Patent application title: ANTI-N3pGlu AMYLOID BETA PEPTIDE ANTIBODIES AND USES THEREOF
Inventors:
Ronald Bradley Demattos (Zionsville, IN, US)
Jirong Lu (Carmel, IN, US)
Jirong Lu (Carmel, IN, US)
Ying Tang (San Diego, CA, US)
IPC8 Class: AC07K1618FI
USPC Class:
1 1
Class name:
Publication date: 2021-12-02
Patent application number: 20210371509
Abstract:
Antibodies to human N3pGlu A.beta., compositions comprising such N3pGlu
A.beta. antibodies, and methods of using such N3pGlu A.beta. antibodies
for the treatment of a disease characterized by deposition of A.beta.
including clinical or pre-clinical Alzheimer's disease, Down's syndrome,
and clinical or pre-clinical cerebral amyloid angiopathy.Claims:
1. An antibody that binds human N3pGlu A.beta., comprising a light chain
variable region (LCVR) and a heavy chain variable region (HCVR), wherein
the LCVR comprises LCDR1 having the amino acid sequence of SEQ ID NO: 4,
LCDR2 having the amino acid sequence of SEQ ID NO: 6, and LCDR3 having
the amino acid sequence of SEQ ID NO: 8, and wherein the HCVR comprises
HCDR1 having the amino acid sequence of SEQ ID NO: 1, HCDR2 having the
amino acid sequence of SEQ ID NO: 2, and HCDR3 having the amino acid
sequence of SEQ ID NO: 3.
2. The antibody of claim 1, wherein the LCVR has the amino acid sequence of SEQ ID NO: 10, and the HCVR has the amino acid sequence of SEQ ID NO:9.
3. The antibody of claim 1, comprising a light chain (LC) having the amino acid sequence of SEQ ID NO: 13, and a heavy chain (HC) having the amino acid sequence of SEQ ID NO: 12.
4. The antibody of claim 3, comprising two LCs and two HCs, wherein the amino acid sequence of each LC is SEQ ID NO: 13, and the amino acid sequence of each HC is SEQ ID NO: 12.
5. A pharmaceutical composition comprising the antibody of claim 1 and one or more pharmaceutically acceptable carriers, diluents or excipients.
6. A method of treating a patient having a condition characterized by deposition of A.beta., comprising administering to the patient an effective amount of the antibody of claim 1.
7. The method of claim 6, wherein the condition is selected from clinical or pre-clinical AD, Down's syndrome, and clinical or pre-clinical CAA.
8. The method of claim 6, wherein the condition is selected from prodromal AD, mild AD, moderate AD, and severe AD.
9. A method of treating memory loss or cognitive decline in a patient having a condition characterized by deposition of A.beta., comprising administering to the patient an effective amount of the antibody of claim 1.
10. A method of slowing cognitive or functional decline in a patient having a condition characterized by deposition of A.beta., comprising administering to the patient an effective amount of the antibody of claim 1.
11. The method of claim 10, wherein the condition is selected from clinical or pre-clinical AD, Down's syndrome, and clinical or pre-clinical CAA.
12. The method of claim 10, wherein the condition is selected from prodromal AD, mild AD, moderate AD, and severe AD.
13. A method of reducing brain A.beta. amyloid plaque load in a patient having a condition characterized by deposition of A.beta., comprising administering to the patient an effective amount of the antibody of claim 1.
14. The method of claim 13, wherein the condition is selected from clinical or pre-clinical AD, Down's syndrome, and clinical or pre-clinical CAA.
15. The method of claim 13, wherein the condition is selected from prodromal AD, mild AD, moderate AD or severe AD.
16. A DNA molecule comprising a polynucleotide that encodes the antibody heavy chain given by the amino acid sequence of SEQ ID NO:12.
17. The DNA molecule of claim 16, wherein the amino acid sequence of the polynucleotide is SEQ ID NO:15.
18. A DNA molecule comprising a polynucleotide that encodes the antibody light chain given by the amino acid sequence of SEQ ID NO:13.
19. The DNA molecule of claim 18, wherein the amino acid sequence of the polynucleotide is SEQ ID NO:16.
20. A DNA molecule comprising a polynucleotide sequence that encodes the antibody heavy chain having the amino acid sequence of SEQ ID NO: 12 and a polynucleotide sequence that encodes the antibody light chain having the amino acid sequence of SEQ ID NO: 13.
21. The DNA molecule of claim 20, wherein the polynucleotide sequence that encodes the antibody heavy chain is SEQ ID NO:15, and the polynucleotide sequence that encodes the antibody light chain is SEQ ID NO:16.
22. A mammalian cell transformed with the DNA molecule of claim 16 and the DNA molecule of claim 18, wherein the transformed cell is capable of expressing an antibody comprising two heavy chains and two light chains, wherein the amino acid sequence of each heavy chain is given by SEQ ID NO:12 and the amino acid sequence of each light chain is given by SEQ ID NO:13.
23. A mammalian cell transformed with the DNA molecule of claim 20, wherein the transformed cell is capable of expressing an antibody comprising two heavy chains and two light chains, wherein the amino acid sequence of each heavy chain is given by SEQ ID NO:12 and the amino acid sequence of each light chain is given by SEQ ID NO:13.
24. A process for producing an antibody, wherein the amino sequence of each of the two HCs is SEQ ID NO: 12, and the amino acid sequence of each of the two LCs is SEQ ID NO: 13, and wherein the process comprises: a) cultivating the mammalian cell of claim 23 under conditions such that the antibody is expressed, and b) recovering the expressed antibody.
25. An antibody obtainable by the process of claim 24.
Description:
[0001] The present invention relates to antibodies that bind human N3pGlu
Amyloid Beta peptide and their use in treating diseases related to
Amyloid Beta (herein referred to as A.beta. or Abeta) peptide.
[0002] The cleavage of the amyloid precursor protein results in A.beta. peptides ranging in size from 38 to 43 amino acids. Conversion of A.beta. from soluble to insoluble forms having high .beta.-sheet content and the deposition of these insoluble forms as neuritic and cerebrovascular plaques in the brain has been associated with a number of conditions and diseases, including Alzheimer's disease (AD), Down's syndrome, and cerebral amyloid angiopathy (CAA).
[0003] The deposits found in plaques are comprised of a heterogeneous mixture of A.beta. peptides. N3pGlu A.beta., also referred to as N3pE, pE3-X, or A.beta..sub.p3-X, is an N-terminal truncated form of A.beta. peptide and is primarily found in plaque. N3pGlu A.beta. lacks the first two amino acid residues at the N-terminus of human A.beta. and has a pyroglutamate which was derived from the glutamic acid at the third amino acid position. Although N3pGlu A.beta. peptide is a minor component of the deposited A.beta. in the brain, studies have demonstrated that N3pGlu A.beta. peptide has aggressive aggregation properties and accumulates early in the deposition cascade.
[0004] Antibodies to N3pGlu A.beta. are known in the art. For example, U.S. Pat. No. 8,679,498 discloses human N3pGlu A.beta. antibodies (e.g. B12L; also known as LY3002813) and methods of treating diseases, such as Alzheimer's disease, with said antibodies. A clinical trial has demonstrated concerns with anti-drug antibodies against an anti-N3pGlu A.beta. antibody (LY3002813). Anti-drug antibodies were present in the plasma of almost everyone treated in this trial, and an associated problem with the immune reaction was a shortened half-life of LY3002813. Therefore, there still remains a need for alternative anti-N3pGlu A.beta. antibodies.
[0005] The antibodies of the present invention seek to provide anti-N3pGlu A.beta. antibodies that bind N3pGlu A.beta., lower plaque (A.beta..sub.1-42) in vivo, but which also demonstrate reduced immunogenicity. Such anti-N3pGlu A.beta. antibodies may also demonstrate reduced non-specific binding to plasma proteins. In addition, such anti-N3pGlu A.beta. antibodies may also provide a reduced predicted T-Dependent Ab Response. Such anti-N3pGlu A.beta. antibodies may also provide increased antibody half-life and an improved safety profile for a potential human therapeutic with pharmacokinetics for a better dosing schedule. The antibodies within the scope of the present invention seek to possess at least one of these desirable characteristics.
[0006] The present invention provides an antibody that binds human N3pGlu A.beta., comprising an LCVR and an HCVR, wherein said LCVR comprises LCDR1, LCDR2, and LCDR3, and wherein said HCVR comprises HCDR1, HCDR2, and HCDR3, and wherein the amino acid sequences are SEQ ID NO:4 or 5 for LCDR1, SEQ ID NO:6 or 7 for LCDR2, SEQ ID NO:8 for LCDR3, SEQ ID NO:1 for HCDR1, SEQ ID NO:2 for HCDR2, and SEQ ID NO:3 for HCDR3. In a particular embodiment, the anti-N3pGlu A.beta. antibody comprises the amino sequences of SEQ ID NO:4 for LCDR1, SEQ ID NO:6 for LCDR2, SEQ ID NO:8 for LCDR3, SEQ ID NO: 1 for HCDR1, SEQ ID NO: 2 for HCDR2, and SEQ ID NO:3 for HCDR3. In another particular embodiment, the anti-N3pGlu A.beta. antibody comprises the amino sequences of SEQ ID NO:5 for LCDR1, SEQ ID NO:7 for LCDR2, SEQ ID NO:8 for LCDR3, SEQ ID NO: 1 for HCDR1, SEQ ID NO:2 for HCDR2, and SEQ ID NO:3 for HCDR3.
[0007] The present invention also provides an antibody that binds human N3pGlu A.beta., wherein said antibody comprises a light chain variable region (LCVR) having the amino acid sequence of SEQ ID NO: 10 or SEQ ID NO: 11, and a heavy chain variable region (HCVR) having the amino acid sequence of SEQ ID NO: 9. In a particular embodiment, the present invention provides an antibody that binds human N3pGlu A.beta., wherein said antibody comprises a light chain variable region (LCVR) having the amino acid sequence of SEQ ID NO: 10, and a heavy chain variable region (HCVR) having the amino acid sequence of SEQ ID NO: 9. In another particular embodiment, the present invention provides an antibody that binds human N3pGlu A.beta., wherein said antibody comprises a light chain variable region (LCVR) having the amino acid sequence of SEQ ID NO: 11, and a heavy chain variable region (HCVR) having the amino acid sequence of SEQ ID NO: 9.
[0008] In an embodiment, the present invention provides an antibody that binds human N3pGlu A.beta., comprising a light chain (LC) and a heavy chain (HC), wherein the amino acid sequence of the LC is SEQ ID NO: 13 or 14, and the amino acid sequence of the HC is SEQ ID NO: 12. In a more particular embodiment, the present invention provides an antibody that binds human N3pGlu A.beta., comprising a light chain (LC) and a heavy chain (HC), wherein the amino acid sequence of the LC is SEQ ID NO: 13, and the amino acid sequence of the HC is SEQ ID NO: 12. In another particular embodiment, the present invention provides an antibody that binds human N3pGlu A.beta., comprising a light chain (LC) and a heavy chain (HC), wherein the amino acid sequence of the LC is SEQ ID NO: 14, and the amino acid sequence of the HC is SEQ ID NO: 12. In a further embodiment, the present invention provides an antibody comprising two LC and two HC, wherein the amino acid sequence of each LC is SEQ ID NO: 13 or 14, and the amino acid sequence of each HC is SEQ ID NO: 12. In a more particular embodiment, the present invention provides an antibody comprising two LC and two HC, wherein the amino acid sequence of each LC is SEQ ID NO: 13, and the amino acid sequence of each HC is SEQ ID NO: 12. In a more particular embodiment, the present invention provides an antibody comprising two LC and two HC, wherein the amino acid sequence of each LC is SEQ ID NO: 14, and the amino acid sequence of each HC is SEQ ID NO: 12.
[0009] The present invention further provides pharmaceutical compositions comprising an antibody of the present invention and one or more pharmaceutically acceptable carriers, diluents or excipients. Further, the present invention provides a method of treating a disease characterized by deposition of A.beta., comprising administering to a patient in need thereof a pharmaceutical composition comprising an antibody of the present invention. In another embodiment, the present invention provides a method of treating a disease characterized by deposition of A.beta., comprising administering an effective amount of an antibody of the present invention. Particularly, the present invention provides a method of treating or preventing a condition selected from clinical or pre-clinical Alzheimer's disease, Down's syndrome, and clinical or pre-clinical CAA comprising administering to said patient an effective amount of an antibody of the present invention. In another embodiment, the present invention provides a method of treating or preventing clinical or pre-clinical Alzheimer's disease, Down's syndrome, and clinical or pre-clinical CAA comprising administering to a patient in need thereof an effective amount of a pharmaceutical composition comprising an antibody of the present invention.
[0010] In another embodiment, the present invention provides a method of treating or preventing a condition selected from prodromal AD (sometimes also referred to as A.beta.-related mild cognitive impairment, or MCI), mild AD, moderate AD, and severe AD, comprising administering to a patient in need thereof an effective amount of an antibody of the present invention. In another embodiment, the present invention provides a method of treating or preventing a condition selected from prodromal AD, mild AD, moderate AD, and severe AD, comprising administering to a patient in need thereof a pharmaceutical composition comprising an antibody of the present invention.
[0011] In another embodiment the present invention provides a method of slowing cognitive decline in a patient diagnosed with pre-clinical Alzheimer's disease, clinical Alzheimer's disease, Down's syndrome, or clinical or pre-clinical cerebral amyloid angiopathy, comprising administering a pharmaceutical composition comprising an antibody of the present invention. More particularly, the present invention further provides a method of slowing cognitive decline in a patient diagnosed with a condition selected from prodromal AD, mild AD, moderate AD and severe AD, comprising administering a pharmaceutical composition comprising an antibody of the present invention. In another such embodiment the present invention provides a method of slowing cognitive decline in a patient diagnosed with pre-clinical Alzheimer's disease, clinical Alzheimer's disease, Down's syndrome, or clinical or pre-clinical cerebral amyloid angiopathy, comprising administering an effective amount of an antibody of the present invention. More particularly, the present invention further provides a method of slowing cognitive decline in a patient diagnosed with a condition selected from prodromal AD, mild AD, moderate AD and severe AD, comprising administering an effective amount of an antibody of the present invention.
[0012] In another embodiment the present invention provides a method of slowing functional decline in a patient diagnosed with pre-clinical Alzheimer's disease or clinical Alzheimer's disease, comprising administering a pharmaceutical composition comprising an antibody of the present invention. More particularly, the present invention provides a method of slowing functional decline in a patient diagnosed with a condition selected from prodromal AD, mild AD, moderate AD and severe AD, comprising administering a pharmaceutical composition comprising an antibody of the present invention. In another such embodiment the present invention provides a method of slowing functional decline in a patient diagnosed with pre-clinical Alzheimer's disease or clinical Alzheimer's disease, comprising administering an effective amount of an antibody of the present invention. More particularly, the present invention provides a method of slowing functional decline in a patient diagnosed with a condition selected from prodromal AD, mild AD, moderate AD and severe AD, comprising administering an effective amount of an antibody of the present invention.
[0013] In another embodiment the present invention provides a method of reducing brain A.beta. amyloid plaque load in a patient diagnosed with pre-clinical or clinical Alzheimer's disease, comprising administering a pharmaceutical composition comprising an antibody of the present invention. More particularly, the present invention provides a method of reducing brain A.beta. amyloid plaque load in a patient diagnosed with a condition selected from prodromal AD, mild AD, moderate AD or severe AD, comprising administering a pharmaceutical composition comprising an antibody of the present invention.
[0014] In another embodiment the present invention provides a method of preventing memory loss or cognitive decline in an asymptomatic patient comprising administering to the patient a pharmaceutical composition comprising an antibody of the present invention. In a preferred embodiment, the patient has low levels of A.beta.1-42 in the cerebrospinal fluid (CSF) or A.beta. plaques in the brain.
[0015] In another embodiment the present invention provides a method of treating asymptomatic patients known to have an Alzheimer's disease-causing genetic mutation, comprising administering to the said patient a pharmaceutical composition comprising an antibody of the present invention. In a particular embodiment, the present invention provides a method of treating asymptomatic patients known to have a PSEN1 E280A Alzheimer's disease-causing genetic mutation (Paisa mutation), comprising administering to the said patient a pharmaceutical composition comprising an antibody of the present invention. In another particular embodiment, the present invention provides a method of treating asymptomatic patients with a genetic mutation, such as a mutation in the APP, PSEN1, or PSEN2 gene, that causes autosomal-dominant Alzheimer's disease, comprising administering to the said patient a pharmaceutical composition comprising an antibody of the present invention.
[0016] In another embodiment the present invention provides a method of preventing memory loss or cognitive decline in asymptomatic patients known to have an Alzheimer's disease-causing genetic mutation, comprising administering to the said patient a pharmaceutical composition comprising an antibody of the present invention. In a particular embodiment, the present invention provides a method of preventing memory loss or cognitive decline in asymptomatic patients known to have a PSEN1 E280A Alzheimer's disease-causing genetic mutation (Paisa mutation), comprising administering to the said patient a pharmaceutical composition comprising an antibody of the present invention. In another particular embodiment, the present invention provides a method of preventing memory loss or cognitive decline in asymptomatic patients with a genetic mutation that causes autosomal-dominant Alzheimer's disease, comprising administering to the said patient a pharmaceutical composition comprising an antibody of the present invention.
[0017] In another embodiment the present invention provides a method of slowing cognitive decline in an asymptomatic patient known to have an Alzheimer's disease-causing genetic mutation, comprising administering to the said patient a pharmaceutical composition comprising an antibody of the present invention. In a particular embodiment, the present invention provides a method of slowing cognitive decline in asymptomatic patients known to have a PSEN1 E280A Alzheimer's disease-causing genetic mutation (Paisa mutation), comprising administering to the said patient a pharmaceutical composition comprising an antibody of the present invention. In another particular embodiment, the present invention provides a method of slowing cognitive decline in asymptomatic patients with a genetic mutation that causes autosomal-dominant Alzheimer's disease, comprising administering to the said patient a pharmaceutical composition comprising an antibody of the present invention.
[0018] The present invention also provides an antibody of the present invention for use in therapy. In an embodiment, the present invention provides an antibody of the present invention for use in the treatment of a disease characterized by deposition of A.beta.. In another embodiment, the present invention provides an antibody of the present invention for use in treatment of clinical or pre-clinical Alzheimer's disease, Down's syndrome, or clinical or pre-clinical cerebral amyloid angiopathy. In another embodiment, the present invention provides an antibody of the present invention for use in treatment of a condition selected from prodromal AD, mild AD, moderate AD and severe AD. In another embodiment, the present invention provides an antibody of the present invention for use in slowing cognitive decline in a patient diagnosed with clinical or pre-clinical Alzheimer's disease, Down's syndrome, or clinical or pre-clinical cerebral amyloid angiopathy. In another embodiment, the present invention provides an antibody of the present invention for use in slowing cognitive decline in a patient diagnosed with prodromal AD, mild AD, moderate AD, or severe AD.
[0019] The present invention also provides an antibody of the present invention for use in reducing brain A.beta. amyloid plaque load. In another embodiment, the present invention provides an antibody of the present invention for use in treating a condition characterized by deposition of A.beta. in a patient having the PSEN1 E280A genetic mutation. In another embodiment, the present invention provides an antibody of the present invention for use in treating memory loss or cognitive decline in a patient having the PSEN1 E280A genetic mutation. In another embodiment, the present invention provides an antibody of the present invention for use in preventing memory loss or cognitive decline in a patient having the PSEN1 E280A genetic mutation.
[0020] The present invention also provides an antibody of the present invention for use in the prevention of a condition selected from clinical or pre-clinical AD, Down's syndrome, and clinical or pre-clinical CAA. In another embodiment, the present invention provides an antibody of the present invention for use in the prevention of a condition selected from prodromal AD, mild AD, moderate AD, and severe AD.
[0021] Further, the present invention provides a pharmaceutical composition comprising an antibody of the present invention for use in therapy. In an embodiment, the present invention provides a pharmaceutical composition comprising an antibody for use in the treatment of a disease characterized by deposition of A.beta..
[0022] The present invention also provides the use of an antibody of the present invention in the manufacture of a medicament for the treatment of a disease characterized by deposition of A.beta.. In an embodiment, the present invention provides the use of an antibody of the present invention in the manufacture of a medicament for the treatment of clinical or pre-clinical Alzheimer's disease, Down's syndrome, and clinical or pre-clinical cerebral amyloid angiopathy. In an embodiment, the present invention provides the use of an antibody of the present invention in the manufacture of a medicament for the treatment of prodromal AD, mild AD, moderate AD or severe AD. In another embodiment, the present invention provides the use of an antibody of the present invention in the manufacture of a medicament for slowing cognitive decline in a patient diagnosed with a condition selected from clinical or pre-clinical Alzheimer's disease, Down's syndrome, and clinical or pre-clinical cerebral amyloid angiopathy. In another embodiment, the present invention provides the use of an antibody of the present invention in the manufacture of a medicament for slowing cognitive decline in a patient diagnosed with a condition selected from prodromal AD, mild AD, moderate AD and severe AD.
[0023] The present invention also provides the use of an antibody of the present invention in the manufacture of a medicament for reducing brain A.beta. amyloid plaque load. In another embodiment, the present invention provides the use of an antibody of the present invention in the manufacture of a medicament for treating a condition characterized by deposition of A.beta. in a patient having the PSEN1 E280A genetic mutation. In another embodiment, the present invention provides the use of an antibody of the present invention in the manufacture of a medicament for treating memory loss or cognitive decline in a patient having the PSEN1 E280A genetic mutation. In another embodiment, the present invention provides the use of an antibody of the present invention in the manufacture of a medicament for preventing memory loss or cognitive decline in a patient. In a preferred embodiment, the patient has the PSEN1 E280A genetic mutation. In another embodiment, the present invention provides the use of an antibody of the present invention in the manufacture of a medicament for preventing a condition selected from clinical or pre-clinical AD, Down's syndrome, and clinical or pre-clinical CAA. In another embodiment, the present invention provides the use of an antibody of the present invention in the manufacture of a medicament for preventing a condition selected from prodromal AD, mild AD, moderate AD, and severe AD.
[0024] In an embodiment, the present invention provides a DNA molecule comprising a polynucleotide sequence encoding a polypeptide having the amino acid sequence of SEQ ID NO: 12. In an embodiment, the present invention provides a DNA molecule comprising a polynucleotide sequence encoding a polypeptide having the amino acid sequence of SEQ ID NO: 13. In an embodiment, the present invention provides a DNA molecule comprising a polynucleotide sequence encoding a polypeptide having the amino acid sequence of SEQ ID NO: 14. In a further embodiment, the present invention provides a DNA molecule comprising a polynucleotide sequence encoding a polypeptide having the amino acid sequence of SEQ ID NO: 12, and comprising a polynucleotide sequence encoding a polypeptide having the amino acid sequence of SEQ ID NO: 13. In another embodiment, the present invention provides a DNA molecule comprising a polynucleotide sequence encoding a polypeptide having the amino acid sequence of SEQ ID NO: 12, and comprising a polynucleotide sequence encoding a polypeptide having the amino acid sequence of SEQ ID NO: 14. In another embodiment, the present invention provides a DNA molecule comprising a polynucleotide sequence encoding a polypeptide having the amino acid sequence of SEQ ID NO: 12, and a DNA molecule comprising a polynucleotide sequence encoding a polypeptide having the amino acid sequence of SEQ ID NO: 13. In another embodiment, the present invention provides a DNA molecule comprising a polynucleotide sequence encoding a polypeptide having the amino acid sequence of SEQ ID NO: 12, and a DNA molecule comprising a polynucleotide sequence encoding a polypeptide having the amino acid sequence of SEQ ID NO: 14. In a particular embodiment the polynucleotide sequence encoding a polypeptide having the amino acid sequence of SEQ ID NO: 12 is SEQ ID NO: 15 and the polynucleotide sequence encoding a polypeptide having the amino acid sequence of SEQ ID NO: 13 is SEQ ID NO: 16. In a particular embodiment the polynucleotide sequence encoding a polypeptide having the amino acid sequence of SEQ ID NO: 12 is SEQ ID NO: 15, the polynucleotide sequence encoding a polypeptide having the amino acid sequence of SEQ ID NO: 14 is SEQ ID NO: 17, and the polynucleotide sequence encoding a polypeptide having the amino acid sequence of SEQ ID NO: 13 is SEQ ID NO: 16.
[0025] Further, the present invention provides a mammalian cell comprising a DNA molecule comprising a polynucleotide sequence encoding a polypeptide having the amino acid sequence of SEQ ID NO: 12 and a DNA molecule comprising a polynucleotide sequence encoding a polypeptide having the amino acid sequence of SEQ ID NO: 13 or 14. Preferably the mammalian cell comprises a DNA molecule comprising a polynucleotide sequence encoding a polypeptide having the amino acid sequence of SEQ ID NO: 12 and a polypeptide having the amino acid sequence SEQ ID NO: 13. In another embodiment, the mammalian cell comprises a DNA molecule comprising a polynucleotide sequence encoding a polypeptide having the amino acid sequence of SEQ ID NO: 12 and a polypeptide having the amino acid sequence of SEQ ID NO: 14. In an embodiment the mammalian cell line is a Chinese Hamster Ovary (CHO) or Hamster embryonic kidney (HEK) cell line.
[0026] The present invention also provides a mammalian cell comprising a DNA molecule comprising a polynucleotide sequence encoding a polypeptide having the amino acid sequence of SEQ ID NO:12 and/or a DNA molecule comprising a polynucleotide sequence encoding a polypeptide having the amino acid sequence of SEQ ID NO: 13, wherein the cell is capable of expressing an antibody comprising a HC having the amino acid sequence of SEQ ID NO:12 and a LC having the amino acid sequence of SEQ ID NO: 13. Preferably the mammalian cell comprises a DNA molecule comprising a polynucleotide sequence encoding a polypeptide having the amino acid sequence of SEQ ID NO:12 and a polypeptide having the amino acid sequence SEQ ID NO: 13. The present invention also provides a mammalian cell comprising a DNA molecule comprising a polynucleotide sequence encoding a polypeptide having the amino acid sequence of SEQ ID NO:12 and/or a DNA molecule comprising a polynucleotide sequence encoding a polypeptide having the amino acid sequence of SEQ ID NO: 13, wherein the cell is capable of expressing an antibody comprising a HC having the amino acid sequence of SEQ ID NO:12 and a LC having the amino acid sequence of SEQ ID NO: 13. Preferably the mammalian cell comprises a DNA molecule comprising a polynucleotide sequence encoding a polypeptide having the amino acid sequence of SEQ ID NO:12 and a polypeptide having the amino acid sequence SEQ ID NO: 13. In an embodiment the mammalian cell line is a CHO or HEK cell line.
[0027] In another embodiment, the present invention provides a process for producing an antibody comprising a LCVR having an amino acid sequence of SEQ ID NO: 10 and a HCVR having an amino acid sequence of SEQ ID NO:9, wherein the process comprises cultivating a mammalian cell comprising a DNA encoding an LCVR having an amino acid sequence of SEQ ID NO: 10 and/or a DNA encoding an HCVR having an amino acid sequence of SEQ ID NO:9 under conditions such that the antibody is expressed, and recovering the expressed antibody. The invention includes an antibody obtainable by the process of the invention as described immediately above. The present invention also provides a process for producing an antibody comprising a LCVR having an amino acid sequence of SEQ ID NO: 11 and a HCVR having an amino acid sequence of SEQ ID NO:9, wherein the process comprises cultivating a mammalian cell comprising a DNA encoding an LCVR having an amino acid sequence of SEQ ID NO: 11 and/or a HCVR having an amino acid sequence of SEQ ID NO:9 under conditions such that the antibody is expressed, and recovering the expressed antibody. The invention includes an antibody obtainable by the process of the invention as described immediately above.
[0028] In another embodiment, the present invention provides a process for producing an antibody comprising a LC having an amino acid sequence of SEQ ID NO: 13 and a HC having an amino acid sequence of SEQ ID NO: 12, wherein the process comprises cultivating a mammalian cell comprising a DNA encoding a LC having an amino acid sequence of SEQ ID NO: 13 and/or a HC having an amino acid sequence of SEQ ID NO: 12 under conditions such that the antibody is expressed, and recovering the expressed antibody. The invention includes an antibody obtainable by the process of the invention as described immediately above. The present invention also provides a process for producing an antibody comprising a LC having an amino acid sequence of SEQ ID NO: 14 and a HC having an amino acid sequence of SEQ ID NO: 12, wherein the process comprises cultivating a mammalian cell comprising a DNA encoding a LC having an amino acid sequence of SEQ ID NO: 14 and/or a HC having an amino acid sequence of SEQ ID NO: 12 under conditions such that the antibody is expressed, and recovering the expressed antibody. The invention includes an antibody obtainable by the process of the invention as described immediately above.
[0029] The present invention includes a process for producing an antibody, which antibody comprises two HCs and two LCs, in which the amino sequence of each of the two HCs is SEQ ID NO: 12, and the amino acid sequence of each of the two LCs is SEQ ID NO: 13, and which process comprises: a) cultivating a mammalian cell of the invention, as described above, under conditions such that the antibody is expressed, and b) recovering the expressed antibody. The invention includes an antibody obtainable by the process of the invention as described immediately above. The present invention also includes a process for producing an antibody, which antibody comprises two HCs and two LCs, in which the amino sequence of each of the two HCs is SEQ ID NO: 12 and the amino acid sequence of each of the two LCs is SEQ ID NO: 14, and which process comprises: a) cultivating a mammalian cell of the invention, as described above, under conditions such that the antibody is expressed, and b) recovering the expressed antibody. The invention includes an antibody obtainable by the process of the invention as described immediately above.
[0030] The antibodies of the present invention bind to N3pGlu A.beta.. The sequence of N3pGlu A.beta. is the amino acid sequence of SEQ ID NO: 22, and carboxyl terminal variants thereof. Examples of a carboxyl terminal variants of N3pGlu A.beta. include A.beta..sub.p3-40 and A.beta..sub.p3-43.
[0031] As used herein, an "antibody" is an immunoglobulin molecule comprising two heavy chains (HC) and two light chains (LC) interconnected by disulfide bonds. The amino terminal portion of each LC and HC includes a variable region responsible for antigen recognition via the complementarity determining regions (CDRs) contained therein. The CDRs are interspersed with regions that are more conserved, termed framework regions. Assignment of amino acids to CDR domains within the LCVR and HCVR regions of the antibodies of the present invention is based on the well-known Kabat numbering convention (Kabat, et al., Ann. NY Acad. Sci. 190:382-93 (1971); Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242 (1991)), and North numbering convention (North et al., A New Clustering of Antibody CDR Loop Conformations, Journal of Molecular Biology, 406:228-256 (2011)).
[0032] The antibodies of the present invention include kappa LC and IgG HC. In a particular embodiment, the antibodies of the present invention are IgG1.
[0033] The antibodies of the present invention are monoclonal antibodies ("mAbs"). Monoclonal antibodies can be produced, for example, by hybridoma technologies, recombinant technologies, phage display technologies, synthetic technologies, e.g., CDR-grafting, or combinations of such or other technologies known in the art. In another embodiment of the present invention, the antibody, or the nucleic acid encoding the same, is provided in isolated form. As used herein, the term "isolated" refers to a protein, peptide or nucleic acid that is not found in nature and is free or substantially free from other macromolecular species found in a cellular environment. "Substantially free", as used herein, means the protein, peptide or nucleic acid of interest comprises more than 80% (on a molar basis) of the macromolecular species present, preferably more than 90% and more preferably more than 95%.
[0034] Following expression and secretion of the antibody, the medium is clarified to remove cells and the clarified media is purified using any of many commonly-used techniques. The purified antibody may be formulated into pharmaceutical compositions according to well-known methods for formulating proteins and antibodies for parenteral administration, particularly for subcutaneous, intrathecal, or intravenous administration. The antibody may be lyophilized, together with appropriate pharmaceutically-acceptable excipients, and then later reconstituted with a water-based diluent prior to use. Alternatively, the antibody may be formulated in an aqueous solution and stored for up to 1-3 years prior to use. In either case, the stored form and the injected form of the pharmaceutical compositions of the antibody will contain a pharmaceutically-acceptable excipient or excipients, which are ingredients other than the antibody. Whether an ingredient is pharmaceutically-acceptable depends on its effect on the safety and effectiveness or on the purity, and potency of the pharmaceutical composition. If an ingredient is judged to have a sufficiently unfavorable effect on safety or effectiveness (or on purity or potency) to warrant it not being used in a composition for administration to humans, then it is not pharmaceutically-acceptable to be used in a pharmaceutical composition of the antibody.
[0035] A pharmaceutical composition comprising an antibody of the present invention can be administered to a patient at risk for, or exhibiting, diseases or disorders as described herein by parental routes (e.g., subcutaneous, intravenous, intraperitoneal, intramuscular). Subcutaneous and intravenous routes are preferred. A pharmaceutical composition of the present invention contains an "effective" amount of an antibody of the present invention. An effective amount refers to an amount necessary (at dosages and for periods of time and for the means of administration) to achieve the desired therapeutic result. An effective amount of the antibody may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the antibody to elicit a desired response in the individual. An effective amount can be readily determined by the attending diagnostician or health care professional, as one skilled in the art, by using known techniques and by observing results. Frequency of dosing is dependent on actual pharmacokinetics and pharmacodynamics in humans. Duration of treatment will vary depending on many factors and it will be determined by the patient's diagnostician or treating health care provider, based on experience and skill in the art. Frequency and duration of treatment may vary by indication. The terms "treatment," "treating" or "to treat" and the like include restraining, slowing or stopping the progression or severity of an existing symptom, condition, disease, or disorder in a patient. The term "patient" refers to a human. The terms "prevent" and "preventing" means prophylactic administration of an antibody of the present invention to an asymptomatic patient in order to keep the patient from having symptoms or clinical features of neurodegenerative diseases such as AD.
[0036] The term "condition characterized by deposition of A.beta.," is a disease that is pathologically characterized by A.beta. deposits in the brain or in brain vasculature. This includes diseases such as Alzheimer's disease, Down's syndrome, and cerebral amyloid angiopathy. A clinical diagnosis, staging or progression of Alzheimer's disease can be readily determined by the attending diagnostician or health care professional, as one skilled in the art, by using known techniques and by observing results. This generally includes some form of brain plaque imagining, mental or cognitive assessment (e.g. Clinical Dementia Rating--summary of boxes (CDR-SB), Mini-Mental State Exam (MMSE) or Alzheimer's Disease Assessment Scale-Cognitive (ADAS-Cog)) or functional assessment (e.g. Alzheimer's Disease Cooperative Study-Activities of Daily Living (ADCS-ADL). "Clinical Alzheimer's disease" as used herein is a diagnosed stage of Alzheimer's disease. It includes conditions diagnosed as prodromal Alzheimer's disease, mild Alzheimer's disease, moderate Alzheimer's disease and severe Alzheimer's disease. The term "pre-clinical Alzheimer's disease" is a stage that precedes clinical Alzheimer's disease, where measurable changes in biomarkers (such as CSF A1342 levels or deposited brain plaque load by amyloid PET) indicate the earliest signs of a patient with Alzheimer's pathology, progressing to clinical Alzheimer's disease. This is usually before symptoms such as memory loss and confusion are noticeable.
[0037] The following Examples and assays demonstrate that the antibodies of the present invention are useful for treating a disease characterized by deposition of A.beta., such as of Alzheimer's disease, Down's syndrome, and CAA. It should be understood however, that the following Examples are set forth by way of illustration and not limitation, and that various modifications may be made by one of ordinary skill in the art.
EXAMPLES
Expression and Purification of Engineered N3pGlu A.beta. Antibodies
[0038] N3pGlu A.beta. antibodies of the present invention can be expressed and purified essentially as follows. A glutamine synthetase (GS) expression vector containing the DNA sequence encoding the LC amino acid sequence of SEQ ID NO: 13 or 14, and the DNA sequence encoding the HC amino acid sequence of SEQ ID NO: 12 is used to transfect a Chinese hamster ovary cell line (CHO) by electroporation. The expression vector encodes an SV Early (Simian Virus 40E) promoter and the gene for GS. Post-transfection, cells undergo bulk selection with 0-50 .mu.M L-methionine sulfoximine (MSX). Selected bulk cells or master wells are then scaled up in serum-free, suspension cultures to be used for production.
[0039] Clarified medium, into which the antibody has been secreted, is applied to a Protein A affinity column that has been equilibrated with a compatible buffer, such as phosphate buffered saline (pH 7.4). The column is washed with 1 M NaCl to remove nonspecific binding components. The bound N3pGlu A.beta. antibody is eluted, for example, with sodium citrate at pH (approx.) 3.5 and fractions are neutralized with 1 M Tris buffer. N3pGlu A.beta. antibody fractions are detected, such as by SDS-PAGE or analytical size-exclusion, and then are pooled. N3pGlu A.beta. antibody of the present invention is concentrated in either PBS buffer at pH 7.4 or 10 mM NaCitrate buffer, 150 mM NaCl at pH around 6. The final material can be sterile filtered using common techniques. The purity of N3pGlu A.beta. antibody is greater than 95%. An N3pGlu A.beta. antibody of the present invention may be immediately frozen at -70.degree. C. or stored at 4.degree. C. for several months. Amino acid SEQ ID NOs for exemplified antibodies of the present invention are shown below.
TABLE-US-00001 TABLE 1 Amino acid sequences of exemplified N3pGlu A.beta. antibodies. Antibody SEQ ID NOs Antibody Light Chain Heavy Chain LCVR HCVR 201c 13 12 10 9 201cYD 14 12 11 9 Antibody SEQ ID NOs Antibody LCDR1 LCDR2 LCDR3 201c 4 6 8 201cYD 5 7 8 Antibody SEQ ID NOs Antibody HCDR1 HCDR2 HCDR3 201c and 201cYD 1 2 3
Binding Kinetics and Avidity
[0040] The binding kinetics and avidity of N3pGlu A.beta. antibody to pE3-42 A.beta. peptide is measured by surface plasmon resonance using Biacore.RTM. 3000 (GE Healthcare). The binding avidity is measured by immobilizing about 120 RU pE3-42 A.beta. peptide via amine coupling on a Biacore.RTM. CM5 chip, and flowing N3pGlu A.beta. antibody, starting from 500 nM in 2-fold serial dilution down to 15.6 nM. The experiments are carried out at 25.degree. C. in HBS-EP buffer (GE Healthcare BR100669; 10 mM HEPES, 150 mM NaCl, 3 mM EDTA, 0.05% surfactant P20, pH 7.4). For each cycle, 250 .mu.L antibody sample is flowed through flow cell 1 and 2 at 50 .mu.l/min, and then dissociated for 10 minutes. The chip surface is regenerated with 5 .mu.L injection of glycine buffer at pH 1.5 at 10 .mu.L/mL flow rate. The data is fit to a 1:1 Langmiur binding model to derive k.sub.on, k.sub.off, and to calculate K.sub.D. Following procedures essentially as described above, the following parameters (shown in Table 2) were observed.
TABLE-US-00002 TABLE 2 Binding kinetics and avidity. Antibody k.sub.on (1/Ms) k.sub.off (1/s) K.sub.D (M) 201c Mean 1.64E+03 6.98E-05 4.57E-08 S.D. 3.88E+02 1.36E-05 2.06E-08 201cYD Mean 2.41E+03 6.39E-05 2.67E-08 S.D. 2.01E+02 2.15E-06 2.61E-09
[0041] These data demonstrate that the antibodies of the present invention bind pE3-42 A.beta..
Ex Vivo Target Engagement
[0042] To determine ex vivo target engagement on brain sections from a fixed PDAPP brain, immunohistochemical analysis is performed with exogenously added N3pGlu A.beta. antibodies of the present invention or the 201c H3B antibody. The 201c H3B antibody differs by one amino acid from the 201c antibody, and this difference is located in the heavy chain HCDR3 (Tyr at position 10 in 201c HCDR3 is Phe in 201c H3B). The 201c H3B antibody comprises a heavy chain amino acid sequence given by SEQ ID NO: 20 and a light chain amino acid sequence given by SEQ ID NO: 13.
[0043] Cryostat serial coronal sections from aged PDAPP mice (26 or 20-month old) are incubated with 5 .mu.g/mL or 20 .mu.g/mL of an exemplified N3pGlu A.beta. antibody of the present invention (201c or 201cYD). Secondary HRP reagents specific for human IgG are employed and the deposited plaques are visualized with DAB-Plus (DAKO). Biotinylated murine 3D6 antibody followed by Step-HRP secondary is used as a positive control.
[0044] The exemplified N3pGlu A.beta. antibodies of the present invention labeled deposited A.beta. in these brain sections. However, a higher background staining for the 201c H3B antibody at the exogenous 20 .mu.g/ml concentration was observed. These histological studies demonstrated that the exemplified N3pGlu A.beta. antibodies of the present invention engaged deposited A.beta. target ex vivo.
Ex Vivo Phagocytosis
[0045] An ex vivo phagocytosis assay is performed to investigate whether N3pGlu A.beta. antibodies of the present invention can facilitate microglial phagocytosis of plaque. Frozen sections from human Alzheimer's brain (20 .mu.m) are pre-incubated with 10 .mu.g/mL of an exemplified N3pGlu A.beta. antibody of the present invention (201c or 201cYD), controls, or the 201c H3B antibody for one hour at 37.degree. C. in 24-well plates. There are four wells per treatment. Primary murine microglia cells (8.times.10.sup.5; C57/BL6) are then added and incubated for 24 hours. Tissue in each well is homogenized in 5.2 M guanidine buffer and the A.beta..sub.1-42 content is evaluated by ELISA. Since the A.beta. content can vary over the span of multiple sections, a sister section control is implemented for every test well and the content of the test well is normalized to that of the sister section.
[0046] Compared to the positive control samples, exemplified N3pGlu A.beta. antibodies of the present invention (201c and 201cYD) and 201c H3B had significantly reduced A.beta..sub.1-42. The negative control samples had negligible clearance of deposited A.beta..sub.1-42. Therefore, ex vivo phagocytosis analyses show that exemplified N3pGlu A.beta. antibodies of the present invention can clear plaque ex vivo by phagocytosis.
In Vivo Target Engagement
[0047] The ability of N3pGlu A.beta. antibodies of the present invention to cross the blood-brain-barrier and bind to deposited plaque in vivo is measured. Aged PDAPP transgenic mice (18.5 to 32 months of age) are given intraperitoneal injections with N3pGlu A.beta. antibody (201c) or negative control IgG. Six mice per group receive one 40 mg/kg injection of antibody on day 1 and on day 3. In vivo target engagement is determined on day 6, when mice are sacrificed and brains are collected for histochemical analyses.
[0048] The extent of in vivo target engagement is quantified as the percent area positive for the in vivo N3pGlu A.beta. antibody engagement normalized to the total plaque area as defined by exogenous 3D6 antibody immunostaining on sister sections (TE Ratio). The TE Ratio is generated by measuring the percent of area bound by the antibody and normalizing the value against the total percent of area of possible target (total deposited A.beta. visualized by exogenous immunohistochemistry with a positive control antibody (3D6) on a sister section).
[0049] Following procedures essentially as described above, the 201c antibody had a TE Ratio of 2.8%. The 201c antibody demonstrated in vivo target engagement within the hippocampus and to a limited extent in the cortex, whereas the animals injected with control IgG show no plaque-specific staining.
In Vivo Plaque Clearance
[0050] Studies are performed with chimera surrogate antibodies with LCVR and HCVR of 201c or 201c H3B fused to murine constant kappa region and IgG2a Fc to evaluate in vivo plaque clearance in aged PDAPP mice. Aged PDAPP mice (21-months of age, n=23 to 25 per group) are injected subcutaneously once a week for 7 weeks with 12.5 mg/kg of chimera 201c antibody, chimera 201c H3B antibody, or control IgG. Control aged PDAPP mice (sacrificed at the onset of the study) are used to evaluate the levels of pre-existing deposition prior to therapeutic treatment.
[0051] At the conclusion of the study, final drug levels are measured in plasma, and brains are evaluated by ELISA for levels of A.beta..sub.1-42. The aged PDAPP mice are at the plaque ceiling as evidenced by a non-significant further accrual of A.beta..sub.1-42 over the 7-week treatment period with the control IgG. The 201c chimera antibody group and the 201c H3B chimera antibody group show significant reduction in A.beta..sub.1-42 (26%, p<0.0182 and 26%, p=0.0121, respectively) compared to control. Antibody exposure level was measured at the end of 7-week dosing period, and 201c chimera had a level of 91 .mu.g/mL, and 201c H3B had a level of 56 .mu.g/mL. This study demonstrated that the exemplified chimera N3pGlu A.beta. antibody 201c was able to lower plaque (A.beta..sub.1-42) in vivo.
Lack of Low Affinity Plasma Binding
[0052] In vitro studies are performed to investigate potential low-affinity interactions of anti-N3PG antibodies of the present invention (201c and 201cYD) with plasma proteins. Antibody 201c, 201cYD, or 201c H3B is covalently coupled to Sepharose beads and incubated with 10 mls of normal human plasma for 2 hours at 37.degree. C. before performing column chromatography. The bead/plasma mixture was packed into columns and washed. Selectively bound proteins are eluted with glycine (pH 2.5) in different fractions. Each fraction is then analyzed on high-resolution sodium dodecyl sulfate (SDS)--polyacrylamide gel electrophoresis (PAGE) gradient gels (4% to 16%). Silver stain is used to visualize the proteins and bands of interest were excised and analyzed by mass spectrometry. In parallel, multiple control human IgG1 antibodies are analyzed.
[0053] Following procedures essentially as described above, visualization of the silver stained gels demonstrated the presence of histidine rich glycoprotein (.about.64 kDa band), fibrinogen alpha-chain (.about.60 kDa band), and fibrinogen beta-chain (.about.50 kDa band) in fraction-5 from the 201c H3B antibody elution as compared to the control IgG1 antibodies. Conversely, the 201c and 201cYD antibodies lacked appreciable low affinity binding to human plasma proteins as compared to the control IgG and the 201c H3B antibody.
Ex Vivo T-Cell Proliferation EpiScreen Assay
[0054] An EpiScreen.RTM. ex vivo human T-cell assay is used to measure activation (proliferation, cytokine secretion) of human CD4+T cells in response to an exemplified N3pGlu A.beta. antibody of the present invention (201c) or the 201c H3B antibody. EpiScreen.RTM. utilizes samples from 50 healthy donors that best represent the number and frequency of HLA-DR and DQ allotypes expressed in the European/North American and world populations. Two positive controls are included in the assay: humanized A33, a clinical benchmark antibody that shows high levels of immunogenicity in the clinic (73%) and routinely induces 20-30% T-cell response in the EpiScreen.RTM. assay, and KLH (keyhole limpet hemocyanin), a mitogen-like protein containing neoantigens. A matched buffer negative control is also included in the assay.
[0055] The percent of T-cell proliferation is calculated from the average of all positive donor responses observed during the time course (days 5-8). The percent T-cell proliferation was 20% and 94% for the positive controls A33 and KLH, respectively, and was 24% for 201c H3B. However, the percent T-cell proliferation was 10% for 201c. These data demonstrate that the 201c antibody has a low T-cell response rate compared to positive controls and the 201c H3B antibody.
In Silico Immunogenicity Analysis
[0056] An EpiMatrix.RTM. assay scans protein sequences for potential T-cell epitopes and uses an algorithm to predict immunogenicity. It also considers Tregitope content and the effect on negatively regulating immunogenic response. The amino acid sequences of antibodies 201c, 201cYD, and B12L (antibody B12L comprises a heavy chain given by SEQ ID NO: 23 and a light chain given by SEQ ID NO: 24) were analyzed by EpiMatrix.RTM.. The EpiMatrix.RTM. predicted scores are shown below in Table 3.
TABLE-US-00003 TABLE 3 EpiMatrix .RTM. scores. EpiMatrix Tregitope-Adjusted Predicted T- Protein EpiMatrix Protein Dependent Antibody Score Score Ab Response 201c 39.14 -35.49 0.28% 201cYD 24.76 -49.87 0.00% B12L 0.44 -17.92 4.03%
[0057] These data demonstrate that the predicted T cell-dependent antibody response is lower for the N3pGlu A.beta. antibodies of the present invention (201c and 201cYD) as compared to the B12L antibody.
Lack of Anti-Drug Antibody (ADA) Recognition
[0058] An Affinity Capture Elution (ACE) Bridge assay using biotin and ruthenium labeled 201c or biotin and ruthenium labeled 201cYD is performed in order to assess whether anti-drug antibodies directed against the LY3002813 antibody could bind to 201c or 201cYD.
[0059] In this assay format, the ADA bridge between the two labeled antibodies (e.g. biotin and ruthenium labeled 201c). The complex then binds to a plate coated with streptavidin (via the biotin-labeled antibody) and the detection uses Ruthenium to generate signal in a Mesoscale platform. If the ADA does not recognize either the 201c or 201cYD antibody, no signal will be generated. Rabbit anti-human IgG most likely binds preferentially to the Fc, and is used as a positive control to show that labeled 201c or 201cYD could bind antibodies.
[0060] The antibodies directed against LY3002813 include antibodies affinity purified from two patient samples from a clinical trial (I5T-MC-AACC NCT01837641) after LY3002813 administration. These patients had developed ADA response for LY3002813 over time as shown by a positive binding signal in ACE bridge.
[0061] Following procedures essentially as described above, no signal was observed above background when detecting binding of either 201c or 201cYD to antibodies against LY3002813. These data demonstrate that ADA directed against LY3002813 in humans does not recognize 201c and 201cYD.
TABLE-US-00004 Sequences Antibody 201c, Antibody 201cYD, and Antibody 201c H3B HCDR1 (SEQ ID NO: 1) AASGFTFSSYPMS Antibody 201c, Antibody 201cYD, and Antibody 201c H3B HCDR2 (SEQ ID NO: 2) AISGSGGSTYYADSVKG Antibody 201c and Antibody 201cYD HCDR3 (SEQ ID NO: 3) AREGGSGSYYNGFDY Antibody 201c and Antibody 201c H3B LCDR1 (SEQ ID NO: 4) RASQSLGNWLA Antibody 201cYD LCDR1 (SEQ ID NO: 5) RASQSLGNYLA Antibody 201c and Antibody 201c H3B LCDR2 (SEQ ID NO: 6) YQASTLES Antibody 201cYD LCDR2 (SEQ ID NO: 7) YDASTLES Antibody 201c, Antibody 201cYD, and Antibody 201c H3B LCDR3 (SEQ ID NO: 8) QHYKGSFWT Antibody 201c and Antibody 201cYD HCVR (SEQ ID NO: 9) EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYPMSWVRQAPGKGLEWVSAISGS GGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREGGSGSYYN GFDYWGQGTLVTVSS Antibody 201c and Antibody 201c H3B LCVR (SEQ ID NO: 10) DIQMTQSPSTLSASVGDRVTITCRASQSLGNWLAWYQQKPGKAPKLLIYQASTLE SGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQHYKGSFWTFGQGTKVEIK Antibody 201cYD LCVR (SEQ ID NO: 11) DIQMTQSPSTLSASVGDRVTITCRASQSLGNYLAWYQQKPGKAPKLLIYDASTLE SGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQHYKGSFWTFGQGTKVEIK Antibody 201c and Antibody 201cYD Heavy Chain (SEQ ID NO: 12) EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYPMSWVRQAPGKGLEWVSAISGS GGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREGGSGSYYN GFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVD KKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSD IAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE ALHNHYTQKSLSLSPG Antibody 201c and Antibody 201c H3B Light Chain (SEQ ID NO: 13) DIQMTQSPSTLSASVGDRVTITCRASQSLGNWLAWYQQKPGKAPKLLIYQASTLE SGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQHYKGSFWTFGQGTKVEIKRTVA APSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQ DSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Antibody 201cYD Light Chain (SEQ ID NO: 14) DIQMTQSPSTLSASVGDRVTITCRASQSLGNYLAWYQQKPGKAPKWYDASTLE SGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQHYKGSFWTFGQGTKVEIKRTVA APSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQ DSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Exemplified DNA for Expressing Antibody Heavy Chain of SEQ ID NO: 12 (SEQ ID NO: 15) gaggtgcagctgttggagtctgggggaggcttggtacagcctggggggtccctgagactctcctgtgcagcctc- tggattcacct ttagcagctatcctatgagctgggtccgccaggctccagggaaggggctggagtgggtctcagctattagtggt- agtggtggtag cacatactacgcagactccgtgaagggccggttcaccatctccagagacaattccaagaacacgctgtatctgc- aaatgaacag cctgagagccgaggacacggccgtatattactgtgcgagagaggggggctcagggagttattataacggctttg- attattgggg ccagggaaccctggtcaccgtctcctcagcctccaccaagggcccatcggtcttcccgctagcaccctcctcca- agagcacctc tgggggcacagcggccctgggctgcctggtcaaggactacttccccgaaccggtgacggtgtcgtggaactcag- gcgccctg accagcggcgtgcacaccttcccggctgtcctacagtcctcaggactctactccctcagcagcgtggtgaccgt- gccctccagc agcttgggcacccagacctacatctgcaacgtgaatcacaagcccagcaacaccaaggtggacaagaaagttga- gcccaaatc ttgtgacaaaactcacacatgcccaccgtgcccagcacctgaactcctggggggaccgtcagtcttcctcttcc- ccccaaaaccc aaggacaccctcatgatctcccggacccctgaggtcacatgcgtggtggtggacgtgagccacgaagaccctga- ggtcaagtt caactggtacgtggacggcgtggaggtgcataatgccaagacaaagccgcgggaggagcagtacaacagcacgt- accgtgt ggtcagcgtcctcaccgtcctgcaccaggactggctgaatggcaaggagtacaagtgcaaggtctccaacaaag- ccctcccag cccccatcgagaaaaccatctccaaagccaaagggcagccccgagaaccacaggtgtacaccctgcccccatcc- cgggacg agctgaccaagaaccaggtcagcctgacctgcctggtcaaaggcttctatcccagcgacatcgccgtggagtgg- gagagcaat gggcagccggagaacaactacaagaccacgccccccgtgctggactccgacggctccttcttcctctatagcaa- gctcaccgtg gacaagagcaggtggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctgcacaaccactacac- gcagaagag cctctccctgtctccgggt Exemplified DNA for Expressing Antibody Light Chain of SEQ ID NO: 13 (SEQ ID NO: 16) gacatccagatgacccagtctccttccaccctgtctgcatctgtaggagacagagtcaccatcacttgccgggc- cagtcagagtct tggtaactggttggcctggtatcagcagaaaccagggaaagcccctaaactcctgatctatcaggcgtctactt- tagaatctgggg tcccatcaagattcagcggcagtggatctgggacagagttcactctcaccatcagcagcctgcagcctgatgat- tttgcaacttatt actgccaacattataaaggttctttttggacgttcggccaagggaccaaggtggaaatcaaacggaccgtggct- gcaccatctgtc ttcatcttcccgccatctgatgagcagttgaaatctggaactgcctctgttgtgtgcctgctgaataacttcta- tcccagagaggcca aagtacagtggaaggtggataacgccctccaatcgggtaactcccaggagagtgtcacagagcaggacagcaag- gacagca cctacagcctcagcagcaccctgacgctgagcaaagcagactacgagaaacacaaagtctacgcctgcgaagtc- acccatca gggcctgagctcgcccgtcacaaagagcttcaacaggggagagtgc Exemplified DNA for Expressing Antibody Light Chain of SEQ ID NO: 14 (SEQ ID NO: 17) gacatccagatgacccagtctccttccaccctgtctgcatctgtaggagacagagtcaccatcacttgccgggc- cagtcagagtct tggtaactatttggcctggtatcagcagaaaccagggaaagcccctaaactcctgatctatgatgcgtctactt- tagaatctggggt cccatcaagattcagcggcagtggatctgggacagagttcactctcaccatcagcagcctgcagcctgatgatt- ttgcaacttatta ctgccaacattataaaggttctttttggacgttcggccaagggaccaaggtggaaatcaaacggaccgtggctg- caccatctgtct tcatcttcccgccatctgatgagcagttgaaatctggaactgcctctgttgtgtgcctgctgaataacttctat- cccagagaggccaa agtacagtggaaggtggataacgccctccaatcgggtaactcccaggagagtgtcacagagcaggacagcaagg- acagcac ctacagcctcagcagcaccctgacgctgagcaaagcagactacgagaaacacaaagtctacgcctgcgaagtca- cccatcag ggcctgagctcgcccgtcacaaagagcttcaacaggggagagtgc Antibody 201c H3B HCDR3 (SEQ ID NO: 18) AREGGSGSYFNGFDY Antibody 201c H3B HCVR (SEQ ID NO: 19) EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYPMSWVRQAPGKGLEWVSAISGS GGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREGGSGSYFNG FDYWGQGTLVTVSS Antibody 201c H3B Heavy Chain (SEQ ID NO: 20) EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYPMSWVRQAPGKGLEWVSAISGS GGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREGGSGSYFNG FDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDI AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE ALHNHYTQKSLSLSPG Exemplified DNA for Expressing Antibody Heavy Chain of SEQ ID NO: 20 (SEQ ID NO: 21) gaggtgcagctgttggagtctgggggaggcttggtacagcctggggggtccctgagactctcctgtgcagcctc- tggattcacct ttagcagctatcctatgagctgggtccgccaggctccagggaaggggctggagtgggtctcagctattagtggt- agtggtggtag cacatactacgcagactccgtgaagggccggttcaccatctccagagacaattccaagaacacgctgtatctgc- aaatgaacag cctgagagccgaggacacggccgtatattactgtgcgagagaggggggctcagggagttattttaacggctttg- attattggggc cagggaaccctggtcaccgtctcctcagcctccaccaagggcccatcggtcttcccgctagcaccctcctccaa- gagcacctct gggggcacagcggccctgggctgcctggtcaaggactacttccccgaaccggtgacggtgtcgtggaactcagg- cgccctga ccagcggcgtgcacaccttcccggctgtcctacagtcctcaggactctactccctcagcagcgtggtgaccgtg- ccctccagca
gcttgggcacccagacctacatctgcaacgtgaatcacaagcccagcaacaccaaggtggacaagaaagttgag- cccaaatct tgtgacaaaactcacacatgcccaccgtgcccagcacctgaactcctggggggaccgtcagtcttcctcttccc- cccaaaaccca aggacaccctcatgatctcccggacccctgaggtcacatgcgtggtggtggacgtgagccacgaagaccctgag- gtcaagttc aactggtacgtggacggcgtggaggtgcataatgccaagacaaagccgcgggaggagcagtacaacagcacgta- ccgtgtg gtcagcgtcctcaccgtcctgcaccaggactggctgaatggcaaggagtacaagtgcaaggtctccaacaaagc- cctcccagc ccccatcgagaaaaccatctccaaagccaaagggcagccccgagaaccacaggtgtacaccctgcccccatccc- gggacga gctgaccaagaaccaggtcagcctgacctgcctggtcaaaggcttctatcccagcgacatcgccgtggagtggg- agagcaatg ggcagccggagaacaactacaagaccacgccccccgtgctggactccgacggctccttcttcctctatagcaag- ctcaccgtgg acaagagcaggtggcagcaggggaacgtcttctcatgctccgtgatgcatgaggctctgcacaaccactacacg- cagaagagc ctctccctgtctccgggt N3pGlu A.beta. (SEQ ID NO: 22) [pE]FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA Antibody B12L Heavy Chain (SEQ ID NO: 23) QVQLVQSGAEVKKPGSSVKVSCKASGYDFTRYYINWVRQAPGQGLEWMGWINP GSGNTKYNEKFKGRVTITADESTSTAYMELSSLRSEDTAVYYCAREGITVYWGQ GTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALT SGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS CDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWES NGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHY TQKSLSLSPG Antibody B12L Light Chain (SEQ ID NO: 24) DIVMTQTPLSLSVTPGQPASISCKSSQSLLYSRGKTYLNWLLQKPGQSPQLLIYAV SKLDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCVQGTHYPFTFGQGTKLEI KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Sequence CWU
1
1
24113PRTArtificial SequenceSynthetic construct 1Ala Ala Ser Gly Phe Thr
Phe Ser Ser Tyr Pro Met Ser1 5
10217PRTArtificial SequenceSynthetic construct 2Ala Ile Ser Gly Ser Gly
Gly Ser Thr Tyr Tyr Ala Asp Ser Val Lys1 5
10 15Gly315PRTArtificial SequenceSynthetic Construct
3Ala Arg Glu Gly Gly Ser Gly Ser Tyr Tyr Asn Gly Phe Asp Tyr1
5 10 15411PRTArtificial
SequenceSynthetic Construct 4Arg Ala Ser Gln Ser Leu Gly Asn Trp Leu Ala1
5 10511PRTArtificial SequenceSynthetic
Construct 5Arg Ala Ser Gln Ser Leu Gly Asn Tyr Leu Ala1 5
1068PRTArtificial SequenceSynthetic Construct 6Tyr Gln
Ala Ser Thr Leu Glu Ser1 578PRTArtificial SequenceSynthetic
Construct 7Tyr Asp Ala Ser Thr Leu Glu Ser1
589PRTArtificial SequenceSynthetic Construct 8Gln His Tyr Lys Gly Ser Phe
Trp Thr1 59122PRTArtificial SequenceSynthetic Construct
9Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15Ser Leu Arg Leu Ser Cys
Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25
30Pro Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu
Glu Trp Val 35 40 45Ser Ala Ile
Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50
55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys
Asn Thr Leu Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Arg Glu Gly Gly Ser
Gly Ser Tyr Tyr Asn Gly Phe Asp Tyr Trp 100
105 110Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115
12010107PRTArtificial SequenceSynthetic Construct 10Asp
Ile Gln Met Thr Gln Ser Pro Ser Thr Leu Ser Ala Ser Val Gly1
5 10 15Asp Arg Val Thr Ile Thr Cys
Arg Ala Ser Gln Ser Leu Gly Asn Trp 20 25
30Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu
Leu Ile 35 40 45Tyr Gln Ala Ser
Thr Leu Glu Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55
60Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Ser
Leu Gln Pro65 70 75
80Asp Asp Phe Ala Thr Tyr Tyr Cys Gln His Tyr Lys Gly Ser Phe Trp
85 90 95Thr Phe Gly Gln Gly Thr
Lys Val Glu Ile Lys 100 10511107PRTArtificial
SequenceSynthetic Construct 11Asp Ile Gln Met Thr Gln Ser Pro Ser Thr Leu
Ser Ala Ser Val Gly1 5 10
15Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Leu Gly Asn Tyr
20 25 30Leu Ala Trp Tyr Gln Gln Lys
Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40
45Tyr Asp Ala Ser Thr Leu Glu Ser Gly Val Pro Ser Arg Phe Ser
Gly 50 55 60Ser Gly Ser Gly Thr Glu
Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70
75 80Asp Asp Phe Ala Thr Tyr Tyr Cys Gln His Tyr
Lys Gly Ser Phe Trp 85 90
95Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys 100
10512451PRTArtificial SequenceSynthetic Construct 12Glu Val Gln Leu
Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Phe Thr Phe Ser Ser Tyr 20 25
30Pro Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45Ser Ala Ile Ser Gly Ser Gly Gly
Ser Thr Tyr Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65
70 75 80Leu Gln Met Asn Ser
Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85
90 95Ala Arg Glu Gly Gly Ser Gly Ser Tyr Tyr Asn
Gly Phe Asp Tyr Trp 100 105
110Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro
115 120 125Ser Val Phe Pro Leu Ala Pro
Ser Ser Lys Ser Thr Ser Gly Gly Thr 130 135
140Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val
Thr145 150 155 160Val Ser
Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro
165 170 175Ala Val Leu Gln Ser Ser Gly
Leu Tyr Ser Leu Ser Ser Val Val Thr 180 185
190Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn
Val Asn 195 200 205His Lys Pro Ser
Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser 210
215 220Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala
Pro Glu Leu Leu225 230 235
240Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu
245 250 255Met Ile Ser Arg Thr
Pro Glu Val Thr Cys Val Val Val Asp Val Ser 260
265 270His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val
Asp Gly Val Glu 275 280 285Val His
Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr 290
295 300Tyr Arg Val Val Ser Val Leu Thr Val Leu His
Gln Asp Trp Leu Asn305 310 315
320Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro
325 330 335Ile Glu Lys Thr
Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln 340
345 350Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu
Thr Lys Asn Gln Val 355 360 365Ser
Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val 370
375 380Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn
Asn Tyr Lys Thr Thr Pro385 390 395
400Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu
Thr 405 410 415Val Asp Lys
Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val 420
425 430Met His Glu Ala Leu His Asn His Tyr Thr
Gln Lys Ser Leu Ser Leu 435 440
445Ser Pro Gly 45013214PRTArtificial SequenceSynthetic Construct 13Asp
Ile Gln Met Thr Gln Ser Pro Ser Thr Leu Ser Ala Ser Val Gly1
5 10 15Asp Arg Val Thr Ile Thr Cys
Arg Ala Ser Gln Ser Leu Gly Asn Trp 20 25
30Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu
Leu Ile 35 40 45Tyr Gln Ala Ser
Thr Leu Glu Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55
60Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Ser
Leu Gln Pro65 70 75
80Asp Asp Phe Ala Thr Tyr Tyr Cys Gln His Tyr Lys Gly Ser Phe Trp
85 90 95Thr Phe Gly Gln Gly Thr
Lys Val Glu Ile Lys Arg Thr Val Ala Ala 100
105 110Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln
Leu Lys Ser Gly 115 120 125Thr Ala
Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala 130
135 140Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln
Ser Gly Asn Ser Gln145 150 155
160Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser
165 170 175Ser Thr Leu Thr
Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr 180
185 190Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser
Pro Val Thr Lys Ser 195 200 205Phe
Asn Arg Gly Glu Cys 21014214PRTArtificial SequenceSynthetic Construct
14Asp Ile Gln Met Thr Gln Ser Pro Ser Thr Leu Ser Ala Ser Val Gly1
5 10 15Asp Arg Val Thr Ile Thr
Cys Arg Ala Ser Gln Ser Leu Gly Asn Tyr 20 25
30Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys
Leu Leu Ile 35 40 45Tyr Asp Ala
Ser Thr Leu Glu Ser Gly Val Pro Ser Arg Phe Ser Gly 50
55 60Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser
Ser Leu Gln Pro65 70 75
80Asp Asp Phe Ala Thr Tyr Tyr Cys Gln His Tyr Lys Gly Ser Phe Trp
85 90 95Thr Phe Gly Gln Gly Thr
Lys Val Glu Ile Lys Arg Thr Val Ala Ala 100
105 110Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln
Leu Lys Ser Gly 115 120 125Thr Ala
Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala 130
135 140Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln
Ser Gly Asn Ser Gln145 150 155
160Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser
165 170 175Ser Thr Leu Thr
Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr 180
185 190Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser
Pro Val Thr Lys Ser 195 200 205Phe
Asn Arg Gly Glu Cys 210151353DNAArtificial SequenceSynthetic Construct
15gaggtgcagc tgttggagtc tgggggaggc ttggtacagc ctggggggtc cctgagactc
60tcctgtgcag cctctggatt cacctttagc agctatccta tgagctgggt ccgccaggct
120ccagggaagg ggctggagtg ggtctcagct attagtggta gtggtggtag cacatactac
180gcagactccg tgaagggccg gttcaccatc tccagagaca attccaagaa cacgctgtat
240ctgcaaatga acagcctgag agccgaggac acggccgtat attactgtgc gagagagggg
300ggctcaggga gttattataa cggctttgat tattggggcc agggaaccct ggtcaccgtc
360tcctcagcct ccaccaaggg cccatcggtc ttcccgctag caccctcctc caagagcacc
420tctgggggca cagcggccct gggctgcctg gtcaaggact acttccccga accggtgacg
480gtgtcgtgga actcaggcgc cctgaccagc ggcgtgcaca ccttcccggc tgtcctacag
540tcctcaggac tctactccct cagcagcgtg gtgaccgtgc cctccagcag cttgggcacc
600cagacctaca tctgcaacgt gaatcacaag cccagcaaca ccaaggtgga caagaaagtt
660gagcccaaat cttgtgacaa aactcacaca tgcccaccgt gcccagcacc tgaactcctg
720gggggaccgt cagtcttcct cttcccccca aaacccaagg acaccctcat gatctcccgg
780acccctgagg tcacatgcgt ggtggtggac gtgagccacg aagaccctga ggtcaagttc
840aactggtacg tggacggcgt ggaggtgcat aatgccaaga caaagccgcg ggaggagcag
900tacaacagca cgtaccgtgt ggtcagcgtc ctcaccgtcc tgcaccagga ctggctgaat
960ggcaaggagt acaagtgcaa ggtctccaac aaagccctcc cagcccccat cgagaaaacc
1020atctccaaag ccaaagggca gccccgagaa ccacaggtgt acaccctgcc cccatcccgg
1080gacgagctga ccaagaacca ggtcagcctg acctgcctgg tcaaaggctt ctatcccagc
1140gacatcgccg tggagtggga gagcaatggg cagccggaga acaactacaa gaccacgccc
1200cccgtgctgg actccgacgg ctccttcttc ctctatagca agctcaccgt ggacaagagc
1260aggtggcagc aggggaacgt cttctcatgc tccgtgatgc atgaggctct gcacaaccac
1320tacacgcaga agagcctctc cctgtctccg ggt
135316642DNAArtificial SequenceSynthetic Construct 16gacatccaga
tgacccagtc tccttccacc ctgtctgcat ctgtaggaga cagagtcacc 60atcacttgcc
gggccagtca gagtcttggt aactggttgg cctggtatca gcagaaacca 120gggaaagccc
ctaaactcct gatctatcag gcgtctactt tagaatctgg ggtcccatca 180agattcagcg
gcagtggatc tgggacagag ttcactctca ccatcagcag cctgcagcct 240gatgattttg
caacttatta ctgccaacat tataaaggtt ctttttggac gttcggccaa 300gggaccaagg
tggaaatcaa acggaccgtg gctgcaccat ctgtcttcat cttcccgcca 360tctgatgagc
agttgaaatc tggaactgcc tctgttgtgt gcctgctgaa taacttctat 420cccagagagg
ccaaagtaca gtggaaggtg gataacgccc tccaatcggg taactcccag 480gagagtgtca
cagagcagga cagcaaggac agcacctaca gcctcagcag caccctgacg 540ctgagcaaag
cagactacga gaaacacaaa gtctacgcct gcgaagtcac ccatcagggc 600ctgagctcgc
ccgtcacaaa gagcttcaac aggggagagt gc
64217642DNAArtificial SequenceSynthetic Construct 17gacatccaga tgacccagtc
tccttccacc ctgtctgcat ctgtaggaga cagagtcacc 60atcacttgcc gggccagtca
gagtcttggt aactatttgg cctggtatca gcagaaacca 120gggaaagccc ctaaactcct
gatctatgat gcgtctactt tagaatctgg ggtcccatca 180agattcagcg gcagtggatc
tgggacagag ttcactctca ccatcagcag cctgcagcct 240gatgattttg caacttatta
ctgccaacat tataaaggtt ctttttggac gttcggccaa 300gggaccaagg tggaaatcaa
acggaccgtg gctgcaccat ctgtcttcat cttcccgcca 360tctgatgagc agttgaaatc
tggaactgcc tctgttgtgt gcctgctgaa taacttctat 420cccagagagg ccaaagtaca
gtggaaggtg gataacgccc tccaatcggg taactcccag 480gagagtgtca cagagcagga
cagcaaggac agcacctaca gcctcagcag caccctgacg 540ctgagcaaag cagactacga
gaaacacaaa gtctacgcct gcgaagtcac ccatcagggc 600ctgagctcgc ccgtcacaaa
gagcttcaac aggggagagt gc 6421815PRTArtificial
SequenceSynthetic Construct 18Ala Arg Glu Gly Gly Ser Gly Ser Tyr Phe Asn
Gly Phe Asp Tyr1 5 10
1519122PRTArtificial SequenceSynthetic Construct 19Glu Val Gln Leu Leu
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe
Thr Phe Ser Ser Tyr 20 25
30Pro Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45Ser Ala Ile Ser Gly Ser Gly Gly
Ser Thr Tyr Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65
70 75 80Leu Gln Met Asn Ser
Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85
90 95Ala Arg Glu Gly Gly Ser Gly Ser Tyr Phe Asn
Gly Phe Asp Tyr Trp 100 105
110Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115
12020451PRTArtificial SequenceSynthetic Construct 20Glu Val Gln Leu Leu
Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5
10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe
Thr Phe Ser Ser Tyr 20 25
30Pro Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45Ser Ala Ile Ser Gly Ser Gly Gly
Ser Thr Tyr Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65
70 75 80Leu Gln Met Asn Ser
Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85
90 95Ala Arg Glu Gly Gly Ser Gly Ser Tyr Phe Asn
Gly Phe Asp Tyr Trp 100 105
110Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro
115 120 125Ser Val Phe Pro Leu Ala Pro
Ser Ser Lys Ser Thr Ser Gly Gly Thr 130 135
140Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val
Thr145 150 155 160Val Ser
Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro
165 170 175Ala Val Leu Gln Ser Ser Gly
Leu Tyr Ser Leu Ser Ser Val Val Thr 180 185
190Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn
Val Asn 195 200 205His Lys Pro Ser
Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser 210
215 220Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala
Pro Glu Leu Leu225 230 235
240Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu
245 250 255Met Ile Ser Arg Thr
Pro Glu Val Thr Cys Val Val Val Asp Val Ser 260
265 270His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val
Asp Gly Val Glu 275 280 285Val His
Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr 290
295 300Tyr Arg Val Val Ser Val Leu Thr Val Leu His
Gln Asp Trp Leu Asn305 310 315
320Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro
325 330 335Ile Glu Lys Thr
Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln 340
345 350Val Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu
Thr Lys Asn Gln Val 355 360 365Ser
Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val 370
375 380Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn
Asn Tyr Lys Thr Thr Pro385 390 395
400Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu
Thr 405 410 415Val Asp Lys
Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val 420
425 430Met His Glu Ala Leu His Asn His Tyr Thr
Gln Lys Ser Leu Ser Leu 435 440
445Ser Pro Gly 450211353DNAArtificial SequenceSynthetic Construct
21gaggtgcagc tgttggagtc tgggggaggc ttggtacagc ctggggggtc cctgagactc
60tcctgtgcag cctctggatt cacctttagc agctatccta tgagctgggt ccgccaggct
120ccagggaagg ggctggagtg ggtctcagct attagtggta gtggtggtag cacatactac
180gcagactccg tgaagggccg gttcaccatc tccagagaca attccaagaa cacgctgtat
240ctgcaaatga acagcctgag agccgaggac acggccgtat attactgtgc gagagagggg
300ggctcaggga gttattttaa cggctttgat tattggggcc agggaaccct ggtcaccgtc
360tcctcagcct ccaccaaggg cccatcggtc ttcccgctag caccctcctc caagagcacc
420tctgggggca cagcggccct gggctgcctg gtcaaggact acttccccga accggtgacg
480gtgtcgtgga actcaggcgc cctgaccagc ggcgtgcaca ccttcccggc tgtcctacag
540tcctcaggac tctactccct cagcagcgtg gtgaccgtgc cctccagcag cttgggcacc
600cagacctaca tctgcaacgt gaatcacaag cccagcaaca ccaaggtgga caagaaagtt
660gagcccaaat cttgtgacaa aactcacaca tgcccaccgt gcccagcacc tgaactcctg
720gggggaccgt cagtcttcct cttcccccca aaacccaagg acaccctcat gatctcccgg
780acccctgagg tcacatgcgt ggtggtggac gtgagccacg aagaccctga ggtcaagttc
840aactggtacg tggacggcgt ggaggtgcat aatgccaaga caaagccgcg ggaggagcag
900tacaacagca cgtaccgtgt ggtcagcgtc ctcaccgtcc tgcaccagga ctggctgaat
960ggcaaggagt acaagtgcaa ggtctccaac aaagccctcc cagcccccat cgagaaaacc
1020atctccaaag ccaaagggca gccccgagaa ccacaggtgt acaccctgcc cccatcccgg
1080gacgagctga ccaagaacca ggtcagcctg acctgcctgg tcaaaggctt ctatcccagc
1140gacatcgccg tggagtggga gagcaatggg cagccggaga acaactacaa gaccacgccc
1200cccgtgctgg actccgacgg ctccttcttc ctctatagca agctcaccgt ggacaagagc
1260aggtggcagc aggggaacgt cttctcatgc tccgtgatgc atgaggctct gcacaaccac
1320tacacgcaga agagcctctc cctgtctccg ggt
13532240PRTArtificial SequenceSynthetic ConstructMISC_FEATURE(1)..(1)Xaa
at position 1 = pyroglutamic acid 22Xaa Phe Arg His Asp Ser Gly Tyr Glu
Val His His Gln Lys Leu Val1 5 10
15Phe Phe Ala Glu Asp Val Gly Ser Asn Lys Gly Ala Ile Ile Gly
Leu 20 25 30Met Val Gly Gly
Val Val Ile Ala 35 4023444PRTArtificial
SequenceSynthetic 23Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys
Pro Gly Ser1 5 10 15Ser
Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Asp Phe Thr Arg Tyr 20
25 30Tyr Ile Asn Trp Val Arg Gln Ala
Pro Gly Gln Gly Leu Glu Trp Met 35 40
45Gly Trp Ile Asn Pro Gly Ser Gly Asn Thr Lys Tyr Asn Glu Lys Phe
50 55 60Lys Gly Arg Val Thr Ile Thr Ala
Asp Glu Ser Thr Ser Thr Ala Tyr65 70 75
80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val
Tyr Tyr Cys 85 90 95Ala
Arg Glu Gly Ile Thr Val Tyr Trp Gly Gln Gly Thr Thr Val Thr
100 105 110Val Ser Ser Ala Ser Thr Lys
Gly Pro Ser Val Phe Pro Leu Ala Pro 115 120
125Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu
Val 130 135 140Lys Asp Tyr Phe Pro Glu
Pro Val Thr Val Ser Trp Asn Ser Gly Ala145 150
155 160Leu Thr Ser Gly Val His Thr Phe Pro Ala Val
Leu Gln Ser Ser Gly 165 170
175Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly
180 185 190Thr Gln Thr Tyr Ile Cys
Asn Val Asn His Lys Pro Ser Asn Thr Lys 195 200
205Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His
Thr Cys 210 215 220Pro Pro Cys Pro Ala
Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu225 230
235 240Phe Pro Pro Lys Pro Lys Asp Thr Leu Met
Ile Ser Arg Thr Pro Glu 245 250
255Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys
260 265 270Phe Asn Trp Tyr Val
Asp Gly Val Glu Val His Asn Ala Lys Thr Lys 275
280 285Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val
Val Ser Val Leu 290 295 300Thr Val Leu
His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys305
310 315 320Val Ser Asn Lys Ala Leu Pro
Ala Pro Ile Glu Lys Thr Ile Ser Lys 325
330 335Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr
Leu Pro Pro Ser 340 345 350Arg
Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys 355
360 365Gly Phe Tyr Pro Ser Asp Ile Ala Val
Glu Trp Glu Ser Asn Gly Gln 370 375
380Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly385
390 395 400Ser Phe Phe Leu
Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln 405
410 415Gln Gly Asn Val Phe Ser Cys Ser Val Met
His Glu Ala Leu His Asn 420 425
430His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 435
44024219PRTArtificial SequenceSynthetic 24Asp Ile Val Met Thr Gln
Thr Pro Leu Ser Leu Ser Val Thr Pro Gly1 5
10 15Gln Pro Ala Ser Ile Ser Cys Lys Ser Ser Gln Ser
Leu Leu Tyr Ser 20 25 30Arg
Gly Lys Thr Tyr Leu Asn Trp Leu Leu Gln Lys Pro Gly Gln Ser 35
40 45Pro Gln Leu Leu Ile Tyr Ala Val Ser
Lys Leu Asp Ser Gly Val Pro 50 55
60Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile65
70 75 80Ser Arg Val Glu Ala
Glu Asp Val Gly Val Tyr Tyr Cys Val Gln Gly 85
90 95Thr His Tyr Pro Phe Thr Phe Gly Gln Gly Thr
Lys Leu Glu Ile Lys 100 105
110Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu
115 120 125Gln Leu Lys Ser Gly Thr Ala
Ser Val Val Cys Leu Leu Asn Asn Phe 130 135
140Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu
Gln145 150 155 160Ser Gly
Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser
165 170 175Thr Tyr Ser Leu Ser Ser Thr
Leu Thr Leu Ser Lys Ala Asp Tyr Glu 180 185
190Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu
Ser Ser 195 200 205Pro Val Thr Lys
Ser Phe Asn Arg Gly Glu Cys 210 215
User Contributions:
Comment about this patent or add new information about this topic: