly Tyr Val 755 760 765Ser Thr
Leu Phe His Arg Arg Arg Tyr Leu Pro Asp Ile His Ala Lys 770
775 780Asn Phe Asn Leu Arg Ser Phe Ala Glu Arg Thr
Ala Met Asn Ser Pro785 790 795
800Ile Gln Gly Thr Ala Ala Asp Ile Ile Lys Leu Ala Met Val Arg Leu
805 810 815Gln Ala Arg Leu
Glu Glu Ala Gly Leu Ser Ser Arg Leu Leu Leu Gln 820
825 830Ile His Asp Glu Leu Ile Leu Glu Gly Pro Lys
Glu Glu Met Pro Gln 835 840 845Leu
Gln Lys Leu Val Val Glu Val Met Glu Ser Ala Ala Asp Leu Ser 850
855 860Val Pro Leu Lys Val Asp Asp His Ile Gly
Asp Asn Trp Tyr Asp Leu865 870 875
880Lys108877PRTArtificial SequenceAMINO ACID SEQUENCE OF DNA
polymerase I [Bacillus anthracis] 108Met Glu Lys Lys Val Val Leu Val
Asp Gly Asn Asn Ile Ala Tyr Arg1 5 10
15Ala Phe Phe Ala Leu Pro Leu Leu Asn Asn Asp Lys Gly Ile
His Thr 20 25 30Asn Ala Ile
Tyr Gly Phe Thr Met Met Leu Met Arg Ile Leu Glu Glu 35
40 45Glu Lys Pro Thr His Met Leu Val Ala Phe Asp
Ala Gly Lys Thr Thr 50 55 60Phe Arg
His Lys Ala Tyr Ser Glu Tyr Lys Gly Gly Arg Gln Lys Thr65
70 75 80Pro Pro Glu Leu Ser Glu Gln
Phe Pro Phe Ile Arg Glu Met Leu Asp 85 90
95Ala Phe Asn Val Pro Arg Tyr Glu Leu Glu Asn Tyr Glu
Ala Asp Asp 100 105 110Ile Met
Gly Thr Leu Ala Lys Glu Ala Ser Glu Gln Gly Ala Ser Val 115
120 125Lys Val Ile Ser Gly Asp Lys Asp Leu Leu
Gln Leu Val Ser Asp Asn 130 135 140Thr
Leu Val Cys Ile Pro Arg Lys Gly Ile Thr Glu Val Asp Glu Tyr145
150 155 160Thr Lys Glu Ala Leu Phe
Glu Lys Tyr Ser Leu Ser Pro Lys Gln Ile 165
170 175Ile Asp Met Lys Gly Leu Met Gly Asp Gln Ser Asp
Asn Ile Pro Gly 180 185 190Val
Pro Gly Val Gly Glu Lys Thr Ala Ile Lys Leu Leu Thr Gln Phe 195
200 205Gly Thr Val Glu Glu Val Tyr Glu Asn
Ile Asp Gln Val Ser Gly Lys 210 215
220Lys Leu Lys Glu Lys Leu Glu Ala Asn Lys Asp Gln Ala Leu Met Ser225
230 235 240Lys Asp Leu Ala
Thr Ile Ile Thr Asp Ala Pro Ile Thr Val Asn Val 245
250 255Asp Asp Met Glu Tyr Lys Gly Tyr Glu Ala
Ser Asp Val Ile Pro Met 260 265
270Phe Glu Asn Leu Gly Phe Thr Ser Leu Leu Asn Lys Leu Gly Val Thr
275 280 285Pro Glu Glu Thr Ala Pro Ala
Glu Leu Asp Asp Ile Thr Phe Asp Ile 290 295
300Val Glu Glu Val Thr Glu Glu Met Leu Gln Gln Asp Ser Ala Leu
Ile305 310 315 320Val Glu
Val Gln Glu Asp Asn Tyr His Lys Ala Asp Ile Gln Gly Phe
325 330 335Gly Ile Gln Asn Glu Asn Gly
Cys Tyr Phe Ile Gln Thr Asp Ile Ala 340 345
350Leu Lys Ser Asp Ala Phe Lys Glu Trp Leu Ala Asp Gly Glu
Met Arg 355 360 365Lys Tyr Thr Phe
Asp Ala Lys Arg Ala Ile Val Ala Leu Lys Trp Asn 370
375 380Gly Ile Asp Met Gln Gly Ile Asp Phe Asp Leu Leu
Ile Ala Ala Tyr385 390 395
400Leu Leu Asp Pro Ala Asp Thr Asp Lys Asp Phe Arg Thr Val Ala Lys
405 410 415Met Lys Glu Thr His
Ala Val Lys Ser Asp Glu Glu Val Tyr Gly Lys 420
425 430Gly Ala Lys Arg Ala Val Pro Glu Leu Glu Ile Val
Ala Glu His Val 435 440 445Ala Arg
Lys Val His Val Leu Tyr Asp Val Lys Gln Thr Phe Val Glu 450
455 460Glu Leu Glu Lys Asn Glu Gln Tyr Glu Leu Phe
Thr Glu Leu Glu Leu465 470 475
480Pro Leu Ala Arg Val Leu Ala Asp Met Glu Val Lys Gly Val Lys Val
485 490 495Asp Thr Glu Arg
Leu Arg Asn Met Gly Glu Glu Leu Ala Gly Arg Leu 500
505 510Lys Glu Met Glu Gln Glu Ile Tyr Lys Leu Ala
Gly Thr Glu Phe Asn 515 520 525Ile
Asn Ser Pro Lys Gln Leu Gly Val Ile Leu Phe Glu Asn Leu Asn 530
535 540Leu Pro Val Ile Lys Lys Thr Lys Thr Gly
Tyr Ser Thr Ser Ala Asp545 550 555
560Val Leu Asp Lys Leu Met Asp His His Glu Ile Ile Pro Asn Ile
Leu 565 570 575His Tyr Arg
Gln Leu Gly Lys Leu Asn Ser Thr Tyr Ile Glu Gly Leu 580
585 590Leu Lys Val Val His Glu Asp Ser Ser Lys
Ile His Thr Arg Phe Asn 595 600
605Gln Val Leu Thr Gln Thr Gly Arg Leu Ser Ser Thr Asp Pro Asn Leu 610
615 620Gln Asn Ile Pro Ile Arg Leu Glu
Glu Gly Arg Lys Ile Arg Gln Ala625 630
635 640Phe Val Pro Ser Glu Glu Gly Trp Ile Met Tyr Ala
Ala Asp Tyr Ser 645 650
655Gln Ile Glu Leu Arg Val Leu Ala His Ile Ala Asn Asp Lys Gly Leu
660 665 670Val Glu Ala Phe Gln His
Asp Met Asp Ile His Thr Lys Thr Ala Met 675 680
685Asp Val Phe Gly Val Glu Lys Asp Glu Val Thr Ser Asn Met
Arg Arg 690 695 700Gln Ala Lys Ala Val
Asn Phe Gly Ile Val Tyr Gly Ile Ser Asp Tyr705 710
715 720Gly Leu Ser Gln Asn Leu Gly Ile Thr Arg
Lys Ala Ala Ala Glu Phe 725 730
735Ile Glu Lys Tyr Leu Glu Ser Phe Pro Gly Val Gln Glu Tyr Met Asp
740 745 750Asp Ile Val Lys Asp
Ala Lys Gln Lys Gly Tyr Val Ala Thr Leu Leu 755
760 765Asn Arg Arg Arg Tyr Ile Pro Glu Ile Thr Ser Arg
Asn Phe Asn Leu 770 775 780Arg Ser Phe
Ala Glu Arg Thr Ala Met Asn Thr Pro Ile Gln Gly Thr785
790 795 800Ala Ala Asp Ile Ile Lys Lys
Ala Met Ile Ile Met Ala Asp Arg Leu 805
810 815Glu Glu Glu Gly Leu Gln Ala Arg Leu Leu Leu Gln
Val His Asp Glu 820 825 830Leu
Ile Phe Glu Ala Pro Lys Glu Glu Val Glu Lys Leu Glu Lys Leu 835
840 845Val Pro Glu Val Met Glu His Ala Ile
Glu Leu Ala Val Pro Leu Lys 850 855
860Val Asp Tyr Ser Tyr Gly Pro Thr Trp Tyr Asp Ala Lys865
870 875109877PRTArtificial SequenceAMINO ACID SEQUENCE OF
DNA polymerase I [Bacillus cereus ATCC 10987] 109Met Glu Lys Lys Val
Val Leu Val Asp Gly Asn Asn Ile Ala Tyr Arg1 5
10 15Ala Phe Phe Ala Leu Pro Leu Leu Asn Asn Asp
Lys Gly Ile His Thr 20 25
30Asn Ala Ile Tyr Gly Phe Thr Met Met Leu Met Arg Ile Leu Glu Glu
35 40 45Glu Lys Pro Thr His Met Leu Val
Ala Phe Asp Ala Gly Lys Thr Thr 50 55
60Phe Arg His Lys Thr Tyr Ser Glu Tyr Lys Gly Gly Arg Gln Lys Thr65
70 75 80Pro Pro Glu Leu Ser
Glu Gln Phe Pro Phe Ile Arg Glu Met Leu Asp 85
90 95Ala Phe Asn Val Pro Arg Tyr Glu Leu Glu Asn
Tyr Glu Ala Asp Asp 100 105
110Ile Met Gly Thr Leu Ala Lys Glu Ala Ser Glu Gln Gly Ala Ser Val
115 120 125Lys Val Ile Ser Gly Asp Lys
Asp Leu Leu Gln Leu Val Ser Asp Asn 130 135
140Thr Leu Val Cys Ile Pro Arg Lys Gly Ile Thr Glu Val Asp Glu
Tyr145 150 155 160Thr Lys
Glu Ala Leu Phe Glu Lys Tyr Ser Leu Ser Pro Lys Gln Ile
165 170 175Ile Asp Met Lys Gly Leu Met
Gly Asp Gln Ser Asp Asn Ile Pro Gly 180 185
190Val Pro Gly Val Gly Glu Lys Thr Ala Ile Lys Leu Leu Thr
Gln Phe 195 200 205Gly Thr Val Glu
Glu Val Tyr Glu Asn Ile Asp Gln Val Ser Gly Lys 210
215 220Lys Leu Lys Glu Lys Leu Glu Ala Asn Lys Glu Gln
Ala Leu Met Ser225 230 235
240Lys Asp Leu Ala Thr Ile Ile Thr Asp Ala Pro Ile Thr Val His Val
245 250 255Asp Asp Met Glu Tyr
Lys Gly Tyr Glu Ala Ser Asp Val Ile Pro Met 260
265 270Phe Glu Asn Leu Gly Phe Thr Ser Leu Leu Asn Lys
Leu Gly Val Thr 275 280 285Pro Glu
Glu Thr Ala Pro Ala Glu Leu Asp Asp Ile Thr Phe Asp Ile 290
295 300Val Glu Glu Val Thr Glu Glu Met Leu Gln Gln
Asp Ser Ala Leu Ile305 310 315
320Val Glu Val Gln Glu Asp Asn Tyr His Lys Ala Asp Ile Gln Gly Phe
325 330 335Gly Ile Gln Asn
Glu Asn Gly Cys Tyr Phe Ile Gln Thr Asp Ile Ala 340
345 350Leu Lys Ser Asp Ala Phe Lys Glu Trp Leu Ala
Asp Gly Glu Met Arg 355 360 365Lys
Tyr Thr Phe Asp Ala Lys Arg Ala Ile Val Ala Leu Lys Trp Asn 370
375 380Gly Ile Asp Met Gln Gly Ile Asp Phe Asp
Leu Leu Ile Ala Ala Tyr385 390 395
400Leu Leu Asp Pro Ala Asp Thr Asp Lys Asp Phe Arg Thr Val Ala
Lys 405 410 415Met Lys Glu
Thr His Ala Val Lys Ser Asp Glu Glu Val Tyr Gly Lys 420
425 430Gly Ala Lys Arg Ala Val Pro Glu Leu Glu
Ile Val Ala Glu His Val 435 440
445Ala Arg Lys Val His Val Leu Tyr Asp Val Lys Gln Thr Phe Val Glu 450
455 460Glu Leu Glu Lys Asn Glu Gln Tyr
Glu Leu Phe Thr Glu Leu Glu Leu465 470
475 480Pro Leu Ala Arg Val Leu Ala Asp Met Glu Val Lys
Gly Val Lys Val 485 490
495Asp Thr Glu Arg Leu Arg Asn Met Gly Glu Glu Leu Ala Gly Arg Leu
500 505 510Lys Glu Met Glu Gln Glu
Ile Tyr Lys Leu Ala Gly Arg Glu Phe Asn 515 520
525Ile Asn Ser Pro Lys Gln Leu Gly Val Ile Leu Phe Glu Asn
Leu Asn 530 535 540Leu Pro Val Ile Lys
Lys Thr Lys Thr Gly Tyr Ser Thr Ser Ala Asp545 550
555 560Val Leu Asp Lys Leu Met Asp His His Glu
Ile Ile Pro Asn Ile Leu 565 570
575His Tyr Arg Gln Leu Gly Lys Leu Asn Ser Thr Tyr Ile Glu Gly Leu
580 585 590Leu Lys Val Val His
Glu Asp Ser Ser Lys Ile His Thr Arg Phe Asn 595
600 605Gln Val Leu Thr Gln Thr Gly Arg Leu Ser Ser Thr
Asp Pro Asn Leu 610 615 620Gln Asn Ile
Pro Ile Arg Leu Glu Glu Gly Arg Lys Ile Arg Gln Ala625
630 635 640Phe Val Pro Ser Glu Glu Gly
Trp Ile Met Tyr Ala Ala Asp Tyr Ser 645
650 655Gln Ile Glu Leu Arg Val Leu Ala His Ile Ala Asn
Asp Lys Gly Leu 660 665 670Val
Glu Ala Phe Gln His Asp Met Asp Ile His Thr Lys Thr Ala Met 675
680 685Asp Val Phe Gly Val Glu Lys Asp Glu
Val Thr Ser Asn Met Arg Arg 690 695
700Gln Ala Lys Ala Val Asn Phe Gly Ile Val Tyr Gly Ile Ser Asp Tyr705
710 715 720Gly Leu Ser Gln
Asn Leu Gly Ile Thr Arg Lys Ala Ala Ala Glu Phe 725
730 735Ile Glu Lys Tyr Leu Glu Ser Phe Pro Gly
Val Gln Glu Tyr Met Asp 740 745
750Asp Ile Val Lys Asp Ala Lys Gln Lys Gly Tyr Val Ala Thr Leu Leu
755 760 765Asn Arg Arg Arg Tyr Ile Pro
Glu Ile Thr Ser Arg Asn Phe Asn Leu 770 775
780Arg Ser Phe Ala Glu Arg Thr Ala Met Asn Thr Pro Ile Gln Gly
Thr785 790 795 800Ala Ala
Asp Ile Ile Lys Lys Ala Met Ile Ile Met Ala Asp Arg Leu
805 810 815Glu Glu Glu Gly Leu Gln Ala
Arg Leu Leu Leu Gln Val His Asp Glu 820 825
830Leu Ile Phe Glu Ala Pro Lys Glu Glu Ile Glu Lys Leu Glu
Lys Leu 835 840 845Val Pro Glu Val
Met Glu His Ala Ile Glu Leu Ala Val Pro Leu Lys 850
855 860Val Asp Tyr Ser Tyr Gly Pro Thr Trp Tyr Asp Ala
Lys865 870 87511053DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 110gggcgcacgt atgcttctgc aggtcggtga
cgagctggtg ttagaagccc cta 5311153DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 111taggggcttc taacaccagc tcgtcaccga
cctgcagaag catacgtgcg ccc 5311253DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 112gggcgcacgt atgcttctgc aggtcgcgga
cgagctggtg ttagaagccc cta 5311353DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 113taggggcttc taacaccagc tcgtccgcga
cctgcagaag catacgtgcg ccc 5311453DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 114gggcgcacgt atgcttctgc aggtcagcga
cgagctggtg ttagaagccc cta 5311553DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 115taggggcttc taacaccagc tcgtcgctga
cctgcagaag catacgtgcg ccc 5311653DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 116gggcgcacgt atgcttctgc aggtcacgga
cgagctggtg ttagaagccc cta 5311753DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 117taggggcttc taacaccagc tcgtccgtga
cctgcagaag catacgtgcg ccc 5311853DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 118gggcgcacgt atgcttctgc aggtctgcga
cgagctggtg ttagaagccc cta 5311953DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 119taggggcttc taacaccagc tcgtcgcaga
cctgcagaag catacgtgcg ccc 5312053DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 120gggcgcacgt atgcttctgc aggtcgtaga
cgagctggtg ttagaagccc cta 5312153DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 121taggggcttc taacaccagc tcgtctacga
cctgcagaag catacgtgcg ccc 5312253DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 122gggcgcacgt atgcttctgc aggtcttgga
cgagctggtg ttagaagccc cta 5312353DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 123taggggcttc taacaccagc tcgtccaaga
cctgcagaag catacgtgcg ccc 5312453DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 124gggcgcacgt atgcttctgc aggtcattga
cgagctggtg ttagaagccc cta 5312553DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 125taggggcttc taacaccagc tcgtcaatga
cctgcagaag catacgtgcg ccc 5312653DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 126gggcgcacgt atgcttctgc aggtcatgga
cgagctggtg ttagaagccc cta 5312753DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 127taggggcttc taacaccagc tcgtccatga
cctgcagaag catacgtgcg ccc 5312853DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 128gggcgcacgt atgcttctgc aggtcccaga
cgagctggtg ttagaagccc cta 5312953DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 129taggggcttc taacaccagc tcgtctggga
cctgcagaag catacgtgcg ccc 5313053DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 130gggcgcacgt atgcttctgc aggtctttga
cgagctggtg ttagaagccc cta 5313153DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 131taggggcttc taacaccagc tcgtcaaaga
cctgcagaag catacgtgcg ccc 5313253DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 132gggcgcacgt atgcttctgc aggtctatga
cgagctggtg ttagaagccc cta 5313353DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 133taggggcttc taacaccagc tcgtcataga
cctgcagaag catacgtgcg ccc 5313453DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 134gggcgcacgt atgcttctgc aggtctggga
cgagctggtg ttagaagccc cta 5313553DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 135taggggcttc taacaccagc tcgtcccaga
cctgcagaag catacgtgcg ccc 5313653DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 136gggcgcacgt atgcttctgc aggtcgatga
cgagctggtg ttagaagccc cta 5313753DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 137taggggcttc taacaccagc tcgtcatcga
cctgcagaag catacgtgcg ccc 5313853DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 138gggcgcacgt atgcttctgc aggtcgaaga
cgagctggtg ttagaagccc cta 5313953DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 139taggggcttc taacaccagc tcgtcttcga
cctgcagaag catacgtgcg ccc 5314053DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 140gggcgcacgt atgcttctgc aggtcaacga
cgagctggtg ttagaagccc cta 5314153DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 141taggggcttc taacaccagc tcgtcgttga
cctgcagaag catacgtgcg ccc 5314253DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 142gggcgcacgt atgcttctgc aggtcaaaga
cgagctggtg ttagaagccc cta 5314353DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 143taggggcttc taacaccagc tcgtctttga
cctgcagaag catacgtgcg ccc 5314453DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 144gggcgcacgt atgcttctgc aggtccggga
cgagctggtg ttagaagccc cta 5314553DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 145taggggcttc taacaccagc tcgtcccgga
cctgcagaag catacgtgcg ccc 531462507DNAArtificial
SequenceNUCLEOTIDE SEQUENCE OF MUTANT ID 20 (H784A) 146catatgcgtg
gtatgctgcc gttgttcgag cctaaaggcc gcgtactgtt agtcgatggt 60catcacttgg
cctatcggac gttccatgca ctcaaaggtc tgacgaccag tcgtggcgaa 120ccggtccagg
ctgtttatgg tttcgctaag tctttgctca aagcactgaa agaagacggg 180gacgcggtaa
ttgttgtatt tgatgccaaa gcaccgagct tccgccacga agcttatggt 240ggctacaagg
caggacgcgc ccctacccca gaagatttcc cccgtcagct ggcattaatt 300aaggagttag
tagaccttct cggcttagcg cgtctggaag ttccgggtta tgaggcggac 360gatgtccttg
catccttggc taaaaaggcc gaaaaagagg gctacgaagt ccgcatcttg 420acggcagaca
aagatctgta ccagcttctg tctgaccgta ttcatgtttt gcaccctgaa 480ggctacttaa
tcactccggc ctggctctgg gaaaagtacg gtctgcgtcc cgatcagtgg 540gcggattatc
gggctttgac gggagatgag agcgacaacc tgccaggagt taagggcatt 600ggtgaaaaaa
ccgcacgtaa gctgcttgaa gagtggggtt ccctggaagc cttgttaaaa 660aatctggatc
gtctcaagcc cgcaattcgt gaaaagatcc tggctcatat ggacgatctt 720aaattaagtt
gggacctggc caaggtgcgc accgatttac cgcttgaagt ggattttgca 780aaacgccgtg
agccggaccg ggaacgttta cgcgctttct tagagcgtct ggaattcggt 840tcactgcttc
atgaattcgg tctgttagag tctcctaaag cactcgaaga ggcaccgtgg 900ccgcccccag
aaggtgcttt tgttggcttc gtactttccc gtaaggagcc tatgtgggca 960gatcttctgg
ctttagcggc tgcacgcggt ggccgtgttc accgggcccc tgagccatac 1020aaagcgttac
gtgatctgaa ggaagcacgt ggcttgctgg caaaagacct ttctgttttg 1080gccctgcgcg
agggtcttgg actgccgcca ggcgacgatc ccatgttatt ggcctatctg 1140ttagacccta
gcaataccac acctgaaggg gtcgctcgtc ggtatggcgg tgaatggact 1200gaggaagccg
gagagcgcgc cgcattgtcc gaacggctct ttgcaaactt atggggtcgt 1260ctggaagggg
aggaacgtct gttatggttg tatcgggaag tcgaacgtcc tctttcggcc 1320gtattagcgc
atatggaggc aacaggtgtg cgtttagatg tcgcgtacct tcgggcctta 1380tcactggaag
ttgcagagga aatcgcccgt ctcgaggctg aagtgttccg gttggccggt 1440cacccgttta
acctcaactc ccgtgaccag ctggaacgcg ttttattcga tgagcttggg 1500cttcccgcaa
ttggcaaaac cgaaaagact ggcaaacgca gtacgagcgc tgccgtcctt 1560gaggcactcc
gcgaggctca ccctattgta gaaaagatcc tgcaataccg tgagttgacg 1620aagcttaaaa
gcacttatat tgatcctctc ccggatctga tccatcctcg taccggccgc 1680ttgcacacac
gtttcaacca gacggcgact gcaaccggcc gtctgtctag ctcggatcca 1740aatctccaga
acattccggt ccgtacaccc ttgggccaac gtatccgccg ggcgtttatc 1800gctgaggaag
gatggttact ggtcgcattg gactactcgc agattgagct gcgcgtcctc 1860gcacatctct
ctggtgacga aaatttaatc cgcgtgtttc aagaggggcg tgatattcac 1920acagaaactg
cctcatggat gttcggtgtc ccacgtgaag cagtggatcc tttgatgcgc 1980cgtgcagcta
aaacaattaa ttttggagtg ctgtacggaa tgagcgctca tcgcttgagt 2040caggaactgg
caatccccta cgaggaagcg caggcattca tcgaacgtta ctttcaatcg 2100tttccgaaag
ttcgcgcatg gatcgagaag acgctcgagg aaggtcgtcg tcggggctat 2160gtcgaaactc
tgtttggtcg ccgtcggtac gtaccagatc ttgaagcccg cgtcaaatcg 2220gtacgggagg
ctgcggagcg tatggcattt aatatgcctg tacagggtac tgcagctgac 2280ctcatgaaac
tggcaatggt caagcttttc ccgcgcttgg aggaaatggg cgcacgtatg 2340cttctgcagg
tcgcggacga gctggtgtta gaagccccta aggagcgcgc cgaagctgtc 2400gcgcgcctcg
ctaaagaagt gatggagggc gtttacccat tggccgtacc cctcgaagtg 2460gaggtcggta
ttggagaaga ttggttatct gcaaaggaag cggccgc
2507147834PRTArtificial SequenceAMINO ACID SEQUENCE OF MUTANT ID 20
(H784A) 147Met Arg Gly Met Leu Pro Leu Phe Glu Pro Lys Gly Arg Val Leu
Leu1 5 10 15Val Asp Gly
His His Leu Ala Tyr Arg Thr Phe His Ala Leu Lys Gly 20
25 30Leu Thr Thr Ser Arg Gly Glu Pro Val Gln
Ala Val Tyr Gly Phe Ala 35 40
45Lys Ser Leu Leu Lys Ala Leu Lys Glu Asp Gly Asp Ala Val Ile Val 50
55 60Val Phe Asp Ala Lys Ala Pro Ser Phe
Arg His Glu Ala Tyr Gly Gly65 70 75
80Tyr Lys Ala Gly Arg Ala Pro Thr Pro Glu Asp Phe Pro Arg
Gln Leu 85 90 95Ala Leu
Ile Lys Glu Leu Val Asp Leu Leu Gly Leu Ala Arg Leu Glu 100
105 110Val Pro Gly Tyr Glu Ala Asp Asp Val
Leu Ala Ser Leu Ala Lys Lys 115 120
125Ala Glu Lys Glu Gly Tyr Glu Val Arg Ile Leu Thr Ala Asp Lys Asp
130 135 140Leu Tyr Gln Leu Leu Ser Asp
Arg Ile His Val Leu His Pro Glu Gly145 150
155 160Tyr Leu Ile Thr Pro Ala Trp Leu Trp Glu Lys Tyr
Gly Leu Arg Pro 165 170
175Asp Gln Trp Ala Asp Tyr Arg Ala Leu Thr Gly Asp Glu Ser Asp Asn
180 185 190Leu Pro Gly Val Lys Gly
Ile Gly Glu Lys Thr Ala Arg Lys Leu Leu 195 200
205Glu Glu Trp Gly Ser Leu Glu Ala Leu Leu Lys Asn Leu Asp
Arg Leu 210 215 220Lys Pro Ala Ile Arg
Glu Lys Ile Leu Ala His Met Asp Asp Leu Lys225 230
235 240Leu Ser Trp Asp Leu Ala Lys Val Arg Thr
Asp Leu Pro Leu Glu Val 245 250
255Asp Phe Ala Lys Arg Arg Glu Pro Asp Arg Glu Arg Leu Arg Ala Phe
260 265 270Leu Glu Arg Leu Glu
Phe Gly Ser Leu Leu His Glu Phe Gly Leu Leu 275
280 285Glu Ser Pro Lys Ala Leu Glu Glu Ala Pro Trp Pro
Pro Pro Glu Gly 290 295 300Ala Phe Val
Gly Phe Val Leu Ser Arg Lys Glu Pro Met Trp Ala Asp305
310 315 320Leu Leu Ala Leu Ala Ala Ala
Arg Gly Gly Arg Val His Arg Ala Pro 325
330 335Glu Pro Tyr Lys Ala Leu Arg Asp Leu Lys Glu Ala
Arg Gly Leu Leu 340 345 350Ala
Lys Asp Leu Ser Val Leu Ala Leu Arg Glu Gly Leu Gly Leu Pro 355
360 365Pro Gly Asp Asp Pro Met Leu Leu Ala
Tyr Leu Leu Asp Pro Ser Asn 370 375
380Thr Thr Pro Glu Gly Val Ala Arg Arg Tyr Gly Gly Glu Trp Thr Glu385
390 395 400Glu Ala Gly Glu
Arg Ala Ala Leu Ser Glu Arg Leu Phe Ala Asn Leu 405
410 415Trp Gly Arg Leu Glu Gly Glu Glu Arg Leu
Leu Trp Leu Tyr Arg Glu 420 425
430Val Glu Arg Pro Leu Ser Ala Val Leu Ala His Met Glu Ala Thr Gly
435 440 445Val Arg Leu Asp Val Ala Tyr
Leu Arg Ala Leu Ser Leu Glu Val Ala 450 455
460Glu Glu Ile Ala Arg Leu Glu Ala Glu Val Phe Arg Leu Ala Gly
His465 470 475 480Pro Phe
Asn Leu Asn Ser Arg Asp Gln Leu Glu Arg Val Leu Phe Asp
485 490 495Glu Leu Gly Leu Pro Ala Ile
Gly Lys Thr Glu Lys Thr Gly Lys Arg 500 505
510Ser Thr Ser Ala Ala Val Leu Glu Ala Leu Arg Glu Ala His
Pro Ile 515 520 525Val Glu Lys Ile
Leu Gln Tyr Arg Glu Leu Thr Lys Leu Lys Ser Thr 530
535 540Tyr Ile Asp Pro Leu Pro Asp Leu Ile His Pro Arg
Thr Gly Arg Leu545 550 555
560His Thr Arg Phe Asn Gln Thr Ala Thr Ala Thr Gly Arg Leu Ser Ser
565 570 575Ser Asp Pro Asn Leu
Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln 580
585 590Arg Ile Arg Arg Ala Phe Ile Ala Glu Glu Gly Trp
Leu Leu Val Ala 595 600 605Leu Asp
Tyr Ser Gln Ile Glu Leu Arg Val Leu Ala His Leu Ser Gly 610
615 620Asp Glu Asn Leu Ile Arg Val Phe Gln Glu Gly
Arg Asp Ile His Thr625 630 635
640Glu Thr Ala Ser Trp Met Phe Gly Val Pro Arg Glu Ala Val Asp Pro
645 650 655Leu Met Arg Arg
Ala Ala Lys Thr Ile Asn Phe Gly Val Leu Tyr Gly 660
665 670Met Ser Ala His Arg Leu Ser Gln Glu Leu Ala
Ile Pro Tyr Glu Glu 675 680 685Ala
Gln Ala Phe Ile Glu Arg Tyr Phe Gln Ser Phe Pro Lys Val Arg 690
695 700Ala Trp Ile Glu Lys Thr Leu Glu Glu Gly
Arg Arg Arg Gly Tyr Val705 710 715
720Glu Thr Leu Phe Gly Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala
Arg 725 730 735Val Lys Ser
Val Arg Glu Ala Ala Glu Arg Met Ala Phe Asn Met Pro 740
745 750Val Gln Gly Thr Ala Ala Asp Leu Met Lys
Leu Ala Met Val Lys Leu 755 760
765Phe Pro Arg Leu Glu Glu Met Gly Ala Arg Met Leu Leu Gln Val Ala 770
775 780Asp Glu Leu Val Leu Glu Ala Pro
Lys Glu Arg Ala Glu Ala Val Ala785 790
795 800Arg Leu Ala Lys Glu Val Met Glu Gly Val Tyr Pro
Leu Ala Val Pro 805 810
815Leu Glu Val Glu Val Gly Ile Gly Glu Asp Trp Leu Ser Ala Lys Glu
820 825 830Ala
Ala1482507DNAArtificial SequenceNUCLEOTIDE SEQUENCE OF MUTANT ID 21
(H784S) 148catatgcgtg gtatgctgcc gttgttcgag cctaaaggcc gcgtactgtt
agtcgatggt 60catcacttgg cctatcggac gttccatgca ctcaaaggtc tgacgaccag
tcgtggcgaa 120ccggtccagg ctgtttatgg tttcgctaag tctttgctca aagcactgaa
agaagacggg 180gacgcggtaa ttgttgtatt tgatgccaaa gcaccgagct tccgccacga
agcttatggt 240ggctacaagg caggacgcgc ccctacccca gaagatttcc cccgtcagct
ggcattaatt 300aaggagttag tagaccttct cggcttagcg cgtctggaag ttccgggtta
tgaggcggac 360gatgtccttg catccttggc taaaaaggcc gaaaaagagg gctacgaagt
ccgcatcttg 420acggcagaca aagatctgta ccagcttctg tctgaccgta ttcatgtttt
gcaccctgaa 480ggctacttaa tcactccggc ctggctctgg gaaaagtacg gtctgcgtcc
cgatcagtgg 540gcggattatc gggctttgac gggagatgag agcgacaacc tgccaggagt
taagggcatt 600ggtgaaaaaa ccgcacgtaa gctgcttgaa gagtggggtt ccctggaagc
cttgttaaaa 660aatctggatc gtctcaagcc cgcaattcgt gaaaagatcc tggctcatat
ggacgatctt 720aaattaagtt gggacctggc caaggtgcgc accgatttac cgcttgaagt
ggattttgca 780aaacgccgtg agccggaccg ggaacgttta cgcgctttct tagagcgtct
ggaattcggt 840tcactgcttc atgaattcgg tctgttagag tctcctaaag cactcgaaga
ggcaccgtgg 900ccgcccccag aaggtgcttt tgttggcttc gtactttccc gtaaggagcc
tatgtgggca 960gatcttctgg ctttagcggc tgcacgcggt ggccgtgttc accgggcccc
tgagccatac 1020aaagcgttac gtgatctgaa ggaagcacgt ggcttgctgg caaaagacct
ttctgttttg 1080gccctgcgcg agggtcttgg actgccgcca ggcgacgatc ccatgttatt
ggcctatctg 1140ttagacccta gcaataccac acctgaaggg gtcgctcgtc ggtatggcgg
tgaatggact 1200gaggaagccg gagagcgcgc cgcattgtcc gaacggctct ttgcaaactt
atggggtcgt 1260ctggaagggg aggaacgtct gttatggttg tatcgggaag tcgaacgtcc
tctttcggcc 1320gtattagcgc atatggaggc aacaggtgtg cgtttagatg tcgcgtacct
tcgggcctta 1380tcactggaag ttgcagagga aatcgcccgt ctcgaggctg aagtgttccg
gttggccggt 1440cacccgttta acctcaactc ccgtgaccag ctggaacgcg ttttattcga
tgagcttggg 1500cttcccgcaa ttggcaaaac cgaaaagact ggcaaacgca gtacgagcgc
tgccgtcctt 1560gaggcactcc gcgaggctca ccctattgta gaaaagatcc tgcaataccg
tgagttgacg 1620aagcttaaaa gcacttatat tgatcctctc ccggatctga tccatcctcg
taccggccgc 1680ttgcacacac gtttcaacca gacggcgact gcaaccggcc gtctgtctag
ctcggatcca 1740aatctccaga acattccggt ccgtacaccc ttgggccaac gtatccgccg
ggcgtttatc 1800gctgaggaag gatggttact ggtcgcattg gactactcgc agattgagct
gcgcgtcctc 1860gcacatctct ctggtgacga aaatttaatc cgcgtgtttc aagaggggcg
tgatattcac 1920acagaaactg cctcatggat gttcggtgtc ccacgtgaag cagtggatcc
tttgatgcgc 1980cgtgcagcta aaacaattaa ttttggagtg ctgtacggaa tgagcgctca
tcgcttgagt 2040caggaactgg caatccccta cgaggaagcg caggcattca tcgaacgtta
ctttcaatcg 2100tttccgaaag ttcgcgcatg gatcgagaag acgctcgagg aaggtcgtcg
tcggggctat 2160gtcgaaactc tgtttggtcg ccgtcggtac gtaccagatc ttgaagcccg
cgtcaaatcg 2220gtacgggagg ctgcggagcg tatggcattt aatatgcctg tacagggtac
tgcagctgac 2280ctcatgaaac tggcaatggt caagcttttc ccgcgcttgg aggaaatggg
cgcacgtatg 2340cttctgcagg tcagcgacga gctggtgtta gaagccccta aggagcgcgc
cgaagctgtc 2400gcgcgcctcg ctaaagaagt gatggagggc gtttacccat tggccgtacc
cctcgaagtg 2460gaggtcggta ttggagaaga ttggttatct gcaaaggaag cggccgc
2507149834PRTArtificial SequenceAMINO ACID SEQUENCE OF MUTANT
ID 21 (H784S) 149Met Arg Gly Met Leu Pro Leu Phe Glu Pro Lys Gly Arg Val
Leu Leu1 5 10 15Val Asp
Gly His His Leu Ala Tyr Arg Thr Phe His Ala Leu Lys Gly 20
25 30Leu Thr Thr Ser Arg Gly Glu Pro Val
Gln Ala Val Tyr Gly Phe Ala 35 40
45Lys Ser Leu Leu Lys Ala Leu Lys Glu Asp Gly Asp Ala Val Ile Val 50
55 60Val Phe Asp Ala Lys Ala Pro Ser Phe
Arg His Glu Ala Tyr Gly Gly65 70 75
80Tyr Lys Ala Gly Arg Ala Pro Thr Pro Glu Asp Phe Pro Arg
Gln Leu 85 90 95Ala Leu
Ile Lys Glu Leu Val Asp Leu Leu Gly Leu Ala Arg Leu Glu 100
105 110Val Pro Gly Tyr Glu Ala Asp Asp Val
Leu Ala Ser Leu Ala Lys Lys 115 120
125Ala Glu Lys Glu Gly Tyr Glu Val Arg Ile Leu Thr Ala Asp Lys Asp
130 135 140Leu Tyr Gln Leu Leu Ser Asp
Arg Ile His Val Leu His Pro Glu Gly145 150
155 160Tyr Leu Ile Thr Pro Ala Trp Leu Trp Glu Lys Tyr
Gly Leu Arg Pro 165 170
175Asp Gln Trp Ala Asp Tyr Arg Ala Leu Thr Gly Asp Glu Ser Asp Asn
180 185 190Leu Pro Gly Val Lys Gly
Ile Gly Glu Lys Thr Ala Arg Lys Leu Leu 195 200
205Glu Glu Trp Gly Ser Leu Glu Ala Leu Leu Lys Asn Leu Asp
Arg Leu 210 215 220Lys Pro Ala Ile Arg
Glu Lys Ile Leu Ala His Met Asp Asp Leu Lys225 230
235 240Leu Ser Trp Asp Leu Ala Lys Val Arg Thr
Asp Leu Pro Leu Glu Val 245 250
255Asp Phe Ala Lys Arg Arg Glu Pro Asp Arg Glu Arg Leu Arg Ala Phe
260 265 270Leu Glu Arg Leu Glu
Phe Gly Ser Leu Leu His Glu Phe Gly Leu Leu 275
280 285Glu Ser Pro Lys Ala Leu Glu Glu Ala Pro Trp Pro
Pro Pro Glu Gly 290 295 300Ala Phe Val
Gly Phe Val Leu Ser Arg Lys Glu Pro Met Trp Ala Asp305
310 315 320Leu Leu Ala Leu Ala Ala Ala
Arg Gly Gly Arg Val His Arg Ala Pro 325
330 335Glu Pro Tyr Lys Ala Leu Arg Asp Leu Lys Glu Ala
Arg Gly Leu Leu 340 345 350Ala
Lys Asp Leu Ser Val Leu Ala Leu Arg Glu Gly Leu Gly Leu Pro 355
360 365Pro Gly Asp Asp Pro Met Leu Leu Ala
Tyr Leu Leu Asp Pro Ser Asn 370 375
380Thr Thr Pro Glu Gly Val Ala Arg Arg Tyr Gly Gly Glu Trp Thr Glu385
390 395 400Glu Ala Gly Glu
Arg Ala Ala Leu Ser Glu Arg Leu Phe Ala Asn Leu 405
410 415Trp Gly Arg Leu Glu Gly Glu Glu Arg Leu
Leu Trp Leu Tyr Arg Glu 420 425
430Val Glu Arg Pro Leu Ser Ala Val Leu Ala His Met Glu Ala Thr Gly
435 440 445Val Arg Leu Asp Val Ala Tyr
Leu Arg Ala Leu Ser Leu Glu Val Ala 450 455
460Glu Glu Ile Ala Arg Leu Glu Ala Glu Val Phe Arg Leu Ala Gly
His465 470 475 480Pro Phe
Asn Leu Asn Ser Arg Asp Gln Leu Glu Arg Val Leu Phe Asp
485 490 495Glu Leu Gly Leu Pro Ala Ile
Gly Lys Thr Glu Lys Thr Gly Lys Arg 500 505
510Ser Thr Ser Ala Ala Val Leu Glu Ala Leu Arg Glu Ala His
Pro Ile 515 520 525Val Glu Lys Ile
Leu Gln Tyr Arg Glu Leu Thr Lys Leu Lys Ser Thr 530
535 540Tyr Ile Asp Pro Leu Pro Asp Leu Ile His Pro Arg
Thr Gly Arg Leu545 550 555
560His Thr Arg Phe Asn Gln Thr Ala Thr Ala Thr Gly Arg Leu Ser Ser
565 570 575Ser Asp Pro Asn Leu
Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln 580
585 590Arg Ile Arg Arg Ala Phe Ile Ala Glu Glu Gly Trp
Leu Leu Val Ala 595 600 605Leu Asp
Tyr Ser Gln Ile Glu Leu Arg Val Leu Ala His Leu Ser Gly 610
615 620Asp Glu Asn Leu Ile Arg Val Phe Gln Glu Gly
Arg Asp Ile His Thr625 630 635
640Glu Thr Ala Ser Trp Met Phe Gly Val Pro Arg Glu Ala Val Asp Pro
645 650 655Leu Met Arg Arg
Ala Ala Lys Thr Ile Asn Phe Gly Val Leu Tyr Gly 660
665 670Met Ser Ala His Arg Leu Ser Gln Glu Leu Ala
Ile Pro Tyr Glu Glu 675 680 685Ala
Gln Ala Phe Ile Glu Arg Tyr Phe Gln Ser Phe Pro Lys Val Arg 690
695 700Ala Trp Ile Glu Lys Thr Leu Glu Glu Gly
Arg Arg Arg Gly Tyr Val705 710 715
720Glu Thr Leu Phe Gly Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala
Arg 725 730 735Val Lys Ser
Val Arg Glu Ala Ala Glu Arg Met Ala Phe Asn Met Pro 740
745 750Val Gln Gly Thr Ala Ala Asp Leu Met Lys
Leu Ala Met Val Lys Leu 755 760
765Phe Pro Arg Leu Glu Glu Met Gly Ala Arg Met Leu Leu Gln Val Ser 770
775 780Asp Glu Leu Val Leu Glu Ala Pro
Lys Glu Arg Ala Glu Ala Val Ala785 790
795 800Arg Leu Ala Lys Glu Val Met Glu Gly Val Tyr Pro
Leu Ala Val Pro 805 810
815Leu Glu Val Glu Val Gly Ile Gly Glu Asp Trp Leu Ser Ala Lys Glu
820 825 830Ala
Ala1502507DNAArtificial SequenceNUCLEOTIDE SEQUENCE OF MUTANT ID 22
(H784T) 150catatgcgtg gtatgctgcc gttgttcgag cctaaaggcc gcgtactgtt
agtcgatggt 60catcacttgg cctatcggac gttccatgca ctcaaaggtc tgacgaccag
tcgtggcgaa 120ccggtccagg ctgtttatgg tttcgctaag tctttgctca aagcactgaa
agaagacggg 180gacgcggtaa ttgttgtatt tgatgccaaa gcaccgagct tccgccacga
agcttatggt 240ggctacaagg caggacgcgc ccctacccca gaagatttcc cccgtcagct
ggcattaatt 300aaggagttag tagaccttct cggcttagcg cgtctggaag ttccgggtta
tgaggcggac 360gatgtccttg catccttggc taaaaaggcc gaaaaagagg gctacgaagt
ccgcatcttg 420acggcagaca aagatctgta ccagcttctg tctgaccgta ttcatgtttt
gcaccctgaa 480ggctacttaa tcactccggc ctggctctgg gaaaagtacg gtctgcgtcc
cgatcagtgg 540gcggattatc gggctttgac gggagatgag agcgacaacc tgccaggagt
taagggcatt 600ggtgaaaaaa ccgcacgtaa gctgcttgaa gagtggggtt ccctggaagc
cttgttaaaa 660aatctggatc gtctcaagcc cgcaattcgt gaaaagatcc tggctcatat
ggacgatctt 720aaattaagtt gggacctggc caaggtgcgc accgatttac cgcttgaagt
ggattttgca 780aaacgccgtg agccggaccg ggaacgttta cgcgctttct tagagcgtct
ggaattcggt 840tcactgcttc atgaattcgg tctgttagag tctcctaaag cactcgaaga
ggcaccgtgg 900ccgcccccag aaggtgcttt tgttggcttc gtactttccc gtaaggagcc
tatgtgggca 960gatcttctgg ctttagcggc tgcacgcggt ggccgtgttc accgggcccc
tgagccatac 1020aaagcgttac gtgatctgaa ggaagcacgt ggcttgctgg caaaagacct
ttctgttttg 1080gccctgcgcg agggtcttgg actgccgcca ggcgacgatc ccatgttatt
ggcctatctg 1140ttagacccta gcaataccac acctgaaggg gtcgctcgtc ggtatggcgg
tgaatggact 1200gaggaagccg gagagcgcgc cgcattgtcc gaacggctct ttgcaaactt
atggggtcgt 1260ctggaagggg aggaacgtct gttatggttg tatcgggaag tcgaacgtcc
tctttcggcc 1320gtattagcgc atatggaggc aacaggtgtg cgtttagatg tcgcgtacct
tcgggcctta 1380tcactggaag ttgcagagga aatcgcccgt ctcgaggctg aagtgttccg
gttggccggt 1440cacccgttta acctcaactc ccgtgaccag ctggaacgcg ttttattcga
tgagcttggg 1500cttcccgcaa ttggcaaaac cgaaaagact ggcaaacgca gtacgagcgc
tgccgtcctt 1560gaggcactcc gcgaggctca ccctattgta gaaaagatcc tgcaataccg
tgagttgacg 1620aagcttaaaa gcacttatat tgatcctctc ccggatctga tccatcctcg
taccggccgc 1680ttgcacacac gtttcaacca gacggcgact gcaaccggcc gtctgtctag
ctcggatcca 1740aatctccaga acattccggt ccgtacaccc ttgggccaac gtatccgccg
ggcgtttatc 1800gctgaggaag gatggttact ggtcgcattg gactactcgc agattgagct
gcgcgtcctc 1860gcacatctct ctggtgacga aaatttaatc cgcgtgtttc aagaggggcg
tgatattcac 1920acagaaactg cctcatggat gttcggtgtc ccacgtgaag cagtggatcc
tttgatgcgc 1980cgtgcagcta aaacaattaa ttttggagtg ctgtacggaa tgagcgctca
tcgcttgagt 2040caggaactgg caatccccta cgaggaagcg caggcattca tcgaacgtta
ctttcaatcg 2100tttccgaaag ttcgcgcatg gatcgagaag acgctcgagg aaggtcgtcg
tcggggctat 2160gtcgaaactc tgtttggtcg ccgtcggtac gtaccagatc ttgaagcccg
cgtcaaatcg 2220gtacgggagg ctgcggagcg tatggcattt aatatgcctg tacagggtac
tgcagctgac 2280ctcatgaaac tggcaatggt caagcttttc ccgcgcttgg aggaaatggg
cgcacgtatg 2340cttctgcagg tcacggacga gctggtgtta gaagccccta aggagcgcgc
cgaagctgtc 2400gcgcgcctcg ctaaagaagt gatggagggc gtttacccat tggccgtacc
cctcgaagtg 2460gaggtcggta ttggagaaga ttggttatct gcaaaggaag cggccgc
2507151834PRTArtificial SequenceAMINO ACID SEQUENCE OF MUTANT
ID 22 (H784T) 151Met Arg Gly Met Leu Pro Leu Phe Glu Pro Lys Gly Arg Val
Leu Leu1 5 10 15Val Asp
Gly His His Leu Ala Tyr Arg Thr Phe His Ala Leu Lys Gly 20
25 30Leu Thr Thr Ser Arg Gly Glu Pro Val
Gln Ala Val Tyr Gly Phe Ala 35 40
45Lys Ser Leu Leu Lys Ala Leu Lys Glu Asp Gly Asp Ala Val Ile Val 50
55 60Val Phe Asp Ala Lys Ala Pro Ser Phe
Arg His Glu Ala Tyr Gly Gly65 70 75
80Tyr Lys Ala Gly Arg Ala Pro Thr Pro Glu Asp Phe Pro Arg
Gln Leu 85 90 95Ala Leu
Ile Lys Glu Leu Val Asp Leu Leu Gly Leu Ala Arg Leu Glu 100
105 110Val Pro Gly Tyr Glu Ala Asp Asp Val
Leu Ala Ser Leu Ala Lys Lys 115 120
125Ala Glu Lys Glu Gly Tyr Glu Val Arg Ile Leu Thr Ala Asp Lys Asp
130 135 140Leu Tyr Gln Leu Leu Ser Asp
Arg Ile His Val Leu His Pro Glu Gly145 150
155 160Tyr Leu Ile Thr Pro Ala Trp Leu Trp Glu Lys Tyr
Gly Leu Arg Pro 165 170
175Asp Gln Trp Ala Asp Tyr Arg Ala Leu Thr Gly Asp Glu Ser Asp Asn
180 185 190Leu Pro Gly Val Lys Gly
Ile Gly Glu Lys Thr Ala Arg Lys Leu Leu 195 200
205Glu Glu Trp Gly Ser Leu Glu Ala Leu Leu Lys Asn Leu Asp
Arg Leu 210 215 220Lys Pro Ala Ile Arg
Glu Lys Ile Leu Ala His Met Asp Asp Leu Lys225 230
235 240Leu Ser Trp Asp Leu Ala Lys Val Arg Thr
Asp Leu Pro Leu Glu Val 245 250
255Asp Phe Ala Lys Arg Arg Glu Pro Asp Arg Glu Arg Leu Arg Ala Phe
260 265 270Leu Glu Arg Leu Glu
Phe Gly Ser Leu Leu His Glu Phe Gly Leu Leu 275
280 285Glu Ser Pro Lys Ala Leu Glu Glu Ala Pro Trp Pro
Pro Pro Glu Gly 290 295 300Ala Phe Val
Gly Phe Val Leu Ser Arg Lys Glu Pro Met Trp Ala Asp305
310 315 320Leu Leu Ala Leu Ala Ala Ala
Arg Gly Gly Arg Val His Arg Ala Pro 325
330 335Glu Pro Tyr Lys Ala Leu Arg Asp Leu Lys Glu Ala
Arg Gly Leu Leu 340 345 350Ala
Lys Asp Leu Ser Val Leu Ala Leu Arg Glu Gly Leu Gly Leu Pro 355
360 365Pro Gly Asp Asp Pro Met Leu Leu Ala
Tyr Leu Leu Asp Pro Ser Asn 370 375
380Thr Thr Pro Glu Gly Val Ala Arg Arg Tyr Gly Gly Glu Trp Thr Glu385
390 395 400Glu Ala Gly Glu
Arg Ala Ala Leu Ser Glu Arg Leu Phe Ala Asn Leu 405
410 415Trp Gly Arg Leu Glu Gly Glu Glu Arg Leu
Leu Trp Leu Tyr Arg Glu 420 425
430Val Glu Arg Pro Leu Ser Ala Val Leu Ala His Met Glu Ala Thr Gly
435 440 445Val Arg Leu Asp Val Ala Tyr
Leu Arg Ala Leu Ser Leu Glu Val Ala 450 455
460Glu Glu Ile Ala Arg Leu Glu Ala Glu Val Phe Arg Leu Ala Gly
His465 470 475 480Pro Phe
Asn Leu Asn Ser Arg Asp Gln Leu Glu Arg Val Leu Phe Asp
485 490 495Glu Leu Gly Leu Pro Ala Ile
Gly Lys Thr Glu Lys Thr Gly Lys Arg 500 505
510Ser Thr Ser Ala Ala Val Leu Glu Ala Leu Arg Glu Ala His
Pro Ile 515 520 525Val Glu Lys Ile
Leu Gln Tyr Arg Glu Leu Thr Lys Leu Lys Ser Thr 530
535 540Tyr Ile Asp Pro Leu Pro Asp Leu Ile His Pro Arg
Thr Gly Arg Leu545 550 555
560His Thr Arg Phe Asn Gln Thr Ala Thr Ala Thr Gly Arg Leu Ser Ser
565 570 575Ser Asp Pro Asn Leu
Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln 580
585 590Arg Ile Arg Arg Ala Phe Ile Ala Glu Glu Gly Trp
Leu Leu Val Ala 595 600 605Leu Asp
Tyr Ser Gln Ile Glu Leu Arg Val Leu Ala His Leu Ser Gly 610
615 620Asp Glu Asn Leu Ile Arg Val Phe Gln Glu Gly
Arg Asp Ile His Thr625 630 635
640Glu Thr Ala Ser Trp Met Phe Gly Val Pro Arg Glu Ala Val Asp Pro
645 650 655Leu Met Arg Arg
Ala Ala Lys Thr Ile Asn Phe Gly Val Leu Tyr Gly 660
665 670Met Ser Ala His Arg Leu Ser Gln Glu Leu Ala
Ile Pro Tyr Glu Glu 675 680 685Ala
Gln Ala Phe Ile Glu Arg Tyr Phe Gln Ser Phe Pro Lys Val Arg 690
695 700Ala Trp Ile Glu Lys Thr Leu Glu Glu Gly
Arg Arg Arg Gly Tyr Val705 710 715
720Glu Thr Leu Phe Gly Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala
Arg 725 730 735Val Lys Ser
Val Arg Glu Ala Ala Glu Arg Met Ala Phe Asn Met Pro 740
745 750Val Gln Gly Thr Ala Ala Asp Leu Met Lys
Leu Ala Met Val Lys Leu 755 760
765Phe Pro Arg Leu Glu Glu Met Gly Ala Arg Met Leu Leu Gln Val Thr 770
775 780Asp Glu Leu Val Leu Glu Ala Pro
Lys Glu Arg Ala Glu Ala Val Ala785 790
795 800Arg Leu Ala Lys Glu Val Met Glu Gly Val Tyr Pro
Leu Ala Val Pro 805 810
815Leu Glu Val Glu Val Gly Ile Gly Glu Asp Trp Leu Ser Ala Lys Glu
820 825 830Ala
Ala1521964DNAArtificial SequenceNUCLEOTIDE SEQUENCE OF MUTANT ID 24
(H784V). 152gattatcggg ctttgacggg agatgagagc gacaacctgc caggagttaa
gggcattggt 60gaaaaaaccg cacgtaagct gcttgaagag tggggttccc tggaagcctt
gttaaaaaat 120ctggatcgtc tcaagcccgc aattcgtgaa aagatcctgg ctcatatgga
cgatcttaaa 180ttaagttggg acctggccaa ggtgcgcacc gatttaccgc ttgaagtgga
ttttgcaaaa 240cgccgtgagc cggaccggga acgtttacgc gctttcttag agcgtctgga
attcggttca 300ctgcttcatg aattcggtct gttagagtct cctaaagcac tcgaagaggc
accgtggccg 360cccccagaag gtgcttttgt tggcttcgta ctttcccgta aggagcctat
gtgggcagat 420cttctggctt tagcggctgc acgcggtggc cgtgttcacc gggcccctga
gccatacaaa 480gcgttacgtg atctgaagga agcacgtggc ttgctggcaa aagacctttc
tgttttggcc 540ctgcgcgagg gtcttggact gccgccaggc gacgatccca tgttattggc
ctatctgtta 600gaccctagca ataccacacc tgaaggggtc gctcgtcggt atggcggtga
atggactgag 660gaagccggag agcgcgccgc attgtccgaa cggctctttg caaacttatg
gggtcgtctg 720gaaggggagg aacgtctgtt atggttgtat cgggaagtcg aacgtcctct
ttcggccgta 780ttagcgcata tggaggcaac aggtgtgcgt ttagatgtcg cgtaccttcg
ggccttatca 840ctggaagttg cagaggaaat cgcccgtctc gaggctgaag tgttccggtt
ggccggtcac 900ccgtttaacc tcaactcccg tgaccagctg gaacgcgttt tattcgatga
gcttgggctt 960cccgcaattg gcaaaaccga aaagactggc aaacgcagta cgagcgctgc
cgtccttgag 1020gcactccgcg aggctcaccc tattgtagaa aagatcctgc aataccgtga
gttgacgaag 1080cttaaaagca cttatattga tcctctcccg gatctgatcc atcctcgtac
cggccgcttg 1140cacacacgtt tcaaccagac ggcgactgca accggccgtc tgtctagctc
ggatccaaat 1200ctccagaaca ttccggtccg tacacccttg ggccaacgta tccgccgggc
gtttatcgct 1260gaggaaggat ggttactggt cgcattggac tactcgcaga ttgagctgcg
cgtcctcgca 1320catctctctg gtgacgaaaa tttaatccgc gtgtttcaag aggggcgtga
tattcacaca 1380gaaactgcct catggatgtt cggtgtccca cgtgaagcag tggatccttt
gatgcgccgt 1440gcagctaaaa caattaattt tggagtgctg tacggaatga gcgctcatcg
cttgagtcag 1500gaactggcaa tcccctacga ggaagcgcag gcattcatcg aacgttactt
tcaatcgttt 1560ccgaaagttc gcgcatggat cgagaagacg ctcgaggaag gtcgtcgtcg
gggctatgtc 1620gaaactctgt ttggtcgccg tcggtacgta ccagatcttg aagcccgcgt
caaatcggta 1680cgggaggctg cggagcgtat ggcatttaat atgcctgtac agggtactgc
agctgacctc 1740atgaaactgg caatggtcaa gcttttcccg cgcttggagg aaatgggcgc
acgtatgctt 1800ctgcaggtcg tagacgagct ggtgttagaa gcccctaagg agcgcgccga
agctgtcgcg 1860cgcctcgcta aagaagtgat ggagggcgtt tacccattgg ccgtacccct
cgaagtggag 1920gtcggtattg gagaagattg gttatctgca aaggaagcgg ccgc
1964153834PRTArtificial SequenceAMINO ACID SEQUENCE OF MUTANT
ID 24 (H784V). 153Met Arg Gly Met Leu Pro Leu Phe Glu Pro Lys Gly Arg Val
Leu Leu1 5 10 15Val Asp
Gly His His Leu Ala Tyr Arg Thr Phe His Ala Leu Lys Gly 20
25 30Leu Thr Thr Ser Arg Gly Glu Pro Val
Gln Ala Val Tyr Gly Phe Ala 35 40
45Lys Ser Leu Leu Lys Ala Leu Lys Glu Asp Gly Asp Ala Val Ile Val 50
55 60Val Phe Asp Ala Lys Ala Pro Ser Phe
Arg His Glu Ala Tyr Gly Gly65 70 75
80Tyr Lys Ala Gly Arg Ala Pro Thr Pro Glu Asp Phe Pro Arg
Gln Leu 85 90 95Ala Leu
Ile Lys Glu Leu Val Asp Leu Leu Gly Leu Ala Arg Leu Glu 100
105 110Val Pro Gly Tyr Glu Ala Asp Asp Val
Leu Ala Ser Leu Ala Lys Lys 115 120
125Ala Glu Lys Glu Gly Tyr Glu Val Arg Ile Leu Thr Ala Asp Lys Asp
130 135 140Leu Tyr Gln Leu Leu Ser Asp
Arg Ile His Val Leu His Pro Glu Gly145 150
155 160Tyr Leu Ile Thr Pro Ala Trp Leu Trp Glu Lys Tyr
Gly Leu Arg Pro 165 170
175Asp Gln Trp Ala Asp Tyr Arg Ala Leu Thr Gly Asp Glu Ser Asp Asn
180 185 190Leu Pro Gly Val Lys Gly
Ile Gly Glu Lys Thr Ala Arg Lys Leu Leu 195 200
205Glu Glu Trp Gly Ser Leu Glu Ala Leu Leu Lys Asn Leu Asp
Arg Leu 210 215 220Lys Pro Ala Ile Arg
Glu Lys Ile Leu Ala His Met Asp Asp Leu Lys225 230
235 240Leu Ser Trp Asp Leu Ala Lys Val Arg Thr
Asp Leu Pro Leu Glu Val 245 250
255Asp Phe Ala Lys Arg Arg Glu Pro Asp Arg Glu Arg Leu Arg Ala Phe
260 265 270Leu Glu Arg Leu Glu
Phe Gly Ser Leu Leu His Glu Phe Gly Leu Leu 275
280 285Glu Ser Pro Lys Ala Leu Glu Glu Ala Pro Trp Pro
Pro Pro Glu Gly 290 295 300Ala Phe Val
Gly Phe Val Leu Ser Arg Lys Glu Pro Met Trp Ala Asp305
310 315 320Leu Leu Ala Leu Ala Ala Ala
Arg Gly Gly Arg Val His Arg Ala Pro 325
330 335Glu Pro Tyr Lys Ala Leu Arg Asp Leu Lys Glu Ala
Arg Gly Leu Leu 340 345 350Ala
Lys Asp Leu Ser Val Leu Ala Leu Arg Glu Gly Leu Gly Leu Pro 355
360 365Pro Gly Asp Asp Pro Met Leu Leu Ala
Tyr Leu Leu Asp Pro Ser Asn 370 375
380Thr Thr Pro Glu Gly Val Ala Arg Arg Tyr Gly Gly Glu Trp Thr Glu385
390 395 400Glu Ala Gly Glu
Arg Ala Ala Leu Ser Glu Arg Leu Phe Ala Asn Leu 405
410 415Trp Gly Arg Leu Glu Gly Glu Glu Arg Leu
Leu Trp Leu Tyr Arg Glu 420 425
430Val Glu Arg Pro Leu Ser Ala Val Leu Ala His Met Glu Ala Thr Gly
435 440 445Val Arg Leu Asp Val Ala Tyr
Leu Arg Ala Leu Ser Leu Glu Val Ala 450 455
460Glu Glu Ile Ala Arg Leu Glu Ala Glu Val Phe Arg Leu Ala Gly
His465 470 475 480Pro Phe
Asn Leu Asn Ser Arg Asp Gln Leu Glu Arg Val Leu Phe Asp
485 490 495Glu Leu Gly Leu Pro Ala Ile
Gly Lys Thr Glu Lys Thr Gly Lys Arg 500 505
510Ser Thr Ser Ala Ala Val Leu Glu Ala Leu Arg Glu Ala His
Pro Ile 515 520 525Val Glu Lys Ile
Leu Gln Tyr Arg Glu Leu Thr Lys Leu Lys Ser Thr 530
535 540Tyr Ile Asp Pro Leu Pro Asp Leu Ile His Pro Arg
Thr Gly Arg Leu545 550 555
560His Thr Arg Phe Asn Gln Thr Ala Thr Ala Thr Gly Arg Leu Ser Ser
565 570 575Ser Asp Pro Asn Leu
Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln 580
585 590Arg Ile Arg Arg Ala Phe Ile Ala Glu Glu Gly Trp
Leu Leu Val Ala 595 600 605Leu Asp
Tyr Ser Gln Ile Glu Leu Arg Val Leu Ala His Leu Ser Gly 610
615 620Asp Glu Asn Leu Ile Arg Val Phe Gln Glu Gly
Arg Asp Ile His Thr625 630 635
640Glu Thr Ala Ser Trp Met Phe Gly Val Pro Arg Glu Ala Val Asp Pro
645 650 655Leu Met Arg Arg
Ala Ala Lys Thr Ile Asn Phe Gly Val Leu Tyr Gly 660
665 670Met Ser Ala His Arg Leu Ser Gln Glu Leu Ala
Ile Pro Tyr Glu Glu 675 680 685Ala
Gln Ala Phe Ile Glu Arg Tyr Phe Gln Ser Phe Pro Lys Val Arg 690
695 700Ala Trp Ile Glu Lys Thr Leu Glu Glu Gly
Arg Arg Arg Gly Tyr Val705 710 715
720Glu Thr Leu Phe Gly Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala
Arg 725 730 735Val Lys Ser
Val Arg Glu Ala Ala Glu Arg Met Ala Phe Asn Met Pro 740
745 750Val Gln Gly Thr Ala Ala Asp Leu Met Lys
Leu Ala Met Val Lys Leu 755 760
765Phe Pro Arg Leu Glu Glu Met Gly Ala Arg Met Leu Leu Gln Val Val 770
775 780Asp Glu Leu Val Leu Glu Ala Pro
Lys Glu Arg Ala Glu Ala Val Ala785 790
795 800Arg Leu Ala Lys Glu Val Met Glu Gly Val Tyr Pro
Leu Ala Val Pro 805 810
815Leu Glu Val Glu Val Gly Ile Gly Glu Asp Trp Leu Ser Ala Lys Glu
820 825 830Ala
Ala1542507DNAArtificial SequenceNUCLEOTIDE SEQUENCE OF MUTANT ID 26
(H784I) 154catatgcgtg gtatgctgcc gttgttcgag cctaaaggcc gcgtactgtt
agtcgatggt 60catcacttgg cctatcggac gttccatgca ctcaaaggtc tgacgaccag
tcgtggcgaa 120ccggtccagg ctgtttatgg tttcgctaag tctttgctca aagcactgaa
agaagacggg 180gacgcggtaa ttgttgtatt tgatgccaaa gcaccgagct tccgccacga
agcttatggt 240ggctacaagg caggacgcgc ccctacccca gaagatttcc cccgtcagct
ggcattaatt 300aaggagttag tagaccttct cggcttagcg cgtctggaag ttccgggtta
tgaggcggac 360gatgtccttg catccttggc taaaaaggcc gaaaaagagg gctacgaagt
ccgcatcttg 420acggcagaca aagatctgta ccagcttctg tctgaccgta ttcatgtttt
gcaccctgaa 480ggctacttaa tcactccggc ctggctctgg gaaaagtacg gtctgcgtcc
cgatcagtgg 540gcggattatc gggctttgac gggagatgag agcgacaacc tgccaggagt
taagggcatt 600ggtgaaaaaa ccgcacgtaa gctgcttgaa gagtggggtt ccctggaagc
cttgttaaaa 660aatctggatc gtctcaagcc cgcaattcgt gaaaagatcc tggctcatat
ggacgatctt 720aaattaagtt gggacctggc caaggtgcgc accgatttac cgcttgaagt
ggattttgca 780aaacgccgtg agccggaccg ggaacgttta cgcgctttct tagagcgtct
ggaattcggt 840tcactgcttc atgaattcgg tctgttagag tctcctaaag cactcgaaga
ggcaccgtgg 900ccgcccccag aaggtgcttt tgttggcttc gtactttccc gtaaggagcc
tatgtgggca 960gatcttctgg ctttagcggc tgcacgcggt ggccgtgttc accgggcccc
tgagccatac 1020aaagcgttac gtgatctgaa ggaagcacgt ggcttgctgg caaaagacct
ttctgttttg 1080gccctgcgcg agggtcttgg actgccgcca ggcgacgatc ccatgttatt
ggcctatctg 1140ttagacccta gcaataccac acctgaaggg gtcgctcgtc ggtatggcgg
tgaatggact 1200gaggaagccg gagagcgcgc cgcattgtcc gaacggctct ttgcaaactt
atggggtcgt 1260ctggaagggg aggaacgtct gttatggttg tatcgggaag tcgaacgtcc
tctttcggcc 1320gtattagcgc atatggaggc aacaggtgtg cgtttagatg tcgcgtacct
tcgggcctta 1380tcactggaag ttgcagagga aatcgcccgt ctcgaggctg aagtgttccg
gttggccggt 1440cacccgttta acctcaactc ccgtgaccag ctggaacgcg ttttattcga
tgagcttggg 1500cttcccgcaa ttggcaaaac cgaaaagact ggcaaacgca gtacgagcgc
tgccgtcctt 1560gaggcactcc gcgaggctca ccctattgta gaaaagatcc tgcaataccg
tgagttgacg 1620aagcttaaaa gcacttatat tgatcctctc ccggatctga tccatcctcg
taccggccgc 1680ttgcacacac gtttcaacca gacggcgact gcaaccggcc gtctgtctag
ctcggatcca 1740aatctccaga acattccggt ccgtacaccc ttgggccaac gtatccgccg
ggcgtttatc 1800gctgaggaag gatggttact ggtcgcattg gactactcgc agattgagct
gcgcgtcctc 1860gcacatctct ctggtgacga aaatttaatc cgcgtgtttc aagaggggcg
tgatattcac 1920acagaaactg cctcatggat gttcggtgtc ccacgtgaag cagtggatcc
tttgatgcgc 1980cgtgcagcta aaacaattaa ttttggagtg ctgtacggaa tgagcgctca
tcgcttgagt 2040caggaactgg caatccccta cgaggaagcg caggcattca tcgaacgtta
ctttcaatcg 2100tttccgaaag ttcgcgcatg gatcgagaag acgctcgagg aaggtcgtcg
tcggggctat 2160gtcgaaactc tgtttggtcg ccgtcggtac gtaccagatc ttgaagcccg
cgtcaaatcg 2220gtacgggagg ctgcggagcg tatggcattt aatatgcctg tacagggtac
tgcagctgac 2280ctcatgaaac tggcaatggt caagcttttc ccgcgcttgg aggaaatggg
cgcacgtatg 2340cttctgcagg tcattgacga gctggtgtta gaagccccta aggagcgcgc
cgaagctgtc 2400gcgcgcctcg ctaaagaagt gatggagggc gtttacccat tggccgtacc
cctcgaagtg 2460gaggtcggta ttggagaaga ttggttatct gcaaaggaag cggccgc
2507155834PRTArtificial SequenceAMINO ACID SEQUENCE OF MUTANT
ID 26 (H784I) 155Met Arg Gly Met Leu Pro Leu Phe Glu Pro Lys Gly Arg Val
Leu Leu1 5 10 15Val Asp
Gly His His Leu Ala Tyr Arg Thr Phe His Ala Leu Lys Gly 20
25 30Leu Thr Thr Ser Arg Gly Glu Pro Val
Gln Ala Val Tyr Gly Phe Ala 35 40
45Lys Ser Leu Leu Lys Ala Leu Lys Glu Asp Gly Asp Ala Val Ile Val 50
55 60Val Phe Asp Ala Lys Ala Pro Ser Phe
Arg His Glu Ala Tyr Gly Gly65 70 75
80Tyr Lys Ala Gly Arg Ala Pro Thr Pro Glu Asp Phe Pro Arg
Gln Leu 85 90 95Ala Leu
Ile Lys Glu Leu Val Asp Leu Leu Gly Leu Ala Arg Leu Glu 100
105 110Val Pro Gly Tyr Glu Ala Asp Asp Val
Leu Ala Ser Leu Ala Lys Lys 115 120
125Ala Glu Lys Glu Gly Tyr Glu Val Arg Ile Leu Thr Ala Asp Lys Asp
130 135 140Leu Tyr Gln Leu Leu Ser Asp
Arg Ile His Val Leu His Pro Glu Gly145 150
155 160Tyr Leu Ile Thr Pro Ala Trp Leu Trp Glu Lys Tyr
Gly Leu Arg Pro 165 170
175Asp Gln Trp Ala Asp Tyr Arg Ala Leu Thr Gly Asp Glu Ser Asp Asn
180 185 190Leu Pro Gly Val Lys Gly
Ile Gly Glu Lys Thr Ala Arg Lys Leu Leu 195 200
205Glu Glu Trp Gly Ser Leu Glu Ala Leu Leu Lys Asn Leu Asp
Arg Leu 210 215 220Lys Pro Ala Ile Arg
Glu Lys Ile Leu Ala His Met Asp Asp Leu Lys225 230
235 240Leu Ser Trp Asp Leu Ala Lys Val Arg Thr
Asp Leu Pro Leu Glu Val 245 250
255Asp Phe Ala Lys Arg Arg Glu Pro Asp Arg Glu Arg Leu Arg Ala Phe
260 265 270Leu Glu Arg Leu Glu
Phe Gly Ser Leu Leu His Glu Phe Gly Leu Leu 275
280 285Glu Ser Pro Lys Ala Leu Glu Glu Ala Pro Trp Pro
Pro Pro Glu Gly 290 295 300Ala Phe Val
Gly Phe Val Leu Ser Arg Lys Glu Pro Met Trp Ala Asp305
310 315 320Leu Leu Ala Leu Ala Ala Ala
Arg Gly Gly Arg Val His Arg Ala Pro 325
330 335Glu Pro Tyr Lys Ala Leu Arg Asp Leu Lys Glu Ala
Arg Gly Leu Leu 340 345 350Ala
Lys Asp Leu Ser Val Leu Ala Leu Arg Glu Gly Leu Gly Leu Pro 355
360 365Pro Gly Asp Asp Pro Met Leu Leu Ala
Tyr Leu Leu Asp Pro Ser Asn 370 375
380Thr Thr Pro Glu Gly Val Ala Arg Arg Tyr Gly Gly Glu Trp Thr Glu385
390 395 400Glu Ala Gly Glu
Arg Ala Ala Leu Ser Glu Arg Leu Phe Ala Asn Leu 405
410 415Trp Gly Arg Leu Glu Gly Glu Glu Arg Leu
Leu Trp Leu Tyr Arg Glu 420 425
430Val Glu Arg Pro Leu Ser Ala Val Leu Ala His Met Glu Ala Thr Gly
435 440 445Val Arg Leu Asp Val Ala Tyr
Leu Arg Ala Leu Ser Leu Glu Val Ala 450 455
460Glu Glu Ile Ala Arg Leu Glu Ala Glu Val Phe Arg Leu Ala Gly
His465 470 475 480Pro Phe
Asn Leu Asn Ser Arg Asp Gln Leu Glu Arg Val Leu Phe Asp
485 490 495Glu Leu Gly Leu Pro Ala Ile
Gly Lys Thr Glu Lys Thr Gly Lys Arg 500 505
510Ser Thr Ser Ala Ala Val Leu Glu Ala Leu Arg Glu Ala His
Pro Ile 515 520 525Val Glu Lys Ile
Leu Gln Tyr Arg Glu Leu Thr Lys Leu Lys Ser Thr 530
535 540Tyr Ile Asp Pro Leu Pro Asp Leu Ile His Pro Arg
Thr Gly Arg Leu545 550 555
560His Thr Arg Phe Asn Gln Thr Ala Thr Ala Thr Gly Arg Leu Ser Ser
565 570 575Ser Asp Pro Asn Leu
Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln 580
585 590Arg Ile Arg Arg Ala Phe Ile Ala Glu Glu Gly Trp
Leu Leu Val Ala 595 600 605Leu Asp
Tyr Ser Gln Ile Glu Leu Arg Val Leu Ala His Leu Ser Gly 610
615 620Asp Glu Asn Leu Ile Arg Val Phe Gln Glu Gly
Arg Asp Ile His Thr625 630 635
640Glu Thr Ala Ser Trp Met Phe Gly Val Pro Arg Glu Ala Val Asp Pro
645 650 655Leu Met Arg Arg
Ala Ala Lys Thr Ile Asn Phe Gly Val Leu Tyr Gly 660
665 670Met Ser Ala His Arg Leu Ser Gln Glu Leu Ala
Ile Pro Tyr Glu Glu 675 680 685Ala
Gln Ala Phe Ile Glu Arg Tyr Phe Gln Ser Phe Pro Lys Val Arg 690
695 700Ala Trp Ile Glu Lys Thr Leu Glu Glu Gly
Arg Arg Arg Gly Tyr Val705 710 715
720Glu Thr Leu Phe Gly Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala
Arg 725 730 735Val Lys Ser
Val Arg Glu Ala Ala Glu Arg Met Ala Phe Asn Met Pro 740
745 750Val Gln Gly Thr Ala Ala Asp Leu Met Lys
Leu Ala Met Val Lys Leu 755 760
765Phe Pro Arg Leu Glu Glu Met Gly Ala Arg Met Leu Leu Gln Val Val 770
775 780Asp Glu Leu Val Leu Glu Ala Pro
Lys Glu Arg Ala Glu Ala Val Ala785 790
795 800Arg Leu Ala Lys Glu Val Met Glu Gly Val Tyr Pro
Leu Ala Val Pro 805 810
815Leu Glu Val Glu Val Gly Ile Gly Glu Asp Trp Leu Ser Ala Lys Glu
820 825 830Ala
Ala1562507DNAArtificial SequenceNUCLEOTIDE SEQUENCE OF MUTANT ID 27
(H784M) 156catatgcgtg gtatgctgcc gttgttcgag cctaaaggcc gcgtactgtt
agtcgatggt 60catcacttgg cctatcggac gttccatgca ctcaaaggtc tgacgaccag
tcgtggcgaa 120ccggtccagg ctgtttatgg tttcgctaag tctttgctca aagcactgaa
agaagacggg 180gacgcggtaa ttgttgtatt tgatgccaaa gcaccgagct tccgccacga
agcttatggt 240ggctacaagg caggacgcgc ccctacccca gaagatttcc cccgtcagct
ggcattaatt 300aaggagttag tagaccttct cggcttagcg cgtctggaag ttccgggtta
tgaggcggac 360gatgtccttg catccttggc taaaaaggcc gaaaaagagg gctacgaagt
ccgcatcttg 420acggcagaca aagatctgta ccagcttctg tctgaccgta ttcatgtttt
gcaccctgaa 480ggctacttaa tcactccggc ctggctctgg gaaaagtacg gtctgcgtcc
cgatcagtgg 540gcggattatc gggctttgac gggagatgag agcgacaacc tgccaggagt
taagggcatt 600ggtgaaaaaa ccgcacgtaa gctgcttgaa gagtggggtt ccctggaagc
cttgttaaaa 660aatctggatc gtctcaagcc cgcaattcgt gaaaagatcc tggctcatat
ggacgatctt 720aaattaagtt gggacctggc caaggtgcgc accgatttac cgcttgaagt
ggattttgca 780aaacgccgtg agccggaccg ggaacgttta cgcgctttct tagagcgtct
ggaattcggt 840tcactgcttc atgaattcgg tctgttagag tctcctaaag cactcgaaga
ggcaccgtgg 900ccgcccccag aaggtgcttt tgttggcttc gtactttccc gtaaggagcc
tatgtgggca 960gatcttctgg ctttagcggc tgcacgcggt ggccgtgttc accgggcccc
tgagccatac 1020aaagcgttac gtgatctgaa ggaagcacgt ggcttgctgg caaaagacct
ttctgttttg 1080gccctgcgcg agggtcttgg actgccgcca ggcgacgatc ccatgttatt
ggcctatctg 1140ttagacccta gcaataccac acctgaaggg gtcgctcgtc ggtatggcgg
tgaatggact 1200gaggaagccg gagagcgcgc cgcattgtcc gaacggctct ttgcaaactt
atggggtcgt 1260ctggaagggg aggaacgtct gttatggttg tatcgggaag tcgaacgtcc
tctttcggcc 1320gtattagcgc atatggaggc aacaggtgtg cgtttagatg tcgcgtacct
tcgggcctta 1380tcactggaag ttgcagagga aatcgcccgt ctcgaggctg aagtgttccg
gttggccggt 1440cacccgttta acctcaactc ccgtgaccag ctggaacgcg ttttattcga
tgagcttggg 1500cttcccgcaa ttggcaaaac cgaaaagact ggcaaacgca gtacgagcgc
tgccgtcctt 1560gaggcactcc gcgaggctca ccctattgta gaaaagatcc tgcaataccg
tgagttgacg 1620aagcttaaaa gcacttatat tgatcctctc ccggatctga tccatcctcg
taccggccgc 1680ttgcacacac gtttcaacca gacggcgact gcaaccggcc gtctgtctag
ctcggatcca 1740aatctccaga acattccggt ccgtacaccc ttgggccaac gtatccgccg
ggcgtttatc 1800gctgaggaag gatggttact ggtcgcattg gactactcgc agattgagct
gcgcgtcctc 1860gcacatctct ctggtgacga aaatttaatc cgcgtgtttc aagaggggcg
tgatattcac 1920acagaaactg cctcatggat gttcggtgtc ccacgtgaag cagtggatcc
tttgatgcgc 1980cgtgcagcta aaacaattaa ttttggagtg ctgtacggaa tgagcgctca
tcgcttgagt 2040caggaactgg caatccccta cgaggaagcg caggcattca tcgaacgtta
ctttcaatcg 2100tttccgaaag ttcgcgcatg gatcgagaag acgctcgagg aaggtcgtcg
tcggggctat 2160gtcgaaactc tgtttggtcg ccgtcggtac gtaccagatc ttgaagcccg
cgtcaaatcg 2220gtacgggagg ctgcggagcg tatggcattt aatatgcctg tacagggtac
tgcagctgac 2280ctcatgaaac tggcaatggt caagcttttc ccgcgcttgg aggaaatggg
cgcacgtatg 2340cttctgcagg tcatggacga gctggtgtta gaagccccta aggagcgcgc
cgaagctgtc 2400gcgcgcctcg ctaaagaagt gatggagggc gtttacccat tggccgtacc
cctcgaagtg 2460gaggtcggta ttggagaaga ttggttatct gcaaaggaag cggccgc
2507157834PRTArtificial SequenceAMINO ACID SEQUENCE OF MUTANT
ID 27 (H784M) 157Met Arg Gly Met Leu Pro Leu Phe Glu Pro Lys Gly Arg Val
Leu Leu1 5 10 15Val Asp
Gly His His Leu Ala Tyr Arg Thr Phe His Ala Leu Lys Gly 20
25 30Leu Thr Thr Ser Arg Gly Glu Pro Val
Gln Ala Val Tyr Gly Phe Ala 35 40
45Lys Ser Leu Leu Lys Ala Leu Lys Glu Asp Gly Asp Ala Val Ile Val 50
55 60Val Phe Asp Ala Lys Ala Pro Ser Phe
Arg His Glu Ala Tyr Gly Gly65 70 75
80Tyr Lys Ala Gly Arg Ala Pro Thr Pro Glu Asp Phe Pro Arg
Gln Leu 85 90 95Ala Leu
Ile Lys Glu Leu Val Asp Leu Leu Gly Leu Ala Arg Leu Glu 100
105 110Val Pro Gly Tyr Glu Ala Asp Asp Val
Leu Ala Ser Leu Ala Lys Lys 115 120
125Ala Glu Lys Glu Gly Tyr Glu Val Arg Ile Leu Thr Ala Asp Lys Asp
130 135 140Leu Tyr Gln Leu Leu Ser Asp
Arg Ile His Val Leu His Pro Glu Gly145 150
155 160Tyr Leu Ile Thr Pro Ala Trp Leu Trp Glu Lys Tyr
Gly Leu Arg Pro 165 170
175Asp Gln Trp Ala Asp Tyr Arg Ala Leu Thr Gly Asp Glu Ser Asp Asn
180 185 190Leu Pro Gly Val Lys Gly
Ile Gly Glu Lys Thr Ala Arg Lys Leu Leu 195 200
205Glu Glu Trp Gly Ser Leu Glu Ala Leu Leu Lys Asn Leu Asp
Arg Leu 210 215 220Lys Pro Ala Ile Arg
Glu Lys Ile Leu Ala His Met Asp Asp Leu Lys225 230
235 240Leu Ser Trp Asp Leu Ala Lys Val Arg Thr
Asp Leu Pro Leu Glu Val 245 250
255Asp Phe Ala Lys Arg Arg Glu Pro Asp Arg Glu Arg Leu Arg Ala Phe
260 265 270Leu Glu Arg Leu Glu
Phe Gly Ser Leu Leu His Glu Phe Gly Leu Leu 275
280 285Glu Ser Pro Lys Ala Leu Glu Glu Ala Pro Trp Pro
Pro Pro Glu Gly 290 295 300Ala Phe Val
Gly Phe Val Leu Ser Arg Lys Glu Pro Met Trp Ala Asp305
310 315 320Leu Leu Ala Leu Ala Ala Ala
Arg Gly Gly Arg Val His Arg Ala Pro 325
330 335Glu Pro Tyr Lys Ala Leu Arg Asp Leu Lys Glu Ala
Arg Gly Leu Leu 340 345 350Ala
Lys Asp Leu Ser Val Leu Ala Leu Arg Glu Gly Leu Gly Leu Pro 355
360 365Pro Gly Asp Asp Pro Met Leu Leu Ala
Tyr Leu Leu Asp Pro Ser Asn 370 375
380Thr Thr Pro Glu Gly Val Ala Arg Arg Tyr Gly Gly Glu Trp Thr Glu385
390 395 400Glu Ala Gly Glu
Arg Ala Ala Leu Ser Glu Arg Leu Phe Ala Asn Leu 405
410 415Trp Gly Arg Leu Glu Gly Glu Glu Arg Leu
Leu Trp Leu Tyr Arg Glu 420 425
430Val Glu Arg Pro Leu Ser Ala Val Leu Ala His Met Glu Ala Thr Gly
435 440 445Val Arg Leu Asp Val Ala Tyr
Leu Arg Ala Leu Ser Leu Glu Val Ala 450 455
460Glu Glu Ile Ala Arg Leu Glu Ala Glu Val Phe Arg Leu Ala Gly
His465 470 475 480Pro Phe
Asn Leu Asn Ser Arg Asp Gln Leu Glu Arg Val Leu Phe Asp
485 490 495Glu Leu Gly Leu Pro Ala Ile
Gly Lys Thr Glu Lys Thr Gly Lys Arg 500 505
510Ser Thr Ser Ala Ala Val Leu Glu Ala Leu Arg Glu Ala His
Pro Ile 515 520 525Val Glu Lys Ile
Leu Gln Tyr Arg Glu Leu Thr Lys Leu Lys Ser Thr 530
535 540Tyr Ile Asp Pro Leu Pro Asp Leu Ile His Pro Arg
Thr Gly Arg Leu545 550 555
560His Thr Arg Phe Asn Gln Thr Ala Thr Ala Thr Gly Arg Leu Ser Ser
565 570 575Ser Asp Pro Asn Leu
Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln 580
585 590Arg Ile Arg Arg Ala Phe Ile Ala Glu Glu Gly Trp
Leu Leu Val Ala 595 600 605Leu Asp
Tyr Ser Gln Ile Glu Leu Arg Val Leu Ala His Leu Ser Gly 610
615 620Asp Glu Asn Leu Ile Arg Val Phe Gln Glu Gly
Arg Asp Ile His Thr625 630 635
640Glu Thr Ala Ser Trp Met Phe Gly Val Pro Arg Glu Ala Val Asp Pro
645 650 655Leu Met Arg Arg
Ala Ala Lys Thr Ile Asn Phe Gly Val Leu Tyr Gly 660
665 670Met Ser Ala His Arg Leu Ser Gln Glu Leu Ala
Ile Pro Tyr Glu Glu 675 680 685Ala
Gln Ala Phe Ile Glu Arg Tyr Phe Gln Ser Phe Pro Lys Val Arg 690
695 700Ala Trp Ile Glu Lys Thr Leu Glu Glu Gly
Arg Arg Arg Gly Tyr Val705 710 715
720Glu Thr Leu Phe Gly Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala
Arg 725 730 735Val Lys Ser
Val Arg Glu Ala Ala Glu Arg Met Ala Phe Asn Met Pro 740
745 750Val Gln Gly Thr Ala Ala Asp Leu Met Lys
Leu Ala Met Val Lys Leu 755 760
765Phe Pro Arg Leu Glu Glu Met Gly Ala Arg Met Leu Leu Gln Val Met 770
775 780Asp Glu Leu Val Leu Glu Ala Pro
Lys Glu Arg Ala Glu Ala Val Ala785 790
795 800Arg Leu Ala Lys Glu Val Met Glu Gly Val Tyr Pro
Leu Ala Val Pro 805 810
815Leu Glu Val Glu Val Gly Ile Gly Glu Asp Trp Leu Ser Ala Lys Glu
820 825 830Ala
Ala1582507DNAArtificial SequenceNUCLEOTIDE SEQUENCE OF MUTANT ID 29
(H784F) 158catatgcgtg gtatgctgcc gttgttcgag cctaaaggcc gcgtactgtt
agtcgatggt 60catcacttgg cctatcggac gttccatgca ctcaaaggtc tgacgaccag
tcgtggcgaa 120ccggtccagg ctgtttatgg tttcgctaag tctttgctca aagcactgaa
agaagacggg 180gacgcggtaa ttgttgtatt tgatgccaaa gcaccgagct tccgccacga
agcttatggt 240ggctacaagg caggacgcgc ccctacccca gaagatttcc cccgtcagct
ggcattaatt 300aaggagttag tagaccttct cggcttagcg cgtctggaag ttccgggtta
tgaggcggac 360gatgtccttg catccttggc taaaaaggcc gaaaaagagg gctacgaagt
ccgcatcttg 420acggcagaca aagatctgta ccagcttctg tctgaccgta ttcatgtttt
gcaccctgaa 480ggctacttaa tcactccggc ctggctctgg gaaaagtacg gtctgcgtcc
cgatcagtgg 540gcggattatc gggctttgac gggagatgag agcgacaacc tgccaggagt
taagggcatt 600ggtgaaaaaa ccgcacgtaa gctgcttgaa gagtggggtt ccctggaagc
cttgttaaaa 660aatctggatc gtctcaagcc cgcaattcgt gaaaagatcc tggctcatat
ggacgatctt 720aaattaagtt gggacctggc caaggtgcgc accgatttac cgcttgaagt
ggattttgca 780aaacgccgtg agccggaccg ggaacgttta cgcgctttct tagagcgtct
ggaattcggt 840tcactgcttc atgaattcgg tctgttagag tctcctaaag cactcgaaga
ggcaccgtgg 900ccgcccccag aaggtgcttt tgttggcttc gtactttccc gtaaggagcc
tatgtgggca 960gatcttctgg ctttagcggc tgcacgcggt ggccgtgttc accgggcccc
tgagccatac 1020aaagcgttac gtgatctgaa ggaagcacgt ggcttgctgg caaaagacct
ttctgttttg 1080gccctgcgcg agggtcttgg actgccgcca ggcgacgatc ccatgttatt
ggcctatctg 1140ttagacccta gcaataccac acctgaaggg gtcgctcgtc ggtatggcgg
tgaatggact 1200gaggaagccg gagagcgcgc cgcattgtcc gaacggctct ttgcaaactt
atggggtcgt 1260ctggaagggg aggaacgtct gttatggttg tatcgggaag tcgaacgtcc
tctttcggcc 1320gtattagcgc atatggaggc aacaggtgtg cgtttagatg tcgcgtacct
tcgggcctta 1380tcactggaag ttgcagagga aatcgcccgt ctcgaggctg aagtgttccg
gttggccggt 1440cacccgttta acctcaactc ccgtgaccag ctggaacgcg ttttattcga
tgagcttggg 1500cttcccgcaa ttggcaaaac cgaaaagact ggcaaacgca gtacgagcgc
tgccgtcctt 1560gaggcactcc gcgaggctca ccctattgta gaaaagatcc tgcaataccg
tgagttgacg 1620aagcttaaaa gcacttatat tgatcctctc ccggatctga tccatcctcg
taccggccgc 1680ttgcacacac gtttcaacca gacggcgact gcaaccggcc gtctgtctag
ctcggatcca 1740aatctccaga acattccggt ccgtacaccc ttgggccaac gtatccgccg
ggcgtttatc 1800gctgaggaag gatggttact ggtcgcattg gactactcgc agattgagct
gcgcgtcctc 1860gcacatctct ctggtgacga aaatttaatc cgcgtgtttc aagaggggcg
tgatattcac 1920acagaaactg cctcatggat gttcggtgtc ccacgtgaag cagtggatcc
tttgatgcgc 1980cgtgcagcta aaacaattaa ttttggagtg ctgtacggaa tgagcgctca
tcgcttgagt 2040caggaactgg caatccccta cgaggaagcg caggcattca tcgaacgtta
ctttcaatcg 2100tttccgaaag ttcgcgcatg gatcgagaag acgctcgagg aaggtcgtcg
tcggggctat 2160gtcgaaactc tgtttggtcg ccgtcggtac gtaccagatc ttgaagcccg
cgtcaaatcg 2220gtacgggagg ctgcggagcg tatggcattt aatatgcctg tacagggtac
tgcagctgac 2280ctcatgaaac tggcaatggt caagcttttc ccgcgcttgg aggaaatggg
cgcacgtatg 2340cttctgcagg tctttgacga gctggtgtta gaagccccta aggagcgcgc
cgaagctgtc 2400gcgcgcctcg ctaaagaagt gatggagggc gtttacccat tggccgtacc
cctcgaagtg 2460gaggtcggta ttggagaaga ttggttatct gcaaaggaag cggccgc
2507159834PRTArtificial SequenceAMINO ACID SEQUENCE OF MUTANT
ID 29 (H784F) 159Met Arg Gly Met Leu Pro Leu Phe Glu Pro Lys Gly Arg Val
Leu Leu1 5 10 15Val Asp
Gly His His Leu Ala Tyr Arg Thr Phe His Ala Leu Lys Gly 20
25 30Leu Thr Thr Ser Arg Gly Glu Pro Val
Gln Ala Val Tyr Gly Phe Ala 35 40
45Lys Ser Leu Leu Lys Ala Leu Lys Glu Asp Gly Asp Ala Val Ile Val 50
55 60Val Phe Asp Ala Lys Ala Pro Ser Phe
Arg His Glu Ala Tyr Gly Gly65 70 75
80Tyr Lys Ala Gly Arg Ala Pro Thr Pro Glu Asp Phe Pro Arg
Gln Leu 85 90 95Ala Leu
Ile Lys Glu Leu Val Asp Leu Leu Gly Leu Ala Arg Leu Glu 100
105 110Val Pro Gly Tyr Glu Ala Asp Asp Val
Leu Ala Ser Leu Ala Lys Lys 115 120
125Ala Glu Lys Glu Gly Tyr Glu Val Arg Ile Leu Thr Ala Asp Lys Asp
130 135 140Leu Tyr Gln Leu Leu Ser Asp
Arg Ile His Val Leu His Pro Glu Gly145 150
155 160Tyr Leu Ile Thr Pro Ala Trp Leu Trp Glu Lys Tyr
Gly Leu Arg Pro 165 170
175Asp Gln Trp Ala Asp Tyr Arg Ala Leu Thr Gly Asp Glu Ser Asp Asn
180 185 190Leu Pro Gly Val Lys Gly
Ile Gly Glu Lys Thr Ala Arg Lys Leu Leu 195 200
205Glu Glu Trp Gly Ser Leu Glu Ala Leu Leu Lys Asn Leu Asp
Arg Leu 210 215 220Lys Pro Ala Ile Arg
Glu Lys Ile Leu Ala His Met Asp Asp Leu Lys225 230
235 240Leu Ser Trp Asp Leu Ala Lys Val Arg Thr
Asp Leu Pro Leu Glu Val 245 250
255Asp Phe Ala Lys Arg Arg Glu Pro Asp Arg Glu Arg Leu Arg Ala Phe
260 265 270Leu Glu Arg Leu Glu
Phe Gly Ser Leu Leu His Glu Phe Gly Leu Leu 275
280 285Glu Ser Pro Lys Ala Leu Glu Glu Ala Pro Trp Pro
Pro Pro Glu Gly 290 295 300Ala Phe Val
Gly Phe Val Leu Ser Arg Lys Glu Pro Met Trp Ala Asp305
310 315 320Leu Leu Ala Leu Ala Ala Ala
Arg Gly Gly Arg Val His Arg Ala Pro 325
330 335Glu Pro Tyr Lys Ala Leu Arg Asp Leu Lys Glu Ala
Arg Gly Leu Leu 340 345 350Ala
Lys Asp Leu Ser Val Leu Ala Leu Arg Glu Gly Leu Gly Leu Pro 355
360 365Pro Gly Asp Asp Pro Met Leu Leu Ala
Tyr Leu Leu Asp Pro Ser Asn 370 375
380Thr Thr Pro Glu Gly Val Ala Arg Arg Tyr Gly Gly Glu Trp Thr Glu385
390 395 400Glu Ala Gly Glu
Arg Ala Ala Leu Ser Glu Arg Leu Phe Ala Asn Leu 405
410 415Trp Gly Arg Leu Glu Gly Glu Glu Arg Leu
Leu Trp Leu Tyr Arg Glu 420 425
430Val Glu Arg Pro Leu Ser Ala Val Leu Ala His Met Glu Ala Thr Gly
435 440 445Val Arg Leu Asp Val Ala Tyr
Leu Arg Ala Leu Ser Leu Glu Val Ala 450 455
460Glu Glu Ile Ala Arg Leu Glu Ala Glu Val Phe Arg Leu Ala Gly
His465 470 475 480Pro Phe
Asn Leu Asn Ser Arg Asp Gln Leu Glu Arg Val Leu Phe Asp
485 490 495Glu Leu Gly Leu Pro Ala Ile
Gly Lys Thr Glu Lys Thr Gly Lys Arg 500 505
510Ser Thr Ser Ala Ala Val Leu Glu Ala Leu Arg Glu Ala His
Pro Ile 515 520 525Val Glu Lys Ile
Leu Gln Tyr Arg Glu Leu Thr Lys Leu Lys Ser Thr 530
535 540Tyr Ile Asp Pro Leu Pro Asp Leu Ile His Pro Arg
Thr Gly Arg Leu545 550 555
560His Thr Arg Phe Asn Gln Thr Ala Thr Ala Thr Gly Arg Leu Ser Ser
565 570 575Ser Asp Pro Asn Leu
Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln 580
585 590Arg Ile Arg Arg Ala Phe Ile Ala Glu Glu Gly Trp
Leu Leu Val Ala 595 600 605Leu Asp
Tyr Ser Gln Ile Glu Leu Arg Val Leu Ala His Leu Ser Gly 610
615 620Asp Glu Asn Leu Ile Arg Val Phe Gln Glu Gly
Arg Asp Ile His Thr625 630 635
640Glu Thr Ala Ser Trp Met Phe Gly Val Pro Arg Glu Ala Val Asp Pro
645 650 655Leu Met Arg Arg
Ala Ala Lys Thr Ile Asn Phe Gly Val Leu Tyr Gly 660
665 670Met Ser Ala His Arg Leu Ser Gln Glu Leu Ala
Ile Pro Tyr Glu Glu 675 680 685Ala
Gln Ala Phe Ile Glu Arg Tyr Phe Gln Ser Phe Pro Lys Val Arg 690
695 700Ala Trp Ile Glu Lys Thr Leu Glu Glu Gly
Arg Arg Arg Gly Tyr Val705 710 715
720Glu Thr Leu Phe Gly Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala
Arg 725 730 735Val Lys Ser
Val Arg Glu Ala Ala Glu Arg Met Ala Phe Asn Met Pro 740
745 750Val Gln Gly Thr Ala Ala Asp Leu Met Lys
Leu Ala Met Val Lys Leu 755 760
765Phe Pro Arg Leu Glu Glu Met Gly Ala Arg Met Leu Leu Gln Val Phe 770
775 780Asp Glu Leu Val Leu Glu Ala Pro
Lys Glu Arg Ala Glu Ala Val Ala785 790
795 800Arg Leu Ala Lys Glu Val Met Glu Gly Val Tyr Pro
Leu Ala Val Pro 805 810
815Leu Glu Val Glu Val Gly Ile Gly Glu Asp Trp Leu Ser Ala Lys Glu
820 825 830Ala
Ala1602507DNAArtificial SequenceNUCLEOTIDE SEQUENCE OF MUTANT ID 30
(H784Y) 160catatgcgtg gtatgctgcc gttgttcgag cctaaaggcc gcgtactgtt
agtcgatggt 60catcacttgg cctatcggac gttccatgca ctcaaaggtc tgacgaccag
tcgtggcgaa 120ccggtccagg ctgtttatgg tttcgctaag tctttgctca aagcactgaa
agaagacggg 180gacgcggtaa ttgttgtatt tgatgccaaa gcaccgagct tccgccacga
agcttatggt 240ggctacaagg caggacgcgc ccctacccca gaagatttcc cccgtcagct
ggcattaatt 300aaggagttag tagaccttct cggcttagcg cgtctggaag ttccgggtta
tgaggcggac 360gatgtccttg catccttggc taaaaaggcc gaaaaagagg gctacgaagt
ccgcatcttg 420acggcagaca aagatctgta ccagcttctg tctgaccgta ttcatgtttt
gcaccctgaa 480ggctacttaa tcactccggc ctggctctgg gaaaagtacg gtctgcgtcc
cgatcagtgg 540gcggattatc gggctttgac gggagatgag agcgacaacc tgccaggagt
taagggcatt 600ggtgaaaaaa ccgcacgtaa gctgcttgaa gagtggggtt ccctggaagc
cttgttaaaa 660aatctggatc gtctcaagcc cgcaattcgt gaaaagatcc tggctcatat
ggacgatctt 720aaattaagtt gggacctggc caaggtgcgc accgatttac cgcttgaagt
ggattttgca 780aaacgccgtg agccggaccg ggaacgttta cgcgctttct tagagcgtct
ggaattcggt 840tcactgcttc atgaattcgg tctgttagag tctcctaaag cactcgaaga
ggcaccgtgg 900ccgcccccag aaggtgcttt tgttggcttc gtactttccc gtaaggagcc
tatgtgggca 960gatcttctgg ctttagcggc tgcacgcggt ggccgtgttc accgggcccc
tgagccatac 1020aaagcgttac gtgatctgaa ggaagcacgt ggcttgctgg caaaagacct
ttctgttttg 1080gccctgcgcg agggtcttgg actgccgcca ggcgacgatc ccatgttatt
ggcctatctg 1140ttagacccta gcaataccac acctgaaggg gtcgctcgtc ggtatggcgg
tgaatggact 1200gaggaagccg gagagcgcgc cgcattgtcc gaacggctct ttgcaaactt
atggggtcgt 1260ctggaagggg aggaacgtct gttatggttg tatcgggaag tcgaacgtcc
tctttcggcc 1320gtattagcgc atatggaggc aacaggtgtg cgtttagatg tcgcgtacct
tcgggcctta 1380tcactggaag ttgcagagga aatcgcccgt ctcgaggctg aagtgttccg
gttggccggt 1440cacccgttta acctcaactc ccgtgaccag ctggaacgcg ttttattcga
tgagcttggg 1500cttcccgcaa ttggcaaaac cgaaaagact ggcaaacgca gtacgagcgc
tgccgtcctt 1560gaggcactcc gcgaggctca ccctattgta gaaaagatcc tgcaataccg
tgagttgacg 1620aagcttaaaa gcacttatat tgatcctctc ccggatctga tccatcctcg
taccggccgc 1680ttgcacacac gtttcaacca gacggcgact gcaaccggcc gtctgtctag
ctcggatcca 1740aatctccaga acattccggt ccgtacaccc ttgggccaac gtatccgccg
ggcgtttatc 1800gctgaggaag gatggttact ggtcgcattg gactactcgc agattgagct
gcgcgtcctc 1860gcacatctct ctggtgacga aaatttaatc cgcgtgtttc aagaggggcg
tgatattcac 1920acagaaactg cctcatggat gttcggtgtc ccacgtgaag cagtggatcc
tttgatgcgc 1980cgtgcagcta aaacaattaa ttttggagtg ctgtacggaa tgagcgctca
tcgcttgagt 2040caggaactgg caatccccta cgaggaagcg caggcattca tcgaacgtta
ctttcaatcg 2100tttccgaaag ttcgcgcatg gatcgagaag acgctcgagg aaggtcgtcg
tcggggctat 2160gtcgaaactc tgtttggtcg ccgtcggtac gtaccagatc ttgaagcccg
cgtcaaatcg 2220gtacgggagg ctgcggagcg tatggcattt aatatgcctg tacagggtac
tgcagctgac 2280ctcatgaaac tggcaatggt caagcttttc ccgcgcttgg aggaaatggg
cgcacgtatg 2340cttctgcagg tctatgacga gctggtgtta gaagccccta aggagcgcgc
cgaagctgtc 2400gcgcgcctcg ctaaagaagt gatggagggc gtttacccat tggccgtacc
cctcgaagtg 2460gaggtcggta ttggagaaga ttggttatct gcaaaggaag cggccgc
2507161834PRTArtificial SequenceAMINO ACID SEQUENCE OF MUTANT
ID 30 (H784Y) 161Met Arg Gly Met Leu Pro Leu Phe Glu Pro Lys Gly Arg Val
Leu Leu1 5 10 15Val Asp
Gly His His Leu Ala Tyr Arg Thr Phe His Ala Leu Lys Gly 20
25 30Leu Thr Thr Ser Arg Gly Glu Pro Val
Gln Ala Val Tyr Gly Phe Ala 35 40
45Lys Ser Leu Leu Lys Ala Leu Lys Glu Asp Gly Asp Ala Val Ile Val 50
55 60Val Phe Asp Ala Lys Ala Pro Ser Phe
Arg His Glu Ala Tyr Gly Gly65 70 75
80Tyr Lys Ala Gly Arg Ala Pro Thr Pro Glu Asp Phe Pro Arg
Gln Leu 85 90 95Ala Leu
Ile Lys Glu Leu Val Asp Leu Leu Gly Leu Ala Arg Leu Glu 100
105 110Val Pro Gly Tyr Glu Ala Asp Asp Val
Leu Ala Ser Leu Ala Lys Lys 115 120
125Ala Glu Lys Glu Gly Tyr Glu Val Arg Ile Leu Thr Ala Asp Lys Asp
130 135 140Leu Tyr Gln Leu Leu Ser Asp
Arg Ile His Val Leu His Pro Glu Gly145 150
155 160Tyr Leu Ile Thr Pro Ala Trp Leu Trp Glu Lys Tyr
Gly Leu Arg Pro 165 170
175Asp Gln Trp Ala Asp Tyr Arg Ala Leu Thr Gly Asp Glu Ser Asp Asn
180 185 190Leu Pro Gly Val Lys Gly
Ile Gly Glu Lys Thr Ala Arg Lys Leu Leu 195 200
205Glu Glu Trp Gly Ser Leu Glu Ala Leu Leu Lys Asn Leu Asp
Arg Leu 210 215 220Lys Pro Ala Ile Arg
Glu Lys Ile Leu Ala His Met Asp Asp Leu Lys225 230
235 240Leu Ser Trp Asp Leu Ala Lys Val Arg Thr
Asp Leu Pro Leu Glu Val 245 250
255Asp Phe Ala Lys Arg Arg Glu Pro Asp Arg Glu Arg Leu Arg Ala Phe
260 265 270Leu Glu Arg Leu Glu
Phe Gly Ser Leu Leu His Glu Phe Gly Leu Leu 275
280 285Glu Ser Pro Lys Ala Leu Glu Glu Ala Pro Trp Pro
Pro Pro Glu Gly 290 295 300Ala Phe Val
Gly Phe Val Leu Ser Arg Lys Glu Pro Met Trp Ala Asp305
310 315 320Leu Leu Ala Leu Ala Ala Ala
Arg Gly Gly Arg Val His Arg Ala Pro 325
330 335Glu Pro Tyr Lys Ala Leu Arg Asp Leu Lys Glu Ala
Arg Gly Leu Leu 340 345 350Ala
Lys Asp Leu Ser Val Leu Ala Leu Arg Glu Gly Leu Gly Leu Pro 355
360 365Pro Gly Asp Asp Pro Met Leu Leu Ala
Tyr Leu Leu Asp Pro Ser Asn 370 375
380Thr Thr Pro Glu Gly Val Ala Arg Arg Tyr Gly Gly Glu Trp Thr Glu385
390 395 400Glu Ala Gly Glu
Arg Ala Ala Leu Ser Glu Arg Leu Phe Ala Asn Leu 405
410 415Trp Gly Arg Leu Glu Gly Glu Glu Arg Leu
Leu Trp Leu Tyr Arg Glu 420 425
430Val Glu Arg Pro Leu Ser Ala Val Leu Ala His Met Glu Ala Thr Gly
435 440 445Val Arg Leu Asp Val Ala Tyr
Leu Arg Ala Leu Ser Leu Glu Val Ala 450 455
460Glu Glu Ile Ala Arg Leu Glu Ala Glu Val Phe Arg Leu Ala Gly
His465 470 475 480Pro Phe
Asn Leu Asn Ser Arg Asp Gln Leu Glu Arg Val Leu Phe Asp
485 490 495Glu Leu Gly Leu Pro Ala Ile
Gly Lys Thr Glu Lys Thr Gly Lys Arg 500 505
510Ser Thr Ser Ala Ala Val Leu Glu Ala Leu Arg Glu Ala His
Pro Ile 515 520 525Val Glu Lys Ile
Leu Gln Tyr Arg Glu Leu Thr Lys Leu Lys Ser Thr 530
535 540Tyr Ile Asp Pro Leu Pro Asp Leu Ile His Pro Arg
Thr Gly Arg Leu545 550 555
560His Thr Arg Phe Asn Gln Thr Ala Thr Ala Thr Gly Arg Leu Ser Ser
565 570 575Ser Asp Pro Asn Leu
Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln 580
585 590Arg Ile Arg Arg Ala Phe Ile Ala Glu Glu Gly Trp
Leu Leu Val Ala 595 600 605Leu Asp
Tyr Ser Gln Ile Glu Leu Arg Val Leu Ala His Leu Ser Gly 610
615 620Asp Glu Asn Leu Ile Arg Val Phe Gln Glu Gly
Arg Asp Ile His Thr625 630 635
640Glu Thr Ala Ser Trp Met Phe Gly Val Pro Arg Glu Ala Val Asp Pro
645 650 655Leu Met Arg Arg
Ala Ala Lys Thr Ile Asn Phe Gly Val Leu Tyr Gly 660
665 670Met Ser Ala His Arg Leu Ser Gln Glu Leu Ala
Ile Pro Tyr Glu Glu 675 680 685Ala
Gln Ala Phe Ile Glu Arg Tyr Phe Gln Ser Phe Pro Lys Val Arg 690
695 700Ala Trp Ile Glu Lys Thr Leu Glu Glu Gly
Arg Arg Arg Gly Tyr Val705 710 715
720Glu Thr Leu Phe Gly Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala
Arg 725 730 735Val Lys Ser
Val Arg Glu Ala Ala Glu Arg Met Ala Phe Asn Met Pro 740
745 750Val Gln Gly Thr Ala Ala Asp Leu Met Lys
Leu Ala Met Val Lys Leu 755 760
765Phe Pro Arg Leu Glu Glu Met Gly Ala Arg Met Leu Leu Gln Val Tyr 770
775 780Asp Glu Leu Val Leu Glu Ala Pro
Lys Glu Arg Ala Glu Ala Val Ala785 790
795 800Arg Leu Ala Lys Glu Val Met Glu Gly Val Tyr Pro
Leu Ala Val Pro 805 810
815Leu Glu Val Glu Val Gly Ile Gly Glu Asp Trp Leu Ser Ala Lys Glu
820 825 830Ala Ala16225DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDEmisc_feature(1)..(1)5'-PHOSPHATE
162ggttcactgc ttcatgaatt cggtc
2516332DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(1)..(1)5'-PHOSPHATE 163catatgtatt ctccttctta
aagttaaaca aa 3216426DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDEmisc_feature(1)..(1)5'-FAM
(6-carboxyfluorescein)misc_feature(26)..(26)3'-IBFQ (Iowa Black FQ
(fluorescence quencher)) 164atggtcaagg tcgcaagctt gctggt
2616527DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(1)..(1)5'-FAM
(6-carboxyfluorescein)misc_feature(14)..(14)RNA
RESIDUEmisc_feature(27)..(27)3'-IBFQ (Iowa BlacK FQ (fluorescence
quencher) 165ttctgaggcc aacuccactg ccactta
2716622DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(1)..(1)5'-FAM
(6-carboxyfluorescein)misc_feature(11)..(11)RNA
RESIDUEmisc_feature(22)..(22)3'-IBFQ (Iowa Black FQ (fluorescence
quencher)) 166cccagagctc cctcagactc ct
221671676DNAArtificial SequenceNUCLEOTIDE SEQUENCE OF MUTANT ID
37 (OptiTaq KlenTaq) 167catatgggtt cactgcttca tgaattcggt ctgttagagt
ctcctaaagc actcgaagag 60gcaccgtggc cgcccccaga aggtgctttt gttggcttcg
tactttcccg taaggagcct 120atgtgggcag atcttctggc tttagcggct gcacgcggtg
gccgtgttca ccgggcccct 180gagccataca aagcgttacg tgatctgaag gaagcacgtg
gcttgctggc aaaagacctt 240tctgttttgg ccctgcgcga gggtcttgga ctgccgccag
gcgacgatcc catgttattg 300gcctatctgt tagaccctag caataccaca cctgaagggg
tcgctcgtcg gtatggcggt 360gaatggactg aggaagccgg agagcgcgcc gcattgtccg
aacggctctt tgcaaactta 420tggggtcgtc tggaagggga ggaacgtctg ttatggttgt
atcgggaagt cgaacgtcct 480ctttcggccg tattagcgca tatggaggca acaggtgtgc
gtttagatgt cgcgtacctt 540cgggccttat cactggaagt tgcagaggaa atcgcccgtc
tcgaggctga agtgttccgg 600ttggccggtc acccgtttaa cctcaactcc cgtgaccagc
tggaacgcgt tttattcgat 660gagcttgggc ttcccgcaat tggcaaaacc gaaaagactg
gcaaacgcag tacgagcgct 720gccgtccttg aggcactccg cgaggctcac cctattgtag
aaaagatcct gcaataccgt 780gagttgacga agcttaaaag cacttatatt gatcctctcc
cggatctgat ccatcctcgt 840accggccgct tgcacacacg tttcaaccag acggcgactg
caaccggccg tctgtctagc 900tcggatccaa atctccagaa cattccggtc cgtacaccct
tgggccaacg tatccgccgg 960gcgtttatcg ctgaggaagg atggttactg gtcgcattgg
actactcgca gattgagctg 1020cgcgtcctcg cacatctctc tggtgacgaa aatttaatcc
gcgtgtttca agaggggcgt 1080gatattcaca cagaaactgc ctcatggatg ttcggtgtcc
cacgtgaagc agtggatcct 1140ttgatgcgcc gtgcagctaa aacaattaat tttggagtgc
tgtacggaat gagcgctcat 1200cgcttgagtc aggaactggc aatcccctac gaggaagcgc
aggcattcat cgaacgttac 1260tttcaatcgt ttccgaaagt tcgcgcatgg atcgagaaga
cgctcgagga aggtcgtcgt 1320cggggctatg tcgaaactct gtttggtcgc cgtcggtacg
taccagatct tgaagcccgc 1380gtcaaatcgg tacgggaggc tgcggagcgt atggcattta
atatgcctgt acagggtact 1440gcagctgacc tcatgaaact ggcaatggtc aagcttttcc
cgcgcttgga ggaaatgggc 1500gcacgtatgc ttctgcaggt ccatgacgag ctggtgttag
aagcccctaa ggagcgcgcc 1560gaagctgtcg cgcgcctcgc taaagaagtg atggagggcg
tttacccatt ggccgtaccc 1620ctcgaagtgg aggtcggtat tggagaagat tggttatctg
caaaggaagc ggccgc 1676168557PRTArtificial SequenceAMINO ACID
SEQUENCE OF MUTANT ID 37 (OptiTaq KlenTaq) 168Met Gly Ser Leu Leu
His Glu Phe Gly Leu Leu Glu Ser Pro Lys Ala1 5
10 15Leu Glu Glu Ala Pro Trp Pro Pro Pro Glu Gly
Ala Phe Val Gly Phe 20 25
30Val Leu Ser Arg Lys Glu Pro Met Trp Ala Asp Leu Leu Ala Leu Ala
35 40 45Ala Ala Arg Gly Gly Arg Val His
Arg Ala Pro Glu Pro Tyr Lys Ala 50 55
60Leu Arg Asp Leu Lys Glu Ala Arg Gly Leu Leu Ala Lys Asp Leu Ser65
70 75 80Val Leu Ala Leu Arg
Glu Gly Leu Gly Leu Pro Pro Gly Asp Asp Pro 85
90 95Met Leu Leu Ala Tyr Leu Leu Asp Pro Ser Asn
Thr Thr Pro Glu Gly 100 105
110Val Ala Arg Arg Tyr Gly Gly Glu Trp Thr Glu Glu Ala Gly Glu Arg
115 120 125Ala Ala Leu Ser Glu Arg Leu
Phe Ala Asn Leu Trp Gly Arg Leu Glu 130 135
140Gly Glu Glu Arg Leu Leu Trp Leu Tyr Arg Glu Val Glu Arg Pro
Leu145 150 155 160Ser Ala
Val Leu Ala His Met Glu Ala Thr Gly Val Arg Leu Asp Val
165 170 175Ala Tyr Leu Arg Ala Leu Ser
Leu Glu Val Ala Glu Glu Ile Ala Arg 180 185
190Leu Glu Ala Glu Val Phe Arg Leu Ala Gly His Pro Phe Asn
Leu Asn 195 200 205Ser Arg Asp Gln
Leu Glu Arg Val Leu Phe Asp Glu Leu Gly Leu Pro 210
215 220Ala Ile Gly Lys Thr Glu Lys Thr Gly Lys Arg Ser
Thr Ser Ala Ala225 230 235
240Val Leu Glu Ala Leu Arg Glu Ala His Pro Ile Val Glu Lys Ile Leu
245 250 255Gln Tyr Arg Glu Leu
Thr Lys Leu Lys Ser Thr Tyr Ile Asp Pro Leu 260
265 270Pro Asp Leu Ile His Pro Arg Thr Gly Arg Leu His
Thr Arg Phe Asn 275 280 285Gln Thr
Ala Thr Ala Thr Gly Arg Leu Ser Ser Ser Asp Pro Asn Leu 290
295 300Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln
Arg Ile Arg Arg Ala305 310 315
320Phe Ile Ala Glu Glu Gly Trp Leu Leu Val Ala Leu Asp Tyr Ser Gln
325 330 335Ile Glu Leu Arg
Val Leu Ala His Leu Ser Gly Asp Glu Asn Leu Ile 340
345 350Arg Val Phe Gln Glu Gly Arg Asp Ile His Thr
Glu Thr Ala Ser Trp 355 360 365Met
Phe Gly Val Pro Arg Glu Ala Val Asp Pro Leu Met Arg Arg Ala 370
375 380Ala Lys Thr Ile Asn Phe Gly Val Leu Tyr
Gly Met Ser Ala His Arg385 390 395
400Leu Ser Gln Glu Leu Ala Ile Pro Tyr Glu Glu Ala Gln Ala Phe
Ile 405 410 415Glu Arg Tyr
Phe Gln Ser Phe Pro Lys Val Arg Ala Trp Ile Glu Lys 420
425 430Thr Leu Glu Glu Gly Arg Arg Arg Gly Tyr
Val Glu Thr Leu Phe Gly 435 440
445Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala Arg Val Lys Ser Val Arg 450
455 460Glu Ala Ala Glu Arg Met Ala Phe
Asn Met Pro Val Gln Gly Thr Ala465 470
475 480Ala Asp Leu Met Lys Leu Ala Met Val Lys Leu Phe
Pro Arg Leu Glu 485 490
495Glu Met Gly Ala Arg Met Leu Leu Gln Val His Asp Glu Leu Val Leu
500 505 510Glu Ala Pro Lys Glu Arg
Ala Glu Ala Val Ala Arg Leu Ala Lys Glu 515 520
525Val Met Glu Gly Val Tyr Pro Leu Ala Val Pro Leu Glu Val
Glu Val 530 535 540Gly Ile Gly Glu Asp
Trp Leu Ser Ala Lys Glu Ala Ala545 550
5551691676DNAArtificial SequenceNUCLEOTIDE SEQUENCE OF MUTANT ID 38
(A661E, I665W, F667L KlenTaq) 169catatgggtt cactgcttca tgaattcggt
ctgttagagt ctcctaaagc actcgaagag 60gcaccgtggc cgcccccaga aggtgctttt
gttggcttcg tactttcccg taaggagcct 120atgtgggcag atcttctggc tttagcggct
gcacgcggtg gccgtgttca ccgggcccct 180gagccataca aagcgttacg tgatctgaag
gaagcacgtg gcttgctggc aaaagacctt 240tctgttttgg ccctgcgcga gggtcttgga
ctgccgccag gcgacgatcc catgttattg 300gcctatctgt tagaccctag caataccaca
cctgaagggg tcgctcgtcg gtatggcggt 360gaatggactg aggaagccgg agagcgcgcc
gcattgtccg aacggctctt tgcaaactta 420tggggtcgtc tggaagggga ggaacgtctg
ttatggttgt atcgggaagt cgaacgtcct 480ctttcggccg tattagcgca tatggaggca
acaggtgtgc gtttagatgt cgcgtacctt 540cgggccttat cactggaagt tgcagaggaa
atcgcccgtc tcgaggctga agtgttccgg 600ttggccggtc acccgtttaa cctcaactcc
cgtgaccagc tggaacgcgt tttattcgat 660gagcttgggc ttcccgcaat tggcaaaacc
gaaaagactg gcaaacgcag tacgagcgct 720gccgtccttg aggcactccg cgaggctcac
cctattgtag aaaagatcct gcaataccgt 780gagttgacga agcttaaaag cacttatatt
gatcctctcc cggatctgat ccatcctcgt 840accggccgct tgcacacacg tttcaaccag
acggcgactg caaccggccg tctgtctagc 900tcggatccaa atctccagaa cattccggtc
cgtacaccct tgggccaacg tatccgccgg 960gcgtttatcg ctgaggaagg atggttactg
gtcgcattgg actactcgca gattgagctg 1020cgcgtcctcg cacatctctc tggtgacgaa
aatttaatcc gcgtgtttca agaggggcgt 1080gatattcaca cagaaactgc ctcatggatg
ttcggtgtcc cacgtgaagc agtggatcct 1140ttgatgcgcc gtgaagctaa aacatggaat
ttgggagtgc tgtacggaat gagcgctcat 1200cgcttgagtc aggaactggc aatcccctac
gaggaagcgc aggcattcat cgaacgttac 1260tttcaatcgt ttccgaaagt tcgcgcatgg
atcgagaaga cgctcgagga aggtcgtcgt 1320cggggctatg tcgaaactct gtttggtcgc
cgtcggtacg taccagatct tgaagcccgc 1380gtcaaatcgg tacgggaggc tgcggagcgt
atggcattta atatgcctgt acagggtact 1440gcagctgacc tcatgaaact ggcaatggtc
aagcttttcc cgcgcttgga ggaaatgggc 1500gcacgtatgc ttctgcaggt ccatgacgag
ctggtgttag aagcccctaa ggagcgcgcc 1560gaagctgtcg cgcgcctcgc taaagaagtg
atggagggcg tttacccatt ggccgtaccc 1620ctcgaagtgg aggtcggtat tggagaagat
tggttatctg caaaggaagc ggccgc 1676170557PRTArtificial SequenceAMINO
ACID SEQUENCE OF MUTANT ID 38 (A661E, I665W, F667L KlenTaq) 170Met
Gly Ser Leu Leu His Glu Phe Gly Leu Leu Glu Ser Pro Lys Ala1
5 10 15Leu Glu Glu Ala Pro Trp Pro
Pro Pro Glu Gly Ala Phe Val Gly Phe 20 25
30Val Leu Ser Arg Lys Glu Pro Met Trp Ala Asp Leu Leu Ala
Leu Ala 35 40 45Ala Ala Arg Gly
Gly Arg Val His Arg Ala Pro Glu Pro Tyr Lys Ala 50 55
60Leu Arg Asp Leu Lys Glu Ala Arg Gly Leu Leu Ala Lys
Asp Leu Ser65 70 75
80Val Leu Ala Leu Arg Glu Gly Leu Gly Leu Pro Pro Gly Asp Asp Pro
85 90 95Met Leu Leu Ala Tyr Leu
Leu Asp Pro Ser Asn Thr Thr Pro Glu Gly 100
105 110Val Ala Arg Arg Tyr Gly Gly Glu Trp Thr Glu Glu
Ala Gly Glu Arg 115 120 125Ala Ala
Leu Ser Glu Arg Leu Phe Ala Asn Leu Trp Gly Arg Leu Glu 130
135 140Gly Glu Glu Arg Leu Leu Trp Leu Tyr Arg Glu
Val Glu Arg Pro Leu145 150 155
160Ser Ala Val Leu Ala His Met Glu Ala Thr Gly Val Arg Leu Asp Val
165 170 175Ala Tyr Leu Arg
Ala Leu Ser Leu Glu Val Ala Glu Glu Ile Ala Arg 180
185 190Leu Glu Ala Glu Val Phe Arg Leu Ala Gly His
Pro Phe Asn Leu Asn 195 200 205Ser
Arg Asp Gln Leu Glu Arg Val Leu Phe Asp Glu Leu Gly Leu Pro 210
215 220Ala Ile Gly Lys Thr Glu Lys Thr Gly Lys
Arg Ser Thr Ser Ala Ala225 230 235
240Val Leu Glu Ala Leu Arg Glu Ala His Pro Ile Val Glu Lys Ile
Leu 245 250 255Gln Tyr Arg
Glu Leu Thr Lys Leu Lys Ser Thr Tyr Ile Asp Pro Leu 260
265 270Pro Asp Leu Ile His Pro Arg Thr Gly Arg
Leu His Thr Arg Phe Asn 275 280
285Gln Thr Ala Thr Ala Thr Gly Arg Leu Ser Ser Ser Asp Pro Asn Leu 290
295 300Gln Asn Ile Pro Val Arg Thr Pro
Leu Gly Gln Arg Ile Arg Arg Ala305 310
315 320Phe Ile Ala Glu Glu Gly Trp Leu Leu Val Ala Leu
Asp Tyr Ser Gln 325 330
335Ile Glu Leu Arg Val Leu Ala His Leu Ser Gly Asp Glu Asn Leu Ile
340 345 350Arg Val Phe Gln Glu Gly
Arg Asp Ile His Thr Glu Thr Ala Ser Trp 355 360
365Met Phe Gly Val Pro Arg Glu Ala Val Asp Pro Leu Met Arg
Arg Glu 370 375 380Ala Lys Thr Trp Asn
Leu Gly Val Leu Tyr Gly Met Ser Ala His Arg385 390
395 400Leu Ser Gln Glu Leu Ala Ile Pro Tyr Glu
Glu Ala Gln Ala Phe Ile 405 410
415Glu Arg Tyr Phe Gln Ser Phe Pro Lys Val Arg Ala Trp Ile Glu Lys
420 425 430Thr Leu Glu Glu Gly
Arg Arg Arg Gly Tyr Val Glu Thr Leu Phe Gly 435
440 445Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala Arg Val
Lys Ser Val Arg 450 455 460Glu Ala Ala
Glu Arg Met Ala Phe Asn Met Pro Val Gln Gly Thr Ala465
470 475 480Ala Asp Leu Met Lys Leu Ala
Met Val Lys Leu Phe Pro Arg Leu Glu 485
490 495Glu Met Gly Ala Arg Met Leu Leu Gln Val His Asp
Glu Leu Val Leu 500 505 510Glu
Ala Pro Lys Glu Arg Ala Glu Ala Val Ala Arg Leu Ala Lys Glu 515
520 525Val Met Glu Gly Val Tyr Pro Leu Ala
Val Pro Leu Glu Val Glu Val 530 535
540Gly Ile Gly Glu Asp Trp Leu Ser Ala Lys Glu Ala Ala545
550 5551711676DNAArtificial SequenceNUCLEOTIDE SEQUENCE
OF MUTANT ID 39 (V783F KlenTaq). 171catatgggtt cactgcttca tgaattcggt
ctgttagagt ctcctaaagc actcgaagag 60gcaccgtggc cgcccccaga aggtgctttt
gttggcttcg tactttcccg taaggagcct 120atgtgggcag atcttctggc tttagcggct
gcacgcggtg gccgtgttca ccgggcccct 180gagccataca aagcgttacg tgatctgaag
gaagcacgtg gcttgctggc aaaagacctt 240tctgttttgg ccctgcgcga gggtcttgga
ctgccgccag gcgacgatcc catgttattg 300gcctatctgt tagaccctag caataccaca
cctgaagggg tcgctcgtcg gtatggcggt 360gaatggactg aggaagccgg agagcgcgcc
gcattgtccg aacggctctt tgcaaactta 420tggggtcgtc tggaagggga ggaacgtctg
ttatggttgt atcgggaagt cgaacgtcct 480ctttcggccg tattagcgca tatggaggca
acaggtgtgc gtttagatgt cgcgtacctt 540cgggccttat cactggaagt tgcagaggaa
atcgcccgtc tcgaggctga agtgttccgg 600ttggccggtc acccgtttaa cctcaactcc
cgtgaccagc tggaacgcgt tttattcgat 660gagcttgggc ttcccgcaat tggcaaaacc
gaaaagactg gcaaacgcag tacgagcgct 720gccgtccttg aggcactccg cgaggctcac
cctattgtag aaaagatcct gcaataccgt 780gagttgacga agcttaaaag cacttatatt
gatcctctcc cggatctgat ccatcctcgt 840accggccgct tgcacacacg tttcaaccag
acggcgactg caaccggccg tctgtctagc 900tcggatccaa atctccagaa cattccggtc
cgtacaccct tgggccaacg tatccgccgg 960gcgtttatcg ctgaggaagg atggttactg
gtcgcattgg actactcgca gattgagctg 1020cgcgtcctcg cacatctctc tggtgacgaa
aatttaatcc gcgtgtttca agaggggcgt 1080gatattcaca cagaaactgc ctcatggatg
ttcggtgtcc cacgtgaagc agtggatcct 1140ttgatgcgcc gtgcagctaa aacaattaat
tttggagtgc tgtacggaat gagcgctcat 1200cgcttgagtc aggaactggc aatcccctac
gaggaagcgc aggcattcat cgaacgttac 1260tttcaatcgt ttccgaaagt tcgcgcatgg
atcgagaaga cgctcgagga aggtcgtcgt 1320cggggctatg tcgaaactct gtttggtcgc
cgtcggtacg taccagatct tgaagcccgc 1380gtcaaatcgg tacgggaggc tgcggagcgt
atggcattta atatgcctgt acagggtact 1440gcagctgacc tcatgaaact ggcaatggtc
aagcttttcc cgcgcttgga ggaaatgggc 1500gcacgtatgc ttctgcagtt ccatgacgag
ctggtgttag aagcccctaa ggagcgcgcc 1560gaagctgtcg cgcgcctcgc taaagaagtg
atggagggcg tttacccatt ggccgtaccc 1620ctcgaagtgg aggtcggtat tggagaagat
tggttatctg caaaggaagc ggccgc 1676172557PRTArtificial SequenceAMINO
ACID SEQUENCE OF MUTANT ID 39 (V783F KlenTaq). 172Met Gly Ser Leu
Leu His Glu Phe Gly Leu Leu Glu Ser Pro Lys Ala1 5
10 15Leu Glu Glu Ala Pro Trp Pro Pro Pro Glu
Gly Ala Phe Val Gly Phe 20 25
30Val Leu Ser Arg Lys Glu Pro Met Trp Ala Asp Leu Leu Ala Leu Ala
35 40 45Ala Ala Arg Gly Gly Arg Val His
Arg Ala Pro Glu Pro Tyr Lys Ala 50 55
60Leu Arg Asp Leu Lys Glu Ala Arg Gly Leu Leu Ala Lys Asp Leu Ser65
70 75 80Val Leu Ala Leu Arg
Glu Gly Leu Gly Leu Pro Pro Gly Asp Asp Pro 85
90 95Met Leu Leu Ala Tyr Leu Leu Asp Pro Ser Asn
Thr Thr Pro Glu Gly 100 105
110Val Ala Arg Arg Tyr Gly Gly Glu Trp Thr Glu Glu Ala Gly Glu Arg
115 120 125Ala Ala Leu Ser Glu Arg Leu
Phe Ala Asn Leu Trp Gly Arg Leu Glu 130 135
140Gly Glu Glu Arg Leu Leu Trp Leu Tyr Arg Glu Val Glu Arg Pro
Leu145 150 155 160Ser Ala
Val Leu Ala His Met Glu Ala Thr Gly Val Arg Leu Asp Val
165 170 175Ala Tyr Leu Arg Ala Leu Ser
Leu Glu Val Ala Glu Glu Ile Ala Arg 180 185
190Leu Glu Ala Glu Val Phe Arg Leu Ala Gly His Pro Phe Asn
Leu Asn 195 200 205Ser Arg Asp Gln
Leu Glu Arg Val Leu Phe Asp Glu Leu Gly Leu Pro 210
215 220Ala Ile Gly Lys Thr Glu Lys Thr Gly Lys Arg Ser
Thr Ser Ala Ala225 230 235
240Val Leu Glu Ala Leu Arg Glu Ala His Pro Ile Val Glu Lys Ile Leu
245 250 255Gln Tyr Arg Glu Leu
Thr Lys Leu Lys Ser Thr Tyr Ile Asp Pro Leu 260
265 270Pro Asp Leu Ile His Pro Arg Thr Gly Arg Leu His
Thr Arg Phe Asn 275 280 285Gln Thr
Ala Thr Ala Thr Gly Arg Leu Ser Ser Ser Asp Pro Asn Leu 290
295 300Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln
Arg Ile Arg Arg Ala305 310 315
320Phe Ile Ala Glu Glu Gly Trp Leu Leu Val Ala Leu Asp Tyr Ser Gln
325 330 335Ile Glu Leu Arg
Val Leu Ala His Leu Ser Gly Asp Glu Asn Leu Ile 340
345 350Arg Val Phe Gln Glu Gly Arg Asp Ile His Thr
Glu Thr Ala Ser Trp 355 360 365Met
Phe Gly Val Pro Arg Glu Ala Val Asp Pro Leu Met Arg Arg Ala 370
375 380Ala Lys Thr Ile Asn Phe Gly Val Leu Tyr
Gly Met Ser Ala His Arg385 390 395
400Leu Ser Gln Glu Leu Ala Ile Pro Tyr Glu Glu Ala Gln Ala Phe
Ile 405 410 415Glu Arg Tyr
Phe Gln Ser Phe Pro Lys Val Arg Ala Trp Ile Glu Lys 420
425 430Thr Leu Glu Glu Gly Arg Arg Arg Gly Tyr
Val Glu Thr Leu Phe Gly 435 440
445Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala Arg Val Lys Ser Val Arg 450
455 460Glu Ala Ala Glu Arg Met Ala Phe
Asn Met Pro Val Gln Gly Thr Ala465 470
475 480Ala Asp Leu Met Lys Leu Ala Met Val Lys Leu Phe
Pro Arg Leu Glu 485 490
495Glu Met Gly Ala Arg Met Leu Leu Gln Leu His Asp Glu Leu Val Leu
500 505 510Glu Ala Pro Lys Glu Arg
Ala Glu Ala Val Ala Arg Leu Ala Lys Glu 515 520
525Val Met Glu Gly Val Tyr Pro Leu Ala Val Pro Leu Glu Val
Glu Val 530 535 540Gly Ile Gly Glu Asp
Trp Leu Ser Ala Lys Glu Ala Ala545 550
5551731676DNAArtificial SequenceNUCLEOTIDE SEQUENCE OF MUTANT ID 40
(H784Q KlenTaq) 173catatgggtt cactgcttca tgaattcggt ctgttagagt ctcctaaagc
actcgaagag 60gcaccgtggc cgcccccaga aggtgctttt gttggcttcg tactttcccg
taaggagcct 120atgtgggcag atcttctggc tttagcggct gcacgcggtg gccgtgttca
ccgggcccct 180gagccataca aagcgttacg tgatctgaag gaagcacgtg gcttgctggc
aaaagacctt 240tctgttttgg ccctgcgcga gggtcttgga ctgccgccag gcgacgatcc
catgttattg 300gcctatctgt tagaccctag caataccaca cctgaagggg tcgctcgtcg
gtatggcggt 360gaatggactg aggaagccgg agagcgcgcc gcattgtccg aacggctctt
tgcaaactta 420tggggtcgtc tggaagggga ggaacgtctg ttatggttgt atcgggaagt
cgaacgtcct 480ctttcggccg tattagcgca tatggaggca acaggtgtgc gtttagatgt
cgcgtacctt 540cgggccttat cactggaagt tgcagaggaa atcgcccgtc tcgaggctga
agtgttccgg 600ttggccggtc acccgtttaa cctcaactcc cgtgaccagc tggaacgcgt
tttattcgat 660gagcttgggc ttcccgcaat tggcaaaacc gaaaagactg gcaaacgcag
tacgagcgct 720gccgtccttg aggcactccg cgaggctcac cctattgtag aaaagatcct
gcaataccgt 780gagttgacga agcttaaaag cacttatatt gatcctctcc cggatctgat
ccatcctcgt 840accggccgct tgcacacacg tttcaaccag acggcgactg caaccggccg
tctgtctagc 900tcggatccaa atctccagaa cattccggtc cgtacaccct tgggccaacg
tatccgccgg 960gcgtttatcg ctgaggaagg atggttactg gtcgcattgg actactcgca
gattgagctg 1020cgcgtcctcg cacatctctc tggtgacgaa aatttaatcc gcgtgtttca
agaggggcgt 1080gatattcaca cagaaactgc ctcatggatg ttcggtgtcc cacgtgaagc
agtggatcct 1140ttgatgcgcc gtgcagctaa aacaattaat tttggagtgc tgtacggaat
gagcgctcat 1200cgcttgagtc aggaactggc aatcccctac gaggaagcgc aggcattcat
cgaacgttac 1260tttcaatcgt ttccgaaagt tcgcgcatgg atcgagaaga cgctcgagga
aggtcgtcgt 1320cggggctatg tcgaaactct gtttggtcgc cgtcggtacg taccagatct
tgaagcccgc 1380gtcaaatcgg tacgggaggc tgcggagcgt atggcattta atatgcctgt
acagggtact 1440gcagctgacc tcatgaaact ggcaatggtc aagcttttcc cgcgcttgga
ggaaatgggc 1500gcacgtatgc ttctgcaggt ccaggacgag ctggtgttag aagcccctaa
ggagcgcgcc 1560gaagctgtcg cgcgcctcgc taaagaagtg atggagggcg tttacccatt
ggccgtaccc 1620ctcgaagtgg aggtcggtat tggagaagat tggttatctg caaaggaagc
ggccgc 1676174557PRTArtificial SequenceAMINO ACID SEQUENCE OF
MUTANT ID 40 (H784Q KlenTaq) 174Met Gly Ser Leu Leu His Glu Phe Gly
Leu Leu Glu Ser Pro Lys Ala1 5 10
15Leu Glu Glu Ala Pro Trp Pro Pro Pro Glu Gly Ala Phe Val Gly
Phe 20 25 30Val Leu Ser Arg
Lys Glu Pro Met Trp Ala Asp Leu Leu Ala Leu Ala 35
40 45Ala Ala Arg Gly Gly Arg Val His Arg Ala Pro Glu
Pro Tyr Lys Ala 50 55 60Leu Arg Asp
Leu Lys Glu Ala Arg Gly Leu Leu Ala Lys Asp Leu Ser65 70
75 80Val Leu Ala Leu Arg Glu Gly Leu
Gly Leu Pro Pro Gly Asp Asp Pro 85 90
95Met Leu Leu Ala Tyr Leu Leu Asp Pro Ser Asn Thr Thr Pro
Glu Gly 100 105 110Val Ala Arg
Arg Tyr Gly Gly Glu Trp Thr Glu Glu Ala Gly Glu Arg 115
120 125Ala Ala Leu Ser Glu Arg Leu Phe Ala Asn Leu
Trp Gly Arg Leu Glu 130 135 140Gly Glu
Glu Arg Leu Leu Trp Leu Tyr Arg Glu Val Glu Arg Pro Leu145
150 155 160Ser Ala Val Leu Ala His Met
Glu Ala Thr Gly Val Arg Leu Asp Val 165
170 175Ala Tyr Leu Arg Ala Leu Ser Leu Glu Val Ala Glu
Glu Ile Ala Arg 180 185 190Leu
Glu Ala Glu Val Phe Arg Leu Ala Gly His Pro Phe Asn Leu Asn 195
200 205Ser Arg Asp Gln Leu Glu Arg Val Leu
Phe Asp Glu Leu Gly Leu Pro 210 215
220Ala Ile Gly Lys Thr Glu Lys Thr Gly Lys Arg Ser Thr Ser Ala Ala225
230 235 240Val Leu Glu Ala
Leu Arg Glu Ala His Pro Ile Val Glu Lys Ile Leu 245
250 255Gln Tyr Arg Glu Leu Thr Lys Leu Lys Ser
Thr Tyr Ile Asp Pro Leu 260 265
270Pro Asp Leu Ile His Pro Arg Thr Gly Arg Leu His Thr Arg Phe Asn
275 280 285Gln Thr Ala Thr Ala Thr Gly
Arg Leu Ser Ser Ser Asp Pro Asn Leu 290 295
300Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln Arg Ile Arg Arg
Ala305 310 315 320Phe Ile
Ala Glu Glu Gly Trp Leu Leu Val Ala Leu Asp Tyr Ser Gln
325 330 335Ile Glu Leu Arg Val Leu Ala
His Leu Ser Gly Asp Glu Asn Leu Ile 340 345
350Arg Val Phe Gln Glu Gly Arg Asp Ile His Thr Glu Thr Ala
Ser Trp 355 360 365Met Phe Gly Val
Pro Arg Glu Ala Val Asp Pro Leu Met Arg Arg Ala 370
375 380Ala Lys Thr Ile Asn Phe Gly Val Leu Tyr Gly Met
Ser Ala His Arg385 390 395
400Leu Ser Gln Glu Leu Ala Ile Pro Tyr Glu Glu Ala Gln Ala Phe Ile
405 410 415Glu Arg Tyr Phe Gln
Ser Phe Pro Lys Val Arg Ala Trp Ile Glu Lys 420
425 430Thr Leu Glu Glu Gly Arg Arg Arg Gly Tyr Val Glu
Thr Leu Phe Gly 435 440 445Arg Arg
Arg Tyr Val Pro Asp Leu Glu Ala Arg Val Lys Ser Val Arg 450
455 460Glu Ala Ala Glu Arg Met Ala Phe Asn Met Pro
Val Gln Gly Thr Ala465 470 475
480Ala Asp Leu Met Lys Leu Ala Met Val Lys Leu Phe Pro Arg Leu Glu
485 490 495Glu Met Gly Ala
Arg Met Leu Leu Gln Val Gln Asp Glu Leu Val Leu 500
505 510Glu Ala Pro Lys Glu Arg Ala Glu Ala Val Ala
Arg Leu Ala Lys Glu 515 520 525Val
Met Glu Gly Val Tyr Pro Leu Ala Val Pro Leu Glu Val Glu Val 530
535 540Gly Ile Gly Glu Asp Trp Leu Ser Ala Lys
Glu Ala Ala545 550
5551751676DNAArtificial SequenceNUCLEOTIDE SEQUENCE OF MUTANT ID 41
(V783L H784Q KlenTaq) 175catatgggtt cactgcttca tgaattcggt ctgttagagt
ctcctaaagc actcgaagag 60gcaccgtggc cgcccccaga aggtgctttt gttggcttcg
tactttcccg taaggagcct 120atgtgggcag atcttctggc tttagcggct gcacgcggtg
gccgtgttca ccgggcccct 180gagccataca aagcgttacg tgatctgaag gaagcacgtg
gcttgctggc aaaagacctt 240tctgttttgg ccctgcgcga gggtcttgga ctgccgccag
gcgacgatcc catgttattg 300gcctatctgt tagaccctag caataccaca cctgaagggg
tcgctcgtcg gtatggcggt 360gaatggactg aggaagccgg agagcgcgcc gcattgtccg
aacggctctt tgcaaactta 420tggggtcgtc tggaagggga ggaacgtctg ttatggttgt
atcgggaagt cgaacgtcct 480ctttcggccg tattagcgca tatggaggca acaggtgtgc
gtttagatgt cgcgtacctt 540cgggccttat cactggaagt tgcagaggaa atcgcccgtc
tcgaggctga agtgttccgg 600ttggccggtc acccgtttaa cctcaactcc cgtgaccagc
tggaacgcgt tttattcgat 660gagcttgggc ttcccgcaat tggcaaaacc gaaaagactg
gcaaacgcag tacgagcgct 720gccgtccttg aggcactccg cgaggctcac cctattgtag
aaaagatcct gcaataccgt 780gagttgacga agcttaaaag cacttatatt gatcctctcc
cggatctgat ccatcctcgt 840accggccgct tgcacacacg tttcaaccag acggcgactg
caaccggccg tctgtctagc 900tcggatccaa atctccagaa cattccggtc cgtacaccct
tgggccaacg tatccgccgg 960gcgtttatcg ctgaggaagg atggttactg gtcgcattgg
actactcgca gattgagctg 1020cgcgtcctcg cacatctctc tggtgacgaa aatttaatcc
gcgtgtttca agaggggcgt 1080gatattcaca cagaaactgc ctcatggatg ttcggtgtcc
cacgtgaagc agtggatcct 1140ttgatgcgcc gtgcagctaa aacaattaat tttggagtgc
tgtacggaat gagcgctcat 1200cgcttgagtc aggaactggc aatcccctac gaggaagcgc
aggcattcat cgaacgttac 1260tttcaatcgt ttccgaaagt tcgcgcatgg atcgagaaga
cgctcgagga aggtcgtcgt 1320cggggctatg tcgaaactct gtttggtcgc cgtcggtacg
taccagatct tgaagcccgc 1380gtcaaatcgg tacgggaggc tgcggagcgt atggcattta
atatgcctgt acagggtact 1440gcagctgacc tcatgaaact ggcaatggtc aagcttttcc
cgcgcttgga ggaaatgggc 1500gcacgtatgc ttctgcagct gcaggacgag ctggtgttag
aagcccctaa ggagcgcgcc 1560gaagctgtcg cgcgcctcgc taaagaagtg atggagggcg
tttacccatt ggccgtaccc 1620ctcgaagtgg aggtcggtat tggagaagat tggttatctg
caaaggaagc ggccgc 1676176557PRTArtificial SequenceAMINO ACID
SEQUENCE OF MUTANT ID 41 (V783L H784Q KlenTaq) 176Met Gly Ser Leu
Leu His Glu Phe Gly Leu Leu Glu Ser Pro Lys Ala1 5
10 15Leu Glu Glu Ala Pro Trp Pro Pro Pro Glu
Gly Ala Phe Val Gly Phe 20 25
30Val Leu Ser Arg Lys Glu Pro Met Trp Ala Asp Leu Leu Ala Leu Ala
35 40 45Ala Ala Arg Gly Gly Arg Val His
Arg Ala Pro Glu Pro Tyr Lys Ala 50 55
60Leu Arg Asp Leu Lys Glu Ala Arg Gly Leu Leu Ala Lys Asp Leu Ser65
70 75 80Val Leu Ala Leu Arg
Glu Gly Leu Gly Leu Pro Pro Gly Asp Asp Pro 85
90 95Met Leu Leu Ala Tyr Leu Leu Asp Pro Ser Asn
Thr Thr Pro Glu Gly 100 105
110Val Ala Arg Arg Tyr Gly Gly Glu Trp Thr Glu Glu Ala Gly Glu Arg
115 120 125Ala Ala Leu Ser Glu Arg Leu
Phe Ala Asn Leu Trp Gly Arg Leu Glu 130 135
140Gly Glu Glu Arg Leu Leu Trp Leu Tyr Arg Glu Val Glu Arg Pro
Leu145 150 155 160Ser Ala
Val Leu Ala His Met Glu Ala Thr Gly Val Arg Leu Asp Val
165 170 175Ala Tyr Leu Arg Ala Leu Ser
Leu Glu Val Ala Glu Glu Ile Ala Arg 180 185
190Leu Glu Ala Glu Val Phe Arg Leu Ala Gly His Pro Phe Asn
Leu Asn 195 200 205Ser Arg Asp Gln
Leu Glu Arg Val Leu Phe Asp Glu Leu Gly Leu Pro 210
215 220Ala Ile Gly Lys Thr Glu Lys Thr Gly Lys Arg Ser
Thr Ser Ala Ala225 230 235
240Val Leu Glu Ala Leu Arg Glu Ala His Pro Ile Val Glu Lys Ile Leu
245 250 255Gln Tyr Arg Glu Leu
Thr Lys Leu Lys Ser Thr Tyr Ile Asp Pro Leu 260
265 270Pro Asp Leu Ile His Pro Arg Thr Gly Arg Leu His
Thr Arg Phe Asn 275 280 285Gln Thr
Ala Thr Ala Thr Gly Arg Leu Ser Ser Ser Asp Pro Asn Leu 290
295 300Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln
Arg Ile Arg Arg Ala305 310 315
320Phe Ile Ala Glu Glu Gly Trp Leu Leu Val Ala Leu Asp Tyr Ser Gln
325 330 335Ile Glu Leu Arg
Val Leu Ala His Leu Ser Gly Asp Glu Asn Leu Ile 340
345 350Arg Val Phe Gln Glu Gly Arg Asp Ile His Thr
Glu Thr Ala Ser Trp 355 360 365Met
Phe Gly Val Pro Arg Glu Ala Val Asp Pro Leu Met Arg Arg Ala 370
375 380Ala Lys Thr Ile Asn Phe Gly Val Leu Tyr
Gly Met Ser Ala His Arg385 390 395
400Leu Ser Gln Glu Leu Ala Ile Pro Tyr Glu Glu Ala Gln Ala Phe
Ile 405 410 415Glu Arg Tyr
Phe Gln Ser Phe Pro Lys Val Arg Ala Trp Ile Glu Lys 420
425 430Thr Leu Glu Glu Gly Arg Arg Arg Gly Tyr
Val Glu Thr Leu Phe Gly 435 440
445Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala Arg Val Lys Ser Val Arg 450
455 460Glu Ala Ala Glu Arg Met Ala Phe
Asn Met Pro Val Gln Gly Thr Ala465 470
475 480Ala Asp Leu Met Lys Leu Ala Met Val Lys Leu Phe
Pro Arg Leu Glu 485 490
495Glu Met Gly Ala Arg Met Leu Leu Gln Leu His Asp Glu Leu Val Leu
500 505 510Glu Ala Pro Lys Glu Arg
Ala Glu Ala Val Ala Arg Leu Ala Lys Glu 515 520
525Val Met Glu Gly Val Tyr Pro Leu Ala Val Pro Leu Glu Val
Glu Val 530 535 540Gly Ile Gly Glu Asp
Trp Leu Ser Ala Lys Glu Ala Ala545 550
5551771676DNAArtificial SequenceNUCLEOTIDE SEQUENCE OF MUTANT ID 42
(H784S KlenTaq) 177catatgggtt cactgcttca tgaattcggt ctgttagagt ctcctaaagc
actcgaagag 60gcaccgtggc cgcccccaga aggtgctttt gttggcttcg tactttcccg
taaggagcct 120atgtgggcag atcttctggc tttagcggct gcacgcggtg gccgtgttca
ccgggcccct 180gagccataca aagcgttacg tgatctgaag gaagcacgtg gcttgctggc
aaaagacctt 240tctgttttgg ccctgcgcga gggtcttgga ctgccgccag gcgacgatcc
catgttattg 300gcctatctgt tagaccctag caataccaca cctgaagggg tcgctcgtcg
gtatggcggt 360gaatggactg aggaagccgg agagcgcgcc gcattgtccg aacggctctt
tgcaaactta 420tggggtcgtc tggaagggga ggaacgtctg ttatggttgt atcgggaagt
cgaacgtcct 480ctttcggccg tattagcgca tatggaggca acaggtgtgc gtttagatgt
cgcgtacctt 540cgggccttat cactggaagt tgcagaggaa atcgcccgtc tcgaggctga
agtgttccgg 600ttggccggtc acccgtttaa cctcaactcc cgtgaccagc tggaacgcgt
tttattcgat 660gagcttgggc ttcccgcaat tggcaaaacc gaaaagactg gcaaacgcag
tacgagcgct 720gccgtccttg aggcactccg cgaggctcac cctattgtag aaaagatcct
gcaataccgt 780gagttgacga agcttaaaag cacttatatt gatcctctcc cggatctgat
ccatcctcgt 840accggccgct tgcacacacg tttcaaccag acggcgactg caaccggccg
tctgtctagc 900tcggatccaa atctccagaa cattccggtc cgtacaccct tgggccaacg
tatccgccgg 960gcgtttatcg ctgaggaagg atggttactg gtcgcattgg actactcgca
gattgagctg 1020cgcgtcctcg cacatctctc tggtgacgaa aatttaatcc gcgtgtttca
agaggggcgt 1080gatattcaca cagaaactgc ctcatggatg ttcggtgtcc cacgtgaagc
agtggatcct 1140ttgatgcgcc gtgcagctaa aacaattaat tttggagtgc tgtacggaat
gagcgctcat 1200cgcttgagtc aggaactggc aatcccctac gaggaagcgc aggcattcat
cgaacgttac 1260tttcaatcgt ttccgaaagt tcgcgcatgg atcgagaaga cgctcgagga
aggtcgtcgt 1320cggggctatg tcgaaactct gtttggtcgc cgtcggtacg taccagatct
tgaagcccgc 1380gtcaaatcgg tacgggaggc tgcggagcgt atggcattta atatgcctgt
acagggtact 1440gcagctgacc tcatgaaact ggcaatggtc aagcttttcc cgcgcttgga
ggaaatgggc 1500gcacgtatgc ttctgcaggt cagcgacgag ctggtgttag aagcccctaa
ggagcgcgcc 1560gaagctgtcg cgcgcctcgc taaagaagtg atggagggcg tttacccatt
ggccgtaccc 1620ctcgaagtgg aggtcggtat tggagaagat tggttatctg caaaggaagc
ggccgc 1676178557PRTArtificial SequenceAMINO ACID SEQUENCE OF
MUTANT ID 42 (H784S KlenTaq) 178Met Gly Ser Leu Leu His Glu Phe Gly
Leu Leu Glu Ser Pro Lys Ala1 5 10
15Leu Glu Glu Ala Pro Trp Pro Pro Pro Glu Gly Ala Phe Val Gly
Phe 20 25 30Val Leu Ser Arg
Lys Glu Pro Met Trp Ala Asp Leu Leu Ala Leu Ala 35
40 45Ala Ala Arg Gly Gly Arg Val His Arg Ala Pro Glu
Pro Tyr Lys Ala 50 55 60Leu Arg Asp
Leu Lys Glu Ala Arg Gly Leu Leu Ala Lys Asp Leu Ser65 70
75 80Val Leu Ala Leu Arg Glu Gly Leu
Gly Leu Pro Pro Gly Asp Asp Pro 85 90
95Met Leu Leu Ala Tyr Leu Leu Asp Pro Ser Asn Thr Thr Pro
Glu Gly 100 105 110Val Ala Arg
Arg Tyr Gly Gly Glu Trp Thr Glu Glu Ala Gly Glu Arg 115
120 125Ala Ala Leu Ser Glu Arg Leu Phe Ala Asn Leu
Trp Gly Arg Leu Glu 130 135 140Gly Glu
Glu Arg Leu Leu Trp Leu Tyr Arg Glu Val Glu Arg Pro Leu145
150 155 160Ser Ala Val Leu Ala His Met
Glu Ala Thr Gly Val Arg Leu Asp Val 165
170 175Ala Tyr Leu Arg Ala Leu Ser Leu Glu Val Ala Glu
Glu Ile Ala Arg 180 185 190Leu
Glu Ala Glu Val Phe Arg Leu Ala Gly His Pro Phe Asn Leu Asn 195
200 205Ser Arg Asp Gln Leu Glu Arg Val Leu
Phe Asp Glu Leu Gly Leu Pro 210 215
220Ala Ile Gly Lys Thr Glu Lys Thr Gly Lys Arg Ser Thr Ser Ala Ala225
230 235 240Val Leu Glu Ala
Leu Arg Glu Ala His Pro Ile Val Glu Lys Ile Leu 245
250 255Gln Tyr Arg Glu Leu Thr Lys Leu Lys Ser
Thr Tyr Ile Asp Pro Leu 260 265
270Pro Asp Leu Ile His Pro Arg Thr Gly Arg Leu His Thr Arg Phe Asn
275 280 285Gln Thr Ala Thr Ala Thr Gly
Arg Leu Ser Ser Ser Asp Pro Asn Leu 290 295
300Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln Arg Ile Arg Arg
Ala305 310 315 320Phe Ile
Ala Glu Glu Gly Trp Leu Leu Val Ala Leu Asp Tyr Ser Gln
325 330 335Ile Glu Leu Arg Val Leu Ala
His Leu Ser Gly Asp Glu Asn Leu Ile 340 345
350Arg Val Phe Gln Glu Gly Arg Asp Ile His Thr Glu Thr Ala
Ser Trp 355 360 365Met Phe Gly Val
Pro Arg Glu Ala Val Asp Pro Leu Met Arg Arg Ala 370
375 380Ala Lys Thr Ile Asn Phe Gly Val Leu Tyr Gly Met
Ser Ala His Arg385 390 395
400Leu Ser Gln Glu Leu Ala Ile Pro Tyr Glu Glu Ala Gln Ala Phe Ile
405 410 415Glu Arg Tyr Phe Gln
Ser Phe Pro Lys Val Arg Ala Trp Ile Glu Lys 420
425 430Thr Leu Glu Glu Gly Arg Arg Arg Gly Tyr Val Glu
Thr Leu Phe Gly 435 440 445Arg Arg
Arg Tyr Val Pro Asp Leu Glu Ala Arg Val Lys Ser Val Arg 450
455 460Glu Ala Ala Glu Arg Met Ala Phe Asn Met Pro
Val Gln Gly Thr Ala465 470 475
480Ala Asp Leu Met Lys Leu Ala Met Val Lys Leu Phe Pro Arg Leu Glu
485 490 495Glu Met Gly Ala
Arg Met Leu Leu Gln Val Ser Asp Glu Leu Val Leu 500
505 510Glu Ala Pro Lys Glu Arg Ala Glu Ala Val Ala
Arg Leu Ala Lys Glu 515 520 525Val
Met Glu Gly Val Tyr Pro Leu Ala Val Pro Leu Glu Val Glu Val 530
535 540Gly Ile Gly Glu Asp Trp Leu Ser Ala Lys
Glu Ala Ala545 550
5551791676DNAArtificial SequenceNUCLEOTIDE SEQUENCE OF MUTANT ID 43
(H784Y KlenTaq) 179catatgggtt cactgcttca tgaattcggt ctgttagagt ctcctaaagc
actcgaagag 60gcaccgtggc cgcccccaga aggtgctttt gttggcttcg tactttcccg
taaggagcct 120atgtgggcag atcttctggc tttagcggct gcacgcggtg gccgtgttca
ccgggcccct 180gagccataca aagcgttacg tgatctgaag gaagcacgtg gcttgctggc
aaaagacctt 240tctgttttgg ccctgcgcga gggtcttgga ctgccgccag gcgacgatcc
catgttattg 300gcctatctgt tagaccctag caataccaca cctgaagggg tcgctcgtcg
gtatggcggt 360gaatggactg aggaagccgg agagcgcgcc gcattgtccg aacggctctt
tgcaaactta 420tggggtcgtc tggaagggga ggaacgtctg ttatggttgt atcgggaagt
cgaacgtcct 480ctttcggccg tattagcgca tatggaggca acaggtgtgc gtttagatgt
cgcgtacctt 540cgggccttat cactggaagt tgcagaggaa atcgcccgtc tcgaggctga
agtgttccgg 600ttggccggtc acccgtttaa cctcaactcc cgtgaccagc tggaacgcgt
tttattcgat 660gagcttgggc ttcccgcaat tggcaaaacc gaaaagactg gcaaacgcag
tacgagcgct 720gccgtccttg aggcactccg cgaggctcac cctattgtag aaaagatcct
gcaataccgt 780gagttgacga agcttaaaag cacttatatt gatcctctcc cggatctgat
ccatcctcgt 840accggccgct tgcacacacg tttcaaccag acggcgactg caaccggccg
tctgtctagc 900tcggatccaa atctccagaa cattccggtc cgtacaccct tgggccaacg
tatccgccgg 960gcgtttatcg ctgaggaagg atggttactg gtcgcattgg actactcgca
gattgagctg 1020cgcgtcctcg cacatctctc tggtgacgaa aatttaatcc gcgtgtttca
agaggggcgt 1080gatattcaca cagaaactgc ctcatggatg ttcggtgtcc cacgtgaagc
agtggatcct 1140ttgatgcgcc gtgcagctaa aacaattaat tttggagtgc tgtacggaat
gagcgctcat 1200cgcttgagtc aggaactggc aatcccctac gaggaagcgc aggcattcat
cgaacgttac 1260tttcaatcgt ttccgaaagt tcgcgcatgg atcgagaaga cgctcgagga
aggtcgtcgt 1320cggggctatg tcgaaactct gtttggtcgc cgtcggtacg taccagatct
tgaagcccgc 1380gtcaaatcgg tacgggaggc tgcggagcgt atggcattta atatgcctgt
acagggtact 1440gcagctgacc tcatgaaact ggcaatggtc aagcttttcc cgcgcttgga
ggaaatgggc 1500gcacgtatgc ttctgcaggt ctatgacgag ctggtgttag aagcccctaa
ggagcgcgcc 1560gaagctgtcg cgcgcctcgc taaagaagtg atggagggcg tttacccatt
ggccgtaccc 1620ctcgaagtgg aggtcggtat tggagaagat tggttatctg caaaggaagc
ggccgc 1676180557PRTArtificial SequenceAMINO ACID SEQUENCE OF
MUTANT ID 43 (H784Y KlenTaq) 180Met Gly Ser Leu Leu His Glu Phe Gly
Leu Leu Glu Ser Pro Lys Ala1 5 10
15Leu Glu Glu Ala Pro Trp Pro Pro Pro Glu Gly Ala Phe Val Gly
Phe 20 25 30Val Leu Ser Arg
Lys Glu Pro Met Trp Ala Asp Leu Leu Ala Leu Ala 35
40 45Ala Ala Arg Gly Gly Arg Val His Arg Ala Pro Glu
Pro Tyr Lys Ala 50 55 60Leu Arg Asp
Leu Lys Glu Ala Arg Gly Leu Leu Ala Lys Asp Leu Ser65 70
75 80Val Leu Ala Leu Arg Glu Gly Leu
Gly Leu Pro Pro Gly Asp Asp Pro 85 90
95Met Leu Leu Ala Tyr Leu Leu Asp Pro Ser Asn Thr Thr Pro
Glu Gly 100 105 110Val Ala Arg
Arg Tyr Gly Gly Glu Trp Thr Glu Glu Ala Gly Glu Arg 115
120 125Ala Ala Leu Ser Glu Arg Leu Phe Ala Asn Leu
Trp Gly Arg Leu Glu 130 135 140Gly Glu
Glu Arg Leu Leu Trp Leu Tyr Arg Glu Val Glu Arg Pro Leu145
150 155 160Ser Ala Val Leu Ala His Met
Glu Ala Thr Gly Val Arg Leu Asp Val 165
170 175Ala Tyr Leu Arg Ala Leu Ser Leu Glu Val Ala Glu
Glu Ile Ala Arg 180 185 190Leu
Glu Ala Glu Val Phe Arg Leu Ala Gly His Pro Phe Asn Leu Asn 195
200 205Ser Arg Asp Gln Leu Glu Arg Val Leu
Phe Asp Glu Leu Gly Leu Pro 210 215
220Ala Ile Gly Lys Thr Glu Lys Thr Gly Lys Arg Ser Thr Ser Ala Ala225
230 235 240Val Leu Glu Ala
Leu Arg Glu Ala His Pro Ile Val Glu Lys Ile Leu 245
250 255Gln Tyr Arg Glu Leu Thr Lys Leu Lys Ser
Thr Tyr Ile Asp Pro Leu 260 265
270Pro Asp Leu Ile His Pro Arg Thr Gly Arg Leu His Thr Arg Phe Asn
275 280 285Gln Thr Ala Thr Ala Thr Gly
Arg Leu Ser Ser Ser Asp Pro Asn Leu 290 295
300Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln Arg Ile Arg Arg
Ala305 310 315 320Phe Ile
Ala Glu Glu Gly Trp Leu Leu Val Ala Leu Asp Tyr Ser Gln
325 330 335Ile Glu Leu Arg Val Leu Ala
His Leu Ser Gly Asp Glu Asn Leu Ile 340 345
350Arg Val Phe Gln Glu Gly Arg Asp Ile His Thr Glu Thr Ala
Ser Trp 355 360 365Met Phe Gly Val
Pro Arg Glu Ala Val Asp Pro Leu Met Arg Arg Ala 370
375 380Ala Lys Thr Ile Asn Phe Gly Val Leu Tyr Gly Met
Ser Ala His Arg385 390 395
400Leu Ser Gln Glu Leu Ala Ile Pro Tyr Glu Glu Ala Gln Ala Phe Ile
405 410 415Glu Arg Tyr Phe Gln
Ser Phe Pro Lys Val Arg Ala Trp Ile Glu Lys 420
425 430Thr Leu Glu Glu Gly Arg Arg Arg Gly Tyr Val Glu
Thr Leu Phe Gly 435 440 445Arg Arg
Arg Tyr Val Pro Asp Leu Glu Ala Arg Val Lys Ser Val Arg 450
455 460Glu Ala Ala Glu Arg Met Ala Phe Asn Met Pro
Val Gln Gly Thr Ala465 470 475
480Ala Asp Leu Met Lys Leu Ala Met Val Lys Leu Phe Pro Arg Leu Glu
485 490 495Glu Met Gly Ala
Arg Met Leu Leu Gln Val Tyr Asp Glu Leu Val Leu 500
505 510Glu Ala Pro Lys Glu Arg Ala Glu Ala Val Ala
Arg Leu Ala Lys Glu 515 520 525Val
Met Glu Gly Val Tyr Pro Leu Ala Val Pro Leu Glu Val Glu Val 530
535 540Gly Ile Gly Glu Asp Trp Leu Ser Ala Lys
Glu Ala Ala545 550 555
User Contributions:
Comment about this patent or add new information about this topic: