Patent application title: GLYCOALKALOID METABOLISM ENYZYMES (GAMES) AND USES THEREOF
Inventors:
IPC8 Class: AC12N1582FI
USPC Class:
1 1
Class name:
Publication date: 2019-12-05
Patent application number: 20190367940
Abstract:
Disclosed herein are genetically modified plants having altered
biological activity of 3-.beta.-hydroxysteroid dehydrogenase/isomerase
(GAME25), or 2-oxoglutarate-dependent dioxygenase (GAME31), or a
combination thereof, wherein the genetically modified plants have an
altered content of at least one cholesterol derived compound selected
from the group including a steroidal alkaloid or a glycosylated
derivative thereof and an unsaturated or saturated steroidal saponin or a
glycoside derivative thereof. Further disclosed herein are genetically
modified plants having altered expression of a gene encoding a
3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), or a
2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof,
wherein the genetically modified plant has an altered content of at least
one cholesterol derived compound selected from the group including a
steroidal alkaloid or a glycosylated derivative thereof and an
unsaturated or saturated steroidal saponin or a glycoside derivative
thereof. Methods of producing these genetically modified plants are also
disclosed.Claims:
1. A genetically modified plant comprising an altered content of at least
one cholesterol derived compound selected from the group comprising a
steroidal alkaloid or a glycosylated derivative thereof, and an
unsaturated or saturated steroidal saponin or a glycoside derivative
thereof, said plant comprising at least one cell having an altered
biological activity of at least one enzyme selected from the group
comprising a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) and
a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination
thereof; or an altered expression of at least one gene selected from the
group comprising a gene encoding a 3-p-hydroxysteroid
dehydrogenase/isomerase (GAME25) and a gene encoding a
2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof;
or a combination thereof of an altered biological activity of at least
one enzyme selected from the group comprising a 3-.beta.-hydroxysteroid
dehydrogenase/isomerase (GAME25) and a 2-oxoglutarate-dependent
dioxygenase (GAME31), or a combination thereof, and an altered expression
of at least one gene selected from the group comprising a gene encoding a
3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) and a gene
encoding a 2-oxoglutarate-dependent dioxygenase (GAME31), or a
combination thereof; wherein said altered expression of said at least one
gene selected from GAME25 or GAME 31 comprises a reduced or inhibited
expression, enhanced expression, or the combination thereof, compared to
their expression in a corresponding unmodified plant; wherein said
altered biological activity of said at least one enzyme selected from
GAME25 or GAME 31 comprises increased enzyme activity, increased
stability, decreased enzyme activity, decreased stability, or the
combination thereof, compared to their biological activity in a
corresponding unmodified plant; wherein the at least one cell of said
genetically modified plant has an altered content of at least one
cholesterol derived compound selected from the group comprising a
steroidal alkaloid or a glycosylated derivative thereof and an
unsaturated or saturated steroidal saponin or a glycoside derivative
thereof compared to a corresponding unmodified plant and said altered
content comprises: (a) a reduced content of said at least one steroidal
alkaloid or a glycosylated derivative thereof or at least one unsaturated
or saturated steroidal saponin or a glycosylated derivative thereof; (b)
an increased content of said at least one steroidal alkaloid or a
glycosylated derivative thereof or at least one unsaturated or saturated
steroidal saponin or a glycosylated derivative thereof; (c) an appearance
of said at least one steroidal alkaloid or a glycosylated derivative
thereof or at least one unsaturated or saturated steroidal saponin or a
glycosylated derivative thereof; or (d) any combination thereof; and
wherein said plant is a Solanaceae crop plant.
2. The genetically modified plant according to claim 1, wherein (a) the amino acid sequence of said 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) comprises the amino acid sequence set forth in any one of SEQ ID NO: 3, SEQ ID NO: 12, and SEQ ID NO: 15, or a protein homologue thereof, wherein said protein homologue is at least 80% homologous to any of SEQ ID NO: 3, SEQ ID NO: 12, and SEQ ID NO: 15 having the same catalytic function as the protein encoded by SEQ ID NO: 3, SEQ ID NO: 12, and SEQ ID NO: 15; (b) said 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) is encoded by a gene comprising the polynucleotide sequence set forth in any one of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 11, SEQ ID NO: 13, and SEQ ID NO: 14, or a gene homologue thereof, wherein said gene homologue is at least 80% homologous to any of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 11, SEQ ID NO: 13, and SEQ ID NO: 14 wherein said encoded enzyme has the same catalytic function as the protein encoded by SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 11, SEQ ID NO: 13, or SEQ ID NO: 14; (c) the amino acid sequence of said 2-oxoglutarate-dependent dioxygenase (GAME31) comprises the amino acid sequence set forth in any one of SEQ ID NO: 18, SEQ ID NO: 21, SEQ ID NO: 24, SEQ ID NO: 27, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 35, SEQ ID NO: 38, SEQ ID NO: 41, SEQ ID NO: 44, SEQ ID NO: 47, SEQ ID NO: 50, and SEQ ID NO: 53, or a protein homologue thereof, wherein said protein homologue is at least 80% homologous to any of SEQ ID NO: 18, SEQ ID NO: 21, SEQ ID NO: 24, SEQ ID NO: 27, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 35, SEQ ID NO: 38, SEQ ID NO: 41, SEQ ID NO: 44, SEQ ID NO: 47, SEQ ID NO: 50, and SEQ ID NO: 53 having the same catalytic function as the protein encoded by SEQ ID NO: 18, SEQ ID NO: 21, SEQ ID NO: 24, SEQ ID NO: 27, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 35, SEQ ID NO: 38, SEQ ID NO: 41, SEQ ID NO: 44, SEQ ID NO: 47, SEQ ID NO: 50, and SEQ ID NO: 53; or (d) said 2-oxoglutarate-dependent dioxygenase (GAME31) is encoded by a gene comprising the polynucleotide sequence set forth in any one of SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 28, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO; 40, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 51, or SEQ ID NO: 52, or a nucleic acid sequence having at least 80% identity to any of SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 28, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 51, or SEQ ID NO: 52; or a combination thereof.
3. (canceled)
4. (canceled)
5. (canceled)
6. (canceled)
7. (canceled)
8. The genetically modified plant according to claim 1, wherein the expression of the at least one gene or combination thereof is altered, said altering comprises mutagenizing the at least one gene, said mutation present within a coding region of said at least one gene, or a regulatory sequence of said at least one gene, or a combination thereof; and wherein said mutagenizing comprises one or more point mutations, a site-directed point mutagenesis, random point mutagenesis, genome editing, mutagenesis using uracil-containing templates, oligonucleotide-directed mutagenesis, phosphorothioate-modified DNA mutagenesis, mutagenesis using gapped duplex DNA, point mismatch repair mutagenesis, mutagenesis using a repair-deficient host strains, restriction-selection and restriction-purification, deletion mutagenesis, mutagenesis by total gene synthesis, mutagenesis during double-strand break repair, mutagenesis by chimeric constructs, mutagenesis by a CRISPR/Cas system, mutagenesis by a zinc-finger nucleases (ZFN) system mutagenesis by a transcription activator-like effector nucleases (TALEN) system, or any combination thereof.
9. (canceled)
10. (canceled)
11. The genetically modified plant according to claim 1, wherein said Solanaceae crop plant is selected from the group comprising a cultivated tomato plant, a wild-tomato plant, a cultivated potato plant, a wild-potato plant, an aubergine plant, a chili pepper plant, a bell pepper plant, and a bittersweet plant.
12. (canceled)
13. The genetically modified plant according to claim 1, wherein said reduced content of at least one steroidal alkaloid or a glycosylated derivative thereof comprises reduced content of at least one anti-nutritional steroidal alkaloid or a glycosylated derivative thereof, or reduced content of at least one toxic steroidal alkaloid or a glycosylated derivative thereof, or a combination thereof; or wherein said increased content of at least one steroidal alkaloid or a glycosylated derivative thereof results in increased plant resistance to at least one plant pathogen, pest, or predator, or any combination thereof, and optionally generates precursor molecules for steroidal alkaloid molecules that provide resistance to at least one plant pathogen, pest, or predator, or any combination thereof; or a combination thereof.
14. (canceled)
15. The genetically modified plant according to claim 1, wherein said at least one steroidal alkaloid or glycosylated derivative thereof is selected from the group comprising tomatidine, .alpha.-tomatine, .alpha.-tomatine isomer (1 and 2), .alpha.-tomatine isomer 1, .alpha.-tomatine isomer 2, hydroxytomatine, acetoxytomatine, dehydrotomatidine, dehydrotomatine, dehydrotomatine isomer 1, dehydrotomatine+4-hexose, acetoxy-hydroxytomatine, acetoxy-hydroxy-dehydrotomatine, tomatidine+4 hexose, esculeosides, esculeoside A, esculeoside A+hexose, esculeoside B, acetoxyesculeoside B, demissidine, demissine, dehydrosolasodine, hydroxy-dehydrotomatine, acetoxy-hydroxy-dehydrotomatine, dehydroesculeosides, dehydroesculeoside A, dehydroesculeoside A+hexose, leptinine I, leptinine II, leptine I, leptine II, lycoperosides, soladulcidine, .beta.-soladulcine, soladulcine A, solanidine, .alpha.-solanine, .alpha.-chaconine, solasodine, .alpha.-solasonine, .alpha.-solamargine, hydroxysolasonine, and hydroxysolamargine, or any derivatives thereof, or any combination thereof; or wherein said at least one unsaturated or saturated steroidal saponin or glycosylated derivative thereof is selected from the group comprising dioscin, diosgenin, parillin, and sarasapogenin; or a combination thereof.
16. (canceled)
17. The genetically modified plant according to claim 1, wherein when said Solanaceae crop plant is a potato plant, said at least one steroidal alkaloid or glycosylated derivative thereof is selected from the group comprising .alpha.-solanine, .alpha.-chaconine, leptinine I, leptinine II, leptine I, and leptine II, or a combination thereof; or wherein when said Solanaceae crop plant is a tomato plant, said at least one steroidal alkaloid or glycosylated derivative thereof is selected from the group comprising .alpha.-tomatine, .alpha.-tomatine isomer (1 and 2), .alpha.-tomatine isomer 2, hydroxytomatine, acetoxytomatine, dehydrotomatidine, dehydrotomatine, dehydrotomatine isomer 1, dehydrotomatine+4-hexose, esculeosides, lycoperoside, or any derivatives thereof, or any combination thereof; or wherein when said Solanaceae crop plant is an eggplant plant, said at least one steroidal alkaloid or glycosylated derivative thereof is selected from the group comprising soladulcidine, 3-soladulcine, soladulcine A, or any derivatives thereof, and said unsaturated or saturated steroidal saponin or glycosylated derivative thereof is selected from the group comprising dioscin, diosgenin, parillin, and sarasapogenin, or any derivatives thereof, or any combination thereof.
18. (canceled)
19. (canceled)
20. The genetically modified plant according to claim 1, wherein said genetically modified plant is a transgenic plant comprising said at least one cell comprising at least one silencing molecule targeted to a gene selected from the group comprising GAME25 and GAME31, or a combination thereof; wherein said silencing molecule is selected from the group comprising an RNA interference molecule and an antisense molecule; and wherein said silencing molecule comprises a polynucleotide having: (a) a nucleic acid sequence substantially complementary to a region of the GAME25 gene or a complementary sequence thereof; or (b) a nucleic acid sequence as set forth in SEQ ID NO: 8, or a fragment thereof; or (c) a nucleic acid sequence substantially complementary to a region of the GAME31 gene or a complementary sequence thereof; or (d) a nucleic acid sequence as set forth in any one of SEQ ID NO: 58 or SEQ ID NO: 59.
21. (canceled)
22. (canceled)
23. (canceled)
24. (canceled)
25. (canceled)
26. The genetically modified plant according to claim 1, wherein said at least one cell having altered biological activity, or altered expression, or a combination thereof, is selected from the group consisting of leaf cell, a young leaf cell, a mature leaf cell, a bud cell, a petal cell, a flower cell, a stem cell, a shoot cell, a peel cell, a root cell, a fruit cell, a tuber cell, and a vegetable cell; and wherein said fruit is a green fruit, a breaker fruit, or a red ripe fruit.
27. (canceled)
28. A method of reducing the content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof in a plant, said method comprising: (a) transforming at least one plant cell within said plant with at least one silencing molecule targeted to a nucleic acid sequence encoding at least one protein selected from the group comprising 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), 2-oxoglutarate-dependent dioxygenase (GAME31), or any combination thereof; or (b) transforming at least one plant cell within said plant with at least one polynucleotide sequence encoding at least one protein selected from the group comprising 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), or a 2-oxoglutarate-dependent dioxygenase (GAME31), or any combination thereof, wherein said at least one polynucleotide sequence comprises a mutation in a coding region or a regulatory region; or (c) a combination of (a) and (b); thereby producing a plant with a reduced content of said at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof compared to a corresponding non-transformed plant; wherein said at least one steroidal alkaloid or a glycosylated derivative thereof comprises an anti-nutritional compound, or a toxic compound, or any combination thereof; or wherein said reducing content of said steroidal alkaloid or a glycosylated derivative thereof and said unsaturated or saturated steroidal saponin or a glycoside derivative thereof, maintains or increases plant resistance to at least one pathogen or predator in said plant, compared to a corresponding non-transformed plant; or wherein said at least one steroidal alkaloid or a glycosylated derivative thereof comprises .alpha.-tomatine, .alpha.-tomatine isomer (1 and 2), hydroxytomatine, or acetoxytomatine, and said at least one unsaturated or saturated steroidal saponin or glycosylated derivative thereof comprises a sarasapogenin or any combination thereof; or any combination thereof.
29. (canceled)
30. (canceled)
31. (canceled)
32. The method according to claim 28, wherein further at least one steroidal alkaloid or a glycosylated derivative thereof is increased, said at least one steroidal alkaloid or a glycosylated derivative thereof comprising a dehydrotomatine, a dehydrotomatine isomer 1, or a dehydrotomatidine+4-hexose, and said at least one unsaturated or saturated steroidal saponin or glycosylated derivative thereof comprises a diosgenin, or any combination thereof.
33. A method of enhancing the content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof in a plant, comprising (a) transforming at least one plant cell within said plant with a nucleic acid sequence encoding 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, wherein said transforming results in overexpression of said GAME25, GAME31, or a combination thereof; or (b) transforming at least one plant cell with at least one polynucleotide sequence encoding at least one protein selected from the group comprising 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), or a 2-oxoglutarate-dependent dioxygenase (GAME31), or any combination thereof, wherein said at least one polynucleotide sequence comprises a mutation in a coding region or a regulatory region; thereby producing a plant with an enhanced content of said at least cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof compared to a corresponding non-transformed plant; wherein said at least one steroidal alkaloid or a glycosylated derivative thereof comprises a .alpha.-tomatine, .alpha.-tomatine isomer (1 and 2), hydroxytomatine, acetoxytomatine, soladulcidine, .beta.-soladulcine, soladulcine A, an unsaturated or saturated steroidal saponin, a leptin, or a leptinine, and said unsaturated or saturated steroidal saponin or glycosylated derivative thereof comprises a sarasapogenin, or any combination thereof; or wherein said enhanced content of said steroidal alkaloid or a glycosylated derivative thereof and said unsaturated or saturated steroidal saponin or a glycoside derivative thereof results in increased plant resistance to at least one plant pathogen, pest or predator, compared to a corresponding non-transformed plant; or a combination thereof.
34. (canceled)
35. (canceled)
36. A method of producing beneficial steroidal derivatives, said method comprising the steps of: (a) incubating a recombinant plant 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), or 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, with selected precursor molecules under biosynthetic conditions; and (b) collecting and isolating the steroidal derivatives from the biosynthetic medium.
37. Use of a recombinant protein having: (a) the amino acid sequence set forth in SEQ ID NO: 3, SEQ ID NO: 12, or SEQ ID NO: 15, or protein homologue thereof, wherein said protein homolog is at least 50% homologous to any of SEQ ID NO: 3, SEQ ID NO: 12, or SEQ ID NO: 15 and has the same catalytic function as the protein encoded by SEQ ID NO: 3, SEQ ID NO: 12, or SEQ ID NO: 15; or (b) the amino acid sequence set forth in SEQ ID NO: 18, SEQ ID NO: 21, SEQ ID NO: 24, SEQ ID NO: 27, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 35, SEQ ID NO: 38, SEQ ID NO: 41, SEQ ID NO: 44, SEQ ID NO: 47, SEQ ID NO: 50 or SEQ ID NO: 53, or protein homologue thereof, wherein said protein homolog is at least 50% homologous to any of SEQ ID NO: 18, SEQ ID NO: 21, SEQ ID NO: 24, SEQ ID NO: 27, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 35, SEQ ID NO: 38, SEQ ID NO: 41, SEQ ID NO: 44, SEQ ID NO: 47, SEQ ID NO: 50 or SEQ ID NO: 53 and has the same catalytic function as the protein encoded by SEQ ID NO: 18, SEQ ID NO: 21, SEQ ID NO: 24, SEQ ID NO: 27, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 35, SEQ ID NO: 38, SEQ ID NO: 41, SEQ ID NO: 44, SEQ ID NO: 47, SEQ ID NO: 50 or SEQ ID NO: 53; for the production of a steroidal derivative comprising a steroidal alkaloid or a glycosylated derivative thereof, an unsaturated or saturated steroidal saponin or a glycoside derivative thereof, or a biosynthetic product thereof.
38. (canceled)
39. Use of a plant nucleic acid sequence encoding a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) enzyme, said nucleic acid comprising the sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 11, SEQ ID NO: 13, or SEQ ID NO: 14, or a nucleic acid sequence having a sequence which is at least 50 identical to SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 11, SEQ ID NO: 13, or SEQ ID NO: 14, wherein said encoded enzyme has the same catalytic function as the protein encoded by SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 11, SEQ ID NO: 13, or SEQ ID NO: 14, or a plant 2-oxoglutarate-dependent dioxygenase (GAME31) enzyme, said nucleic acid comprising the sequence set forth in SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 28, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 51, and SEQ ID NO: 52 or a nucleic acid sequence having a sequence which is at least 50% identical to SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 28, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 51, and SEQ ID NO: 52, wherein said encoded enzyme has the same catalytic function as the protein encoded by SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 28, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 51, and SEQ ID NO: 52, or a combination of a plant nucleic acid encoding 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) and a plant nucleic acid encoding 2-oxoglutarate-dependent dioxygenase (GAME31), for the production of a recombinant cell capable of biosynthesis of a steroidal alkaloid or a glycosylated derivative thereof or an unsaturated or saturated steroidal saponin or a glycosylated derivative thereof, wherein said cell comprises a non-plant cell.
40. A method for breeding a plant having altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof; said method comprising: (a) providing a first plant, wherein the expression level of a polynucleotide encoding a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof is in a pre-determined range of values, or a biological activity of a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, is in a pre-determined range of values; (b) providing a second plant; (c) crossing said first and second plants to generate an offspring plant; and (d) selecting an offspring plant that has a significantly different content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof, to said second plant; wherein said pre-determined value of expression comprises under-expression or over-expression or said pre-determine value of biological activity comprises increases enzyme activity, or decreased enzyme activity, or increased stability, or decreased stability of said 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) or 2-oxoglutarate-dependent dioxygenase (GAME31), or the combination thereof.
41. (canceled)
42. A method for breeding a plant having an altered expression of at least one gene selected from the group comprising a gene encoding 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), a gene encoding a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, said method comprising: (a) providing a first transformed plant, wherein said first transformed plant is transformed with an expression vector comprising a polynucleotide comprising at least one silencing molecule targeted to a nucleic acid sequence encoding at least one protein selected from the group comprising a3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) and a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, wherein said at least one silencing molecule is operably linked to a promoter; or (b) providing a first transformed plant, wherein said first transformed plant is transformed with an expression vector comprising at least one polynucleotide which overexpresses at least one protein selected from the group comprising a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof; or (c) providing a first transformed plant, wherein said first transformed plant is transformed with an expression vector comprising at least one polynucleotide which comprises a mutation in a gene encoding at least one protein selected from the group comprising a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof; (d) providing a second non-transformed plant; (e) crossing said first transformed plant of (a) or (b) or (c) with a second plant to generate a hybrid plant, wherein the hybrid plant comprises the expression vector; and (f) selecting a hybrid plant that has an altered expression of said at least one gene selected from the group comprising a gene encoding 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), a gene encoding a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof compared to a corresponding unmodified plant; (g) and wherein optionally, said plant comprises an altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof, compared to a corresponding unmodified plant; wherein said at least one silencing molecule or said overexpressing polynucleotide is operably linked to a constitutive promoter, an inducible promoter, a tissue-specific promoter, or a developmental-stage specific promoter; or wherein said at least one polynucleotide comprising a mutation is operably linked to a constitutive promoter, an inducible promoter, a tissue-specific promoter, or a developmental-stage specific promoter; or wherein the expression level and/or biological activity of the 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), or the 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, provide a biological marker for a plant comprising altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof; or a combination thereof.
43. (canceled)
44. (canceled)
45. (canceled)
46. The method of claim 42, wherein said altered content comprises reduced content of an anti-nutritional or toxic steroidal alkaloid or a glycosylated derivative thereof; or wherein said altered content comprises increased content of a steroidal alkaloid or a glycosylated derivative thereof that provides resistance to a plant pathogen, pest, or predator; or a combination thereof.
47. (canceled)
48. A method for selecting plant progenitors, said method comprising a step of (a) determining the expression level of a gene encoding a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), or a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, wherein expression levels of said GAME25 gene, or said GAME31 gene, or the combination thereof, is predictive of altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof in an offspring plant; or (b) determining the biological activity of a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), or a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, wherein biological activity of said GAME25 enzyme, or said GAME31 enzyme, or the combination thereof, is predictive of altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof in an offspring plant.
49. A method for determining the capacity of a plant to produce at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof in at least a part of said plant, said method comprising a step of (a) measuring the expression level of GAME25, or GAME31, or a combination thereof, in at least a part of said plant; or (b) measuring the biological activity of a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), or a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, in at least a part of said plant; (c) or a combination of (a) and (b); wherein said steroidal alkaloids or glycosylated derivatives thereof are selected from the group comprising: tomatidine, .alpha.-tomatine, .alpha.-tomatine isomer (1 and 2), .alpha.-tomatine isomer 1, .alpha.-tomatine isomer 2, hydroxytomatine, acetoxytomatine, dehydrotomatidine, dehydrotomatine, dehydrotomatine isomer 1, dehydrotomatine+4-hexose, acetoxy-hydroxytomatine, acetoxy-hydroxy-dehydrotomatine, tomatidine+4 hexose, esculeosides, esculeoside A, esculeoside A+hexose, esculeoside B, acetoxyesculeoside B, demissidine, demissine, dehydrosolasodine, hydroxy-dehydrotomatine, acetoxy-hydroxy-dehydrotomatine, dehydroesculeosides, dehydroesculeoside A, dehydroesculeoside A+hexose, leptinine I, leptinine II, leptine I, leptine II, lycoperosides, soladulcidine, .beta.-soladulcine, soladulcine A, an unsaturated or saturated steroidal saponin, solanidine, .alpha.-solanine, .alpha.-chaconine, solasoidine, .alpha.-solasonine, .alpha.-solamargine, hydroxysolasonine, and hydroxysolamargine, or any derivatives thereof, or any combination thereof.
50. (canceled)
Description:
FIELD OF THE DISCLOSURE
[0001] Identification and use of key genes in the biosynthesis of steroidal alkaloids to genetically modified plants, wherein the genetically modified plants have an altered content of steroidal alkaloids and glycosylated derivatives thereof. Genetically modified plants described comprise Solanaceae crop plants, including those with reduced content of anti-nutritional steroidal glycoalkaloids.
BACKGROUND
[0002] The plant kingdom produces hundreds of thousands of different small compounds that are often genus or family specific. These molecules, referred to as secondary metabolites, are not vital to cells that produce them, but contribute to the overall fitness of the organisms. Steroidal alkaloids are one example of secondary metabolites. They are low molecular weight nitrogen-containing organic compounds, typically with a heterocyclic structure. Steroidal alkaloid biosynthesis in plants is tightly controlled during development and in response to stress and pathogens.
[0003] Consisting of a C-27 cholestane skeleton and a heterocyclic nitrogen component, steroidal alkaloids (SAs) were suggested to be synthesized in the cytosol from cholesterol. Conversion of cholesterol to the alkamine SA should require several hydroxylation, oxidation and transamination reactions (Eich E. 2008. Solanaceae and Convolvulaceae--secondary metabolites: biosynthesis, chemotaxonomy, biological and economic significance: a handbook. Berlin: Springer), and in most cases further glycosylation to form steroidal glycoalkaloids (SGAs) (Arnqvist L. et al. 2003. Plant Physiol 131:1792-1799). The oligosaccharide moiety components of SGAs directly conjugate to the hydroxyl group at C-3/3 of the alkamine steroidal skeleton (aglycone). The oligosaccharide moiety includes D-glucose, D-galactose, L-rhamnose, D-xylose, and L-arabinose, the first two monosaccharides being the predominant units.
[0004] SGA biosynthesis depends on genes encoding UDP-glycosyltransferases (UGTs) that add to the aglycone various sugar moieties (McCue K F et al., 2005. Plant Sci. 168:267-273; Itkin M et al., 2011. Plant Cell 23:4507-4525). The tomato GLYCOALKALOID METABOLISM 1 (GAME1) glycosyltransferase, a homolog of the potato SGT1 (McCue et al., 2005, supra), catalyzes galactosylation of the alkamine tomatidine (Itkin et al., 2011, supra).
[0005] SAs play a role in protecting plants against a broad range of pathogens and are thus referred to as phytoanticipins (antimicrobial compounds). SGAs are also known to contribute to plant resistance towards a wide range of pathogens, pests, and predators, including bacteria, fungi, oomycetes, viruses, insects and animals many SGAs are harmful to a variety of organisms including mammals and humans. When present in edible plant parts, these harmful SGAs are referred to as anti-nutritional substances. These SGAs cause gastrointestinal and neurological disorders and, at high concentrations, may be lethal to humans. For this reason, total SGA levels exceeding 200 mg per kilogram fresh weight of edible tuber are deemed unsafe for human consumption.
[0006] Thus, SGA are well known anti-nutritional secondary metabolites produced by numerous members of Solanaceae family (e.g. potato, tomato, eggplant). Well-known examples of SGA anti-nutritional secondary metabolite compounds include .alpha.-tomatine and dehydrotomatine in tomato (Solanum lycopersicum), .alpha.-chaconine and .alpha.-solanine in potato (Solanum tuberosum), and .alpha.-solamargine and .alpha.-solasonine in aubergine (Solanum melongena).
[0007] In tomato, .alpha.-tomatine and dehydrotomatine represent the major SGAs accumulating predominantly in green tissues; young and mature leaves, flower buds, skin and seeds of immature and mature green fruit. Dehydrotomatidine (i.e. tomatidenol) is the first SA aglycone formed in SGA biosynthesis which could further be hydrogenated at the C-5 position to form tomatidine (FIGS. 1A-1C). Both aglycones are further glycosylated (tetra-saccharide moiety i.e. lycotetrose) to produce dehydrotomatine and .alpha.-tomatine respectively (FIGS. 1A-1C). Thus, the SGA pathway branches at dehydrotomatidine for either formation of tomatidine derived SGAs or glycosylated dehydrotomatine derivatives (FIGS. 1A-1C). Notably, dehydrotomatidine and tomatidine are only different in their structures by the presence or absence of the double bond at the C-5 position. The conversion of dehydrotomatidine to tomatidine was hypothesized in the past as a single reaction catalyzed by a hypothetical hydrogenase. In most tomato plant tissues, the relative portion of dehydrotomatine as compared to .alpha.-tomatine ranges from .about.2.5-.about.10%. As tomato fruit matures and reaches to the red stage, the entire pool of .alpha.-tomatine and dehydrotomatine is largely being converted to esculeosides (major SGAs) and dehydroesculeosides (minor SGAs), respectively (FIGS. 1A-1C).
[0008] In cultivated potato, .alpha.-chaconine and .alpha.-solanine are the major SGAs sharing the same aglycone, solanidine (in which a C-5,6 double bond is present) and possess chacotriose and solatriose moieties, respectively. As there is no demissidine or demissine detected in cultivated potatoes, it was suggested that a hydrogenase enzyme able to convert solanidine to demissidine is lacking in these species. Several wild potato species (e.g. S. demissum, S. chacoense, S. commersonii) and their somatic hybrids (S. brevidens.times.S. tuberosum), predicted to contain an active hydrogenase, do produce demissidine or its glycosylated form, demissine being one of their major SGAs (FIGS. 2A-2B). In eggplant, .alpha.-solamargine and .alpha.-solasonine are the most abundant SGAs derived from the solasodine aglycone (in which a C-5,6 double bond is present); while some wild solanum species, e.g. S. dulcamara produce soladulcidine or its glycosylated forms, soladulcine A and .beta.-soladulcine (C-5,6 double bond is absent), as major SGAs from the solasodine aglycone (FIGS. 3A-3C).
[0009] In addition to SGAs, many Solanum species also produce cholesterol-derived unsaturated or saturated steroidal saponins. Unsaturated and saturated steroidal saponins are widespread in the plant kingdom, especially among monocots, e.g. the Agavaceae, Asparagaceae, Dioscoreaceae and Liliaceae families. Similar to SGAs, steroidal saponins are highly diverse in structures and could be either saturated (e.g. sarasapogenin) or unsaturated (e.g. diosgenin) in the C-5,6 position.
[0010] Cholesterol, the main sterol produced by all animals, serves as a key building block in the biosynthesis of SGAs. An array of tomato and potato GLYCOALKALOIDMETABOLISM (GAME) genes participating in core SGA biosynthesis starting from cholesterol were reported in recent years. The tomato SGAs biosynthetic pathway can be divided into two main parts. In the first, the SA aglycone is formed from cholesterol by the likely action of the GAME6, GAME8, GAME11, GAME4 and GAME12 enzymes. The second part results in the generation of SGA through the action of UDP-glycosyltransferases (UGTs): GAME1, GAME2, GAME17 and GAME18 in tomato, and STEROL ALKALOID GLYCOSYL TRANSFERASE1 (SGT1), SGT2 and SGT3 in potato.
[0011] The formation of unsaturated steroidal saponin aglycone is also a main step in steroidal saponin biosynthesis pathway (FIG. 3A). The aglycone of steroidal saponin is either a spirostanol (closed ring) or a furostanol (open ring). Both these saponin aglycones (e.g. diosgenin) undergoes either glycosylation to form unsaturated saponin glycosides (e.g. dioscin) or hydrogenation at C-5,6 position to form saturated saponin aglycones (e.g. sarasapogenin). These saturated saponin aglycones are further glycosylated to produce downstream saturated saponin glycosides (e.g. parillin) (FIG. 3A). Therefore, like SGAs, unsaturated and saturated aglycone forms of steroidal saponin metabolites also primarily contribute for their structural diversity. Notably, dehydrotomatidine/tomatidine, solanidine/demissidine, solasodine/soladulcidine SA aglycones and unsaturated/saturated steroidal saponin aglycones are only different in their structures by the presence or absence of the double bond at the C-5,6 position. However, the biosynthetic basis of the formation of saturated steroidal alkaloid and steroidal saponin aglycones from their unsaturated forms in Solanaceae or in any other plant families remains unclear till date. In fact, the conversion of dehydrotomatidine to tomatidine in tomato, and solanidine to demissidine in wild potato species by elimination of the C-5,6 double bond was hypothesized for decades to be carried out in a single reaction catalyzed by a hypothetical hydrogenase enzyme.
[0012] There is an ongoing attempt to elucidate the biosynthesis pathway of steroidal alkaloids and to control their production. It would be advantageous to both the farmer and the consumer to have a Solanaceae plant wherein the levels of SGA present would provide the necessary plant resistance to pathogens and predators, while the fruits, tubers and vegetables had reduced anti-nutritional secondary metabolites. The ability to manipulate the synthesis of the SGAs may provide the means to develop, through classical breeding or genetic engineering, crops with modified levels and composition of SGAs, conferring the plant with a preexisting chemical barrier against a broad range of pathogens and insects. At the same time, anti-nutritional compounds (e.g., chaconine and solanine from potato) would be removed.
[0013] Disclosed herein are newly identified genes present in Solanaceae family members encoding enzymes active in the steroidal glycoalkaloids metabolic pathway, whose manipulation may provide just such a balance between plant resistance and decreased anti-nutritional secondary metabolites. For example, in tomato plants genes encoding enzymes active in the conversion of dehydrotomatidine to tomatidine and from .alpha.-tomatine to hydroxytomatine have been identified, whose manipulation within tomato plants may provide just such a balance between tomato plant resistance during growth and fruit development, and decreased anti-nutritional secondary metabolites present in resultant tomatoes.
SUMMARY
[0014] In one aspect, provided herein is a genetically modified plant comprising an altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof, and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof, said plant comprising at least one cell having an altered biological activity of at least one enzyme selected from the group comprising a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) and a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof; or an altered expression of at least one gene selected from the group comprising a gene encoding a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) and a gene encoding a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof; or a combination thereof of an altered biological activity of at least one enzyme selected from the group comprising a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) and a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, and an altered expression of at least one gene selected from the group comprising a gene encoding a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) and a gene encoding a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof; wherein the at least one cell of said genetically modified plant has an altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof compared to a corresponding unmodified plant.
[0015] In a related aspect, the amino acid sequence of 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) comprises the amino acid sequence set forth in any one of SEQ ID NO: 3, SEQ ID NO: 12, and SEQ ID NO: 15, or a protein homologue thereof, wherein said protein homologue is at least 80% homologous to any of SEQ ID NO: 3, SEQ ID NO: 12, and SEQ ID NO: 15.
[0016] In a related aspect, 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) is encoded by a gene comprising the polynucleotide sequence set forth in any one of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 11, SEQ ID NO: 13, and SEQ ID NO: 14, or a gene homologue thereof, wherein said gene homologue is at least 80% homologous to any of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 11, SEQ ID NO: 13, and SEQ ID NO: 14.
[0017] In a related aspect, the amino acid sequence of 2-oxoglutarate-dependent dioxygenase (GAME31) comprises the amino acid sequence set forth in any one of SEQ ID NO: 18, SEQ ID NO: 21, SEQ ID NO: 24, SEQ ID NO: 27, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 35, SEQ ID NO: 38, SEQ ID NO: 41, SEQ ID NO: 44, SEQ ID NO: 47, SEQ ID NO: 50, and SEQ ID NO: 53, or a protein homologue thereof, wherein said protein homologue is at least 80% homologous to any of SEQ ID NO: 18, SEQ ID NO: 21, SEQ ID NO: 24, SEQ ID NO: 27, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 35, SEQ ID NO: 38, SEQ ID NO: 41, SEQ ID NO: 44, SEQ ID NO: 47, SEQ ID NO: 50, and SEQ ID NO: 53.
[0018] In a related aspect, 2-oxoglutarate-dependent dioxygenase (GAME31) is encoded by a gene comprising the polynucleotide sequence set forth in any one of SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 28, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 51, or SEQ ID NO: 52, or a nucleic acid sequence having at least 80% identity to any of SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 28, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 51, or SEQ ID NO: 52.
[0019] In a related aspect, altered expression comprises a reduced or inhibited expression of said GAME25 gene, or GAME31 gene, or a combination thereof compared to its expression in a corresponding unmodified plant; or an increased expression of said GAME25 gene, or GAME31 gene, or a combination thereof compared to its expression in a corresponding unmodified plant; or a combination of reduced or inhibited expression of one of said GAME25 gene or said GAME31 gene, and increased expression the other of said GAME25 gene or said GAME31 gene of compared to their expression in a corresponding unmodified plant and increased expression of.
[0020] In a related aspect, altered biological activity comprises increased enzyme activity of said 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) or said 2-oxoglutarate-dependent dioxygenase (GAME31), or the combination thereof; or increased stability of said 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) or said 2-oxoglutarate-dependent dioxygenase (GAME31), or the combination thereof; or decreased enzyme activity of said 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) or said 2-oxoglutarate-dependent dioxygenase (GAME31), or the combination thereof; or decreased stability of said 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) or said 2-oxoglutarate-dependent dioxygenase (GAME31), or the combination thereof; compared to the biological activity in an unmodified plant.
[0021] In a related aspect, the expression of the at least one gene or combination thereof in said genetically modified plant is altered, said altering comprises mutagenizing the at least one gene, said mutation present within a coding region of said at least one gene, or a regulatory sequence of said at least one gene, or a combination thereof.
[0022] In a related aspect, mutagenesis comprises one or more point mutations, a site-directed point mutagenesis, random point mutagenesis, genome editing, mutagenesis using uracil-containing templates, oligonucleotide-directed mutagenesis, phosphorothioate-modified DNA mutagenesis, mutagenesis using gapped duplex DNA, point mismatch repair mutagenesis, mutagenesis using a repair-deficient host strains, restriction-selection and restriction-purification, deletion mutagenesis, mutagenesis by total gene synthesis, mutagenesis during double-strand break repair, mutagenesis by chimeric constructs, mutagenesis by a CRISPR/Cas system, mutagenesis by a zinc-finger nucleases (ZFN) system, mutagenesis by a transcription activator-like effector nucleases (TALEN) system, or any combination thereof.
[0023] In a related aspect, the plant is a Solanaceae crop plant. In a related aspect, a Solanaceae crop plant is selected from the group comprising a cultivated tomato plant, a wild-tomato plant, a cultivated potato plant, a wild-potato plant, an aubergine plant, a chili pepper plant, a bell pepper plant, and a bittersweet plant.
[0024] In a related aspect, altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof comprises a reduced content of at least one steroidal alkaloid or a glycosylated derivative thereof compared to said corresponding unmodified plant, or an increased content of at least one steroidal alkaloid or a glycosylated derivative thereof compared to said corresponding unmodified plant, or a reduced content of at least one unsaturated or saturated steroidal saponin or a glycosylated derivative thereof compared to said corresponding unmodified plant, or an increased content of at least one unsaturated or saturated steroidal saponin or a glycosylated derivative thereof compared to said corresponding unmodified plant, or a combination of a reduced content of at least one steroidal alkaloid or a glycosylated derivative thereof, and an increased content of at least one steroidal alkaloid or a glycosylated derivative thereof, or an appearance of at least one steroidal alkaloid or a glycosylated derivative thereof compared to said corresponding unmodified plant that does not contain said at least one steroidal alkaloid or a glycosylated derivative thereof; or an appearance of at least one unsaturated or saturated steroidal saponin or a glycosylated derivative thereof compared to said corresponding unmodified plant that does not contain said at least one unsaturated or saturated steroidal saponin or a glycosylated derivative thereof; or any combination thereof, compared to said corresponding unmodified plant.
[0025] In a related aspect, the reduced content of at least one steroidal alkaloid or a glycosylated derivative thereof comprises reduced content of at least one anti-nutritional steroidal alkaloid or a glycosylated derivative thereof, or reduced content of at least one toxic steroidal alkaloid or a glycosylated derivative thereof, or a combination thereof. In a related aspect, the increased content of at least one steroidal alkaloid or a glycosylated derivative thereof results in increased plant resistance to at least one plant pathogen, pest, or predator, or any combination thereof, and optionally generates precursor molecules for steroidal alkaloid molecules that provide resistance to at least one plant pathogen, pest, or predator, or any combination thereof.
[0026] In a related aspect, the at least one steroidal alkaloid or glycosylated derivative thereof is selected from the group comprising tomatidine, .alpha.-tomatine, .alpha.-tomatine isomer (1 and 2), .alpha.-tomatine isomer 1, .alpha.-tomatine isomer 2, hydroxytomatine, acetoxytomatine, dehydrotomatidine, dehydrotomatine, dehydrotomatine isomer 1, dehydrotomatine+4-hexose, acetoxy-hydroxytomatine, acetoxy-hydroxy-dehydrotomatine, tomatidine+4 hexose, esculeosides, esculeoside A, esculeoside A+hexose, esculeoside B, acetoxyesculeoside B, demissidine, demissine, dehydrosolasodine, hydroxy-dehydrotomatine, acetoxy-hydroxy-dehydrotomatine, dehydroesculeosides, dehydroesculeoside A, dehydroesculeoside A+hexose, leptinine I, leptinine II, leptine I, leptine II, lycoperosides, soladulcidine, .beta.-soladulcine, soladulcine A, solanidine, .alpha.-solanine, .alpha.-chaconine, solasodine, .alpha.-solasonine, .alpha.-solamargine, hydroxysolasonine, and hydroxysolamargine, or any derivatives thereof, or any combination thereof.
[0027] In a related aspect, the at least one unsaturated or saturated steroidal saponin or glycosylated derivative thereof is selected from the group comprising dioscin, diosgenin, parillin, and sarasapogenin. In a related aspect, the plant is a potato plant and said at least one steroidal alkaloid or glycosylated derivative thereof is selected from the group comprising .alpha.-solanine, .alpha.-chaconine, leptinine I, leptinine II, leptine I, and leptine II. In a related aspect, the plant is a tomato plant and said at least one steroidal alkaloid or glycosylated derivative thereof is selected from the group comprising .alpha.-tomatine, .alpha.-tomatine isomer (1 and 2), .alpha.-tomatine isomer 2, hydroxytomatine, acetoxytomatine, dehydrotomatidine, dehydrotomatine, dehydrotomatine isomer 1, dehydrotomatine+4-hexose, esculeosides, lycoperoside, or any derivatives thereof, or any combination thereof.
[0028] In a related aspect, the plant is an eggplant plant and said at least one steroidal alkaloid or glycosylated derivative thereof is selected from the group comprising soladulcidine, .beta.-soladulcine, soladulcine A, or any derivatives thereof, and said unsaturated or saturated steroidal saponin or glycosylated derivative thereof is selected from the group comprising dioscin, diosgenin, parillin, and sarasapogenin, or any derivatives thereof, or any combination thereof. In a related aspect, the genetically modified plant is a transgenic plant comprising said at least one cell comprising at least one silencing molecule targeted to a gene selected from the group comprising GAME25 and GAME31, or a combination thereof.
[0029] In a related aspect, the silencing molecule is selected from the group comprising an RNA interference molecule and an antisense molecule. In a related aspect, the silencing molecule comprises a polynucleotide having a nucleic acid sequence substantially complementary to a region of the GAME25 gene or a complementary sequence thereof. In a related aspect, the nucleic acid sequence comprises the nucleic acid sequence set forth in SEQ ID NO: 8, or a fragment thereof. In a related aspect, the silencing molecule comprises a polynucleotide having a nucleic acid sequence substantially complementary to a region of the GAME31 gene or a complementary sequence thereof. In a related aspect, the nucleic acid sequence is set forth in any one of SEQ ID NO: 58 or SEQ ID NO: 59.
[0030] In a related aspect, the at least one cell having altered biological activity, or altered expression, or a combination thereof, is selected from the group consisting of leaf cell, a young leaf cell, a mature leaf cell, a bud cell, a petal cell, a flower cell, a stem cell, a shoot cell, a peel cell, a root cell, a fruit cell, a tuber cell, and a vegetable cell. In a related aspect, the fruit is a green fruit, a breaker fruit, or a red ripe fruit.
[0031] In one aspect, provided herein is a method of reducing the content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof in a plant, said method comprising transforming at least one plant cell within said plant with at least one silencing molecule targeted to a nucleic acid sequence encoding at least one protein selected from the group comprising 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), 2-oxoglutarate-dependent dioxygenase (GAME31), or any combination thereof; or transforming at least one plant cell within said plant with at least one polynucleotide sequence encoding at least one protein selected from the group comprising 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), or a 2-oxoglutarate-dependent dioxygenase (GAME31), or any combination thereof, wherein said at least one polynucleotide sequence comprises a mutation in a coding region or a regulatory region; or a combination thereof; thereby producing a plant with a reduced content of said at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof compared to a corresponding non-transformed plant.
[0032] In a related aspect, the at least one steroidal alkaloid or a glycosylated derivative thereof comprises .alpha.-tomatine, .alpha.-tomatine isomer (1 and 2), hydroxytomatine, or acetoxytomatine, and said at least one unsaturated or saturated steroidal saponin or glycosylated derivative thereof comprises a sarasapogenin or any combination thereof. In a related aspect, the further at least one steroidal alkaloid or a glycosylated derivative thereof is increased, said at least one steroidal alkaloid or a glycosylated derivative thereof comprising a dehydrotomatine, a dehydrotomatine isomer 1, or a dehydrotomatidine+4-hexose, and said at least one unsaturated or saturated steroidal saponin or glycosylated derivative thereof comprises a diosgenin, or any combination thereof.
[0033] In one aspect, provided herein is a method of enhancing the content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof in a plant, comprising transforming at least one plant cell within said plant with a nucleic acid sequence encoding 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, wherein said transforming results in overexpression of said GAME25, GAME31, or a combination thereof; or transforming at least one plant cell with at least one polynucleotide sequence encoding at least one protein selected from the group comprising 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), or a 2-oxoglutarate-dependent dioxygenase (GAME31), or any combination thereof, wherein said at least one polynucleotide sequence comprises a mutation in a coding region or a regulatory region; thereby producing a plant with an enhanced content of said at least cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof compared to a corresponding non-transformed plant.
[0034] In a related aspect, the at least one steroidal alkaloid or a glycosylated derivative thereof comprises a .alpha.-tomatine, .alpha.-tomatine isomer (1 and 2), hydroxytomatine, acetoxytomatine, soladulcidine, .beta.-soladulcine, soladulcine A, an unsaturated or saturated steroidal saponin, a leptin, or a leptinine, and said unsaturated or saturated steroidal saponin or glycosylated derivative thereof comprises a sarasapogenin, or any combination thereof.
[0035] In one aspect, provided herein is a method of producing beneficial steroidal derivatives, said method comprising the steps of: incubating a recombinant plant 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), or 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, with selected precursor molecules under biosynthetic conditions; and collecting and isolating the steroidal derivatives from the biosynthetic medium.
[0036] In one aspect, provided herein is a recombinant protein having the amino acid sequence set forth in SEQ ID NO: 3, SEQ ID NO: 12, or SEQ ID NO: 15, or protein homologue thereof, wherein said protein homolog is at least 50% homologous to any of SEQ ID NO: 3, SEQ ID NO: 12, or SEQ ID NO: 15 and has the same catalytic function as the protein encoded by SEQ ID NO: 3, SEQ ID NO: 12, or SEQ ID NO: 15, for the production of a steroidal derivative comprising a steroidal alkaloid or a glycosylated derivative thereof, an unsaturated or saturated steroidal saponin or a glycoside derivative thereof, or a biosynthetic product thereof.
[0037] In one aspect, provided herein is the use of a recombinant protein having the amino acid sequence set forth in SEQ ID NO: 18, SEQ ID NO: 21, SEQ ID NO: 24, SEQ ID NO: 27, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 35, SEQ ID NO: 38, SEQ ID NO: 41, SEQ ID NO: 44, SEQ ID NO: 47, SEQ ID NO: 50 or SEQ ID NO: 53, or protein homologue thereof, wherein said protein homolog is at least 50% homologous to any of SEQ ID NO: 18, SEQ ID NO: 21, SEQ ID NO: 24, SEQ ID NO: 27, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 35, SEQ ID NO: 38, SEQ ID NO: 41, SEQ ID NO: 44, SEQ ID NO: 47, SEQ ID NO: 50 or SEQ ID NO: 53 and has the same catalytic function as the protein encoded by SEQ ID NO: 18, SEQ ID NO: 21, SEQ ID NO: 24, SEQ ID NO: 27, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 35, SEQ ID NO: 38, SEQ ID NO: 41, SEQ ID NO: 44, SEQ ID NO: 47, SEQ ID NO: 50 or SEQ ID NO: 53, for the production of a steroidal derivative comprising a steroidal alkaloid or a glycosylated derivative thereof, an unsaturated or saturated steroidal saponin or a glycoside derivative thereof, or a biosynthetic product thereof.
[0038] In one aspect, provided herein is the use of a plant nucleic acid sequence encoding a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) enzyme, said nucleic acid comprising the sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 11, SEQ ID NO: 13, or SEQ ID NO: 140r a nucleic acid sequence having a sequence which is at least 50% identical to SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 11, SEQ ID NO: 13, or SEQ ID NO: 14, wherein said encoded enzyme has the same catalytic function as the protein encoded by SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 11, SEQ ID NO: 13, or SEQ ID NO: 14, or a plant 2-oxoglutarate-dependent dioxygenase (GAME31) enzyme, said nucleic acid comprising the sequence set forth in SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 28, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 51, and SEQ ID NO: 52 or a nucleic acid sequence having a sequence which is at least 50% identical to SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 28, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 51, and SEQ ID NO: 52, wherein said encoded enzyme has the same catalytic function as the protein encoded by SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 28, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 51, and SEQ ID NO: 52, or a combination of a plant nucleic acid encoding 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) and a plant nucleic acid encoding 2-oxoglutarate-dependent dioxygenase (GAME31), for the production of a recombinant cell capable of biosynthesis of a steroidal alkaloid or a glycosylated derivative thereof or an unsaturated or saturated steroidal saponin or a glycosylated derivative thereof, wherein said cell comprises a non-plant cell.
[0039] In one aspect, provided herein is a method for breeding a plant having altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof; said method comprising: providing a first plant, wherein the expression level of a polynucleotide encoding a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof is in a pre-determined range of values, or a biological activity of a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, is in a pre-determined range of values; providing a second plant; crossing said first and second plants to generate an offspring plant; and selecting an offspring plant that has a significantly different content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof, compared to said second plant.
[0040] In a related aspect, the pre-determined value of expression comprises under-expression or over-expression or said pre-determine value of biological activity comprises increases enzyme activity, or decreased enzyme activity, or increased stability, or decreased stability of said 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) or 2-oxoglutarate-dependent dioxygenase (GAME31), or the combination thereof.
[0041] In one aspect, provided herein is a method for breeding a plant having an altered expression of at least one gene selected from the group comprising a gene encoding 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), a gene encoding a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, said method comprising: providing a first transformed plant, wherein said first transformed plant is transformed with an expression vector comprising a polynucleotide comprising at least one silencing molecule targeted to a nucleic acid sequence encoding at least one protein selected from the group comprising a3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) and a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, wherein said at least one silencing molecule is operably linked to a promoter; or providing a first transformed plant, wherein said first transformed plant is transformed with an expression vector comprising at least one polynucleotide which overexpresses at least one protein selected from the group comprising a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof; or providing a first transformed plant, wherein said first transformed plant is transformed with an expression vector comprising at least one polynucleotide which comprises a mutation in a gene encoding at least one protein selected from the group comprising a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof; providing a second non-transformed plant; crossing said first transformed plant with a second plant to generate a hybrid plant, wherein the hybrid plant comprises the expression vector; and selecting a hybrid plant that has an altered expression of said at least one gene selected from the group comprising a gene encoding 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), a gene encoding a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof compared to a corresponding unmodified plant; and wherein optionally, said plant comprises an altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof, compared to a corresponding unmodified plant.
[0042] In a related aspect, the at least one silencing molecule or said overexpressing polynucleotide is operably linked to a constitutive promoter, an inducible promoter, a tissue-specific promoter, or a developmental-stage specific promoter. In a related aspect, the at least one polynucleotide comprising a mutation is operably linked to a constitutive promoter, an inducible promoter, a tissue-specific promoter, or a developmental-stage specific promoter. In a related aspect, the expression level and/or biological activity of the 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), or the 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, provide a biological marker for a plant comprising altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof.
[0043] In a related aspect, the altered content comprises reduced content of an anti-nutritional or toxic steroidal alkaloid or a glycosylated derivative thereof. In a related aspect, the altered content comprises increased content of a steroidal alkaloid or a glycosylated derivative thereof that provides resistance to a plant pathogen, pest, or predator.
[0044] In some aspects, provided herein is a method for selecting plant progenitors, said method comprising a step of determining the expression level of a gene encoding a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), or a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, wherein expression levels of said GAME25 gene, or said GAME31 gene, or the combination thereof, is predictive of altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof in an offspring plant; or determining the biological activity of a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), or a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, wherein biological activity of said GAME25 enzyme, or said GAME31 enzyme, or the combination thereof, is predictive of altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof in an offspring plant.
[0045] In some aspects, provided herein is a method for determining the capacity of a plant to produce at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof in at least a part of said plant, said method comprising a step of measuring the expression level of GAME25, or GAME31, or a combination thereof, in at least a part of said plant; or measuring the biological activity of a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), or a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, in at least a part of said plant; or a combination thereof.
BRIEF DESCRIPTION OF THE DRAWINGS
[0046] The following drawings form part of the present specification and are included to further demonstrate certain embodiments of the present disclosure, the compositions and formulations described herein may be better understood by reference to one or more of these drawings in combination with the detailed description of specific embodiments presented herein.
[0047] FIGS. 1A-1C together provide an overview of Steroidal Glycoalkaloid (SGA) biosynthesis in tomato. SGA biosynthesis starts with the conversion of cholesterol to unsaturated dehyrotomatidine (tomatidenol), the first SA aglycone in the green stage of fruit development. This occurs through the action of GAME enzymes (GAME-6, 8, 11, 4, 12). Dehydrotomatidine is further converted to saturated tomatidine, another steroidal alkaloid aglycone. Both dehydrotomatidine and tomatidine are glycosylated by various UGTs (GAME-1, 17, 18, 2) to form dehydrotomatine and .alpha.-tomatine respectively. The presence or absence of C-5,6 double bond is the only difference between dehydrotomatidine and tomatidine steroidal alkaloid aglycones structure. This difference in the C-5,6 double bond at steroidal aglycones level further creates a vast structural diversity of SGAs (either unsaturated or saturated derivatives) during tomato fruit development and ripening stages (see all structures). .alpha.-tomatine and dehydrotomatine are major SGAs in green tomato fruit. Subsequently, hydroxy- and/or acetoxy-derivatives of .alpha.-tomatine and dehydrotomatine accumulate in the breaker tomato fruit. In red fruit, esculeosides and lycoperosides are the most abundant SGAs. .alpha.-tomatine derived saturated SGAs are highly abundant compared to dehydrotomatine-derived unsaturated SGAs throughout tomato fruit development and ripening. The conversion of dehydrotomatidine to tomatidine was previously predicted as a single step reaction by the action of a hypothetical hydrogenase. FIG. 1A shows a schematic representation of the main steps of SGA biosynthesis in tomato. FIG. 1B shows a schematic representation of SGA biosynthesis in tomato illustrating also the molecular structure of the compounds generated. FIG. 1C shows a further schematic representation of SGA biosynthesis in tomato illustrating also the molecular structure of the compounds generated. .alpha.-tomatine derived saturated SGAs are shown in black color and dehydrotomatine-derived unsaturated SGAs are shown in red color.
[0048] FIGS. 2A-2B provide an overview of SGA biosynthesis in potato. Cholesterol is first converted to the aglycone solanidine in potato. Solanidine is further glycosylated by SGT enzymes to produce .alpha.-solanine and .alpha.-chaconine in cultivated potato. Some wild potato species (e.g. S. chacoense and S. demissum etc.) produce demissidine or its glycosylated form demissine from the solanidine aglycone. The enzymatic conversion of solanidine to demissidine in wild potato plants was hypothesized previously to be carried out in a single reaction catalyzed by a hypothetical hydrogenase GAME. GTs--GAME Glycosyltransferase. SGT--Sterol alkaloid Glycosyltransferase. Dotted arrows represent multiple glycosyltransferase enzymatic steps between the compounds shown. Solid arrows represent a single enzymatic step between compounds. FIG. 2A shows a schematic representation of the main steps of SGA biosynthesis in potato. FIG. 2B shows a schematic representation of SGA biosynthesis in potato illustrating also the molecular structure of the compounds generated.
[0049] FIGS. 3A-3C shows the proposed biosynthetic pathway for steroidal saponin glycosides in steroidal saponin producing plant species and steroidal glycoalkaloids in eggplant. FIG. 3A shows biosynthetic pathway of steroidal saponins and their glycosides. First, cholesterol is converted to either unsaturated furostanol type saponin aglycone or spirostanol type saponin aglycone. Both these unsaturated aglycones are further glycosylated by GTs (glycosyltransferases) to form their unsaturated saponin glycosides respectively. Alternatively, both unsaturated saponin aglycones are further hydrogenated at C-5,6 position to form their saturated saponin aglycone forms. Similar to unsaturated ones, these saturated aglycone forms also undergoes glycosylation to form diverse saturated saponin glycosides. The enzymatic conversion responsible for formation of saturated saponin aglycone from unsaturated ones is unknown till date in any well-known steroidal saponin producing plant species. FIG. 3B shows a schematic representation of the main steps of SGA biosynthesis in eggplant. FIG. 3C shows a schematic representation of SGA biosynthesis in eggplant illustrating also the molecular structure of the compounds generated. In eggplant SGA biosynthesis, cholesterol is first converted to solasodine, unsaturated SA aglycone. Solasodine is further glycosylated by SGT (STEROL ALKALOID GLYCOSYL TRANSFERASE) enzymes to produce unsaturated .alpha.-solasonine and .alpha.-solamargine SGAs in cultivated eggplant. Cultivated eggplant is deficient in GAME25 gene and therefore lacks saturated SGAs. In contrary, some Solanum species, e.g. S. dulcamara produce saturated soladulcidine alkaloid aglycone and further its glycosylated derivatives soladulcine A and .beta.-soladulcine from the solasodine aglycone. This suggests the presence of GAME25 homolog in those Solanum species. The formation of saturated alkaloid aglycone in any known Solanum species remains unclear till date.
[0050] FIGS. 4A-4B show levels of major SGAs and expression profile of GAME25 in various tomato wild accessions. FIG. 4A GAME25 normalized expression level among various tomato tissue types and developmental stages (from RNA-Seq data). Briefly, RNA-Seq transcriptome data was obtained from different tomato tissues and organs (flesh, peel, roots, young leaf, flower buds and young flower petals) and five developmental stages for peel and flesh tissues (19 experiments in total). FIG. 4B shows expression of GAME25 in four stages of fruit development of different wild tomato species (normalized RNA-seq data). IG: immature green, MG: mature green, BR: breaker, R: ripe. FPKM: Fragments Per Kilobase of transcript per Million mapped reads.
[0051] FIG. 5 shows the alignment of tomato, S. pennellii and potato GAME25 proteins investigated in this study. GAME25 is a classical SDR family member protein possessing TGxxxGxG cofactor binding and the YxxxK catalytic motifs (marked in boxes). The Asp (D) residue at 40th position indicating preference for NAD+ over NADP+ was shown in asterisk.
[0052] FIG. 6 shows that GAME25 proteins form a separate clade in the large short-chain dehydrogenases/reductases family. Tomato, potato and S. pennellii (wild tomato species) GAME25 proteins characterized in this disclosure are marked in red, blue and green triangles, respectively. Five large short-chain dehydrogenases/reductases families (SDR65C, SDR108E, SDR110C, SDR114C and SDR119C) were included in the phylogenetic analysis that comprises enzymes involved predominantly in secondary metabolism. TR-like, tropane alkaloids; ACR, anthocyanidins; 4-DFR, 4-dihydroflavonols; LCR, leucoanthocyanidins; NOS, narcotinehemeacetal precursors; ABA2, abscisic acid; MS and MIS, diterpenoid; SR, quinoline alkaloids; 11/17 .beta.-hydroxysteroid dehydrogenase, steroid metabolism. Another separate clade, ADH (`alcohol dehydrogenase`) comprises SDRs from various plant species whose functions are still unknown. Details of the amino acid sequences used are provided in below. The evolutionary history was inferred using the maximum-likelihood method in MEGA6.0. Numbers on branches indicate bootstrap values in percentage of 1,000 replicates.
[0053] FIG. 7 shows the GAME25 expression levels in leaves and different fruit tissues (developmental stages) of GAME25-RNAi (#2, #3 and #4) transgenic tomato lines (qRT PCR assay). Briefly, RNA-Seq transcriptome data was obtained from different tomato tissues and organs (flesh, peel, roots, young leaf, flower buds and young flower petals) and five developmental stages for peel and flesh tissues (19 experiments in total). Values represent mean.+-.standard error (n=3). Asterisks indicate significant changes from control samples (wild-type) as calculated by a Student's t-test (*P-value <0.05; **P-value <0.01; ***P-value <0.001).
[0054] FIG. 8 shows the SGAs levels in leaves of wild-type (non-transformed) and GAME25-RNAi tomato lines determined by Liquid Chromatography-Mass Spectrometry (LC-MS). Samples #2, #3 and #4 are three independent GAME25-RNAi transgenic tomato lines. Values indicate means of three biological replicates.+-.standard error. Asterisks indicate significant changes from wild-type samples as calculated by a Student's t-test (*P-value <0.05; **P-value <0.01; ***P-value <0.001).
[0055] FIG. 9 shows levels of less abundant SGAs in GAME25 silenced tomato leaf tissues. Line #2, #3 and #4 are three independent GAME25-RNAi transgenic tomato lines. Values indicate means of three biological replicates.+-.standard error. Asterisks indicate significant changes from wild-type samples as calculated by a Student's t-test (*P-value <0.05; **P-value <0.01; ***P-value <0.001).
[0056] FIG. 10 shows the silencing of GAME25 in S. pennellii. Expression of GAME25 in leaves of GAME25i S. pennellii transgenic lines (qRT PCR assay). Line #21 and #23 are two independent GAME25-RNAi transgenic lines.
[0057] FIGS. 11A-11I show substantially altered SGA metabolism in fruit of GAME25-silenced tomato lines (#2, #3 and #4 are three independent lines). Values represent mean.+-.standard error (n=3). FIG. 11A shows reduced levels of saturated .alpha.-tomatine and its downstream derivatives in green fruit of GAME25-silenced tomato compared to wild-type. FIG. 11B shows levels of less abundant SGAs in GAME25 silenced tomato green fruits. FIG. 11C shows increased levels of unsaturated dehydrotomatine and its downstream SGAs in green fruit of GAME25-silenced tomato lines compared to wild-type. FIG. 11D shows increased dehydrotomatine derived SGA levels in breaker fruits of GAME25i lines compared to wild-type breaker fruits. FIG. 11E shows levels of less abundant SGAs in GAME25 silenced tomato breaker fruits. FIG. 11F shows increased .alpha.-tomatine derived SGA levels in breaker fruits of GAME25i lines compared to wild-type breaker fruits. FIG. 11G shows substantial reduction in levels of esculeoside A, major saturated SGA in red stage fruit, in GAME25-silenced red ripe fruit. .alpha.-tomatine and its derived saturated SGAs were not detected in GAME25-silenced red ripe fruit. FIG. 11H shows a massive increase in levels of unsaturated dehydroesculeoside A in GAME25-silenced red fruit compared to wild-type red fruits. FIG. 11I shows levels of less abundant SGAs in GAME25 silenced tomato red fruits. Asterisks indicate significant changes from wild-type samples as calculated by a Student's t-test (*P-value <0.05; **P-value <0.01; ***P-value <0.001).
[0058] FIG. 12 shows that altering GAME25 expression does not affect other SGA biosynthetic genes in tomato. The figure shows the expression of selected genes involved in SGA biosynthesis from leaves of GAME25i tomato transgenic lines (qRT PCR assay). Line #2, #3 and #4 are three independent GAME25-RNAi transgenic tomato lines. Values represent mean.+-.standard error (n=3). Asterisks indicate significant changes from control samples (wild-type) as calculated by a Student's t-test (*P-value <0.05; **P-value <0.01; ***P-value <0.001).
[0059] FIGS. 13A-13E show that overexpression of GAME25 in tomato enhances the levels of the .alpha.-tomatine branch in the SGA pathway. FIG. 13A shows GAME25 expression in leaves, green and red fruit of transgenic tomato lines overexpressing the tomato GAME25 gene (GAME25-Ox) as determined by quantitative Real Time-PCR (qRT-PCR). FIG. 13B shows levels of .alpha.-tomatine, and FIG. 13C shows levels of additional SGAs in leaves of GAME25-Ox tomato lines as compared to wild-type ones. FIGS. 13D-13E show levels of .alpha.-tomatine, dehydrotomatine and additional SGAs in breaker (FIG. 13D) and red (FIG. 13E) fruit of GAME25-Ox lines as compared to wild-type fruit. Overexpression of GAME25 resulted in accumulation of either .alpha.-tomatine or its derived SGAs (e.g. acetoxy- or acetoxyhydroxytomatine) in leaves and fruit tissues. The values indicate means of three biological replicates.+-.standard error. Student's t-test was used to assess the significance of the difference between transgenic and wild-type tissues (*P-value <0.05; **P-value <0.01; ***P-value <0.001). #91, #92 and #93 represent three independent GAME25-Ox tomato transgenes. LC-MS was used for metabolite analysis.
[0060] FIG. 14 shows that overexpression of tomato GAME25 results in accumulation of new saturated SGAs and steroidal saponins in eggplant. Comparison of SGA (upper panel) and steroidal saponin (lower panel) profile of wild-type (WT) and GAME25 overexpression transgenic eggplant lines; the naturally occurring unsaturated steroidal alkaloids (Solmargine, m/z 868.5106; Solasonine, m/z 884.5076 and malonyl-solamargine, m/z 954.5066) are reduced in the overexpression lines compared to the WT, while the saturated derivatives (lacking the 5-6 double bond) accumulate soladulcine A (m/z 870.5265), .beta.-soladulcine (m/z 886.5131) & saturated malonyl-solamargine (m/z 956.5238); similarly the steroidal saponins (m/z 1031.5396 & m/z 1117.5479) are reduced, while their saturated forms (m/z 1033.5608 & 1119.5586) accumulate in GAME25 overexpression transgenic eggplants.
[0061] FIG. 15 shows the relative expression level of tomato GAME25 gene in leaves of GAME25-Ox eggplant (cv. Tudela) as compared to wild-type plants determined by quantitative real-time PCR (qRT-PCR). Tomato GAME25 gene was overexpressed in eggplant. #E1 and #E2 are two independent GAME25-Ox eggplant transgenic lines. Values indicate means of three biological replicates.+-.standard error. Asterisks indicate significant changes from wild-type samples as calculated by a Student's t-test (*P-value <0.05; **P-value <0.01; ***P-value <0.001).
[0062] FIGS. 16A-16F show the structures of detected steroidal alkaloids and saponins in leaves of GAME25-Ox eggplant (cv. Tudela). Chemical structures were putatively assigned by calculating elemental compositions from the accurate mass and interpretation of mass fragmentation patterns, loss of water in positive ionization mode from steroidal saponins is typical for furostanol-type compounds (Heinig & Aharoni, 2014). FIG. 16A Solasonine (m/z 884.5076) and .beta.-soladulcine (m/z 886.5131). FIG. 16B Solmargine (m/z 868.5106) and soladulcine A (m/z 870.5265). FIG. 16C malonyl-solamargine (m/z 954.5066) and saturated malonyl-solamargine (m/z 956.5238). FIG. 16D steroidal saponin (m/z 1031.5396) and saturated steroidal saponin (m/z 1033.5608). FIG. 16E steroidal saponin (m/z 1117.5479) and saturated steroidal saponin (m/z 1119.5586). FIG. 16F shows a comparison of mass fragmentation of steroidal alkaloid and steroidal saponin aglycones; Upper panel: Overlays of mass spectra of saturated SA aglycones (red) and unsaturated SA aglycones (black), lower panel: Overlays of mass spectra of saturated steroidal saponin aglycones (red) and unsaturated steroidal saponin aglycones (black). Characteristic fragment structures are shown, fragments after loss of the side chain of steroidal alkaloids or saponins are identical, m/z 253.19 & 271.21 (blue) for unsaturated compounds and m/z 255.21 & 273.22 (red) for saturated compounds.
[0063] FIGS. 17A-17C show overexpression of GAME25 in potato. FIG. 17A shows GAME25 gene expression (qRT-PCR) in GAME25-Ox lines in potato. Line #11, #12 and #13 are independent GAME25-Ox transgenic lines. FIGS. 17B-17C show levels of .alpha.-solanine and .alpha.-chaconine in leaves (FIG. 17B) and tuber peel (FIG. 17C) of GAME25-Ox lines as determined by LC-MS. Values represent mean.+-.standard error (n=3). Student's t-test was used to assess whether the transgenic lines significantly differ from wild-type plants (*P-value <0.05; **P-value <0.01; ***P-value <0.001). #13 transgenic plants did not produce tubers.
[0064] FIGS. 18A-18B show expression of tomato and potato GAME25 protein in the microsomal fraction of Sf9 cells. Recombinant GAME25 proteins were expressed in Sf9 cells and analyzed by immunoblot with anti-myc antibodies. FIG. 18A shows tomato GAME25 protein. FIG. 18B shows potato GAME25 protein. M: Molecular weight protein marker.
[0065] FIGS. 19A-19L show the activity of the recombinant tomato and potato GAME25 produced in Sf9 insect cells with dehydrotomatidine and solanidine as substrates. FIGS. 19A-19B show an overlay of extracted ion chromatograms of m/z 412.32 Da, [M+H.sup.+].sup.+ (mass of the GAME25 reaction product and the control reaction (sf9 cells microsomes) obtained with dehydrotomatidine as a substrate and tomato GAME25. FIGS. 19C-19D show the mass spectra and structures of the detected product (upper panel) and substrate (lower panel) of potato GAME25 enzymatic reaction with dehydrotomatidine as a substrate. FIG. 19E shows the mass fragmentation spectrum of the GAME25 enzymatic reaction product (with dehydrotomatidine as substrate) including the interpretation of the detected mass fragments. The fragmentation pattern corresponds to the proposed structure of the GAME25 product obtained with tomato GAME25. FIGS. 19F-19G shows an overlay of extracted ion chromatograms of m/z 396.32 Da, [M+H.sup.+].sup.+ (mass of the GAME25 reaction product) and the control reaction (sf9 cells microsomes) with solanidine as a substrate and tomato GAME25. FIGS. 19H-19I shows the mass spectra and structures of the detected product (upper panel) and substrate (lower panel) of the potato GAME25 enzymatic reaction with solanidine as a substrate. FIG. 19J shows chromatograms of the potato GAME25 enzymatic reaction (upper panel), control reaction (middle panel), both with solanidine as substrate, and the solanid-4-en-3-one authentic standard injection (lower panel). The newly formed product (at RT 23.2 min.) co-elutes with solanid-4-en-3one. FIG. 19K shows an overlay of extracted ion chromatograms of potato GAME25 enzyme reaction product [m/z 412.32 Da, [M+H+]+] and the control reaction (sf9 cells microsomes) with solasodine as a substrate. FIG. 19L shows the mass spectra and structures of the detected product (upper panel) and substrate (lower panel) of potato GAME25 enzymatic reaction with solasodine as a substrate.
[0066] FIGS. 20A-20D show a characterization of GAME25 (tomato) by in vitro enzyme activity assay. GAME25 (tomato) was expressed in Sf9 insect cells. FIG. 20A shows an overlay of extracted ion chromatograms of m/z 412.32 Da, [M+H+]+, mass of product of GAME25 of enzyme reaction and control (reaction mixture without GAME25) using Solasodine as a substrate. FIG. 20B shows the mass spectra and structures of detected product (upper panel) and substrate (lower panel) of GAME25 enzymatic reaction with Solasodine as substrate. FIG. 20C shows the structures of fragments detected in MS-MS analysis of product of GAME25 (tomato) using Solasodine as a substrate. FIG. 20D shows MSMS spectrum of product of GAME25 (tomato) with Solasodine as a substrate.
[0067] FIGS. 21A-21C show GAME25 and GAME35 protein expression in BL21(DE3). FIG. 21A shows the expression of recombinant GAME25 and GAME35 proteins in E. coli BL21 (DE3) cells analyzed on SDS-PAGE. FIG. 21B and FIG. 21C show Western blot analysis of His-tagged recombinant GAME25 and GAME35 proteins. M: Molecular weight protein marker, W: Whole cell extract, El: Imidazole eluted fractions from Ni-NTA column, pET28: Empty pET28 vector transformed into BL21(DE3) cells was used as negative control. Recombinant proteins are marked with red arrows.
[0068] FIGS. 22A-22B show enzyme assays of the purified recombinant tomato GAME25 and GAME 25 produced in E. coli BL21 (DE3) cells. FIG. 22A shows chromatograms of the GAME25 enzymatic reaction using solanidine as substrate, control reaction (empty pET28 vector transformed into BL21(DE3) cells) and the solanid-4-en-3-one authentic standard injection (lower panel). GAME25 efficiently converted solanidine to the solanid-4-en-3-one product. FIG. 22B shows GAME35 enzyme reaction using solanid-4-en-3-one as substrate. GAME35 did not show any enzyme activity with solanid-4-en-3-one as a substrate.
[0069] FIGS. 23A-23J show inhibition of growth and spore germination of Colletotrichum gloeosporioides and Botrytis cinereal fungi on medium containing leaf extracts derived from GAME25 silenced tomato plants. Methanol extracts of tomato leaves from wild-type (WT) and GAME25 silenced lines (i.e. GAME25i, #2, #3 and #4 are three independent GAME25i transgenic lines) were used for fungal inhibition assays. FIG. 23A shows the inhibition area of C. gloeosporioides mycelial growth resulting from addition of leaf extracts of GAME25i plants compared to wild-type leaf extracts. FIG. 23B shows a representative image of the C. gloeosporioides mycelial growth inhibition after application of leaf extracts from GAME25i plants. FIG. 23C shows the inhibition area of Botrytis cinereal mycelial growth resulting from addition of leaf extracts of GAME25i plants compared to wild-type leaf extracts. FIG. 23D shows a representative image of the Botrytis cinereal mycelial growth inhibition after application of leaf extracts from GAME25i plants. FIG. 23E shows the percentage of C. gloeosporioides conidia germination resulting from addition of leaf extracts of GAME25i plants compared to wild-type leaf extracts. FIGS. 23F-G show representative images of C. gloeosporioides conidia germination in the presence of a GAME25i leaf extract (FIG. 23F) and wild-type leaf extract (FIG. 23G). FIG. 23H shows the percentage of Botrytis cinereal conidia germination resulting from addition of leaf extracts of GAME25i plants compared to wild-type leaf extracts. FIGS. 23I-J show representative images of Botrytis cinerea conidia germination in the presence of a GAME25i leaf extract (FIG. 23I) and wild-type leaf extract (FIG. 23J). FIGS. 23A, 23C, 23E and 23H indicate show means.+-.standard error (n=15). This 15 process replicates were obtained from three separate experiment repetitions. Asterisks indicate significant changes from wild-type samples as calculated by a Student's t-test (*P-value <0.05; **P-value <0.01; ***P-value <0.001).
[0070] FIGS. 24A-24B show the conversion of Diosgenin, a steroidal saponin to Diosgen-4-en-3-one by tomato GAME25 enzyme. FIG. 24A shows an overlay of extracted ion chromatograms of m/z 415.32 (M+H.sup.+ of Diosgenin substrate) and 413.31 (M+H.sup.+ of detected reaction product), red: reaction with recombinant GAME25 protein from tomato, produced in E. coli, black: control reaction with E. coli protein extract (empty vector). GAME25 converts Diosgenin quantitatively to the putative product Diosgen-4-en-3-one. FIG. 24B shows mass fragmentation spectra of Diosgenin substrate (lower panel) and reaction product (upper panel) with explanation of characteristic fragments for Diosgenin and Diosgen-4-en-3-one, loss of the side chain leads to fragments m/z 271.21 and 269.19 respectively, followed by a neutral loss of water resulting in fragments m/z 253.19 and 251.18. Abbreviations: E. coli: Escherichia coli, EIC: extracted ion chromatogram, m/z mass to charge, M: molecular mass.
[0071] FIG. 25 shows that GAME25 enzymes plays a key role in the formation of saturated (elimination of the C-5,6 double bond) SA and steroidal saponin aglycones produced in different plant species in a sequence of three reactions. A three step reaction sequence for the conversion of dehydrotomatidine to tomatidine in tomato, solanidine to demissidine in wild potatoes (S. chacoense) and solasodine to soladulcidine in certain solanum species (e.g. S. dulcamara) is proposed. Additionally, it suggests three step reactions for the conversion of unsaturated steroidal saponin aglycone to saturated steroidal saponin aglycone in steroidal saponin producing plant species. GAME25, a novel 3.beta.-hydroxysteroid dehydrogenase/isomerase perform the first step in this reaction sequence and produce 3-oxo-.DELTA..sup.5,4 steroidal alkaloid/saponin aglycone derivatives from the respective unsaturated steroidal alkaloid/saponin aglycone substrates (e.g. dehydrotomatidine or diosgenin) which are further converted to saturated (C.sub.5-C.sub.6 deficient) products by successive actions of putative 5-reductases and aldo-keto reductases respectively. This three step conversion partly resembles to steroid metabolism (e.g. progesterone formation and further catabolism) in plant species such as Digitalis spp. that produce cardiac glycoside secondary metabolites. Dashed arrows indicate multi-step reactions.
[0072] FIGS. 26A-26G show variation in SGA levels in the BIL/IL populations. The SGA content in leaf tissues was determined by leaf-dipping method and further analysis by UPLC-qTOF-MS. In all figures, the x-axis represents all 671 lines from the populations and the Y axis represents relative peak abundance. FIG. 26A shows levels of .alpha.-tomatine isomer 1. FIG. 26B shows levels of .alpha.-tomatine isomer 2. FIG. 26C shows levels of dehydrotomatine isomer 1. FIG. 26D shows levels of dehydrotomatine isomer 2. FIG. 26E shows levels of hydroxytomatine FIG. 26F shows levels of acetoxytomatine. FIG. 26G shows levels of di-dehydrotomatine. While .alpha.-tomatine (isomer 1 and 2) and dehydrotomatine (isomer 1) were present in most of the lines, other SGAs were either absent of present predominantly in few tomato lines.
[0073] FIGS. 27A-27G show the SGA levels in the IL populations. The SGA content was determined from ground-tissue extracts by UPLC-qTOF-MS. The peak areas were determined by target analysis using the TargetLynx software Values represent mean.+-.s.d. (n=3). FIG. 27A shows levels of .alpha.-tomatine isomer 1. FIG. 27B shows levels of .alpha.-tomatine isomer 2. FIG. 27C shows levels of dehydrotomatine isomer 1. FIG. 27D shows levels of dehydrotomatine isomer 2. FIG. 27E shows levels of hydroxytomatine. FIG. 27F shows levels of acetoxytomatine. FIG. 27G shows levels of di-dehydrotomatine.
[0074] FIGS. 28A and 28B present a region in tomato chromosome 1 linked to the accumulation of dehydrotomatine isomer 2. FIG. 28A presents the schematic representation of chromosome 1 showing the region in IL 1-1-1 controlling the content of dehydrotomatine isomer 2. FIG. 28B presents the suggested structures of the two isomers of dehydrotomatine (Schilmiler et al., (2010) Mass spectrometry screening reveals widespread diversity in trichome specialized metabolites of tomato chromosomal substitution lines. Plant J. 62: 391-403.).
[0075] FIGS. 29A and 29B present in tabular form a detailed list of genes present in the regions linked to SGA content in the BIL/IL populations. The table presented in FIG. 29A lists the genes in chromosome 1 region linked to content of dehydrotomatine isomer 2. The Table presented in FIG. 29B lists the genes in chromosome 2 region linked to content of hydroxytomatine and acetoxytomatine.
[0076] FIGS. 30A-30C present figures supporting the finding that a region in tomato chromosome 2 is linked to hydroxytomatine and acetoxytomatine content. FIG. 30A presents a schematic representation of chromosome 2 showing the region controlling the content of hydroxytomatine and acetoxytomatine in the BIL/IL populations. FIG. 30B schematically shows that out of the 17 genes in the region, four correspond to 2-oxoglutarate-dependent dioxygenases, named in this study SlGAME31 and SlGAME31-like genes. SlGAME31 and SlGAME31-like3 are full length coding sequences, while SlGAME31-like1 and SlGAME31-like2 are partial. FIG. 30C presents the predicted reaction catalyzed by GAME31, from .alpha.-tomatine to hydroxytomatine (position pointed by red arrow) and downstream pathway to esculeosides.
[0077] FIGS. 31A and 31B present graphs of SlGAME31 and SlGAME31-like gene expression. FIG. 31A presents a normalized expression profile of SlGAME31 and SlGAME31-like genes in RNA-Seq data from vegetative apex of the ILs (Chitwood et al., (2013) A quantitative genetic basis for leaf morphology in a set of precisely defined tomato introgression lines. Plant Cell 25: 2465-2481). SlGAME31 showed about 4.6-fold increased expression in IL2-1 (marked by *) in comparison with the other ILs, while SlGAME31-like genes showed very low expression levels across the population (<15 normalized Reads Per Million, RPM). FIG. 31B presents a normalized expression profile (from RNA-Seq dataset previously reported (Cardenas et al., (2016) Nat. Commun. 7, 10654) of SlGAME31 in different tomato (cv. Microtom) tissue types and developmental stages. SlGAME31 showed an expression pattern correlating with fruit ripening, being lower in immature stages of fruit and other tissues (leaf, buds, petals and root). SlGAME31-like3 was slightly expressed while SlGAME31-like1 and SlGAME31-like2 genes were not detected in this dataset. IG: immature green; MG: mature green; Br: breaker; Or: or ange; RR: red ripe. FPKM: Fragments Per Kilobase of transcript per Million mapped reads.
[0078] FIGS. 32A and 32B present the results of sequence searches for SlGAME31 homologs in eggplant and potato. FIG. 32A shows that the sequence homology searches identified SmGAME31, encoding a 2-oxoglutarate-dependent dioxygenase in chromosome 1 of eggplant, as the closest homolog of the tomato GAME31. SmGAME31 is predicted to catalyze the hydroxylation of .alpha.-solamargine to hydrosolamargine. FIG. 32B shows that in potato, a tandem gene cluster of 8 homologs of SlGAME31 was identified, and which spanned .about.205 Kbp. At the protein level, StGAME31 displayed 54% identity to StGAME31-like1, 94% to StGAME31-like2, 67% to StGAME31-like3, 51% StGAME31-like4 and StGAME31-like5, 58% to StGAME31-like6 and 54% identity to StGAME31-like7. GAME31 in potato is predicted to hydroxylate .alpha.-chaconine and .alpha.-solanine, precursors of leptinine I and II, respectively. These later compounds can be further acetylated to produce leptine I and II, respectively.
[0079] FIGS. 33A-33H shows the hydroxylation of SA/SGAs by recombinant SlGAME31. Enzymatic reactions were performed with SlGAME31 using multiple SA/SGA substrates: .alpha.-tomatine (FIG. 33A), tomatidine (FIG. 33B), dehydrotomatine (FIG. 33C), .alpha.-solamargine (FIG. 33D), solasodine (FIG. 33E), .alpha.-chaconine (FIG. 33F), .alpha.-solanine (FIG. 33G) and solanidine (FIG. 3311). The enzymatic reaction was carried out in multiple conditions (FIGS. 33A-33G-see box) and formation of hydroxy-derivatives was assessed by UPLC-qTOF-MS. For each compound its m/z and the m/z of its hydroxylated derivatives are shown. The x-axes show the retention time (RT).
[0080] FIGS. 34A-34B show SlGAME31 in vitro enzyme activity. SlGAME31 expressed and purified from E. coli produced the same isomer (FIG. 34A) found in plants (FIG. 34B) (e.g. tomato line BIL 2037). The chromatogram shows the specific m/z=1050.5 for hydroxytomatine.
[0081] FIGS. 35A-35D show the hydroxylation of SA/SGAs by SmGAME31. Enzymatic reactions were performed with the same set of SA/SGAs as for SlGAME31. Hydroxylated derivatives were obtained for: .alpha.-solamargine (FIG. 35A), solasodine (FIG. 35B), .alpha.-tomatine (FIG. 35C), and dehydrotomatine (FIG. 35D). The enzymatic reaction was carried out in multiple conditions (A-G-see box) and formation of hydroxy-derivatives were assessed by UPLC-qTOF-MS. For each compound, its m/z and the m/z of its hydroxylated derivatives are shown. The x-axes show the retention time (RT).
[0082] FIGS. 36A-36D present data showing SlGAME31 downregulation alters SGA profile in red ripe tomato fruit. The figures show SlGAME31 gene expression (qRT-PCR) in SlGAME31-RNAi (silencing) (FIG. 36A) and SlGAME31-Cosup (co-suppression) (FIG. 36B) tomato lines. WT: wild-type. Tomato independent T.sub.0 primary transgenic plants, SlGAME31-RNAi (#17, #18, #19) and SlGAME31-Cosup (#5, #6, #7). FIG. 36C presents a schematic representation of the SGA biosynthetic pathway. FIG. 36D shows changes in SGAs when SlGAME31 is downregulated.
DETAILED DESCRIPTION
[0083] In the following detailed description, numerous specific details are set forth in order to provide a thorough understanding of the genetically modified plants and methods presented herein. However, it will be understood by those skilled in the art that these genetically modified plants and methods may be practiced without these specific details. In other instances, well-known methods, procedures, and components have not been described in detail so as not to obscure the formulations and compositions disclosed herein.
Genetically Modified Plants
[0084] Disclosed herein are genetically modified plants, wherein expression of key genes in the steroidal glycoalkaloids metabolic pathway (biosynthesis pathway of steroidal alkaloids and glycosylated derivatives thereof) have been altered. Altering the expression of these genes results in concomitant alteration in the steroidal alkaloid profile. Changing the production level of steroidal alkaloid can result in improved plants comprising elevated content of steroidal alkaloids having increased resistance to pathogens, or plants having a reduced content of these secondary compounds in the plant edible parts and thus producing improved crops, wherein the improved crop has reduced or eliminated anti-nutritional content. Alternatively, or additionally, controlling the expression of genes disclosed herein may be used for the production of desired steroidal alkaloids for further use, for example in the pharmaceutical industry. In particular, disclosed herein are the means and methods for producing crop plants of the Solanaceae family that are devoid of toxic amounts of deleterious steroidal alkaloids typically present in edible parts of these plants. The plants disclosed herein are thus of significant nutritional and commercial value.
[0085] The Examples presented below demonstrate that unexpectedly by modifying the expression of a gene within the steroidal glycoalkaloid metabolic pathway, the level of at least one steroidal alkaloid, and/or at least one steroidal glycoalkaloid may be altered. For example, silencing of a single gene within the steroidal glycoalkaloid metabolic pathway, for example GAME25 in a tomato plant, resulted in significant reduction in the amount of .alpha.-tomatine concurrent with a significant accumulation of dehydrotomatine and its isomers.
[0086] In one embodiment, disclosed herein is a genetically modified plant comprising at least one cell having an altered expression of at least one gene selected from the group comprising a gene encoding a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) and a gene encoding a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, wherein the genetically modified plant has an altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof compared to a corresponding unmodified plant.
[0087] In some embodiments, disclosed herein is a genetically modified plant comprising an altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof, said plant comprising at least one cell having
[0088] an altered biological activity of at least one enzyme selected from the group comprising a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) and a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof; or
[0089] an altered expression of at least one gene selected from the group comprising a gene encoding a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) and a gene encoding a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof; or
[0090] a combination thereof of an altered biological activity of at least one enzyme selected from the group comprising a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) and a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, and an altered expression of at least one gene selected from the group comprising a gene encoding a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) and a gene encoding a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof; wherein the at least one cell of said genetically modified plant has an altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof compared to a corresponding unmodified plant.
[0091] One of ordinary skill in the art would appreciate that the term "gene" may encompass a nucleic acid (e.g., DNA or RNA) sequence that comprises coding sequences necessary for the production of RNA or a polypeptide. A polypeptide can be encoded by a full-length coding sequence or by any part thereof. The term "parts thereof" when used in reference to a gene refers to fragments of that gene. The fragments may range in size from a few nucleotides to the entire gene sequence minus one nucleotide. Thus, "a nucleic acid sequence comprising at least a part of a gene" may comprise fragments of the gene or the entire gene.
[0092] The skilled artisan would appreciate that the term "gene" optionally also encompasses the coding regions of a structural gene and includes sequences located adjacent to the coding region on both the 5' and 3' ends for a distance of about 1 kb on either end such that the gene corresponds to the length of the full-length mRNA. The sequences which are located 5' of the coding region and which are present on the mRNA are referred to as 5' non-translated sequences. The sequences which are located 3' or downstream of the coding region and which are present on the mRNA are referred to as 3' non-translated sequences.
[0093] In one embodiment, a gene comprises DNA sequence comprising upstream and downstream regions, as well as the coding region, which comprises exons and any intervening introns of the gene. In some embodiments, upstream and downstream regions comprise non-coding regulatory regions. In some embodiments, upstream and downstream regions comprise regulatory sequences, for example but not limited to promoters, enhancers, and silencers. Non-limiting examples of regulatory sequences include, but are not limited to, AGGA box, TATA box, Inr, DPE, ZmUbi1, PvUbi1, PvUbi2, CaMV, 35S, OsAct1, zE19, E8, TA29, A9, pDJ3S, B33, PAT1, alcA, G-box, ABRE, DRE, and PCNA. Regulatory regions, may in some embodiments, increase or decrease the expression of specific genes within a plant described herein.
[0094] In another embodiment, a gene comprises the coding regions of the gene, which comprises exons and any intervening introns of the gene. In another embodiment, a gene comprises its regulatory sequences. In another embodiment, a gene comprises the gene promoter. In another embodiment, a gene comprises its enhancer regions. In another embodiment, a gene comprises 5' non-coding sequences. In another embodiment, a gene comprises 3' non-coding sequences.
[0095] In one embodiment, the skilled artisan would appreciate that DNA comprises a gene, which may include upstream and downstream sequences, as well as the coding region of the gene. In another embodiment, DNA comprises a cDNA (complementary DNA). One of ordinary skill in the art would appreciate that cDNA may encompass synthetic DNA reverse transcribed from RNA through the action of a reverse transcriptase. The cDNA may be single stranded or double stranded and can include strands that have either or both of a sequence that is substantially identical to a part of the RNA sequence or a complement to a part of the RNA sequence. Further, cDNA may include upstream and downstream regulatory sequences. In still another embodiment, DNA comprises CDS (complete coding sequence). One of ordinary skill in the art would appreciate that CDS may encompass a DNA sequence, which encodes a full-length protein or polypeptide. A CDS typically begins with a start codon ("ATG") and ends at (or one before) the first in-frame stop codon ("TAA", "TAG", or "TGA"). The skilled artisan would recognize that a cDNA, in one embodiment, comprises a CDS.
[0096] As used herein, the terms "polynucleotide", "polynucleotide sequence", "nucleic acid sequence", and "isolated polynucleotide" may be used interchangeably herein, having all the same qualities and meanings. These terms encompass nucleotide sequences and the like. A polynucleotide may be a polymer of RNA or DNA or hybrid thereof, that is single- or double-stranded, linear or branched, and that optionally contains synthetic, non-natural or altered nucleotide bases. The terms also encompass RNA/DNA hybrids.
[0097] One of ordinary skill in the art would appreciate that a genetically modified plant may encompass a plant comprising at least one cell genetically modified by man. In some embodiments, the genetic modification includes modification of an endogenous gene(s), for example by introducing mutation(s) deletions, insertions, transposable element(s) and the like into an endogenous polynucleotide or gene of interest. Additionally, or alternatively, in some embodiments, the genetic modification includes transforming at least one plant cell with a heterologous polynucleotide or multiple heterologous polynucleotides. The skilled artisan would appreciate that a genetically modified plant comprising transforming at least one plant cell with a heterologous polynucleotide or multiple heterologous polynucleotides may in certain embodiments be termed a "transgenic plant".
[0098] A skilled artisan would appreciate that a comparison of a "genetically modified plant" to a "corresponding unmodified plant" as used herein encompasses comparing a plant comprising at least one genetically modified cell and to a plant of the same type lacking the modification.
[0099] The skilled artisan would appreciate that the term "transgenic" when used in reference to a plant as disclosed herein encompasses a plant that contains at least one heterologous transcribable polynucleotide in one or more of its cells. The term "transgenic material" encompasses broadly a plant or a part thereof, including at least one cell, multiple cells or tissues that contain at least one heterologous polynucleotide in at least one of cell. Thus, comparison of a "transgenic plant" and a "corresponding non transgenic plant", or of a "genetically modified plant comprising at least one cell having altered expression, wherein said plant comprising at least one cell comprising a heterologous transcribable polynucleotide" and a "corresponding un modified plant" encompasses comparison of the "transgenic plant" or "genetically modified plant" to a plant of the same type lacking said heterologous transcribable polynucleotide. A skilled artisan would appreciate that, in some embodiments, a "transcribable polynucleotide" comprises a polynucleotide that can be transcribed into an RNA molecule by an RNA polymerase.
[0100] One of ordinary skill in the art would appreciate that the terms "transformants" or "transformed cells" include the primary transformed cell and cultures derived from that cell without regard to the number of transfers. All progeny may not be precisely identical in DNA content, due to deliberate or inadvertent mutations. Mutant progeny that have the same functionality as screened for in the originally transformed cell are included in the definition of transformants.
[0101] Transformation of a cell may be stable or transient. The skilled artisan would appreciate that the term "transient transformation" or "transiently transformed" may encompass the introduction of one or more exogenous polynucleotides into a cell in the absence of integration of the exogenous polynucleotide into the host cell's genome. In contrast, the term "stable transformation" or "stably transformed" may encompass the introduction and integration of one or more exogenous polynucleotides into the genome of a cell. The skilled artisan would therefore appreciate that the term "stable transformant" may encompass a cell which has stably integrated one or more exogenous polynucleotides into the genomic or organellar DNA. It is to be understood that an organism or its cell transformed with the nucleic acids, constructs and/or vectors as disclosed herein can be transiently as well as stably transformed.
[0102] The skilled artisan would appreciate that the term "construct" may encompass an artificially assembled or isolated nucleic acid molecule which includes the polynucleotide of interest. In general, a construct may include the polynucleotide or polynucleotides of interest, a marker gene which in some cases can also be a gene of interest and appropriate regulatory sequences. It should be appreciated that the inclusion of regulatory sequences in a construct is optional, for example, such sequences may not be required in situations where the regulatory sequences of a host cell are to be used. The term construct includes vectors but should not be seen as being limited thereto.
[0103] The skilled artisan would appreciate that the term "expression" may encompass the production of a functional end-product e.g., an mRNA or a protein.
[0104] The enzymes encoded by GAME25 and GAME31 are involved in particular steps of cholesterol metabolism (FIGS. 1A-1C, FIGS. 2A-2B, FIGS. 3A-3C). For example, a tomato GAME25 gene (SEQ ID NO: 1) encodes a side chain reductase enzyme, 3-.beta.-hydroxysteroid dehydrogenase/isomerase, (GAME25; SEQ ID NO: 3), which in tomato catalyzes the first step in the multi-step conversion of dehydrotomatidine to tomatidine (FIGS. 1A-1C).
[0105] A homologue of the GAME25 gene was identified in potato (SEQ ID NO: 13), wherein the encoded enzyme (SEQ ID NO: 15) may catalyze the first step in the conversion of solanidine to demissidine (FIGS. 2A-2B).
[0106] In some embodiments, a tomato plant comprises a cultivated tomato plant. In some embodiments, a cultivated tomato plant comprises a Solanum lycopersicum (S. lycopersicum) species of tomato plant. In some embodiment, a tomato plant comprises a wild tomato plant. In some embodiments, a wild tomato plant comprises a Solanum pennellii (S. pennellii) species.
[0107] In one embodiment, a tomato GAME25 gene comprises the nucleic acid sequence of SEQ ID NO: 1. In another embodiment, a tomato GAME25 gene consists of the nucleic acid sequence of SEQ ID NO: 1. In another embodiment, SEQ ID NO: 1 comprises or consists of the following nucleic acid sequence:
TABLE-US-00001 (SEQ ID NO: 1) GTGATATATTTCAAAAAATAATTAAAATACATATATATTGCATACATAAT TCACTTTTAATACATATTGCAGATTTAACTTAAACATTGTTATAAATGGT GATAAATAAAAAAATCGTTAAAATTAGTAATTATTCATTAAACTGCATCT ATTTATGTAATTTTTCCAATTAAAAATCTATTATTTTTTTTCAATCCAAT CCAAACAGGCTCTAAAGCATCAATGTTTTTGAAATTACCAAAATAGCCTC GGTTGTTAAGCGCTTCCTTCTATATATTAGTGAATTCAAACTACAGTCGG TACAAAGGAAGTTATTTACTCTTATAATGGCAAATAAGCTCAGGTATAGC ATAGTTAGTATTTGTTTAAATTAATGGTGCTAATCAGTACATTAATTTAT TTTCTCAAAATTGTGTAATTACATATAATTAAATGTGTTTAATCAAATGT TTTTCTTTTTTATATGCATCGATCCTGTAGGTTGGAGGGCAAAGTAGCTA TAATTACCGGTGCTGCTAGTGGCATTGGAGAAGCAAGTGCTAGATTGTTC GTTGAACATGGTGCTCGTGTCGTCGTCGCCGATATTCAAGATGAACTTGG TCAAAAAGTAGTTGATTCTATCGGATCTGACAAAGCCAGCTACCGGCACT GCGACGTTACAGACGAGAAGCAAGTTGAGGAAACCGTAGCTTACGCGGTA GAGAAATACGGTACTCTTGACATTATGTTTAGTAATGTCGGGACGCTGAA TTTCTGCAGCGTCCTCGACATGGACGTGCTGGCCTTCGATGAGACCATGG CCATCAACGTACGCGGATCCGCGTTAGCGGTTAAGCACGCGGCTAAAGTT ATGGTTGATAAGAAAATTCGGGGATCTATTATATGTAACGCGAGTTTAGA AGGGATTTTAGCTGGGGCCGCTTCGCTCGCCTACATTGCGTCAAAGCACG CAGTGGTAGGCATTATAAAAGCGGCCGCACGTGAACTGGGTCCACATGGG ATAAGGGTGAATGGGGTGTCGCCCTATGGAATAGCGACGCCCCTTGTGAC TAAGGCGTATGGACTGGATGCGGCTCTATTGGAAGAAGCAATTTACGGTA ATGGACACTTGAAAGGAGTTAAGTTGAGCACGATGCATGTAGCACAATCA GCACTTTTTTTGGCGTCTGATGAATCTGCTTATACAAGTGGTCAAAATTT AGCTGTTGATGGTGGACTAAGTTCTATTTTGAAGCTACAATAAATTGTCA CGCTATTTGTGTTGGCGTGCTGTGGCGTGGGCCTTAATCCTCACTCTCTT GTGTCTGTACTTCTGTTTCATCTCGTTTCGTTTCAAATTTTCAACTTAAT AATACTCTCATATTTTATGCGATATTTTTCAGATTTATACTAAGTTTTTT ATAGATATTTTAAACGTTGTGACTTAAAAAGATATAAATTTCATTTTTTT AAAATTAAAAATTTTATG.
[0108] In one embodiment, a potato comprises a cultivated potato plant or a wild potato plant.
[0109] In some embodiments, a potato plant comprises a cultivated potato plant. In some embodiments, a cultivated potato plant comprises a Solanum tuberosum (S. tuberosum) species of potato plant. In some embodiment, a potato plant comprises a wild potato plant. In some embodiments, a wild potato plant comprises a Solanum pennellii (S. pennellii) species.
[0110] In another embodiment, a potato GAME25 gene comprises the nucleic acid sequence of SEQ ID NO: 13. In another embodiment, a potato GAME25 gene consists of the nucleic acid sequence of SEQ ID NO: 13. In another embodiment, SEQ ID NO: 13 comprises or consists of the following nucleic acid sequence:
TABLE-US-00002 (SEQ ID NO: 13) AAAAAATTTAACATACAGTTGCTGCAAAGGAAGCTACCTACTCGTATAAT GGCAAATAAGCTCAGGTACTTAATTAGTACATTAATTTCTTTCTTTCTTT TCTCAAATTGTATATGAGAATTAAATGTGTATTTTTAGCTTTAATCAAAT GTTTTTGTGGTATATTATATGCATCGTGTAGGTTGGAGGGCAAAGTGGCT ATAATTACAGGTGCTGCAAGTGGCATTGGAGAAGCAAGTGCTAGATTGTT CGCCGAACATGGTGCTCGTATTGTCGTAGCCGATATTCAAGATGAACTTG GTCTGAAAGTAGTTGAATCTATCGGAGCTGACAAAGCCAGCTACCGACAC TGCGACGTTACAGACGAGAAGCAAGTTGAGGATACCGTAGCTTACACGGT AGAGAAATACGGTACTCTTGACATCATGTTTAGTAATGTTGGGACGCTGA ATTTTTGCAGCGTCCTGGACATGGACGTGATGGTCTTCGATAAGACGATG GCCATCAACGCACGAGGATCCGCGTTAGCGGTCAAGCACGCGGCTAGATT TATGGTTGATAAGAAAATTCGGGGATCCATTATATGCAACGCGAGTTTAG ATGGTATTGTAGCTGGGGCCACTTCGCTTGCCTACATTGCGTCAAAGCAC GCAGTTGTAGGCATTGTGAAAGCGGCCGCACGTGACCTAGGTCCATACGG GATAAGGGTGAATGGGGTGTCGCCATATGGAATAGCGACGCCCCTGGTGT GCAAAGCGTATGGGTTGGATGCGGGTCCATTGGAAGCAGCAATATATGGA AATGGAAACTTGAAAGGTGTTAGGTTGAGCACGATGCATGTAGCACAATC AGCACTTTTCTTGGCGTCTGATGAATCTGCTTACACAAGTGGTCAAAATT TAGCTGTTGATGGTGGACTTAGTTCTATTTTGAAGGTACAATAGATTGTC ACTCTATTGTGCTGGTGTGCTGTGATGTGTGCATTAGTTCTATTTTGAAG CTACAATAATTCCTTTGTCATGTAGTACTGTTTATCTTGTTTCATTTCGA ATTTTCAACTTAAATAATATTCTCTCACAG.
[0111] In one embodiment, a tomato GAME25 cDNA comprises the nucleic acid sequence of SEQ ID NO: 2. In another embodiment, a tomato GAME25 cDNA consists of the nucleic acid sequence of SEQ ID NO: 2. In another embodiment, SEQ ID NO: 2 comprises or consists of the following nucleic acid sequence:
TABLE-US-00003 (SEQ ID NO: 2) ATGGCAAATAAGCTCAGGTTGGAGGGCAAAGTAGCTATAATTACCGGTGC TGCTAGTGGCATTGGAGAAGCAAGTGCTAGATTGTTCGTTGAACATGGTG CTCGTGTCGTCGTCGCCGATATTCAAGATGAACTTGGTCAAAAAGTAGTT GATTCTATCGGATCTGACAAAGCCAGCTACCGGCACTGCGACGTTACAGA CGAGAAGCAAGTTGAGGAAACCGTAGCTTACGCGGTAGAGAAATACGGTA CTCTTGACATTATGTTTAGTAATGTCGGGACGCTGAATTTCTGCAGCGTC CTCGACATGGACGTGCTGGCCTTCGATGAGACCATGGCCATCAACGTACG CGGATCCGCGTTAGCGGTTAAGCACGCGGCTAAAGTTATGGTTGATAAGA AAATTCGGGGATCTATTATATGTAACGCGAGTTTAGAAGGGATTTTAGCT GGGGCCGCTTCGCTCGCCTACATTGCGTCAAAGCACGCAGTGGTAGGCAT TATAAAAGCGGCCGCACGTGAACTGGGTCCACATGGGATAAGGGTGAATG GGGTGTCGCCCTATGGAATAGCGACGCCCCTTGTGACTAAGGCGTATGGA CTGGATGCGGCTCTATTGGAAGAAGCAATTTACGGTAATGGACACTTGAA AGGAGTTAAGTTGAGCACGATGCATGTAGCACAATCAGCACTTTTTTTGG CGTCTGATGAATCTGCTTATACAAGTGGTCAAAATTTAGCTGTTGATGGT GGACTAAGTTCTATTTTGAAGCTACAATAA.
[0112] In another embodiment, a tomato GAME25 cDNA comprises the nucleic acid sequence of SEQ ID NO: 11. In another embodiment, a tomato GAME25 cDNA consists of the nucleic acid sequence of SEQ ID NO: 11. In another embodiment, SEQ ID NO: 11 comprises or consists of the following nucleic acid sequence:
TABLE-US-00004 (SEQ ID NO: 11) ATGGCAAATAAGCTCAGGTTGGAGGGCAAAGTAGCTATAATTACTGGTGC TGCTAGTGGCATTGGAGAGGCAAGTGCTAGATTGTTCGTTGAACATGGTG CTCGTGTCGTCGTCGCCGATATTCAAGATGAACTTGGTCAAAAAGTAGTT GATTCTATCGGAGCTGACAAAGCCAGCTACCGGCACTGCGACGTTACAGA CGAGAAGCAAGTTGAGGAAACCGTAGCCTACGCGGTAGAGAAATACGGTA CTCTTGACATTATGTTTAGTAATGTCGGGACGCTGAATTTCTGCAGCGTC CTCGACATGGACGTGATGGCCTTCGATGAGACGATGGCCATCAACGTACG TGGATCCGCGCTAGCGGTTAAGCACGCGGCTAAAGTTATGGTTGATAAGA AAATTCGGGGATCTATTATATGTAACGCGAGTTTAGAGGGGATTTTAGCT GGGGCCGCTTCGCTTGCCTACATTGCGTCAAAGCACGCAGTCGTAGGCAT AATAAAAGCGGCCGCACGTGAACTGGGTCCACATGGGATAAGGGTGAATG GGGTGTCGCCATATGGAATAGCGACGCCCCTGGTGTGTAAGGCGTATGGA CTGGATGCGGCTCTATTGGAAGAAGCAATTTATGGTAATGGACACTTGAA AGGTGTTAAGTTGAGCACGATGCATGTAGCACAATCAGCACTTTTTTTGG CGTCTGATGAATCTGCTTACACAAGTGGTCAAAATTTAGCTGTTGATGGT GGACTAAGTTCTATTTTGAAGCTACAATAA.
[0113] In another embodiment, a potato GAME25 cDNA comprises the nucleic acid sequence of SEQ ID NO: 14. In another embodiment, a potato GAME25 cDNA consists of the nucleic acid sequence of SEQ ID NO: 14. In another embodiment, SEQ ID NO: 14 comprises or consists of the following nucleic acid sequence:
TABLE-US-00005 (SEQ ID NO: 14) ATGGCAAATAAGCTCAGGTTGGAGGGCAAAGTGGCTATAATTACAGGTGC TGCAAGTGGCATTGGAGAAGCAAGTGCTAGATTGTTCGCCGAACATGGTG CTCGTATTGTCGTAGCCGATATTCAAGATGAACTTGGTCTGAAAGTAGTT GAATCTATCGGAGCTGACAAAGCCAGCTACCGACACTGCGACGTTACAGA CGAGAAGCAAGTTGAGGATACCGTAGCTTACACGGTAGAGAAATACGGTA CTCTTGACATCATGTTTAGTAATGTTGGGACGCTGAATTTTTGCAGCGTC CTGGACATGGACGTGATGGTCTTCGATAAGACGATGGCCATCAACGCACG AGGATCCGCGTTAGCGGTCAAGCACGCGGCTAGATTTATGGTTGATAAGA AAATTCGGGGATCCATTATATGCAACGCGAGTTTAGATGGTATTGTAGCT GGGGCCACTTCGCTTGCCTACATTGCGTCAAAGCACGCAGTTGTAGGCAT TGTGAAAGCGGCCGCACGTGACCTAGGTCCATACGGGATAAGGGTGAATG GGGTGTCGCCATATGGAATAGCGACGCCCCTGGTGTGCAAAGCGTATGGG TTGGATGCGGGTCCATTGGAAGCAGCAATATATGGAAATGGAAACTTGAA AGGTGTTAGGTTGAGCACGATGCATGTAGCACAATCAGCACTTTTCTTGG CGTCTGATGAATCTGCTTACACAAGTGGTCAAAATTTAGCTGTTGATGGT GGACTTAGTTCTATTTTGAAGGTACAATAG.
[0114] In one embodiment, a tomato GAME25 polypeptide comprises the amino acid sequence set forth in SEQ ID NO: 3. In another embodiment, a tomato GAME25 polypeptide consists of the amino acid sequence set forth in SEQ ID NO: 3. In another embodiment, SEQ ID NO: 3 comprises or consists of the following amino acid sequence:
TABLE-US-00006 (SEQ ID NO: 3) MANKLRLEGKVAIITGAASGIGEASARLFVEHGARVVVADIQDELGQKVV DSIGSDKASYRHCDVTDEKQVEETVAYAVEKYGTLDIMFSNVGTLNFCSV LDMDVLAFDETMAINVRGSALAVKHAAKVMVDKKIRGSIICNASLEGILA GAASLAYIASKHAVVGIIKAAARELGPHGIRVNGVSPYGIATPLVTKAYG LDAALLEEAIYGNGHLKGVKLSTMHVAQSALFLASDESAYTSGQNLAVDG GLSSILKLQ.
[0115] In another embodiment, a tomato GAME25 polypeptide comprises the amino acid sequence set forth in SEQ ID NO: 12. In another embodiment, a tomato GAME25 polypeptide consists of the amino acid sequence set forth in SEQ ID NO: 12. In another embodiment, SEQ ID NO: 12 comprises or consists of the following amino acid sequence:
TABLE-US-00007 (SEQ ID NO: 12) MANKLRLEGKVAIITGAASGIGEASARLFVEHGARVVVADIQDELGQKVV DSIGADKASYRHCDVTDEKQVEETVAYAVEKYGTLDIMFSNVGTLNFCSV LDMDVMAFDETMAINVRGSALAVKHAAKVMVDKKIRGSIICNASLEGILA GAASLAYIASKHAVVGIIKAAARELGPHGIRVNGVSPYGIATPLVCKAYG LDAALLEEAIYGNGHLKGVKLSTMHVAQSALFLASDESAYTSGQNLAVDG GLSSILKLQ.
[0116] In another embodiment, a potato GAME25 polypeptide comprises the amino acid sequence set forth in SEQ ID NO: 15. In another embodiment, a potato GAME25 polypeptide consists of the amino acid sequence set forth in SEQ ID NO: 15. In another embodiment, SEQ ID NO: 15 comprises or consists of the following amino acid sequence:
TABLE-US-00008 (SEQ ID NO: 15) MANKLRLEGKVAIITGAASGIGEASARLFAEHGARIVVADIQDELGLKVV ESIGADKASYRHCDVTDEKQVEDTVAYTVEKYGTLDIMFSNVGTLNFCSV LDMDVMVFDKTMAINARGSALAVKHAARFMVDKKIRGSIICNASLDGIVA GATSLAYIASKHAVVGIVKAAARDLGPYGIRVNGVSPYGIATPLVCKAYG LDAGPLEAAIYGNGNLKGVRLSTMHVAQSALFLASDESAYTSGQNLAVDG GLSSILKVQ.
[0117] In one embodiment, a GLYCOALKALOID METABOLISM 25 (GAME25) polypeptide comprises a 3-.beta.-hydroxysteroid dehydrogenase/isomerase enzyme activity. In another embodiment, a3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) enzyme comprises the amino acid sequence set forth in any one of SEQ ID NO: 3, SEQ ID NO: 12, and SEQ ID NO: 15, or a protein homologue thereof, wherein said protein homologue is at least 80% homologous to any of SEQ ID NO: 3, SEQ ID NO: 12, and SEQ ID NO: 15.
[0118] One of ordinary skill in the art would recognize that a 3-.beta.-hydroxysteroid dehydrogenase/isomerase is a side chain reductase enzyme. In one embodiment, homologues of the GAME25 enzyme comprise a 3-.beta.-hydroxysteroid dehydrogenase/isomerase enzyme activity. In some embodiments, a homologue also encompasses deletion, insertion, or substitution variants, including an amino acid substitution, thereof and biologically active polypeptide fragments thereof. In one embodiment, the variant comprises conservative substitutions, or deletions, insertions, or substitutions that do not significantly alter the three dimensional structure of the GAME25 enzyme. In another embodiment, the deletion, insertion, or substitution does not alter the function of interest of the GAME25 enzyme, which in one embodiment wherein said plant is a tomato plant is a first step in the multi-step conversion of dehydrotomatidine to tomatidine. In another embodiment, the deletion, insertion, or substitution does not alter the function of interest of the GAME25 enzyme, which in another embodiment wherein said plant is a potato plant is a first step in the multi-step conversion of solanidine to demissidine.
[0119] In some embodiments, when a genetically modified plant is a tomato plant, the altered at least one steroidal alkaloid or a glycosylated derivative thereof is selected from the group comprising .alpha.-tomatine, .alpha.-tomatine isomer (1 and 2), .alpha.-tomatine isomer 2, hydroxytomatine, acetoxytomatine, dehydrotomatidine, dehydrotomatine, dehydrotomatine isomer 1, dehydrotomatine+4-hexose, or any derivatives thereof, or any combination thereof. In some embodiments, when a genetically modified plant is an eggplant plant, the altered at least one steroidal alkaloid or a glycosylated derivative thereof is selected from the group comprising .beta.-soldulcine, soladulcine A, and the unsaturated or saturated steroidal saponin or glycosylated derivative thereof is selected from dioscin, diosgenin, parillin, sarasapogenin, or any derivatives thereof, or any combination thereof.
[0120] In another embodiment, the disclosure includes a homologue of a GAME25 enzyme. In another embodiment, the disclosure includes a homologue of a GAME25 enzyme having a 3-.beta.-hydroxysteroid dehydrogenase/isomerase enzyme activity. In another embodiment, homologues comprise polypeptides which are at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 87%, at least 89%, at least 91%, at least 93%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% homologous to a GAME25 enzyme as determined using BlastP software of the National Center of Biotechnology Information (NCBI) using default parameters.
[0121] In another embodiment, the amino acid sequence of a GAME25 enzyme homologue is at least 70% homologous to a GAME25 amino acid sequence or a peptide thereof, described herein. In another embodiment, the amino acid sequence of a GAME25 enzyme homologue is at least 80% homologous a GAME25 amino acid sequence or a peptide thereof, described herein. In another embodiment, the amino acid sequence of a GAME25 enzyme homologue is at least 90% homologous a GAME25 amino acid sequence or a peptide thereof, described herein. In another embodiment, the amino acid sequence of a GAME25 enzyme homologue is at least 95% homologous a GAME25 amino acid sequence or a peptide thereof, described herein. In another embodiment, the amino acid sequence of a GAME25 enzyme homologue is at least 98% homologous a GAME25 amino acid sequence or a peptide thereof, described herein.
[0122] A skilled artisan would appreciate that the terms "polypeptides", "polypeptide", "enzyme" or grammatical equivalents thereof, may be used interchangeably to encompass amino acid sequences or proteins and may encompass polymers of amino acids of any length. These polypeptides may in some embodiments include proteins which have been modified post-translationally by reactions such as glycosylation, phosphorylation, acetylation or protein processing. The structure of the polypeptide may be modified, for example, by substitutions, deletions or insertions of amino acids and fusion with other proteins while retaining its biological activity.
[0123] In some embodiment, homologues of GAME25 enzyme are produced in plants, wherein said plants comprise a cultivated tomato plant, a wild tomato plant, a cultivated potato plant, a wild potato plant, or a bittersweet plant.
[0124] In another embodiment, a3-.beta.-hydroxysteroid dehydrogenase/isomerase comprises the amino acid sequence set forth in any one of SEQ ID NO: 3, SEQ ID NO: 12, or SEQ ID NO: 15.
[0125] In one embodiment, the 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) polypeptide is encoded by a gene comprising the nucleotide sequence set forth in any one of SEQ ID NO: 1, SEQ ID NO. 13, or a gene homologue thereof, wherein said gene homologue is at least 80% homologous to any of SEQ ID NO: 1, SEQ ID NO. 13. In another embodiment, the 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) polypeptide is encoded by a cDNA comprising the nucleotide sequence set forth in any one of SEQ ID NO: 2, SEQ ID NO: 11, or SEQ ID NO. 14, or a gene homologue thereof, wherein said gene homologue is at least 80% homologous to any of SEQ ID NO: 2, SEQ ID NO: 11, or SEQ ID NO. 14.
[0126] In another embodiment, the 3-.beta.-hydroxysteroid dehydrogenase/isomerase is encoded by a gene comprising the nucleotide sequence set forth in SEQ ID NO: 1, SEQ ID NO. 13. In another embodiment, a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) is encoded by the nucleic acid sequence set forth in any one of SEQ ID NO: 2, SEQ ID NO: 11, or SEQ ID NO. 14, or a polynucleotide homologue thereof, wherein said polynucleotide homologue is at least 80% homologous to any of SEQ ID NO: 2, SEQ ID NO: 11, or SEQ ID NO. 14. In another embodiment, a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) is encoded by the nucleic acid sequence set forth in any one of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 11, SEQ ID NO: 13, or SEQ ID NO. 14, or a polynucleotide homologue thereof, wherein said polynucleotide homologue is at least 80% homologous to any of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 11, SEQ ID NO: 13, or SEQ ID NO. 14.
[0127] In some embodiments, said 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) is encoded by a gene comprising the polynucleotide sequence set forth in any one of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 11, SEQ ID NO: 13, and SEQ ID NO: 14, or a gene homologue thereof, wherein said gene homologue is at least 80% homologous to any of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 11, SEQ ID NO: 13, and SEQ ID NO: 14.
[0128] A skilled artisan would appreciate that a "homologue" of a nucleic acid sequence as disclosed herein, for example a homologue of a gene sequence or a homologue of a cDNA sequence, comprises a percent homology with a corresponding nucleic acid sequence disclosed herein.
[0129] Homology is, in some embodiment, determined by computer algorithm for sequence alignment, by methods well described in the art. For example, computer algorithm analysis of nucleic acid sequence homology may include the utilization of any number of software packages available, such as, for example, the BLAST, DOMAIN, BEAUTY (BLAST Enhanced Alignment Utility), GENPEPT and TREMBL packages.
[0130] In one embodiment, homologues of a GAME25 gene or a GAME25 cDNA encode a polypeptide comprising a 3-.beta.-hydroxysteroid dehydrogenase/isomerase enzyme activity. In some embodiments, a homologue also encompasses deletion, insertion, or substitution variants, thereof, and biologically active polynucleotide fragments thereof. In one embodiment, the variant comprises conservative substitutions, or deletions, insertions, or substitutions that do not significantly alter the three dimensional structure of the encoded GAME25 enzyme. In another embodiment, the deletion, insertion, or substitution does not alter the function of interest of the encoded GAME25 enzyme, which in one embodiment wherein said plant is a tomato plant, is a first step in the multi-step conversion of dehydrotomatidine to tomatidine. In another embodiment, the deletion, insertion, or substitution does not alter the function of interest of the encoded GAME25 enzyme, which in another embodiment wherein said plant is a potato plant, is a first step in the multi-step conversion of solanidine to demissidine.
[0131] In another embodiment, the disclosure includes a homologue of a GAME25 gene. In another embodiment, the disclosure includes a homologue of a GAME25 cDNA. In another embodiment, the disclosure includes a homologue of a GAME25 gene encoding an enzyme having a 3-.beta.-hydroxysteroid dehydrogenase/isomerase enzyme activity. In another embodiment, the disclosure includes a homologue of a GAME25 cDNA encoding an enzyme having a 3-.beta.-hydroxysteroid dehydrogenase/isomerase enzyme activity. In another embodiment, homologues comprise a polynucleotide sequence which is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 87%, at least 89%, at least 91%, at least 93%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% homologous to a GAME25 gene nucleic acid sequence.
[0132] In one embodiment, the phrase "a polynucleotide sequence" encompasses a single or double stranded nucleic acid sequence which is isolated and provided in the form of an RNA sequence, a complementary polynucleotide sequence (cDNA), a genomic polynucleotide sequence and/or a composite polynucleotide sequences (e.g., a combination of the above).
[0133] In one embodiment, a "complementary polynucleotide sequence" encompasses a sequence, which results from reverse transcription of messenger RNA using a reverse transcriptase or any other RNA-dependent DNA polymerase. In one embodiment, the sequence can be subsequently amplified in vivo or in vitro using a DNA polymerase.
[0134] In one embodiment, a "genomic polynucleotide sequence" encompasses a sequence derived (isolated) from a chromosome and thus it represents a contiguous portion of a chromosome.
[0135] In one embodiment, a "composite polynucleotide sequence" encompasses a sequence, which is at least partially complementary and at least partially genomic. In one embodiment, a composite sequence can include some exonal sequences required to encode the polypeptide disclosed herein, as well as some intronic sequences interposing therebetween. In one embodiment, the intronic sequences can be of any source, including of other genes, and typically will include conserved splicing signal sequences. In one embodiment, intronic sequences include cis-acting expression regulatory elements.
[0136] In another embodiment, the nucleic sequence of a GAME25 gene homologue is at least 70% homologous to a GAME25 nucleic acid sequence or a fragment thereof, described herein. In another embodiment, the nucleic sequence of a GAME25 gene homologue is at least 80% homologous to a GAME25 nucleic acid sequence or a fragment thereof, described herein. In another embodiment, the nucleic sequence of a GAME25 gene homologue is at least 90% homologous to a GAME25 nucleic acid sequence or a fragment thereof, described herein. In another embodiment, the nucleic sequence of a GAME25 gene homologue is at least 95% homologous to a GAME25 nucleic acid sequence or a fragment thereof, described herein. In another embodiment, the nucleic sequence of a GAME25 gene homologue is at least 98% homologous to a GAME25 nucleic acid sequence or a fragment thereof, described herein.
[0137] In another embodiment, the nucleic sequence of a GAME25 cDNA homologue is at least 70% homologous to a GAME25 nucleic acid sequence or a fragment thereof, described herein. In another embodiment, the nucleic sequence of a GAME25 cDNA homologue is at least 80% homologous to a GAME25 nucleic acid sequence or a fragment thereof, described herein. In another embodiment, the nucleic sequence of a GAME25 cDNA homologue is at least 90% homologous to a GAME25 nucleic acid sequence or a fragment thereof, described herein. In another embodiment, the nucleic sequence of a GAME25 cDNA homologue is at least 95% homologous to a GAME25 nucleic acid sequence or a fragment thereof, described herein. In another embodiment, the nucleic sequence of a GAME25 cDNA homologue is at least 98% homologous to a GAME25 nucleic acid sequence or a fragment thereof, described herein.
[0138] In one embodiment, homologues of a GAME25 gene are expressed in plants, wherein said plants comprise cultivated tomato, wild tomato, cultivated potato, wild potato, aubergine, sweet or chili pepper plants, or bittersweet plants. In one embodiment, homologues of a GAME25 cDNA are expressed in plants, wherein said plants comprise cultivated tomato, wild tomato, cultivated potato, wild potato, aubergine, sweet or chili pepper plants, or bittersweet plants.
[0139] In one embodiment, a GLYCOALKALOID METABOLISM 31 (GAME31) polypeptide comprises a 2-oxoglutarate-dependent dioxygenase enzyme activity. In one embodiment, a GAME31 polypeptide is encoded by a GAME31 gene. In another embodiment, a GAME31 polypeptide is encoded by a GAME31 cDNA.
[0140] In one embodiment, a tomato GAME31 gene comprises the nucleic acid sequence of SEQ ID NO: 16. In another embodiment, a tomato GAME31 gene consists of the nucleic acid sequence of SEQ ID NO: 16. In another embodiment, SEQ ID NO: 16 comprises or consists of the following nucleic acid sequence:
TABLE-US-00009 (SEQ ID NO: 16) TGACTATAATTGATACTCAATCTGTTGAAATATAATGAACCAATTCTTAT CAAAACACAGTGGAGTACAAGTAATCACGTTGGTTCCTATGAAATGGTTC ATCTATTTCCCATTATATATAGGCTACTTATTTCCTCACCTATAAAGTAA AAAACTTTCTAGTGTTTTCTTCTTTCTTTTGTTTTTTTCTCTTTGCTCAT ATTCTAAAAATATTTCATCAATGGCATCTATCAAATCAGTTAAAGTTCCT ACTATAGATTTTTCCAATTATCAAGAGCTAAAACCAAACACTCCACTATG GGAATCCACAAAAATTCAAGTTTTTGAAGCTTTACAAGAATATGGTTGTT TTGAAGCAATATATGATAAAGTTTCAAAGGAAATTAGAGAGGAAACATTT GATATGTCAAAAGAAATATTTGAATTTCCTTTAGAGACTAAAGTGAAAAA TATCTCAGAAAAACCAATGCATGGCTATATGGGGATGATTCCACAATTGC CATTGTATGAGAGTTTGTGTATTCCTGATTTGCTTAATCCTCAAAGTCTT GAAAAATTTTCTAATATCTTTTGGCCTCAGGGTAATCAACATTTCTGGTA TGTTTACTTTTATTTCTTTTTCATTTTTGTTTTCTTATTATCTTTAAATT TTGTTCTAGTGGAACTGTTCAAAAGCTACTATCTTTAGAAATAATAATTT TTATTAGCTTAGTTGATTGATTATGCGATATTATTAATAGCTTAAAAAAA TAATTTTTATTAGCTTAGAAATAATAATTTTTATTAACTTAGTTGATTGA CTATGCGATATTATTAATAGCTTAAAAGAGCTTAGTTGATCAGACTACGA AAGTAAAATAAAAAGAGACGGAAGTCTGTGTCTCGCATCTATTTTTTATT GCACCGTTTAAACTAAATAAAATATAGACAACAACATCAAAATATTTGGT AGGAAGACACGATTTATTCAACAGAAATATAGACAACAACATTAAAGTAT TTGGTACATGAAATCACTATCCAATAAGTGACAGTTCGTTGGCCTTCTCA TTTTTTATAAAATAAATAGAAACACAAGAGTTGTCTCAAGTGAAAAAATT GAATTATGTTCAACCTTCTTCATATGTTTATACTAATATTACATGAGCGT TAATTTTTGCAGCAATTTGATAAAATCTTATTCTAATCCACTTGTGGAAT TGGATGGGATGTTGAAAAGGATGATTTCGGAGAATTTGGGATTGAAAAAT CACATTGATGAATTATTGAATGCCAATTACTTCCTATTTAGATTTACACA TTATAAGGGATCATCAATTGCTAGTGGAGATGAAAATAATAAAGCTGCTG GATTGGGTGGCCACACGGATGGTAACTTCTTGACTTTTATATCGCAAAAT CAAGTTAATGGATTGCAAATCAACAAAAATGGAGAATGGATTGATGTGAT TATTTCACCAAATTCTTACGTTGTTTTGGCCGGTGATTCCTTCAAAGTAA GTATTTTAAGTTTTGAACTAGTGTTACTTATCTTGTTGGGAACTGTTTTG TTTGATTTTTAAAAGAAAAAATATTAAATGATCAAAAAAATTATAATATC TTTTTTGTTTTAAGGTTAAATAAATTGATTTAAAAATTTCATTTTTAATT AAAAGAGGGTAGTAAAATGCTTAAAAAGCTAAAATAATTTAGTGTGAAAT ATATTATTTTATTATCATTCTAATCAAAATTTCTGGTCACACCTTATAGC ATAGGGGTTTCAGAGGGCCCCGAGATATTTTGTTTTGATCTTATATTTCT CGAATCTATGAAAATGTTATTCCACTAGTGTTTATATTATTTTCTGAAAT GCATATTTTTGAATGATTTGATATATGCTCAATATTTTCATGCAAAACTG AAAATGAATTTTGGTATTATTGACCGTATTTGTATTGTTTTACTCTCCAA AAATATTATCGATCGCATCTATCTTTGTATTTATACAGGCTTGGACAAAT GGTCGATTGCATTCACCTCTCCACAGAGTAACAATGTCCGGACAAAATGA TAGACTCTCCATTCAATTGTTTTCATTATCAAAGCCAGGTCACTTCATCC AGGCACCAAAAGAACTAGTAGATGAAGAACACCCATTACTCTTCAAGCCA TTTGAAATTCTTGAATTATTCAAGTATGGTACCACAGAAGCTGGCTATAC AGCTCCTCCAAGTGATCTTTTCAAGATTTATTGTGGTGTTTGATATGCTA ATTGTTGAATTTCCGCTTCAACAAGCAACTTTTCTAATGAGTTTCATCTT GTTTTTTTAAGTAGTATGCATTTTATGTTTGAATTGTTGCAGTTGGCAAT TCATGTTTAATTTGTTTTTGTTTTTTTGAGAAAATATTTCCAATGGGTTT CGTTGGAAATTCGTCTTGTTTTTTTTTTTCAAGTAGTGTACATCTTATTT TTGGATTGTTGATGTTGAGCGCTAATGTTTAATTTGTTTGTGTTTTGAAG AGGATGATTATACTCTTTAAGAGGATTCACCGTAATCTTTTAGTATTATT TG.
[0141] The start codon (ATG) for SEQ ID NO: 16 starts at nucleotide 221 of SEQ ID NO: 16. The coding sequence present within SEQ ID NO: 16 ends at nucleotide 2243. Therefore, the skilled artisan would recognize that the coding sequence comprised in SEQ ID NO: 16 is found between nucleotides 221-2243.
[0142] In one embodiment, a tomato GAME31-like gene comprises the nucleic acid sequence of SEQ ID NO: 19. In another embodiment, a tomato GAME31-like gene consists of the nucleic acid sequence of SEQ ID NO: 19. In another embodiment, SEQ ID NO: 19 comprises or consists of the following nucleic acid sequence:
TABLE-US-00010 (SEQ ID NO: 19; SlGAME31-like1) ATGGCATCTACCAAATTAGTTAAAGTTCCCACAATAGATTTTTCAAATCA TCAAGATCTAAAACCAAACACTCCACTATGGGAATCCAAAAAAATTCAAG TTTTTGAAGCTTTGCAAGAATATGGTTGTTTTGAAGCAATTTATGATAAA GTTCCAAAAGATATTAGAGAGGAAACATTTAGTATTTCAAAAGAAATATT TGAATTTCCTTTAGAGACTAAATTGAAAAATATTTCAGAAAAACCAACGC ATGGATATATGGGAATGATTCCACAATTGCCATTGTATGAGAGTTTGTGT ATTCCTGATTTGCTTAATCCTAAAAGTCTTCAAAGTTTTGCTAATATCTT TTGGCCTCAGGGTAACCAACATTTCTGGTATGTTTACTTATGTTTTTATT TCGCCCTAGCAGAAGTGTTCAAAAGTACGACATTAGAAATTCTTAGTGAC TTAATTGATTGA
[0143] In one embodiment, a tomato GAME31-like gene comprises the nucleic acid sequence of SEQ ID NO: 22. In another embodiment, a tomato GAME31-like gene consists of the nucleic acid sequence of SEQ ID NO: 22. In another embodiment, SEQ ID NO: 22 comprises or consists of the following nucleic acid sequence:
TABLE-US-00011 (SEQ ID NO: 22; SlGAME31-like2) TGAGATGTTGAAAAGGATGATTTCGGAGAATTTGGGATTAAAAAATCACA TTGATGAATTATTGAATGCCAATTACATCCTATTTAGATTTACACAGTAT AAGGGATCATCAATTGCTAGTGGAGATGAAAATAATAAAGCAGCTGGATT GGGTGGCCACACAGATGGTAACTTCTTGTCTATTATATCACAAAATGAAG TTAATGGATTGCAAATCAACAAAAATGGAGAGTGGATTGATGTCAACATT TCGCCAAATTCTTATGTTGTTTTATCCGGTGATTCCTTCACAGTAAGTGT TAAGTTTTGAGCTAGTGTTATTATCTTGTTGGGAACTGTGTTGTTTGATT TTCTAAAGGGATAATGCTAAATGACAAGAAACTCAAAAAATCAATAAGAT ATTTGTTGAATCTTACGTCTCTAAATATATTATCATGCTAGTGTTAATTA TTTCCCGAAATGCATATTTTTGAAGAATCTGACATACTGAGTGATATTCT GGAAGAGTCCAACCAAGACACTTTGTTGAAACTACATGCTCAATATTTTC ATGCAAAACTGAAAATGAATCTTGATATTTGTTGACCCTATGTTGCTCTA TTCTCCAAAAATACTACTGCGACTATCTTTGTATTTATGCAGGCATGGAC AAATGGCCGATTGCATTCTCCTGTTCATAGAGTTGAAATGCCCAGAGGAA GTGATAGATATTCCATTCAATTATTTTCATTATCAAAACCAGGTCACTTC ATCGAGGCACCAAAAGAAATGGTGGATGAAGAACACCCTTTGCTTTTCAA GCCATTTGAAATTCTTGGATTACTTGGGTATGGTGCCACAGAAGCTGGCT ATACAACTCCTCCCAGTGATCTTTTCAAGGCATATTGCGGTGTCTGATAT GCTAATTGCGAATTTCCATTTCTATTAGAATAAAGTTAGTATTTATGAGA TTTTTGTTGGTAATTCATGTTTAATTGGTTTGTGTTTTTTTGGAAAATAT TTCTAATGTGTTCCGTTGGAAATTCGTGTGCATCTTATGTTTGGATTGTT GGTATTGGGAATTCATGTTTAATTTGTTTGTGTTCTTGGGCAAATAATAA ATTTGAAGCGGAT.
[0144] In one embodiment, a tomato GAME31-like gene comprises the nucleic acid sequence of SEQ ID NO: 25. In another embodiment, a tomato GAME31-like gene consists of the nucleic acid sequence of SEQ ID NO: 25. In another embodiment, SEQ ID NO: 25 comprises or consists of the following nucleic acid sequence:
TABLE-US-00012 TGACTAGAAATAGACATAAAACCCTGTACTTTTTGACACACATGTAATAG CACTTTCTCTATCTAATACGCAACTCTTTATTAATTTTGCGTAAATTTTG AGCTATTTCCCATTATATATAGGCTACTTATTTCCTCACCTCTTAAGTAA AAAACTTTCAAGTGTTTCTTCTTTCTTTTATTTCTCTTTGTTCACATATT CTAAAAATATTTCATCAATGGCATCTATCAAATCAGTTAAAGTTCCTACT ATAGATTTTTCCAATTATCAAGAGCTAAAACCAAACACTCCACTATGGGA ATCCACAAAAATTCAAGTTTTTGAAGCTTTTCAAGAATATGGTTGTTTTG AAGCAATATATGATAAAGTTCCAAATGAAATTAGAGAGGAAACATTTGAT ATGTCAAAAGAAATATTTGAATTTCCTTTAGATACTAAAGTGAAAAATAT TTCAGAAAAACCAATGCATGGATATATGGGAATGATTCCACAATTGCCAT TGTATGAGAGTTTGTGTATTCCTGATTTGCTTAATCCTCAAAGTCTTCAA AATTTTGCTAATATCTTTTGGCCTCAGGGTAATCAACATTTCTGGTATGT CTATTTCACTGTTTTCATCTTTTTTATTTTCTTACTATCATTATCTTTAA ATTTAAGAAAAAACGATAAATATATCCTTAAATATAAATGGTATGCAGAT ATTCTCCATCATATTTTTGGGACATATATTTTTACCGTTCAAAAATTAAA GCATATATACCATTTTATACTAATGGATATAGACGTGTCATAATCTTATC TACCGCCCCAACATTGGATCGATGGATAAGATTGTGCCAAGTTTCCTAAT TTAACCATTCGTTAGAGTGAAGGGCAGAAATTTTCGACTTTTTAAATGTC AGGGACATCAATGTCCCAAAAGTATGACGGAGGAAAAATATAACGAAAAA TATGTGCATACTATTTACGATCGTTTGAAAAAATATTTGTCTTTTTTCCT TTTAAATTTTGGCCTAATGAAAGTGTTCAAAAAGTATAACATTAGAGATT CCCAGTAAATTGATTAACTATTTGACCATTCAATAGTTTTATGGAATAAG TTAATTTTTTCTTTGAGAAAAACAAAATAGGAGATTATAAATGGAAGTTT CCTTCTCGAATCTATTCATTAGCACACCCCTAAACAAACAAAAGTGCCGA TAACGTTAAAATATTTGGTATGAAGTCTCGATCTACTCAATAAAAACAAA TAAATTAATAGGAGACAATAGACAGTATCTTTCTCGAATCAATTTCGAAT TTATTTCTTTTATCACATTGTTAATAAAATGAAAATTATCAACAACATCA GAATATTTGGTATGTGTCACGATCTAATAATTGTAGAAATCGAGATATAA ATACGATTTGAGAAATCAAAGATTGTATTGATGAAAAATAATGTTAAGTT ACAAGGTTTTTATATGGAGAGAATTGTAGAGTTCTAAGTTAACTATAATA AAATACTATTACAATACATATTACTATTATAATAATAATAATAATGCAAA TCCTAGTCGTAATATAATTCTAATCGACTTCAACTAGTACAATAAGTAAA TAAGTAGCACTGCGTCTAATCCTAGTATGAATCTAACTCGTCAGTCAGTT CCGCTTTCCCATTTTTGTTTTCACTATCCTAGTTTTAAAAATAAAATAAA ATATAAGACTTAGTTAACGTAAATATGGCCTCATTTGTTTGTATTTAATT GGGGGTCTAAATCTTAATCAATCAGATTCGCCTCATTCAGTATGTTTGTT TTTTTATGACTGAATCTTAATTATTTAGATTTAATTCATTAAGTTTGTTT GTTTTATTTTCTTAGAAGTCTCTTAACGAGTCTGAATACATCTGAGTTAA TCAGATCTGTAATACACTCTTAAGACCATTCAGACTCAAAAGTAATTCCT ATCTTAATTCAACTACATCACAAAAACTCATAAAAGTTTTTTTCTTATTA AATTAATGTTAATTACATGCTTACCCGTTATAATTTCCTTTATTTTACTA ACTTAATATACGTCCTTTACTTTCATAAATTAATCAATATATTTGAATTG ATAAACACTTCATGATATAATATTTAGCACGATTCTAGAAAACAAGAAAG TATTGATTAGTTGATCGATAACAATAACAAATCTGCATTATAAAATAAAA TGCTTTCATAAACATTATATTACTACTCTATATAAACTATTTTACATTGC ATTATATTAGATTATCAAAGTTTTTGAGTGCAAAAAAGAATAGTCATATA TTAGTGATGTAACTTAATGTTAAATTCTTAATAGATAAATCATATGACCT ATTCATGATAAGAATGTCCAAAAATTTATTTTCCATATAAAAAATTATTT TACTAAAATGAGGTTTTTATAATTTTTTGTTGATACATCGTTTAATTTCA TATGTACATTCAAATATTAAAAACGAATTATCTCAATAATCCAGTTTTCA TATTCAGAGAAAATACCTTAATATTAAAATGTTTATTCAGATTTACATAT CTAGATCTTAATGCATATTTTAATATTTAGATGTATATTCAGATTCAGAC GTTTTGATCTTAATAGAAACAAATAAGGCCTAAGTGAAAGAATGGTATCA ACTTGAAATGTTTCTAAATCTGTTCAACCTTCTTTATATGTTTATAAACA TTATATGTGTATTTTTTTTTTGCAGCAATTTGGTAAAGTCTTATTCTAAT CCACTTGTGGAATTGGATGAGATTTTGAAAAGGATGATTTCGGAGAATTT GAGATTAAAAATTCACATTGATGAATTGTTGAATGCCAATTATTTCCTAT TTAGATTTACACATTACAAGGGATCATCAATTACTGGTGGAGATGAGAAT AACAAAGTTGCTGGATTGGGTGGCCACACAGATGGTAACTTCTTGACTTT TATATCGCAAAATCAAGTCAATGGATTGCAAATCAACAAAAATGGAGAAT GGATTGATGTGAATATTTCACCAAATTCTTATGTTGTTTTGGCTGGTGAT TCCTTCAAAGTAAGTGTTAAGTTTTGAATTATTGTTATTATCTTGTTGGG AACTGTTTTGTTTGATTTTTAAAAGAAAAATGCTAAATGGTCACAAATTT TTAAAGTCAATAATATTTTTTTTGTTTTAAGGTAAATAAATTGATAAAAA AAGAATTCATTTTTAATTAAAAGATATTGAAATTAAAAGGGTAAAAATAC TTTAAACATAGTGTGAATTATGTTATTTTATCATTCTAATCAAAATTTGT GGCCAATATTGTTACACCTTATAGGATTTATCAAAAAAACATAGTTTTCA GAGGCTCAAGATATTTGTTGGATCTTATGTTTCTCGAATCTCTGAAAATG TTGTTCCGCTTGTGTTGAATGTATTATTTTCTGAAATGTATATTTTTGAA GAATTTGATATATTAATGATATGCTCAATATTTTCATGCAAAACGGAAAA TGAATTTTGGTATTATTGACCCTATTTGTATTGTTCTACTCTCCAAAAAT ATTATCGATCACGTCTATCTTTGTATTTATACAGGCTTGGACAAATGGTC GATTGCATTCTCCTCTTCACAGAGTAACAATGTCCGGAGAAAATGATAGA CTCTCCATTCAATTATTTTCATTATCAAAACCAGGTCACTTCATCGAGGC ACCAAAAGAACTAGTGGATGAAGAACACCCTTTACTCTTCAAGCCATTTG AAATTATTGGATTATTTGAGTATGGTACCACAGAAGCTGGCTATACAGCT CCTCCAAGTGATCTTCTCAAGAGTTATTGCGGTGTTTGATATGCTAATTG CGAATTTCCGCTTCAGCAACCAACTTTTCTAATAAGTTTCGTCTGAAATT CGTGTTGTTTTAATTATTATGCATTTTATGTTTGAATTGTTGTAGTTGGC AATTCATGTTTAATTTGTTTGTGTTTTTTTTTTTGAGAAAATATTGCATT GGGTTTCATTGGAAATTTGTGTTTTTTAAAAAGTAGTGTGCATCTTATGT TTGGATTGTTGGTGTTGAGAATTCATTTTTAATTTGTTTTTTTTTTTGGG CAAATAATGAATTTAAAATTGTTGATTTTACTCTTTAGTGGAAATGAT (SEQ ID NO: 25; SlGAME31-like3).
[0145] The start codon (ATG) for SEQ ID NO: 25 starts at nucleotide 218. The coding sequence present within SEQ ID NO: 25 ends at nucleotide 1182. Therefore, the skilled artisan would recognize that the CDS comprised in SEQ ID NO: 25 comprises nucleotides 21-1182.
[0146] In another embodiment, a potato GAME31 gene comprises the nucleic acid sequence of SEQ ID NO: 30. In another embodiment, a potato GAME31 gene consists of the nucleic acid sequence of SEQ ID NO: 30. In another embodiment, SEQ ID NO: 30 comprises or consists of the following nucleic acid sequence:
TABLE-US-00013 (SEQ ID NO: 30) GAAACTTTGAAGTCTTTCTTGTTTCCTAAATATTCCTCAAATGGCATC TACCAAAGTTACGATTCCCACCATAGATTTTTGCGATTCTGAGCTTAAAC CAAACACTCCACAATGGGAATCAACAAAAGTTCAAGTTTTTGAAGCCTTA CAAGAATTTGGTTGTTTTGAAGCAATATATAACAAAGTTCCAAATGAAAT TAGAGAGGGCATGTTTGATACTTTAAAAGAAGTATTTGATTTTCCACTGC CCAAATTGATAGAATATAGAGAGAAACCCTTTCATATATATGATGGGCAA ATTCCAAGTGTACCACTCTTTGGTAGTGTGTACTCTGCTGATTTGGTCCT CCCAAATAGTGTTGAAACATTTGCCAATACCTTTTGGTCTCATGGAAACC CTAATTTTAGGTATGCATTACTTCTTTTTCATTAATTATAGGGAGTCACG ATAGTGTAAGATGCATTAAAAGGAGAAACGTTTCCTAGTAGAATTGTTTC TATTCCTAGGGCTAGAATCAGGAACCTTTAGTTAAATTAATAGAGATAAT ATTCATTCCATCACTAAAGGTGAAAATTAAGTATCTTATATTGTCCATAA ATTTTATATAGAAGAGATGTGAGAATTAATAAAATAAAAATTAAAAACTC ACGAGTAAACAAAATAATTATATCTAATTTATATTAATAAAGAAGAGTAT TTGATTATTATATTAAGTCAAATGATAAGCTAATAAATCAATATTAACAA TCTAATCACATGATTTATATAAAATTGGTTATGGGTATGGGAAGGGAGGG AGGGAAGTACATTTCATTGAGGAACAATGCAATAGTTAGACAGGATTTAA CATACTTGAACAAGATATCATAATCTAAAATGATTAAAAATAATTTTTTA ATATTATCTACACATCGCGCGAATATATATATATATATATATTAAGTGTA TTTCTTAAATAATATTGTATTACTATTTATATAAATTTTGTATGTTTTAA TTTTGCAGCAATGTGGCAAAGTCCTACTTCAAGCAACTTATGGAATTAAA TGACATGGTTAAAAAGATGGTTTTGGAGAGTCTTGGGCTAAAAAATTACA TTGATGAATTCTTGAATTCCAATGTTTATATGTCAAGATTTACTAATTAC AAGGTAATTAAAGGTGAAAATGAGAATAAATCAGGATTACCTTCCCACAC AGATAGTTCCTACTTGACCATAATTAAACAAAATCAAAATGGATTGCAAG TTCTCTACAAAAATGGAGAGTGGATTGAGCTCAATCGTCAAAATGGACTG CAAGTTCTCTACAAAAATGGAGAGTGGATTGAGCTCAATCATACTTCACC AAATTCCTATATTGTTTTATCAGAAGATGTTTTTATGGTAAGTTATTATT TATTTTTTATTACAGAAGTCAAAAATACACCTAAACTTTTTATTTATATG TATTTTTGACGCTTAACTCTTTATTTTTTTGTGTGTAGGGGTGGTTTGTT GCTATAGTAGAGGAGAATAAAAGAAATAGATTTTTTTTGTATGATTGATT ATTCAAGCCCAACTAGAAGCTAAGATTAGAGGAGTTTTGAAGCAACGAAA AAAAATGTTGTGTGTGATTTATAGATATTGATGCAGGCTCGATCCGTGAA AGAAATCACTAATATTTATATTAGATTAGATCGTTTACCTAACTAAACAT CCCTTGAAGTACTGCCCTTTCTCCAAACCATATGTGAACGTCAAATATTT TATGCATCAACCTGTCTTTTTTTATTTGGCCCCAACTAACTTCAATCCAC ATAAATTATTAAATCTTGATATTAGTTGGAATAACATATCTCTTTTCTGA GAAATTGAAAATAATGCCAGAACTATCATAATCTTTTTTTAAAAAAATTG TCTTGTTATTATCTTATTAATTTAAAATTTTCTTTCTTCAGAGGAAATTT AAGTCAATCTTTTTGTTCCTTAATTATTAATTAAACAAATAAATTCTTAT ACATACTTTTTATGTGTTGATGCTATGAATTAATTATACAGGCATGGACA AATGATAGATTGACATCTGCTCAACACAGGGTTGTAACAACAGGAGACAA AGAAAGATTCTCTATTCAAGTTTTTTCCTTTCCAAATCCAGATTACACTG TGAAGGTCCCACAAGAATTAGTGGATGAAGAACACCCTTTAATGTACAAG CCTTTTAAGATGTCTGAATATAATAAATATATTATGTTAGGTGCTAAAAA TGGATTGGGTGTCAAGAATTATTGTGGTCTTTAAAAATTTAGTAGCTATG AAAATTTATTTATGTATTGTTTTGATGAATAAAATGTATCAGATGGC.
[0147] In one embodiment, a potato GAME31-like gene comprises the nucleic acid sequence of SEQ ID NO: 33. In another embodiment, a potato GAME31-like gene consists of the nucleic acid sequence of SEQ ID NO: 33. In another embodiment, SEQ ID NO: 33 comprises or consists of the following nucleic acid sequence:
TABLE-US-00014 ''GAAACTTTGAAGTCTTTCTTGTTTCCTAAATATTCCTCAAATGGCATCT ACCAAAGTTACGATTCCCACCATAGATTTTTGCGATTCTGAGCTTAAACC AAACACTCCACAATGGGAATCAACAAAAGTTCAAGTTTTTGAAGCCTTAC AAGAATTTGGTTGTTTTGAAGCAATATATAACAAAGTTCCAAATGAAATT AGAGAGGGCATGTTTGATACTTTAAAAGAAGTATTTGATTTTCCACTGCC CAAATTGATAGAATATAGAGAGAAACCCTTTCATATATATGATGGGCAAA TTCCAAGTGTACCACTCTTTGGTAGTGTGTACTCTGCTGATTTGGTCCTC CCAAATAGTGTTGAAACATTTGCCAATACCTTTTGGTCTCATGGAAACCC TAATTTTAGGTATGCATTACTTCTTTTTCATTAATTATAGGGAGTCACGA TAGTGTAAGATGCATTAAAAGGAGAAACGTTTCCTAGTAGAATTGTTTCT ATTCCTAGGGCTAGAATCAGGAACCTTTAGTTAAATTAATAGAGATAATA TTCATTCCATCACTAAAGGTGAAAATTAAGTATCTTATATTGTCCATAAA TTTTATATAGAAGAGATGTGAGAATTAATAAAATAAAAATTAAAAACTCA CGAGTAAACAAAATAATTATATCTAATTTATATTAATAAAGAAGAGTATT TGATTATTATATTAAGTCAAATGATAAGCTAATAAATCAATATTAACAAT CTAATCACATGATTTATATAAAATTGGTTATGGGTATGGGAAGGGAGGGA GGGAAGTACATTTCATTGAGGAACAATGCAATAGTTAGACAGGATTTAAC ATACTTGAACAAGATATCATAATCTAAAATGATTAAAAATAATTTTTTAA TATTATCTACACATCGCGCGAATATATATATATATATATATTAAGTGTAT TTCTTAAATAATATTGTATTACTATTTATATAAATTTTGTATGTTTTAAT TTTGCAGCAATGTGGCAAAGTCCTACTTCAAGCAACTTATGGAATTAAAT GACATGGTTAAAAAGATGGTTTTGGAGAGTCTTGGGCTAAAAAATTACAT TGATGAATTCTTGAATTCCAATGTTTATATGTCAAGATTTACTAATTACA AGGTAATTAAAGGTGAAAATGAGAATAAATCAGGATTACCTTCCCACACA GATAGTTCCTACTTGACCATAATTAAACAAAATCAAAATGGATTGCAAGT TCTCTACAAAAATGGAGAGTGGATTGAGCTCAATCGTCAAAATGGACTGC AAGTTCTCTACAAAAATGGAGAGTGGATTGAGCTCAATCATACTTCACCA AATTCCTATATTGTTTTATCAGAAGATGTTTTTATGGTAAGTTATTATTT ATTTTTTATTACAGAAGTCAAAAATACACCTAAACTTTTTATTTATATGT ATTTTTGACGCTTAACTCTTTATTTTTTTGTGTGTAGGCGTGGTTTGTTG CTATAGTAGAGGAGAATAAAAGAAATAGATTTTTTTTGTATGATTGATTA TTCAAGCCCAACTAGAAGCTAAGATTAGAGGAGTTTTGAAGCAACGAAAA AAAATGTTGTGTGTGATTTATAGATATTGATGCAGGCTCGATCCGTGAAA GAAATCACTAATATTTATATTAGATTAGATCGTTTACCTAACTAAACATC CCTTGAAGTACTGCCCTTTCTCCAAACCATATGTGAACGTCAAATATTTT ATGCATCAACCTGTCTTTTTTTATTTGGCCCCAACTAACTTCAATCCACA TAAATTATTAAATCTTGATATTAGTTGGAATAACATATCTCTTTTCTGAG AAATTGAAAATAATGCCAGAACTATCATAATCTTTTTTTAAAAAAATTGT CTTGTTATTATCTTATTAATTTAAAATTTTCTTTCTTCAGAGGAAATTTA AGTCAATCTTTTTGTTCCTTAATTATTAATTAAACAAATAAATTCTTATA CATACTTTTTATGTGTTGATGCTATGAATTAATTATACAGGCATGGACAA ATGATAGATTGACATCTGCTCAACACAGGGTTGTAACAACAGGAGACAAA GAAAGATTCTCTATTCAAGTTTTTTCCTTTCCAAATCCAGATTACACTGT GAAGGTCCCACAAGAATTAGTGGATGAAGAACACCCTTTAATGTACAAGC CTTTTAAGATGTCTGAATATAATAAATATATTATGTTAGGTGCTAAAAAT GGATTGGGTGTCAAGAATTATTGTGGTCTTTAAAAATTTAGTAGCTATGA AAATTTATTTATGTATTGTTTTGATGAATAAAATGTATCAGATGGC (SEQ ID NO: 33; StGAME31-like1.
[0148] In one embodiment, a potato GAME31-like gene comprises the nucleic acid sequence of SEQ ID NO: 36. In another embodiment, a potato GAME31-like gene consists of the nucleic acid sequence of SEQ ID NO: 36. In another embodiment, SEQ ID NO: 36 comprises or consists of the following nucleic acid sequence:
TABLE-US-00015 TTATTATTTGCACAAAAAATACAAACAAAGCATGAATTCCCATCGAA ATTACTCACTGTTACAACAATTCAAACATAAGATACACACTACTAAAGAA ACACGAATTTCGACAAGCATTCTGTTAGAAATCCCATATATACTTACAGT ATTCTAACAAGAACGTTCATAAAAAAATCACGTTTTTTTATTCTAGCATA TATAAAACAAAGAACTCTAAAGCTAAAGATACACACTATTATAAAAACAC GAATTCCAAATGAAATCCATTGGAAATGATGAAGACATTTTCGATGAATA TTCTGTTAGAAATCCCAAATATACTAACAGTACTCTGACAAAAATGTTCA TTAGAAATTCACGTTTATCATATCAAAGACCACAATAAGCCTTGAAAGCA TCACTGGGAGCTGCATAGCCAGCTTGGGAAGTAACATACTCAGATAATCC AACCATTTCAAATGGCTTGAAGAGTAAAGGGTGTTCTTCATCCACAAGTT CTTTTGGGGCCTTTATAAAGTGACCTGGTTTTGAGAATGAAAATAATTGA ATTGAGAATCTATCACTTTCACCAAATATTTTTACCTTGTGGATGGGAGA ATGCAATCGACCATTTGTCCATGCCTGTATAAATTCACGTCGTCAGTGCA TAAAACTCAAACACATTTATTTGAAGGATCCAACATTTTTAGAGATTCAA AAAGCATAGACTCCAACAAATATCAAAATTCATTTTTCAGTTTTGCATGA AAATATTAAATATGTAGGTAGTTCCATTTAATATTCGAGAAACATAGGTT AATTCCAACAAATATGAAGATTCATTTTCAATTTTGCATCAAGATATTAA ACCTAAATTTTGTTTGGTATATTCCAACCTTGGAAATATTCTTCACAAAT ATCGTTAGGTATGCGTCAGATCCTCTAAAATCTATATTTTGTTTTTGAAG GTGCAATAATAATATTTTTGAAGAGTTCGAGTAACATGGATTTCAACAAA GTAATATGACTAGCTAAAAAAATAAAATGAGTAACACTTACTTTGAATGA ATCACCAGACAAAACAACATAAGAATTTGGTGAAATATTGACATCAATCC ACTCTCCATTTTTGTTGATTTGCAAACCATTGACTTGATTTTGTGATATA AAAGTCAAGAAGTTACCATCTGTGTGGCCATTCAATCCATCTTGTTTAAT ATTATTTTCATGATCTCCACTAATAATTGATGATCCCTTGTAATGTGTAA ATCTAAATCTCATATAATTAATATCCAGCAATTCATCAATATGATTTTCT AATCCCAAATTCTCCAAAATCATCTTTTTCAACATTTCATCCAATTCCAT AAGTGGATTTGAGTAAGCTTTTACCAAATTGCTGCAAAAATTTATCACTA TCTCAAAAATAACTTTCTCGCTACTCCACGACTCTAATCAATGCACAAAA TAATTTTATTTTAAAAAATAAAATAAAGTAGACATACCAGAAATCAGGAT TACCATGAGGCCAAAAGATATTAGCAAAAGTTTCAACATTTTGAGGATTA AGCAAATCAGGAATACACAAACTCTCATAAAATGGCAAGTGTGGAATCAT TCCTACATAGCCATGTAATGTTATATCTGAATAATTTTTCACTTTGGTCT CTAAAGGAAATTGAAATATTTCTTTTGTAATACCAAAAATACCCTCTCTA ATTTCATTTGGAATTTTATCATATGTTGCTTCAAAACAACCATATTCTTT TAAAGCTTCAAAAACTTGAACTTTTGTGGATTCCCATAGTGGAGTGTTTG GTTTTAGTTCTAGATTAGAAAAATCTATGGTGGGAATCTTAACTTTGGTA GATGCCATTTGAAAGAAACAAAGAAGGAATTAAAGACTTCACAATGTGAA (SEQ ID NO: 36; StGAME31-like2).
[0149] In one embodiment, a potato GAME31-like gene comprises the nucleic acid sequence of SEQ ID NO: 39. In another embodiment, a potato GAME31-like gene consists of the nucleic acid sequence of SEQ ID NO: 39. In another embodiment, SEQ ID NO: 39 comprises or consists of the following nucleic acid sequence:
TABLE-US-00016 ATTTTTTAATAAAAATAATACAGTACAATACATTACAATACAACGCA ACACAATACAATACGTTATGTAATCATATGCAATAACCATTCAAATATAA ATTTTCAACCACCCATACATACGATACATTTTATTCATAAAGAAAATACA CATATATAAATTTTCATACCCTACAAAAATTTTAAAGACCACAATAATTC TTGAGATTAATTCCATTTTTATCACCTGACATAGTTTATTTATGAAATTC AAGCAAGTTAAAAGGCTTGAAGAGTAAAGGGTGGTCTTCATCCACTAATT CTTTTGGGGTCCTTCACAGTATAATCTGGATGTGGTATGGAAAATAATTG AATAGATAATCTATCTTTGTCTCCTGTTGGTACTACTCTGTGTTCAGCAG ATGTCAAACTATTATTTGTCCATGCCTGTATAAATCCACAACATCGACAC ATAAAAAGCATTAGTGATTTCTTTCACAGAGAAAGGGCAGCACCTCAAGG GGATGTTAGGAAAACAATCTAATCTAATAGAAAATATTAGTGATTTTTTC TCGATCAAGCCCGCATCGTAATCTATATATCACATACAAACAATCTTATC GTTACTTCAAAACTGCTCTGATCTTAGCTTCTAGTTGGGCTTAAATAATC AACCATACAAAAAAAATCTCTATTTCTTTNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGTGTGTTTGGTA CGAAGGAAAATATTTTCTGGAAAATGTTTTTTAATTTCCCATGTTTGGTT GACTTTAATTATTTGGAAAATGTTTTCCAAATCAACTTATTTTCCTCAAA TTTAAGGAAAATGATTTCCCTTAAAAATTAAGGAAAACATTTTCGAAACT TCTACTTCATCCTTAAATTATAATATTTTTTTACCCCTACTACCAAACCA GCCCGCCACCCCTGTCAAATTTTATTTTATTTAAAAAATTACTTTTGAAA AATATTTCAGGGTCGGAAGTTTGGCTGGGGTCCTAGGTCAGATCTCTAGG TCGGATTTTGAACGGTCATCAAGGTCATGTCCTAGTTCGGGTGTTAGGGT CGGGTCCTAGATTGATTATTGGGATTGATTTTCGAGTTAAAAGTTATTTT CCTAAAGAGTATTTTCTAGTCTTAAGCGAAAAATAAAAGATATTTTCTGG AAAAAAAATTCATTCACCAACCAAACATTAAAAAATAGTTTCTACTCATC AACTAAATATGAGAAAATAAGTTAGAAATCCACTTGTTTTCCAAGAAAAC ATTTTCCTTCATACCAAACACACCCTTAATATATATNNNNNNNNNNNNNN NNNNTTATATATGTATAGATAGCTAGTATACATACTCGAGCGATGTGCGG AAAATATTAATATGTTATTTTTAATCTTACCCCTACCCATGCCCCTACCC GACCTTCCCCATTCAAAAAAATAAATTAAAATTTTTAAAATTTCAAATAT ATTTTTATCACTACCACCAAACTAGCTCCCCCGCCCCCCTCCCCTCAAAC ATAAAAAAAAAAAATTAAAATTATTTTTGAAAAATTTTTAAATCTTAAAT TTTTTTTACCTCACCAACCCCTACCACCCCTACTCCCTTCCCCCTCATTT TTAATTTCCCATGTTTGGTTGACTTTAATGATTTGGAAAATGTTTTCCAA ATCAACTTATTTTCCTCAAATTTAAGGAAAATGATTATCCTAAAAGTTAT TTTCCTAAAGAGTATTTTCTAGTCTCAAGAGAAAATAAAAGATATTTTTT CAGAAAATAATTTTCATTCACCAACCAAACATGAGAAAATAAGTTAGAAA TCCACTTGTTTTCCAAGAAAACATTTTCCTTCATACCAAACACACCCTTA ATATATAATGTATATATACCTAGTATACATACTCGCGTGATGTGTGAAAA ATATTTAAATGTTATTTTAAATCATTTTAGATTGTGATATCTTGTTCGAG CATGTTAAATCACGTCCAACTATTGCATTGTTACTCAATGAAATGTACTC CCCTCCATCCCTTCACATACCCGTAACCAATTCTATATGAATAGCGACAA TGAATCATGTGATTAGATTGTTAGTATTGATTTTATTAGCTTATCACTTG GATATAATTATTAAATACTCTTCTAATTAATATAAATTAGATATATTTAT TTTGTTTACTCGTGAGTTCTTAATTTTTATTTTATTAATGATCACATCTC TTTTATATAAAATGTATGGACAATAAGATACTTAATTTTCACCTTTAGTG ATGGAATGAATATTATCTCTATAATTTAACTAAAGATTCATGATTCTAGC CTTAGGAATAAAAACAATTCTAGTAGGAAACGTTTCTCCTTTTAATGTGT CTTACACTATCGTGACTCCATATTATTAATCTGAATCCCAAAATAAATAC CGAATACATAATGAAAAAAAAAAAATCTCCTACAAATATATGAGCAAGAA TAATTGGTGTACTAACATGACTAAAACTAAATGATATCACCTACATAAAT CTTATTCTTTCAAATATCATTAATGAAAAATGACTTTCATAATACCGAGC ACATTATATGTAATTAAAAGAAGTAATACATACCTAAAGTTAGGGTTTCC ATCAGACCAAAAGGTATTGGCAAATGTTTCAATACTATTTGGGAGGACCA AATCAGCAGAGCTCACACTACCATAGAGTGGTATACTTGGAATTTTCCCA TCATATATATGAAAGGGTTTTTCTCTATATTCTATCAATTTGGACAATGG AAAATCAAATACTTCTTTTAAATTATCAAACATGCCCTCTCTAATTTCAT TTGGAACTTTGTCATATATTGCTTCAAAACAACCAAATTCTTTTAAGGCT TCAAAAACTTGAACTTTTGTTGATTCCCATTGTGGAGTGTTTGGTTTTAG CTCAAGATTGCAAAAATCTATGGTGGGAATCTTACCTTTAGTAGATGCCA TTGATGAATAAATTAAAAAGAGAGGAAATAGAAAGAAATAAAGAAGGAGA AATACTTTACAATATGAAAATTAAAG (SEQ ID NO: 39; St. GAME31-like3; N represents unknown nucleotide sequence).
[0150] In one embodiment, a potato GAME31-like gene comprises the nucleic acid sequence of SEQ ID NO: 42. In another embodiment, a potato GAME31-like gene consists of the nucleic acid sequence of SEQ ID NO: 42. In another embodiment, SEQ ID NO: 42 comprises or consists of the following nucleic acid sequence:
TABLE-US-00017 GAAACTTTGAAGTCTTTCTTGTTTCCTAAATATTCCTCAAATGGCATC TACCAAAGTTACGATTCCCACCATAGATTTTTGCGATTCTGAGCTTAAAC CAAACACTCCACAATGGGAATCAACAAAAGTTCAAGTTTTTGAAGCCTTA CAAGAATTTGGTTGTTTTGAAGCAATATATAACAAAGTTCCAAATGAAAT TAGAGAGGGCATGTTTGATACTTTAAAAGAAGTATTTGATTTTCCACTGC CCAAATTGATAGAATATAGAGAGAAACCCTTTCATATATATGATGGGCAA ATTCCAAGTGTACCACTCTTTGGTAGTGTGTACTCTGCTGATTTGGTCCT CCCAAATAGTGTTGAAACATTTGCCAATACCTTTTGGTCTCATGGAAACC CTAATTTTAGGTATGCATTACTTCTTTTTCATTAATTATAGGGAGTCACG ATAGTGTAAGATGCATTAAAAGGAGAAACGTTTCCTAGTAGAATTGTTTC TATTCCTAGGGCTAGAATCAGGAACCTTTAGTTAAATTAATAGAGATAAT ATTCATTCCATCACTAAAGGTGAAAATTAAGTATCTTATATTGTCCATAA ATTTTATATAGAAGAGATGTGAGAATTAATAAAATAAAAATTAAAAACTC ACGAGTAAACAAAATAATTATATCTAATTTATATTAATAAAGAAGAGTAT TTGATTATTATATTAAGTCAAATGATAAGCTAATAAATCAATATTAACAA TCTAATCACATGATTTATATAAAATTGGTTATGGGTATGGGAAGGGAGGG AGGGAAGTACATTTCATTGAGGAACAATGCAATAGTTAGACAGGATTTAA CATACTTGAACAAGATATCATAATCTAAAATGATTAAAAATAATTTTTTA ATATTATCTACACATCGCGCGAATATATATATATATATATATTAAGTGTA TTTCTTAAATAATATTGTATTACTATTTATATAAATTTTGTATGTTTTAA TTTTGCAGCAATGTGGCAAAGTCCTACTTCAAGCAACTTATGGAATTAAA TGACATGGTTAAAAAGATGGTTTTGGAGAGTCTTGGGCTAAAAAATTACA TTGATGAATTCTTGAATTCCAATGTTTATATGTCAAGATTTACTAATTAC AAGGTAATTAAAGGTGAAAATGAGAATAAATCAGGATTACCTTCCCACAC AGATAGTTCCTACTTGACCATAATTAAACAAAATCAAAATGGATTGCAAG TTCTCTACAAAAATGGAGAGTGGATTGAGCTCAATCGTCAAAATGGACTG CAAGTTCTCTACAAAAATGGAGAGTGGATTGAGCTCAATCATACTTCACC AAATTCCTATATTGTTTTATCAGAAGATGTTTTTATGGTAAGTTATTATT TATTTTTTATTACAGAAGTCAAAAATACACCTAAACTTTTTATTTATATG TATTTTTGACGCTTAACTCTTTATTTTTTTGTGTGTAGGGGTGGTTTGTT GCTATAGTAGAGGAGAATAAAAGAAATAGATTTTTTTTGTATGATTGATT ATTCAAGCCCAACTAGAAGCTAAGATTAGAGGAGTTTTGAAGCAACGAAA AAAAATGTTGTGTGTGATTTATAGATATTGATGCAGGCTCGATCCGTGAA AGAAATCACTAATATTTATATTAGATTAGATCGTTTACCTAACTAAACAT CCCTTGAAGTACTGCCCTTTCTCCAAACCATATGTGAACGTCAAATATTT TATGCATCAACCTGTCTTTTTTTATTTGGCCCCAACTAACTTCAATCCAC ATAAATTATTAAATCTTGATATTAGTTGGAATAACATATCTCTTTTCTGA GAAATTGAAAATAATGCCAGAACTATCATAATCTTTTTTTAAAAAAATTG TCTTGTTATTATCTTATTAATTTAAAATTTTCTTTCTTCAGAGGAAATTT AAGTCAATCTTTTTGTTCCTTAATTATTAATTAAACAAATAAATTCTTAT ACATACTTTTTATGTGTTGATGCTATGAATTAATTATACAGGCATGGACA AATGATAGATTGACATCTGCTCAACACAGGGTTGTAACAACAGGAGACAA AGAAAGATTCTCTATTCAAGTTTTTTCCTTTCCAAATCCAGATTACACTG TGAAGGTCCCACAAGAATTAGTGGATGAAGAACACCCTTTAATGTACAAG CCTTTTAAGATGTCTGAATATAATAAATATATTATGTTAGGTGCTAAAAA TGGATTGGGTGTCAAGAATTATTGTGGTCTTTAAAAATTTAGTAGCTATG AAAATTTATTTATGTATTGTTTTGATGAATAAAATGTATCAGATGGC (SEQ ID NO: 42; StGAME31-like4).
[0151] In one embodiment, a potato GAME31-like gene comprises the nucleic acid sequence of SEQ ID NO: 45. In another embodiment, a potato GAME31-like gene consists of the nucleic acid sequence of SEQ ID NO: 45. In another embodiment, SEQ ID NO: 45 comprises or consists of the following nucleic acid sequence:
TABLE-US-00018 (SEQ ID NO: 45; St.GAME31-like5) GAAACTTTGAAGTCTTTCTTGTTTCCTAAATATTCCTCAAATGGCATCTA CCAAAGTTACGATTCCCACCATAGATTTTTGCGATTCTGAGCTTAAACCA AACACTCCACAATGGGAATCAACAAAAGTTCAAGTTTTTGAAGCCTTACA AGAATTTGGTTGTTTTGAAGCAATATATAACAAAGTTCCAAATGAAATTA GAGAGGGCATGTTTGATACTTTAAAAGAAGTATTTGATTTTCCACTGCCC AAATTGATAGAATATAGAGAGAAACCCTTTCATATATATGATGGGCAAAT TCCAAGTGTACCACTCTTTGGTAGTGTGTACTCTGCTGATTTGGTCCTCC CAAATAGTGTTGAAACATTTGCCAATACCTTTTGGTCTCATGGAAACCCT AATTTTAGGTATGCATTACTTCTTTTTCATTAATTATAGGGAGTCACGAT AGTGTAAGATGCATTAAAAGGAGAAACGTTTCCTAGTAGAATTGTTTCTA TTCCTAGGGCTAGAATCAGGAACCTTTAGTTAAATTAATAGAGATAATAT TCATTCCATCACTAAAGGTGAAAATTAAGTATCTTATATTGTCCATAAAT TTTATATAGAAGAGATGTGAGAATTAATAAAATAAAAATTAAAAACTCAC GAGTAAACAAAATAATTATATCTAATTTATATTAATAAAGAAGAGTATTT GATTATTATATTAAGTCAAATGATAAGCTAATAAATCAATATTAACAATC TAATCACATGATTTATATAAAATTGGTTATGGGTATGGGAAGGGAGGGAG GGAAGTACATTTCATTGAGGAACAATGCAATAGTTAGACAGGATTTAACA TACTTGAACAAGATATCATAATCTAAAATGATTAAAAATAATTTTTTAAT ATTATCTACACATCGCGCGAATATATATATATATATATATTAAGTGTATT TCTTAAATAATATTGTATTACTATTTATATAAATTTTGTATGTTTTAATT TTGCAGCAATGTGGCAAAGTCCTACTTCAAGCAACTTATGGAATTAAATG ACATGGTTAAAAAGATGGTTTTGGAGAGTCTTGGGCTAAAAAATTACATT GATGAATTCTTGAATTCCAATGTTTATATGTCAAGATTTACTAATTACAA GGTAATTAAAGGTGAAAATGAGAATAAATCAGGATTACCTTCCCACACAG ATAGTTCCTACTTGACCATAATTAAACAAAATCAAAATGGATTGCAAGTT CTCTACAAAAATGGAGAGTGGATTGAGCTCAATCGTCAAAATGGACTGCA AGTTCTCTACAAAAATGGAGAGTGGATTGAGCTCAATCATACTTCACCAA ATTCCTATATTGTTTTATCAGAAGATGTTTTTATGGTAAGTTATTATTTA TTTTTTATTACAGAAGTCAAAAATACACCTAAACTTTTTATTTATATGTA TTTTTGACGCTTAACTCTTTATTTTTTTGTGTGTAGGGGTGGTTTGTTGC TATAGTAGAGGAGAATAAAAGAAATAGATTTTTTTTGTATGATTGATTAT TCAAGCCCAACTAGAAGCTAAGATTAGAGGAGTTTTGAAGCAACGAAAAA AAATGTTGTGTGTGATTTATAGATATTGATGCAGGCTCGATCCGTGAAAG AAATCACTAATATTTATATTAGATTAGATCGTTTACCTAACTAAACATCC CTTGAAGTACTGCCCTTTCTCCAAACCATATGTGAACGTCAAATATTTTA TGCATCAACCTGTCTTTTTTTATTTGGCCCCAACTAACTTCAATCCACAT AAATTATTAAATCTTGATATTAGTTGGAATAACATATCTCTTTTCTGAGA AATTGAAAATAATGCCAGAACTATCATAATCTTTTTTTAAAAAAATTGTC TTGTTATTATCTTATTAATTTAAAATTTTCTTTCTTCAGAGGAAATTTAA GTCAATCTTTTTGTTCCTTAATTATTAATTAAACAAATAAATTCTTATAC ATACTTTTTATGTGTTGATGCTATGAATTAATTATACAGGCATGGACAAA TGATAGATTGACATCTGCTCAACACAGGGTTGTAACAACAGGAGACAAAG AAAGATTCTCTATTCAAGTTTTTTCCTTTCCAAATCCAGATTACACTGTG AAGGTCCCACAAGAATTAGTGGATGAAGAACACCCTTTAATGTACAAGCC TTTTAAGATGTCTGAATATAATAAATATATTATGTTAGGTGCTAAAAATG GATTGGGTGTCAAGAATTATTGTGGTCTTTAAAAATTTAGTAGCTATGAA AATTTATTTATGTATTGTTTTGATGAATAAAATGTATCAGATGGC.
[0152] In one embodiment, a potato GAME31-like gene comprises the nucleic acid sequence of SEQ ID NO: 48. In another embodiment, a potato GAME31-like gene consists of the nucleic acid sequence of SEQ ID NO: 48. In another embodiment, SEQ ID NO: 48 comprises or consists of the following nucleic acid sequence:
TABLE-US-00019 (SEQ ID NO: 48; StGAME31-like6) CACTAATATATTTTTAATAAAAACAATACAGTACAATACATTACAATACA ACGCAACACAACACAATACAATACGTTATGAAATCATATGCAATAACCAC ACAAATATAAATTTTCAACCACCCATGCATACGATACATTGTATTCATAA AGAAAATACACATAAATAAATACCCTACTAAATTTTTAAAGACCACAATA ATTCTTGAGATTAATTCAATTTTTATTACCTGACATAGTTTATTTATGAA ATTCAAGCAAGTTAAAAGGCTTGAAGAGTAAGGGTGGTCTTCATCCACTA ATTATTTTGGGGCCTTCACAGCAAAATCTTGATTTGGGAAAGGAAAATAA TTGAATAGATAGTCTATCTTTGTCTCCTGTTGTTACTACTCTGTGTTCAG CAGATGTCAAACTATCATTTGTCCATGCCTGTATAAATCCACAACATCGA CACATAAAAAGTATTAGTGATTTCTTTTCACAGAGAAAGGGCAACACCTC AAGGGATGTTAGGAAAACAATCTAATCTAATACAAAATATTAGTGATTTT TTCTCGATCAAGCCCGCATCGTAATCTATAAATCACATACAAACAATCTT ATCGTTACTTCAAAACTGCTCTGATCTTAGCTTCTAGTTGGGCTTGAATA ATCAACCATACAAAAAAATCTCTATTTCTTTTATTCTCCTCTTCTATAGC ATCAACCCACCCCCTCACACACAAAATAATAAAGAGTTAAGCGTCAAAAA TACACATAAATAAATAATTTAGGTGTATTTTTTACCTTGATACTCAAAAA TAAATAATAACTTACCCTGAAAGCATCTGCTGATAAAACAATATAGGAAT TTGGTGTTGTATTATTGAGCTCTATCCACTCTCCATTTTTGTAGAGAACT TGCAATCCATTTTGATTTTGTTTAATTATAGTCAAGTAGCCACTATCTGT GTGGGGAGGTAATTCTGATCTATTCTCATCTTCACCTTTAATTACCTTGT AATTAGTAAATCTTGACACAAAAACATTGGAATTCAAGATTTCATCAATG TAATTTGTTTTCCCAAGACTCTCCAAAACCATTTTTTCCACCATGTCATT CAATTCCATAAGTTGCTTGAAGTAGGACTTTGCCACATTGCTGCCAAATT AAAACATACAAAACTTATATAATGGTAATGCAATATTGTGATATTACTCA AAATTATGTAAGAAATACACTTAGGGTGTGTTTGGTACGAAGGAAAATAT TTTCTAGAAAATGTTTTTTAATTTCCCATGTTTGGTTGACTTTAATGATT TGGAAAATGTTTTCCAAATCAACTTATTTTCCTCAAATTTAAGGAAAATG ATTATCCTAAAAGTTATTTTCCTAAAGAGTATTTTCTAGTCTTAAGTGAA AAATAAGTTAGAAATCCACTTGTTTTCCAAGAAAACATTTTCCTTCATAC CAAACACACCCTTAATATATAATGTATATATACCTAGTATACATACTCGC GCGATGTGTGAAAAATATTTAAATGTTATTTTAATCATTTTAGATTGTGA TATCTTGTTCGAGCATGTTAAATCATGTCCAACTATTGCATTGTTACTCA ATGAAATGTACTCCCCTCCATCCCTTCACATACCCGTAACCAATTCTATA TGAATAGCGATGTGTGAAAAATATTTAAATGTTATTTTTAATCATTTTAG ATTGTGATATCTTGTTCGAGCATGTTAAATCATGTCCAACTATTGCATTG TTACTCAATGAAATGTACTCCCCTCCATCCCTTCACATACCCGTAACCAA TTCTATATGAATAGCGACAATGAATCATGTGATTAGATTGTTAATATTGA TTTTATTAGCTTATCACTTGGATATAATTATTAAATACTCTTCTAATTAA TATAAATTAGATATATTTATTTTGTTTACTCGTGAGTTCTTAATTTTTAT TTTATTAATGATCACATCTCTTTTATATAAAATGTATGGACAATAAGATA CTTAATTTTCACCTTTAGTGATGGAATGAATATTATCTCTATAATTTAAC TAAAGATTCCTGATTCTAGCCTTAGGAATAAAAACAATTCTAGTAGGAAA CGTTTCTCCTTTTAATGTGTCTTACACTATCGTGACTCCATATTATTAAA TCTGAAATCCCAAAAATAAATACCGAATACATAATGAAAAAAAAAAAATC TCCTACAAAATATATGAGCAAGAATAATTGGTGTACTAACATGACTAAAC TAAATGATATCACCTACATAAATCTTATTCTTTCAAATATCATTAATGAA AAATAACTTTCATAATACCGAACACATTATATATAATTAAAAGAAGTAAT ACATACCTAAAGTTAGGGTTTCCATCAGACCAAAAGGTATTGGCAAATGT TTCAACACTATTTGGGAGGACCAAATCAGCAGAGCTCACACTACCATAGA GTGGTATACTTGGAATTTGCCCATCATATAAATGGGGTTTTTCTCTATAT TCTATCAATTTGGACACTGGAAAATCAAATACTTCTTTTAAAGTATCAAA CATGCCCTCTCTAATTTCATTTGGAACTTTGTCATATATTGCTTCAAAAC AACCAAATTCTTTTAAGGCTTCAAAAACTTGAACTTTTGTTGATTCCCAT TGTGGAGTGTTTGGTTTTAGCTCAAGATTGCAAAAATCTATGGTGGGAAT CTTAACTTTGGTAGATGCCATTGATGAATAAATTAAATAGAGAGGAAATA GAAAGAAATAAA.
[0153] In one embodiment, a potato GAME31-like gene comprises the nucleic acid sequence of SEQ ID NO: 51. In another embodiment, a potato GAME31-like gene consists of the nucleic acid sequence of SEQ ID NO: 51. In another embodiment, SEQ ID NO: 51 comprises or consists of the following nucleic acid sequence:
TABLE-US-00020 (SEQ ID NO: 51; StGAME31-like7) GCAGCAATGTGGCAAAGTCCTACTTCAAGCAACTTATGGAATTGAATGGC ATGGTGGAAAAGATGGTTTTGGAGAGTCTTGGGCTAAAAAATTACATTGA TGAATTCTTGAATTCCAATGTTTATATGTCAAGATTTACTAATTACAAGG TAATTAAAGGTGAAAATGAGAATAAATCAGGATTACCTTCCCACACAGAT AGTTCCTACTTGACCATAATTAAACAAAATCAAAATGGATTGCAAGTTCT TCTACAAAAATGGAGAGTGGATTGAGCTCAATCATACCTCACCAAATTCC TATATTGTTTTATCAGCAGATGCTCTTATGGTAAGTTATTATTTATTTTT GATTACAGCAGTCAAAAATACGCCTAAACTTCTAATTTATATGTATTTTT GACGCTTTAACTCATTATTATTTTTTGTGTGTGGGGTGGTTTGTTGCTAT AGTAGAGGAGAATAAAAGAAATAGAGATTTTTTTTGTATGATTGATTATT CAAGCCCAACTAGAAGCTAAGATTAGAGGAGTTTTCAACCAACGAAAAAA ATGTTTGTGTGTGATTTATATATCATGATGCAGGCTCAATCCGTAAAAGA AATCACTAATATTTGTATTAGATTAGATTGTTTACCTAACTAACATCCCT TGAAGTGTTGCCCTTTCTCCAAACCCTATGTGAACGTCAAATATTTTATG CATCAACCTGTCTTATTTTATTTGACCTCAACTAACTTCAATCCACAAAA AATATTAAATCTTGATATTATTTGGAATAACGTATCTCTTTTTCTGGAAA ATTGAAAATGATACCAGAACTATCATAATAATTTTTTAAATTGTCTTGTT ATTATCTTATTAATTTAAAATTTTCATTCTCCATAGGAAATTTAAGTCAA TCTTTTTGTTCCTTAATTATTAATTAAACAAATAAATTCTTATACATACT TTTTATGTGTTGATGATATGAATTAATTATACAGGCATGGACAAATGATA GATTGACATCTGCTCAACATAGGGTTGTAACAACAGGAGACAAAGATAGA TTCTCTGTTCAATTATTTTCCCTCGTAAATCCAGATTATACTTTGAAGGT CCCAAAAGAATTAGTGGATGAAGAACACCCTTTAATGTACAAGCCTTTTA AGATGCCTGAATATAATAAATATCTTATGTTAGGTGCTAAAAATGGATTG GGTGTCAAGAATTATTGTGGTCTTTAAAAATTTAGTAGCTATGAAAATTT ATTTATGTATTGTTTTGATGAATAAAATGTATCAGATGGCTGGTTGAATA CTTTGAATTTATATTTGGATGGTTATTACGTATGATTGCGTAAAGTATTG TATTGTATTTTATTTTGTTGTGTTGTTTTGTATTGTGTTGCGTTGTATAT ATTGTTTTGATGAATAAAATATATGAGTG.
[0154] In one embodiment, a tomato GAME31 cDNA comprises the nucleic acid sequence of SEQ ID NO: 17. In another embodiment, a tomato GAME31 cDNA consists of the nucleic acid sequence of SEQ ID NO: 17. In another embodiment, SEQ ID NO: 17 comprises or consists of the following nucleic acid sequence:
TABLE-US-00021 (SEQ ID NO: 17) TGACTATAATTGATACTCAATCTGTTGAAATATAATGAACCAATTCTTAT CAAAACACAGTGGAGTACAAGTAATCACGTTGGTTCCTATGAAATGGTTC ATCTATTTCCCATTATATATAGGCTACTTATTTCCTCACCTATAAAGTAA AAAACTTTCTAGTGTTTTCTTCTTTCTTTTGTTTTTTTCTCTTTGCTCAT ATTCTAAAAATATTTCATCAATGGCATCTATCAAATCAGTTAAAGTTCCT ACTATAGATTTTTCCAATTATCAAGAGCTAAAACCAAACACTCCACTATG GGAATCCACAAAAATTCAAGTTTTTGAAGCTTTACAAGAATATGGTTGTT TTGAAGCAATATATGATAAAGTTTCAAAGGAAATTAGAGAGGAAACATTT GATATGTCAAAAGAAATATTTGAATTTCCTTTAGAGACTAAAGTGAAAAA TATCTCAGAAAAACCAATGCATGGCTATATGGGGATGATTCCACAATTGC CATTGTATGAGAGTTTGTGTATTCCTGATTTGCTTAATCCTCAAAGTCTT GAAAAATTTTCTAATATCTTTTGGCCTCAGGGTAATCAACATTTCTGCAA TTTGATAAAATCTTATTCTAATCCACTTGTGGAATTGGATGGGATGTTGA AAAGGATGATTTCGGAGAATTTGGGATTGAAAAATCACATTGATGAATTA TTGAATGCCAATTACTTCCTATTTAGATTTACACATTATAAGGGATCATC AATTGCTAGTGGAGATGAAAATAATAAAGCTGCTGGATTGGGTGGCCACA CGGATGGTAACTTCTTGACTTTTATATCGCAAAATCAAGTTAATGGATTG CAAATCAACAAAAATGGAGAATGGATTGATGTGATTATTTCACCAAATTC TTACGTTGTTTTGGCCGGTGATTCCTTCAAAGCTTGGACAAATGGTCGAT TGCATTCACCTCTCCACAGAGTAACAATGTCCGGACAAAATGATAGACTC TCCATTCAATTGTTTTCATTATCAAAGCCAGGTCACTTCATCCAGGCACC AAAAGAACTAGTAGATGAAGAACACCCATTACTCTTCAAGCCATTTGAAA TTCTTGAATTATTCAAGTATGGTACCACAGAAGCTGGCTATACAGCTCCT CCAAGTGATCTTTTCAAGATTTATTGTGGTGTTTGATATGCTAATTGTTG AATTTCCGCTTCAACAAGCAACTTTTCTAATGAGTTTCATCTTGTTTTTT TAAGTAGTATGCATTTTATGTTTGAATTGTTGCAGTTGGCAATTCATGTT TAATTTGTTTTTGTTTTTTTGAGAAAATATTTCCAATGGGTTTCGTTGGA AATTCGTCTTGTTTTTTTTTTTCAAGTAGTGTACATCTTATTTTTGGATT GTTGATGTTGAGCGCTAATGTTTAATTTGTTTGTGTTTTGAAGAGGATGA TTATACTCTTTAAGAGGATTCACCGTAATCTTTTAGTATTATTTG.
[0155] The start codon (ATG) for SEQ ID NO: 17 starts at nucleotide 221 of SEQ ID NO: 17. The coding sequence present within SEQ ID NO: 17 ends at nucleotide 1186. Therefore, the skilled artisan would recognize that the CDS comprised in SEQ ID NO: 17 comprises nucleotides 221-1186. In one embodiment, the tomato GAME31 CDS comprises the nucleic acid sequence of SEQ ID NO: 59. In another embodiment, the tomato GAME31 CDS consists of the nucleic acid sequence of SEQ ID NO: 59. In another embodiment, SEQ ID NO: 59 comprises or consists of the following nucleic acid sequence:
TABLE-US-00022 (SEQ ID NO: 59) ATGGCATCTATCAAATCAGTTAAAGTTCCTACTATAGATTTTTCCAATTA TCAAGAGCTAAAACCAAACACTCCACTATGGGAATCCACAAAAATTCAAG TTTTTGAAGCTTTACAAGAATATGGTTGTTTTGAAGCAATATATGATAAA GTTTCAAAGGAAATTAGAGAGGAAACATTTGATATGTCAAAAGAAATATT TGAATTTCCTTTAGAGACTAAAGTGAAAAATATCTCAGAAAAACCAATGC ATGGCTATATGGGGATGATTCCACAATTGCCATTGTATGAGAGTTTGTGT ATTCCTGATTTGCTTAATCCTCAAAGTCTTGAAAAATTTTCTAATATCTT TTGGCCTCAGGGTAATCAACATTTCTGCAATTTGATAAAATCTTATTCTA ATCCACTTGTGGAATTGGATGGGATGTTGAAAAGGATGATTTCGGAGAAT TTGGGATTGAAAAATCACATTGATGAATTATTGAATGCCAATTACTTCCT ATTTAGATTTACACATTATAAGGGATCATCAATTGCTAGTGGAGATGAAA ATAATAAAGCTGCTGGATTGGGTGGCCACACGGATGGTAACTTCTTGACT TTTATATCGCAAAATCAAGTTAATGGATTGCAAATCAACAAAAATGGAGA ATGGATTGATGTGATTATTTCACCAAATTCTTACGTTGTTTTGGCCGGTG ATTCCTTCAAAGCTTGGACAAATGGTCGATTGCATTCACCTCTCCACAGA GTAACAATGTCCGGACAAAATGATAGACTCTCCATTCAATTGTTTTCATT ATCAAAGCCAGGTCACTTCATCCAGGCACCAAAAGAACTAGTAGATGAAG AACACCCATTACTCTTCAAGCCATTTGAAATTCTTGAATTATTCAAGTAT GGTACCACAGAAGCTGGCTATACAGCTCCTCCAAGTGATCTTTTCAAGAT TTATTGTGGTGTTTGA
[0156] In one embodiment, a tomato GAME31 cDNA comprises the nucleic acid sequence of SEQ ID NO: 20. In another embodiment, a tomato GAME31 cDNA consists of the nucleic acid sequence of SEQ ID NO: 20. In another embodiment, SEQ ID NO: 20 comprises or consists of the following nucleic acid sequence:
TABLE-US-00023 (SEQ ID NO: 20; SlGAME31-like1) ATGGCATCTACCAAATTAGTTAAAGTTCCCACAATAGATTTTTCAAATCA TCAAGATCTAAAACCAAACACTCCACTATGGGAATCCAAAAAAATTCAAG TTTTTGAAGCTTTGCAAGAATATGGTTGTTTTGAAGCAATTTATGATAAA GTTCCAAAAGATATTAGAGAGGAAACATTTAGTATTTCAAAAGAAATATT TGAATTTCCTTTAGAGACTAAATTGAAAAATATTTCAGAAAAACCAACGC ATGGATATATGGGAATGATTCCACAATTGCCATTGTATGAGAGTTTGTGT ATTCCTGATTTGCTTAATCCTAAAAGTCTTCAAAGTTTTGCTAATATCTT TTGGCCTCAGGGTAACCAACATTTCTGGTATGTTTACTTATGTTTTTATT TCGCCCTAGCAGAAGTGTTCAAAAGTACGACATTAGAAATTCTTAGTGAC TTAATTGATTGA.
[0157] In one embodiment, a tomato GAME31 cDNA comprises the nucleic acid sequence of SEQ ID NO: 23. In another embodiment, a tomato GAME31 cDNA consists of the nucleic acid sequence of SEQ ID NO: 23. In another embodiment, SEQ ID NO: 23 comprises or consists of the following nucleic acid sequence:
TABLE-US-00024 (SEQ ID NO: 23; SlGAME31-like2) TGAGATGTTGAAAAGGATGATTTCGGAGAATTTGGGATTAAAAAATCACA TTGATGAATTATTGAATGCCAATTACATCCTATTTAGATTTACACAGTAT AAGGGATCATCAATTGCTAGTGGAGATGAAAATAATAAAGCAGCTGGATT GGGTGGCCACACAGATGGTAACTTCTTGTCTATTATATCACAAAATGAAG TTAATGGATTGCAAATCAACAAAAATGGAGAGTGGATTGATGTCAACATT TCGCCAAATTCTTATGTTGTTTTATCCGGTGATTCCTTCACAGCATGGAC AAATGGCCGATTGCATTCTCCTGTTCATAGAGTTGAAATGCCCAGAGGAA GTGATAGATATTCCATTCAATTATTTTCATTATCAAAACCAGGTCACTTC ATCGAGGCACCAAAAGAAATGGTGGATGAAGAACACCCTTTGCTTTTCAA GCCATTTGAAATTCTTGGATTACTTGGGTATGGTGCCACAGAAGCTGGCT ATACAACTCCTCCCAGTGATCTTTTCAAGGCATATTGCGGTGTCTGA.
[0158] In one embodiment, a tomato GAME31 cDNA comprises the nucleic acid sequence of SEQ ID NO: 26. In another embodiment, a tomato GAME31 cDNA consists of the nucleic acid sequence of SEQ ID NO: 26. In another embodiment, SEQ ID NO: 26 comprises or consists of the following nucleic acid sequence: TGACTAGAAATAGACATAAAACCCTGTACTTTTTGACACACATGTAA TAGCACTTTCTCTATCTAATACGCAACTCTTTATTAATTTTGCGTAAATTTTGA GCTATTTCCCATTATATATAGGCTACTTATTTCCTCACCTCTTAAGTAAAAAAC TTTCAAGTGTTTCTTCTTTCTTTTATTTCTCTTTGTTCACATATTCTAAAAATAT TTCATCAATGGCATCTATCAAATCAGTTAAAGTTCCTACTATAGATTTTTCCA ATTATCAAGAGCTAAAACCAAACACTCCACTATGGGAATCCACAAAAATTCA AGTTTTTGAAGCTTTTCAAGAATATGGTTGTTTTGAAGCAATATATGATAAAG TTCCAAATGAAATTAGAGAGGAAACATTTGATATGTCAAAAGAAATATTTGA ATTTCCTTTAGATACTAAAGTGAAAAATATTTCAGAAAAACCAATGCATGGAT ATATGGGAATGATTCCACAATTGCCATTGTATGAGAGTTTGTGTATTCCTGAT TTGCTTAATCCTCAAAGTCTTCAAAATTTTGCTAATATCTTTTGGCCTCAGGGT AATCAACATTTCTGCAATTTGGTAAAGTCTTATTCTAATCCACTTGTGGAATT GGATGAGATTTTGAAAAGGATGATTTCGGAGAATTTGAGATTAAAAATTCAC ATTGATGAATTGTTGAATGCCAATTATTTCCTATTTAGATTTACACATTACAA GGGATCATCAATTACTGGTGGAGATGAGAATAACAAAGTTGCTGGATTGGGT GGCCACACAGATGGTAACTTCTTGACTTTTATATCGCAAAATCAAGTCAATGG ATTGCAAATCAACAAAAATGGAGAATGGATTGATGTGAATATTTCACCAAAT TCTTATGTTGTTTTGGCTGGTGATTCCTTCAAAGCTTGGACAAATGGTCGATTG CATTCTCCTCTTCACAGAGTAACAATGTCCGGAGAAAATGATAGACTCTCCAT TCAATTATTTTCATTATCAAAACCAGGTCACTTCATCGAGGCACCAAAAGAAC TAGTGGATGAAGAACACCCTTTACTCTTCAAGCCATTTGAAATTATTGGATTA TTTGAGTATGGTACCACAGAAGCTGGCTATACAGCTCCTCCAAGTGATCTTCT CAAGAGTTATTGCGGTGTTTGATATGCTAATTGCGAATTTCCGCTTCAGCAAC CAACTTTTCTAATAAGTTTCGTCTGAAATTCGTGTTGTTTTAATTATTATGCAT TTTATGTTTGAATTGTTGTAGTTGGCAATTCATGTTTAATTTGTTTGTGTTTTTT TTTTTTCTTTAGTGGAAATGAT (SEQ ID NO: 26; SlGAME31-like3). The start codon (ATG) for SEQ ID NO: 26 starts at nucleotide 217. The coding sequence present within SEQ ID NO: 26 ends at nucleotide 1182. Therefore, the skilled artisan would recognize that the CDS comprised in SEQ ID NO: 26 comprises nucleotides 21-1182.
[0159] In another embodiment, an aubergine GAME31 cDNA comprises the nucleic acid sequence of SEQ ID NO: 28. In another embodiment, an aubergine GAME31 cDNA consists of the nucleic acid sequence of SEQ ID NO: 28. In another embodiment, SEQ ID NO: 28 comprises or consists of the following nucleic acid sequence:
TABLE-US-00025 (SEQ ID NO: 28) ATGGGATCTACCAAATCAATTAAAGTTCCCACTATCGATTTTTCCAA CCATCAAGATCTAAAACCAAACACTCCACAATGGGAATCCACAAAAGATC AAGTTTTTGAAGCTTTTCAAGAATTTGGTTGTTTTGAAGCAATATATGAT AAAGTGCCAAATGAAATTAGAAAGGGCATGTTTGATGTTTCAAAAGAAAT ATTTGAATTTCCCCTAGAGACCAAATTGAAAAACTTATCAGACAAACCAT TACATGGCTACATGGGGATGATTCCAAACTTGCCTTTGTATGAGAGTTTG TGTATTCCTGATTTGCTTAATCCTCAAAGTCTTCAAAATTTTGAAAATAT CTTTTGGCCACATGGAAATCCTGATTTTTGCAATTTGGTAAAATGTTACT CAAATCCACTTGTGGAATTGGATGAAATGTTGAAGAGGATGATTTTGGAG AAATTGGGAGTAGAAAATCAGATTGATGAGTTATTGGATCCCAAATATGT CCTATTTAGATTTACACACTACAAGGGGTCATCACCAACTAATGGAGATA AAAATACTAAAAGTGAGGGACTAGGTGGCCACACTGATGGTAACTTCTTG ACTTTTATAGCACAAAATCAAGTAAGTGGATTGCAAATTAATAAAAATGG AGAGTGGATTGATGTCAACATCTCACCAAATTCTTTTGCTGTTTTGTCTG CTGATTCCTTCAAAGCATGGACAAATGGTCGATTGCATTCTCCAATTCAC AGAGTAACAATGGCTGGAGAAAATGATAGATTCTCCATTCAATTATTTTC ACTATCCAAACCAGGTCACTTCATAGAGGCCCCAAAAGAACTTGTGGATG AACAACACCCTTTACTCTTCAAACCATATGAAATGCTTGGATTATTTAAG TATGTTACTTCACAAAGTGGATATGGAGCTCCTGGTGATGCTTTCAAGGC TTATTGTGGTGTTTGA.
[0160] In another embodiment, a potato GAME31 cDNA comprises the nucleic acid sequence of SEQ ID NO: 31. In another embodiment, a potato GAME31 cDNA consists of the nucleic acid sequence of SEQ ID NO: 31. In another embodiment, SEQ ID NO: 31 comprises or consists of the following nucleic acid sequence:
TABLE-US-00026 (SEQ ID NO: 31) ATGGCATCTACCAAAGTTAAGATTCCCACCATAGATTTTTCTAATCTAGA ACTAAAACCAAACACTCCACTATGGGAATCCACAAAAGTTCAAGTTTTTG AAGCTTTAAAAGAATATGGTTGTTTTGAAGCAACATATGATAAAATTCCA AATGAAATTAGAGAGGGTATTTTTGGTATTACAAAAGAAATATTTCAATT TCCTTTAGAGACCAAAGTGAAAAATTATTCAGATATAACATTACATGGCT ATGTAGGAATGATTCCACACTTGCCATTTTATGAGAGTTTGTGTATTCCT GATTTGCTTAATCCTCAAAATGTTGAAACTTTTGCTAATATCTTTTGGCC TCATGGTAATCCTGATTTCTGCAATTTGGTAAAAGCTTACTCAAATCCAC TTATGGAATTGGATGAAATGTTGAAAAAGATGATTTTGGAGAATTTGGGA TTAGAAAATCATATTGATGAATTGCTGGATATTAATTATATGAGATTTAG ATTTACACATTACAAGGGATCATCAATTATTAGTGGAGATCATGAAAATA ATATTAAACAAGATGGATTGAATGGCCACACAGATGGTAACTTCTTGACT TTTATATCACAAAATCAAGTCAATGGTTTGCAAATCAACAAAAATGGAGA GTGGATTGATGTCAATATTTCACCAAATTCTTATGTTGTTTTGTCTGGTG ATTCATTCAAAGCATGGACAAATGGTCGATTGCATTCTCCCATCCACAAG GTAAAAATATTTGGTGAAAGTGATAGATTCTCAATTCAATTATTTTCATT CTCAAAACCAGGTCACTTTATAAAGGCCCCAAAAGAACTTGTGGATGAAG AACACCCTTTACTCTTCAAGCCATTTGAAATGGTTGGATTATCTGAGTAT GTTACTTCCCAAGCTGGCTATGCAGCTCCCAGTGATGCTTTCAAGGCTTA TTGTGGTCTTTGA.
[0161] In another embodiment, a potato GAME31 cDNA comprises the nucleic acid sequence of SEQ ID NO: 34. In another embodiment, a potato GAME31 cDNA consists of the nucleic acid sequence of SEQ ID NO: 34. In another embodiment, SEQ ID NO: 34 comprises or consists of the following nucleic acid sequence:
TABLE-US-00027 ATGGCATCTACCAAAGTTACGATTCCCACCATAGATTTTTGCGATTCTGA GCTTAAACCAAACACTCCACAATGGGAATCAACAAAAGTTCAAGTTTTTG AAGCCTTACAAGAATTTGGTTGTTTTGAAGCAATATATAACAAAGTTCCA AATGAAATTAGAGAGGGCATGTTTGATACTTTAAAAGAAGTATTTGATTT TCCACTGCCCAAATTGATAGAATATAGAGAGAAACCCTTTCATATATATG ATGGGCAAATTCCAAGTGTACCACTCTTTGGTAGTGTGTACTCTGCTGAT TTGGTCCTCCCAAATAGTGTTGAAACATTTGCCAATACCTTTTGGTCTCA TGGAAACCCTAATTTTAGCAATGTGGCAAAGTCCTACTTCAAGCAACTTA TGGAATTAAATGACATGGTTAAAAAGATGGTTTTGGAGAGTCTTGGGCTA AAAAATTACATTGATGAATTCTTGAATTCCAATGTTTATATGTCAAGATT TACTAATTACAAGGTAATTAAAGGTGAAAATGAGAATAAATCAGGATTAC CTTCCCACACAGATAGTTCCTACTTGACCATAATTAAACAAAATCAAAAT GGATTGCAAGTTCTCTACAAAAATGGAGAGTGGATTGAGCTCAATCGTCA AAATGGACTGCAAGTTCTCTACAAAAATGGAGAGTGGATTGAGCTCAATC ATACTTCACCAAATTCCTATATTGTTTTATCAGAAGATGTTTTTATGGCA TGGACAAATGATAGATTGACATCTGCTCAACACAGGGTTGTAACAACAGG AGACAAAGAAAGATTCTCTATTCAAGTTTTTTCCTTTCCAAATCCAGATT ACACTGTGAAGGTCCCACAAGAATTAGTGGATGAAGAACACCCTTTAATG TACAAGCCTTTTAAGATGTCTGAATATAATAAATATATTATGTTAGGTGC TAAAAATGGATTGGGTGTCAAGAATTATTGTGGTCTTTAA (SEQ ID NO: 34; StGAME31-like1).
[0162] In another embodiment, a potato GAME31 cDNA comprises the nucleic acid sequence of SEQ ID NO: 37. In another embodiment, a potato GAME31 cDNA consists of the nucleic acid sequence of SEQ ID NO: 37. In another embodiment, SEQ ID NO: 37 comprises or consists of the following nucleic acid sequence:
TABLE-US-00028 ATGATTCCACACTTGCCATTTTATGGGAGTTTGTGTATTCCTGATTTGCT TAATCCTCAAAATGTTGAAACTTTTGCTAATATCTTTTGGCCTCATGGTA ATCCTGATTTCTGCAATTTGGTAAAAGCTTACTCAAATCCACTTATGGAA TTGGATGAATTGTTGAAAAGGATGATTTTGGAGAATTTGGGATTAGAAAA TCATATTGATGAATTGTTGGATCCTAATTATATGAGATTTAGATTTACAC ATTACAAGGGATCATCAATTATTAGTGGAGATCATGAAAATAATATTAAA CATGATGGATTGAATGCCACACAGATGGTAGCTTCTTGA (SEQ ID NO: 37; StGAME31-like2).
[0163] In another embodiment, a potato GAME31 cDNA comprises the nucleic acid sequence of SEQ ID NO: 40. In another embodiment, a potato GAME31 cDNA consists of the nucleic acid sequence of SEQ ID NO: 40. In another embodiment, SEQ ID NO: 40 comprises or consists of the following nucleic acid sequence:
TABLE-US-00029 ATGGCATCTACTAAAGGTAAGATTCCCACCATAGATTTTTGCAATCTTGAG CTAAAACCAAACACTCCACAATGGGAATCAACAAAAGTTCAAGTTTTTGAA GCCTTAAAAGAATTTGGTTGTTTTGAAGCAATATATGACAAAGTTCCAAAT GAAATTAGAGAGGGCATGTTTGATAATTTAAAAGAAGTATTTGATTTTCCA TTGTCCAAATTGATAGAATATAGAGAAAAACCCTTTCATATATATGATGGG AAAATTCCAAGTATACCACTCTATGGTAGTGTGAGCTCTGCTGATTTGGTC CTCCCAAATAGTGTTGAAACATTTGCCAATACCTTTTGGTCTGATGGAAAC CCTAACTTTAGGTATGTATTACTTCTTTTAATTATATATAATGTGCTTGGT ATTATGAAAGTCATTTTTCATTAA (SEQ ID NO: 40; StGAME31- like3).
[0164] In another embodiment, a potato GAME31 cDNA comprises the nucleic acid sequence of SEQ ID NO: 43. In another embodiment, a potato GAME31 cDNA consists of the nucleic acid sequence of SEQ ID NO: 43. In another embodiment, SEQ ID NO: 43 comprises or consists of the following nucleic acid sequence:
TABLE-US-00030 ATGGCATCTACCAAAGTTACGATTCCCACCATAGATTTTTGCGATTCTGAG CTTAAACCAAACACTCCACAATGGGAATCAACAAAAGTTCAAGTTTTTGAA GCCTTACAAGAATTTGGTTGTTTTGAAGCAATATATAACAAAGTTCCAAAT GAAATTAGAGAGGGCATGTTTGATACTTTAAAAGAAGTATTTGATTTTCCA CTGCCCAAATTGATAGAATATAGAGAGAAACCCTTTCATATATATGATGGG CAAATTCCAAGTGTACCACTCTTTGGTAGTGTGTACTCTGCTGATTTGGTC CTCCCAAATAGTGTTGAAACATTTGCCAATACCTTTTGGTCTCATGGAAAC CCTAATTTTAGCAATGTGGCAAAGTCCTACTTCAAGCAACTTATGGAATTG AATGACATGGTGGAAAAGATGGTTTTGGAGAGTCTTGGGCTAAAAAATTAC ACTGATGAATTCTTGAATTCCAATGTTTATATGTCAAGATTTACTAATTAC AAGGTAATTAAAGGTGAAAATGAGAATAAATCAGCATTACCTTCACACACA GATAGTTCCTACTTGACCATAATTAAACAAAATCAAAATGGATTGCAAGCA TGGACAAATGATAGATTGACATCTGCTCAACACAGGGTTGTAACAACAGGA GACAAAGATAGATTCTCTGTTCAATTATTTTCCCTCCTAAATCCAGATTAT ACTGTGAAGGTCCCAAAAGAATTAGTGGATGAAGAACACCCTTTAATGTAC AAGCCTTTTAAGATGCCTGAATATAATAAATATCTTATGTTAGGTGCTAAA AATGGATTGGGTGTCAAGAATTATTGTGGTCTTTAA (SEQ ID NO: 43; StGAME31-like4).
[0165] In another embodiment, a potato GAME31 cDNA comprises the nucleic acid sequence of SEQ ID NO: 46. In another embodiment, a potato GAME31 cDNA consists of the nucleic acid sequence of SEQ ID NO: 46. In another embodiment, SEQ ID NO: 46 comprises or consists of the following nucleic acid sequence:
TABLE-US-00031 ATGATATCTTGTTCTGGGCTAAAAAATTACATTGATGAATTCTTGAATTC CAATGTTTTTATGTCAAGATTTACTAATTACAGGGTAATTAAAGGTGAAA ATGAGAATAAATCAGCACTACCTTCCCACACAGATAGTTCCTACTTGACC ATAATTAAACAAAATCAAAATGGATTGCAAGTTCTCTACAAAAATGGAGA GTGGATTGAGCTCAATCATACTTCACCAAATTCCTATATTGTTTTATCAG AAGATGTTTTTATGGCATGGACAAATGATAGATTGACATCTGCTCAACAC AGGGTTGTAACAACAGGAGACAAAGATAGATTCTCTATTCAAGTTTTTTC CTTTCCAAATCCAGATTACACTGTGAAGGTCCCACAAGAATTAGTGGATG AAGAACACCCTTTAATGTTCAAGCCTTTTAAGTTGCCTGAATTTAATAAA TATATTAAGTTAGGTGCTAAAAATGGACCGGGTCTCAAGAATTATTGTGG TTTTTAA (SEQ ID NO: 46; StGAME31-like5).
[0166] In another embodiment, a potato GAME31 cDNA comprises the nucleic acid sequence of SEQ ID NO: 49. In another embodiment, a potato GAME31 cDNA consists of the nucleic acid sequence of SEQ ID NO: 49. In another embodiment, SEQ ID NO: 49 comprises or consists of the following nucleic acid sequence:
TABLE-US-00032 (SEQ ID NO: 49; StGAME31-like6) ATGGCATCTACCAAAGTTAAGATTCCCACCATAGATTTTTGCAATCTTGA GCTAAAACCAAACACTCCACAATGGGAATCAACAAAAGTTCAAGTTTTTG AAGCCTTAAAAGAATTTGGTTGTTTTGAAGCAATATATGACAAAGTTCCA AATGAAATTAGAGAGGGCATGTTTGATACTTTAAAAGAAGTATTTGATTT TCCAGTGTCCAAATTGATAGAATATAGAGAAAAACCCCATTTATATGATG GGCAAATTCCAAGTATACCACTCTATGGTAGTGTGAGCTCTGCTGATTTG GTCCTCCCAAATAGTGTTGAAACATTTGCCAATACCTTTTGGTCTGATGG AAACCCTAACTTTAGCAATGTGGCAAAGTCCTACTTCAAGCAACTTATGG AATTGAATGACATGGTGGAAAAAATGGTTTTGGAGAGTCTTGGGAAAACA AATTACATTGATGAAATCTTGAATTCCAATGTTTTTGTGTCAAGATTTAC TAATTACAAGGTAATTAAAGGTGAAGATGAGAATAGATCAGAATTACCTC CCCACACAGATAGTGGCTACTTGACTATAATTAAACAAAATCAAAATGGA TTGCAAGTTCTCTACAAAAATGGAGAGTGGATAGAGCTCAATAATACAAC ACCAAATTCCTATATTGTTTTATCAGCAGATGCTTTCAGGGCATGGACAA ATGATAGTTTGACATCTGCTGAACACAGAGTAGTAACAACAGGAGACAAA GATAGACTATCTATTCAATTATTTTCCTTTCCCAAATCAAGATTTTGCTG TGAAGGCCCCAAAATAATTAGTGGATGA.
[0167] In another embodiment, a potato GAME31 cDNA comprises the nucleic acid sequence of SEQ ID NO: 52. In another embodiment, a potato GAME31 cDNA consists of the nucleic acid sequence of SEQ ID NO: 52. In another embodiment, SEQ ID NO: 52 comprises or consists of the following nucleic acid sequence:
TABLE-US-00033 (SEQ ID NO: 52; StGAME31-like7) ATGGATTGCAAGTTCTTCTACAAAAATGGAGAGTGGATTGAGCTCAATCA TACCTCACCAAATTCCTATATTGTTTTATCAGCAGATGCTCTTATGGCAT GGACAAATGATAGATTGACATCTGCTCAACATAGGGTTGTAACAACAGGA GACAAAGATAGATTCTCTGTTCAATTATTTTCCCTCGTAAATCCAGATTA TACTTTGAAGGTCCCAAAAGAATTAGTGGATGAAGAACACCCTTTAATGT ACAAGCCTTTTAAGATGCCTGAATATAATAAATATCTTATGTTAGGTGCT AAAAATGGATTGGGTGTCAAGAATTATTGTGGTCTTTAA.
[0168] In one embodiment, a tomato GAME31 polypeptide comprises the amino acid sequence set forth in SEQ ID NO: 18. In another embodiment, a tomato GAME31 polypeptide consists of the amino acid sequence set forth in SEQ ID NO: 18. In another embodiment, SEQ ID NO: 18 comprises or consists of the following amino acid sequence:
TABLE-US-00034 (SEQ ID NO: 18) MASIKSVKVPTIDFSNYQELKPNTPLWESTKIQVFEALQEYGCFEAIYDK VSKEIREETFDMSKEIFEFPLETKVKNISEKPMHGYMGMIPQLPLYESLC IPDLLNPQSLEKFSNIFWPQGNQHFCNLIKSYSNPLVELDGMLKRMISEN LGLKNHIDELLNANYFLFRFTHYKGSSIASGDENNKAAGLGGHTDGNFLT FISQNQVNGLQINKNGEWIDVIISPNSYVVLAGDSFKAWTNGRLHSPLHR VTMSGQNDRLSIQLFSLSKPGHFIQAPKELVDEEHPLLFKPFEILELFKY GTTEAGYTAPPSDLFKIYCGV.
[0169] In one embodiment, a tomato GAME31 polypeptide comprises the amino acid sequence set forth in SEQ ID NO: 21. In another embodiment, a tomato GAME31 polypeptide consists of the amino acid sequence set forth in SEQ ID NO: 21. In another embodiment, SEQ ID NO: 21 comprises or consists of the following amino acid sequence:
TABLE-US-00035 (SEQ ID NO: 21; SlGAME31-like1) MASTKLVKVPTIDFSNHQDLKPNTPLWESKKIQVFEALQEYGCFEAIYDK VPKDIREETFSISKEIFEFPLETKLKNISEKPTHGYMGMIPQLPLYESLC IPDLLNPKSLQSFANIFWPQGNQHFWYVYLCFYFALAEVFKSTTLEILSD LID.
[0170] In one embodiment, a tomato GAME31 polypeptide comprises the amino acid sequence set forth in SEQ ID NO: 24. In another embodiment, a tomato GAME31 polypeptide consists of the amino acid sequence set forth in SEQ ID NO: 24. In another embodiment, SEQ ID NO: 24 comprises or consists of the following amino acid sequence:
TABLE-US-00036 (SEQ ID NO: 24; SlGAME31-like2) EMLKRMISENLGLKNHIDELLNANYILFRFTQYKGSSIASGDENNKAAGL GGHTDGNFLSIISQNEVNGLQINKNGEWIDVNISPNSYVVLSGDSFTAWT NGRLHSPVHRVEMPRGSDRYSIQLFSLSKPGHFIEAPKEMVDEEHPLLFK PFEILGLLGYGATEAGYTTPPSDLFKAYCGV.
[0171] In one embodiment, a tomato GAME31 polypeptide comprises the amino acid sequence set forth in SEQ ID NO: 27. In another embodiment, a tomato GAME31 polypeptide consists of the amino acid sequence set forth in SEQ ID NO: 27. In another embodiment, SEQ ID NO: 27 comprises or consists of the following amino acid sequence:
TABLE-US-00037 MASIKSVKVPTIDFSNYQELKPNTPLWESTKIQVFEAFQEYGCFEAIYDK VPNEIREETFDMSKEIFEFPLDTKVIKNISEKPMHGYMGMIPQLPLYESL CIPDLLNPQSLQNFANIFWPQGNQHFCNLVKSYSNPLVELDEILKRMISE NLRLKIHIDELLNANYFLFRFTHYKGSSITGGDENNKVAGLGGHTDGNFL TFISQNQVNGLQINKNGEWIDVNISPNSYVVLAGDSFKAWTNGRLHSPLH RVTMSGENDRLSIQLFSLSKPGHFIEAPKELVDEEHPLLFKPFEIIGLFE YGTTEAGYTAPPSDLLKSYCGV (SEQ ID NO: 27; SlGAME31- like3).
[0172] In another embodiment, an aubergine GAME31 polypeptide comprises the amino acid sequence set forth in SEQ ID NO: 29. In another embodiment, an aubergine GAME31 polypeptide consists of the amino acid sequence set forth in SEQ ID NO: 29. In another embodiment, SEQ ID NO: 29 comprises or consists of the following amino acid sequence:
TABLE-US-00038 (SEQ ID NO: 29) MGSTKSIKVPTIDFSNHQDLKPNTPQWESTKDQVFEAFQEFGCFEAWD KVPNEIRKGMFDVSKEIFEFPLETKLKNLSDKPLHGYMGMIPNLPLYESL CIPDLLNPQSLQNFENIFWPHGNPDFCNLVKCYSNPLVELDEMLKRMILE KLGVENQIDELLDPKYVLFRFTHYKGSSPTNGDKNTKSEGLGGHTDGNFL TFIAQNQVSGLQINKNGEWIDVNISPNSFAVLSADSFKAWTNGRLHSPIH RVTMAGENDRFSIQLFSLSKPGHFIEAPKELVDEQHPLLFKPYEMLGLFK YVTSQSGYGAPGDAFKAYCGV.
[0173] In another embodiment, a potato GAME31 polypeptide comprises the amino acid sequence set forth in SEQ ID NO: 32. In another embodiment, a potato GAME31 polypeptide consists of the amino acid sequence set forth in SEQ ID NO: 32. In another embodiment, SEQ ID NO: 32 comprises or consists of the following amino acid sequence:
TABLE-US-00039 (SEQ ID NO: 32) MASTKVKIPTIDFSNLELKPNTPLWESTKVQVFEALKEYGCFEATYDKIP NEIREGIFGITKEIFQFPLETKVKNYSDITLHGYVGMIPHLPFYESLCIP DLLNPQNVETFANIFWPHGNPDFCNLVKAYSNPLMELDEMLKKMILENLG LENHIDELLDINYMRFRFTHYKGSSIISGDHENNIKQDGLNGHTDGNFLT FISQNQVNGLQINKNGEWIDVNISPNSYVVLSGDSFKAWTNGRLHSPIHK VKIFGESDRFSIQLFSFSKPGHFIKAPKELVDEEHPLLFKPFEMVGLSEY VTSQAGYAAPSDAFKAYCGL.
[0174] In another embodiment, a potato GAME31 polypeptide comprises the amino acid sequence set forth in SEQ ID NO: 35 In another embodiment, a potato GAME31 polypeptide consists of the amino acid sequence set forth in SEQ ID NO: 35. In another embodiment, SEQ ID NO: 35 comprises or consists of the following amino acid sequence:
TABLE-US-00040 MASTKVTIPTIDFCDSELKPNTPQWESTKVQVFEALQEFGCFEAIYNKVP NEIREGMFDTLKEVFDFPLPKLIEYREKPFHIYDGQIPSVPLFGSVYSAD LVLPNSVETFANTFWSHGNPNFSNVAKSYFKQLMELNDMVKKMVLESLGL KNYIDEFLNSNVYMSRFTNYKVIKGENENKSGLPSHTDSSYLTIIKQNQN GLQVLYKNGEWIELNRQNGLQVLYKNGEWIELNHTSPNSYIVLSEDVFMA WTNDRLTSAQHRVVTTGDKERFSIQVFSFPNPDYTVKVPQELVDEEHPLM YKPFKMSEYNKYIMLGAKNGLGVKNYCGL (SEQ ID NO: 35; StGAME31-like1).
[0175] In another embodiment, a potato GAME31 polypeptide comprises the amino acid sequence set forth in SEQ ID NO: 38 In another embodiment, a potato GAME31 polypeptide consists of the amino acid sequence set forth in SEQ ID NO: 38. In another embodiment, SEQ ID NO: 38 comprises or consists of the following amino acid sequence:
TABLE-US-00041 MIPHLPFYGSLCIPDLLNPQNVETFANIFVVPHGNPDFCNLVKAYSNPLM ELDELLKRMILENLGLENHIDELLDPNYMRFRFTHYKGSSIISGDHENNI KHDGLNATQMVAS (SEQ ID NO: 38; StGAME31-like2).
[0176] In another embodiment, a potato GAME31 polypeptide comprises the amino acid sequence set forth in SEQ ID NO: 41. In another embodiment, a potato GAME31 polypeptide consists of the amino acid sequence set forth in SEQ ID NO: 41. In another embodiment, SEQ ID NO: 41 comprises or consists of the following amino acid sequence:
TABLE-US-00042 MASTKGKIPTIDFCNLELKPNTPQWESTKVQVFEALKEFGCFEAIYDKVP NEIREGMFDNLKEVFDFPLSKLIEYREKPFHIYDGKIPSIPLYGSVSSAD LVLPNSVETFANTFWSDGNPNFRYVLLLLITYNVLGINIKVIFH (SEQ ID NO: 41; StGAME31-like3).
[0177] In another embodiment, a potato GAME31 polypeptide comprises the amino acid sequence set forth in SEQ ID NO: 44. In another embodiment, a potato GAME31 polypeptide consists of the amino acid sequence set forth in SEQ ID NO: 44. In another embodiment, SEQ ID NO: 44 comprises or consists of the following amino acid sequence:
TABLE-US-00043 MISCSGLKNYIDEFLNSNVFMSRFTNYRVIKGENENKSALPSHTDSSYLT IIKQNQNGLQVLYKNGEWIELNHTSPNSYIVLSEDVFMAWTNDRLTSAQH RVVTTGDKDRFSIQVFSFPNPDYTVKVPQELVDEEHPLMFKPFKLPEFNK YIKLGAKNGPGLKNYCGF (SEQ ID NO: 44; StGAME31- like4).
[0178] In another embodiment, a potato GAME31 polypeptide comprises the amino acid sequence set forth in SEQ ID NO: 47. In another embodiment, a potato GAME31 polypeptide consists of the amino acid sequence set forth in SEQ ID NO: 47. In another embodiment, SEQ ID NO: 47 comprises or consists of the following amino acid sequence:
TABLE-US-00044 MISCSGLKNYIDEFLNSNVFMSRFTNYRVIKGENENKSALPSHTDSSYLT IIKQNQNGLQVLYKNGEWIELNHTSPNSYIVLSEDVFMAWTNDRLTSAQH RVVTTGDKDRFSIQVFSFPNPDYTVKVPQELVDEEHPLMFKPFKLPEFNK YIKLGAKNGPGLKNYCGF (SEQ ID NO: 47; StGAME31- like5).
[0179] In another embodiment, a potato GAME31 polypeptide comprises the amino acid sequence set forth in SEQ ID NO: 50 In another embodiment, a potato GAME31 polypeptide consists of the amino acid sequence set forth in SEQ ID NO: 50. In another embodiment, SEQ ID NO: 50 comprises or consists of the following amino acid sequence:
TABLE-US-00045 MASTKVKIPTIDFCNLELKPNTPQWESTKVQVFEALKEFGCFEAIYDKVP NEIREGMFDTLKEVFDFPVSKLIEYREKPHLYDGQIPSIPLYGSVSSADL VLPNSVETFANTFWSDGNPNFSNVAKSYFKQLMELNDMVEKMVLESLGKT NYIDEILNSNVFVSRFTNYKVIKGEDENRSELPPHTDSGYLTIIKQNQNG LQVLYKNGEWIELNNTTPNSYIVLSADAFRAWTNDSLTSAEHRVVTTGDK DRLSIQLFSFPKSRFCCEGPKIISG (SEQ ID NO: 50; StGAME31-like6).
[0180] In another embodiment, a potato GAME31 polypeptide comprises the amino acid sequence set forth in SEQ ID NO: 53. In another embodiment, a potato GAME31 polypeptide consists of the amino acid sequence set forth in SEQ ID NO: 53. In another embodiment, SEQ ID NO: 53 comprises or consists of the following amino acid sequence:
TABLE-US-00046 MDCKFFYKNGEWIELNHTSPNSYIVLSADALMAWTNDRLTSAQHRVVTTGD KDRFSVQLFSLVNPDYTLKVPKELVDEEHPLMYKPFKMPEYNKYLMLGAKN GLGVKNYCGL (SEQ ID NO: 53; StGAME31-like7).
[0181] In another embodiment, a 2-oxoglutarate-dependent dioxygenase enzyme (GAME31) comprises the amino acid sequence set forth in any one of SEQ ID NO: 18, SEQ ID NO: 21, SEQ ID NO: 24, SEQ ID NO: 27, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 35, SEQ ID NO: 38, SEQ ID NO: 41, SEQ ID NO: 44, SEQ ID NO: 47, SEQ ID NO: 50, and SEQ ID NO: 53, or a protein homologue thereof, wherein said protein homologue is at least 80% homologous to any of SEQ ID NO: 18, SEQ ID NO: 21, SEQ ID NO: 24, SEQ ID NO: 27, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 35, SEQ ID NO: 38, SEQ ID NO: 41, SEQ ID NO: 44, SEQ ID NO: 47, SEQ ID NO: 50, and SEQ ID NO: 53.
[0182] In one embodiment, homologues of the GAME31 enzyme comprise a 2-oxoglutarate-dependent dioxygenase enzyme activity. In some embodiments, a homologue also encompasses deletion, insertion, or substitution variants thereof and biologically active polypeptide fragments thereof. In one embodiment, the variant comprises conservative substitutions, or deletions, insertions, or substitutions that do not significantly alter the three dimensional structure of the GAME31 enzyme. In another embodiment, the deletion, insertion, or substitution does not alter the function of interest of the GAME31 enzyme, which in one embodiment wherein said plant is a tomato plant, is a step in the conversion of dehydrotomatine to hydroxy-dehydrotomatine, and a step in the conversion of .alpha.-tomatine to hydroxytomatine. In another embodiment, the deletion, insertion, or substitution does not alter the function of interest of the GAME31 enzyme, which in one embodiment wherein said plant is a potato plant, is a step in the conversion of .alpha.-solanine to leptinine II and a step in the conversion of .alpha.-chaconine to leptinine I. In another embodiment, the deletion, insertion, or substitution does not alter the function of interest of the GAME31 enzyme, which in one embodiment wherein said plant is an aubergine plant, is a step in the conversion of solasonine to hydroxysolasonine and a step in the conversion of .alpha.-solamargine to hydroxysolamargine.
[0183] In another embodiment, the disclosure includes a homologue of a GAME31 enzyme. In another embodiment, the disclosure includes a homologue of a GAME31 enzyme having a 2-oxoglutarate-dependent dioxygenase enzyme activity. In another embodiment, homologues comprise polypeptides which are at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 87%, at least 89%, at least 91%, at least 93%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% homologous to a GAME31 enzyme as determined using BlastP software of the National Center of Biotechnology Information (NCBI) using default parameters.
[0184] In another embodiment, the amino acid sequence of a GAME31 enzyme homologue is at least 70% homologous to a GAME31 amino acid sequence or a peptide thereof, described herein. In another embodiment, the amino acid sequence of a GAME31 enzyme homologue is at least 80% homologous a GAME31 amino acid sequence or a peptide thereof, described herein. In another embodiment, the amino acid sequence of a GAME31 enzyme homologue is at least 90% homologous a GAME31 amino acid sequence or a peptide thereof, described herein. In another embodiment, the amino acid sequence of a GAME31 enzyme homologue is at least 95% homologous a GAME31 amino acid sequence or a peptide thereof, described herein. In another embodiment, the amino acid sequence of a GAME31 enzyme homologue is at least 98% homologous a GAME31 amino acid sequence or a peptide thereof, described herein.
[0185] In one embodiment, homologues of GAME31 enzyme are expressed in a plant, wherein said plant comprises a cultivated tomato, a wild tomato, a cultivated potato, a wild potato, or an aubergine plant.
[0186] In another embodiment, a 2-oxoglutarate-dependent dioxygenase comprises the amino acid sequence set forth in any one of SEQ ID NO: 18, SEQ ID NO: 21, SEQ ID NO: 24, SEQ ID NO: 27, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 35, SEQ ID NO: 38, SEQ ID NO: 41, SEQ ID NO: 44, SEQ ID NO: 47, SEQ ID NO: 50, and SEQ ID NO: 53.
[0187] In one embodiment, the 2-oxoglutarate-dependent dioxygenase (GAME31) polypeptide is encoded by a gene comprising the nucleotide sequence set forth in any one of SEQ ID NO: 16, SEQ ID NO: 19, SEQ ID NO: 22, SEQ ID NO: 25, SEQ ID NO: 30, SEQ ID NO: 33, SEQ ID NO: 36, SEQ ID NO: 39, SEQ ID NO: 42, SEQ ID NO: 45, SEQ ID NO: 48, and SEQ ID NO: 51, or a gene homologue thereof, wherein said gene homologue is at least 80% homologous to any of SEQ ID NO: 16, SEQ ID NO: 19, SEQ ID NO: 22, SEQ ID NO: 25, SEQ ID NO: 30, SEQ ID NO: 33, SEQ ID NO: 36, SEQ ID NO: 39, SEQ ID NO: 42, SEQ ID NO: 45, SEQ ID NO: 48, and SEQ ID NO: 51. In another embodiment, the 2-oxoglutarate-dependent dioxygenase (GAME31) polypeptide is encoded by a cDNA comprising the nucleotide sequence set forth in any one of SEQ ID NO: 17, SEQ ID NO: 20, SEQ ID NO: 23, SEQ ID NO: 26, SEQ ID NO: 28, SEQ ID NO: 31, SEQ ID NO: 34, SEQ ID NO: 37, SEQ ID NO: 40, SEQ ID NO: 43, SEQ ID NO: 46, SEQ ID NO: 49, and SEQ ID NO: 52, or a cDNA homologue thereof, wherein said cDNA homologue is at least 80% homologous to any of SEQ ID NO: 17, SEQ ID NO: 20, SEQ ID NO: 23, SEQ ID NO: 26, SEQ ID NO: 28, SEQ ID NO: 31, SEQ ID NO: 34, SEQ ID NO: 37, SEQ ID NO: 40, SEQ ID NO: 43, SEQ ID NO: 46, SEQ ID NO: 49, and SEQ ID NO: 52.
[0188] In one embodiment, the 2-oxoglutarate-dependent dioxygenase (GAME31) polypeptide is encoded by a gene comprising the nucleotide sequence set forth in any one of SEQ ID NO: 16, SEQ ID NO: 19, SEQ ID NO: 22, SEQ ID NO: 25, SEQ ID NO: 30, SEQ ID NO: 33, SEQ ID NO: 36, SEQ ID NO: 39, SEQ ID NO: 42, SEQ ID NO: 45, SEQ ID NO: 48, and SEQ ID NO: 51. In another embodiment, the 2-oxoglutarate-dependent dioxygenase (GAME31) polypeptide is encoded by a cDNA comprising the nucleotide sequence set forth in any one of SEQ ID NO: 17, SEQ ID NO: 20, SEQ ID NO: 23, SEQ ID NO: 26, SEQ ID NO: 28, SEQ ID NO: 31, SEQ ID NO: 34, SEQ ID NO: 37, SEQ ID NO: 40, SEQ ID NO: 43, SEQ ID NO: 46, SEQ ID NO: 49, and SEQ ID NO: 52.
[0189] In one embodiment, the 2-oxoglutarate-dependent dioxygenase (GAME31) polypeptide is encoded by a nucleic acid sequence set forth in any one of SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 28, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 51 and SEQ ID NO: 52, or a nucleic acid homologue thereof, wherein said homologue is at least 80% homologous to any of SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 28, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 51 and SEQ ID NO: 52.
[0190] In one embodiment, the 2-oxoglutarate-dependent dioxygenase (GAME31) polypeptide is encoded by a nucleic acid sequence set forth in any one of SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 28, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 51 and SEQ ID NO: 52.
[0191] In some embodiment, the 2-oxoglutarate-dependent dioxygenase (GAME31) is encoded by a gene comprising the polynucleotide sequence set forth in any one of SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 28, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 51, or SEQ ID NO: 52, or a nucleic acid sequence having at least 80% identity to any of SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 28, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 51, or SEQ ID NO: 52.
[0192] In one embodiment, homologues of a GAME31 gene or a GAME31 cDNA encode a polypeptide comprising a 2-oxoglutarate-dependent dioxygenase enzyme activity. In some embodiments, a homologue also encompasses deletion, insertion, or substitution variants, thereof, and biologically active polynucleotide fragments thereof. In one embodiment, the variant comprises conservative substitutions, or deletions, insertions, or substitutions that do not significantly alter the three dimensional structure of the encoded GAME31 enzyme. In another embodiment, the deletion, insertion, or substitution does not alter the function of interest of the encoded GAME31 enzyme, which in one embodiment wherein said plant is a tomato plant, is a step in the conversion of dehydrotomatine to hydroxy-dehydrotomatine and/or a step in the conversion of .alpha.-tomatine to hydroxy tomatine. In another embodiment, the deletion, insertion, or substitution does not alter the function of interest of the encoded GAME31 enzyme, which in another embodiment wherein said plant is a potato plant, is a step in the conversion of .alpha.-solanine to leptinine II and/or conversion of .alpha.-chaconine to leptinine I. In another embodiment, the deletion, insertion, or substitution does not alter the function of interest of the encoded GAME31 enzyme, which in another embodiment wherein said plant is an aubergine plant, is a step in the conversion of solasonine to hydroxysolasonine and/or the conversion of solamargine to hydroxysolamargine.
[0193] In another embodiment, disclosed herein are GAME31 gene homologues. In another embodiment, disclosed herein are GAME31 cDNA homologues. In another embodiment, disclosed herein are GAME31 gene homologues encoding an enzyme having a 2-oxoglutarate-dependent dioxygenase enzyme activity. In another embodiment, the disclosure includes a homologue of a GAME31 cDNA encoding an enzyme having a 2-oxoglutarate-dependent dioxygenase enzyme activity. In another embodiment, homologues comprise a polynucleotide sequence which is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 87%, at least 89%, at least 91%, at least 93%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% homologous to a GAME31 gene nucleic acid sequence.
[0194] In another embodiment, the nucleic sequence of a GAME31 gene homologue is at least 70% homologous to a GAME31 nucleic acid sequence or a fragment thereof, described herein. In another embodiment, the nucleic sequence of a GAME31 gene homologue is at least 80% homologous to a GAME31 nucleic acid sequence or a fragment thereof, described herein. In another embodiment, the nucleic sequence of a GAME31 gene homologue is at least 90% homologous to a GAME31 nucleic acid sequence or a fragment thereof, described herein. In another embodiment, the nucleic sequence of a GAME31 gene homologue is at least 95% homologous to a GAME31 nucleic acid sequence or a fragment thereof, described herein. In another embodiment, the nucleic sequence of a GAME31 gene homologue is at least 98% homologous to a GAME31 nucleic acid sequence or a fragment thereof, described herein.
[0195] In another embodiment, the nucleic sequence of a GAME31 cDNA homologue is at least 70% homologous to a GAME31 nucleic acid sequence or a fragment thereof, described herein. In another embodiment, the nucleic sequence of a GAME31 cDNA homologue is at least 80% homologous to a GAME31 nucleic acid sequence or a fragment thereof, described herein. In another embodiment, the nucleic sequence of a GAME31 cDNA homologue is at least 90% homologous to a GAME31 nucleic acid sequence or a fragment thereof, described herein. In another embodiment, the nucleic sequence of a GAME31 cDNA homologue is at least 95% homologous to a GAME31 nucleic acid sequence or a fragment thereof, described herein. In another embodiment, the nucleic sequence of a GAME31 cDNA homologue is at least 98% homologous to a GAME31 nucleic acid sequence or a fragment thereof, described herein.
[0196] In one embodiment, homologues of a GAME31 gene are expressed in a plant, wherein said plant includes a cultivated tomato, a wild tomato, a cultivated potato, a wild potato, a sweet or chili pepper, an aubergine plant, and a bittersweet plant. In one embodiment, homologues of a GAME31 cDNA are expressed in a plant, wherein said plant comprises a cultivated tomato, a wild tomato, a cultivated potato, a wild potato, a sweet or chili pepper, an aubergine plant, and a bittersweet plant.
[0197] In one embodiment, a genetically modified plant as disclosed herein comprises a Solanaceae crop plant. A skilled artisan would appreciate that the term "Solanaceae" refers to a family of plants that includes the genus Solanum. In some embodiments, a Solanaceae crop plant is selected from the group comprising Solanum lycopersicum, Solanum pennellii, Solanum tuberosum, Solanum chacoense, Capiscum annuum, Solanum melongena, and Solanum dulcamara. In some embodiments, a Solanaceae crop plant comprises any Solanaceae crop plant that produces a steroidal alkaloid or a glycosylated derivative thereof, or an unsaturated or saturated steroidal saponin or a glycoside derivative thereof, or any combination thereof.
[0198] Steroidal alkaloids (SAs), also known as "Solanum alkaloids" and the glycosylated derivatives thereof, are common constituents of numerous plants belonging to the Solanaceae family, particularly of the genus Solanum. Estimated in the order of 1350 species, Solanum is one of the largest genera of flowering plants, representing about a half of the species in the Solanaceae. SAs the glycosylated derivatives thereof have diverse structural composition and biological activity, and they occur in food plants included in the Solanum genus, including tomato (Solanum lycopersicum), wild-tomato (Solanum pennellii), potato (Solanum tuberosum), eggplant (Solanum melongena), and bittersweet plant (Solanum dukamara). In one embodiment, a plant disclosed herein is selected from the Solanum genus of plants comprising cultivated tomato (Solanum lycopersicum), wild-tomato (Solanum pennellii), cultivated potato (Solanum tuberosum), wild potato Solanum chacoense, eggplant (Solanum melongena), and bittersweet plant (Solanum dulcamara). In another embodiment, a plant disclosed herein is selected from the family of Solanaceae crop plants comprising a cultivated tomato plant (Solanum lycopersicum), a wild-tomato plant (Solanum pennellii), a cultivated potato plant (Solanum tuberosum), a wild potato plant Solanum chacoense, a sweet bell pepper plant (Capsicum annuum), a sweet or chili pepper plant (Capsicum annuum), an eggplant plant (Solanum melongena), and a bittersweet plant (Solanum dulcamara).
[0199] In one embodiment, an altered expression of said at least one gene comprising GAME25, or GAME31, or a combination thereof, comprises a reduced or inhibited expression of said at least one gene compared to its expression in a corresponding unmodified plant, and wherein said altered content comprises a reduced content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof compared to said corresponding unmodified plant.
[0200] In another embodiment, altered expression of said at least one gene is comprises reduced or inhibited expression of said gene. In another embodiment, altered expression of said at least one gene comprises reduced expression of said gene. In another embodiment, altered expression of said at least one gene comprises inhibited expression of said gene.
[0201] In another embodiment, altered expression of a GAME25 gene comprises reduced or inhibited expression of the GAME25 gene. In another embodiment, altered expression of said GAME25 gene comprises reduced expression of the GAME25 gene. In another embodiment, altered expression of said GAME25 gene comprises inhibited expression of the GAME25 gene.
[0202] In another embodiment, altered expression of a GAME31 gene comprises reduced or inhibited expression of the GAME31 gene. In another embodiment, altered expression of said GAME31 gene comprises reduced expression of the GAME31 gene. In another embodiment, altered expression of said GAME31 gene comprises inhibited expression of the GAME31 gene.
[0203] In another embodiment, altered expression of a GAME31 gene and a GAME25 gene comprises reduced or inhibited expression of the GAME31 gene and the GAME25 gene. In another embodiment, altered expression of said GAME31 gene and said GAME25 gene comprises reduced expression of both genes. In another embodiment, altered expression of said GAME31 gene and said GAME25 gene comprises inhibited expression of both genes. In another embodiment, altered expression of said GAME31 gene and said GAME25 gene comprises reduced expression of said GAME31 gene and inhibited expression of said GAME25 gene. Alternatively, in another embodiment, altered expression of said GAME31 gene and said GAME25 gene comprises reduced expression of said I gene and inhibited expression of said GAME31 gene.
[0204] In some embodiments, altered expression comprises a reduced or inhibited expression of said GAME25 gene, or GAME31 gene, or a combination thereof compared to its expression in a corresponding unmodified plant; or an increased expression of said GAME25 gene, or GAME31 gene, or a combination thereof compared to its expression in a corresponding unmodified plant; or a combination of reduced or inhibited expression of one of said GAME25 gene or said GAME31 gene, and increased expression the other of said GAME25 gene or said GAME31 gene of compared to their expression in a corresponding unmodified plant and increased expression of.
[0205] In one embodiment, gene expression of at least one gene is reduced by at least 5% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least one gene is reduced by at least 10% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least one gene is reduced by at least 15% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least one gene is reduced by at least 20% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least one gene is reduced by at least 25% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least one gene is reduced by at least 30% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least one gene is reduced by at least 35% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least one gene is reduced by at least 40% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least one gene is reduced by at least 45% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least one gene is reduced by at least 50% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least one gene is reduced by at least 55% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least one gene is reduced by at least 60% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least one gene is reduced by at least 65% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least one gene is reduced by at least 70% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least one gene is reduced by at least 75% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least one gene is reduced by at least 80% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least one gene is reduced by at least 85% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least one gene is reduced by at least 90% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least one gene is reduced by at least 95% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least one gene is reduced by at least 98% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least one gene is reduced by 100% compared to a corresponding unmodified plant.
[0206] In another embodiment, gene expression of at least two genes is reduced by at least 5% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least two genes is reduced by at least 10% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least two genes is reduced by at least 15% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least two genes is reduced by at least 20% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least two genes is reduced by at least 25% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least two genes is reduced by at least 30% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least two genes is reduced by at least 35% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least two genes is reduced by at least 40% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least two genes is reduced by at least 45% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least two genes is reduced by at least 50% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least two genes is reduced by at least 55% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least two genes is reduced by at least 60% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least two genes is reduced by at least 65% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least two genes is reduced by at least 70% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least two genes is reduced by at least 75% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least two genes is reduced by at least 80% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least two genes is reduced by at least 85% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least two genes is reduced by at least 90% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least two genes is reduced by at least 95% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least two genes is reduced by at least 98% compared to a corresponding unmodified plant. In another embodiment, gene expression of at least two genes is reduced by 100% compared to a corresponding unmodified plant.
[0207] It would be appreciated by the skilled artisan that while the gene expression of more than one gene may be altered, the percent change of expression, for example reduction, may not be the same for both genes. That is one gene may have reduced expression of a percent greater than or less than the percent change in a second gene.
[0208] Altered gene expression in at least one cell of a genetically modified plant described herein, results in the genetically modified plant having an altered content of at least one steroidal alkaloids or a glycosylated derivative thereof, compared to a corresponding unmodified plant. In one embodiment, an at least one steroidal alkaloid or glycosylated derivative thereof a genetically modified plant described herein comprises a steroidal alkaloid or glycosylated derivative thereof selected from the group comprising solasodine, hydroxyl solasodine, .alpha.-solanine, .alpha.-chaconine, tomatidine, .alpha.-tomatine, hydroxytomatine, acetoxytomatine, acetoxy-hydroxytomatine, tomatidine+4 hexose, esculeoside A, esculeoside A+hexose, esculeoside B, acetoxyesculeoside B, demissidine, demissine, dehydrosolasodine, hydroxy-dehydrotomatine, acetoxy-hydroxy-dehydrotomatine, dehydrotomatidine, dehydroesculeosides, leptinine I, leptinine II, leptine I, leptine II, and hydroxysolamargine, or any derivatives thereof, or any combination thereof. In another embodiment, the altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof is altered in a part of the plant selected from the group comprising a peel, a leaf, a young leaf, a mature leaf, a bud, a petal, a root, and an edible part of the plant. In another embodiment, the altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof is altered in an edible plant part. In another embodiment, the altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof is altered in a non-edible plant part. In another embodiment, the altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof is altered in a leaf. In another embodiment, the altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof is altered in a young leaf. In another embodiment, the altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof is altered in a mature leaf. In another embodiment, the altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof is altered in a bud. In another embodiment, the altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof is altered in a petal. In another embodiment, the altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof is altered in a root. In another embodiment, the genetically modified plant has an altered content of a at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof is selected from the family of Solanaceae crop plants.
[0209] In some embodiments, altered content comprises an appearance of at least one steroidal alkaloid or a glycosylated derivative thereof compared to said corresponding unmodified plant that does not contain said at least one steroidal alkaloid or a glycosylated derivative thereof. In some embodiments, the appearance of at least one steroidal alkaloid or a glycosylated derivative thereof comprises a new appearance of said steroidal alkaloid or a glycosylated derivative thereof, wherein the plant does not naturally produce said steroidal alkaloid or a glycosylated derivative thereof.
[0210] In some embodiments, altered content comprises an appearance of at least one unsaturated or saturated steroidal saponin or a glycosylated derivative thereof compared to said corresponding unmodified plant that does not contain said at least one unsaturated or saturated steroidal saponin or a glycosylated derivative thereof. In some embodiments, the altered content comprises an appearance of said at least one unsaturated or saturated steroidal saponin or a glycosylated derivative thereof, wherein the plant does not naturally produce said unsaturated or saturated steroidal saponin or a glycosylated derivative thereof.
[0211] In another embodiment, the altered content of at least one steroidal alkaloid or a glycosylated derivative thereof comprises altering the content of an anti-nutritional steroidal alkaloid or glycosylated derivative thereof. In yet another embodiment, the altered content of at least one steroidal alkaloid or a glycosylated derivative thereof comprises altering the content of a steroidal alkaloid or glycosylated derivative thereof that provides plant resistance to pests or pathogens. In still a further embodiment, the altered content of at least one steroidal alkaloid or a glycosylated derivative thereof comprises altering the content of both an anti-nutritional steroidal alkaloid or glycosylated derivative thereof, and a steroidal alkaloid or glycosylated derivative thereof that provides plant resistance to pests or pathogens.
[0212] In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises reduction of said SA or SGA content by at least 5% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises reduction of said SA or SGA content by at least 10% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises reduction of said SA or SGA content by at least 15% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises reduction of said SA or SGA content by at least 20% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises reduction of said SA or SGA content by at least 25% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises reduction of said SA or SGA content by at least 30% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises reduction of said SA or SGA content by at least 35% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises reduction of said SA or SGA content by at least 40% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises reduction of said SA or SGA content by at least 45% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises reduction of said SA or SGA content by at least 50% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises reduction of said SA or SGA content by at least 55% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises reduction of said SA or SGA content by at least 60% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises reduction of said SA or SGA content by at least 65% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises reduction of said SA or SGA content by at least 70% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises reduction of said SA or SGA content by at least 75% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises reduction of said SA or SGA content by at least 80% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises reduction of said SA or SGA content by at least 85% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises reduction of said SA or SGA content by at least 90% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises reduction of said SA or SGA content by at least 95% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises reduction of said SA or SGA content by 100% compared to the corresponding unmodified plant.
[0213] In some embodiments, the altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof comprises
[0214] a reduced content of at least one steroidal alkaloid or a glycosylated derivative thereof compared to said corresponding unmodified plant, or
[0215] an increased content of at least one steroidal alkaloid or a glycosylated derivative thereof compared to said corresponding unmodified plant, or
[0216] a reduced content of at least one unsaturated or saturated steroidal saponin or a glycosylated derivative thereof compared to said corresponding unmodified plant, or
[0217] an increased content of at least one unsaturated or saturated steroidal saponin or a glycosylated derivative thereof compared to said corresponding unmodified plant, or
[0218] a combination of a reduced content of at least one steroidal alkaloid or a glycosylated derivative thereof, and an increased content of at least one steroidal alkaloid or a glycosylated derivative thereof,
[0219] or any combination thereof,
compared to said corresponding unmodified plant.
[0220] In some embodiments, the reduced content of at least one steroidal alkaloid or a glycosylated derivative thereof comprises reduced content of at least one anti-nutritional steroidal alkaloid or a glycosylated derivative thereof, or reduced content of at least one toxic steroidal alkaloid or a glycosylated derivative thereof, or a combination thereof. In some embodiments, the increased content results in increased plant resistance to at least one plant pathogen, pest, or predator, or any combination thereof, and optionally generates precursor molecules for steroidal alkaloid molecules that provide resistance to at least one plant pathogen, pest, or predator, or any combination thereof.
[0221] In some embodiments, an altered steroidal alkaloid or a glycosylated derivative thereof is selected from the group comprising tomatidine, .alpha.-tomatine, .alpha.-tomatine isomer (1 and 2), .alpha.-tomatine isomer 1, .alpha.-tomatine isomer 2, hydroxytomatine, acetoxytomatine, dehydrotomatidine, dehydrotomatine, dehydrotomatine isomer 1, dehydrotomatine+4-hexose, acetoxy-hydroxytomatine, acetoxy-hydroxy-dehydrotomatine, tomatidine+4 hexose, esculeoside A, esculeoside A+hexose, esculeoside B, acetoxyesculeoside B, demissidine, demissine, dehydrosolasodine, hydroxy-dehydrotomatine, acetoxy-hydroxy-dehydrotomatine, dehydroesculeosides, dehydroesculeoside A, dehydroesculeoside A+hexose, leptinine I, leptinine II, leptine I, leptine II, soladulcidine, .beta.-soladulcine, soladulcine A, solanidine, .alpha.-solanine, .alpha.-chaconine, solasoidine, .alpha.-solasonine, .alpha.-solamargine, hydroxysolasonine, and hydroxysolamargine, or any derivatives thereof, or any combination thereof.
[0222] In some embodiments, an altered unsaturated or saturated steroidal saponin or a glycosylated derivative thereof is selected from the group comprising dioscin, diosgenin, parillin, and sarasapogenin.
[0223] In some embodiments, an altered unsaturated or saturated steroidal saponin or a glycosylated derivative thereof is selected from the group comprising aescin, araloside A, astragaloside, bacopaside, bacoside, bacoside A, chaconine, charantin, daucosterol, esculeoside A, ginsenoside, glycyrrhizin, .alpha.-hederin, holothurin, momordicine, momordin, osladin, protodioscin, pseudoginsenoside F11, QS21, solanine, triterpenoid saponin, and ziziphin.
[0224] In some embodiments, the reduced content of at least one steroidal alkaloid or a glycosylated derivative thereof comprises reduced content of at least one anti-nutritional steroidal alkaloid or a glycosylated derivative thereof. In some embodiments, an anti-nutritional steroidal alkaloid or a glycosylated derivative thereof comprises a steroidal alkaloid or glycosylated derivative endogenous to the plant.
[0225] In some embodiments, an anti-nutritional steroidal alkaloid or a glycosylated derivative thereof comprises anti-nutritional properties towards a mammal. In some embodiments, an anti-nutritional steroidal alkaloid or a glycosylated derivative thereof comprises anti-nutritional properties towards a human subject. In some embodiments, an anti-nutritional steroidal alkaloid or a glycosylated derivative thereof comprises anti-nutritional properties towards a farm animal. In some embodiments, an anti-nutritional steroidal alkaloid or a glycosylated derivative thereof comprises anti-nutritional properties towards a domesticated animal A skilled artisan would appreciate that an anti-nutritional steroidal alkaloid, or a glycosylated derivative may encompass lethal toxins or compounds that disrupt digestion and nutrient absorption, or any combination thereof. In another embodiment, an anti-nutritional steroidal alkaloid or a glycosylated derivative comprises a toxin. In some embodiments, the reduced content of at least one steroidal alkaloid or a glycosylated derivative thereof comprises reduced content of at least one toxic steroidal alkaloid or a glycosylated derivative thereof.
[0226] In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said SA or SGA content by at least 5% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said SA or SGA content by at least 10% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said SA or SGA content by at least 15% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said SA or SGA content by at least 20% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said SA or SGA content by at least 25% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said SA or SGA content by at least 30% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said SA or SGA content by at least 35% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said SA or SGA content by at least 40% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said SA or SGA content by at least 45% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said SA or SGA content by at least 50% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said SA or SGA content by at least 55% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said SA or SGA content by at least 60% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said SA or SGA content by at least 65% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said SA or SGA content by at least 70% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said SA or SGA content by at least 75% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said SA or SGA content by at least 80% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said SA or SGA content by at least 85% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said SA or SGA content by at least 90% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said SA or SGA content by at least 95% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said SA or SGA content by 100% compared to the corresponding unmodified plant.
[0227] In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) comprises increased content of at least one steroidal alkaloid or glycosylated derivative thereof that provides resistance to a plant pathogen, pest, or predator compared to a corresponding unmodified plant.
[0228] In another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) comprises increased content of at least one precursor molecule for at least steroidal alkaloid or glycosylated derivative thereof that provides resistance to a plant pathogen, pest, or predator compared to a corresponding unmodified plant. In another embodiment the content of said at least one precursor is increased by at least 5% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one precursor steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said precursor SA or SGA content by at least 10% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one precursor steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said precursor SA or SGA content by at least 15% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one precursor steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said precursor SA or SGA content by at least 20% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one precursor steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said precursor SA or SGA content by at least 25% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one precursor steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said precursor SA or SGA content by at least 30% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one precursor steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said precursor SA or SGA content by at least 35% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one precursor steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said precursor SA or SGA content by at least 40% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one precursor steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said precursor SA or SGA content by at least 45% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one precursor steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said precursor SA or SGA content by at least 50% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one precursor steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said precursor SA or SGA content by at least 55% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one precursor steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said precursor SA or SGA content by at least 60% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one precursor steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said precursor SA or SGA content by at least 65% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one precursor steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said precursor SA or SGA content by at least 70% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one precursor steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said precursor SA or SGA content by at least 75% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one precursor steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said precursor SA or SGA content by at least 80% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one precursor steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said precursor SA or SGA content by at least 85% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one precursor steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said precursor SA or SGA content by at least 90% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one precursor steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said precursor SA or SGA content by at least 95% compared to the corresponding unmodified plant. In another embodiment, the altered content of at least one precursor steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises increase of said precursor SA or SGA content by 100% compared to the corresponding unmodified plant.
[0229] A skilled artisan would appreciate that the terms "plant pathogen" or "plant predator" or "plant pest" may encompass any organism that can infect and cause harm to a plant or any part thereof. In some embodiments, a plant can be harmed by an inhibition or slowing of the growth of a plant, by damage to a tissue or tissues of a plant, by a weakening of the defense mechanism of a plant, by a reduction in the resistance of a plant to abiotic stresses, by a premature death of the plant, and the like. Plant pathogens, pests, and or predators include, but are not limited to insects, fungi, oomycetes, viruses, and bacteria.
[0230] In another embodiment, a genetically modified potato plant comprises increased content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant, wherein said SA or SGA is selected from the group comprising leptinine I, leptinine II, leptine I, or leptine II, or any combination thereof. In another embodiment, a genetically modified potato plant comprises increased content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant, wherein said SA or SGA comprises a precursor of a compound selected from the group comprising leptinine I, leptinine II, leptine I, or leptine II, or any combination thereof. In some embodiments, a genetically modified potato plant comprises an altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant, wherein said SA or SGA is selected from the group comprising .alpha.-solanine, .alpha.-chaconine, leptinine I, leptinine II, leptine I, and leptine II, or any combination thereof.
[0231] In one embodiment, disclosed herein are methods of enhancing the content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof in a plant, comprising transforming at least one plant cell within said plant with a nucleic acid sequence operably linked to a 2-oxoglutarate-dependent dioxygenase gene (GAME31), wherein said nucleic acid sequence operably linked to a GAME31 gene results in overexpression of said GAME31 gene, thereby producing a plant with an enhanced content of said at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof compared to a corresponding non-transformed plant. A non-limiting example of a nucleic acid sequence that could be operably linked to a GAME31 gene to achieve overexpression would be a 35S promotor. In another embodiment, an at least one steroidal alkaloid or a glycosylated derivative thereof comprises a leptin or a derivative thereof, or leptinine or a derivative thereof, or any combination thereof. In another embodiment, the increase of a leptin or a derivative thereof, or leptinine or a derivative thereof, or any combination thereof provides resistance to at least one plant pathogen, pest, or predator.
[0232] In some embodiments, a genetically modified plant comprising increased expression of GAME25 in at least one cell, comprises increased saturated steroidal alkaloids or steroidal glycoalkaloids, or derivatives thereof. In some embodiments, a genetically modified plant comprising increased expression of GAME25 in at least one cell, comprises decreased unsaturated steroidal alkaloids or steroidal glycoalkaloids, or derivatives thereof. In some embodiments, a genetically modified plant comprising increased expression of GAME25 in at least one cell, comprises increased saturated steroidal alkaloids or steroidal glycoalkaloids, or derivatives thereof, wherein said change in saturation is at a C5,C6 bond. In some embodiments, a genetically modified plant comprising increased expression of GAME25 in at least one cell, comprises decreased unsaturated steroidal alkaloids or steroidal glycoalkaloids, or derivatives thereof, wherein said change in saturation is at a C5,C6 bond.
[0233] In some embodiments, said increased SA, or SGA, or derivatives thereof occurs in a fruit. In some embodiments, the increased SA, or SGA, or derivatives thereof, occurs in a green fruit, a breaker fruit, a turning fruit, a pink fruit, a light red fruit, or a red fruit, or a combination thereof. In some embodiments, said decreased SA, or SGA, or derivatives thereof occurs in a fruit. In some embodiments, the decreased SA, or SGA, or derivatives thereof, occurs in a green fruit, a breaker fruit, a turning fruit, a pink fruit, a light red fruit, or a red fruit, or a combination thereof.
[0234] In some embodiments, a genetically modified plant comprising increased expression of GAME25 in at least one cell, comprises increased unsaturated or saturated steroidal saponins or a glycoside derivative thereof.
[0235] In some embodiments, a genetically modified tomato plant comprising increased expression of GAME25 in at least one cell, comprises increased saturated steroidal alkaloids or steroidal glycoalkaloids, or derivatives thereof in said at least one cell, said SA or SGA comprising increased .alpha.-tomatine, or hydroxytomatine, or acetoxytomatine, or .alpha.-tomatine isomers (2), or acetoxy-hydroxytomatine, or esculeosides, or lycoperosides, or derivatives thereof, or any combination thereof, compared to a non-modified tomato plant. In some embodiments, a genetically modified tomato plant comprising increased expression of GAME25 in at least one cell, comprises decreased unsaturated steroidal alkaloids or steroidal glycoalkaloids, or derivatives thereof, said SA or SGA comprising dehydrotomatine, or hydroxy-dehydrotomatine, or acetoxy-dehydrotomatine, or acetoxy-hydroxy-dehydrotomatine, or dehydroesculeosides, or dehydrolycoperosides, or any derivatives thereof, or any combination thereof, compared to a non-modified tomato plant.
[0236] A skilled artisan would appreciate that a genetically modified plant comprising a GAME25 enzyme having increased biological activity in at least one cell, would similarly comprises increased saturated steroidal alkaloids or steroidal glycoalkaloids, or derivatives thereof, compared to a non-modified plant. Similarly, a genetically modified plant comprising a GAME25 enzyme having increased biological activity in at least one cell, would similarly comprise decreased unsaturated steroidal alkaloids or steroidal glycoalkaloids, or derivatives thereof, compared to a non-modified plant.
[0237] In a further embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises an increase in at least one SA or SGA, and a reduction in at least one other SA or SGA, wherein the percent increase or reduction of said SAs or SGAs may independently be increased or reduced by different percentages. Alternatively, in another embodiment, the altered content of at least one steroidal alkaloid (SA) or a glycosylated derivative thereof (SGA) compared to a corresponding unmodified plant comprises an increase in at least one SA or SGA, and a reduction in at least one other SA or SGA, wherein the percent increase or reduction of said SAs or SGAs may be equal to equivalent percent increase and decrease. In another embodiment, the altered content of at least one SA or SGA comprises altered contented or multiple SA or SGA compounds, wherein the number of SA or SGA compounds increased or reduced is not equivalent, e.g., decrease of two SA or SGA compounds and increase of one SA or SGA compound. One of ordinary skill in the art would appreciate that there are many possible combinations of increased and/or decreased SA or SGA compounds, wherein each comprises an embodiment herein.
[0238] According to certain embodiments, a genetically modified plant described herein, comprises non-toxic amount of at least one steroidal alkaloid or a glycosylated derivative thereof. A skilled artisan would recognize that the term "non-toxic amount" encompasses less than 200 mg of anti-nutritional steroidal; alkaloids or glycoalkaloids per kilogram fresh weight of an edible plant part. According to certain embodiments, the genetically modified plant comprises non-detectable amount of anti-nutritional steroidal alkaloid or a glycosylated derivative thereof.
[0239] In another embodiment, a genetically modified plant comprises a Solanaceae crop plant and said altered content comprises reduction of at least one steroidal alkaloid or glycosylated derivative thereof selected from the group comprising solanidine, solasodine hydroxy solasodine, .alpha.-solanine, .alpha.-chaconine, tomatidine, .alpha.-tomatine, hydroxytomatine, acetoxytomatine, acetoxy-hydroxytomatine, tomatidine+4 hexose, esculeosides, esculeoside A, esculeoside A+hexose, esculeoside B, acetoxyesculeoside B, demissidine, demissine, dehydrosolasodine, dehydrotomatidine, hydroxy-dehydrotomatine, acetoxy-dehydrotomatine, acetoxy-hydroxy-dehydrotomatine, dehydroesculeosides, leptinine I, leptinine II, leptine I, leptine II, lycoperosides, and hydroxysolamargine, or any derivatives thereof, or any combination thereof.
[0240] In one embodiment, disclosed herein is a method of producing beneficial steroidal derivatives, said method comprising the steps of: incubating a recombinant GAME25 enzyme, as disclosed herein, or GAME31 enzyme, as disclosed herein, or a combination thereof with selected precursor molecules under biosynthetic conditions; and collecting and isolating the steroidal derivatives from the biosynthetic medium. In another embodiment, the recombinant GAME25 enzyme or GAME31 enzyme or the combination thereof are expressed in a microbial cell or an insect cell, and wherein said incubating comprises incubating said cell in media comprising necessary precursor molecules. In some embodiments, said beneficial steroidal derivatives comprise precursors of a steroidal alkaloid or glycosylated derivative thereof. In some embodiments, a beneficial steroidal derivative is selected from the group comprising demissidine, soladelucidine, leptin, leptinine 1, and leptinine 2.
[0241] In some embodiments, disclosed herein are uses of a recombinant protein disclosed herein having the amino acid sequence set forth in SEQ ID NO: 3, SEQ ID NO: 12, or SEQ ID NO: 15, or a protein homologue thereof, wherein said protein homolog is at least 50% homologous to any of SEQ ID NO: 3, SEQ ID NO: 12, or SEQ ID NO: 15 and has the same catalytic function as the protein set forth in SEQ ID NO: 3, SEQ ID NO: 12, or SEQ ID NO: 15, for the production of a cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof or a biosynthetic product thereof. In some embodiment, disclosed herein are uses of a recombinant protein having the amino acid sequence set forth in SEQ ID NO: 18, SEQ ID NO: 21, SEQ ID NO: 24, SEQ ID NO: 27, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 35, SEQ ID NO: 38, SEQ ID NO: 41, SEQ ID NO: 44, SEQ ID NO: 47, SEQ ID NO: 50 or SEQ ID NO: 53, or a protein homologue thereof, wherein said protein homolog is at least 50% homologous to any of SEQ ID NO: 18, SEQ ID NO: 21, SEQ ID NO: 24, SEQ ID NO: 27, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 35, SEQ ID NO: 38, SEQ ID NO: 41, SEQ ID NO: 44, SEQ ID NO: 47, SEQ ID NO: 50 or SEQ ID NO: 53 and has the same catalytic function as the protein set forth in SEQ ID NO: 18, SEQ ID NO: 21, SEQ ID NO: 24, SEQ ID NO: 27, SEQ ID NO: 29, SEQ ID NO: 32, SEQ ID NO: 35, SEQ ID NO: 38, SEQ ID NO: 41, SEQ ID NO: 44, SEQ ID NO: 47, SEQ ID NO: 50 or SEQ ID NO: 53, for the production of a cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof, an unsaturated or saturated steroidal saponin or a glycoside derivative thereof, or a hydroxylated derivative thereof, or a biosynthetic product thereof. In some embodiments, uses disclosed herein are in vitro uses.
[0242] In some embodiments, disclosed herein are uses of a nucleic acid sequence encoding a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) enzyme, said nucleic acid comprising the sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 11, SEQ ID NO: 13, or SEQ ID NO: 14, or a nucleic acid sequence having a sequence which is at least 50% identical to SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 11, SEQ ID NO: 13, or SEQ ID NO: 14, wherein said encoded enzyme has the same catalytic function as the protein of SEQ ID NO:1, SEQ ID NO: 2, SEQ ID NO: 11, SEQ ID NO: 13, or SEQ ID NO: 14, for the production of a recombinant cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof. In some embodiments, disclosed herein are uses of a nucleic acid sequence encoding a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) enzyme, said nucleic acid comprising the sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 11, SEQ ID NO: 13, or SEQ ID NO: 14, or a nucleic acid sequence having a sequence which is at least 50% identical to SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 11, SEQ ID NO: 13, or SEQ ID NO: 14, wherein said encoded enzyme has the same catalytic function as the protein of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 11, SEQ ID NO: 13, or SEQ ID NO: 14, for the production of a recombinant cell capable of biotransformation of a cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof. In one embodiment, a use for production of a recombinant cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof comprises an in vitro use. In one embodiment, a use for production of a recombinant cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof comprises an in vivo use.
[0243] In some embodiments, uses disclosed herein comprise use of a nucleic acid sequence encoding a 2-oxoglutarate-dependent dioxygenase (GAME31) enzyme, said nucleic acid comprising the sequence set forth in SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 28, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 51, and SEQ ID NO: 52 or a nucleic acid sequence having a sequence which is at least 50% identical to SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 28, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 51, and SEQ ID NO: 52, wherein said encoded enzyme has the same catalytic function as the protein of SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 28, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 51, and SEQ ID NO: 52, for the production of a recombinant cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof. In some embodiments, uses disclosed herein comprise use of a nucleic acid sequence encoding a 2-oxoglutarate-dependent dioxygenase (GAME31) enzyme, said nucleic acid comprising the sequence set forth in SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 28, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 51, and SEQ ID NO: 52 or a nucleic acid sequence having a sequence which is at least 50% identical to SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 28, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 51, and SEQ ID NO: 52, wherein said encoded enzyme has the same catalytic function as the protein of SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 28, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 51, and SEQ ID NO: 52, for the production of a recombinant cell capable of biotransformation of a cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof. In one embodiment, a use for production of a recombinant. In one embodiment, a use for production of a recombinant cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof comprises an in vitro use. In one embodiment, a use for production of a recombinant cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof comprises an in vivo use.
[0244] In another embodiment, a genetically modified plant comprises a Solanaceae crop plant and said altered content comprises increase of at least one steroidal alkaloid or glycosylated derivative thereof selected from the group comprising hydroxy solasodine, dehydrotomatine or an isomer thereof, hydroxy-dehydrotomatine, acetoxy-dehydrotomatine, acetoxy-hydroxy-dehydrotomatine, dehydrotomatidine+4 hexose, dehydroesculeoside A, dehydroesculeoside A+hexose, solanidine, .alpha.-solanine, .alpha.-chaconine, leptinine I, leptinine II, leptine I, leptine II, solasodine, .alpha.-solasonine, .alpha.-solamargine, hydroxysolasonine, and hydroxysolamargine, or any derivatives thereof, or any combination thereof.
[0245] In another embodiment, said Solanaceae crop plant comprises a tomato plant, said altered expression comprises altered expression of GAME25, and said altered content comprises reduction of at least tomatidine and .alpha.-tomatine, or derivatives thereof compared to a corresponding non-genetically modified plant. In another embodiment, said Solanaceae crop plant comprises a tomato plant, said altered expression comprises altered expression of GAME25, and said altered content comprises increase of at least dehydrotomatidine or derivatives thereof compared to a corresponding non-genetically modified plant. In another embodiment, said Solanaceae crop plant comprises a tomato plant, said altered expression comprises altered expression of GAME25, and said altered content comprises reduction of at least tomatidine and .alpha.-tomatine, or derivatives thereof compared to a corresponding non-genetically modified plant increase of at least dehydrotomatidine or derivatives thereof compared to a corresponding non-genetically modified plant.
[0246] In another embodiment, said Solanaceae crop plant comprises a potato plant, said altered expression comprises altered expression of GAME25, and said altered content comprises reduction of at least demissidine or derivatives thereof compared to a corresponding non-genetically modified plant. In another embodiment, said Solanaceae crop plant comprises a potato plant, said altered expression comprises altered expression of GAME25, and said altered content comprises increase of at least solanidine or derivatives thereof compared to a corresponding non-genetically modified plant. In another embodiment, said Solanaceae crop plant comprises a potato plant, said altered expression comprises altered expression of GAME25, and said altered content comprises reduction of at least demissidine or derivatives thereof compared to a corresponding non-genetically modified plant and increase of at least solanidine or derivatives thereof compared to a corresponding non-genetically modified plant.
[0247] In another embodiment, said Solanaceae crop plant comprises an aubergine plant, said altered expression comprises altered expression of GAME25, and said altered content comprises reduction of at least dihydrosolasodine or derivatives thereof compared to a corresponding non-genetically modified plant. In another embodiment, said Solanaceae crop plant comprises an aubergine plant, said altered expression comprises altered expression of GAME25, and said altered content comprises increase of at least solasoidine or derivatives thereof compared to a corresponding non-genetically modified plant. In another embodiment, said Solanaceae crop plant comprises an aubergine plant, said altered expression comprises altered expression of GAME25, and said altered content comprises reduction of at least dihydrosolasodine or derivatives thereof compared to a corresponding non-genetically modified plant and increase of at least solasoidine or derivatives thereof compared to a corresponding non-genetically modified plant.
[0248] In another embodiment, said Solanaceae crop plant comprises a tomato plant, said altered expression comprises altered expression of GAME31, and said altered content comprises reduction of at least hydroxy-dehydrotomatine, or hydroxytomatine, or any combination thereof, or derivatives thereof, compared to a corresponding non-genetically modified plant. In another embodiment, said Solanaceae crop plant comprises a tomato plant, said altered expression comprises altered expression of GAME31, and said altered content comprises increase of at least dehydrotomatine, or .alpha.-tomatine, or any combination thereof, or derivatives thereof compared to a corresponding non-genetically modified plant. In another embodiment, said Solanaceae crop plant comprises a tomato plant, said altered expression comprises altered expression of GAME31, and said altered content comprises reduction of at least hydroxy-dehydrotomatine, or hydroxytomatine, or any combination thereof, or derivatives thereof, compared to a corresponding non-genetically modified plant and increase of at least dehydrotomatine, or .alpha.-tomatine, or any combination thereof, or derivatives thereof compared to a corresponding non-genetically modified plant.
[0249] In another embodiment, said Solanaceae crop plant comprises a potato plant, said altered expression comprises altered expression of GAME31, and said altered content comprises reduction of at least leptinine II, leptinine I, or derivatives thereof or any combination thereof, compared to a corresponding non-genetically modified plant. In another embodiment, said Solanaceae crop plant comprises a potato plant, said altered expression comprises altered expression of GAME31, and said altered content comprises increase of at least .alpha.-solanine, .alpha.-chaconine, or derivatives thereof, or any combination thereof, compared to a corresponding non-genetically modified plant. In another embodiment, said Solanaceae crop plant comprises a potato plant, said altered expression comprises altered expression of GAME31, and said altered content comprises reduction of at least leptinine II, leptinine I, or derivatives thereof or any combination thereof, compared to a corresponding non-genetically modified plant and increase of at least .alpha.-solanine, .alpha.-chaconine, or derivatives thereof, or any combination thereof, compared to a corresponding non-genetically modified plant.
[0250] In another embodiment, said Solanaceae crop plant comprises an aubergine plant, said altered expression comprises altered expression of GAME31, and said altered content comprises reduction of at least hydroxysolasonine, hydroxysolamargine, or derivatives thereof, or any combination thereof compared to a corresponding non-genetically modified plant. In another embodiment, said Solanaceae crop plant comprises an aubergine plant, said altered expression comprises altered expression of GAME31, and said altered content comprises increase of at least solasonine, solamargine, or derivatives thereof, or any combination thereof compared to a corresponding non-genetically modified plant. In another embodiment, said Solanaceae crop plant comprises an aubergine plant, said altered expression comprises altered expression of GAME31, and said altered content comprises reduction of at least hydroxysolasonine, hydroxysolamargine, or derivatives thereof, or any combination thereof compared to a corresponding non-genetically modified plant and increase of at least solasonine, solamargine, or derivatives thereof, or any combination thereof compared to a corresponding non-genetically modified plant.
[0251] While being exemplified in a genetically modified plant, the disclosure herein may further enable manipulating the synthesis of steroidal alkaloids or glycosylated derivatives thereof in any organism naturally capable of steroidal alkaloid synthesis. Thus, according in another embodiment, a genetically modified organism comprising at least one cell having altered expression of at least one gene selected from the group comprising a gene encoding a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) and a gene encoding 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof compared to an unmodified organism, wherein the genetically modified organism has an altered content of at least one compound selected from steroidal alkaloids and glycosylated derivatives thereof compared to a corresponding unmodified organism.
[0252] Down-regulation or inhibition of the gene expression can be affected on the genomic and/or the transcript level using a variety of molecules that interfere with transcription and/or translation (e.g., antisense, siRNA, Ribozyme, or DNAzyme), or on the protein level using, e.g., antagonists, enzymes that cleave the polypeptide, and the like. One of ordinary skill in the art would appreciate that molecules that interfere with transcription and/or translation may be termed "silencing molecules".
[0253] In one embodiment, the genetically modified plant described herein comprising at least one cell having an altered gene expression comprises at least one silencing molecule targeted to a gene selected from the group comprising GAME25 and GAME31, or a combination thereof.
[0254] In another embodiment, the genetically modified plant is a transgenic plant comprising at least one cell comprising at least one silencing molecule targeted to a gene selected from the group comprising GAME25 and GAME31, and a combination thereof.
[0255] A silencing molecule targeted to at least one of GAME25 and/or GAME31 can be designed as is known to a person skilled in the art (See below and Methods for Examples 3-9).
[0256] In one embodiment, a silencing molecule is selected from the group comprising an RNA interference molecule, a co-suppression molecule, and an antisense molecule.
[0257] In one embodiment, a silencing molecule comprises a polynucleotide having a nucleic acid sequence substantially complementary to a region of the GAME25 gene or a complementary sequence thereof. In another embodiment, the silencing molecule comprises a polynucleotide having a nucleic acid sequence substantially complementary to a region of the GAME25 gene, the gene having the nucleic acids sequence set forth in any one of SEQ ID 1, and SEQ ID NO: 13, In yet another embodiment, the silencing molecule comprises a polynucleotide having a nucleic acid sequence substantially complementary to a region of the GAME25 cDNA, the cDNA having the nucleic acids sequence set forth in any one of SEQ ID 2, SEQ ID NO: 11, and SEQ ID NO: 14.
[0258] In one embodiment, the nucleic acid sequence of a silencing molecule comprises the nucleic acid sequence set forth in SEQ ID NO: 8, or a fragment thereof.
[0259] In one embodiment, a silencing molecule comprises a polynucleotide having a nucleic acid sequence substantially complementary to a region of the GAME31 gene or a complementary sequence thereof. In another embodiment, the silencing molecule comprises a polynucleotide having a nucleic acid sequence substantially complementary to a region of the GAME31 gene, the gene having the nucleic acids sequence set forth in any one of SEQ ID NO: 16, SEQ ID NO: 19, SEQ ID NO: 22, SEQ ID NO: 25, SEQ ID NO: 30, SEQ ID NO: 33, SEQ ID NO: 36, SEQ ID NO: 39, SEQ ID NO: 42, SEQ ID NO: 45, SEQ ID NO: 48, and SEQ ID NO: 51. In yet another embodiment, the silencing molecule comprises a polynucleotide having a nucleic acid sequence substantially complementary to a region of the GAME31 cDNA, the cDNA having the nucleic acids sequence set forth in any one of SEQ ID NO: 17, SEQ ID NO: 20, SEQ ID NO: 23, SEQ ID NO: 26, SEQ ID NO: 28, SEQ ID NO: 31, SEQ ID NO: 34, SEQ ID NO: 37, SEQ ID NO: 40, SEQ ID NO: 43, SEQ ID NO: 46, SEQ ID NO: 49, and SEQ ID NO: 52.
[0260] In one embodiment, the nucleic acid sequence of a silencing molecule comprises the nucleic acid sequence set forth in SEQ ID NO: 58, or a fragment thereof. In one embodiment, the nucleic acid sequence of a silencing molecule comprises the nucleic acid sequence set forth in SEQ ID NO: 59, or a fragment thereof.
[0261] In some embodiments, a genetically modified plant comprising reduced expression of GAME25 in at least one cell, comprises decreased saturated steroidal alkaloids or steroidal glycoalkaloids, or derivatives thereof. In some embodiments, a genetically modified plant comprising reduced expression of GAME25 in at least one cell, comprises increased unsaturated steroidal alkaloids or steroidal glycoalkaloids, or derivatives thereof. In some embodiments, a genetically modified plant comprising reduced expression of GAME25 in at least one cell, comprises decreased saturated steroidal alkaloids or steroidal glycoalkaloids, or derivatives thereof, wherein said change in saturation is at a C5,C6 bond. In some embodiments, a genetically modified plant comprising reduced expression of GAME25 in at least one cell, comprises increased unsaturated steroidal alkaloids or steroidal glycoalkaloids, or derivatives thereof, wherein said change in saturation is at a C5,C6 bond. In some embodiments, said decreased SA, or SGA, or derivatives thereof occurs in a fruit. In some embodiments, the decreased SA, or SGA, or derivatives thereof, occurs in a green fruit, a breaker fruit, a turning fruit, a pink fruit, a light red fruit, or a red fruit, or a combination thereof. In some embodiments, said increased SA, or SGA, or derivatives thereof occurs in a fruit. In some embodiments, the increased SA, or SGA, or derivatives thereof, occurs in a green fruit, a breaker fruit, a turning fruit, a pink fruit, a light red fruit, or a red fruit, or a combination thereof.
[0262] In some embodiments, a genetically modified tomato plant comprising reduced expression of GAME25 in at least one cell, comprises decreased saturated steroidal alkaloids or steroidal glycoalkaloids, or derivatives thereof in said at least one cell, said SA or SGA comprising decreased .alpha.-tomatine, or hydroxytomatine, or acetoxytomatine, or .alpha.-tomatine isomers (1 and 2), or acetoxy-hydroxytomatine, or tomatidine+4 hexoses, or esculeoside A, or esculeosides, or lycoperosides, or any derivatives thereof, or any combination thereof, compared to a non-modified tomato plant. In some embodiments, a genetically modified tomato plant comprising reduced expression of GAME25 in at least one cell, comprises increased unsaturated steroidal alkaloids or steroidal glycoalkaloids, or derivatives thereof, said SA or SGA comprising dehydrotomatine, or hydroxy-dehydrotomatine, or dehydrotomatine isomer (1 and 2), or acetoxy-dehydrotomatine, or acetoxy-hydroxy-dehydrotomatine, or dehydrotomatidine+4 hexose, or dehydroesculeoside A, or dehydroesculeosides, or dehydrolycoperosides, or any derivatives thereof, or any combination thereof.
[0263] A skilled artisan would appreciate that a genetically modified plant comprising a GAME25 enzyme having decreased biological activity in at least one cell, would similarly comprises decreased saturated steroidal alkaloids or steroidal glycoalkaloids, or derivatives thereof, compared to a non-modified plant. Similarly, a genetically modified plant comprising a GAME25 enzyme having decreased biological activity in at least one cell, would similarly comprise increased unsaturated steroidal alkaloids or steroidal glycoalkaloids, or derivatives thereof, compared to a non-modified plant.
Antisense Molecules
[0264] Antisense technology is the process in which an antisense RNA or DNA molecule interacts with a target sense DNA or RNA strand. A sense strand is a 5' to 3' mRNA molecule or DNA molecule. The complementary strand, or mirror strand, to the sense is called an antisense. When an antisense strand interacts with a sense mRNA strand, the double helix is recognized as foreign to the cell and will be degraded, resulting in reduced or absent protein production. Although DNA is already a double stranded molecule, antisense technology can be applied to it, building a triplex formation.
[0265] One skilled in the art would appreciate that the terms "complementary" or "complement thereof" are used herein to encompass the sequences of polynucleotides which is capable of forming Watson & Crick base pairing with another specified polynucleotide throughout the entirety of the complementary region. This term is applied to pairs of polynucleotides based solely upon their sequences and not any particular set of conditions under which the two polynucleotides would actually bind.
[0266] RNA antisense strands can be either catalytic or non-catalytic. The catalytic antisense strands, also called ribozymes, cleave the RNA molecule at specific sequences. A non-catalytic RNA antisense strand blocks further RNA processing.
[0267] Antisense modulation of expression levels of GAME25, GAME31, or any combination thereof, in cells and/or tissues of an organisms may be effected by transforming the organism cells or tissues with at least one antisense compound, including antisense DNA, antisense RNA, a ribozyme, DNAzyme, a locked nucleic acid (LNA) and an aptamer. In some embodiments the molecules are chemically modified. In other embodiments the antisense molecule is antisense DNA or an antisense DNA analog. In some embodiment, an organism is a plant. In other embodiments, an organism is not a plant. In some embodiments, a cell is a plant cell. In other embodiments, a cell is not a plant cell.
RNA Interference (RNAi) Molecules
[0268] RNAi refers to the introduction of homologous double stranded RNA (dsRNA) to target a specific gene product, resulting in post transcriptional silencing of that gene. This phenomenon was first reported in Caenorhabditis elegans by Guo and Kemphues (1995, Cell, 81(4):611-620) and subsequently Fire et al. (1998, Nature 391:806-811) discovered that it is the presence of dsRNA, formed from the annealing of sense and antisense strands present in the in vitro RNA preps, that is responsible for producing the interfering activity.
[0269] In certain embodiments, disclosed herein altered gene expression comprises the use of RNA interference (RNAi) to down regulate the expression of GAME25, GAME31, or combination thereof to attenuate the level of steroidal alkaloids/glycoalkaloids in plants.
[0270] In both plants and animals, RNAi is mediated by RNA-induced silencing complex (RISC), a sequence-specific, multicomponent nuclease that destroys messenger RNAs homologous to the silencing trigger. RISC is known to contain short RNAs (approximately 22 nucleotides) derived from the double-stranded RNA trigger. The short-nucleotide RNA sequences are homologous to the target gene that is being suppressed. Thus, the short-nucleotide sequences appear to serve as guide sequences to instruct a multicomponent nuclease, RISC, to destroy the specific mRNAs.
[0271] The dsRNA used to initiate RNAi, may be isolated from native source or produced by known means, e.g., transcribed from DNA. Plasmids and vectors for generating RNAi molecules against target sequence are now readily available from commercial sources.
[0272] The dsRNA can be transcribed from the vectors as two separate strands. In other embodiments, the two strands of DNA used to form the dsRNA may belong to the same or two different duplexes in which they each form with a DNA strand of at least partially complementary sequence. When the dsRNA is thus-produced, the DNA sequence to be transcribed is flanked by two promoters, one controlling the transcription of one of the strands, and the other that of the complementary strand. These two promoters may be identical or different. Alternatively, a single promoter can derive the transcription of single-stranded hairpin polynucleotide having self-complementary sense and antisense regions that anneal to produce the dsRNA.
[0273] One skilled in the art would appreciate that the terms "promoter element," "promoter," or "promoter sequence" may encompass a DNA sequence that is located at the 5' end (i.e. precedes) the coding region of a DNA polymer. The location of most promoters known in nature precedes the transcribed region. The promoter functions as a switch, activating the expression of a gene. If the gene is activated, it is said to be transcribed, or participating in transcription. Transcription involves the synthesis of mRNA from the gene. The promoter, therefore, serves as a transcriptional regulatory element and also provides a site for initiation of transcription of the gene into mRNA.
[0274] Inhibition is sequence-specific in that nucleotide sequences corresponding to the duplex region of the RNA are targeted for genetic inhibition. RNA molecules containing a nucleotide sequence identical to a portion of the target gene are preferred for inhibition. RNA sequences with insertions, deletions, and single point mutations relative to the target sequence have also been found to be effective for inhibition. Thus, sequence identity may be optimized by sequence comparison and alignment algorithms known in the art (see Gribskov and Devereux, Sequence Analysis Primer, Stockton Press, 1991, and references cited therein) and calculating the percent difference between the nucleotide sequences by, for example, the Smith-Waterman algorithm as implemented in the BESTFIT software program using default parameters (e.g., University of Wisconsin Genetic Computing Group). Greater than 90% sequence identity, or even 100% sequence identity, between the inhibitory RNA and the portion of the target gene is preferred. Alternatively, the duplex region of the RNA may be defined functionally as a nucleotide sequence that is capable of hybridizing with a portion of the target gene transcript. The length of the identical nucleotide sequences may be at least 25, 50, 100, 200, 300 or 400 bases. There is no upper limit on the length of the dsRNA that can be used. For example, the dsRNA can range from about 21 base pairs (bp) of the gene to the full length of the gene or more.
[0275] The term "RNA interference" or "RNAi" refers to the silencing or decreasing of gene expression mediated by small double stranded RNAs. It is the process of sequence-specific, post-transcriptional gene silencing in animals and plants, initiated by inhibitory RNA (iRNA) that is homologous in its duplex region to the sequence of the silenced gene. The gene may be endogenous or exogenous to the organism, present integrated into a chromosome or present in a transfection vector that is not integrated into the genome. The expression of the gene is either completely or partially inhibited. RNAi may also be considered to inhibit the function of a target RNA; the function of the target RNA may be complete or partial.
[0276] One of ordinary skill in the art would appreciate that the term RNAi molecule refers to single- or double-stranded RNA molecules comprising both a sense and antisense sequence. For example, the RNA interference molecule can be a double-stranded polynucleotide molecule comprising self-complementary sense and antisense regions, wherein the antisense region comprises complementarity to a target nucleic acid molecule. Alternatively the RNAi molecule can be a single-stranded hairpin polynucleotide having self-complementary sense and antisense regions, wherein the antisense region comprises complementarity to a target nucleic acid molecule or it can be a circular single-stranded polynucleotide having two or more loop structures and a stem comprising self-complementary sense and antisense regions, wherein the antisense region comprises complementarity to a target nucleic acid molecule, and wherein the circular polynucleotide can be processed either in vivo or in vitro to generate an active molecule capable of mediating RNAi.
[0277] According to some embodiments, the silencing molecule is RNAi targeted to the GAME25 gene, comprising the nucleic acid sequence set forth in SEQ ID NO:8 or a complementary sequence thereof.
According to some embodiments, the silencing molecule is RNAi targeted to the GAME31 gene, comprising the nucleic acid sequence set forth in SEQ ID NO: 58 or a complementary sequence thereof
Co-Suppression Molecules
[0278] Another agent capable of down-regulating the expression of GAME25, or GAME31, or a combination thereof is a Co-Suppression molecule. Co-suppression is a post-transcriptional mechanism where both the transgene and the endogenous gene are silenced.
[0279] Surprisingly, in some embodiments, overexpression of GAME25 results in suppression of the GAME25 gene. According to some embodiments, the co-suppression molecule is polynucleotide homologous to the GAME25 coding sequence. In some embodiments, the co-suppression molecule comprising a polynucleotide homologous to the GAME 25 coding sequence comprises a sequence selected from SEQ ID NO: 8, SEQ ID NO: 2, SEQ ID NO: 11, and SEQ ID NO: 14, or a fragment thereof, or a complementary sequence thereof.
[0280] Surprisingly, in some embodiments, overexpression of GAME31 results in suppression of the GAME31 gene. According to some embodiments, the co-suppression molecule is polynucleotide homologous to the GAME31 coding sequence. In some embodiments, the co-suppression molecule comprising a polynucleotide homologous to the GAME 31 coding sequence comprises a sequence selected from SEQ ID NO: 58, SEQ ID NO: 59, and SEQ ID NO: 30, or a fragment thereof, or a complementary sequence thereof. According to some embodiments, the co-suppression molecule is polynucleotide homologous to the GAME31 coding sequence, comprising the nucleic acid sequence set forth in SEQ ID NO: 59 or a complementary sequence thereof.
DNAzyme Molecules
[0281] Another agent capable of down-regulating the expression of GAME25, or GAME31, or a combination thereof is a DNAzyme molecule, which is capable of specifically cleaving an mRNA transcript or a DNA sequence of the GAME25, and/or GAME31. DNAzymes are single-stranded polynucleotides that are capable of cleaving both single- and double-stranded target sequences. A general model (the "10-23" model) for the DNAzyme has been proposed. "10-23" DNAzymes have a catalytic domain of 15 deoxyribonucleotides, flanked by two substrate-recognition domains of seven to nine deoxyribonucleotides each. This type of DNAzyme can effectively cleave its substrate RNA at purine:pyrimidine junctions (for review of DNAzymes, see: Khachigian, L. M. (2002) Curr Opin Mol Ther 4, 119-121).
[0282] Examples of construction and amplification of synthetic, engineered DNAzymes recognizing single- and double-stranded target cleavage sites are disclosed in U.S. Pat. No. 6,326,174, the disclosure of which is incorporated herein in its entirety.
Enzymatic Oligonucleotide
[0283] The terms "enzymatic nucleic acid molecule" or "enzymatic oligonucleotide" refers to a nucleic acid molecule which has complementarity in a substrate binding region to a specified gene target, and also has an enzymatic activity which is active to specifically cleave target RNA of GAME25, or GAME31, thereby silencing each of the genes. The complementary regions allow sufficient hybridization of the enzymatic nucleic acid molecule to the target RNA and subsequent cleavage. The term enzymatic nucleic acid is used interchangeably with for example, ribozymes, catalytic RNA, enzymatic RNA, catalytic DNA, aptazyme or aptamer-binding ribozyme, catalytic oligonucleotide, nucleozyme, DNAzyme, RNAenzyme. The specific enzymatic nucleic acid molecules described in the instant application are not limiting and an enzymatic nucleic acid molecule of this invention requires a specific substrate binding site which is complementary to one or more of the target nucleic acid regions, and that it have nucleotide sequences within or surrounding that substrate binding site which impart a nucleic acid cleaving and/or ligation activity to the molecule. U.S. Pat. No. 4,987,071 discloses examples of such molecules.
Mutagenesis
[0284] Altering the expression of endogenous or exogenous GAME25, or GAME31 genes or a combination thereof, can be also achieved by the introduction of one or more point mutations into a nucleic acid molecule encoding the corresponding proteins. Mutations can be introduced using, for example, site-directed mutagenesis (see, e.g. Wu Ed., 1993 Meth. In Enzymol. Vol. 217, San Diego: Academic Press; Higuchi, "Recombinant PCR" in Innis et al. Eds., 1990 PCR Protocols, San Diego: Academic Press, Inc). Such mutagenesis can be used to introduce a specific, desired amino acid insertion, deletion or substitution. Several technologies for targeted mutagenesis are based on the targeted induction of double-strand breaks (DSBs) in the genome followed by error-prone DNA repair. Mostly commonly used for genome editing by these methods are custom designed nucleases, including zinc finger nucleases and Xanthomonas-derived transcription activator-like effector nuclease (TALEN) enzymes.
[0285] In some embodiments, when the expression of the at least one gene or combination thereof is altered, said altering comprises mutagenizing the at least one gene, said mutation present within a coding region of said at least one gene, or a regulatory sequence of said at least one gene, or a combination thereof.
[0286] Various types of mutagenesis can be used to modify GAME25 or GAME31 and their encoded polypeptides in order to produce conservative or non-conservative variants. Any available mutagenesis procedure can be used. In some embodiments, the mutagenesis procedure comprises site-directed point mutagenesis. In some embodiments, the mutagenesis procedure comprises random point mutagenesis. In some embodiments, the mutagenesis procedure comprises in vitro or in vivo homologous recombination (DNA shuffling). In some embodiments, the mutagenesis procedure comprises mutagenesis using uracil-containing templates. In some embodiments, the mutagenesis procedure comprises oligonucleotide-directed mutagenesis. In some embodiments, the mutagenesis procedure comprises phosphorothioate-modified DNA mutagenesis. In some embodiments, the mutagenesis procedure comprises mutagenesis using gapped duplex DNA. In some embodiments, the mutagenesis procedure comprises point mismatch repair. In some embodiments, the mutagenesis procedure comprises mutagenesis using repair-deficient host strains. In some embodiments, the mutagenesis procedure comprises restriction-selection and restriction-purification. In some embodiments, the mutagenesis procedure comprises deletion mutagenesis. In some embodiments, the mutagenesis procedure comprises mutagenesis by total gene synthesis. In some embodiments, the mutagenesis procedure comprises double-strand break repair. In some embodiments, the mutagenesis procedure comprises mutagenesis by chimeric constructs. In some embodiments, the mutagenesis procedure comprises mutagenesis by CRISPR/Cas. In some embodiments, the mutagenesis procedure comprises mutagenesis by zinc-finger nucleases (ZFN). In some embodiments, the mutagenesis procedure comprises mutagenesis by transcription activator-like effector nucleases (TALEN). In some embodiments, the mutagenesis procedure comprises any other mutagenesis procedure known to a person skilled in the art.
[0287] In some embodiments, mutagenesis can be guided by known information about the naturally occurring molecule and/or the mutated molecule. By way of example, this known information may include sequence, sequence comparisons, physical properties, crystal structure and the like. In some embodiments, the mutagenesis is essentially random. In some embodiments the mutagenesis procedure is DNA shuffling.
[0288] A skilled artisan would appreciate that clustered regularly interspaced short palindromic repeats (CRISPR)/CRISPR associated protein (Cas) system comprises genome engineering tools based on the bacterial CRISPR/Cas prokaryotic adaptive immune system. This RNA-based technology is very specific and allows targeted cleavage of genomic DNA guided by a customizable small noncoding RNA, resulting in gene modifications by both non-homologous end joining (NHEJ) and homology-directed repair (HDR) mechanisms (Belhaj K. et al., 2013. Plant Methods 2013, 9:39), In some embodiments, a CRISPR/Cas system comprises a CRISPR/Cas9 system.
[0289] In some embodiments, a CRISPR/Cas system comprises a single-guide RNA (sgRNA) and/or a Cas protein known in the art. In some embodiments, a CRISPR/Cas system comprises a single-guide RNA (sgRNA) and/or a Cas protein newly created to cleave at a preselected site. The skilled artisan would appreciate that the terms "single-guide RNA", "sgRNA", and "gRNA" are interchangeable having all the same qualities and meanings, wherein an sgRNA may encompass a chimeric RNA molecule which is composed of a CRISPR RNA (crRNA) and trans-encoded CRISPR RNA (tracrRNA). In some embodiments, a crRNA is complementary to a preselected region of GAME25 or GAME31 DNA, wherein the crRNA "targets" the CRISPR associated polypeptide (Cas) nuclease protein to the preselected target site.
[0290] In some embodiments, the length of crRNA sequence complementary is 19-22 nucleotides long e.g., 19-22 consecutive nucleotides complementary to the target site. In another embodiment, the length of crRNA sequence complementary to the region of DNA is about 15-30 nucleotides long. In another embodiment, the length of crRNA sequence complementary to the region of DNA is about 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 nucleotides long. In another embodiment, the length of crRNA sequence complementary to the region of DNA is 20 nucleotides long. In some embodiments, the crRNA is located at the 5' end of the sgRNA molecule. In another embodiment, the crRNA comprises 100% complementation within the preselected target sequence. In another embodiment, the crRNA comprises at least 80% complementation within the preselected target sequence. In another embodiment, the crRNA comprises at least 85% complementation within the preselected target sequence. In another embodiment, the crRNA comprises at least 90% complementation within the preselected target sequence. In another embodiment, the crRNA comprises at least 95% complementation within the preselected target sequence. In another embodiment, the crRNA comprises at least 97% complementation within the preselected target sequence. In another embodiment, the crRNA comprises at least 99% complementation within the preselected target sequence. In another embodiment, a tracrRNA is 100-300 nucleotides long and provides a binding site for the Cas nuclease e.g., a Cas9 protein forming the CRISPR/Cas9 complex.
[0291] In one embodiment, a mutagenesis system comprises a CRISPR/Cas system. In another embodiment, a CRISPR/Cas system comprises a Cas nuclease and a gRNA molecule, wherein said gRNA molecule binds within said preselected endogenous target site thereby guiding said Cas nuclease to cleave the DNA within said preselected endogenous target site.
[0292] In some embodiments, a CRISPR/Cas system comprise an enzyme system including a guide RNA sequence ("gRNA" or "sgRNA") that contains a nucleotide sequence complementary or substantially complementary to a region of a target polynucleotide, for example a preselected endogenous target site, and a protein with nuclease activity.
[0293] In another embodiment, a CRISPR/Cas system comprises a Type I CRISPR-Cas system, or a Type II CRISPR-Cas system, or a Type III CRISPR-Cas system, or derivatives thereof. In another embodiment, a CRISPR-Cas system comprises an engineered and/or programmed nuclease system derived from naturally accruing CRISPR-Cas systems. In another embodiment, a CRISPR-Cas system comprises engineered and/or mutated Cas proteins. In another embodiment, a CRISPR-Cas system comprises engineered and/or programmed guide RNA.
[0294] A skilled artisan would appreciate that a guide RNA may contain nucleotide sequences other than the region complementary or substantially complementary to a region of a target DNA sequence, for example a preselected endogenous target site. In another embodiment, a guide RNA comprises a crRNA or a derivative thereof. In another embodiment, a guide RNA comprises a crRNA: tracrRNA chimera.
[0295] In another embodiment, a gRNA molecule comprises a domain that is complementary to and binds to a preselected endogenous target site on at least one homologous chromosome. In another embodiment, a gRNA molecule comprises a domain that is complementary to and binds to a polymorphic allele on at least one homologous chromosome. In another embodiment, a gRNA molecule comprises a domain that is complementary to and binds to a preselected endogenous target site on both homologous chromosomes. In another embodiment, a gRNA molecule comprises a domain that is complementary to and binds to polymorphic alleles on both homologous chromosomes.
[0296] Cas enzymes comprise RNA-guided DNA endonuclease able to make double-stranded breaks (DSB) in DNA. The term "Cas enzyme" may be used interchangeably with the terms "CRISPR-associated endonucleases" or "CRISPR-associated polypeptides" having all the same qualities and meanings. In one embodiment, a Cas enzyme is selected from the group comprising Cas1, Cas1B, Cas2, Cas3, Cas4, Cas5, Cas6, Cas7, Cas8, Cas9, Cas10, C2cl, CasX, NgAgo, Cpf1, Csy1, Csy2, Csy3, Cse1, Cse2, Csc1, Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmr1, Cmr3, Cmr4, Cmr5, Cmr6, Csb1, Csb2, Csb3, Csx17, Csx14, Csx10, Csx16, CsaX, Csx3, Csx1, Csx15, Csf1, Csf2, Csf3, and Csf4, or homologs thereof, or modified versions thereof. In another embodiment, a Cas enzyme comprises Cas9. In another embodiment, a Cas enzyme comprises Cas1. In another embodiment, a Cas enzyme comprises Cas1B. In another embodiment, a Cas enzyme comprises Cas2. In another embodiment, a Cas enzyme comprises Cas3. In another embodiment, a Cas enzyme comprises Cas4. In another embodiment, a Cas enzyme comprises Cas5. In another embodiment, a Cas enzyme comprises Cas6. In another embodiment, a Cas enzyme comprises Cas7. In another embodiment, a Cas enzyme comprises Cas8. In another embodiment, a Cas enzyme comprises Cas10. In another embodiment, a Cas enzyme comprises Cpf1. In another embodiment, a Cas enzyme comprises Csy1. In another embodiment, a Cas enzyme comprises Csy2. In another embodiment, a Cas enzyme comprises Csy3. In another embodiment, a Cas enzyme comprises Cse1. In another embodiment, a Cas enzyme comprises Cse2. In another embodiment, a Cas enzyme comprises Csc1. In another embodiment, a Cas enzyme comprises Csc2. In another embodiment, a Cas enzyme comprises Csa5. In another embodiment, a Cas enzyme comprises Csn2. In another embodiment, a Cas enzyme comprises Csm2. In another embodiment, a Cas enzyme comprises Csm3. In another embodiment, a Cas enzyme comprises Csm4. In another embodiment, a Cas enzyme comprises Csm5. In another embodiment, a Cas enzyme comprises Csm6. In another embodiment, a Cas enzyme comprises Cmr1. In another embodiment, a Cas enzyme comprises Cmr3. In another embodiment, a Cas enzyme comprises Cmr4. In another embodiment, a Cas enzyme comprises Cmr5. In another embodiment, a Cas enzyme comprises Cmr6. In another embodiment, a Cas enzyme comprises Csb1. In another embodiment, a Cas enzyme comprises Csb2. In another embodiment, a Cas enzyme comprises Csb3. In another embodiment, a Cas enzyme comprises Csx17. In another embodiment, a Cas enzyme comprises Csx14. In another embodiment, a Cas enzyme comprises Csx10. In another embodiment, a Cas enzyme comprises Csx16, CsaX. In another embodiment, a Cas enzyme comprises Csx3. In another embodiment, a Cas enzyme comprises Csx1, Csx15, Csf1. In another embodiment, a Cas enzyme comprises Csf2. In another embodiment, a Cas enzyme comprises Csf3. In another embodiment, a Cas enzyme comprises Csf4. In another embodiment, a Cas enzyme comprises Cpf1. In another embodiment, a Cas enzyme comprises C2cl. In another embodiment, a Cas enzyme comprises CasX. In another embodiment, a Cas enzyme comprises NgAgo. In another embodiment, a Cas enzyme is Cas homologue. In another embodiment, a Cas enzyme is a Cas orthologue. In another embodiment, a Cas enzyme is a modified Cas enzyme. In another embodiment, a Cas enzyme is any CRISPR-associated endonucleases known in the art.
[0297] A skilled artisan would appreciate that the terms "zinc finger nuclease" or "ZFN" are interchangeable having all the same meanings and qualities, wherein a ZFN encompasses a chimeric protein molecule comprising at least one zinc finger DNA binding domain operatively linked to at least one nuclease capable of double-strand cleaving of DNA. In some embodiments, a ZFN system comprises a ZFN known in the art. In some embodiments, a ZFN system comprises a ZFN newly created to cleave a preselected site.
[0298] In some embodiments, a ZFN creates a double-stranded break at a preselected endogenous target site. In some embodiments, a ZFN comprises a DNA-binding domain and a DNA-cleavage domain, wherein the DNA binding domain is comprised of at least one zinc finger and is operatively linked to a DNA-cleavage domain. In another embodiment, a zinc finger DNA-binding domain is at the N-terminus of the chimeric protein molecule and the DNA-cleavage domain is located at the C-terminus of the molecule. In another embodiment, a zinc finger DNA-binding domain is at the C-terminus of the chimeric protein molecule and the DNA-cleavage domain is located at the N-terminus of the molecule. In another embodiment, a zinc finger binding domain encompasses the region in a zinc finger nuclease that is capable of binding to a target locus, for example a preselected endogenous target site as disclosed herein. In another embodiment, a zinc finger DNA-binding domain comprises a protein domain that binds to a preselected endogenous target site on at least one homologous chromosome. In another embodiment, a zinc finger DNA-binding domain comprises a protein domain that binds to a polymorphic allele on at least one homologous chromosome. In another embodiment, a zinc finger DNA-binding domain comprises a protein domain that binds to a preselected endogenous target site on both homologous chromosomes. In another embodiment, a zinc finger DNA-binding domain comprises a protein domain that binds to polymorphic alleles on both homologous chromosomes.
[0299] The skilled artisan would appreciate that the term "chimeric protein" is used to describe a protein that has been expressed from a DNA molecule that has been created by operatively joining two or more DNA fragments. The DNA fragments may be from the same species, or they may be from a different species. The DNA fragments may be from the same or a different gene. The skilled artisan would appreciate that the term "DNA cleavage domain" of a ZFN encompasses the region in the zinc finger nuclease that is capable of breaking down the chemical bonds between nucleic acids in a nucleotide chain. Examples of proteins containing cleavage domains include restriction enzymes, topoisomerases, recombinases, integrases and DNAses.
[0300] In some embodiments, a TALEN system comprises a TAL effector DNA binding domain and a DNA cleavage domain, wherein said TAL effector DNA binding domain binds within said preselected endogenous target site, thereby targeting the DNA cleavage domain to cleave the DNA within said preselected endogenous target site.
[0301] A skilled artisan would appreciate that the terms "transcription activator-like effector nuclease", "TALEN", and "TAL effector nuclease" may be used interchangeably having all the same meanings and qualities, wherein a TALEN encompasses a nuclease capable of recognizing and cleaving its target site, for example a preselected endogenous target site as disclosed herein. In another embodiment, a TALEN comprises a fusion protein comprising a TALE domain and a nucleotide cleavage domain. In another embodiment, a TALE domain comprises a protein domain that binds to a nucleotide in a sequence-specific manner through one or more TALE-repeat modules. A skilled artisan would recognize that TALE-repeat modules comprise a variable number of about 34 amino acid repeats that recognize plant DNA sequences. Further, repeat modules can be rearranged according to a simple cipher to target new DNA sequences. In another embodiment, a TALE domain comprises a protein domain that binds to a preselected endogenous target site on at least one homologous chromosome. In another embodiment, a TALE domain comprises a protein domain that binds to a polymorphic allele on at least one homologous chromosome. In another embodiment, a TALE domain comprises a protein domain that binds to a preselected endogenous target site on both homologous chromosomes. In another embodiment, a TALE domain comprises a protein domain that binds to polymorphic alleles on both homologous chromosomes.
[0302] In one embodiment, a TALE domain comprises at least one of the TALE-repeat modules. In another embodiment, a TALE domain comprises from one to thirty TALE-repeat modules. In another embodiment, a TALE domain comprises more than thirty repeat modules. In another embodiment, a TALEN fusion protein comprises an N-terminal domain, one or more of TALE-repeat modules followed by a half-repeat module, a linker, and a nucleotide cleavage domain.
[0303] Chemical mutagenesis using an agent such as Ethyl Methyl Sulfonate (EMS) can be employed to obtain a population of point mutations and screen for mutants of the GAME25, or GAME31 genes, or a combination thereof that may become silent or down-regulated. In plants, methods relaying on introgression of genes from natural populations can be used. Cultured and wild types species are crossed repetitively such that a plant comprising a given segment of the wild genome is isolated. Certain plant species, for example Maize (corn) or snapdragon have natural transposons. These transposons are either autonomous, i.e. the transposase is located within the transposon sequence or non-autonomous, without a transposase. A skilled person can cause transposons to "jump" and create mutations. Alternatively, a nucleic acid sequence can be synthesized having random nucleotides at one or more predetermined positions to generate random amino acid substituting.
[0304] In some embodiments, the expression of endogenous GAME25 or GAME31 genes can be altered by the introduction of one or more point mutations into their regulatory sequences. In some embodiments, the expression of exogenous GAME25 or GAME31 genes can be altered by the introduction of one or more point mutations into their regulatory sequences. A skilled artisan would appreciate that "regulatory sequences" refers to nucleotide sequences located upstream (5' non-coding sequences), within, or downstream (3' non-coding sequences) of a coding sequence, and which influence the transcription, RNA processing or stability, or translation of the associated coding sequence. In some embodiments, regulatory sequences comprise promoters. In some embodiments, regulatory sequences comprise translation leader sequences. In some embodiments, regulatory sequences comprise introns. In some embodiments, regulatory sequences comprise polyadenylation recognition sequences. In some embodiments, regulatory sequences comprise RNA processing sites. In some embodiments, regulatory sequences comprise effector binding sites. In some embodiments, regulatory sequences comprise stem-loop structures.
[0305] A skilled artisan would appreciate that "promoter" refers to a DNA sequence capable of controlling the expression of a coding sequence or functional RNA. In some embodiments, a coding sequence is located 3' to a promoter sequence. It is understood by those skilled in the art that different promoters may direct the expression of a gene in different tissues or cell types, or at different stages of development, or in response to different environmental or physiological conditions. In some embodiments, the promoter comprises a constitutive promoter, i.e., a promoter that causes a gene to be expressed in most cell types at most times. In some embodiments, the promoter comprises a regulated promoter, i.e., a promoter that causes a gene to be expressed in response to sporadic specific stimuli. It is further recognized that in many cases the exact boundaries of regulatory sequences have not been completely defined yet.
[0306] A skilled artisan would appreciate that the term "3' non-coding sequences" or "transcription terminator" refers to DNA sequences located downstream of a coding sequence. In some embodiments, 3' non-coding sequences comprise polyadenylation recognition sequences. In some embodiments, 3' non-coding sequences comprise sequences encoding regulatory signals capable of affecting mRNA processing. In some embodiments, 3' non-coding sequences comprise sequences encoding regulatory signals capable of affecting gene expression. The polyadenylation signal is usually characterized by affecting the addition of polyadenylic acid tracts to the 3' end of the mRNA precursor. In some embodiments, mutations in the 3' non-coding sequences affect gene transcription. In some embodiments, mutations in the 3' non-coding sequences affect RNA processing. In some embodiments, mutations in the 3' non-coding sequences affect gene stability. In some embodiments, mutations in the 3' non-coding sequences affect translation of the associated coding sequence.
[0307] Biological Activity
[0308] In some embodiments, the biological activity of GAME25 or GAME31 is altered compared with a control GAME25 enzyme or a control GAME31 enzyme.
[0309] A skilled artisan would recognize that the term "biological activity" refers to any activity associated with a protein that can be measured by an assay. In some embodiments, the biological activity of GAME25 and/or GAME31 comprises biosynthesis of steroidal alkaloids and glycosylated derivatives thereof. In some embodiments, the biological activity of GAME25 and/or GAME31 affect the levels of steroidal alkaloids in at least a part of a plant. In some embodiments, an altered biological activity comprises increased enzyme activity. In some embodiments, an altered biological activity comprises decreased enzyme activity. In some embodiments, an altered biological activity comprises increased stability of the polypeptide. In some embodiments, an altered biological activity comprises decreased stability of the polypeptide.
[0310] In some embodiments, the altered biological activity comprises
[0311] increased enzyme activity of said 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) or said 2-oxoglutarate-dependent dioxygenase (GAME31), or the combination thereof; or
[0312] increased stability of said 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) or said 2-oxoglutarate-dependent dioxygenase (GAME31), or the combination thereof; or
[0313] decreased enzyme activity of said 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) or said 2-oxoglutarate-dependent dioxygenase (GAME31), or the combination thereof; or
[0314] decreased stability of said 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) or said 2-oxoglutarate-dependent dioxygenase (GAME31), or the combination thereof; compared to the biological activity in an unmodified plant.
[0315] In some embodiments, the biological activity of a GAME25 enzyme is increased compared with a control GAME25 enzyme. In some embodiments, the biological activity of a GAME 25 enzyme is decreased compared with a control GAME25 enzyme. In some embodiments, a GAME25 enzyme has increased stability compared with a control GAME25 enzyme. In some embodiments, a GAME25 enzyme has decreased stability compared with a control GAME25 enzyme.
[0316] In some embodiments, the biological activity of a GAME31 enzyme is increased compared with a control GAME31 enzyme. In some embodiments, the biological activity of a GAME 31 enzyme is decreased compared with a control GAME31 enzyme. In some embodiments, a GAME31 enzyme has increased stability compared with a control GAME31 enzyme. In some embodiments, a GAME31 enzyme has decreased stability compared with a control GAME31 enzyme.
[0317] In some embodiments, the biological activity of a GAME25 enzyme is increased compared with a control GAME25 enzyme, and the biological activity of GAME 31 is unchanged. In some embodiments, the biological activity of a GAME25 enzyme is increased compared with a control GAME25 enzyme, and the biological activity of GAME 31 is also increased compared with a control GAME31. In some embodiments, the biological activity of a GAME25 enzyme is increased compared with a control GAME25 enzyme, and the biological activity of GAME 31 is decreased compared with a control GAME31. In some embodiments, the biological activity of a GAME 25 enzyme is decreased compared with a control GAME25 enzyme and the biological activity of GAME31 is unchanged. In some embodiments, the biological activity of a GAME 25 enzyme is decreased compared with a control GAME25 enzyme and the biological activity of GAME31 is also decreased compared with a control GAME31. In some embodiments, the biological activity of a GAME 25 enzyme is decreased compared with a control GAME25 enzyme and the biological activity of GAME31 is increased compared with a control GAME31.
[0318] In some embodiments, the stability of a GAME25 enzyme is increased compared with a control GAME25 enzyme, and the stability of GAME 31 is unchanged. In some embodiments, the stability of a GAME25 enzyme is increased compared with a control GAME25 enzyme, and the stability of GAME 31 is also increased compared with a control GAME31. In some embodiments, the stability of a GAME25 enzyme is increased compared with a control GAME25 enzyme, and the stability of GAME 31 is decreased compared with a control GAME31. In some embodiments, the stability of a GAME 25 enzyme is decreased compared with a control GAME25 enzyme and the stability of GAME31 is unchanged. In some embodiments, the stability of a GAME 25 enzyme is decreased compared with a control GAME25 enzyme and the stability of GAME31 is also decreased compared with a control GAME31. In some embodiments, the stability of a GAME 25 enzyme is decreased compared with a control GAME25 enzyme and the stability of GAME31 is increased compared with a control GAME31.
[0319] In some embodiment, the biological activity comprises biosynthesis of steroidal alkaloids and glycosylated derivatives thereof. Thus, the biological activity of GAME25 and/or GAME31 affect the levels of steroidal alkaloids in at least a part of a plant.
In some embodiments, a genetically modified plant comprising an altered the biological activity of GAME25 alters the content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof compared to a corresponding unmodified plant. In some embodiments, a genetically modified plant comprising an altered the biological activity of GAME31 alters the content of at least one steroidal alkaloid or a glycosylated derivative thereof compared to a corresponding unmodified plant. In some embodiments, a genetically modified plant comprising an altered the biological activity of GAME25 and GAME31 alters the content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof compared to a corresponding unmodified plant.
[0320] In some embodiments, disclosed herein is a method of altering the content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof in a plant, comprising altering the biological activity of at least one protein selected from the group comprising a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) and a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof. In some embodiments, altering the biological activity of at least one protein selected from the group comprising a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) and a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, comprises introducing one or more point mutations into a DNA sequence coding GAME25, or GAME31, or a combination thereof, wherein said mutated DNA sequence is expressed in at least one plant cell within said plant. In some embodiments, altering the biological activity of at least one protein selected from the group comprising a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) and a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, comprises introducing one or more point mutations into a DNA regulatory sequence that is operably linked to the DNA sequence encoding GAME25, or GAME31, or a combination thereof, wherein said mutated regulatory DNA sequence alters the expression of the DNA sequence encoding GAME25, or GAME31, or a combination thereof in at least one plant cell within said plant.
[0321] In some embodiments, a method of producing a plant with an altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof comprises altering the biological activity of a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) and a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, as described herein, or altering the expression level of a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) and a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof as described herein, or altering the activity and expression level of a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) and a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof as described herein, compared to a corresponding non-transformed plant. In some embodiments, altering the content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof in a plant comprises increasing said content. In some embodiments, altering the content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof in a plant comprises decreasing said content. In some embodiments, altering the content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof in a plant comprises increasing the content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof and decreasing the content of at least one other cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof.
[0322] In some embodiments, the biological activity of GAME25 comprises a 3-.beta.-hydroxysteroid dehydrogenase/isomerase enzyme activity. In some embodiments, the biological activity of GAME25 comprises a step in the multi-step conversion of dehydrotomatidine to tomatidine. In some embodiments, the biological activity of GAME25 comprises a step in the multi-step conversion of solanidine to demissidine. In some embodiments, the biological activity of GAME25 comprises a step in the multi-step conversion of solasoidine to dihydrosolasodine.
[0323] In some embodiments, the biological activity of GAME31 comprises a 2-oxoglutarate-dependent dioxygenase enzyme activity. In some embodiments, the biological activity of GAME31 comprises a step in the conversion of dehydrotomatine to hydroxy-dehydrotomatine. In some embodiments, the biological activity of GAME31 comprises a step in the conversion of .alpha.-tomatine to hydroxytomatine. In some embodiments, the biological activity of GAME31 comprises a step in the conversion of .alpha.-solanine to leptinine II. In some embodiments, the biological activity of GAME31 comprises a step in the conversion of .alpha.-chaconine to leptinine I. In some embodiments, the biological activity of GAME31 comprises a step in the conversion of solasonine to hydroxysolasonine. In some embodiments, the biological activity of GAME31 comprises a step in the conversion of .alpha.-solamargine to hydroxysolamargine.
[0324] In some embodiments, the biological activity of GAME 25, GAME31, or a combination thereof, comprises altering the content of a steroidal alkaloid or a glycosylated derivative thereof selected from the group comprising: tomatidine, .alpha.-tomatine, .alpha.-tomatine isomer (1 and 2), hydroxytomatine, acetoxytomatine, acetoxy-hydroxytomatine, tomatidine+4 hexose, esculeosides, esculeoside A, esculeoside A+hexose, esculeoside B, acetoxyesculeoside B, demissidine, demissine, dehydrosolasodine, hydroxy-dehydrotomatine, acetoxy-hydroxy-dehydrotomatine, dehydroesculeosides, leptinine I, leptinine II, leptine I, leptine II, lycoperosides, and hydroxysolamargine, or any derivatives thereof, or any combination thereof.
[0325] In some embodiments, the biological activity of GAME 25, GAME31, or a combination thereof, comprises altering the content of a steroidal alkaloid or a glycosylated derivative thereof selected from the group comprising: dehydrotomatine or an isomer thereof, hydroxy-dehydrotomatine, acetoxy-dehydrotomatine, acetoxy-hydroxy-dehydrotomatine, dehydrotomatidine+4 hexose, dehydroesculeoside A, dehydroesculeoside A+hexose, solanidine, .alpha.-solanine, .alpha.-chaconine, leptinine I, leptinine II, leptine I, leptine II, solasoidine, .alpha.-solasonine, .alpha.-solamargine, hydroxysolasonine, and hydroxysolamargine, or any derivatives thereof, or any combination thereof.
[0326] In some embodiments, the biological activity of GAME 25, GAME31, or a combination thereof, comprises increasing plant resistance to at least one plant pathogen, pest, or predator, or any combination thereof. In some embodiments, the biological activity of GAME 25, GAME31, or a combination thereof, comprises generating precursor molecules for steroidal alkaloid molecules that provide resistance to at least one plant pathogen, pest, or predator, or any combination thereof.
[0327] In some embodiments, the biological activity of GAME 25, GAME31, or a combination thereof, comprises synthesizing anti-nutritional steroidal alkaloids or glycosylated derivatives thereof.
[0328] In some embodiments, the biological activity of GAME25 is enhanced by the introduction of one or more point mutations into its DNA coding sequences. In some embodiments, the biological activity of GAME25 is diminished by the introduction of one or more point mutations into its DNA coding sequences. In some embodiments, the biological activity of GAME31 is enhanced by the introduction of one or more point mutations into its DNA coding sequences. In some embodiments, the biological activity of GAME31 is diminished by the introduction of one or more point mutations into its DNA coding sequences. In some embodiments, the biological activity of GAME25, GAME31, or a combination thereof, is enhanced by increasing the stability of GAME25, GAME31, or a combination thereof, by the introduction of one or more point mutations into their DNA coding sequences. In some embodiments, the biological activity of GAME25, GAME31, or a combination thereof, is decreased by decreasing the stability of GAME25, GAME31, or a combination thereof, by the introduction of one or more point mutations into their DNA coding sequences.
Overexpression
[0329] According to yet additional embodiments, provided herein is a genetically modified plant having enhanced expression of at least one gene selected from the group comprising a gene encoding 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), and a gene encoding 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, wherein the genetically modified plant has an increased amount of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof compared to a corresponding unmodified plant. In plants, steroidal alkaloids play a role in protecting the plant from various pathogens. Steroidal alkaloids are referred to as phytoanticipins, i.e. low molecular weight anti-microbial compounds that are present in the plant before challenge by microorganisms or produced after infection solely from preexisting constituents. Over-expression of GAME25, or GAME31, or any combination thereof in non-edible parts of the plant can thus enhance the plant resistance to steroidal-alkaloid-sensitive pathogens.
Transgenic Plants
[0330] Cloning of a polynucleotide encoding a protein of the present invention selected from the group comprising of 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25, 2-oxoglutarate-dependent dioxygenase (GAME31), and a combination thereof or a molecule that silences a gene encoding same may be performed by any method as is known to a person skilled in the art. Various DNA constructs may be used to express the desired gene or silencing molecule targeted to the gene in a desired organism.
[0331] In certain embodiments, the gene or a silencing molecule targeted thereto form part of an expression vector comprising all necessary elements for expression of the gene or its silencing molecule. In certain embodiments, the expression is controlled by a constitutive promoter. In certain embodiments, the constitutive promoter is specific to a plant tissue. According to these embodiments, the tissue specific promoter is selected from the group consisting of root, tuber, leaves and fruit specific promoter. Root specific promoters are described, e.g. in Martinez, E. et al. 2003. Curr. Biol. 13:1435-1441. Fruit specific promoters are described among others in Estornell L. H et al. 2009. Plant Biotechnol. J. 7:298-309 and Fernandez A. I. Et al. 2009 Plant Physiol. 151:1729-1740. Tuber specific promoters are described, e.g. in Rocha-Sosa M, et al., 1989. EMBO J. 8:23-29; McKibbin R. S. et al., 2006. Plant Biotechnol J. 4(4):409-18. Leaf specific promoters are described, e.g. in Yutao Yang, Guodong Yang, Shijuan Liu, Xingqi Guo and Chengchao Zheng. Science in China Series C: Life Sciences. 46: 651-660.
[0332] In certain embodiments, the expression vector further comprises regulatory elements at the 3' non-coding sequence. A skilled artisan would appreciate that the term "3' non-coding sequences" encompasses DNA sequences located downstream of a coding sequence and include polyadenylation recognition sequences and other sequences encoding regulatory signals capable of affecting mRNA processing or gene expression. The polyadenylation signal is usually characterized by affecting the addition of polyadenylic acid tracts to the 3' end of the mRNA precursor. The use of different 3' non-coding sequences is exemplified by Ingelbrecht I L et al. (1989. Plant Cell 1:671-680).
[0333] Those skilled in the art would appreciate that the various components of the nucleic acid sequences and the transformation vectors described in the present invention are operatively linked, so as to result in expression of said nucleic acid or nucleic acid fragment. Techniques for operatively linking the components of the constructs and vectors of the present invention are well known to those skilled in the art. Such techniques include the use of linkers, such as synthetic linkers, for example including one or more restriction enzyme sites.
[0334] One skilled in the art would appreciate that the term "operably linked" may encompass the association of nucleic acid sequences on a single nucleic acid fragment so that the function of one is regulated by the other. For example, a promoter is operably linked with a coding sequence when it is capable of regulating the expression of that coding sequence (i.e., that the coding sequence is under the transcriptional control of the promoter). Coding sequences can be operably linked to regulatory sequences in a sense or antisense orientation.
[0335] Methods for transforming a plant, described herein, are known to those skilled in the art. One skilled in the art would appreciate that the term "transformation" or "transforming" describes a process by which a foreign DNA, such as a DNA construct, including expression vector, enters and changes a recipient cell into a transformed, genetically altered or transgenic cell. Transformation may be stable, wherein the nucleic acid sequence is integrated into the organism genome and as such represents a stable and inherited trait, or transient, wherein the nucleic acid sequence is expressed by the cell transformed but is not integrated into the genome, and as such represents a transient trait. According to preferred embodiments the nucleic acid sequence of the present invention is stably transformed into the plant cell.
[0336] The genetically altered plants having altered content of the desired steroidal alkaloid(s) or steroidal glycoalkaloid(s), disclosed herein, are typically first selected based on the expression of the gene or protein. Plants having enhanced or aberrant expression of the gene or protein, are then analyzed for the content of steroidal alkaloids and steroidal glycoalkaloids.
[0337] Detection of mutated GAME25, or GAME31 genes, or a combination thereof and/or the presence of silencing molecule targeted to the gene is performed employing standard methods of molecular genetics, known to a person of ordinary skill in the art.
[0338] For measuring the gene(s) or silencing molecule(s) expression, cDNA or mRNA should be obtained from an organ in which the nucleic acid is expressed. The sample may be further processed before the detecting step. For example, the polynucleotides in the cell or tissue sample may be separated from other components of the sample, may be amplified, etc. All samples obtained from an organism, including those subjected to any sort of further processing are considered to be obtained from the organism.
[0339] Detection of the gene(s) or the silencing molecule(s) typically requires amplification of the polynucleotides taken from the candidate altered organism. Methods for DNA amplification are known to a person skilled in the art. Most commonly used method for DNA amplification is PCR (polymerase chain reaction; see, for example, PCR Basics: from background to Bench, Springer Verlag, 2000; Eckert et al., 1991. PCR Methods and Applications 1:17). Additional suitable amplification methods include the ligase chain reaction (LCR), transcription amplification and self-sustained sequence replication, and nucleic acid based sequence amplification (NASBA).
[0340] In certain embodiments, the nucleic acid sequence comprising the GAME25, or GAME31 genes or its silencing molecule further comprises a nucleic acid sequence encoding a selectable marker. In certain embodiments, the selectable marker confers resistance to antibiotic or to an herbicide; in these embodiments the transgenic plants are selected according to their resistance to the antibiotic or herbicide.
[0341] The content of steroidal alkaloids and/or steroidal glycoalkaloids is measured as exemplified hereinbelow and as is known to a person skilled in the art.
[0342] In one embodiment, the genetically modified plant disclosed herein comprising at least one cell having an altered expression, comprises at least one transcribable polynucleotide. In another embodiment, the genetically modified plant disclosed herein comprising at least one cell having an altered expression, comprises at least one transcribable polynucleotide encoding at least one protein, said at least one protein selected from the group comprising a GAME25 3-.beta.-hydroxysteroid dehydrogenase/isomerase and a GAME31 2-oxoglutarate-dependent dioxygenase, or any combination thereof. In another embodiment, the genetically modified plant disclosed herein comprising at least one cell having an altered expression, comprises at least one transcribable polynucleotide complementary of anti-sense to a GAME25 gene or portion thereof. In another embodiment, the genetically modified plant disclosed herein comprising at least one cell having an altered expression, comprises at least one transcribable polynucleotide complementary or anti-sense to a GAME31 gene or portion thereof. In another embodiment, the genetically modified plant disclosed herein comprising at least one cell having an altered expression, comprises at least one transcribable polynucleotide complementary of anti-sense to a GAME25 gene or portion thereof, or complementary or anti-sense to a GAME31 gene or portion thereof, or any combination thereof.
[0343] In some embodiments, the at least one transcribable polynucleotide comprises the nucleic acid sequence set forth in SEQ ID NO: 8. In some embodiments, the at least one transcribable polynucleotide comprises the nucleic acid sequence set forth in SEQ ID NO: 58. In some embodiments, the at least one transcribable polynucleotide comprises the nucleic acid sequence set forth in SEQ ID NO: 59. In some embodiments, the at least one transcribable polynucleotide comprises the nucleic acid sequence set forth in any one of SEQ ID NO: 8, SEQ ID NO: 58, and SEQ ID NO: 59, or any combination thereof.
[0344] One skilled in the art would appreciate that edible components of plants may go through ripening stages. For example, for a tomato, six ripening stages may be identified: Green, Breakers, Turning, Pink, Light Red, and Red. In one embodiment, Green--stage one--means that the surface of the tomato is completely green in color, wherein the shade of green may vary from light to dark. In one embodiment, Breakers--stage two--means there is a definite "break" in color from green to tannish-yellow, pink or red on not more than 10% of the surface. In one embodiment, Turning--stage 3--means that more than 10%, but not more than 30%, of the surface, in the aggregate, shows a definite change in color from green to tannish-yellow, pink, red, or a combination thereof. In one embodiment, Pink--stage four--means that more than 30%, but not more than 60%, of the surface, in the aggregate, shows pink or red in color. Light Red--stage 5--means that more than 60% of the surface, in the aggregate, shows pinkish-red or red, provided that not more than 90% of the surface is red. Red--stage 6--means that more than 90% of the surface, in the aggregate, is red.
[0345] In one embodiment, the at least one cell having altered expression is selected from the group consisting of an immature green tissue cell, a mature green tissue cell, an orange tissue cell, a breaker tissue cell, and a ripe tissue cell.
[0346] In another embodiment, the at least one cell having altered expression is selected from the group consisting of leaf cell, a bud cell, a petal cell, a root cell, a peal cell, a flower cell, a stem cell, a shoot cell, and a fruit cell. One skilled in the art would appreciate that it may be advantageous for a plant to have increased expressions of at least one SA/SGA in order to provide the plant with resistance to pathogens and pests during development and growth, wherein at the same time it would be advantageous for an edible part of the plant to have reduced SA/SGA, wherein the SA/SGA comprising anti-nutritional compounds. In some embodiments, a leaf cell comprises a young leaf cell. In some embodiments, a leaf cell comprises a mature leaf cell.
[0347] In one embodiment, an edible part of a plant is a fruit. In another embodiment, an edible part of a plant is a tuber. In another embodiment, an edible part of a plant is a leaf, a young leaf, or a mature leaf. In another embodiment, an edible part of a plant is a bud. In one embodiment, a fruit comprises a green fruit, a breaker fruit, a turning fruit, a pink fruit, a light red fruit, or a red ripe fruit. In another embodiment, a fruit comprises a green fruit, a breaker fruit, or a red ripe fruit.
[0348] In one embodiment, disclosed herein is a method of reducing the content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof in a plant, comprising transforming at least one plant cell within said plant with at least one silencing molecule targeted to a nucleic acid sequence encoding at least one protein selected from the group comprising a3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) and a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, thereby producing a plant with a reduced content of said at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof compared to a corresponding non-transformed plant. In another embodiment, a method of reducing the content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof comprises reducing the content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof comprising an anti-nutritional compound.
[0349] In some embodiments, a method of reducing the content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof in a plant, said method comprising a step
[0350] transforming at least one plant cell within said plant with at least one silencing molecule targeted to a nucleic acid sequence encoding at least one protein selected from the group comprising 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), 2-oxoglutarate-dependent dioxygenase (GAME31), or any combination thereof; or
[0351] transforming at least one plant cell within said plant with at least one polynucleotide sequence encoding at least one protein selected from the group comprising 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), or a 2-oxoglutarate-dependent dioxygenase (GAME31), or any combination thereof, wherein said at least one polynucleotide sequence comprises a mutation in a coding region or a regulatory region; or
[0352] a combination of (a) and (b);
thereby producing a plant with a reduced content of said at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof compared to a corresponding non-transformed plant.
[0353] In another embodiment, the method of reducing the content of at least one steroidal alkaloid or a glycosylated derivative thereof comprising reducing the content of at least one anti-nutritional compound, maintains or essentially maintains the resistance to at least one pathogen or predator in the plant, compared to a corresponding non-transformed plant. In an alternate embodiment, the plant resistance to at least one pathogen or predator is increased compared to a corresponding non-transformed plant.
[0354] In some embodiments, the reduced at least one steroidal alkaloid or a glycosylated derivative thereof comprises any of the SA or SGA disclosed herein. In some embodiments, the reduced at least one steroidal alkaloid or a glycosylated derivative thereof comprises a sub-set of the SA or SGA disclosed herein. In some embodiments, the sub-set of reduced at least one steroidal alkaloid or a glycosylated derivative thereof comprises .alpha.-tomatine, .alpha.-tomatine isomer (1 and 2), hydroxytomatine, acetoxytomatine, acetoxy-hydroxytomatine, esculeosides, lycoperosides, or derivatives thereof, or any combination thereof. In some embodiments, while a sub-set of SA or SGA are reduced, additionally at least one steroidal alkaloid or a glycosylated derivative thereof is increased, wherein the at least one steroidal alkaloid or a glycosylated derivative thereof comprising a dehydrotomatine, a dehydrotomatine isomer 1, a dehydrotomatidine+4-hexose, a hydroxy-dehydrotomatine, an acetoxy-dehydrotomatine, an acetoxy-hydroxy-dehydrotomatine, an dehydroesculeosides, an dehydrolycoperosides, or any derivatives thereof, or any combination thereof.
[0355] In some embodiments, the reduced at least one unsaturated or saturated steroidal saponin or a glycosylated derivative thereof comprises any unsaturated or saturated steroidal saponin or glycosylated derivative thereof. In some embodiments, the reduced at least one unsaturated or saturated steroidal saponin or a glycosylated derivative thereof comprises dioscin, diosgenin, parillin, or sarasapogenin. In some embodiments, the reduced at least one unsaturated or saturated steroidal saponin or a glycosylated derivative thereof comprises aescin, araloside A, astragaloside, bacopaside, bacoside, bacoside A, chaconine, charantin, daucosterol, esculeoside A, ginsenoside, glycyrrhizin, .alpha.-hederin, holothurin, momordicine, momordin, osladin, protodioscin, pseudoginsenoside F11, QS21, solanine, triterpenoid saponin, and ziziphin
Breeding
[0356] In some embodiments, disclosed herein is a method for breeding a plant having altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof; said method comprising providing a first plant, wherein the expression level of GAME25, GAME31, or a combination thereof, in said first plant is in a pre-determined range of values; providing a second plant; crossing said first and second plants to generate an offspring plant; and selecting an offspring plant that has a significantly different content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof compared to said second plant. In some embodiments, a method for breeding a plant having altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof; comprises (a) providing a first plant, wherein the expression level of a polynucleotide encoding a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof is in a pre-determined range of values, or a biological activity of a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, is in a pre-determined range of values; (b) providing a second plant; (c) crossing said first and second plants to generate an offspring plant; and (d) selecting an offspring plant that has a significantly different content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof compared to said second plant.
[0357] In some embodiments, a pre-determined value of expression comprises under-expression or over-expression compared to a non-genetically modified plant. In some embodiments, a pre-determined value of expression comprises under-expression or over-expression compared to a wild-type plant. In some embodiments, a pre-determined value of expression comprises under-expression or over-expression compared to a different genetically modified plant.
[0358] In some embodiments, a pre-determine value of biological activity comprises increase enzyme activity, or decreased enzyme activity, or increased stability, or decreased stability of said GAME25 or GAME31, or the combination thereof, compared to a non-genetically modified plant. In some embodiments, a pre-determine value of biological activity comprises increase enzyme activity, or decreased enzyme activity, or increased stability, or decreased stability of said GAME25 or GAME31, or the combination thereof, compared to a wild-type plant. In some embodiments, a pre-determine value of biological activity comprises increase enzyme activity, or decreased enzyme activity, or increased stability, or decreased stability of said GAME25 or GAME31, or the combination thereof, compared to a different genetically modified plant.
[0359] In some embodiments, disclosed herein is a method for breeding a plant with decreased content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof; said method comprising providing a first plant, wherein the expression level of GAME25, GAME31, or a combination thereof, in said first plant is below a pre-determined value; providing a second plant; crossing said first and second plants to generate an offspring plant; and selecting an offspring plant that has decreased content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof compared to said second plant.
[0360] In some embodiments, disclosed herein is a method for breeding a plant with increased content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof; said method comprising providing a first plant, wherein the expression level of GAME25, GAME31, or a combination thereof, in said first plant is above a pre-determined value; providing a second plant; crossing said first and second plants to generate an offspring plant; and selecting an offspring plant that has increased content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof compared to said second plant.
[0361] In some embodiments, alternative methods may be used to breed a plant having an altered expression of at least one gene. For example, in some embodiments, a method for breeding a plant having an altered expression of at least one gene selected from the group comprising a gene encoding 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), a gene encoding a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, said method comprising:
[0362] providing a first transformed plant, wherein said first transformed plant is transformed with an expression vector comprising a polynucleotide comprising at least one silencing molecule targeted to a nucleic acid sequence encoding at least one protein selected from the group comprising a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25) and a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, wherein said at least one silencing molecule is operably linked to a promoter; or
[0363] providing a first transformed plant, wherein said first transformed plant is transformed with an expression vector comprising at least one polynucleotide which overexpresses at least one protein selected from the group comprising a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof; or
[0364] providing a first transformed plant, wherein said first transformed plant is transformed with an expression vector comprising at least one polynucleotide which comprises a mutation in a gene encoding at least one protein selected from the group comprising a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof;
[0365] providing a second non-transformed plant;
[0366] crossing said first transformed plant of (a) or (b) or (c) with a second plant to generate a hybrid plant, wherein the hybrid plant comprises the expression vector; and
[0367] selecting a hybrid plant that has an altered expression of at least one of said genes compared with an unmodified plant. Further, said plant may, in certain embodiments comprise an altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof, compared to a corresponding unmodified plant.
[0368] In some embodiments, the at least one silencing molecule or said overexpressing polynucleotide is operably linked to a constitutive promoter, an inducible promoter, a tissue-specific promoter, or a developmental-stage specific promoter. In some embodiments, the at least one polynucleotide comprising a mutation is operably linked to a constitutive promoter, an inducible promoter, a tissue-specific promoter, or a developmental-stage specific promoter. In some embodiments, the expression level and/or biological activity of the 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), or the 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, provide a biological marker for a plant comprising altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof. In some embodiments, the altered content comprises reduced content of an anti-nutritional or toxic steroidal alkaloid or a glycosylated derivative thereof. In some embodiments, the altered content comprises increased content of a steroidal alkaloid or a glycosylated derivative thereof that provides resistance to a plant pathogen, pest, or predator.
[0369] In some embodiments, increased content of at least one SA or SGA can be produced in a genetically modified plant. In some embodiments, a method of enhancing the content of at least one steroidal alkaloid or a glycosylated derivative thereof in a plant, comprising
[0370] transforming at least one plant cell within said plant with a nucleic acid sequence encoding 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, wherein said transforming results in overexpression of said GAME25, GAME31, or a combination thereof; or
[0371] transforming at least one plant cell with at least one polynucleotide sequence encoding at least one protein selected from the group comprising 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), or a 2-oxoglutarate-dependent dioxygenase (GAME31), or any combination thereof, wherein said at least one polynucleotide sequence comprises a mutation in a coding region or a regulatory region;
thereby producing a plant with an enhanced content of said at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof, compared to a corresponding non-transformed plant.
[0372] In some embodiments, increased content of at least one SA of SGA comprises any SA or SGA disclosed herein. In some embodiments, increased content of at least one SA of SGA comprises a subset of SA or SGA disclosed herein. In some embodiments, a sub-set of increased SA of SGA comprises at least one of a .alpha.-tomatine, .alpha.-tomatine isomer (1 and 2), hydroxytomatine, acetoxytomatine, soladulcidine, .beta.-soladulcine, soladulcine A, an unsaturated or saturated steroidal saponin or a glycoside derivative thereof, a leptin, or a leptinine, or any combination thereof. In some embodiments, increased SA or SGA results in a plant, wherein said plant resistance to at least one plant pathogen, pests or predator is increased, compared to a corresponding non-transformed plant.
[0373] In some embodiments, provided herein is a method for selecting plant progenitors for plant breeding, said method comprising a step of determining the expression level of GAME25, GAME31, or a combination thereof, wherein expression levels of GAME25, GAME31, or a combination thereof, below a pre-determined value are predictive of low content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof in the offspring plants.
[0374] In some embodiments, provided herein is a method for selecting plant progenitors for plant breeding, said method comprising a step of determining the expression level of GAME25, GAME31, or a combination thereof, wherein expression levels of GAME25, GAME31, or a combination thereof, above a pre-determined value are predictive of high content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof in the offspring plants.
[0375] In some embodiments, a method for selecting plant progenitors, comprises a step of
[0376] (a) determining the expression level of a gene encoding a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), or a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, wherein expression levels of said GAME25 gene, or said GAME31 gene, or the combination thereof, is predictive of altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof in an offspring plant; or
[0377] (b) determining the biological activity of a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), or a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, wherein biological activity of said GAME25 enzyme, or said GAME31 enzyme, or the combination thereof, is predictive of altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof in an offspring plant.
[0378] In some embodiments, a method for determining the capacity of a plant to produce steroidal alkaloids or glycosylated derivatives thereof in at least a part of said plant, comprises a step of measuring the expression level of GAME25, or GAME31, or a combination thereof, in at least a part of said plant; or measuring the biological activity of a 3-.beta.-hydroxysteroid dehydrogenase/isomerase (GAME25), or a 2-oxoglutarate-dependent dioxygenase (GAME31), or a combination thereof, in at least a part of said plant; or a combination thereof. In some embodiments, the steroidal alkaloids or glycosylated derivatives thereof are selected from the group comprising: tomatidine, .alpha.-tomatine, .alpha.-tomatine isomer (1 and 2), .alpha.-tomatine isomer 1, .alpha.-tomatine isomer 2, hydroxytomatine, acetoxytomatine, dehydrotomatidine, dehydrotomatine, dehydrotomatine isomer 1, dehydrotomatine 4-hexose, acetoxy-hydroxytomatine, acetoxy-hydroxy-dehydrotomatine, tomatidine+4 hexose, esculeosides, esculeoside A, esculeoside A+hexose, esculeoside B, acetoxyesculeoside B, demissidine, demissine, dehydrosolasodine, hydroxy-dehydrotomatine, acetoxy-hydroxy-dehydrotomatine, dehydroesculeosides, dehydroesculeoside A, dehydroesculeoside A+hexose, lycoperosides, leptinine I, leptinine II, leptine I, leptine II, soladulcidine, .beta.-soladulcine, soladulcine A, an unsaturated or saturated steroidal saponin or a glycoside derivative thereof, solanidine, .alpha.-solanine, .alpha.-chaconine, solasoidine, .alpha.-solasonine, .alpha.-solamargine, hydroxysolasonine, and hydroxysolamargine, or any derivatives thereof, or any combination thereof.
[0379] In some embodiments, disclosed herein are methods for breeding a plant having an altered expression of at least one gene selected from the group comprising GAME25, GAME31, or a combination thereof, said method comprising providing a first transformed plant, wherein said first transformed plant is transformed with an expression vector comprising a polynucleotide comprising at least one silencing molecule targeted to a nucleic acid sequence encoding at least one protein selected from the group comprising GAME25, GAME31, or a combination thereof, wherein said at least one silencing molecule is operably linked to a promoter; providing a second non-transformed plant; crossing said first and second plants to generate an offspring hybrid plant, wherein the offspring hybrid plant comprises the expression vector; and selecting an offspring hybrid plant that has an altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof compared to a corresponding unmodified plant.
[0380] In some embodiments, an expression vector is operably linked to a different promoter so that the expression of the silencing molecule can be controlled under different conditions. In another embodiment, the silencing molecule is operably linked to a constitutive promoter. In another embodiment, the silencing molecule is operably linked to an inducible promoter. In another embodiment, the silencing molecule is operably linked to a tissue active or specific promoter. In another embodiment, the silencing molecule is operably linked to a developmental-stage active or specific promoter. When the silencing molecule is linked to a constitutive promoter, changes in expression of a gene will be observed in all tissues and at all times and a broad overview of the effects of the expression of the gene on a plant will be observed. When the silencing molecule is linked to a tissue specific promoter or an inducible promoter or developmental-stage promoter, the expression of the silencing molecule may be turned on or off in a particular tissue such as seed, roots, flowers, leaves, shoots, fruits or stems, during a particular period in development, such as early, middle or late stages in development, or under particular conditions, such as specific environmental or disease stresses. In some embodiments, a plant may be transformed with more than one expression vector. In one embodiment, the at least one silencing molecule is operably linked to a constitutive promoter, an inducible promoter, a tissue-specific promoter, or a developmental-stage specific promoter.
[0381] In some embodiments, a hybrid plant is then selected wherein said plant comprises the desired expression of GAME25, or GAME31, or a combination thereof. In some embodiment, the expression level of GAME25, GAME31, or a combination thereof, provide a marker for a plant comprising altered content of at least one cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof. In some embodiments, use of GAME25 levels, or GAME31 levels, or a combination thereof as a marker provides the ability to select a plant breed to comprise a reduced content of an anti-nutritional or toxic cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof, as compared to a control plant. In some embodiments, use of GAME25 levels, or GAME31 levels, or a combination thereof as a marker provides the ability to select a plant breed to comprise improved resistance to a plant pathogen, pest, or predator, as compared to a control plant.
[0382] In one embodiment, the method combines genomic and plant breeding techniques. In one embodiment, the method alters the expression level or levels of GAME25, GAME31, or a combination thereof. Expression levels may be altered constitutively, or altered selectively to monitor tissue specific expression, inducible expression, developmental-stage specific expression or the like in a high-throughput manner. In another embodiment, the expression of these known genes, or the enzymes they encode, act as markers for breeding plants having SA or SGA derivatives comprising beneficial properties, for example SA or SGA derivatives that provide increased resistance to pathogens, pests, or predators, plants having a decreased anti-nutritional content or decreased toxins, or any combination thereof.
[0383] In some embodiments, transformation techniques including breeding through transgene editing, use of transgenes, use of transient expression of a gene or genes, or use of molecular markers, or any combination thereof, may be used in the breeding of a plant having an altered expression. If transformation techniques require use of tissue culture, transformed cells may be regenerated into plants in accordance with techniques well known to those of skill in the art. The regenerated plants may then be grown and crossed with the same or different plant varieties using traditional breeding techniques to produce seed, which are then selected under the appropriate conditions.
[0384] In some embodiments, an offspring plant comprises decreased anti-nutritional contents or decreased toxins compared to at least one of the progenitor plants. In some embodiments, an offspring plant comprises improved resistance to a plant pathogen, pest, or predator compared to at least one of the progenitor plants.
[0385] In one embodiment, a plant as disclosed herein comprises a Solanaceae crop plant. In some embodiments, a Solanaceae crop plant is selected from the group comprising Solanum lycopersicum, Solanum pennellii, Solanum tuberosum, Solanum chacoense, Capiscum annuum, and Solanum melongena. In some embodiments, a Solanaceae plant is selected from the group comprising ground cherry, eggplant, potato, tomato, pepper, bell pepper, cayenne pepper, chili pepper, pimiento, tabasco pepper, tobacco, and bittersweet. In some embodiments, a Solanaceae plant comprises any Solanaceae plant that produces a steroidal alkaloid or a glycosylated derivative thereof, or an unsaturated or saturated steroidal saponin or a glycoside derivative thereof, or any combination thereof.
[0386] A skilled artisan would appreciate that plant breeding can be accomplished through many different techniques ranging from simply selecting plants with desirable characteristics for propagation, to methods that make use of knowledge of genetics and chromosomes, to more complex molecular techniques.
[0387] A skilled artisan would appreciate that the term "hybrid plant" may encompass a plant generated by crossing two plants of interest, propagating by seed or tissue and then growing the plants. When plants are crossed sexually, the step of pollination may include cross pollination or self-pollination or back crossing with an untransformed plant or another transformed plant. Hybrid plants include first generation and later generation plants. Disclosed herein is a method to manipulate and improve a plant trait, for a non limiting example--increasing plant resistance, decreasing anti-nutritional properties in a plant, or decreasing toxins in a plant, or any combination thereof.
Biomarkers
[0388] A skilled artisan would appreciate that the term "biomarker" comprises any measurable substance in an organism whose presence is indicative of a biological state or a condition of interest. In some embodiments, the presence of a biomarker is indicative of the presence of a compound or a group of compounds of interest. In some embodiments, the concentration of a biomarker is indicative of the concentration of a compound or a group of compounds of interest. In some embodiments, the concentration of a biomarker is indicative of an organism phenotype.
[0389] The enzymes GAME25 and GAME31, are hereby disclosed to have an essential role in the biosynthesis of steroidal alkaloids found in Solanaceae plants. Thus, in some embodiments, the expression levels of GAME25, GAME31, or a combination thereof, are indicative of the capacity of a plant to produce steroidal alkaloids or glycosylated derivatives thereof.
[0390] In some embodiments, disclosed herein is a method for determining the capacity of a plant to produce steroidal alkaloids or glycosylated derivatives thereof in at least a part of said plant, the method comprising a step of determining the expression level of GAME25, or GAME31, or a combination thereof, in at least a part of said plant. In some embodiments, said expression level is compared to a pre-determined value. In some embodiments, expression levels above a pre-determined value indicate a high capacity of a plant to produce steroidal alkaloids or glycosylated derivatives thereof. In some embodiments, expression levels below a pre-determined value indicate a low capacity of a plant to produce steroidal alkaloids or glycosylated derivatives thereof.
[0391] In some embodiments, the expression level of GAME25, or GAME31 are determined in at least a part of the plant, wherein said part of said plant is selected from the group comprising: a peel, a leaf, a bud, a petal, a root, an edible part of the plant, and any combination thereof. In some embodiments, the plant is a Solanaceae crop plant. In some embodiments, the steroidal alkaloids or glycosylated derivatives thereof are produced in at least a part of the plant, wherein said part of said plant is selected from the group comprising: a peel, a leaf, a bud, a petal, a root, an edible part of the plant, and any combination thereof. In some embodiments, a leaf comprises a young leaf. In some embodiments, a leaf comprises a mature leaf.
[0392] In some embodiments, said steroidal alkaloids or glycosylated derivatives thereof are selected from the group comprising: tomatidine, .alpha.-tomatine, .alpha.-tomatine isomer (1 and 2), hydroxytomatine, acetoxytomatine, acetoxy-hydroxytomatine, tomatidine+4 hexose, esculeoside A, esculeoside A+hexose, esculeoside B, acetoxyesculeoside B, demissidine, demissine, dehydrosolasodine, hydroxy-dehydrotomatine, acetoxy-hydroxy-dehydrotomatine, dehydroesculeosides, leptinine I, leptinine II, leptine I, leptine II, and hydroxysolamargine, or any derivatives thereof, or any combination thereof.
[0393] In some embodiments, disclosed herein is a method for determining the capacity of a plant to produce tomatidine in at least a part of said plant, said method comprising a step of determining the expression level of GAME25, or GAME31, or a combination thereof, in at least a part of said plant. In some embodiments, disclosed herein is a method for determining the capacity of a plant to produce .alpha.-tomatine in at least a part of said plant, said method comprising a step of determining the expression level of GAME25, or GAME31, or a combination thereof, in at least a part of said plant. In some embodiments, disclosed herein is a method for determining the capacity of a plant to produce hydroxytomatine in at least a part of said plant, said method comprising a step of determining the expression level of GAME25, or GAME31, or a combination thereof, in at least a part of said plant. In some embodiments, disclosed herein is a method for determining the capacity of a plant to produce acetoxytomatine in at least a part of said plant, said method comprising a step of determining the expression level of GAME25, or GAME31, or a combination thereof, in at least a part of said plant.
[0394] In some embodiments, disclosed herein is a method for determining the capacity of a plant to produce acetoxy-hydroxytomatine in at least a part of said plant, said method comprising a step of determining the expression level of GAME25, or GAME31, or a combination thereof, in at least a part of said plant. In some embodiments, disclosed herein is a method for determining the capacity of a plant to produce tomatidine+4 hexose in at least a part of said plant, said method comprising a step of determining the expression level of GAME25, or GAME31, or a combination thereof, in at least a part of said plant. In some embodiments, disclosed herein is a method for determining the capacity of a plant to produce esculeoside A in at least a part of said plant, said method comprising a step of determining the expression level of GAME25, or GAME31, or a combination thereof, in at least a part of said plant. In some embodiments, disclosed herein is a method for determining the capacity of a plant to produce esculeoside A+hexose in at least a part of said plant, said method comprising a step of determining the expression level of GAME25, or GAME31, or a combination thereof, in at least a part of said plant.
[0395] In some embodiments, disclosed herein is a method for determining the capacity of a plant to produce esculeoside B in at least a part of said plant, said method comprising a step of determining the expression level of GAME25, or GAME31, or a combination thereof, in at least a part of said plant. In some embodiments, disclosed herein is a method for determining the capacity of a plant to produce acetoxyesculeoside B in at least a part of said plant, said method comprising a step of determining the expression level of GAME25, or GAME31, or a combination thereof, in at least a part of said plant. In some embodiments, disclosed herein is a method for determining the capacity of a plant to produce demissidine in at least a part of said plant, said method comprising a step of determining the expression level of GAME25, or GAME31, or a combination thereof, in at least a part of said plant. In some embodiments, disclosed herein is a method for determining the capacity of a plant to produce demissine in at least a part of said plant, said method comprising a step of determining the expression level of GAME25, or GAME31, or a combination thereof, in at least a part of said plant. In some embodiments, disclosed herein is a method for determining the capacity of a plant to produce dehydrosolasodine in at least a part of said plant, said method comprising a step of determining the expression level of GAME25, or GAME31, or a combination thereof, in at least a part of said plant.
[0396] In some embodiments, disclosed herein is a method for determining the capacity of a plant to produce hydroxy-dehydrotomatine in at least a part of said plant, said method comprising a step of determining the expression level of GAME25, or GAME31, or a combination thereof, in at least a part of said plant. In some embodiments, disclosed herein is a method for determining the capacity of a plant to produce acetoxy-hydroxy-dehydrotomatine in at least a part of said plant, said method comprising a step of determining the expression level of GAME25, or GAME31, or a combination thereof, in at least a part of said plant. In some embodiments, disclosed herein is a method for determining the capacity of a plant to produce dehydroesculeosides in at least a part of said plant, said method comprising a step of determining the expression level of GAME25, or GAME31, or a combination thereof, in at least a part of said plant. In some embodiments, disclosed herein is a method for determining the capacity of a plant to produce leptinine I in at least a part of said plant, said method comprising a step of determining the expression level of GAME25, or GAME31, or a combination thereof, in at least a part of said plant.
[0397] In some embodiments, disclosed herein is a method for determining the capacity of a plant to produce leptinine II in at least a part of said plant, said method comprising a step of determining the expression level of GAME25, or GAME31, or a combination thereof, in at least a part of said plant. In some embodiments, disclosed herein is a method for determining the capacity of a plant to produce leptine I in at least a part of said plant, said method comprising a step of determining the expression level of GAME25, or GAME31, or a combination thereof, in at least a part of said plant. In some embodiments, disclosed herein is a method for determining the capacity of a plant to produce leptine II in at least a part of said plant, said method comprising a step of determining the expression level of GAME25, or GAME31, or a combination thereof, in at least a part of said plant. In some embodiments, disclosed herein is a method for determining the capacity of a plant to produce hydroxysolamargine in at least a part of said plant, said method comprising a step of determining the expression level of GAME25, or GAME31, or a combination thereof, in at least a part of said plant.
[0398] In some embodiments, disclosed herein is a method for selecting a plant with reduced content of an anti-nutritional or toxic cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof, as compared to a control plant, said method comprising a step of determining the expression level of GAME25, or GAME31, or a combination thereof, in said plant, wherein expression level below a pre-determined value indicates reduced content of an anti-nutritional or toxic cholesterol derived compound selected from the group comprising a steroidal alkaloid or a glycosylated derivative thereof and an unsaturated or saturated steroidal saponin or a glycoside derivative thereof.
[0399] In some embodiments, disclosed herein is a method for selecting a plant with improved resistance to a plant pathogen, pest, or predator, as compared to a control plant, said method comprising a step of determining the expression level of GAME25, or GAME31, or a combination thereof, in said plant, wherein expression level above a pre-determined value indicates improved resistance to a plant pathogen, pest, or predator.
[0400] In some embodiments, disclosed herein is a method for selecting a plant with altered content of steroidal alkaloids or glycosylated derivatives thereof, as compared to a control plant, said method comprising a step of determining mutations in GAME25, or GAME31, or a combination thereof, in said plant, wherein mutations indicate altered content of steroidal alkaloids or glycosylated derivatives thereof. In some embodiments, disclosed herein is a method for selecting a plant with decreased content of steroidal alkaloids or glycosylated derivatives thereof, as compared to a control plant, said method comprising a step of determining mutations in GAME25, or GAME31, or a combination thereof, in said plant, wherein mutations indicate decreased content of steroidal alkaloids or glycosylated derivatives thereof.
[0401] Further, one skilled in the art would appreciate that the term "comprising" used throughout is intended to mean that the genetically modified plants disclosed herein, and methods of altering expression of genes, and altering production of SA and/or SGA within these genetically modified plants includes the recited elements, but not excluding others which may be optional. "Consisting of" shall thus mean excluding more than traces of other elements. The skilled artisan would appreciate that while, in some embodiments the term "comprising" is used, such a term may be replaced by the term "consisting of", wherein such a replacement would narrow the scope of inclusion of elements not specifically recited.
[0402] The following examples are presented in order to more fully illustrate embodiments described herein above. They should in no way be construed, however, as limiting.
EXAMPLES
Example 1
[0403] Expression of GAME25, a Short-Chain Dehydrogenases/Reductases Family Member Accords with the Accumulation of the Typical Green Tissue Steroidal Glycoalkaloids
[0404] Objective:
[0405] GAME9 AP2-type transcription factor is associated with the regulation of steroidal glycoalkaloids (SGAs) biosynthesis in tomato and potato. Transcriptome analysis of GAME9 overexpressing (GAME9-Ox) and GAME9 silenced (GAME9-RNAi) tomato lines revealed a concise set of 27 genes that were common among up- and down-regulated genes. Among these genes, a putative 3-.beta.-hydroxysteroid dehydrogenase/isomerase was identified and termed GAME25 (SEQ ID NO: 1). To understand the role of this gene, the expression pattern of GAME25 was examined in 14 different tomato tissue types.
[0406] Methods:
[0407] Plant Materials
[0408] Tomato (Solanum lycopersicum) cultivar(cv). MicroTom plants were grown in a climate-controlled greenhouse at 24.degree. C. during the day and 18.degree. C. during the night, with natural light.
[0409] The database SolGenomics (Fernandez-Pozo N, Menda N, Edwards J D, Saha S, Tecle I Y, Strickler S R, Bombarely A, Fisher-York T, Pujar A, Foerster H, Yan A, Mueller L A. The Sol Genomics Network (SGN) from genotype to phenotype to breeding. (2015) Nucleic Acids Res. Volume 43 (Database issue):D1036-41) was used for searching and analyzing sequences.
[0410] Quantitative Real-Time PCR (qPCR) Analysis
[0411] Total RNA was isolated from tomato (leaf, green fruit, breaker and red fruits) tissues using the Trizol method (Sigma-Aldrich). DNase I (Sigma-Aldrich)-treated RNA was reverse transcribed using a high-capacity cDNA reverse transcription kit (Applied Biosystems). Gene-specific oligonucleotides were designed with Primer Express 3 software (Applied Biosystems). The TIP41 gene was used as a reference gene for tomato samples.
TABLE-US-00047 GAME25 qRT Forward primer: (SEQ ID NO: 4) GAAGCAATTTACGGTAATGGACAC GAME25 qRT Reverse primer: (SEQ ID NO: 5) GAACTTAGTCCACCATCAACAGC
[0412] Results:
[0413] GAME25 showed higher expression in flower buds and young leaves compared to fruit specific tissues. During fruit development highest expression of GAME25 was observed at the early stage of fruit development, i.e. immature green (IG) fruit (FIG. 4A).
[0414] The expression pattern of GAME25 was similar to the profile of steroidal glycoalkaloids (SGAs) .alpha.-tomatine and dehydrotomatine that accumulate predominantly in green tissues (leaves, buds, peel and flesh of immature green fruit). For example, the reduced transcript levels of the GAME25 gene observed at later time points of fruit development correlates with the typical pattern of reduction of .alpha.-tomatine and dehydrotomatine levels observed during fruit development and ripening. Moreover, GAME25 expression in pattern during tomato fruit developmental stages was similar to the one observed in wild tomato accessions (FIG. 4B).
[0415] Conclusion:
[0416] The association between GAME25 transcript level and accumulation of .alpha.-tomatine and dehydrotomatine SGAs in the tissues examined suggests a possible role of GAME25 in steroidal glycoalkaloid metabolism.
Example 2
[0417] Characterization of GAME25 as a Short-Chain Dehydrogenases/Reductases Family Member
[0418] Objective:
[0419] To characterize GAME25 structurally and functionally.
[0420] Methods:
[0421] Phylogenetic Analysis
[0422] GAME25 and its homologous sequences from various plants were obtained using the BLASTP program (https://blast.ncbi.nlm.nih.gov/Blast.cgi). Additionally, literature search was performed for known SDR family proteins that partake in secondary metabolism among various plant species. Amino acid sequences were aligned using ClustalOmega. The Maximum Likelihood tree was inferred in MEGA6 using 1000 bootstrap replications. Evolutionary distances are in units of number of amino acid substitutions per site. All positions containing gaps and missing data were eliminated. The amino acid sequences used in the phylogenetic analysis are provided in below.
TABLE-US-00048 S. lycopersicum GAME25: (SEQ ID NO: 3) MANKLRLEGKVAIITGAASGIGEASARLFVEHGARVVVADIQDELGQKV VDSIGSDKASYRHCDVTDEKQVEETVAYAVEKYGTLDIMFSNVGTLNFCSVLD MDVLAFDETMAINVRGSALAVKHAAKVMVDKKIRGSIICNASLEGILAGAASL AYIASKHAVVGIIKAAARELGPHGIRVNGVSPYGIATPLVTKAYGLDAALLEEAI YGNGHLKGVKLSTMHVAQSALFLASDESAYTSGQNLAVDGGLSSILKLQ S. pennellii GAME25: (SEQ ID NO: 12) MANKLRLEGKVAIITGAASGIGEASARLFVEHGARVVVADIQDELGQKV VDSIGADKASYRHCDVTDEKQVEETVAYAVEKYGTLDIMFSNVGTLNFCSVLD MDVMAFDETMAINVRGSALAVKHAAKVMVDKKIRGSIICNASLEGILAGAASL AYIASKHAVVGIIKAAARELGPHGIRVNGVSPYGIATPLVCKAYGLDAALLEEAI YGNGHLKGVKLSTMHVAQSALFLASDESAYTSGQNLAVDGGLSSILKLQ S. tuberosum GAME25: (SEQ ID NO: 15) MANKLRLEGKVAIITGAASGIGEASARLFAEHGARIVVADIQDELGLKV VESIGADKASYRHCDVTDEKQVEDTVAYTVEKYGTLDIMFSNVGTLNFCSVLD MDVMVFDKTMAINARGSALAVKHAARFMVDKKIRGSIICNASLDGIVAGATSL AYIASKHAVVGIVKAAARDLGPYGIRVNGVSPYGIATPLVCKAYGLDAGPLEA AIYGNGNLKGVRLSTMHVAQSALFLASDESAYTSGQNLAVDGGLSSILKVQ S. lycopersicum 3.beta.HSD: (SEQ ID NO: 66) MASKLRLEGKVAIITGGASGIGEASARLFVQHGARVVVADIQDELGLQV VQSIGIHKATYRHCDVTDEKQVEDTVAYAVQKYATLDIMFSNVGTLNFCSVLD MDMTAFDETMTVNVRGSALAVKHAARVMVDKKIRGSIICNVSLEGILAGAASL AYIASKHAVVGIVKAAARELGPYGIRVNGVSPYGIATPLVCKAYGLDAAPLEA AINGNANLKGVTLSTMHVAQSALFLASDESAYTSGQNLAVDGGLSSILKLQ S. pennellii 3.beta.HSD: (SEQ ID NO: 67) MASKLRLEGKVAIITGGASGIGEASARLFVQHGARVVVADIQDELGLQV VQSIGIHKATYRHCDVTDEKQVEDTVAYAVQKYATLDVMFSNVGTLNFCSVL DMDMTAFDETMTVNVRGSALAVKHAARVMVDKKIRGSIICNVSLEGILAGAAS LAYIASKHAVVGIVKAAARELGPYGIRVNGVSPYGIATPLVCKAYGLDAAPLEA AINGNANLKGVTLSTMHVAQSALFLASDESAYTSGQNLAVDGGLSSILKLQ C. annuum 3.beta.HSD: (SEQ ID NO: 68) LEGKVAVITGAASGIGEASARLFVEHGARVVIADIQDELGLQIAASIGTD KASYIHCDVTDEKQVEEAVAYAVENSVLDLDVKAFDETMVINARGSAVAVKH AARVMVEKKIRGSIICTASLEGILAGAASLAYVSSKHAVVGLVKAAARELGVH GIRVNGVSPYGIATPLVCKAYGLDAGPLETAIYGNAHLKGVTLSTMHVAQAAL FLASDESAYISGQNLAVDGGLSSILKLE N. benthamiana 3.beta.HSD: (SEQ ID NO: 69) MANKLRLEGKVAVITGGASGIGEATARLFVEHGARVVIADIQDELGLQV VASIGTDKASYRHCDVTDENKVEETVAYAVEKYGTLDIMFSNVGTLNFCSVLD IDVTAFDKTMALNVRGTALAVKHAARVMVAKQVKGSIICNASIEAILAGAASL AYVASKHAVVGIVKAAARELGLHGIRVNGVSPYGIATPLVCKAYGCEDAASLE AGISVNAHLKGVTLSTEHIAQAALFLASDESAYISGHNLAVDGGLTSMLKLSY S. melongena ADH1: (SEQ ID NO: 70) MANKLKLEGKVAVITGGASGIGEESARLFVEHGARVVIADIQDDLGLEV VTSIGADKACYRHCDVSEEKQVKETVAYAVEKYGTLDIMFSNAGTLGTLGSVL EMDMTAFDMTMAVNMRGSALAVKHAARVMVANKIRGSIICTASVEAILAGAA PLAYVASKHAILGVMKAAARELGQYGIRVNCVSPYGIATPLVCKAYHSDAGSL EASIYERAHLKGITLSTKHIANASLFLASDESAYVSGHNLAVDGALSSIMS C. annuum ADH1: (SEQ ID NO: 71) MIFFFCGTRLEGKIAIITGAASGIGEASARLFVEHGAHVIIADIQDELGLQV VSSIGTDKACYRHCDVTDEKQVEETVAYAVEKYGTLDIMFSNAGMLGTFGSLL DMDVKEFDLTIAVNTRGAALAVKHAARVMVAKNIRGSIICTASVESILAGAAPL AYIASKHGILGVVKAAARELGKNGIRVNCVSPFGIATPMVCKSYGAEASYIETS VGGHANLKGVSLTTKHIAEAALFLASEESAYISGQNLAVDGGLSAIMRLD S. melongena ADH2: (SEQ ID NO: 72) MANKLRLEGKVAVITGGASGIGEASARLFVEHGARVVIADIQDELSLQV VSSIGGDKACYRRCDVSDEKQVEETVAYAVEKYGTLDIMFSNAGILGSFGSLLE MDMTAFDRIMAVNTRGAALAVKHAARVMVANKIRGSIICTASVEAILAGEASL AYIASKHAILGVVKAAARDLGQYGIRVNCVSPYGIATPMVCKSIGADAATIEAR ICGNANLKGVSLNTKHIAEAALFLGSDESAYVSAHNLAVDGGLSSIMKLN S. tuberosum ADH1: (SEQ ID NO: 73) MANKLRLEGKVAVITGGASGIGEATARLFVEHGAHVVIADIQDELALQV VSSIGSDNVCYRRCDVTDEKQVDETVAFAVQKYGTLDIMFSNAGILGSSGSLLE MDMAVFDRTMAVNTRGAALAVKHAAKVMVAKKIRGSIICTASVESILAGAAS LAYIASKHAVLGVVKAAARELGQHGIRVNCVSPFGVATPMVCKSFGADAAAM EATIRGNANLKGVSLTTMHIAEAALFLASDESAYISAHNLAIDGGLSSIMKINVN S. lycopersicum ADH1: (SEQ ID NO: 74) MANKLRLEGKVAVITGGASGIGEAAARLFVEHGARVVIADIQDELALQV ASSIGSDNVCYQRCDVSDEKQVNETVAFAVEKYGTLDIMFSNAGILNPFESILE MDMTVFDRTIAVNARGAALAVKHAARVMVANKIRGSIICTASVESILAGAAPL AYIASKHAVLGVVKAAARELGQHGIRVNCVSPFGIATPMVCKSFGADAAAIEA KICGNANLKGVSLTTMHIAEAALFLASDESAYISAQNLAVDGGLSSMMKLM S. pennellii ADH1: (SEQ ID NO: 75) MANKLRLEGKVAVITGGASGIGEAAARLFVEHGARVVIADIQDELALQV ASSIGSVNVCCRRCDVSDEKQVNETVAFAVEKYGTLDIMFSNAGILNPFESILEM DMTVFDRTIAVNARGAALAVKHAARVMVANKIRGSIICTASVESILAGAAPLA YIASKHAVLGVVKAAARELGQHGIRVNCVSPFGIATPMVCKSFGADAAAIEAKI CGNANLKGVSLTTMHIAEAALFLASDESAYISAQNLAVDGGLSSMMKLM N. benthamiana ADH1: (SEQ ID NO: 76) MANKRRLEGKVAVITGAASGIGEATARLFVEHGARVVIADIQDELGHQV VASIGTDKASYRHCDVTDEKQVEDTVVYTVEKYGTLDIMFSNAGTIGTLGSILD MDMTVFDRTMAINARGSALAVKHAARVMVTKKIQGSIICTASLEATLAGAAPL AYVTSKHAILGVVKAAARELGQHGIRVNCVSPYGIATPMVCKTFGGDAAPIEAS ISGNANLKGITLSTKHIAEAALFLASDESAYVSAHNLAVDGGLSSIMKLD N. benthamiana ADH2: (SEQ ID NO: 77) MANKLRLEGKVAVITGAASGIGEATARLFVEHGARVVIADIQDELGHQV VASIGTDKASYRHCDVTDEKQVEDTVVYAVEKYGTLDIMFSNAGTIGTLSSILD MDMTVFDRTMAINARGSALAVKHAARIMVTKKIQGSIICTASLEAILAGAAPLA YVASKHAILGVVKAAARELGQHGIRVNCVSPYGIATPMVCKTFGGDAAPIEASI SGNANLKGITLSTKHIAEAALFLASDESAY A. thaliana ADH: (SEQ ID NO: 78) MSGKRLDGKIVIITGGASGIGAESVRLFTEHGARVVIVDVQDELGQNVA VSIGEDKASYYHCDVTNETEVENAVKFTVEKYGKLDVLFSNAGVIEPFVSILDL NLNELDRTIAINLRGTAAFIKHAARAMVEKGIRGSIVCTTSVAAEIAGTAPHGYT TSKHGLLGLIKSASGGLGKYGIRVNGVAPFGVATPLVCNGFKMEPNVVEQNTS ASANLKGIVLKARHVAEAALFLASDESAYVSGQNLAVDGGYSVVKP M. truncatula ADH: (SEQ ID NO: 79) MSRKRLEGKVAIVTGGASGIGAETAKTFVENGAFVVIADINDELGHQVA TSIGLDKVSYHHCDVRDEKQVEETVAFALEKYGTLDIMFSNAGIEGGMSSSILEF DLNEFDNTMAINVRGSLAAIKHAARFMVERKIRGSIICTASVAASVAGNRGHDY VTSKHGLLGLVRSTCGELGAYGIRVNSISPYGVATPLACRALNMEMSKVEANM KDSANLKGITLKATHIAEAALFLASEESAYISGHNLVVDGGFSVINSCVPTTIKK C. annuum ADH2: (SEQ ID NO: 80) MAVVMQKLKGKVAIVTGGASGIGEATVRLFAEHGARAVVIADIQDEKG RAVAESIPLQVCSYVHCDVSDENQVKGLVDWTVKKYGQLDIMFSNAGTVGNS GQKVLDLDLSEFDRVIRVNARGMAACVKHAARAMVEQGGRGSIICTGSVGAS KGAAWRTDYTMSKHAVLGLVTSASRQLGKYGIRVNSISPSAVMTPLMSSAEAE TSMKVLKMYGPLTSLKGITLTVKHLADAVLFLASDDSAFVNGHDLLVDGGLLH LPDPMSSL S. tuberosum ADH2: (SEQ ID NO: 81) MAEVTQKLKGKVAIVTGGASGIGEATARLFAQHGARAVVIADIQDGKG RAVAVSIPSQICSYVQCDVSDENQVKAMVDWTVQKYGQLDIMFSNAGVVGNS GQKVLDLDLSEFDRVMNVNARGMAACVKHAARAMVDKRVRGSIICTGSIGAS RGGAWRTDYIMSKHAVLGLVRSACRQLGEYGIRVNSISPSAVMTPLMISAEPEV SMKSLKRYGPQTSLKGITLTVKHLAEAALFLASDDSAFSSRSNEFIVKQREQPNL SLFFF S. melongena ADH3: (SEQ ID NO: 82) MSAITQKLNGKVAIVTGGASGIGEATVRLFAQHGARAVVIADIQDEKGR AVAQSIPSQICIYVKCDVSDENQVKSMVDWTVQQYGQLDIMFSNAGTVGNSGQ KILDLDLSEFDRVMNVNARGMAACVKHAARAMVEKRVRGSIICTGSIAASRAG AWRTDYAMSKHAVLGLMRSASRQLGEYGIRVNSISPSAVMTPLMISAEAEASM RVLKMYGSVTSLKGITLTVKHLADAVLFLASDDSVFVSGHDLAVDGGLISLPDP MSSL O. sativa MIS2: (SEQ ID NO: 83) MFTAMHRILSRGRRTPAASSSSVTAFATASDSQRLAGKVAVITGGASGIG
RATAEEFVRNGAKVILADVQDDLGHAVAAELGADAASYARCDVTDEAQVAA AVDLAVARHGRLDVVFNNAGIPGDLTPTPVGALDLADFDRVMAVNTRAVVAG VKHAARVMVPRRRGSIICTASTAGVIGGVAVPHYSVSKAAVLGLVRAVAGEM ARSGVRVNAISPNYIWTPMAAVAFARWYPSRSADDHRRIVENDINEMDGVTLE AEDVARAAVFLASDEAKYVNGHNLVVDGGYTVGKVPNMPVPDGH O. sativa MIS3: (SEQ ID NO: 84) MFRAAQLLLRETNRALGAATSPAGFVSGFSTASNSAQRLAGKVAVITGG ASGIGKATAKEFIENGAKVIMADVQDDLGHSTAAELGPDASYTRCDVTDEAQV AAAVDLAVKRHGHLDILYNNAGVMGAMPQDDMASVDLANFDRMMAINARA ALVGIKHAARVMSPRRSGVILCTASDTGVMPMPNIALYAVSKATTIAIVRAAAE PLSRHGLRVNAISPHGTRTPMAMHVLSQMYPGVSKDDLEKMADAAMDAGEV MEPKYVARAALYLASDEAKYVNGHNLVVDGGFTSHKGSDTRLN A. thaliana ABA2: (SEQ ID NO: 85) MSTNTESSSYSSLPSQRLLGKVALITGGATGIGESIVRLFHKHGAKVCIVD LQDDLGGEVCKSLLRGESKETAFFIHGDVRVEDDISNAVDFAVKNFGTLDILIN NAGLCGAPCPDIRNYSLSEFEMTFDVNVKGAFLSMKHAARVMIPEKKGSIVSLC SVGGVVGGVGPHSYVGSKHAVLGLTRSVAAELGQHGIRVNCVSPYAVATKLA LAHLPEEERTEDAFVGFRNFAAANANLKGVELTVDDVANAVLFLASDDSRYIS GDNLMIDGGFTCTNHSFKVFR O. sativa MS3: (SEQ ID NO: 86) MAGSSYGDVHESARKLVGKVALITGGASGIGECTARLFVKHGAQVVVA DIQDEAGARLCAELGSATASYVRCDVTSEDDVAAAVDHAVARYGKLDVMFN NAGIGGAACHSILESTKADFDRVLAVNLTGPFLGTKHAARVMVAAGRGGCIIG TASLASAVAGTASHAYTCAKRALVGLTENAAAELGRHGIRVNCVSPAAAATPL ATGYVGLEGEAFEAAMEAVANLKGVRLRVEDIAAAVLFLASDDARYVSGHNL LIDGGCSIVNPSFGIFKD O. sativa MS1: (SEQ ID NO: 87) MAAGSSHVSADARKLVGKVAVITGGASGIGACTARLFVKHGARVVVA DIQDELGASLVAELGPDASSYVHCDVTNEGDVAAAVDHAVARFGKLDVMFNN AGVSGPPCFRMSECTKEDFERVLAVNLVGPFLGTKHAARVMAPARRGSIISTAS LSSSVSGAASHAYTTSKHALVGFTENAAGELGRHGIRVNCVSPAGVATPLARA AMGMDDEAIEAIMANSANLKGAGALKADDIAAAALFLASDDGRYVSGQNLRV DGGLSVVNSSFGFFRD O. sativa MS2: (SEQ ID NO: 88) MAGSSHVSADARKLVGKVAVITGGASGIGACTARLFVKHGARVVVADI QDELGASLVAELGPDASSYVHCDVTNEGDVAAAVDHAVATFGKLDVMFNNA GVTGPPCFRITESTKEDFERVLAVNLIGPFLGTKHAARVMAPARRGSIISTASLSS SVSGTASHAYTTSKRALVGFTENAAGELGRHGIRVNCVSPAAVATPLARAAMG MDMDDETIEAIMEKSANLKGVGLKVDDIAAAALFLASDDGRYVSGQNLRVDG GVSVVNSSFGFFRD A. thaliana 11/17-.beta.HSD: (SEQ ID NO: 89) MELINDFLNLTAPFFTFFGLCFFLPPFYFFKFLQSIFSTIFSENLYGKVVLIT GASSGIGEQLAYEYACRGACLALTARRKNRLEEVAEIARELGSPNVVTVHADV SKPDDCRRIVDDTITHFGRLDHLVNNAGMTQISMFENIEDITRTKAVLDTNFWG SVYTTRAALPYLRQSNGKIVAMSSSAAWLTAPRMSFYNASKAALLSFFETMRIE LGGDVHITIVTPGYIESELTQGKYFSGEGELIVNQDMRDVQVGPFPVASASGCA KSIVNGVCRKQRYVTEPSWFKVTYLWKVLCPELIEWGCRLLYMTGTGMSEDT ALNKRIMDIPGVRSTLYPESIRTPEIKSD A. thaliana TR: (SEQ ID NO: 90) METDKRWSLAGKTALVTGGTRGIGRAVVEELAKFGAKVHTCSRNQEEL NACLNDWKANGLVVSGSVCDASVRDQREKLIQEASSAFSGKLNILINNVGTNV RKPTVEYSSEEYAKIMSTNLESAFHLSQIAHPLLKASGVGSIVFISSVAGLVHLSS GSIYGATKGALNQLTRNLACEWASDNIRTNCVAPWYIKTSLVETLLEKKEFVEA VVSRTPLGRVGEPEEVSSLVAFLCLPASSYITGQVISVDGGFTVNGFSYAMKP Z. mays SDR: (SEQ ID NO: 91) MDAAAAAASPTSKRIALVTGGNKGIGLETCRQLASRGVRVVLTARNEA RGLEAVERVRCARGDAEVYFHQLDVTDPCSAARLADFVRDQFGRLDILINNAG ISGVHRDPVLSAAVKDKVDGMDVNQRVEWNIKENSKETYEEAVQCMKTNYYG AKLVTEALLPLLQLSSSGRIVNVSSGFGLLRNFNSEDLRKEFEDIDNLTESRLEEL MDKFLEDFKANLVEEHGWPTGGSSAYKVVKAALNAYTRILAKKYPTLRINCLT PGYVKTDISMHMGVLTLEEGARNPVKVALLPDDGPTGAYFDLNGEASFV A. thaliana SR: (SEQ ID NO: 92) MAEETPRLFNGFCRYAVVTGANRGIGFEICRQLASEGIRVVLTSRDENRG LEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIG GIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLS DSPRIVNVSSSMGQLKNVLNEWAKGILSDAENLTEERIDQVINQLLNDFKEGTV KEKNWAKFMSAYVVSKASLNGYTRVLAKKHPEFRVNAVCPGFVKTDMNFKT GVLSVEEGASSPVRLALLPHQETPSGCFFSRKQVSEF P. bracteatum SR: (SEQ ID NO: 93) MPETCPNTVTKMRCAVVTGGNKGIGFEICKQLSSSGIMVVLTCRDVTRG LEAVEKLKNSNHENVVFHQLDVTDPITTMSSLADFIKARFGKLDILVNNAGVAG FSVDADRFKAMISDIGEDSEEVVKIYEKPEAQELMSETYELAEECLKINYYGVK SVTEVLLPLLQLSDSPRIVNVSSSTGSLKYVSNETALEILGDGDALTEERIDMVV NMLLKDFKENLIETNGWPSFGAAYTTSKACLNAYTRVLAKKIPKFQVNCVCPG LVKTEMNYGIGNYTADEGAKHVVRIALFPDDGPSGFFYDCSELSAF Z. mays LCR: (SEQ ID NO: 94) MSTGGRKMRTACVTGGNGYIASALIKVLLEKGYAVKTTVRNPDDMEK NSHLKDLQALGSLEVFRADLDEDGSFDDAVAGCDYAFLVAAPVNLHTKNPEEE MIEPAVRGTLNVMRSCVKAGTVRRVVLTSSAAAVTTRPQLQGDGHVLDEESW SDVEYLRAHKPAGPWGYPVSKVLLEKEASRFAEEHGIGLVTVCPGLTVGAAPA PTARTSVPNCLSLLSGDEAAFAVLDAIESATGCLPLVHVDDVCRAELFAAEEGA AARRYVCCGLNTTVAELARFLADKYPQYGVKTNLLSGERLEKPRVCLSSAKLV KEGFEFRYRTLDDIYDDMVEYGKALGILPDL A. thaliana ACR: (SEQ ID NO: 95) MDQTLTHTGSKKACVIGGTGNLASILIKHLLQSGYKVNTTVRDPENEKK IAHLRKLQELGDLKIFKADLTDEDSFESSFSGCEYIFHVATPINFKSEDPEKDMIK PAIQGVINVLKSCLKSKSVKRVIYTSSAAAVSINNLSGTGIVMNEENWTDVEFLT EEKPFNWGYPISKVLAEKTAWEFAKENKINLVTVIPALIAGNSLLSDPPSSLSLS MSFITGKEMHVTGLKEMQKLSGSISFVHVDDLARAHLFLAEKETASGRYICCAY NTSVPEIADFLIQRYPKYNVLSEFEEGLSIPKLTLSSQKLINEGFRFEYGINEMYD QMIEYFESKGLIKAK P. somniferum NOS: (SEQ ID NO: 96) MHGQKNISERYQKFKEMEGTGKIVCVTGGAGYLASWLIMRLLERGYSV RTTVRSDPKFREDVSHLKALPEATEKLQIFEADLENPESFDDAINGCVGVFLVA QGMNFAEEYTLEKIIKTCVEGTLRILQSCLKSKTVKKVVYTSSADAAMMISNLK AVKEIDETIWSEVDNFISKPEQVIPGLPSYVVSKVLTERACLKFSEEHGLDVVTIL PPLVVGPFITPHPPPSVSIALSIISGDVSMMLGVRLENAVHIDDVALAHIFVFECE KAKGRHICSSVDFPMHDLPKFISENYPEFNVPTDLLKDIEEQEPVHLSSDKLLSM GFQFKYDFAEIFGDAIRCAKEKGFL A. thaliana 4-DFR: (SEQ ID NO: 97) MVREEEEDDNNGGGGERKLPVADETVPSLLDGTGLVCVTGGTGFVAS WLIMRLLQRGYSVRATVRTNPEGNKKDISYLTELPFASERLQIFTADLNEPESFK PAIEGCKAVFHVAHPMDPNSNETEETVTKRTVQGLMGILKSCLDAKTVKRFFY TSSAVTVFYSGKNGGGGGEVDESVWSDVEVFRNQKEKRVSSSYVVSKMAAET AALEFGGKNGLEVVTLVIPLVVGPFISPSLPSSVFISLAMLFGNYKEKYLFDTYN MVHIDDVARAMILLLEKPVAKGRYICSSVEMKIDEVFEFLSTKFPQFQLPSIDLK NYKVEKRMSLSSKKLRSEGFEFKYGAEEIFGGAIRSCQARGFL H. sapiens AKR: (SEQ ID NO: 98) MDPKYQRVELNDGHFMPVLGFGTYAPPEVPRNRAVEVTKLAIEAGFRHI DSAYLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCTFFQPQMVQPALESSL KKLQLDYVDLYLLHFPMALKPGETPLPKDENGKVIFDTVDLSATWEVMEKCK DAGLAKSIGVSNFNCRQLEMILNKPGLKYKPVCNQVECHPYLNQSKLLDFCKS KDIVLVAHSALGTQRHKLWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQL QRGVVVLAKSYNEQRIRENIQVFEFQLTSEDMKVLDGLNRNYRYVVMDFLMD HPDYPFSDEY M. musculus AKR: (SEQ ID NO: 99) MDSKQQTVRLSDGHFIPILGFGTYAPQEVPKSKATEATKIAIDAGFRHIDS ASMYQNEKEVGLAIRSKIADGTVKREDIFYTSKVWCTFHRPELVRVCLEQSLKQ LQLDYVDLYLIHFPMAMKPGENYLPKDENGKLIYDAVDICDTWEAMEKCKDA GLAKSIGVSNFNRRQLEKILKKPGLKYKPVCNQVECHPYLNQGKLLDFCRSKDI VLVAYSALGSHREKQWVDQSSPVLLDNPVLGSMAKKYNRTPALIALRYQLQR GVVVLAKSFSEKRIKENMQVFEFQLTSEDMKVLDDLNKNIRYISGSSFKDHPDF PFWDEY S. lycopersicum AKR2: (SEQ ID NO: 100) MAEATEMPYIELNTGFSIPAVGLGTWQSDPGVVGKAVETAIKMGYRHID CAQIYKNEKEIGEVLSRLFKDGVVKRRELFITSKLWNTNHAPEDVPVALDKTLQ
DLQLEYVDLYLIHWPVSMKPGSVDFKPENLMPTNIPRIWEAMEKVYDSGKARV IGVSNFSTKKLEDLLQVARTPPAVNQVECHPSWQQAKLRELCKSNNVHLSAYS PLGSPGTTWLKSDVLKQPAVISVAEKLGKTPAQVCLRWGIQMGQSVLPKSTHE ARIKENLDVLNWSIPDDLLAKFSEIPQARLLKGASFAHETHGQYRTLEELWDGE S. lycopersicum AKR1: (SEQ ID NO: 101) MTMNLIKQMLVPNVNLNSGHKMPLIGMGTAPSLPEHDQLVSTLIDAIEI GYRHFDTAAVYGSEEALGQAVVEAIQRGLIKSREQVFITSKLWCTETHRHLVLP ALKRTLGRLKMDYLDLYLIHLPVTMKKKVNSKDDEMRVDKEDIIPFDMRGTW EAMEECCRLGLAKSIGVSNFTCTKISQILHYATILPAVNQVEMHVAWRQEKML EFCKEKGIHVSAWSPLGANGLTPWGIHSVMESPVLKDIAIHKRKSVAQVALRW VYEQGASVIVKSFNKERMKENLQILDWELSNEEIAQIQEIPPCTGFNVDMVLVH PNGPYKSANQFWDGEI M. truncatula AKR: (SEQ ID NO: 102) MGSVEIPTKVLTNTSSQLKMPVVGMGSAPDFTCKKDTKDAIIEAIKQGY RHFDTAAAYGSEQALGEALKEAIELGLVTRQDLFVTSKLWVTENHPHLVIPALQ KSLKTLQLDYLDLYLIHWPLSSQPGKFTFPIDVADLLPFDVKGVWESMEEGLKL GLTKAIGVSNFSVKKLENLLSVATILPAVNQVEMNLAWQQKKLREFCNANGIV LTAFSPLRKGASRGPNEVMENDMLKEIADAHGKSVAQISLRWLYEQGVTFVPK SYDKERMNQNLCIFDWSLTKEDHEKIDQIKQNRLIPGPTKPGLNDLYDD P. somniferum COR: (SEQ ID NO: 103) MESNGVPMITLSSGIRMPALGMGTAETMVKGTEREKLAFLKAIEVGYRH FDTAAAYQTEECLGEAIAEALQLGLIKSRDELFITSKLWCADAHADLVLPALQN SLRNLKLDYLDLYLIHHPVSLKPGKFVNEIPKDHILPMDYKSVWAAMEECQTL GFTRAIGVCNFSCKRLQELMETANSPPVVNQVEMSPTLHQKNLREYCKANNIMI TAHSVLGAVGAAWGTNAVMHSKVLHQIAVARGKSVAQVSMRWVYQQGASL VVKSFNEARMKENLKIFDWELTAEDMEKISEIPQSRTSSAAFLLSPTGPFKTEEE FWDEKD A. thaliana AKR: (SEQ ID NO: 104) MSALTFPIGSVHHLMPVLALGTAASPPPEPIVLKRTVLEAIKLGYRHFDTS PRYQTEEPLGEALAEAVSLGLIQSRSELFVTSKLWCADAHGGLVVPAIQRSLETL KLDYLDLYLIHWPVSSKPGKYKFPIEEDDFLPMDYETVWSEMEECQRLGVAKC IGVSNFSCKKLQHILSIAKIPPSVNQVEMSPVWQQRKLRELCKSKGIVVTAYSVL GSRGAFWGTHKIMESDVLKEIAEAKGKTVAQVSMRWAYEEGVSMVVKSFRK DRLEENLKIFDWSLTEEEKQRISTEISQSRIVDGEVYISEKGPIKSVTEMWDGEI D. lanata 3.beta.HSD: (SEQ ID NO: 105) MSSKPRLEGKVAIITGAASGIGEETARLFVEHGASVVVADVQDELGRQV VASVNSDDKISYYHCDVRDEKQVAATVRYAVEKYGRLDIMLSNAGVFGALMT NVIDLDMVDFENVLATNVRGVANTIKHAARAMVEGKVKGSIICTASVSASLGG MGPPAYTASKHAVLGLVKGACAELGVHGIRVNSVAPYGVATPMPCSAYGMTP SQMEEANNSRANLKGVVLKAKHVAEAALFLASDESAYVSGQNLAVDGGFTVV R
[0423] Results:
[0424] Short-chain dehydrogenases/reductases (SDR) represents one of the largest and most diverse NAD(P)(H)-dependent enzyme superfamilies' that have evolved in plants and were recently categorized into 49 sub-families. SDR is over-represented in plants and was recently categorized into sets of 49 sub-families. The 259 amino acid GAME25 protein sequence shows the characteristics of a classical SDR family member containing the TGxxxGxG cofactor binding and the YxxxK catalytic motifs (FIG. 5). The presence of a specific Asp residue (40.sup.th amino acid) indicated the likely preference of GAME25 for NAD.sup.+ over NADP.sup.+ cofactor (FIG. 5). Phylogenetic analysis showed that GAME25 homologs of certain Solanaceae species (i.e. tomato, potato, and Solanum pennellii) form a distinct sub-clade compared to other plant SDRs (FIG. 6). The most related sub-clade next to GAME25 proteins in the phylogenetic tree included 3.beta.-hydroxysteroid dehydrogenase homologs from tomato and Solanum pennellii (3-.beta.HSD, .about.90% amino acid identity with GAME25 sub-clade proteins) that may possibly be involved in plant steroid metabolism. Phylogenetic analysis also suggested that there is no homolog of GAME25 protein in eggplant and capsicum (FIG. 6). Moreover, GAME25 proteins are clearly separated from Digitalis lanata 3-.beta.HSD protein (showing .about.75% amino acid identity with the GAME25 proteins) that is involved in removal of C-5,6 double bond from steroid derivatives during the progesterone and cardenolide biosynthesis (FIG. 6). The distinctiveness of the tomato GAME25 sub-clade suggested unique catalytic capabilities for this sub-clade that is most likely different even from the relatively similar 3-.beta.HSD sub-clade members (FIG. 6).
Methods for Examples 3-9
[0425] Plant Materials
[0426] Tomato (Solanum lycopersicum) cv. Micro Tom, potato (Solanum tuberosum) cv. Desiree and eggplant (Solanum melongena) cv. Tudela plants were grown in a climate-controlled greenhouse at 24.degree. C. during the day and 18.degree. C. during the night, with natural light.
[0427] Analytical Standards
[0428] Analytical standards Tomatidine (the commercial standard of tomatidine also contains dehydrotomatidine as impurity, Sigma-Aldrich), solanidine (ChemFaces), solasodine (ChemFaces), .alpha.-tomatine (the commercial standard of .alpha.-tomatine also contains dehydrotomatine as impurity, Carbosynth USA), .alpha.-solanine (Sigma Aldrich), .alpha.-chaconine (Sigma-Aldrich) and .alpha.-solamargine (ChemFaces), solanid-4-en-3-one (Sigma-Aldrich) and diosgenin (Sigma-Aldrich) were dissolved in methanol at concentration of 1 mg/ml.
[0429] Generation of GAME25 Transgenic Tomato, Potato, Eggplant and S. pennellii Plants
[0430] The GAME25 silencing construct (RNAi, GAME25i) for tomato was generated by introducing a 199 bp 3' UTR fragment to pENTR/D-TOPO (Invitrogen) (by NotI and AscI, Forward primer: GCGGCCGCATTGTCACGCTATTTGTGTTGG (SEQ ID NO: 6), Reverse primer: GGCGCGCCGAAATTTATATCTTTTTAAGTCACAACG (SEQ ID NO: 7) and further cloning of the GAME25 fragment to the pK7GWIWG2 (II) binary vector using the Gateway LR Clonase II enzyme mix (Invitrogen). The GAME25 silencing construct for S. pennellii(Forward primer: GCGGCCGCATTGTCACTCTATTGTGTTGGCGTG (SEQ ID NO: 106), Reverse primer: GGCGCGCCTAAATTTATATCTTTTCAAGTCACAATG (SEQ ID NO: 107) was prepared using the same methods described as above. For the over-expression (GAME25-Ox), corresponding GAME25 coding sequence from tomato and potato was cloned into pDONR221 using the Gateway BP Clonase II enzyme mix (Invitrogen) and then transferred to the pK2GW7 binary vector using Gateway LR Clonase II enzyme mix. Constructs were transformed into tomato cv. Micro Tom, potato, eggplant cv. Tudela and S. pennellii as described previously. Positive transgenic lines were selected by quantitative Real Time--PCR (qPCR) and further used for metabolite analysis.
[0431] Fragment Used for GAME25-RNAi Construction
[0432] The nucleic acid sequence of the GAME25-RNAi construct is set forth in SEQ ID NO: 8.
TABLE-US-00049 (SEQ ID NO: 8) ATTGTCACGCTATTTGTGTTGGCGTGCTGTGGCGTGGGCCTTAATCC TCACTCTCTTGTGTCTGTACTTCTGTTTCATCTCGTTTCGTTTCAAATTTTCA ACTTAATAATACTCTCATATTTTATGCGATATTTTTCAGATTTATACTAAGTT TTTTATAGATATTTTAAACGTTGTGACTTAAAAAGATATAAATTTC
[0433] Plants Extract Preparation and Targeted Profiling of Steroidal Metabolites
[0434] Preparation of extracts and the profiling of steroidal alkaloids (SAs) and steroidal glycoalkaloids (SGAs) in various tomato (leaves, green and red fruit), potato (leaves, tuber skin and flesh), eggplant (leaves), and S. pennellii (leaves) tissues were performed with same methods as described by Itkin et al. (2011) and Cardenas et al. (2016) Nat. Commun. 7:10654. Three biological replicates (n=3) from each genotype were used for metabolic analysis (e.g. #2, #3 and #4 are three independent GAME25-RNAi transgenic lines and each transgenic line represents three biological samples collected from three different plants). Briefly, 100 mg frozen powder of plant tissue was extracted with 80% methanol and 0.1% formic acid, and followed by brief vortex and sonication for 20 min at room temperature. Finally, the extracts were centrifuged for 15 min at 14,000.times.g and filtered through 0.22 .mu.m filters.
[0435] Samples were analyzed using a high-resolution UPLC/qTOF system comprised of a UPLC (Waters Acquity) connected to a qTOF detector (tandem quadrupole/time-of-flight mass spectrometer, Waters). Separation of metabolites was performed on the 100.times.2.1-mm i.d., 1.7-um UPLC BEH C18 column (Waters Acquity). The mobile phase consisted of 0.1% formic acid in acetonitrile:water (5:95, v/v; phase A) and 0.1% formic acid in acetonitrile (phase B). The following linear gradient was used for steroidal alkaloids analysis and for the enzyme assays products: from 100 to 72% phase A over 22 min, from 72 to 0% phase A over 14 min, then held at 100% phase B for further 2 min; and then returned to the initial conditions (100% phase A) in 0.5 min and conditioning at 100% phase A for 1.5 min. For the separation of GAME25 enzyme assay product with dehydrotomatidine as a substrate, that is tomatid-4-en-3-one a different, shorter linear gradient was used: from 75 to 55% phase A over 10.5 min, from 55 to 0% phase A over 0.5 min, then held at 100% phase B for further 1.5 min; and then returned to the initial conditions (75% phase A) in 0.5 min and conditioning at 75% phase A for 1 min. The flow rate was 0.3 mL/min, and the column temperature was kept at 35.degree. C. Masses of the eluted compounds were detected with two different qTOF detectors, equipped with an electrospray ionization source (ESI): either with a XEVO MS or with Synapt HDMS. The following settings were used for XEVO MS: capillary--1 kV; cone--27 V; source temperature was set to 140.degree. C., desolvation--400.degree. C., desolvation gas flow--800 Uh. The following settings were used for Synapt HDMS: capillary--3.4 kV; cone--24 V; source temperature was set to 125.degree. C., desolvation--275.degree. C., desolvation gas flow--650 L/h. Argon was used as a collision gas. ESI was used in positive ionization mode at the m/z range from 50 to 1600 Da. The MS system was calibrated using sodium formate, and Leu enkephalin was used as the lock mass. MassLynx software version 4.1 (Waters) was used to control the instrument and calculate accurate masses and elemental compositions. In addition, a mixture of 15 standard metabolites, injected after each 10 samples, was used for quality control. For steroidal alkaloids analysis, data acquisition was performed in the MS.sup.E mode with energy ramp that records an exact mass precursor and fragment ion information from every detectable component in a sample. MS.sup.E mode rapidly alternates between two functions: the first acquiring low-energy exact mass precursor ion spectra and the second acquiring elevated-energy exact mass fragment ion spectra. The collision energy was set to 4 eV for low-energy function, and for the high-energy function the collision energy was set either to 10-30 eV ramp for Synapt HDMS, or 15-45 eV for XEVO MS. Metabolites were identified using standard compounds (see the Analytical Standards section above) by comparison of their retention times and mass fragments. When the corresponding standards were not available, compounds were putatively identified by comparing their retention times, elemental composition and fragmentation pattern with those described in literature (see Itkin et al. (2011); Wu et al. (2013); Schwahn et al. (2015)). Relative quantification of the compounds was carried out using TargetLynx.TM. (Waters), which is a targeted analysis application.
[0436] For enzyme assay experiments, an additional MS-MS analysis with a collision energy ramp from 20 to 50 eV was performed to identify the structures of the enzymatic reaction products. The solanid-4-en-3-one product was identified based on the comparison of its retention time and MS-MS spectrum to those measured for its corresponding standard. Another three products (tomatid-4-en-3-one, solasod-4-en-3-one and diosgen-4-en-3-one) were putatively assigned as follows: first, elemental composition based on accurate masses and the isotopic pattern was calculated using the MassLynx software. Then the MS-MS fragmentation pattern was analyzed, and the fragments were assigned applying the fragmentation rules for steroid-based compounds.
[0437] Quantitative Real-Time PCR Analysis
[0438] Total RNA was isolated from wild type and transgenic tomato lines (leaf, green fruit, breaker fruit and red ripe fruit), transgenic potato (leaves, tuber skin and flesh), transgenic eggplant (leaves) and transgenic S. pennellii leaves with three biological replicates (n=3) using the Trizol method (Sigma-Aldrich). Three biological replicates (for each genotype) denote three separate tissue samples obtained from three different plants. DNase I (Sigma-Aldrich)-treated RNA was reverse transcribed using a high-capacity cDNA reverse transcription kit (Applied Biosystems). Gene-specific oligonucleotides were designed with the Primer Express 3 software (Applied Biosystems). The TIP41 gene was used as a reference gene for tomato and S. pennellii samples and the NAC gene was used as an endogenous control for potato. For eggplant, the cyclophilin gene was used as a reference for Real Time PCR analysis.
Example 3
[0439] Tomato Steroidal Glycoalkaloid Metabolism is Re-Routed from the Native, Predominant Saturated .alpha.-Tomatine Branch to the Unsaturated Dehydrotomatine Branch in GAME25-Silenced Leaves
[0440] Objective:
[0441] To determine the role of GAME25 in SGA metabolism.
[0442] Results:
[0443] 3 independent GAME25-RNAi transgenic tomato lines (#2, #3 and #4) were generated as described above. GAME25 transcript level was significantly reduced in GAME25i leaves and various fruit tissues of developmental stages (green, breaker and red ripe fruit) (FIG. 7). GAME25-RNAi leaves showed significant reduction in .alpha.-tomatine (.about.2.5-3 fold), hydroxytomatine (.about.6-10 fold), acetoxytomatine (.about.2.5-3 fold), and .alpha.-tomatine isomers (1 and 2; .about.3-4 fold) compared to wild-type leaves (FIG. 8). On the other hand, dehydrotomatine (.about.4-6 fold), dehydrotomatine isomer 1 (.about.9-11 fold) and dehyrotomatidine+4 hexose (.about.6-9 fold) were increased considerably compared to wild-type leaves (FIG. 8 and FIG. 9).
[0444] Conclusion:
[0445] Reduction in .alpha.-tomatine and its downstream metabolite levels, yet, accumulation of dehydrotomatine and its isomers in GAME25i lines suggest that either (i) GAME25 is involved in .alpha.-tomatine biosynthesis directly from the dehydrotomatine glycoside or (ii) it mediates tomatidine biosynthesis from dehydrotomatidine (also called tomatidenol)
[0446] No significant accumulation of dehydrotomatidine (tomatidenol), which is a dehydrotomatine precursor, was observed in GAME25i lines. This SGA appeared to be converted to its glycosylated derivative, dehydrotomatine that actually did show a major accumulation (FIGS. 1A-1C, and FIG. 8). The accumulation of dehyrotomatidine+4 hexoses metabolite derived from dehydrotomatidine (FIGS. 1A-1C, and FIG. 8) after GAME25 silencing indicate a role of GAME25 upstream of the SA aglycone glycosylation steps in SGA biosynthesis. Hence, it is hereby proposed that GAME25 is involved in the conversion dehydrotomatidine to tomatidine, rather than acting on dehydrotomatine.
[0447] Subsequent in vitro enzyme assays confirmed that GAME25 could not act on glycosylated SAs (e.g. dehydrotomatine) Similar to the cultivated species, silencing of GAME25 in the wild tomato species, S. pennellii also resulted in reduced tomatine derived alkaloids levels, as .alpha.-tomatine and acetoxytomatine, while dehydro-alkaloids were enriched, i.e. dehydrotomatine and acetoxy-dehydrotomatine (FIG. 10).
Example 4
GAME25-Silencing Results in Gradual Loss of Saturated SGAs in Developing and Ripening Tomato Fruit and has a Major Impact on SGAs in Tomato Green Fruit
[0448] Objective:
[0449] Observe the SGA profile in tomato green fruit when GAME25 expression is altered.
[0450] Results:
[0451] The SGAs profile of green fruit of GAME25i lines was compared to wild-type green fruits. During the transition from green to red fruit in tomato, .alpha.-tomatine is converted to esculeosides and lycoperosides (saturated SGAs), while dehydrotomatine is converted to dehydroesculeosides and dehydrolycoperosides (unsaturated SGAs) (FIGS. 1A-1C). Esculeoside A and its derivatives are the major SGAs found in tomato red ripe fruit, while dehydroesculeosides and dehydrolycoperosides are minor SGAs found in this tissue. GAME25i green fruits displayed drastic reduction in levels of .alpha.-tomatine (.about.15-25 fold), hydroxytomatine (.about.100 fold), acetoxytomatine (.about.30 fold), acetoxy-hydroxytomatine (.about.50 fold), .alpha.-tomatine isomer (1 and 2) and complete absence of tomatidine+4 hexose as compared to wild-type (FIGS. 11A-11B). Thus, .alpha.-tomatine and its downstream saturated SGA intermediates were severely affected in green fruit tissue due to GAME25 silencing.
[0452] In contrast, unsaturated SGAs as dehydrotomatine (.about.10-12 fold), hydroxy-dehydrotomatine (.about.25 fold), dehydrotomatine isomer (1 and 2), acetoxy-dehydrotomatine (.about.12-15 fold), acetoxy-hydroxy-dehydrotomatine (.about.6-8 fold) and dehydrotomatidine+4 hexose (.about.12-18 fold) were increased significantly compared to wild-type suggesting redirection of the flux towards unsaturated dehydro-SGAs due to GAME25 silencing (FIGS. 11B-11C).
[0453] Conclusion:
[0454] Silencing of GAME25 diverted metabolic flux from the .alpha.-tomatine derived pathway to the dehydrotomatine dependent SGAs branch.
Example 5
[0455] GAME25i Breaker Fruit Accumulates Dehydrotomatine Derived SGAs
[0456] Objective:
[0457] To determine the SGAs in GAME25i breaker fruit.
[0458] Results:
[0459] SGAs analysis was performed in breaker fruits from GAME25i lines and compared to wild-type breaker fruits. The metabolic flux from .alpha.-tomatine to the dehydro-SGAs pathway was further extended to dehydrotomatine and additional downstream SGAs. SGAs metabolites accumulated following GAME25-silencing included hydroxy-dehydrotomatine (.about.20-30 fold), acetoxy-dehydrotomatine (.about.7-15 folds), acetoxy-hydroxy-dehydrotomatine (.about.20-25 fold) as well as dehydroesculeoside A (.about.20-25 fold) and its derivatives (FIGS. 11D-11E). On the other hand, tomatine derived SGAs including hydroxytomatine, acetoxytomatine, acetoxy-hydroxytomatine and esculeoside A, were almost non-existent in GAME25i lines (FIGS. 11E-11F).
Example 6
[0460] Dehydroesculeoside A, is the Predominant SGA in GAME25i Red Ripe Fruit
[0461] Objective:
[0462] To determine the SGAs in GAME25i red ripe fruit.
[0463] Results:
[0464] Esculeoside A and its derivatives are the predominant SGAs found in wild-type tomato red ripe fruits. The drastic reduction in .alpha.-tomatine levels at the green stage fruit in GAME25i lines resulted in severe decline of esculeoside A and lycoperosides (.about.20-25 folds) in red ripe fruit stage (FIG. 11G). On the other hand, the significant accumulation of dehydrotomatine in green fruit in GAME25i lines resulted in a massive accumulation of dehydroesculeoside A (.about.20-25) and derivatives in red ripe fruit (FIGS. 11G-11I), providing additional evidence regarding the role of GAME25 in the early divergence of the saturated (.alpha.-tomatine) and unsaturated (dehydrotomatine) SGA biosynthesis branches. It appeared that GAME25 silencing did not affect expression of core SGA biosynthesis genes including GAME4 and GAME12 involved in the formation of the dehydrotomatidine aglycone and GAME1, GAME17 and GAME18 performing the glycosylation of the SA-aglycones (FIG. 12).
Example 7
GAME25 Over-Expression in Tomato Resulted in the Accumulation of Saturated .alpha.-Tomatine and its Downstream SGAs
[0465] Objective:
[0466] To examine the role of GAME25 in SGA biosynthesis.
Results:
[0467] 3 independent transgenic tomato lines over-expressing GAME25 (GAME25-Ox; lines #91, #92 and #93) were generated as described above. GAME25 expression in leaves and fruit tissues (green and red fruit) of transgenic tomato lines was significantly higher than in wild-type tomato plants as determined by qRT PCR (FIG. 13A). In leaves of GAME25-Ox lines, levels of .alpha.-tomatine, .alpha.-tomatine (isomer 2) and acetoxytomatine increased significantly with simultaneous reduction of dehydrotomatine compared to wild-type leaves (FIGS. 13B-13C). GAME25-Ox tomato green fruits displayed a significant reduction in dehydrotomatine levels, whereas no change in .alpha.-tomatine content was observed in the same tissues (FIG. 13D). However, significant increase in acetoxytomatine and acetoxy-hydroxytomatine (.alpha.-tomatine derived SGAs) was detected when compared to wild-type green fruits (FIG. 13D). Analysis of red fruit derived from GAME25-Ox lines clearly showed accumulation of .alpha.-tomatine (.about.4-6 fold) and its downstream saturated derivatives (i.e. hydroxytomatine (.about.2-3 fold), acetoxytomatine (.about.5-7 fold), and acetoxy-hydroxytomatine (.about.2-3 fold)) (FIG. 13E). Yet, red fruit of the GAME25-Ox plants did not show a change in esculeoside A content suggesting that the glycosylation step of the SGA steroidal backbone (likely of acetoxy-hydroxytomatine) is a limiting factor (FIGS. 1A-1C, and 13E).
Example 8
[0468] Tomato GAME25 Overexpression in Cultivated Eggplant Results in Newly Produced Saturated SGAs and Steroidal Saponins
[0469] Unlike tomato, saturated SGAs (without C5,6-double bond) are normally not present in cultivated eggplant suggesting the absence of GAME25 activity in this species. This is further supported by the absence of a GAME25 homolog in eggplant as observed in phylogenetic analysis of GAME25 proteins (FIG. 6). In cultivated eggplant (wild type), .alpha.-solasonine [m/z 884.5, M+H.sup.+], .alpha.-solamargine [m/z 868.5, M+H.sup.+] and malonyl-solamargine [m/z 954.5, M+H.sup.+] are the major unsaturated SGAs (with C-5,6 double bond) derived from the solasodine aglycone (FIG. 14). Moreover, cultivated eggplant also produces unsaturated furostanol type steroidal saponin glycosides [m/z 1031.5, (M+H.sup.+-H.sub.2O).sup.+ and m/z 1117.5, (M+H.sup.+-H.sub.2O).sup.+] from unsaturated furostanol type saponin aglycone (FIG. 14). Henceforth, the impact of tomato GAME25 activity in eggplant was examined in order to see whether GAME25 can shift SGA metabolism in eggplant from predominant unsaturated SGA branch to normally not occurring saturated SGA branch. Transgenic eggplant lines were generated overexpressing the tomato GAME25 gene (#E1 and #E2 are two independent transgenic eggplant lines; FIG. 15). Surprisingly, in eggplant leaves, GAME25 overexpression resulted in reduction of the unsaturated .alpha.-solasonine, .alpha.-solamargine, malonyl-solamargine SGAs as well as unsaturated furostanol saponin glycosides (FIG. 14). Conversely, major accumulation of .beta.-soladulcine [m/z 886.5, M+H.sup.+], soladulcine A [m/z 870.5, M+H.sup.+] and saturated form of malonyl-solamargine [m/z 956.5, M+H.sup.+] (FIG. 14) was observed in GAME25-Ox eggplant leaves. Both .beta.-soladulcine and soladulcine A (lacking the C-5,6 double bond) are SGAs derived from the saturated soladulcidine aglycone and are typically found in S. dulcamara (FIG. 3A). Thus, S. dulcamara must have an active GAME25 homolog that mediates the formation of above mentioned saturated SGAs. Surprisingly, saturated furostanol type steroidal saponin glycosides (m/z 1033.5, (M+H.sup.+-H.sub.2O).sup.+ and m/z 1119.5, (M+H.sup.+-H.sub.2O).sup.+ in FIG. 14) were also found in GAME25 overexpressing transgenic eggplant lines that were completely absent in wild type. Thus, tomato GAME25 drives the formation of saturated soladulcidine (SA aglycone) from solasodine and saturated saponin aglycone from unsaturated ones respectively in eggplant that further produce their respective glycosylated forms.
[0470] The chemical structures of unsaturated and saturated, SGAs as well unsaturated and saturated steroidal saponins metabolites identified here are provided in FIGS. 16A-16E. The identification of metabolites was based on Mass fragmentation pattern. Loss of C-3 sugar moieties in unsaturated SGAs led to the formation of the fragment ion with m/z 414.3 that corresponds to unsaturated steroidal aglycone backbone (FIG. 16F). Further loss of E and F ring in unsaturated steroidal backbone resulted in the fragment ion m/z 271.2 which further produced ion with m/z 253.19 after dehydration (FIG. 16F, upper panel). On the other hand, due to absence of C-5,6 double bond, saturated SGAs formed the fragment ion with m/z 416.3 corresponding to saturated steroidal aglycone that further produced the fragment ions m/z 273.2 and 255.2 after loss of E/F rings and dehydration respectively (FIG. 16F, upper panel) Similarly, unsaturated furostanol type steroidal saponins showed m/z 415.3, 271.2 and 253.19 fragment ions whereas saturated furostanol type steroidal saponins displayed m/z 417.3, 273.2 and 255.2 fragment ions after MS-fragmentation analysis (FIG. 16F, lower panel).
[0471] In tomato, it is hereby predicted that GAME25 catalyzes conversion of unsaturated dehydrotomatidine aglycone to saturated tomatidine aglycone. As tomato GAME25 induces the formation of saturated SGAs (e.g. .beta.-soladulcine and soladulcine A) from solasodine aglycone as well as saturated saponins from unsaturated furostanol saponin aglycone in eggplant, it is possible that GAME25 might have broad preference for unsaturated SA aglycone and saponin substrates in Solanum plants.
Example 9
[0472] GAME25 Overexpression Results in Reduced Levels of .alpha.-Solanine and .alpha.-Chaconine, the Major SGAs in Potato
[0473] Objective:
[0474] To examine the impact of GAME25 activity on SGAs metabolism in potato.
[0475] Results:
[0476] Potato plants overexpressing GAME25 (GAME25-Ox) were generated as described above (FIG. 17A). The pathway from the aglycone solanidine to demissidine and its glycosylated form (i.e. demissine) in potato corresponds to the tomato pathway in which the C-5,6 double bond is eliminated from dehydrotomatidine towards tomatidine and the glycosylated .alpha.-tomatine (FIGS. 2A and 2B). While .alpha.-tomatine and its derivatives accumulate to high levels in tomato, the domesticated potato does not accumulate demissidine or demissine SGAs in any plant part (while wild potato species do). In contrast to tomato, the potato GAME25 showed very low expression in green and vegetative potato tissues. Yet, a GAME25 transcript is abundant in various potato tuber tissues (i.e. skin and cortex).
[0477] Over-expression of GAME25 in potato leaves resulted in a significant reduction in levels of .alpha.-solanine and .alpha.-chaconine, the major SGAs in potato (FIG. 17B). Yet, accumulation of demissidine or demissine was not detected in these leaves. Moreover, analysis of tuber skin tissue in GAME25-Ox potato plants showed no accumulation of demissidine or demissine along with no major change in .alpha.-solanine and .alpha.-chaconine SGAs (FIG. 17C).
Example 10
[0478] Functional Characterization of the S. lycopersicum GAME25 Encoded Recombinant Enzyme Produced in Sf9 Insect Cells and E. coli
[0479] Objective:
[0480] To functionally characterize the enzyme activity encoded by GAME25.
[0481] Methods:
[0482] The recombinant tomato and potato GAME25 enzymes were produced in Sf9 insect cells and examined for activity with dehydrotomatidine, solanidine and solasodine as substrates (the major SGAs aglycones in tomato, potato and eggplant, respectively).
[0483] Heterologous Expression of the S. lycopersicum GAME25 Encoded Enzyme in Baculovirus Infected Sf9 Insect Cells
[0484] The GAME25 gene was cloned into the pVL1393 baculovirus expression vector using the following primers.
TABLE-US-00050 GAME25 baculo Forward primer: (SEQ ID NO: 9) CCCGGGATGGCAAATAAGCTCAGGTTGG. GAME25 baculo Reverse primer: (SEQ ID NO: 10) TCTAGATTACAGATCTTCTTCAGAAATAAGTTTTTGTTCTTGTAGCTTCAAA ATAGAACTTAGTCC.
[0485] Each expression vector construct was co-transfected with the ProGreen GFP linearized baculovirus DNA (AB vector) to generate the recombinant viruses in Spodoptera frugiperda (Sf9) insect cells. Infection efficiency was monitored by fluorescence of recombinant GFP viruses infected cells. Sf9 cells were grown in ESF921, protein free culture medium (Expression Systems). Three days post-infection cells were collected and washed twice in PBS. Microsomal fractions were isolated by suspending the cell pellet in 20 mM potassium phosphate buffer pH 7.25, 20% (v/v) glycerol, 1 mM EDTA and 1 mM DTT. The resuspended cells were sonicated, and the cell debris was removed by centrifugation at 10,000.times.g for 15 min. The supernatant was further centrifuged at 100,000.times.g for 60 min. The pellet containing the microsomal fractions was homogenized in lysis buffer. GAME25 was expressed with a myc-tag at the C-terminus. The isolated microsomal fractions were analyzed by SDS-PAGE and immune-blot with c-myc antibodies (A2S Technologies Ltd.).
[0486] GAME25 and GAME35 Expression in E. coli BL21 (DE3) Cells and their Protein Purification
[0487] GAME25 and GAME35 genes were cloned into pET28 vector separately and expressed in E. coli BL21 (DE3). Bacterial cells were grown in LB medium at 37.degree. C. When cultures reached A600=0.6, protein expression was induced with 200 .mu.M of isopropyl-1-thio-.beta.-d-galactopyranoside (IPTG) at 15.degree. C. for 24 h. Bacterial cells were lysed by sonication in 50 mM Tris-HCl pH 7.5, 500 mM NaCl, 1 mM PMSF and protease inhibitor cocktail (Calbiochem). An aliquot of whole cell extract was kept for further analysis. Soluble protein was purified using Ni-NTA agarose beads (Adar Biotech) and eluted with 500 mM imidazole in buffer containing 50 mM NaH.sub.2PO.sub.4 pH-7.5 and 300 mM NaCl. The whole cell extract and the eluted fractions were analyzed by SDS-PAGE staining with InstatBlue and by Western blot with HRP conjugated anti-His antibodies (Sigma).
[0488] In Vitro Assays of the Recombinant GAME25 Enzyme(s) Expressed in Insect Cells
[0489] The steroidal alkaloid aglycones dehydrotomatidine, solanidine and solasodine as well as their glycosylated forms (i.e. SGAs) .alpha.-tomatine, .alpha.-solanine, .alpha.-chaconine and .alpha.-solamargine were used as substrates for GAME25 enzyme assays. In vitro assays for the tomato and potato recombinant GAME25 enzymes were performed as follows: Briefly, microsomal fractions of Sf9 cells expressing tomato or potato GAME25 proteins (0.2 mg total protein was used per reaction) were separately incubated in sodium phosphate buffer (pH 7.4) with 100 .mu.M of each individual substrate (details are mentioned above), DTT (5 mM) and NAD.sup.+ (150 .mu.M) at 37.degree. C. for 4 hrs. The reactions were stopped by addition of 300 .mu.l of 80% methanol and 0.1% formic acid, followed by brief vortex and sonication for 15 min. Finally, the extracts were centrifuged for 15 min at 14,000.times.g, filtered through 0.22 .mu.m filters, and analyzed by LC-MS (see Plant extracts preparation and targeted profiling of steroidal metabolites section above). Sf9 cells (without the baculovirus vector) microsomes were used in control enzyme reactions.
[0490] In Vitro Assays of the Recombinant Tomato GAME25 Enzyme Expressed in E. coli
[0491] Assay for purified recombinant tomato GAME25 enzyme (5 .mu.g) from E. coli cells using solanidine (steroidal alkaloid aglycone) and diosgenin (steroidal saponin aglycone) substrates was performed under standard assay conditions similarly as described above.
[0492] In Vitro Assays of the Recombinant Tomato GAME25 Enzyme Expressed in E. coli
[0493] Assay for purified recombinant tomato GAME25 enzyme (5 .mu.g) from E. coli cells using solanidine (steroidal alkaloid aglycone) and diosgenin (steroidal saponin aglycone) substrates was performed under standard assay conditions similarly as described above.
[0494] GAME35 Enzyme Assay
[0495] Purified GAME35 protein (5 .mu.g) was incubated with solanid-4-en-3-one substrate (150 .mu.M), DTT (1 mM), NADH or NADPH (500 .mu.M) in sodium phosphate buffer (pH 7.4) at 30.degree. C. for 3 hrs. The reactions were stopped by addition of 250 .mu.l of 80% methanol and 0.1% formic acid, and followed by brief vortex and sonication for 15 min. Finally, the extracts were centrifuged for 10 min at 13,000.times.g and filtered through 0.22 .mu.m filters, and analyzed by LC-MS, as described in the section above (plant extracts preparation and targeted profiling of steroidal metabolites). Fractions from pET28 vector (empty) transformed into BL21 (DE3) cells was used as a control in enzyme reaction.
[0496] Results:
[0497] The suggested role of GAME25 in conversion of dehydrotomatidine to tomatidine was examined by expressing the recombinant tomato and potato enzymes in sf9 insect cells and testing microsomal fractions for activity with dehydrotomatidine, solanidine and solasodine (SA aglycones) as substrates respectively. The expression of potato and tomato GAME25 recombinant proteins in sf9 cell microsomes was confirmed by western blot using c-myc antibody (FIGS. 18A and 18B). Enzymatic assays were performed in the presence of NAD.sup.+ as a cofactor. Assays with either tomato or potato recombinant GAME25 did not result in the formation of tomatidine, demissidine and soladulcidine (saturated steroidal alkaloid aglycones), the expected reaction products. However, assay of both recombinant GAME25 enzymes with dehydrotomatidine (m/z 414.3, M+H.sup.+) resulted in the formation of a novel compound with the mass m/z 412.3 (M+H.sup.+) in tomato (FIGS. 19A and 19B) and potato (FIGS. 19C and 19D) GAME25 assay. To identify the newly formed compounds, MS-MS fragmentation pattern analysis was employed (FIGS. 19A, 19B and 19E). The observed fragmentation pattern contains three major fragment ions from 2 parallel fragmentation routes. Loss of the carbonyl-oxygen and formation of an additional double bond leads to the fragment ion with m/z 394.3. Loss of the E and F ring of the steroidal skeleton leads to the fragment ion m/z 269.2 which afterwards gets dehydrated to form fragment m/z 251.17 (FIG. 19E). In conclusion, the newly formed compound was putatively assigned as tomatid-4-en-3-one.
[0498] Using solanidine as a substrate (M+H.sup.+, m/z 398.3), GAME25 enzyme assay (with both tomato and potato GAME25 enzymes) led to formation of a new product with an apparent molecular ion of m/z 396.3 (M+H.sup.+). This product was identified as solanid-4-en-3-one by comparing retention time and mass spectrum to the authentic commercially available solanid-4-en-3-one standard both for tomato GAME25 (FIGS. 19F-19H) and for tomato GAME25 (FIGS. 17B, 19I, and 19J) assay. The recombinant GAME25 enzymes (both from tomato and potato) were also able to convert solasodine, the eggplant aglycone (M+H.sup.+, m/z 414.3) to the putative solasod-4-en-3-one compound (M+H.sup.+, m/z 412.3) identified based on MS-MS fragmentation pattern analysis similarly as described above for assignment of tomadid-4-en-3-one for potato GAME25 (FIGS. 19K and 19L) and for tomato GAME25 (FIG. 20A-20D) assay.
[0499] Tomato and potato recombinant GAME25 enzymes were also tested with glycosylated SAs; .alpha.-tomatine, dehydrotomatine, .alpha.-solanine, .alpha.-chaconine and .alpha.-solamargine, however, no activity was observed with these substrates. These results suggest that GAME25 catalyzes the oxidation of the 3.beta.-hydroxyl group (3.beta.-hydroxysteroid dehydrogenase activity) and the isomerization of double bond from the C-5,6 to the C-4,5 position (3-oxosteroid .DELTA..sup.5,4 isomerase activity) in SA aglycone substrates to form the 3-oxo-.DELTA..sup.5,4 SA aglycone intermediates that have been identified here (tomatid-4-en-3-one, solanid-4-en-3-one and solasod-4-en-3-one) (FIGS. 19B, 19D, 19E, 19G, 19J, 19L, and 20B-20D). Furthermore, these results show that GAME25 has activity on various SA aglycones and possibly possesses a novel 3.beta.-hydroxysteroid dehydrogenase/.DELTA..sup.5,4 isomerase activity.
[0500] The observed 3.beta.-hydroxysteroid dehydrogenase/.DELTA..sup.5,4 isomerase activity for tomato and potato recombinant GAME25 enzymes is rather uncommon since other SDR family enzymes partaking in secondary metabolism typically possess 3.beta.-hydroxysteroid dehydrogenase activity only. For example, in Digitalis, the oxidation (3.beta.-hydroxyl group) and isomerization (C-5,6 to the C-4,5 position) steps which are required during the conversion of pregnenolone to progesterone are carried out successively by two separate enzymes, the 3-.beta.HSD (3.beta.-hydroxysteroid dehydrogenase activity) and the 3-KSI (.DELTA..sup.5-3-ketosteroid isomerase activity), In order to confirm that the .DELTA..sup.5,4 isomerase activity observed previously for recombinant GAME25 enzymes produced in insect cells came originally from GAME25 enzymes and not from any endogenous enzymes of insect cells, tomato GAME25 protein was expressed in E. coli and purified by Ni-NTA chromatography (FIGS. 21A-21C). Enzyme assay with the purified GAME25 recombinant enzyme using solanidine substrate and NAD.sup.+ as a cofactor resulted in the formation of the same solanid-4-en-3-one product (FIG. 22A) as described before. The solanid-4-en-3-one product's identity was confirmed by comparison of retention time and mass spectrum with authentic solanid-4-en-3-one standard as described above (FIGS. 17B and 19F-19H). Thus, it is hereby shown doubtlessly that the recombinant GAME25 enzyme possesses both the 3.beta.-hydroxysteroid dehydrogenase and the .DELTA..sup.5,4 isomerase activities. These results also indicate that the removal of C-5,6 double bond in the SA aglycones is not a single step reaction as suggested previously.
[0501] A Putative 5.beta.-Progesterone Reductase Homolog Doesn't Act as Second Enzyme Following GAME25 Reaction in Tomato
[0502] Recombinant enzyme assay of GAME25 with various SA aglycones clearly shows that GAME25 alone is not sufficient to catalyze the entire .DELTA..sup.5 reduction (removal of C-5,6 double bond) in SA aglycone substrates and thus additional enzymes are required to form saturated SA aglycone and further saturated SGAs. In Digitalis, following the reactions of 3-.beta.HSD and 3-KSI, conversion of progesterone to 5.beta.-pregnan-3,20-dione (removal of C-4,5 bond) is catalyzed by 5.beta.-progesterone reductase (5.beta.-POR). Thus, it was hypothesized that a 5.beta.-POR homolog in tomato might act as a second enzyme and catalyzing a similar reduction with the various 3-oxo-.DELTA..sup.5,4 steroidal alkaloid aglycone intermediates (e.g. solanid-4-en-3-one). Sequence homology search with Digitalis 5.beta.-POR against the tomato genome resulted in two candidates; Solyc10g049600 (71% identity) and Solyc10g049620 (78% identity). Among these two genes, only Solyc10g049620 (termed here GAME35) was found to be expressed in different tomato tissues (Cardenas et al. (2016), Tomato RNA seq data in NCBI Sequence Read Archive with BioProject ID PRJNA307656). In order to examine whether GAME35 catalyzes the enzymatic reaction following GAME25, GAME35 was expressed in E. coli and purified by Ni-NTA chromatography (FIGS. 21A-21C). For GAME35 activity assay, solanid-4-en-3-one was used as a substrate. GAME35 did not react with the solanid-4-en-3-one substrate, suggesting its minimal role in the reduction of the C-4,5 double bond in SA aglycone substrates (FIG. 22B). Thus, a different reductase enzyme might be required to carry out second reaction (removal of C-4,5 bond) during the biosynthesis of saturated SA aglycone from unsaturated one in Solanum plants.
Example 11
[0503] The Presence of the C-5,6 Double Bond in SGAs is Significant to Pathogenicity and Growth of Tomato Fungi
[0504] Objective:
[0505] Given the finding that silencing of GAME25 in tomato redirects SGA metabolism towards the dehydro-SGAs branch instead of its typical tomatine derived SGAs, it was examined whether dehydro-SGAs levels affect pathogenicity or growth of disease causing fungi.
[0506] Methods:
[0507] Fungal Inhibition Assay
[0508] Methanolic extracts from 2.5 g wild-type leaves and three independent GAME25i transgenic plant leaves (#2, #3 and #4 are three independent GAME25i transgenic lines, and for each transgenic line, three separate tissue samples (weighing 0.8, 0.8 and 0.9 g each) were collected from three different plants respectively) were evaporated to dryness and redissolved in 700 .mu.l of methanol. Fungal inhibition activity of the GAME25i and wild-type methanolic extracts was determined by the disc diffusion method. Botrytis cinerea (B05.10) and Colletotrichum gloeosporioides (Cg14) were grown on PDA (potato dextrose agar) plates for 10 days at 28.degree. C. After 10 days, a conidial suspension was prepared and 4.times.10.sup.4 conidia were spread in each petri dish containing PDA medium. Whatman filter paper (13 mm) was soaked with 100 .mu.L of extract and allowed it to dry. Furthermore, the loaded Whatman filter paper was placed on the pre-inoculated petri dishes. Discs soaked with methanol were used as a control. The plates were then incubated at 28.degree. C. for 2 days. Fungal inhibition activity was evaluated as the area of inhibition of mycelium growth subtracted by the area of the disc. Inhibition of conidia germination by GAME25i and wild-type extracts was tested as described earlier. Briefly, fungal conidia were collected from respective PDA plates and adjusted to the final conidia concentration of 1.times.10.sup.5 conidia/ml using sterile distilled water. A drop of conidia suspension was incubated with GAME25i and wild-type methanol extracts (diluted by 5 times) on glass slides with 5 replicates and incubated in a humid chamber for 19 hrs. After incubation, slides were examined under microscope (.times.40) and each slide was evaluated in three different fields for recording the percentage of conidia germination. This experiment was repeated three times.
[0509] Results:
[0510] The predominant SGA .alpha.-tomatine in tomato green tissues is renowned to affect the growth of many pathogenic fungi, including Botrytiscinerea, Fusariumoxysporum and Colletotrichumgloeosporioides. As it normally produced in small amounts in tomato tissues, the role of dehydrotomatine in phytopathogenicity was not examined. Analysis of GAME25i leaf extracts (producing predominantly dehydrotomatine and downstream SGAs) showed a clear and significant mycelial growth inhibition of the pathogenic fungi B. cinerea and C. gloeosporioides as compared to wild-type extracts (accumulating .alpha.-tomatine and derived SGAs) (FIGS. 23A-23D). In addition, fungal conidia germination was severely affected in treatments with GAME25i extracts as compared to wild-type ones (FIGS. 23E-23J).
Example 12
[0511] The Tomato Recombinant GAME25 Enzyme Also Converts Diosgenin, a Spirostanol Type Saponin Aglycone to Diosgen-4-en-3-one, 3-Oxo-.DELTA..sup.5,4 Steroidal Saponin Intermediate
[0512] Similar to SGAs, steroidal saponins also display two structural forms, unsaturated or saturated based on C-5,6 double bond position in saponin aglycone (that is either furostanol or spirostanol type) (FIG. 3A). Formation of new saturated furostanol type saponins by GAME25 overexpression in eggplant suggests its possible role also in removal of C-5,6 double bond from steroidal saponin metabolites. Furthermore, recombinant GAME25 enzyme exhibits the 3.beta.-hydroxysteroid dehydrogenase and .DELTA..sup.5,4 isomerase activities on various SA aglycone substrates to form the 3-oxo-.DELTA..sup.5,4 SA aglycone intermediates. To examine whether GAME25 can catalyze similar reactions but on steroidal saponin aglycone substrate, a recombinant enzyme assay was performed using diosgenin [(M+H.sup.+, m/z 415.3); a major spirostanol type steroidal saponin aglycone produced by Dioscorea species] as substrate. Interestingly, GAME25 assay resulted in the formation of novel compound with molecular ion m/z 413.3 (M+H.sup.+) representing oxidation of 3.beta.-hydroxyl group and isomerization of double bond from C-5,6 position to C-4,5 position (FIGS. 24A-24B). While unsaturated diosgenin substrate produce three major fragment ions with m/z 415.3, 271.2 and 253.2, the newly formed compound (m/z 413.3) showed fragment ions with m/z 413.3, 269.2 and 251.2 respectively. Based on mass fragmentation analysis and assignment described as above for SA aglycones (e.g. dehydrotomatidine), this newly formed compound was putatively assigned as diosgen-4-en-3-one (FIGS. 24A-24B). Thus, similar to SA aglycones, GAME25 also catalyzes oxidation of the 3.beta.-hydroxyl group and the isomerization of double bond from the C-5,6 to the C-4,5 position in steroidal saponin aglycone substrates to form the 3-oxo-.DELTA..sup.5,4 steroidal saponin aglycone intermediates. The results also suggest that formation of saturated steroidal saponin aglycone (removal of C-5,6 double bond) from unsaturated saponin aglycone is also not a single step reaction and GAME25 is catalyzing the first of them.
Summary for Examples 1-12
[0513] GAME25 is a Key Branch Point Enzyme that Determines the Diversity of SGAs Produced in Solanum Species and Modulates their Level of Toxicity
[0514] The enormous diversity of chemical structures produced by plants are often due to what seems to be a minor change in one or more of the core scaffolds that are consequently metabolized by various downstream modifications. This occurs in steroidal glycoalkaloids; a renowned class of secondary metabolites that likely evolved separately in the Solanaceae and Liliaceae families. In Solanum species investigated here, the presence or absence of a double bond at the C-5,6 in the core scaffolds is a major source of structural diversity. More specifically, in tomato, two SA aglycones, namely, dehydrotomatidine and tomatidine, differing in the presence or absence of the C-5,6 double bond, are similarly glycosylated to their corresponding glycoalkaloids dehydrotomatine and .alpha.-tomatine, respectively. Both dehydrotomatidine and tomatidine aglycones are highly toxic to plant cells and likely undergo glycosylation to prevent self-toxicity. Studies in animal models demonstrated that SGAs deficient in the C-5,6 double bond, e.g. .alpha.-tomatine, are much less toxic to animals and humans as compared to those possessing it (e.g. .alpha.-chaconine and .alpha.-solanine from potato). This suggests that dehydrotomatine is likely a more toxic SGA when compared to .alpha.-tomatine.
[0515] Although less toxic to humans and animals, .alpha.-tomatine is a highly active molecule that is involved in a range of host-plant resistance mechanisms in tomato plants. Yet, the contribution of dehydrotomatine, typically produced to lower levels in tomato, to the plant resistance against pathogens was not clear. In the present disclosure, severe growth and conidia germination inhibition of the pathogenic fungi B. cinerea and C. gloeosporioides pointed towards enhanced toxicity of extracts enriched with dehydro-derivatives (due to GAME25 silencing) as compared to those (wild-type) predominantly containing .alpha.-tomatine and related metabolites (FIG. 23). Thus, in planta, .alpha.-tomatine and dehydrotomatine SGAs could be acting synergistically against pathogens and both of these SGAs might have co-evolved in order to exert synergistic effect against a broad range of diseases. GAME25 reported here, catalyzes the first step in the conversion of dehydrotomatidine to tomatidine in which the double bond at the C-5,6 position is reduced (FIG. 22). This reaction is therefore a key branch point that not only determines the diversity of SGAs produced in more than hundreds of Solanum species known to date but also modulates the toxic effects of these molecules in planta, animals and likely also in pathogens and herbivores.
[0516] The Formation of Tomatidine from Dehydrotomatidine in Tomato Involves the Reaction Catalyzed by GAME25 and Further Requires Additional Biochemical Reactions.
[0517] During the past decades the biosynthesis of dehydrotomatine and .alpha.-tomatine was hypothesized to occur through several different pathways. In one scenario, dehydrotomatidine was proposed to be derived from cholesterol which contains a C-5,6 double bond while tomatidine from cholestanol lacking the C-5,6 double bond. Thus, conversion of cholesterol to cholestanol might be responsible for formation of tomatidine. An alternative pathway suggested that teneimine having the double bond, an intermediate derived from cholesterol, is partitioned, leading to tomatidine through the action of a hypothetical hydrogenase reducing the double bond while a portion of it is converted to dehydrotomatidine. In another hypothesis, tomatidine was proposed to be partly dehydrogenated to form dehydrotomatidine by a hypothetical dehydrogenase. In another case, the formation of tomatidine from dehydrotomatidine was hypothesized as a single step reaction catalyzed by a hypothetical hydrogenase. The present disclosure functionally characterizes GAME25 through in planta and in vitro assays and rules out these previous hypotheses. Instead, it is suggested that the formation of tomatidine from dehydrotomatidine, i.e. the reduction of .DELTA..sup.5 (C-5,6 position) bond in the SA aglycones, is carried out in multiple steps and GAME25 catalyzes the first of them.
[0518] Furthermore, the examples above show that, unexpectedly, SA/SGA levels can be severely reduced in a tomato plant by modifying expression of an enzyme involved in the steroidal alkaloids biosynthetic pathway.
[0519] GAME25 Exhibits a Novel Dual-Function Activity in Solanum Plants
[0520] In vitro enzyme assays with the recombinant tomato and potato GAME25 enzyme pointed towards its dual activity, i.e., (i) oxidation of the 3.beta.-hydroxyl group (3.beta.-hydroxysteroid dehydrogenase activity) and (ii) isomerization of the double bond from the C-5,6 position to the C-4,5 position (3-oxosteroid .DELTA..sup.5,4 isomerase activity) in SA and steroidal saponin aglycone substrates (FIGS. 19, 20, and 22A). The dual activity reported here for GAME25 is apparently novel as most if not all 3-.beta.HSD enzymes participating in plant secondary metabolism (i.e. members of the 3-.beta.HSD and SDR family) possess only 3.beta.-hydroxysteroid dehydrogenase activity but not isomerase activity; for example, the 3-.beta.HSD enzyme from Digitalis, Noscapine synthase (NOS) from poppy and momilactone synthase (MS) in rice. Interestingly, in mammals' steroid hormone metabolism, the conversion of pregnenolone to progesterone includes a 3.beta.HSD enzyme that is similar to GAME25 and possesses a dual dehydrogenase and isomerase activity.
[0521] Additional results obtained in these assays showed that GAME25 is active with steroidal aglycones produced by tomato (dehydrotomatidine), potato (solanidine) and eggplant (solasodine) but not with the glycosylated steroidal alkaloids forms (e.g. .alpha.-tomatine, dehydrotomatine, .alpha.-solanine, .alpha.-chaconine and .alpha.-solamargine). The latter, more bulky structures that contain multi-glycoside residues might not be able to bind to the active site pocket in the GAME25 enzyme. The GAME25 enzyme was also not reactive with cholesterol and cholestenol that were predicted in the past to be precursor molecules for dehydrotomatidine and tomatidine, respectively. Furthermore, a similar three-step enzymatic conversion in wild potato species producing demissidine and further demissine SGAs as well as additional Solanum species like S. dulcamara that produce both the more toxic double bond containing SGAs and the less toxic, saturated ones (FIG. 22) is predicted.
[0522] Absence of GAME25 Activity in Cultivated Potato and Eggplants is Responsible for Lack of Saturated SGAs in them
[0523] The pathway from the unsaturated SA aglycone solanidine to saturated SA aglycone demissidine and its glycosylated form (i.e. demissine) in wild potato species corresponds to the tomato pathway in which the C-5,6 double bond is eliminated from dehydrotomatidine towards tomatidine and the glycosylated .alpha.-tomatine (FIG. 2B). While .alpha.-tomatine and its derivatives accumulate to high levels in tomato, the domesticated potato does not accumulate saturated demissidine or demissine SGAs in any plant part (while wild potato species do). The absence of the saturated SGAs demissidine or demissine in cultivated potato tubers albeit GAME25 gene in it suggests that these SGAs were selected against and lost during the domestication process (possibly through altered GAME25 activity). In addition, even if GAME25 is considered to be active in vivo, additional enzymes required for further conversion of solanid-4-en-3-one (3-oxo-.DELTA..sup.5,4 SA aglycone intermediate formed after GAME25 activity) might be absent or inactive in potato. Although recombinant GAME25 enzyme from potato showed in vitro activity with various SA aglycone substrates tested, the involvement of GAME25 gene in SGA metabolism in cultivated potato remains unclear (FIG. 19).
[0524] In the case of eggplant, merely GAME25 activity might be lacking as overexpression of the tomato GAME25 gene resulted in the production of saturated SGAs, suggesting the availability of the additional enzymes that are required to produce final saturated forms of SGAs after GAME25 action. In addition to saturated SGAs, novel saturated steroidal saponins were also formed in GAME25-Ox eggplant transgenic lines underscoring its crucial role in steroidal saponin biosynthesis in solanum plants. Based on these results, for other plant species that produce steroidal saponins, it is hereby predicted the existence of a GAME25-like enzyme and other additional enzymes in them that are required for eliminating the C-5,6 double bond from unsaturated steroidal saponin aglycone substrates and further to form saturated steroidal saponin aglycone and saponin glycosides (FIG. 3C).
[0525] GAME25 is a Unique Classical SDR Family Member for Specialized Metabolism in Solanum Plants
[0526] In plants, more than 3000 known SDR enzymes catalyze NAD(P)(H)-dependent oxidation/reduction reactions on a wide range of substrates including alcohols, sugars, steroids, aromatic compounds and xenobiotics and thus contribute to a wide array of biochemical processes. As found in other eukaryotes, the majority of plant SDRs is either classical or extended types SDRs, yet, high number of SDRs in plants could not be classified to a particular functional category. With respect to distribution, the number of SDRs in land plants varies significantly, e.g. 126 in P. patens to around 315 in G. max. Members of SDR family have been reported to participate in the metabolism of various specialized metabolites including cardiac glycosides in Digitalis spp. (3.beta.HSD), tropane-like alkaloids (SDR65C), terpenoids like xanthoxin, menthone and zerumbone (SDR110C, SDR114C), benzylisoquinoline alkaloids in poppy (NOS), oryzalexin diterpenoids in rice (MSI and MI1-3) and phenolic substrates, e.g. 4-dihydroflavanol, anthocyanidin, cinnamoyl-CoA and phenylacetaldehyde (SDR108E). The present disclosure shows that GAME25 is a key enzyme in the biosynthesis of saturated SGAs and unsaturated and saturated steroidal saponins, renowned classes of specialized metabolites in the Solanum genus. Phylogenetic analysis of SDR family proteins from plants partaking in specialized metabolism suggested that GAME25 proteins of the Solanaceae family have undergone significant diversification as compared to other family proteins that are known to be involved in plant secondary metabolism (FIG. 6). This can be supported by novel dual enzyme activities (dehydrogenase and isomerase) of GAME25 proteins in Solanaceae plants which could be acquired during the evolution over other SDR members that has evolved only with a single classic activity (e.g. only dehydrogenase).
[0527] Three Steps Enzymatic Conversion is Required for Formation of Saturated SA and Saponin Aglycones from Respective Unsaturated Forms
[0528] Digitalis species are known to produce an important class of specialized metabolites, the cardenolides or cardiac glycosides. During the biosynthesis of cardenolides, pregnenolone is converted to pregnanolone. Both pregnenolone and pregnanolone are steroid derivatives which differ only by the presence or absence of the double bond at the C-5,6 position (FIG. 25). The conversion of pregnenolone to pregnanolone (reduction of .DELTA..sup.5 bond) occurs in four steps: (i) oxidation of (3.beta.-hydroxyl group) pregnenolone by 3.beta.HSD enzyme followed by (ii) isomerization of double bond from the C-5,6 to the C-4,5 position by 3-KSI enzyme to form progesterone, (iii) In the third step, progesterone is converted to 5.beta.-pregnan-3,20-dione (removal of C-4,5 bond) by 5.beta.-progesterone reductase (5.beta.-POR) which is subsequently converted to pregnanolone by 3.beta.HSD enzyme. Thus, the conversion of pregnenolone to pregnanolone resembles to formation of tomatidine from dehydrotomatidine aglycone in tomato, or demissidine from solanidine aglycone in wild potato plants where C-5,6 double bond is also removed (FIG. 25). Interestingly, formation of saturated SA aglycone (e.g. tomatidine or demissidine) in Solanaceae plants was predicted to occur in single step by hypothetical hydrogenase enzyme. The present disclosure clearly demonstrates that the removal of C-5,6 bond of steroid derivatives in Digitalis spp. and SA aglycones in Solanaceae plants is strikingly different because of a novel dual activity of GAME25 enzyme that catalyzes first step in Solanum plants as compared to two separate enzyme activities required for same first step in Digitalis spp. (FIG. 25). In addition, 5.beta.-progesterone reductase (5.beta.-POR) homolog in tomato doesn't seem to be appropriate enzyme for catalyzing second step following GAME25 activity in saturated SGA biosynthesis. Based on further requirement of analogous enzymes after GAME25 reaction step that has been characterized extensively here in various Solanaceae plants, it is hereby proposed that the conversion of dehydrotomatidine to tomatidine in tomato is a three step reaction sequence with GAME25 catalyzing the first step, converting dehydrotomatidine to tomatid-4-en-3-one (3-oxo-.DELTA..sup.5,4 SA aglycone intermediate (FIG. 25). Tomatid-4-en-3-one is subsequently reduced to tomatidine by the successive action of a putative 5-reductase and an aldo-keto reductase (FIG. 25). The possible steroidal glycoalkaloids pathway reactions from the unsaturated aglycone solanidine to saturated demissidine and its glycosylated form (i.e. demissine) in wild potato species (e.g. S. chacoense) corresponds to the tomato SGA pathway reactions where the C-5,6 double bond is eliminated from dehydrotomatidine towards tomatidine in three steps (FIG. 25). A similar three-step conversion in wild potato species producing saturated demissidine from solanidine aglycone is predicted hereby. In addition, tomato GAME25 overexpression in cultivated eggplants generated saturated SGAs (soladulcidine and its glycosylated derivatives) from solasodine aglycone that are actually native to certain solanum species (e.g. S. dulcamara), thus indicating presence of active GAME25 in them. Based on this, it is hereby suggested that three step conversion reactions in those solanum species (e.g. S. dulcamara) produce saturated soladulcidine from solasodine aglycone (FIG. 25). Finally, based on in vivo (GAME25-Ox in eggplant) and in vitro (enzyme activity) results, it is hereby proposed three step reactions in the hundreds of steroidal saponin producing plant species that produce saturated saponin aglycones from their unsaturated forms and further saturated steroidal saponin glycosides (FIG. 25).
[0529] The characterization of GAME25 activity in the SGAs and biosynthesis pathway is a significant step towards resolving the complete core SGAs pathway in Solanaceae species. Likewise, it further contributes to the understanding of how a large portion of the structural diversity in the SGAs steroidal saponin producing Solanaceae species is formed. Nevertheless, the enzymes completing the elimination of the C-5,6 double bond from the core SGAs aglycones succeeding GAME25, are yet to be identified. The dramatic shift from saturated (without C-5,6 double bond) to unsaturated SGAs (with C-5,6 double bond) in GAME25 silenced tomato plants including the dominance of dehydroesculeosides in ripening fruit make these genetic materials an excellent resource for future investigation. It will allow probing the significance of this structural variance to the potency of these molecules with respect to plant pathogens and herbivores. Ripe fruit accumulating .alpha.-tomatine on behalf of the typical esculeosides as a result of GAME25 overexpression will also be of value for carrying out similar interaction studies in tomato. The presence of the double bond at the C-5,6 position is not merely an issue of structural variation, but ample evidence suggests its relevance to the level of toxicity these molecules possess to humans. SGAs, largely the unsaturated ones, prevalent in potato tubers are renowned `anti-nutritionals` and their levels in cultivated potato are tightly regulated. Together with the previously reported structural and regulatory genes, overexpression of GAME25 affords a valuable strategy to reduce the levels of these substances in commercial potato varieties.
Methods for Examples 12-17
[0530] Plant Material
[0531] The tomato Introgression Line (IL) and Backcross Inbred Line (BIL) populations derived from crosses of the M82 tomato cultivar and Solanum pennellii were obtained from publicly available collections of inbred lines as described in Ofner, I et al., (2016) Solanum pennellii backcross inbred lines (BILs) link small genomic bins with tomato traits. Plant J. 87(2):151-160; and Eshed and Zamir (1995) An introgression line population of Lycopersicon pennellii in the cultivated tomato enables the identification and fine mapping of yield-associated QTL. Genetics 141: 1147-1162. These populations (IL and BIL) consist of 671 lines, including the two parental lines M82 and S. pennellii, F1, 132 ILs and 536 BILs. The plants were grown in a climate-controlled greenhouse at 24.degree. C. during the day and 18.degree. C. during night, with natural light.
[0532] The GAME31-RNAi construct was created by introducing a GAME31 fragment to pENTR/D-TOPO (Invitrogen) (by NotI and AscI) and further transfer of the resulting cloned fragment to the pK7GWIWG2 (II) binary vector (Karimi et al., (2002) GATEWAY.TM. vectors for Agrobacterium-mediated plant transformation. Trends Plant Sci. 7: 193-195) using Gateway LR Clonase II enzyme mix (Invitrogen). The GAME31-Cosup (co-suppression) construct was generated by introducing the corresponding tomato GAME31 coding sequences into pDONR221 using the Gateway BP Clonase II enzyme mix (Invitrogen) and then transferred to the pK2GW7 binary vector (https://gateway.psb.ugent.be/) using Gateway LR Clonase II enzyme mix. Constructs were transformed into tomato (cv. Microtom) as described previously (Itkin et al., 2011, ibid, 2013, ibid). Primers used in this work are listed in Table I, below:
TABLE-US-00051 TABLE 1 Primers used for Examples 12-17. Name Sequence SEQ ID NO: Use RF-Tomato- tccgcgggtgaaaacctgtacttccaggg 54 RF cloning GAME31-Fw tgcatctatcaaatcagttaaagttc RF-Tomato- gtggtggtgctcgagtgcggccgcaagc 55 RF cloning GAME31-Rv tttcaaacaccacaataaatcttgaaaag RF-Eggplant- tccgcgggtgaaaacctgtacttccaggg 56 RF cloning GAME31-Fw tggatctaccaaatcaattaaagttc RF-Eggplant- gtggtggtgctcgagtgcggccgcaagc 57 RF cloning GAME31-Rv tttcaaacaccacaataagcctt Diox460-Fw agtacaagtaatcacgttggttcctatga 60 qRT-PCR Diox460-Rv cactagaaagttttttactttataggtgagg 61 qRT-PCR aaa Dioxy-NotI- aaaaagcggccgcgggatcgaggaaat 62 Cloning RNAi-Fw tcgtct SlGAME31 for RNAi Dioxy-AscI- aaaaaggcgcgccctaaaagattacggt 63 Cloning RNAi-Rv gaatcctctt SlGAME31 for RNAi Dioxy-attB1- ggggacaagtagtacaaaaaagcaggct 64 Cloning Fw atggcatctatcaaatcagttaaagt SlGAME31 for co- suppression Dioxy-attB2- ggggaccactttgtacaagaaagctgggt 65 Cloning Rv tcaaacaccacaataaatcttgaaa SlGAME31 for co- suppression
[0533] Screening of SGAs in Tomato BIL and IL Populations
[0534] For screening experiments for SGAs, a rapid extraction method and a short 10-min run in the UPLC-qTOF-MS (Xevo, Waters) was developed. For the extraction, the leaflet next to the youngest leaf was selected (about .about.1-month old plants). The leaflet was dipped in 1 ml of isopropanol:acetonitrile:water (3:3:2 v/v) containing 0.1% formic acid (in a 2 ml Eppendorf tube) and gently rocked for 1 min. Then the solvent was transferred to a LC vial for injection. The leaflets were dried in an oven to obtain their weight (mg).
[0535] Data from UPLC-qTOF-MS analyses were manually inspected in order to determine the major SGA metabolites present in the populations. Elemental composition and MS/MS fragmentation patterns were used for putative identification of SGAs previously reported (Itkin et al., 2011, ibid). A list of peaks was generated using retention time (RT) and m/z as identifiers for each compound. Peak area quantification was performed by the program TargetLynx (Waters). The resulting values were normalized to dry leaf weights and considered to be the amount of metabolite present in each sample. For ground-tissue, preparation of plant extracts and metabolite analysis by UPLC-qTOF-MS was carried out as described previously (Cardenas et al., (2016) GAME9 regulates the biosynthesis of steroidal alkaloids and upstream isoprenoids in the plant mevalonate pathway. Nat. Commun. 7: 10654.).
[0536] Briefly, tomato plant tissues were frozen in liquid nitrogen and ground to a fine powder using an analytical mill or mortar and pestle. Then, frozen tissue (100 mg) was extracted with 80% methanol:water (v/v) containing 0.1% formic acid [the solid:liquid ratio was kept at 1:3 (w/v)]. The mixture was vortexed for 30 s, sonicated for 30 min at room temperature, vortexed again for 30 s, centrifuged (20,000.times.g, 10 min), and filtered through a 0.22-mm polytetrafluoroethylene membrane filter. Metabolite targeted analysis was performed using the targeted analysis program, TargetLynx program (Waters).
[0537] Genotyping and Mapping of QTL
[0538] The BIL/IL populations were constructed and genotyped as previously described (Ofner et al., 2016, ibid).
[0539] Generation of Recombinant GAME31 Enzyme
[0540] GAME31 was amplified from cDNA (SEQ ID NO: 17) and cloned into pET28 vector by restriction free (RF) cloning as described previously (Unger et al., 2010, J Struct Biol. 172:34-44). The primers used for the cloning of GAME31 are listed in Table 1 above.
[0541] The resulting plasmids were verified by sequencing and transformed to E. coli BL21 DE3. For isolation of the GAME31-His tagged enzymes, fresh overnight cultures were diluted 1:100 in 1000 ml of LB medium (Formedium) with 50 .mu.g/ml kanamycin and incubated at 37.degree. C. and 250 rpm until an A.sub.600 nm of 0.5 was reached. Subsequently, for induction of expression of the recombinant proteins, IPTG was added to a final concentration of 0.2 .mu.M and the incubation was continued overnight at 16.degree. C. and 250 rpm. Then cells were harvested by centrifugation at 10,000.times.g and bacteria were lysed by sonication in a buffer (pH 7.4) containing 0.02 M NaH.sub.2PO.sub.4 0.02 M, 0.5 M NaCl, and SIGMAFAST protease inhibitor tablets (Sigma-Aldrich) and benzonase nuclease (Sigma-Aldrich) according to manufacturer's instructions. Lysed cultures were centrifuged, and the soluble fraction was purified by nickel affinity chromatography which was operated with an AKTA liquid chromatography system (AKTA avant, GE Healthcare) according to the manufacturer's instructions. Proteins were stored at -80.degree. C. until further analysis.
[0542] Enzymatic Activity Assays for GAME31 Enzymes
[0543] All the SA/SGAs substrates were prepared at a concentration of 1 mg/ml, dissolved in methanol, except dehydrotomatine that was prepared in DMSO. The enzymatic activity was performed according to Kawai et al. (2014) Evolution and diversity of the 2-oxoglutarate-dependent dioxygenase superfamily in plants. Plant J. 78: 328-43. Briefly, the standard full reaction (100 .mu.L) consisted of 10 mM L-ascorbic acid, 10 mM .alpha.-ketoglutaric acid, 500 .mu.M FeSO.sub.4, 20 .mu.M substrate, 50 mM potassium phosphate buffer (pH 7.5) and purified enzyme. All the components, except the enzyme, were pre-incubated for 10 min at 30.degree. C., after which the reaction was started by addition of the enzyme. After incubation at 30.degree. C. for 1 h, the reaction was stopped by freezing in liquid nitrogen Finally, the reaction was mixed with 300 .mu.L methanol, extracted and analyzed by UPLC-qTOF-MS as described above.
[0544] Quantitative Real-Time PCR
[0545] Gene expression analysis was performed with three biological replicates (n=3) for each genotype. RNA isolation was performed by the Trizol method (Sigma-Aldrich). DNase I (Sigma-Aldrich)-treated RNA was reverse transcribed using a high-capacity cDNA reverse transcription kit (Applied Biosystems). Gene-specific oligonucleotides were designed with Primer Express 2 software (Applied Biosystems). The TIP41 gene (Exposito-Rodriguez et al., (2008) Selection of internal control genes for quantitative real-time RT-PCR studies during tomato development process. BMC Plant Biol. 8: 131-142) was used as an endogenous control for tomato samples. Oligonucleotides used are listed in Table 1, above.
[0546] SGA Targeted Analysis
[0547] Preparation of plant extracts and metabolite analysis by UPLC-qTOF-MS was carried out as described previously (Cardenas et al., 2016, Nat. Commun. 7:10654). Briefly, tomato plant tissues were frozen in liquid nitrogen and ground to a fine powder using an analytical mill or mortar and pestle. Then, frozen tissue (100 mg) was extracted with 80% methanol:water (v/v) containing 0.1% formic acid (the solid:liquid ratio was kept at 1:3 [w/v]). The mixture was vortexed for 30 s, sonicated for 30 min at room temperature, vortexed again for 30 s, centrifuged (20,000 g, 10 min), and filtered through a 0.22-mm polytetrafluoroethylene membrane filter. Metabolite targeted analysis was performed using the TargetLynx program (Waters).
[0548] Constructs
[0549] The GAME31-RNAi construct was created by introducing a GAME31 fragment into pENTR/D-TOPO (Invitrogen) (by NotI and AscI) and further transferring the resulting plasmid to the pK7GWIWG2 (II) binary vector (Karimi et al., 2002, Trends Plant Sci. 7:193-195) using Gateway LR Clonase II enzyme mix (Invitrogen).
[0550] The GAME31-Cosup (co-suppression) construct was generated by introducing the corresponding tomato GAME31 coding sequences (SEQ ID NO: 59) into pDONR221 using the Gateway BP Clonase II enzyme mix (Invitrogen) and then transferred to the pK2GW7 binary vector using Gateway LR Clonase II enzyme mix.
[0551] Constructs were transformed into tomato (cv. Microtom) as described previously (Itkin et al., 2011, Plant Cell 23:4507-45-25; Itkin et al., 2013, Science 341:175-179.). Primers used in this work are listed in Table 1.
Example 12
[0552] Screening of SGAs in Backcross Inbred Line (BIL) and Introgression Line (IL) Populations
[0553] Objective:
[0554] To find new candidate genes involved in the metabolism of steroidal glycoalkaloids (SGAs). FIGS. 1-3 provide the core genes (GLYCOALKALOID METABOLISM genes; GAMEs) required for synthesis of SA aglycones, starting from the precursor cholesterol, and its glycosylation in tomato have been elucidated (Itkin et al., 2011 ibid., 2013, ibid). In tomato, cholesterol is generated from the cytosolic mevalonic acid pathway and further modified by GLYCOALKALOID METABOLISM (GAME) enzymes (in blue) through hydroxylation, oxidation and transamination to generate the aglycone tomatidine. Then, tomatidine is glycosylated generating .alpha.-tomatine, the major SGA in green tissues along with dehydrotomatine. Subsequently, hydroxy- and acetoxy-derivatives accumulate at the fruit breaker stage. In the red ripe tomato fruit, the most abundant SGA correspond to esculeoside A. SGAs detected in the leaf-dip screening of the BIL/IL populations are shown in green. Dashed arrows represent multiple biosynthetic reactions whereas solid arrows represent a single step.
[0555] Results:
[0556] In the search for new candidate genes involved in the metabolism of steroidal glycoalkaloids (SGAs), SGA levels were screened in tomato Introgression Line (IL) and Backcross Inbred Line (BIL) populations derived from crosses of the M82 tomato cultivar and Solanum pennellii LA0716. This whole set consisted of 671 lines, including the two parental lines M82 and S. pennellii, F1, 132 ILs and 536 BILs. In these lines, single (in the case of the ILs) or multiple (for the BILs) regions from the wild species S. pennellii, replaced the homologous counterpart of the cultivated M82 variety. In order to analyze alkaloid content in the large number of lines in a high-throughput manner, metabolite analysis was performed using a leaf-dip method (Schilmiller et al., (2010) Mass spectrometry screening reveals widespread diversity in trichome specialized metabolites of tomato chromosomal substitution lines. Plant J. 62: 391-403), instead of extracting the metabolites from ground tissues. Leaflets from .about.1-month old plants were harvested and immediately extracted by dipping in the extraction solvent and gentle agitation. This method offers information on a relatively low number of SGAs as compared to the number of SGAs detected in ground-tissue extracts; however, it provided a more efficient screening procedure.
[0557] For profiling of SGAs, a rapid method using a short 10-minute run in the Ultra Performance Liquid Chromatography coupled to Quadrupole Time-Of-Flight Mass Spectrometry (UPLC-qTOF-MS) was developed. This allowed screening 7 different SGAs: 2 isomers of .alpha.-tomatine, 2 isomers of dehydrotomatine and 1 isomer of di-dehydrotomatine, acetoxytomatine and hydroxytomatine (FIGS. 1A-1C, 2A-2B,3A-3C, and FIGS. 26A-26G). Under tested conditions, it was found that the .alpha.-tomatine isomers 1 and 2 and dehydrotomatine isomer 1 were the most abundant SGAs found in the population. Detailed inspection of the chromatograms revealed a second early-eluting isomer of dehydrotomatine present only in few samples. Similarly, hydroxytomatine, acetoxytomatine and di-dehydrotomatine were either absent or present at very low levels across the population and few lines accumulated them in larger quantities (FIGS. 26A-26G). These results were validated in ground-tissue extracts derived from the IL population and the relevant BILs (FIGS. 27A-27G).
Example 13
[0558] Mapping of GAME31 in Tomato and Identification in Other Solanum Species
[0559] Objective:
[0560] To identify chromosomal areas linked to the variation of each SGA.
[0561] Results:
[0562] Using the SGA content information from the screened lines, chromosomal areas linked to the variation of each SGA were identified. For instance, a region in chromosome 1 (covering 146 genes) associated to accumulation of dehydrotomatine isomer 2 in IL1-1-3 was identified (FIGS. 28A and 28B). This region has been previously reported from the IL population, and it has been suggested that this accumulating metabolite could be converted to .alpha.-tomatine by the action of a reductase, and that this activity was deficient in the ILs accumulating dehydrotomatine isomer 2 (Schilmiller et al., (2010), ibid). A detailed examination of the 146 genes in the region (FIGS. 29A and 29B), allowed us to point a candidate reductase (Solyc01g009310) and several cytochrome P450 enzymes as the most likely responsible enzymes for the observed metabolic change (FIGS. 28A and 28B).
[0563] A region spanning .about.250 Kbp in chromosome 2 of tomato (Solanum lycopersicum) was also identified as associated with an increase in hydroxytomatine and acetoxytomatine content (FIGS. 30A-30C). The increased amounts of these compounds in leaf tissues suggested the presence of an active hydroxylating enzyme in these BIL/IL populations. An examination of the 17 genes found in the QTL region revealed the presence of four 2-oxoglutarate-dependent dioxygenases (FIGS. 29A and 29B). The gene annotation provided the first indication that these enzymes may be acting in the hydroxylation of .alpha.-tomatine into hydroxytomatine. The genes were named GLYCOALKALOID METABOLISM 31 (SlGAME31; Solyc02g062460; SEQ ID NO: 16), SlGAME31-like1 (Solyc02g062470), SlGAME31-like2 (Solyc02g062490) and SlGAME31-like3 (Solyc02g062500) (FIG. 30B). Two of them are full length 2-oxoglutarate-dependent dioxygenase coding proteins (i.e. SlGAME31 and SlGAME31-like3), while the two others are partial (i.e. SlGAME31-like1 and SlGAME31-like2).
[0564] The annotation as a dioxygenase provided the first indication of the GAME31 enzyme (SEQ ID NO: 18) as the putative enzyme responsible for hydroxylating .alpha.-tomatine to form hydroxytomatine.
[0565] Hydroxylated SGAs are also found in other Solanum species. In eggplant (S. melongena), .alpha.-solamargine is hydroxylated generating hydroxysolamargine. In cultivated potato (S. tuberosum), hydroxylated SGAs are found in minor amounts. However, in wild relatives, like S. chacoense, SGAs are accumulated in higher amounts. When hydroxylated, .alpha.-chaconine and .alpha.-solanine are converted into leptinine I and leptinine II, respectively. Furthermore, these two potato SGAs could be further acetylated into leptine I and leptine II, respectively.
[0566] In the tomato chromosomal region harboring GAME31, as described above and in FIGS. 30A-30C, three additional SlGAME31-like genes were found (Table 2).
TABLE-US-00052 TABLE 2 Sequence IDs for GAME31 and GAME31-like genes in Solanum spp. SEQ Solanum spp Sequence ID** ID NO: S. lycopersycum SIGAME31 Solyc02g062460 16 SIGAME31- Solyc02g062470 17 like1 SIGAME31- Solyc02g062490 22 like2 SIGAME31- Solyc02g062500 25 like3 S. melongena SmGAME31 Sme2.5_04260.1_g00001.1 28 S. tuberosum StGAME31 Sotub01g007080 30 (CDS) StGAME31- Sotub01g007070 33 like1 StGAME31- Sotub01g007090 36 like2 StGAME31- Sotub01g007100 39 like3 StGAME31- Sotub01g007110 42 like4 StGAME31- Sotub01g007120 45 like5 StGAME31- Sotub01g007130 48 like6 StGAME31- Sotub01g007150 53 like7 **Sol Genomics Network (for tomato and eggplant) https://solgenomics.net/; Spud DB (for potato) http://potato.plantbiology.msu.edu/ - (Fernandez-Pozo N, Menda N, Edwards JD, Saha S, Tecle IY, Strickler SR, Bombarely A, Fisher-York T, Pujar A, Foerster H, Yan A, Mueller LA. The Sol Genomics Network (SGN)-from genotype to phenotype to breeding. (2015) Nucleic Acids Res. Volume 43 (Database issue): D1036-41.)
[0567] The knowledge of hydroxylated SGAs in eggplant and potato, led to an investigation of the presence of GAME31-like homologous genes in these species. In eggplant, one gene sitting on chromosome 1 (named SmGAME31) was found which has 88% similarity to SlGAME31 (78% identity), while in potato a region in chromosome 1 containing seven GAME31-like genes was found, with the closest gene having 86% similarity (77% identity) (Table 2).
Example 14
[0568] Association of GAME31 with SGA Hydroxylation
[0569] Objective:
[0570] To examine the function of GAME31 enzyme.
[0571] Results:
[0572] The expression of genes found in the chromosome 2 region associated with higher hydroxytomatine and acetoxytomatine content in the BIL and IL lines was examined. RNA-Sequencing (RNA-Seq) gene expression data from vegetative apex, which had previously been reported for the IL population (Chitwood et al., (2013), A quantitative genetic basis for leaf morphology in a set of precisely defined tomato introgression lines. Plant Cell 25: 2465-2481), was used. By analyzing this dataset, expression of 12 out the 17 genes contained in the QTL region was detected. Excluding SlGAME31, all of the genes presented similar expression levels across the IL lines (<20 normalized Reads Per Million, RPM; data not shown). SlGAME31 showed 4.6-fold increased expression in IL2-1 (35 RPM) in comparison with the rest of the IL population (average 7.6 RPM) (FIG. 31A). SlGAME31-like1, SlGAME31-like2 and SlGAME31-like3 showed relatively low expression (<7 RPM) which appeared similar in all IL lines (FIG. 31A). The expression pattern of SlGAME31 in the ILs and increased accumulation of hydroxytomatine in IL2-1 (FIG. 27E) strongly suggested the role of this enzyme in hydroxylation of .alpha.-tomatine.
[0573] To provide additional evidence regarding the involvement of GAME31 in the hydroxylation of SGAs, the gene expression of GAME31 in RNA-Seq data covering various tissues and developmental stages of tomato (Cardenas et al., (2016), ibid) was examined. It was found that SlGAME31 was highly expressed in fruit tissues among 19 different tomato tissues (FIG. 31B). In skin, flesh and seeds of tomato fruit the expression of GAME31 positively correlated with ripening, being less expressed in early immature stages of development. In other tissues, including leaf, flower buds, petals and roots S/GAME31 displayed lower expression levels. SlGAME31-like3 was found to be expressed at very low levels (<1.2 RPM), while SlGAME31-like1 and SlGAME31-like2 were not detected in this RNA-Seq dataset. The expression of SlGAME31 correlated with the previously reported accumulation of hydroxytomatine during tomato fruit ripening (Mintz-Oron et al., (2008) Gene expression and metabolism in tomato fruit surface tissues. Plant Physiol. 147: 823-851) supporting the hypothesis that SlGAME31 encodes an enzyme that potentially hydroxylates SGAs.
Example 15
Identification of SlGAME31 Homologs in Eggplant and Potato
[0574] Objective:
[0575] To examine the genomes of other species of Solanaceae plants for homologs to SlGAME31 The knowledge of hydroxylated SGAs in other Solanaceae species like eggplant and potato led to the investigation of the presence of GAME31 homologous genes in these species.
[0576] Results:
[0577] Using sequence similarity searches in the Sol Genomics Network database, a single gene in eggplant (Solanum melongena) was identified located in chromosome 1 (SmGAME31; Sme2.5_04260.1_g00001.1) with 88% similarity (78% identity) at the protein level to SlGAME31 (FIGS. 32A-32B). In eggplant, SmGAME31 was predicted to catalyze the hydroxylation of .alpha.-solamargine to hydroxysolamargine.
[0578] In potato (Solanum tuberosum) a region was found in chromosome 1, spanning .about.205 Kbp and containing eight GAME31 homologs. One of these (StGAME31) displayed 86% similarity (77% identity) to SlGAME31 at the protein sequence level (FIGS. 32A-32B). Out of the eight homologs, four represented full length 2-oxoglutarate-dependent dioxygenase coding sequences [StGAME31 (Sotub01g007080), StGAME31-like1 (Sotub01g007070), StGAME31-like4 (Sotub01g007110) and StGAME31-like6 (Sotub01g007130)] and four possessed only partial coding sequences [StGAME31-like2 (Sotub01g007090), StGAME31-like3 (Sotub01g007100), StGAME31-like5 (Sotub01g007120) and StGAME31-like? (Sotub01g007150)]. In potato, StGAME31 is predicted to hydroxylate .alpha.-chaconine and .alpha.-solanine into leptinine I and II, respectively. These compounds are found in minor amounts in cultivated potatoes (Itkin et al., (2013), ibid); however, they are major relatively abundant in wild species like Solanum chacoense. Leptinine I and II can be further acetylated to produce leptine I and II, respectively (FIG. 32B).
Example 16
In Vitro Hydroxylation of SGAs by GAME31
[0579] Objective:
[0580] To examine the enzyme activity of GAME31 in vitro.
[0581] Results:
[0582] The in vitro function of the recombinant SlGAME31 produced in Escherichia coli was examined for hydroxylation activity with 8 SA/SGAs. From tomato .alpha.-tomatine and its aglycone tomatidine, dehydrotomatine were tested; from eggplant .alpha.-solamargine and its aglycone solasodine were tested; and in potato .alpha.-chaconine, .alpha.-solanine and its aglycone solanidine were tested.
[0583] The recombinant SlGAME31 catalyzed the hydroxylation of .alpha.-tomatine forming hydroxytomatine (FIG. 33A) in the presence of the cofactors ketoglutaric and ascorbic acid. Removal of either cofactors resulted in lack of activity. Nevertheless, when the reaction was carried out in the absence of iron, minor amounts of hydroxytomatine were still generated. This is likely due to trace amounts of iron found in the reagents used; additionally previous reports have shown that the absence of iron had no effect in reactions catalyzed by a 2-oxoglutarate-dependent dioxygenase from Catharanthus roseus (De Carolis et al., (1990) Isolation and characterization of a 2-oxoglutarate dependent dioxygenase involved in the second-to-last step in vindoline biosynthesis. Plant Physiol. 94: 1323-1329). Interestingly, SlGAME31 generated the same hydroxytomatine isomer accumulating in the BIL lines containing the S. pennellii introgression on chromosome 2 (FIGS. 34A-34B). SlGAME31 did not show activity when the aglycone tomatidine was used as substrate, but it did perform hydroxylation of dehydrotomatine (FIGS. 33B-33C).
[0584] When SlGAME31 was tested with eggplant steroidal alkaloids, it hydroxylated .alpha.-solamargine generating hydroxysolamargine, and to a lesser extent the aglycone solasodine (FIGS. 33D and 33E). However, SlGAME31 did not hydroxylate any potato SA/SGA (FIGS. 33F-33H).
[0585] In the same way, enzymatic activity assays were performed using the recombinant enzyme cloned from eggplant, SmGAME31, and the same set of SA/SGAs used previously. Similar to the tomato enzyme, SmGAME31 performed hydroxylation of .alpha.-solamargine and to a lesser extent of solasodine, .alpha.-tomatine and dehydrotomatine (FIGS. 35A-35D). Conversely, SmGAME31 did not hydroxylate the aglycone tomatidine or potato SA/SGAs.
[0586] Conclusion:
[0587] The preference of both tomato and eggplant GAME31 for glycosylated substrates (see FIGS. 33A-33H and 35A-35D) indicates that these enzymes act preferably after glucosyltransferases have added the sugar moiety to the 3-OH position on the A ring of the SA aglycone.
Example 17
Altering SlGAME31 Expression Impacts SGA Profile in Tomato Fruit During Ripening
[0588] Objective:
[0589] To characterized in more detail the role of GAME31 enzyme and observe the SGA profile in tomato fruit when GAME31 expression is altered.
[0590] Results:
[0591] To further understand the role of SlGAME31 in hydroxylation of SGAs, transgenic tomato lines in which SlGAME31 was silenced by RNA interference (SlGAME31-RNAi) were generated. Also, lines constitutively expressing the tomato GAME31 were generated but these turned to be co-suppressed (SlGAME31-Cosup). Thus, although these plants were generated as plants having overexpression of GAME31, co-suppression is a post-transcriptional mechanism where both the transgene and the endogenous gene are silenced. Quantitative Real-Time PCR (qRT-PCR) analyses of independent T.sub.0 primary transgenic plants showed that expression of SlGAME31 was reduced in SlGAME31-RNAi and strongly decreased in SlGAME31-Cosup tomato leaves, allowing selection of those lines for further metabolic analyses (FIG. 36A).
To further understand the role of SlGAME31 in hydroxylation of SGAs, transgenic tomato lines in which SlGAME31 was silenced by RNA interference (SlGAME31-RNAi) were generated. Also, lines constitutively expressing the tomato GAME31 were generated but these turned to be co-suppressed (SlGAME31-Cosup). Quantitative Real-Time PCR (qRT-PCR) analyses of independent T.sub.0 primary transgenic plants showed that expression of SlGAME31 was reduced in SlGAME31-RNAi and strongly decreased in SlGAME31-Cosup tomato leaves, allowing selection of those lines for further metabolic analyses (FIG. 36A).
[0592] To further understand the role of SlGAME31 in hydroxylation of SGAs, transgenic tomato lines in which SlGAME31 was silenced by RNA interference (SlGAME31-RNAi) were generated. Also, lines constitutively expressing the tomato GAME31 were generated but these turned to be co-suppressed (SlGAME31-Cosup). Quantitative Real-Time PCR (qRT-PCR) analyses of independent T.sub.0 primary transgenic plants showed that expression of SlGAME31 was reduced in SlGAME31-RNAi and strongly decreased in SlGAME31-Cosup tomato leaves, allowing selection of those lines for further metabolic analyses (FIG. 36B).
[0593] FIG. 36C presents a schematic representation of the SGA biosynthetic pathway and GAME31 role in it. SGA profiling was carried out on extracts of skin and flesh of red ripe tomato fruit of these lines by UPLC-qTOF-MS (FIG. 33D). In fruit of SlGAME31-RNAi lines, the levels of .alpha.-tomatine increased 2.6-8.4 fold as compared to wild-type (WT) plants, while in the SlGAME31-Cosup lines, where the silencing was stronger, .alpha.-tomatine increased more than 340-520 fold relative to WT plants. Similarly, dehydrotomatine increased 1.4-4.3 fold in SlGAME31-RNAi and 105-177 fold in SlGAME31-Cosup as compared with WT plants. On the other hand, hydroxytomatine and esculeoside A remained in similar levels in SlGAME31-RNAi and WT tomato fruit. However, in the co-suppression lines, SlGAME31-Cosup, a strong decrease in hydroxytomatine (1.8-6 fold, lines #7, #5) and esculeoside A (4-29 fold, lines #7, #5) was observed when compared to WT tomato fruit (FIG. 36D).
[0594] Conclusion:
[0595] Enzymatic activity assays using recombinant GAME31 and transgenic plants suppressing this gene, confirmed the role of SlGAME31 in hydroxylation of .alpha.-tomatine, the first step in the pathway leading to esculeoside A.
[0596] Summary for Examples 12-17
[0597] Examples 12-17 above describe the identification of a gene (GAME31) that encodes a 2-oxoglutarate-dependent dioxygenase (GAME31), where the dioxygenase activity hydroxylates .alpha.-tomatine in the first step leading to fruit-related SGAs (esculeosides and derivatives) in tomato. Recombinant tomato GAME31 enzyme produced in E. coli could catalyze the formation of the same hydroxytomatine isomer accumulating in tomato fruit. Additionally, homologs of GAME31 were identified in potato and eggplant, which are the putative genes responsible for the production of hydroxylated alkaloids in these species. Further, reduction of GAME31 expression resulted in altered SGA content in tomato fruit.
[0598] While certain features disclosed herein have been illustrated and described herein, many modifications, substitutions, changes, and equivalents will now occur to those of ordinary skill in the art. It is, therefore, to be understood that the appended claims are intended to cover all such modifications and changes as fall within the true spirit of the genetically modified plants and methods disclosed herein.
Sequence CWU
1
1
10711468DNASolanum lycopersicum 1gtgatatatt tcaaaaaata attaaaatac
atatatattg catacataat tcacttttaa 60tacatattgc agatttaact taaacattgt
tataaatggt gataaataaa aaaatcgtta 120aaattagtaa ttattcatta aactgcatct
atttatgtaa tttttccaat taaaaatcta 180ttattttttt tcaatccaat ccaaacaggc
tctaaagcat caatgttttt gaaattacca 240aaatagcctc ggttgttaag cgcttccttc
tatatattag tgaattcaaa ctacagtcgg 300tacaaaggaa gttatttact cttataatgg
caaataagct caggtatagc atagttagta 360tttgtttaaa ttaatggtgc taatcagtac
attaatttat tttctcaaaa ttgtgtaatt 420acatataatt aaatgtgttt aatcaaatgt
ttttcttttt tatatgcatc gatcctgtag 480gttggagggc aaagtagcta taattaccgg
tgctgctagt ggcattggag aagcaagtgc 540tagattgttc gttgaacatg gtgctcgtgt
cgtcgtcgcc gatattcaag atgaacttgg 600tcaaaaagta gttgattcta tcggatctga
caaagccagc taccggcact gcgacgttac 660agacgagaag caagttgagg aaaccgtagc
ttacgcggta gagaaatacg gtactcttga 720cattatgttt agtaatgtcg ggacgctgaa
tttctgcagc gtcctcgaca tggacgtgct 780ggccttcgat gagaccatgg ccatcaacgt
acgcggatcc gcgttagcgg ttaagcacgc 840ggctaaagtt atggttgata agaaaattcg
gggatctatt atatgtaacg cgagtttaga 900agggatttta gctggggccg cttcgctcgc
ctacattgcg tcaaagcacg cagtggtagg 960cattataaaa gcggccgcac gtgaactggg
tccacatggg ataagggtga atggggtgtc 1020gccctatgga atagcgacgc cccttgtgac
taaggcgtat ggactggatg cggctctatt 1080ggaagaagca atttacggta atggacactt
gaaaggagtt aagttgagca cgatgcatgt 1140agcacaatca gcactttttt tggcgtctga
tgaatctgct tatacaagtg gtcaaaattt 1200agctgttgat ggtggactaa gttctatttt
gaagctacaa taaattgtca cgctatttgt 1260gttggcgtgc tgtggcgtgg gccttaatcc
tcactctctt gtgtctgtac ttctgtttca 1320tctcgtttcg tttcaaattt tcaacttaat
aatactctca tattttatgc gatatttttc 1380agatttatac taagtttttt atagatattt
taaacgttgt gacttaaaaa gatataaatt 1440tcattttttt aaaattaaaa attttatg
14682780DNAArtificial SequenceGAME25 CDS
of Solanum Lycopersicum 2atggcaaata agctcaggtt ggagggcaaa gtagctataa
ttaccggtgc tgctagtggc 60attggagaag caagtgctag attgttcgtt gaacatggtg
ctcgtgtcgt cgtcgccgat 120attcaagatg aacttggtca aaaagtagtt gattctatcg
gatctgacaa agccagctac 180cggcactgcg acgttacaga cgagaagcaa gttgaggaaa
ccgtagctta cgcggtagag 240aaatacggta ctcttgacat tatgtttagt aatgtcggga
cgctgaattt ctgcagcgtc 300ctcgacatgg acgtgctggc cttcgatgag accatggcca
tcaacgtacg cggatccgcg 360ttagcggtta agcacgcggc taaagttatg gttgataaga
aaattcgggg atctattata 420tgtaacgcga gtttagaagg gattttagct ggggccgctt
cgctcgccta cattgcgtca 480aagcacgcag tggtaggcat tataaaagcg gccgcacgtg
aactgggtcc acatgggata 540agggtgaatg gggtgtcgcc ctatggaata gcgacgcccc
ttgtgactaa ggcgtatgga 600ctggatgcgg ctctattgga agaagcaatt tacggtaatg
gacacttgaa aggagttaag 660ttgagcacga tgcatgtagc acaatcagca ctttttttgg
cgtctgatga atctgcttat 720acaagtggtc aaaatttagc tgttgatggt ggactaagtt
ctattttgaa gctacaataa 7803259PRTSolanum lycopersicum 3Met Ala Asn Lys
Leu Arg Leu Glu Gly Lys Val Ala Ile Ile Thr Gly1 5
10 15Ala Ala Ser Gly Ile Gly Glu Ala Ser Ala
Arg Leu Phe Val Glu His 20 25
30Gly Ala Arg Val Val Val Ala Asp Ile Gln Asp Glu Leu Gly Gln Lys
35 40 45Val Val Asp Ser Ile Gly Ser Asp
Lys Ala Ser Tyr Arg His Cys Asp 50 55
60Val Thr Asp Glu Lys Gln Val Glu Glu Thr Val Ala Tyr Ala Val Glu65
70 75 80Lys Tyr Gly Thr Leu
Asp Ile Met Phe Ser Asn Val Gly Thr Leu Asn 85
90 95Phe Cys Ser Val Leu Asp Met Asp Val Leu Ala
Phe Asp Glu Thr Met 100 105
110Ala Ile Asn Val Arg Gly Ser Ala Leu Ala Val Lys His Ala Ala Lys
115 120 125Val Met Val Asp Lys Lys Ile
Arg Gly Ser Ile Ile Cys Asn Ala Ser 130 135
140Leu Glu Gly Ile Leu Ala Gly Ala Ala Ser Leu Ala Tyr Ile Ala
Ser145 150 155 160Lys His
Ala Val Val Gly Ile Ile Lys Ala Ala Ala Arg Glu Leu Gly
165 170 175Pro His Gly Ile Arg Val Asn
Gly Val Ser Pro Tyr Gly Ile Ala Thr 180 185
190Pro Leu Val Thr Lys Ala Tyr Gly Leu Asp Ala Ala Leu Leu
Glu Glu 195 200 205Ala Ile Tyr Gly
Asn Gly His Leu Lys Gly Val Lys Leu Ser Thr Met 210
215 220His Val Ala Gln Ser Ala Leu Phe Leu Ala Ser Asp
Glu Ser Ala Tyr225 230 235
240Thr Ser Gly Gln Asn Leu Ala Val Asp Gly Gly Leu Ser Ser Ile Leu
245 250 255Lys Leu
Gln424DNAArtificial SequenceGAME25 qRT Forward primer 4gaagcaattt
acggtaatgg acac
24523DNAArtificial SequenceGAME25 qRT Reverse primer 5gaacttagtc
caccatcaac agc
23630DNAArtificial SequenceGAME25 RNAi Forward primer 6gcggccgcat
tgtcacgcta tttgtgttgg
30736DNAArtificial SequenceGAME25 RNAi Reverse primer 7ggcgcgccga
aatttatatc tttttaagtc acaacg
368199DNAArtificial SequenceGAME25-RNAi construct 8attgtcacgc tatttgtgtt
ggcgtgctgt ggcgtgggcc ttaatcctca ctctcttgtg 60tctgtacttc tgtttcatct
cgtttcgttt caaattttca acttaataat actctcatat 120tttatgcgat atttttcaga
tttatactaa gttttttata gatattttaa acgttgtgac 180ttaaaaagat ataaatttc
199928DNAArtificial
SequenceGAME25 baculo Forward primer 9cccgggatgg caaataagct caggttgg
281066DNAArtificial SequenceGAME25
baculo Reverese primer 10tctagattac agatcttctt cagaaataag tttttgttct
tgtagcttca aaatagaact 60tagtcc
6611780DNAArtificial SequenceGAME25 CDS of
Solanum pennellii 11atggcaaata agctcaggtt ggagggcaaa gtagctataa
ttactggtgc tgctagtggc 60attggagagg caagtgctag attgttcgtt gaacatggtg
ctcgtgtcgt cgtcgccgat 120attcaagatg aacttggtca aaaagtagtt gattctatcg
gagctgacaa agccagctac 180cggcactgcg acgttacaga cgagaagcaa gttgaggaaa
ccgtagccta cgcggtagag 240aaatacggta ctcttgacat tatgtttagt aatgtcggga
cgctgaattt ctgcagcgtc 300ctcgacatgg acgtgatggc cttcgatgag acgatggcca
tcaacgtacg tggatccgcg 360ctagcggtta agcacgcggc taaagttatg gttgataaga
aaattcgggg atctattata 420tgtaacgcga gtttagaggg gattttagct ggggccgctt
cgcttgccta cattgcgtca 480aagcacgcag tcgtaggcat aataaaagcg gccgcacgtg
aactgggtcc acatgggata 540agggtgaatg gggtgtcgcc atatggaata gcgacgcccc
tggtgtgtaa ggcgtatgga 600ctggatgcgg ctctattgga agaagcaatt tatggtaatg
gacacttgaa aggtgttaag 660ttgagcacga tgcatgtagc acaatcagca ctttttttgg
cgtctgatga atctgcttac 720acaagtggtc aaaatttagc tgttgatggt ggactaagtt
ctattttgaa gctacaataa 78012259PRTSolanum pennellii 12Met Ala Asn Lys
Leu Arg Leu Glu Gly Lys Val Ala Ile Ile Thr Gly1 5
10 15Ala Ala Ser Gly Ile Gly Glu Ala Ser Ala
Arg Leu Phe Val Glu His 20 25
30Gly Ala Arg Val Val Val Ala Asp Ile Gln Asp Glu Leu Gly Gln Lys
35 40 45Val Val Asp Ser Ile Gly Ala Asp
Lys Ala Ser Tyr Arg His Cys Asp 50 55
60Val Thr Asp Glu Lys Gln Val Glu Glu Thr Val Ala Tyr Ala Val Glu65
70 75 80Lys Tyr Gly Thr Leu
Asp Ile Met Phe Ser Asn Val Gly Thr Leu Asn 85
90 95Phe Cys Ser Val Leu Asp Met Asp Val Met Ala
Phe Asp Glu Thr Met 100 105
110Ala Ile Asn Val Arg Gly Ser Ala Leu Ala Val Lys His Ala Ala Lys
115 120 125Val Met Val Asp Lys Lys Ile
Arg Gly Ser Ile Ile Cys Asn Ala Ser 130 135
140Leu Glu Gly Ile Leu Ala Gly Ala Ala Ser Leu Ala Tyr Ile Ala
Ser145 150 155 160Lys His
Ala Val Val Gly Ile Ile Lys Ala Ala Ala Arg Glu Leu Gly
165 170 175Pro His Gly Ile Arg Val Asn
Gly Val Ser Pro Tyr Gly Ile Ala Thr 180 185
190Pro Leu Val Cys Lys Ala Tyr Gly Leu Asp Ala Ala Leu Leu
Glu Glu 195 200 205Ala Ile Tyr Gly
Asn Gly His Leu Lys Gly Val Lys Leu Ser Thr Met 210
215 220His Val Ala Gln Ser Ala Leu Phe Leu Ala Ser Asp
Glu Ser Ala Tyr225 230 235
240Thr Ser Gly Gln Asn Leu Ala Val Asp Gly Gly Leu Ser Ser Ile Leu
245 250 255Lys Leu
Gln131080DNASolanum tubersoum 13aaaaaattta acatacagtt gctgcaaagg
aagctaccta ctcgtataat ggcaaataag 60ctcaggtact taattagtac attaatttct
ttctttcttt tctcaaattg tatatgagaa 120ttaaatgtgt atttttagct ttaatcaaat
gtttttgtgg tatattatat gcatcgtgta 180ggttggaggg caaagtggct ataattacag
gtgctgcaag tggcattgga gaagcaagtg 240ctagattgtt cgccgaacat ggtgctcgta
ttgtcgtagc cgatattcaa gatgaacttg 300gtctgaaagt agttgaatct atcggagctg
acaaagccag ctaccgacac tgcgacgtta 360cagacgagaa gcaagttgag gataccgtag
cttacacggt agagaaatac ggtactcttg 420acatcatgtt tagtaatgtt gggacgctga
atttttgcag cgtcctggac atggacgtga 480tggtcttcga taagacgatg gccatcaacg
cacgaggatc cgcgttagcg gtcaagcacg 540cggctagatt tatggttgat aagaaaattc
ggggatccat tatatgcaac gcgagtttag 600atggtattgt agctggggcc acttcgcttg
cctacattgc gtcaaagcac gcagttgtag 660gcattgtgaa agcggccgca cgtgacctag
gtccatacgg gataagggtg aatggggtgt 720cgccatatgg aatagcgacg cccctggtgt
gcaaagcgta tgggttggat gcgggtccat 780tggaagcagc aatatatgga aatggaaact
tgaaaggtgt taggttgagc acgatgcatg 840tagcacaatc agcacttttc ttggcgtctg
atgaatctgc ttacacaagt ggtcaaaatt 900tagctgttga tggtggactt agttctattt
tgaaggtaca atagattgtc actctattgt 960gctggtgtgc tgtgatgtgt gcattagttc
tattttgaag ctacaataat tcctttgtca 1020tgtagtactg tttatcttgt ttcatttcga
attttcaact taaataatat tctctcacag 108014780DNAArtificial SequenceCDS of
GAME25 of Solanum tubersoum 14atggcaaata agctcaggtt ggagggcaaa gtggctataa
ttacaggtgc tgcaagtggc 60attggagaag caagtgctag attgttcgcc gaacatggtg
ctcgtattgt cgtagccgat 120attcaagatg aacttggtct gaaagtagtt gaatctatcg
gagctgacaa agccagctac 180cgacactgcg acgttacaga cgagaagcaa gttgaggata
ccgtagctta cacggtagag 240aaatacggta ctcttgacat catgtttagt aatgttggga
cgctgaattt ttgcagcgtc 300ctggacatgg acgtgatggt cttcgataag acgatggcca
tcaacgcacg aggatccgcg 360ttagcggtca agcacgcggc tagatttatg gttgataaga
aaattcgggg atccattata 420tgcaacgcga gtttagatgg tattgtagct ggggccactt
cgcttgccta cattgcgtca 480aagcacgcag ttgtaggcat tgtgaaagcg gccgcacgtg
acctaggtcc atacgggata 540agggtgaatg gggtgtcgcc atatggaata gcgacgcccc
tggtgtgcaa agcgtatggg 600ttggatgcgg gtccattgga agcagcaata tatggaaatg
gaaacttgaa aggtgttagg 660ttgagcacga tgcatgtagc acaatcagca cttttcttgg
cgtctgatga atctgcttac 720acaagtggtc aaaatttagc tgttgatggt ggacttagtt
ctattttgaa ggtacaatag 78015259PRTSolanum tubersoum 15Met Ala Asn Lys
Leu Arg Leu Glu Gly Lys Val Ala Ile Ile Thr Gly1 5
10 15Ala Ala Ser Gly Ile Gly Glu Ala Ser Ala
Arg Leu Phe Ala Glu His 20 25
30Gly Ala Arg Ile Val Val Ala Asp Ile Gln Asp Glu Leu Gly Leu Lys
35 40 45Val Val Glu Ser Ile Gly Ala Asp
Lys Ala Ser Tyr Arg His Cys Asp 50 55
60Val Thr Asp Glu Lys Gln Val Glu Asp Thr Val Ala Tyr Thr Val Glu65
70 75 80Lys Tyr Gly Thr Leu
Asp Ile Met Phe Ser Asn Val Gly Thr Leu Asn 85
90 95Phe Cys Ser Val Leu Asp Met Asp Val Met Val
Phe Asp Lys Thr Met 100 105
110Ala Ile Asn Ala Arg Gly Ser Ala Leu Ala Val Lys His Ala Ala Arg
115 120 125Phe Met Val Asp Lys Lys Ile
Arg Gly Ser Ile Ile Cys Asn Ala Ser 130 135
140Leu Asp Gly Ile Val Ala Gly Ala Thr Ser Leu Ala Tyr Ile Ala
Ser145 150 155 160Lys His
Ala Val Val Gly Ile Val Lys Ala Ala Ala Arg Asp Leu Gly
165 170 175Pro Tyr Gly Ile Arg Val Asn
Gly Val Ser Pro Tyr Gly Ile Ala Thr 180 185
190Pro Leu Val Cys Lys Ala Tyr Gly Leu Asp Ala Gly Pro Leu
Glu Ala 195 200 205Ala Ile Tyr Gly
Asn Gly Asn Leu Lys Gly Val Arg Leu Ser Thr Met 210
215 220His Val Ala Gln Ser Ala Leu Phe Leu Ala Ser Asp
Glu Ser Ala Tyr225 230 235
240Thr Ser Gly Gln Asn Leu Ala Val Asp Gly Gly Leu Ser Ser Ile Leu
245 250 255Lys Val
Gln162552DNASolanum lycopersycum 16tgactataat tgatactcaa tctgttgaaa
tataatgaac caattcttat caaaacacag 60tggagtacaa gtaatcacgt tggttcctat
gaaatggttc atctatttcc cattatatat 120aggctactta tttcctcacc tataaagtaa
aaaactttct agtgttttct tctttctttt 180gtttttttct ctttgctcat attctaaaaa
tatttcatca atggcatcta tcaaatcagt 240taaagttcct actatagatt tttccaatta
tcaagagcta aaaccaaaca ctccactatg 300ggaatccaca aaaattcaag tttttgaagc
tttacaagaa tatggttgtt ttgaagcaat 360atatgataaa gtttcaaagg aaattagaga
ggaaacattt gatatgtcaa aagaaatatt 420tgaatttcct ttagagacta aagtgaaaaa
tatctcagaa aaaccaatgc atggctatat 480ggggatgatt ccacaattgc cattgtatga
gagtttgtgt attcctgatt tgcttaatcc 540tcaaagtctt gaaaaatttt ctaatatctt
ttggcctcag ggtaatcaac atttctggta 600tgtttacttt tatttctttt tcatttttgt
tttcttatta tctttaaatt ttgttctagt 660ggaactgttc aaaagctact atctttagaa
ataataattt ttattagctt agttgattga 720ttatgcgata ttattaatag cttaaaaaaa
taatttttat tagcttagaa ataataattt 780ttattaactt agttgattga ctatgcgata
ttattaatag cttaaaagag cttagttgat 840cagactacga aagtaaaata aaaagagacg
gaagtctgtg tctcgcatct attttttatt 900gcaccgttta aactaaataa aatatagaca
acaacatcaa aatatttggt aggaagacac 960gatttattca acagaaatat agacaacaac
attaaagtat ttggtacatg aaatcactat 1020ccaataagtg acagttcgtt ggccttctca
ttttttataa aataaataga aacacaagag 1080ttgtctcaag tgaaaaaatt gaattatgtt
caaccttctt catatgttta tactaatatt 1140acatgagcgt taatttttgc agcaatttga
taaaatctta ttctaatcca cttgtggaat 1200tggatgggat gttgaaaagg atgatttcgg
agaatttggg attgaaaaat cacattgatg 1260aattattgaa tgccaattac ttcctattta
gatttacaca ttataaggga tcatcaattg 1320ctagtggaga tgaaaataat aaagctgctg
gattgggtgg ccacacggat ggtaacttct 1380tgacttttat atcgcaaaat caagttaatg
gattgcaaat caacaaaaat ggagaatgga 1440ttgatgtgat tatttcacca aattcttacg
ttgttttggc cggtgattcc ttcaaagtaa 1500gtattttaag ttttgaacta gtgttactta
tcttgttggg aactgttttg tttgattttt 1560aaaagaaaaa atattaaatg atcaaaaaaa
ttataatatc ttttttgttt taaggttaaa 1620taaattgatt taaaaatttc atttttaatt
aaaagagggt agtaaaatgc ttaaaaagct 1680aaaataattt agtgtgaaat atattatttt
attatcattc taatcaaaat ttctggtcac 1740accttatagc ataggggttt cagagggccc
cgagatattt tgttttgatc ttatatttct 1800cgaatctatg aaaatgttat tccactagtg
tttatattat tttctgaaat gcatattttt 1860gaatgatttg atatatgctc aatattttca
tgcaaaactg aaaatgaatt ttggtattat 1920tgaccgtatt tgtattgttt tactctccaa
aaatattatc gatcgcatct atctttgtat 1980ttatacaggc ttggacaaat ggtcgattgc
attcacctct ccacagagta acaatgtccg 2040gacaaaatga tagactctcc attcaattgt
tttcattatc aaagccaggt cacttcatcc 2100aggcaccaaa agaactagta gatgaagaac
acccattact cttcaagcca tttgaaattc 2160ttgaattatt caagtatggt accacagaag
ctggctatac agctcctcca agtgatcttt 2220tcaagattta ttgtggtgtt tgatatgcta
attgttgaat ttccgcttca acaagcaact 2280tttctaatga gtttcatctt gtttttttaa
gtagtatgca ttttatgttt gaattgttgc 2340agttggcaat tcatgtttaa tttgtttttg
tttttttgag aaaatatttc caatgggttt 2400cgttggaaat tcgtcttgtt tttttttttc
aagtagtgta catcttattt ttggattgtt 2460gatgttgagc gctaatgttt aatttgtttg
tgttttgaag aggatgatta tactctttaa 2520gaggattcac cgtaatcttt tagtattatt
tg 2552171495DNAArtificial SequencecDNA
of GAME31 of Solanum lycopersycum 17tgactataat tgatactcaa tctgttgaaa
tataatgaac caattcttat caaaacacag 60tggagtacaa gtaatcacgt tggttcctat
gaaatggttc atctatttcc cattatatat 120aggctactta tttcctcacc tataaagtaa
aaaactttct agtgttttct tctttctttt 180gtttttttct ctttgctcat attctaaaaa
tatttcatca atggcatcta tcaaatcagt 240taaagttcct actatagatt tttccaatta
tcaagagcta aaaccaaaca ctccactatg 300ggaatccaca aaaattcaag tttttgaagc
tttacaagaa tatggttgtt ttgaagcaat 360atatgataaa gtttcaaagg aaattagaga
ggaaacattt gatatgtcaa aagaaatatt 420tgaatttcct ttagagacta aagtgaaaaa
tatctcagaa aaaccaatgc atggctatat 480ggggatgatt ccacaattgc cattgtatga
gagtttgtgt attcctgatt tgcttaatcc 540tcaaagtctt gaaaaatttt ctaatatctt
ttggcctcag ggtaatcaac atttctgcaa 600tttgataaaa tcttattcta atccacttgt
ggaattggat gggatgttga aaaggatgat 660ttcggagaat ttgggattga aaaatcacat
tgatgaatta ttgaatgcca attacttcct 720atttagattt acacattata agggatcatc
aattgctagt ggagatgaaa ataataaagc 780tgctggattg ggtggccaca cggatggtaa
cttcttgact tttatatcgc aaaatcaagt 840taatggattg caaatcaaca aaaatggaga
atggattgat gtgattattt caccaaattc 900ttacgttgtt ttggccggtg attccttcaa
agcttggaca aatggtcgat tgcattcacc 960tctccacaga gtaacaatgt ccggacaaaa
tgatagactc tccattcaat tgttttcatt 1020atcaaagcca ggtcacttca tccaggcacc
aaaagaacta gtagatgaag aacacccatt 1080actcttcaag ccatttgaaa ttcttgaatt
attcaagtat ggtaccacag aagctggcta 1140tacagctcct ccaagtgatc ttttcaagat
ttattgtggt gtttgatatg ctaattgttg 1200aatttccgct tcaacaagca acttttctaa
tgagtttcat cttgtttttt taagtagtat 1260gcattttatg tttgaattgt tgcagttggc
aattcatgtt taatttgttt ttgttttttt 1320gagaaaatat ttccaatggg tttcgttgga
aattcgtctt gttttttttt ttcaagtagt 1380gtacatctta tttttggatt gttgatgttg
agcgctaatg tttaatttgt ttgtgttttg 1440aagaggatga ttatactctt taagaggatt
caccgtaatc ttttagtatt atttg 149518321PRTSolanum lycopersycum 18Met
Ala Ser Ile Lys Ser Val Lys Val Pro Thr Ile Asp Phe Ser Asn1
5 10 15Tyr Gln Glu Leu Lys Pro Asn
Thr Pro Leu Trp Glu Ser Thr Lys Ile 20 25
30Gln Val Phe Glu Ala Leu Gln Glu Tyr Gly Cys Phe Glu Ala
Ile Tyr 35 40 45Asp Lys Val Ser
Lys Glu Ile Arg Glu Glu Thr Phe Asp Met Ser Lys 50 55
60Glu Ile Phe Glu Phe Pro Leu Glu Thr Lys Val Lys Asn
Ile Ser Glu65 70 75
80Lys Pro Met His Gly Tyr Met Gly Met Ile Pro Gln Leu Pro Leu Tyr
85 90 95Glu Ser Leu Cys Ile Pro
Asp Leu Leu Asn Pro Gln Ser Leu Glu Lys 100
105 110Phe Ser Asn Ile Phe Trp Pro Gln Gly Asn Gln His
Phe Cys Asn Leu 115 120 125Ile Lys
Ser Tyr Ser Asn Pro Leu Val Glu Leu Asp Gly Met Leu Lys 130
135 140Arg Met Ile Ser Glu Asn Leu Gly Leu Lys Asn
His Ile Asp Glu Leu145 150 155
160Leu Asn Ala Asn Tyr Phe Leu Phe Arg Phe Thr His Tyr Lys Gly Ser
165 170 175Ser Ile Ala Ser
Gly Asp Glu Asn Asn Lys Ala Ala Gly Leu Gly Gly 180
185 190His Thr Asp Gly Asn Phe Leu Thr Phe Ile Ser
Gln Asn Gln Val Asn 195 200 205Gly
Leu Gln Ile Asn Lys Asn Gly Glu Trp Ile Asp Val Ile Ile Ser 210
215 220Pro Asn Ser Tyr Val Val Leu Ala Gly Asp
Ser Phe Lys Ala Trp Thr225 230 235
240Asn Gly Arg Leu His Ser Pro Leu His Arg Val Thr Met Ser Gly
Gln 245 250 255Asn Asp Arg
Leu Ser Ile Gln Leu Phe Ser Leu Ser Lys Pro Gly His 260
265 270Phe Ile Gln Ala Pro Lys Glu Leu Val Asp
Glu Glu His Pro Leu Leu 275 280
285Phe Lys Pro Phe Glu Ile Leu Glu Leu Phe Lys Tyr Gly Thr Thr Glu 290
295 300Ala Gly Tyr Thr Ala Pro Pro Ser
Asp Leu Phe Lys Ile Tyr Cys Gly305 310
315 320Val19462DNASolanum lycoperscum 19atggcatcta
ccaaattagt taaagttccc acaatagatt tttcaaatca tcaagatcta 60aaaccaaaca
ctccactatg ggaatccaaa aaaattcaag tttttgaagc tttgcaagaa 120tatggttgtt
ttgaagcaat ttatgataaa gttccaaaag atattagaga ggaaacattt 180agtatttcaa
aagaaatatt tgaatttcct ttagagacta aattgaaaaa tatttcagaa 240aaaccaacgc
atggatatat gggaatgatt ccacaattgc cattgtatga gagtttgtgt 300attcctgatt
tgcttaatcc taaaagtctt caaagttttg ctaatatctt ttggcctcag 360ggtaaccaac
atttctggta tgtttactta tgtttttatt tcgccctagc agaagtgttc 420aaaagtacga
cattagaaat tcttagtgac ttaattgatt ga
46220462DNAArtificial SequencecDNA of GAME31-like 1 of Solanum
lycopersycum 20atggcatcta ccaaattagt taaagttccc acaatagatt tttcaaatca
tcaagatcta 60aaaccaaaca ctccactatg ggaatccaaa aaaattcaag tttttgaagc
tttgcaagaa 120tatggttgtt ttgaagcaat ttatgataaa gttccaaaag atattagaga
ggaaacattt 180agtatttcaa aagaaatatt tgaatttcct ttagagacta aattgaaaaa
tatttcagaa 240aaaccaacgc atggatatat gggaatgatt ccacaattgc cattgtatga
gagtttgtgt 300attcctgatt tgcttaatcc taaaagtctt caaagttttg ctaatatctt
ttggcctcag 360ggtaaccaac atttctggta tgtttactta tgtttttatt tcgccctagc
agaagtgttc 420aaaagtacga cattagaaat tcttagtgac ttaattgatt ga
46221153PRTSolanum lycopersycum 21Met Ala Ser Thr Lys Leu Val
Lys Val Pro Thr Ile Asp Phe Ser Asn1 5 10
15His Gln Asp Leu Lys Pro Asn Thr Pro Leu Trp Glu Ser
Lys Lys Ile 20 25 30Gln Val
Phe Glu Ala Leu Gln Glu Tyr Gly Cys Phe Glu Ala Ile Tyr 35
40 45Asp Lys Val Pro Lys Asp Ile Arg Glu Glu
Thr Phe Ser Ile Ser Lys 50 55 60Glu
Ile Phe Glu Phe Pro Leu Glu Thr Lys Leu Lys Asn Ile Ser Glu65
70 75 80Lys Pro Thr His Gly Tyr
Met Gly Met Ile Pro Gln Leu Pro Leu Tyr 85
90 95Glu Ser Leu Cys Ile Pro Asp Leu Leu Asn Pro Lys
Ser Leu Gln Ser 100 105 110Phe
Ala Asn Ile Phe Trp Pro Gln Gly Asn Gln His Phe Trp Tyr Val 115
120 125Tyr Leu Cys Phe Tyr Phe Ala Leu Ala
Glu Val Phe Lys Ser Thr Thr 130 135
140Leu Glu Ile Leu Ser Asp Leu Ile Asp145
150221113DNASolanum lycopersycum 22tgagatgttg aaaaggatga tttcggagaa
tttgggatta aaaaatcaca ttgatgaatt 60attgaatgcc aattacatcc tatttagatt
tacacagtat aagggatcat caattgctag 120tggagatgaa aataataaag cagctggatt
gggtggccac acagatggta acttcttgtc 180tattatatca caaaatgaag ttaatggatt
gcaaatcaac aaaaatggag agtggattga 240tgtcaacatt tcgccaaatt cttatgttgt
tttatccggt gattccttca cagtaagtgt 300taagttttga gctagtgtta ttatcttgtt
gggaactgtg ttgtttgatt ttctaaaggg 360ataatgctaa atgacaagaa actcaaaaaa
tcaataagat atttgttgaa tcttacgtct 420ctaaatatat tatcatgcta gtgttaatta
tttcccgaaa tgcatatttt tgaagaatct 480gacatactga gtgatattct ggaagagtcc
aaccaagaca ctttgttgaa actacatgct 540caatattttc atgcaaaact gaaaatgaat
cttgatattt gttgacccta tgttgctcta 600ttctccaaaa atactactgc gactatcttt
gtatttatgc aggcatggac aaatggccga 660ttgcattctc ctgttcatag agttgaaatg
cccagaggaa gtgatagata ttccattcaa 720ttattttcat tatcaaaacc aggtcacttc
atcgaggcac caaaagaaat ggtggatgaa 780gaacaccctt tgcttttcaa gccatttgaa
attcttggat tacttgggta tggtgccaca 840gaagctggct atacaactcc tcccagtgat
cttttcaagg catattgcgg tgtctgatat 900gctaattgcg aatttccatt tctattagaa
taaagttagt atttatgaga tttttgttgg 960taattcatgt ttaattggtt tgtgtttttt
tggaaaatat ttctaatgtg ttccgttgga 1020aattcgtgtg catcttatgt ttggattgtt
ggtattggga attcatgttt aatttgtttg 1080tgttcttggg caaataataa atttgaagcg
gat 111323547DNAArtificial SequencecDNA of
GAME31-like 2 of Solanum lycopersycum 23tgagatgttg aaaaggatga tttcggagaa
tttgggatta aaaaatcaca ttgatgaatt 60attgaatgcc aattacatcc tatttagatt
tacacagtat aagggatcat caattgctag 120tggagatgaa aataataaag cagctggatt
gggtggccac acagatggta acttcttgtc 180tattatatca caaaatgaag ttaatggatt
gcaaatcaac aaaaatggag agtggattga 240tgtcaacatt tcgccaaatt cttatgttgt
tttatccggt gattccttca cagcatggac 300aaatggccga ttgcattctc ctgttcatag
agttgaaatg cccagaggaa gtgatagata 360ttccattcaa ttattttcat tatcaaaacc
aggtcacttc atcgaggcac caaaagaaat 420ggtggatgaa gaacaccctt tgcttttcaa
gccatttgaa attcttggat tacttgggta 480tggtgccaca gaagctggct atacaactcc
tcccagtgat cttttcaagg catattgcgg 540tgtctga
54724181PRTSolanum lycopersycum 24Glu
Met Leu Lys Arg Met Ile Ser Glu Asn Leu Gly Leu Lys Asn His1
5 10 15Ile Asp Glu Leu Leu Asn Ala
Asn Tyr Ile Leu Phe Arg Phe Thr Gln 20 25
30Tyr Lys Gly Ser Ser Ile Ala Ser Gly Asp Glu Asn Asn Lys
Ala Ala 35 40 45Gly Leu Gly Gly
His Thr Asp Gly Asn Phe Leu Ser Ile Ile Ser Gln 50 55
60Asn Glu Val Asn Gly Leu Gln Ile Asn Lys Asn Gly Glu
Trp Ile Asp65 70 75
80Val Asn Ile Ser Pro Asn Ser Tyr Val Val Leu Ser Gly Asp Ser Phe
85 90 95Thr Ala Trp Thr Asn Gly
Arg Leu His Ser Pro Val His Arg Val Glu 100
105 110Met Pro Arg Gly Ser Asp Arg Tyr Ser Ile Gln Leu
Phe Ser Leu Ser 115 120 125Lys Pro
Gly His Phe Ile Glu Ala Pro Lys Glu Met Val Asp Glu Glu 130
135 140His Pro Leu Leu Phe Lys Pro Phe Glu Ile Leu
Gly Leu Leu Gly Tyr145 150 155
160Gly Ala Thr Glu Ala Gly Tyr Thr Thr Pro Pro Ser Asp Leu Phe Lys
165 170 175Ala Tyr Cys Gly
Val 180254148DNASolanum lycopersycum 25tgactagaaa tagacataaa
accctgtact ttttgacaca catgtaatag cactttctct 60atctaatacg caactcttta
ttaattttgc gtaaattttg agctatttcc cattatatat 120aggctactta tttcctcacc
tcttaagtaa aaaactttca agtgtttctt ctttctttta 180tttctctttg ttcacatatt
ctaaaaatat ttcatcaatg gcatctatca aatcagttaa 240agttcctact atagattttt
ccaattatca agagctaaaa ccaaacactc cactatggga 300atccacaaaa attcaagttt
ttgaagcttt tcaagaatat ggttgttttg aagcaatata 360tgataaagtt ccaaatgaaa
ttagagagga aacatttgat atgtcaaaag aaatatttga 420atttccttta gatactaaag
tgaaaaatat ttcagaaaaa ccaatgcatg gatatatggg 480aatgattcca caattgccat
tgtatgagag tttgtgtatt cctgatttgc ttaatcctca 540aagtcttcaa aattttgcta
atatcttttg gcctcagggt aatcaacatt tctggtatgt 600ctatttcact gttttcatct
tttttatttt cttactatca ttatctttaa atttaagaaa 660aaacgataaa tatatcctta
aatataaatg gtatgcagat attctccatc atatttttgg 720gacatatatt tttaccgttc
aaaaattaaa gcatatatac cattttatac taatggatat 780agacgtgtca taatcttatc
taccgcccca acattggatc gatggataag attgtgccaa 840gtttcctaat ttaaccattc
gttagagtga agggcagaaa ttttcgactt tttaaatgtc 900agggacatca atgtcccaaa
agtatgacgg aggaaaaata taacgaaaaa tatgtgcata 960ctatttacga tcgtttgaaa
aaatatttgt cttttttcct tttaaatttt ggcctaatga 1020aagtgttcaa aaagtataac
attagagatt cccagtaaat tgattaacta tttgaccatt 1080caatagtttt atggaataag
ttaatttttt ctttgagaaa aacaaaatag gagattataa 1140atggaagttt ccttctcgaa
tctattcatt agcacacccc taaacaaaca aaagtgccga 1200taacgttaaa atatttggta
tgaagtctcg atctactcaa taaaaacaaa taaattaata 1260ggagacaata gacagtatct
ttctcgaatc aatttcgaat ttatttcttt tatcacattg 1320ttaataaaat gaaaattatc
aacaacatca gaatatttgg tatgtgtcac gatctaataa 1380ttgtagaaat cgagatataa
atacgatttg agaaatcaaa gattgtattg atgaaaaata 1440atgttaagtt acaaggtttt
tatatggaga gaattgtaga gttctaagtt aactataata 1500aaatactatt acaatacata
ttactattat aataataata ataatgcaaa tcctagtcgt 1560aatataattc taatcgactt
caactagtac aataagtaaa taagtagcac tgcgtctaat 1620cctagtatga atctaactcg
tcagtcagtt ccgctttccc atttttgttt tcactatcct 1680agttttaaaa ataaaataaa
atataagact tagttaacgt aaatatggcc tcatttgttt 1740gtatttaatt gggggtctaa
atcttaatca atcagattcg cctcattcag tatgtttgtt 1800tttttatgac tgaatcttaa
ttatttagat ttaattcatt aagtttgttt gttttatttt 1860cttagaagtc tcttaacgag
tctgaataca tctgagttaa tcagatctgt aatacactct 1920taagaccatt cagactcaaa
agtaattcct atcttaattc aactacatca caaaaactca 1980taaaagtttt tttcttatta
aattaatgtt aattacatgc ttacccgtta taatttcctt 2040tattttacta acttaatata
cgtcctttac tttcataaat taatcaatat atttgaattg 2100ataaacactt catgatataa
tatttagcac gattctagaa aacaagaaag tattgattag 2160ttgatcgata acaataacaa
atctgcatta taaaataaaa tgctttcata aacattatat 2220tactactcta tataaactat
tttacattgc attatattag attatcaaag tttttgagtg 2280caaaaaagaa tagtcatata
ttagtgatgt aacttaatgt taaattctta atagataaat 2340catatgacct attcatgata
agaatgtcca aaaatttatt ttccatataa aaaattattt 2400tactaaaatg aggtttttat
aattttttgt tgatacatcg tttaatttca tatgtacatt 2460caaatattaa aaacgaatta
tctcaataat ccagttttca tattcagaga aaatacctta 2520atattaaaat gtttattcag
atttacatat ctagatctta atgcatattt taatatttag 2580atgtatattc agattcagac
gttttgatct taatagaaac aaataaggcc taagtgaaag 2640aatggtatca acttgaaatg
tttctaaatc tgttcaacct tctttatatg tttataaaca 2700ttatatgtgt attttttttt
tgcagcaatt tggtaaagtc ttattctaat ccacttgtgg 2760aattggatga gattttgaaa
aggatgattt cggagaattt gagattaaaa attcacattg 2820atgaattgtt gaatgccaat
tatttcctat ttagatttac acattacaag ggatcatcaa 2880ttactggtgg agatgagaat
aacaaagttg ctggattggg tggccacaca gatggtaact 2940tcttgacttt tatatcgcaa
aatcaagtca atggattgca aatcaacaaa aatggagaat 3000ggattgatgt gaatatttca
ccaaattctt atgttgtttt ggctggtgat tccttcaaag 3060taagtgttaa gttttgaatt
attgttatta tcttgttggg aactgttttg tttgattttt 3120aaaagaaaaa tgctaaatgg
tcacaaattt ttaaagtcaa taatattttt tttgttttaa 3180ggtaaataaa ttgataaaaa
aagaattcat ttttaattaa aagatattga aattaaaagg 3240gtaaaaatac tttaaacata
gtgtgaatta tgttatttta tcattctaat caaaatttgt 3300ggccaatatt gttacacctt
ataggattta tcaaaaaaac atagttttca gaggctcaag 3360atatttgttg gatcttatgt
ttctcgaatc tctgaaaatg ttgttccgct tgtgttgaat 3420gtattatttt ctgaaatgta
tatttttgaa gaatttgata tattaatgat atgctcaata 3480ttttcatgca aaacggaaaa
tgaattttgg tattattgac cctatttgta ttgttctact 3540ctccaaaaat attatcgatc
acgtctatct ttgtatttat acaggcttgg acaaatggtc 3600gattgcattc tcctcttcac
agagtaacaa tgtccggaga aaatgataga ctctccattc 3660aattattttc attatcaaaa
ccaggtcact tcatcgaggc accaaaagaa ctagtggatg 3720aagaacaccc tttactcttc
aagccatttg aaattattgg attatttgag tatggtacca 3780cagaagctgg ctatacagct
cctccaagtg atcttctcaa gagttattgc ggtgtttgat 3840atgctaattg cgaatttccg
cttcagcaac caacttttct aataagtttc gtctgaaatt 3900cgtgttgttt taattattat
gcattttatg tttgaattgt tgtagttggc aattcatgtt 3960taatttgttt gtgttttttt
ttttgagaaa atattgcatt gggtttcatt ggaaatttgt 4020gttttttaaa aagtagtgtg
catcttatgt ttggattgtt ggtgttgaga attcattttt 4080aatttgtttt tttttttggg
caaataatga atttaaaatt gttgatttta ctctttagtg 4140gaaatgat
4148261345DNAArtificial
SequencecDNA of GAME31-like 3 of Solanum lycopersycum 26tgactagaaa
tagacataaa accctgtact ttttgacaca catgtaatag cactttctct 60atctaatacg
caactcttta ttaattttgc gtaaattttg agctatttcc cattatatat 120aggctactta
tttcctcacc tcttaagtaa aaaactttca agtgtttctt ctttctttta 180tttctctttg
ttcacatatt ctaaaaatat ttcatcaatg gcatctatca aatcagttaa 240agttcctact
atagattttt ccaattatca agagctaaaa ccaaacactc cactatggga 300atccacaaaa
attcaagttt ttgaagcttt tcaagaatat ggttgttttg aagcaatata 360tgataaagtt
ccaaatgaaa ttagagagga aacatttgat atgtcaaaag aaatatttga 420atttccttta
gatactaaag tgaaaaatat ttcagaaaaa ccaatgcatg gatatatggg 480aatgattcca
caattgccat tgtatgagag tttgtgtatt cctgatttgc ttaatcctca 540aagtcttcaa
aattttgcta atatcttttg gcctcagggt aatcaacatt tctgcaattt 600ggtaaagtct
tattctaatc cacttgtgga attggatgag attttgaaaa ggatgatttc 660ggagaatttg
agattaaaaa ttcacattga tgaattgttg aatgccaatt atttcctatt 720tagatttaca
cattacaagg gatcatcaat tactggtgga gatgagaata acaaagttgc 780tggattgggt
ggccacacag atggtaactt cttgactttt atatcgcaaa atcaagtcaa 840tggattgcaa
atcaacaaaa atggagaatg gattgatgtg aatatttcac caaattctta 900tgttgttttg
gctggtgatt ccttcaaagc ttggacaaat ggtcgattgc attctcctct 960tcacagagta
acaatgtccg gagaaaatga tagactctcc attcaattat tttcattatc 1020aaaaccaggt
cacttcatcg aggcaccaaa agaactagtg gatgaagaac accctttact 1080cttcaagcca
tttgaaatta ttggattatt tgagtatggt accacagaag ctggctatac 1140agctcctcca
agtgatcttc tcaagagtta ttgcggtgtt tgatatgcta attgcgaatt 1200tccgcttcag
caaccaactt ttctaataag tttcgtctga aattcgtgtt gttttaatta 1260ttatgcattt
tatgtttgaa ttgttgtagt tggcaattca tgtttaattt gtttgtgttt 1320tttttttttc
tttagtggaa atgat
134527321PRTSolanum lycopersycum 27Met Ala Ser Ile Lys Ser Val Lys Val
Pro Thr Ile Asp Phe Ser Asn1 5 10
15Tyr Gln Glu Leu Lys Pro Asn Thr Pro Leu Trp Glu Ser Thr Lys
Ile 20 25 30Gln Val Phe Glu
Ala Phe Gln Glu Tyr Gly Cys Phe Glu Ala Ile Tyr 35
40 45Asp Lys Val Pro Asn Glu Ile Arg Glu Glu Thr Phe
Asp Met Ser Lys 50 55 60Glu Ile Phe
Glu Phe Pro Leu Asp Thr Lys Val Lys Asn Ile Ser Glu65 70
75 80Lys Pro Met His Gly Tyr Met Gly
Met Ile Pro Gln Leu Pro Leu Tyr 85 90
95Glu Ser Leu Cys Ile Pro Asp Leu Leu Asn Pro Gln Ser Leu
Gln Asn 100 105 110Phe Ala Asn
Ile Phe Trp Pro Gln Gly Asn Gln His Phe Cys Asn Leu 115
120 125Val Lys Ser Tyr Ser Asn Pro Leu Val Glu Leu
Asp Glu Ile Leu Lys 130 135 140Arg Met
Ile Ser Glu Asn Leu Arg Leu Lys Ile His Ile Asp Glu Leu145
150 155 160Leu Asn Ala Asn Tyr Phe Leu
Phe Arg Phe Thr His Tyr Lys Gly Ser 165
170 175Ser Ile Thr Gly Gly Asp Glu Asn Asn Lys Val Ala
Gly Leu Gly Gly 180 185 190His
Thr Asp Gly Asn Phe Leu Thr Phe Ile Ser Gln Asn Gln Val Asn 195
200 205Gly Leu Gln Ile Asn Lys Asn Gly Glu
Trp Ile Asp Val Asn Ile Ser 210 215
220Pro Asn Ser Tyr Val Val Leu Ala Gly Asp Ser Phe Lys Ala Trp Thr225
230 235 240Asn Gly Arg Leu
His Ser Pro Leu His Arg Val Thr Met Ser Gly Glu 245
250 255Asn Asp Arg Leu Ser Ile Gln Leu Phe Ser
Leu Ser Lys Pro Gly His 260 265
270Phe Ile Glu Ala Pro Lys Glu Leu Val Asp Glu Glu His Pro Leu Leu
275 280 285Phe Lys Pro Phe Glu Ile Ile
Gly Leu Phe Glu Tyr Gly Thr Thr Glu 290 295
300Ala Gly Tyr Thr Ala Pro Pro Ser Asp Leu Leu Lys Ser Tyr Cys
Gly305 310 315
320Val28963DNAArtificial SequenceCDS of GAME31 28atgggatcta ccaaatcaat
taaagttccc actatcgatt tttccaacca tcaagatcta 60aaaccaaaca ctccacaatg
ggaatccaca aaagatcaag tttttgaagc ttttcaagaa 120tttggttgtt ttgaagcaat
atatgataaa gtgccaaatg aaattagaaa gggcatgttt 180gatgtttcaa aagaaatatt
tgaatttccc ctagagacca aattgaaaaa cttatcagac 240aaaccattac atggctacat
ggggatgatt ccaaacttgc ctttgtatga gagtttgtgt 300attcctgatt tgcttaatcc
tcaaagtctt caaaattttg aaaatatctt ttggccacat 360ggaaatcctg atttttgcaa
tttggtaaaa tgttactcaa atccacttgt ggaattggat 420gaaatgttga agaggatgat
tttggagaaa ttgggagtag aaaatcagat tgatgagtta 480ttggatccca aatatgtcct
atttagattt acacactaca aggggtcatc accaactaat 540ggagataaaa atactaaaag
tgagggacta ggtggccaca ctgatggtaa cttcttgact 600tttatagcac aaaatcaagt
aagtggattg caaattaata aaaatggaga gtggattgat 660gtcaacatct caccaaattc
ttttgctgtt ttgtctgctg attccttcaa agcatggaca 720aatggtcgat tgcattctcc
aattcacaga gtaacaatgg ctggagaaaa tgatagattc 780tccattcaat tattttcact
atccaaacca ggtcacttca tagaggcccc aaaagaactt 840gtggatgaac aacacccttt
actcttcaaa ccatatgaaa tgcttggatt atttaagtat 900gttacttcac aaagtggata
tggagctcct ggtgatgctt tcaaggctta ttgtggtgtt 960tga
96329320PRTSolanum melongena
29Met Gly Ser Thr Lys Ser Ile Lys Val Pro Thr Ile Asp Phe Ser Asn1
5 10 15His Gln Asp Leu Lys Pro
Asn Thr Pro Gln Trp Glu Ser Thr Lys Asp 20 25
30Gln Val Phe Glu Ala Phe Gln Glu Phe Gly Cys Phe Glu
Ala Ile Tyr 35 40 45Asp Lys Val
Pro Asn Glu Ile Arg Lys Gly Met Phe Asp Val Ser Lys 50
55 60Glu Ile Phe Glu Phe Pro Leu Glu Thr Lys Leu Lys
Asn Leu Ser Asp65 70 75
80Lys Pro Leu His Gly Tyr Met Gly Met Ile Pro Asn Leu Pro Leu Tyr
85 90 95Glu Ser Leu Cys Ile Pro
Asp Leu Leu Asn Pro Gln Ser Leu Gln Asn 100
105 110Phe Glu Asn Ile Phe Trp Pro His Gly Asn Pro Asp
Phe Cys Asn Leu 115 120 125Val Lys
Cys Tyr Ser Asn Pro Leu Val Glu Leu Asp Glu Met Leu Lys 130
135 140Arg Met Ile Leu Glu Lys Leu Gly Val Glu Asn
Gln Ile Asp Glu Leu145 150 155
160Leu Asp Pro Lys Tyr Val Leu Phe Arg Phe Thr His Tyr Lys Gly Ser
165 170 175Ser Pro Thr Asn
Gly Asp Lys Asn Thr Lys Ser Glu Gly Leu Gly Gly 180
185 190His Thr Asp Gly Asn Phe Leu Thr Phe Ile Ala
Gln Asn Gln Val Ser 195 200 205Gly
Leu Gln Ile Asn Lys Asn Gly Glu Trp Ile Asp Val Asn Ile Ser 210
215 220Pro Asn Ser Phe Ala Val Leu Ser Ala Asp
Ser Phe Lys Ala Trp Thr225 230 235
240Asn Gly Arg Leu His Ser Pro Ile His Arg Val Thr Met Ala Gly
Glu 245 250 255Asn Asp Arg
Phe Ser Ile Gln Leu Phe Ser Leu Ser Lys Pro Gly His 260
265 270Phe Ile Glu Ala Pro Lys Glu Leu Val Asp
Glu Gln His Pro Leu Leu 275 280
285Phe Lys Pro Tyr Glu Met Leu Gly Leu Phe Lys Tyr Val Thr Ser Gln 290
295 300Ser Gly Tyr Gly Ala Pro Gly Asp
Ala Phe Lys Ala Tyr Cys Gly Val305 310
315 320302345DNASolanum tuberosum 30gaaactttga agtctttctt
gtttcctaaa tattcctcaa atggcatcta ccaaagttac 60gattcccacc atagattttt
gcgattctga gcttaaacca aacactccac aatgggaatc 120aacaaaagtt caagtttttg
aagccttaca agaatttggt tgttttgaag caatatataa 180caaagttcca aatgaaatta
gagagggcat gtttgatact ttaaaagaag tatttgattt 240tccactgccc aaattgatag
aatatagaga gaaacccttt catatatatg atgggcaaat 300tccaagtgta ccactctttg
gtagtgtgta ctctgctgat ttggtcctcc caaatagtgt 360tgaaacattt gccaatacct
tttggtctca tggaaaccct aattttaggt atgcattact 420tctttttcat taattatagg
gagtcacgat agtgtaagat gcattaaaag gagaaacgtt 480tcctagtaga attgtttcta
ttcctagggc tagaatcagg aacctttagt taaattaata 540gagataatat tcattccatc
actaaaggtg aaaattaagt atcttatatt gtccataaat 600tttatataga agagatgtga
gaattaataa aataaaaatt aaaaactcac gagtaaacaa 660aataattata tctaatttat
attaataaag aagagtattt gattattata ttaagtcaaa 720tgataagcta ataaatcaat
attaacaatc taatcacatg atttatataa aattggttat 780gggtatggga agggagggag
ggaagtacat ttcattgagg aacaatgcaa tagttagaca 840ggatttaaca tacttgaaca
agatatcata atctaaaatg attaaaaata attttttaat 900attatctaca catcgcgcga
atatatatat atatatatat taagtgtatt tcttaaataa 960tattgtatta ctatttatat
aaattttgta tgttttaatt ttgcagcaat gtggcaaagt 1020cctacttcaa gcaacttatg
gaattaaatg acatggttaa aaagatggtt ttggagagtc 1080ttgggctaaa aaattacatt
gatgaattct tgaattccaa tgtttatatg tcaagattta 1140ctaattacaa ggtaattaaa
ggtgaaaatg agaataaatc aggattacct tcccacacag 1200atagttccta cttgaccata
attaaacaaa atcaaaatgg attgcaagtt ctctacaaaa 1260atggagagtg gattgagctc
aatcgtcaaa atggactgca agttctctac aaaaatggag 1320agtggattga gctcaatcat
acttcaccaa attcctatat tgttttatca gaagatgttt 1380ttatggtaag ttattattta
ttttttatta cagaagtcaa aaatacacct aaacttttta 1440tttatatgta tttttgacgc
ttaactcttt atttttttgt gtgtaggggt ggtttgttgc 1500tatagtagag gagaataaaa
gaaatagatt ttttttgtat gattgattat tcaagcccaa 1560ctagaagcta agattagagg
agttttgaag caacgaaaaa aaatgttgtg tgtgatttat 1620agatattgat gcaggctcga
tccgtgaaag aaatcactaa tatttatatt agattagatc 1680gtttacctaa ctaaacatcc
cttgaagtac tgccctttct ccaaaccata tgtgaacgtc 1740aaatatttta tgcatcaacc
tgtctttttt tatttggccc caactaactt caatccacat 1800aaattattaa atcttgatat
tagttggaat aacatatctc ttttctgaga aattgaaaat 1860aatgccagaa ctatcataat
ctttttttaa aaaaattgtc ttgttattat cttattaatt 1920taaaattttc tttcttcaga
ggaaatttaa gtcaatcttt ttgttcctta attattaatt 1980aaacaaataa attcttatac
atacttttta tgtgttgatg ctatgaatta attatacagg 2040catggacaaa tgatagattg
acatctgctc aacacagggt tgtaacaaca ggagacaaag 2100aaagattctc tattcaagtt
ttttcctttc caaatccaga ttacactgtg aaggtcccac 2160aagaattagt ggatgaagaa
caccctttaa tgtacaagcc ttttaagatg tctgaatata 2220ataaatatat tatgttaggt
gctaaaaatg gattgggtgt caagaattat tgtggtcttt 2280aaaaatttag tagctatgaa
aatttattta tgtattgttt tgatgaataa aatgtatcag 2340atggc
234531963DNAArtificial
SequencecDNA of GAME31of Solanum tuberosum 31atggcatcta ccaaagttaa
gattcccacc atagattttt ctaatctaga actaaaacca 60aacactccac tatgggaatc
cacaaaagtt caagtttttg aagctttaaa agaatatggt 120tgttttgaag caacatatga
taaaattcca aatgaaatta gagagggtat ttttggtatt 180acaaaagaaa tatttcaatt
tcctttagag accaaagtga aaaattattc agatataaca 240ttacatggct atgtaggaat
gattccacac ttgccatttt atgagagttt gtgtattcct 300gatttgctta atcctcaaaa
tgttgaaact tttgctaata tcttttggcc tcatggtaat 360cctgatttct gcaatttggt
aaaagcttac tcaaatccac ttatggaatt ggatgaaatg 420ttgaaaaaga tgattttgga
gaatttggga ttagaaaatc atattgatga attgctggat 480attaattata tgagatttag
atttacacat tacaagggat catcaattat tagtggagat 540catgaaaata atattaaaca
agatggattg aatggccaca cagatggtaa cttcttgact 600tttatatcac aaaatcaagt
caatggtttg caaatcaaca aaaatggaga gtggattgat 660gtcaatattt caccaaattc
ttatgttgtt ttgtctggtg attcattcaa agcatggaca 720aatggtcgat tgcattctcc
catccacaag gtaaaaatat ttggtgaaag tgatagattc 780tcaattcaat tattttcatt
ctcaaaacca ggtcacttta taaaggcccc aaaagaactt 840gtggatgaag aacacccttt
actcttcaag ccatttgaaa tggttggatt atctgagtat 900gttacttccc aagctggcta
tgcagctccc agtgatgctt tcaaggctta ttgtggtctt 960tga
96332320PRTSolanum tuberosum
32Met Ala Ser Thr Lys Val Lys Ile Pro Thr Ile Asp Phe Ser Asn Leu1
5 10 15Glu Leu Lys Pro Asn Thr
Pro Leu Trp Glu Ser Thr Lys Val Gln Val 20 25
30Phe Glu Ala Leu Lys Glu Tyr Gly Cys Phe Glu Ala Thr
Tyr Asp Lys 35 40 45Ile Pro Asn
Glu Ile Arg Glu Gly Ile Phe Gly Ile Thr Lys Glu Ile 50
55 60Phe Gln Phe Pro Leu Glu Thr Lys Val Lys Asn Tyr
Ser Asp Ile Thr65 70 75
80Leu His Gly Tyr Val Gly Met Ile Pro His Leu Pro Phe Tyr Glu Ser
85 90 95Leu Cys Ile Pro Asp Leu
Leu Asn Pro Gln Asn Val Glu Thr Phe Ala 100
105 110Asn Ile Phe Trp Pro His Gly Asn Pro Asp Phe Cys
Asn Leu Val Lys 115 120 125Ala Tyr
Ser Asn Pro Leu Met Glu Leu Asp Glu Met Leu Lys Lys Met 130
135 140Ile Leu Glu Asn Leu Gly Leu Glu Asn His Ile
Asp Glu Leu Leu Asp145 150 155
160Ile Asn Tyr Met Arg Phe Arg Phe Thr His Tyr Lys Gly Ser Ser Ile
165 170 175Ile Ser Gly Asp
His Glu Asn Asn Ile Lys Gln Asp Gly Leu Asn Gly 180
185 190His Thr Asp Gly Asn Phe Leu Thr Phe Ile Ser
Gln Asn Gln Val Asn 195 200 205Gly
Leu Gln Ile Asn Lys Asn Gly Glu Trp Ile Asp Val Asn Ile Ser 210
215 220Pro Asn Ser Tyr Val Val Leu Ser Gly Asp
Ser Phe Lys Ala Trp Thr225 230 235
240Asn Gly Arg Leu His Ser Pro Ile His Lys Val Lys Ile Phe Gly
Glu 245 250 255Ser Asp Arg
Phe Ser Ile Gln Leu Phe Ser Phe Ser Lys Pro Gly His 260
265 270Phe Ile Lys Ala Pro Lys Glu Leu Val Asp
Glu Glu His Pro Leu Leu 275 280
285Phe Lys Pro Phe Glu Met Val Gly Leu Ser Glu Tyr Val Thr Ser Gln 290
295 300Ala Gly Tyr Ala Ala Pro Ser Asp
Ala Phe Lys Ala Tyr Cys Gly Leu305 310
315 320332345DNASolanum tuberosum 33gaaactttga agtctttctt
gtttcctaaa tattcctcaa atggcatcta ccaaagttac 60gattcccacc atagattttt
gcgattctga gcttaaacca aacactccac aatgggaatc 120aacaaaagtt caagtttttg
aagccttaca agaatttggt tgttttgaag caatatataa 180caaagttcca aatgaaatta
gagagggcat gtttgatact ttaaaagaag tatttgattt 240tccactgccc aaattgatag
aatatagaga gaaacccttt catatatatg atgggcaaat 300tccaagtgta ccactctttg
gtagtgtgta ctctgctgat ttggtcctcc caaatagtgt 360tgaaacattt gccaatacct
tttggtctca tggaaaccct aattttaggt atgcattact 420tctttttcat taattatagg
gagtcacgat agtgtaagat gcattaaaag gagaaacgtt 480tcctagtaga attgtttcta
ttcctagggc tagaatcagg aacctttagt taaattaata 540gagataatat tcattccatc
actaaaggtg aaaattaagt atcttatatt gtccataaat 600tttatataga agagatgtga
gaattaataa aataaaaatt aaaaactcac gagtaaacaa 660aataattata tctaatttat
attaataaag aagagtattt gattattata ttaagtcaaa 720tgataagcta ataaatcaat
attaacaatc taatcacatg atttatataa aattggttat 780gggtatggga agggagggag
ggaagtacat ttcattgagg aacaatgcaa tagttagaca 840ggatttaaca tacttgaaca
agatatcata atctaaaatg attaaaaata attttttaat 900attatctaca catcgcgcga
atatatatat atatatatat taagtgtatt tcttaaataa 960tattgtatta ctatttatat
aaattttgta tgttttaatt ttgcagcaat gtggcaaagt 1020cctacttcaa gcaacttatg
gaattaaatg acatggttaa aaagatggtt ttggagagtc 1080ttgggctaaa aaattacatt
gatgaattct tgaattccaa tgtttatatg tcaagattta 1140ctaattacaa ggtaattaaa
ggtgaaaatg agaataaatc aggattacct tcccacacag 1200atagttccta cttgaccata
attaaacaaa atcaaaatgg attgcaagtt ctctacaaaa 1260atggagagtg gattgagctc
aatcgtcaaa atggactgca agttctctac aaaaatggag 1320agtggattga gctcaatcat
acttcaccaa attcctatat tgttttatca gaagatgttt 1380ttatggtaag ttattattta
ttttttatta cagaagtcaa aaatacacct aaacttttta 1440tttatatgta tttttgacgc
ttaactcttt atttttttgt gtgtaggggt ggtttgttgc 1500tatagtagag gagaataaaa
gaaatagatt ttttttgtat gattgattat tcaagcccaa 1560ctagaagcta agattagagg
agttttgaag caacgaaaaa aaatgttgtg tgtgatttat 1620agatattgat gcaggctcga
tccgtgaaag aaatcactaa tatttatatt agattagatc 1680gtttacctaa ctaaacatcc
cttgaagtac tgccctttct ccaaaccata tgtgaacgtc 1740aaatatttta tgcatcaacc
tgtctttttt tatttggccc caactaactt caatccacat 1800aaattattaa atcttgatat
tagttggaat aacatatctc ttttctgaga aattgaaaat 1860aatgccagaa ctatcataat
ctttttttaa aaaaattgtc ttgttattat cttattaatt 1920taaaattttc tttcttcaga
ggaaatttaa gtcaatcttt ttgttcctta attattaatt 1980aaacaaataa attcttatac
atacttttta tgtgttgatg ctatgaatta attatacagg 2040catggacaaa tgatagattg
acatctgctc aacacagggt tgtaacaaca ggagacaaag 2100aaagattctc tattcaagtt
ttttcctttc caaatccaga ttacactgtg aaggtcccac 2160aagaattagt ggatgaagaa
caccctttaa tgtacaagcc ttttaagatg tctgaatata 2220ataaatatat tatgttaggt
gctaaaaatg gattgggtgt caagaattat tgtggtcttt 2280aaaaatttag tagctatgaa
aatttattta tgtattgttt tgatgaataa aatgtatcag 2340atggc
234534990DNAArtificial
SequencecDNA of GAME31-like1of Solanum tuberosum 34atggcatcta ccaaagttac
gattcccacc atagattttt gcgattctga gcttaaacca 60aacactccac aatgggaatc
aacaaaagtt caagtttttg aagccttaca agaatttggt 120tgttttgaag caatatataa
caaagttcca aatgaaatta gagagggcat gtttgatact 180ttaaaagaag tatttgattt
tccactgccc aaattgatag aatatagaga gaaacccttt 240catatatatg atgggcaaat
tccaagtgta ccactctttg gtagtgtgta ctctgctgat 300ttggtcctcc caaatagtgt
tgaaacattt gccaatacct tttggtctca tggaaaccct 360aattttagca atgtggcaaa
gtcctacttc aagcaactta tggaattaaa tgacatggtt 420aaaaagatgg ttttggagag
tcttgggcta aaaaattaca ttgatgaatt cttgaattcc 480aatgtttata tgtcaagatt
tactaattac aaggtaatta aaggtgaaaa tgagaataaa 540tcaggattac cttcccacac
agatagttcc tacttgacca taattaaaca aaatcaaaat 600ggattgcaag ttctctacaa
aaatggagag tggattgagc tcaatcgtca aaatggactg 660caagttctct acaaaaatgg
agagtggatt gagctcaatc atacttcacc aaattcctat 720attgttttat cagaagatgt
ttttatggca tggacaaatg atagattgac atctgctcaa 780cacagggttg taacaacagg
agacaaagaa agattctcta ttcaagtttt ttcctttcca 840aatccagatt acactgtgaa
ggtcccacaa gaattagtgg atgaagaaca ccctttaatg 900tacaagcctt ttaagatgtc
tgaatataat aaatatatta tgttaggtgc taaaaatgga 960ttgggtgtca agaattattg
tggtctttaa 99035329PRTSolanum
tuberosum 35Met Ala Ser Thr Lys Val Thr Ile Pro Thr Ile Asp Phe Cys Asp
Ser1 5 10 15Glu Leu Lys
Pro Asn Thr Pro Gln Trp Glu Ser Thr Lys Val Gln Val 20
25 30Phe Glu Ala Leu Gln Glu Phe Gly Cys Phe
Glu Ala Ile Tyr Asn Lys 35 40
45Val Pro Asn Glu Ile Arg Glu Gly Met Phe Asp Thr Leu Lys Glu Val 50
55 60Phe Asp Phe Pro Leu Pro Lys Leu Ile
Glu Tyr Arg Glu Lys Pro Phe65 70 75
80His Ile Tyr Asp Gly Gln Ile Pro Ser Val Pro Leu Phe Gly
Ser Val 85 90 95Tyr Ser
Ala Asp Leu Val Leu Pro Asn Ser Val Glu Thr Phe Ala Asn 100
105 110Thr Phe Trp Ser His Gly Asn Pro Asn
Phe Ser Asn Val Ala Lys Ser 115 120
125Tyr Phe Lys Gln Leu Met Glu Leu Asn Asp Met Val Lys Lys Met Val
130 135 140Leu Glu Ser Leu Gly Leu Lys
Asn Tyr Ile Asp Glu Phe Leu Asn Ser145 150
155 160Asn Val Tyr Met Ser Arg Phe Thr Asn Tyr Lys Val
Ile Lys Gly Glu 165 170
175Asn Glu Asn Lys Ser Gly Leu Pro Ser His Thr Asp Ser Ser Tyr Leu
180 185 190Thr Ile Ile Lys Gln Asn
Gln Asn Gly Leu Gln Val Leu Tyr Lys Asn 195 200
205Gly Glu Trp Ile Glu Leu Asn Arg Gln Asn Gly Leu Gln Val
Leu Tyr 210 215 220Lys Asn Gly Glu Trp
Ile Glu Leu Asn His Thr Ser Pro Asn Ser Tyr225 230
235 240Ile Val Leu Ser Glu Asp Val Phe Met Ala
Trp Thr Asn Asp Arg Leu 245 250
255Thr Ser Ala Gln His Arg Val Val Thr Thr Gly Asp Lys Glu Arg Phe
260 265 270Ser Ile Gln Val Phe
Ser Phe Pro Asn Pro Asp Tyr Thr Val Lys Val 275
280 285Pro Gln Glu Leu Val Asp Glu Glu His Pro Leu Met
Tyr Lys Pro Phe 290 295 300Lys Met Ser
Glu Tyr Asn Lys Tyr Ile Met Leu Gly Ala Lys Asn Gly305
310 315 320Leu Gly Val Lys Asn Tyr Cys
Gly Leu 325361897DNASolanum tuberosum 36ttattatttg
cacaaaaaat acaaacaaag catgaattcc catcgaaatt actcactgtt 60acaacaattc
aaacataaga tacacactac taaagaaaca cgaatttcga caagcattct 120gttagaaatc
ccatatatac ttacagtatt ctaacaagaa cgttcataaa aaaatcacgt 180ttttttattc
tagcatatat aaaacaaaga actctaaagc taaagataca cactattata 240aaaacacgaa
ttccaaatga aatccattgg aaatgatgaa gacattttcg atgaatattc 300tgttagaaat
cccaaatata ctaacagtac tctgacaaaa atgttcatta gaaattcacg 360tttatcatat
caaagaccac aataagcctt gaaagcatca ctgggagctg catagccagc 420ttgggaagta
acatactcag ataatccaac catttcaaat ggcttgaaga gtaaagggtg 480ttcttcatcc
acaagttctt ttggggcctt tataaagtga cctggttttg agaatgaaaa 540taattgaatt
gagaatctat cactttcacc aaatattttt accttgtgga tgggagaatg 600caatcgacca
tttgtccatg cctgtataaa ttcacgtcgt cagtgcataa aactcaaaca 660catttatttg
aaggatccaa catttttaga gattcaaaaa gcatagactc caacaaatat 720caaaattcat
ttttcagttt tgcatgaaaa tattaaatat gtaggtagtt ccatttaata 780ttcgagaaac
ataggttaat tccaacaaat atgaagattc attttcaatt ttgcatcaag 840atattaaacc
taaattttgt ttggtatatt ccaaccttgg aaatattctt cacaaatatc 900gttaggtatg
cgtcagatcc tctaaaatct atattttgtt tttgaaggtg caataataat 960atttttgaag
agttcgagta acatggattt caacaaagta atatgactag ctaaaaaaat 1020aaaatgagta
acacttactt tgaatgaatc accagacaaa acaacataag aatttggtga 1080aatattgaca
tcaatccact ctccattttt gttgatttgc aaaccattga cttgattttg 1140tgatataaaa
gtcaagaagt taccatctgt gtggccattc aatccatctt gtttaatatt 1200attttcatga
tctccactaa taattgatga tcccttgtaa tgtgtaaatc taaatctcat 1260ataattaata
tccagcaatt catcaatatg attttctaat cccaaattct ccaaaatcat 1320ctttttcaac
atttcatcca attccataag tggatttgag taagctttta ccaaattgct 1380gcaaaaattt
atcactatct caaaaataac tttctcgcta ctccacgact ctaatcaatg 1440cacaaaataa
ttttatttta aaaaataaaa taaagtagac ataccagaaa tcaggattac 1500catgaggcca
aaagatatta gcaaaagttt caacattttg aggattaagc aaatcaggaa 1560tacacaaact
ctcataaaat ggcaagtgtg gaatcattcc tacatagcca tgtaatgtta 1620tatctgaata
atttttcact ttggtctcta aaggaaattg aaatatttct tttgtaatac 1680caaaaatacc
ctctctaatt tcatttggaa ttttatcata tgttgcttca aaacaaccat 1740attcttttaa
agcttcaaaa acttgaactt ttgtggattc ccatagtgga gtgtttggtt 1800ttagttctag
attagaaaaa tctatggtgg gaatcttaac tttggtagat gccatttgaa 1860agaaacaaag
aaggaattaa agacttcaca atgtgaa
189737339DNAArtificial SequencecDNA of GAME31-like2of Solanum tuberosum
37atgattccac acttgccatt ttatgggagt ttgtgtattc ctgatttgct taatcctcaa
60aatgttgaaa cttttgctaa tatcttttgg cctcatggta atcctgattt ctgcaatttg
120gtaaaagctt actcaaatcc acttatggaa ttggatgaat tgttgaaaag gatgattttg
180gagaatttgg gattagaaaa tcatattgat gaattgttgg atcctaatta tatgagattt
240agatttacac attacaaggg atcatcaatt attagtggag atcatgaaaa taatattaaa
300catgatggat tgaatgccac acagatggta gcttcttga
33938112PRTSolanum tuberosum 38Met Ile Pro His Leu Pro Phe Tyr Gly Ser
Leu Cys Ile Pro Asp Leu1 5 10
15Leu Asn Pro Gln Asn Val Glu Thr Phe Ala Asn Ile Phe Trp Pro His
20 25 30Gly Asn Pro Asp Phe Cys
Asn Leu Val Lys Ala Tyr Ser Asn Pro Leu 35 40
45Met Glu Leu Asp Glu Leu Leu Lys Arg Met Ile Leu Glu Asn
Leu Gly 50 55 60Leu Glu Asn His Ile
Asp Glu Leu Leu Asp Pro Asn Tyr Met Arg Phe65 70
75 80Arg Phe Thr His Tyr Lys Gly Ser Ser Ile
Ile Ser Gly Asp His Glu 85 90
95Asn Asn Ile Lys His Asp Gly Leu Asn Ala Thr Gln Met Val Ala Ser
100 105 110393623DNASolanum
tuberosummisc_feature(677)..(1284)n is a, c, g, or
tmisc_feature(1884)..(1901)n is a, c, g, or t 39attttttaat aaaaataata
cagtacaata cattacaata caacgcaaca caatacaata 60cgttatgtaa tcatatgcaa
taaccattca aatataaatt ttcaaccacc catacatacg 120atacatttta ttcataaaga
aaatacacat atataaattt tcatacccta caaaaatttt 180aaagaccaca ataattcttg
agattaattc catttttatc acctgacata gtttatttat 240gaaattcaag caagttaaaa
ggcttgaaga gtaaagggtg gtcttcatcc actaattctt 300ttggggtcct tcacagtata
atctggatgt ggtatggaaa ataattgaat agataatcta 360tctttgtctc ctgttggtac
tactctgtgt tcagcagatg tcaaactatt atttgtccat 420gcctgtataa atccacaaca
tcgacacata aaaagcatta gtgatttctt tcacagagaa 480agggcagcac ctcaagggga
tgttaggaaa acaatctaat ctaatagaaa atattagtga 540ttttttctcg atcaagcccg
catcgtaatc tatatatcac atacaaacaa tcttatcgtt 600acttcaaaac tgctctgatc
ttagcttcta gttgggctta aataatcaac catacaaaaa 660aaatctctat ttctttnnnn
nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn 720nnnnnnnnnn nnnnnnnnnn
nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn 780nnnnnnnnnn nnnnnnnnnn
nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn 840nnnnnnnnnn nnnnnnnnnn
nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn 900nnnnnnnnnn nnnnnnnnnn
nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn 960nnnnnnnnnn nnnnnnnnnn
nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn 1020nnnnnnnnnn nnnnnnnnnn
nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn 1080nnnnnnnnnn nnnnnnnnnn
nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn 1140nnnnnnnnnn nnnnnnnnnn
nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn 1200nnnnnnnnnn nnnnnnnnnn
nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn 1260nnnnnnnnnn nnnnnnnnnn
nnnnggtgtg tttggtacga aggaaaatat tttctggaaa 1320atgtttttta atttcccatg
tttggttgac tttaattatt tggaaaatgt tttccaaatc 1380aacttatttt cctcaaattt
aaggaaaatg atttccctta aaaattaagg aaaacatttt 1440cgaaacttct acttcatcct
taaattataa tattttttta cccctactac caaaccagcc 1500cgccacccct gtcaaatttt
attttattta aaaaattact tttgaaaaat atttcagggt 1560cggaagtttg gctggggtcc
taggtcagat ctctaggtcg gattttgaac ggtcatcaag 1620gtcatgtcct agttcgggtg
ttagggtcgg gtcctagatt gattattggg attgattttc 1680gagttaaaag ttattttcct
aaagagtatt ttctagtctt aagcgaaaaa taaaagatat 1740tttctggaaa aaaaattcat
tcaccaacca aacattaaaa aatagtttct actcatcaac 1800taaatatgag aaaataagtt
agaaatccac ttgttttcca agaaaacatt ttccttcata 1860ccaaacacac ccttaatata
tatnnnnnnn nnnnnnnnnn nttatatatg tatagatagc 1920tagtatacat actcgagcga
tgtgcggaaa atattaatat gttattttta atcttacccc 1980tacccatgcc cctacccgac
cttccccatt caaaaaaata aattaaaatt tttaaaattt 2040caaatatatt tttatcacta
ccaccaaact agctcccccg cccccctccc ctcaaacata 2100aaaaaaaaaa attaaaatta
tttttgaaaa atttttaaat cttaaatttt ttttacctca 2160ccaaccccta ccacccctac
tcccttcccc ctcattttta atttcccatg tttggttgac 2220tttaatgatt tggaaaatgt
tttccaaatc aacttatttt cctcaaattt aaggaaaatg 2280attatcctaa aagttatttt
cctaaagagt attttctagt ctcaagagaa aataaaagat 2340attttttcag aaaataattt
tcattcacca accaaacatg agaaaataag ttagaaatcc 2400acttgttttc caagaaaaca
ttttccttca taccaaacac acccttaata tataatgtat 2460atatacctag tatacatact
cgcgtgatgt gtgaaaaata tttaaatgtt attttaaatc 2520attttagatt gtgatatctt
gttcgagcat gttaaatcac gtccaactat tgcattgtta 2580ctcaatgaaa tgtactcccc
tccatccctt cacatacccg taaccaattc tatatgaata 2640gcgacaatga atcatgtgat
tagattgtta gtattgattt tattagctta tcacttggat 2700ataattatta aatactcttc
taattaatat aaattagata tatttatttt gtttactcgt 2760gagttcttaa tttttatttt
attaatgatc acatctcttt tatataaaat gtatggacaa 2820taagatactt aattttcacc
tttagtgatg gaatgaatat tatctctata atttaactaa 2880agattcatga ttctagcctt
aggaataaaa acaattctag taggaaacgt ttctcctttt 2940aatgtgtctt acactatcgt
gactccatat tattaatctg aatcccaaaa taaataccga 3000atacataatg aaaaaaaaaa
aatctcctac aaatatatga gcaagaataa ttggtgtact 3060aacatgacta aaactaaatg
atatcaccta cataaatctt attctttcaa atatcattaa 3120tgaaaaatga ctttcataat
accgagcaca ttatatgtaa ttaaaagaag taatacatac 3180ctaaagttag ggtttccatc
agaccaaaag gtattggcaa atgtttcaat actatttggg 3240aggaccaaat cagcagagct
cacactacca tagagtggta tacttggaat tttcccatca 3300tatatatgaa agggtttttc
tctatattct atcaatttgg acaatggaaa atcaaatact 3360tcttttaaat tatcaaacat
gccctctcta atttcatttg gaactttgtc atatattgct 3420tcaaaacaac caaattcttt
taaggcttca aaaacttgaa cttttgttga ttcccattgt 3480ggagtgtttg gttttagctc
aagattgcaa aaatctatgg tgggaatctt acctttagta 3540gatgccattg atgaataaat
taaaaagaga ggaaatagaa agaaataaag aaggagaaat 3600actttacaat atgaaaatta
aag 362340432DNAArtificial
SequencecDNA of GAME31-like3of Solanum tuberosum 40atggcatcta ctaaaggtaa
gattcccacc atagattttt gcaatcttga gctaaaacca 60aacactccac aatgggaatc
aacaaaagtt caagtttttg aagccttaaa agaatttggt 120tgttttgaag caatatatga
caaagttcca aatgaaatta gagagggcat gtttgataat 180ttaaaagaag tatttgattt
tccattgtcc aaattgatag aatatagaga aaaacccttt 240catatatatg atgggaaaat
tccaagtata ccactctatg gtagtgtgag ctctgctgat 300ttggtcctcc caaatagtgt
tgaaacattt gccaatacct tttggtctga tggaaaccct 360aactttaggt atgtattact
tcttttaatt atatataatg tgcttggtat tatgaaagtc 420atttttcatt aa
43241143PRTSolanum tuberosum
41Met Ala Ser Thr Lys Gly Lys Ile Pro Thr Ile Asp Phe Cys Asn Leu1
5 10 15Glu Leu Lys Pro Asn Thr
Pro Gln Trp Glu Ser Thr Lys Val Gln Val 20 25
30Phe Glu Ala Leu Lys Glu Phe Gly Cys Phe Glu Ala Ile
Tyr Asp Lys 35 40 45Val Pro Asn
Glu Ile Arg Glu Gly Met Phe Asp Asn Leu Lys Glu Val 50
55 60Phe Asp Phe Pro Leu Ser Lys Leu Ile Glu Tyr Arg
Glu Lys Pro Phe65 70 75
80His Ile Tyr Asp Gly Lys Ile Pro Ser Ile Pro Leu Tyr Gly Ser Val
85 90 95Ser Ser Ala Asp Leu Val
Leu Pro Asn Ser Val Glu Thr Phe Ala Asn 100
105 110Thr Phe Trp Ser Asp Gly Asn Pro Asn Phe Arg Tyr
Val Leu Leu Leu 115 120 125Leu Ile
Ile Tyr Asn Val Leu Gly Ile Met Lys Val Ile Phe His 130
135 140422345DNASolanum tuberosum 42gaaactttga
agtctttctt gtttcctaaa tattcctcaa atggcatcta ccaaagttac 60gattcccacc
atagattttt gcgattctga gcttaaacca aacactccac aatgggaatc 120aacaaaagtt
caagtttttg aagccttaca agaatttggt tgttttgaag caatatataa 180caaagttcca
aatgaaatta gagagggcat gtttgatact ttaaaagaag tatttgattt 240tccactgccc
aaattgatag aatatagaga gaaacccttt catatatatg atgggcaaat 300tccaagtgta
ccactctttg gtagtgtgta ctctgctgat ttggtcctcc caaatagtgt 360tgaaacattt
gccaatacct tttggtctca tggaaaccct aattttaggt atgcattact 420tctttttcat
taattatagg gagtcacgat agtgtaagat gcattaaaag gagaaacgtt 480tcctagtaga
attgtttcta ttcctagggc tagaatcagg aacctttagt taaattaata 540gagataatat
tcattccatc actaaaggtg aaaattaagt atcttatatt gtccataaat 600tttatataga
agagatgtga gaattaataa aataaaaatt aaaaactcac gagtaaacaa 660aataattata
tctaatttat attaataaag aagagtattt gattattata ttaagtcaaa 720tgataagcta
ataaatcaat attaacaatc taatcacatg atttatataa aattggttat 780gggtatggga
agggagggag ggaagtacat ttcattgagg aacaatgcaa tagttagaca 840ggatttaaca
tacttgaaca agatatcata atctaaaatg attaaaaata attttttaat 900attatctaca
catcgcgcga atatatatat atatatatat taagtgtatt tcttaaataa 960tattgtatta
ctatttatat aaattttgta tgttttaatt ttgcagcaat gtggcaaagt 1020cctacttcaa
gcaacttatg gaattaaatg acatggttaa aaagatggtt ttggagagtc 1080ttgggctaaa
aaattacatt gatgaattct tgaattccaa tgtttatatg tcaagattta 1140ctaattacaa
ggtaattaaa ggtgaaaatg agaataaatc aggattacct tcccacacag 1200atagttccta
cttgaccata attaaacaaa atcaaaatgg attgcaagtt ctctacaaaa 1260atggagagtg
gattgagctc aatcgtcaaa atggactgca agttctctac aaaaatggag 1320agtggattga
gctcaatcat acttcaccaa attcctatat tgttttatca gaagatgttt 1380ttatggtaag
ttattattta ttttttatta cagaagtcaa aaatacacct aaacttttta 1440tttatatgta
tttttgacgc ttaactcttt atttttttgt gtgtaggggt ggtttgttgc 1500tatagtagag
gagaataaaa gaaatagatt ttttttgtat gattgattat tcaagcccaa 1560ctagaagcta
agattagagg agttttgaag caacgaaaaa aaatgttgtg tgtgatttat 1620agatattgat
gcaggctcga tccgtgaaag aaatcactaa tatttatatt agattagatc 1680gtttacctaa
ctaaacatcc cttgaagtac tgccctttct ccaaaccata tgtgaacgtc 1740aaatatttta
tgcatcaacc tgtctttttt tatttggccc caactaactt caatccacat 1800aaattattaa
atcttgatat tagttggaat aacatatctc ttttctgaga aattgaaaat 1860aatgccagaa
ctatcataat ctttttttaa aaaaattgtc ttgttattat cttattaatt 1920taaaattttc
tttcttcaga ggaaatttaa gtcaatcttt ttgttcctta attattaatt 1980aaacaaataa
attcttatac atacttttta tgtgttgatg ctatgaatta attatacagg 2040catggacaaa
tgatagattg acatctgctc aacacagggt tgtaacaaca ggagacaaag 2100aaagattctc
tattcaagtt ttttcctttc caaatccaga ttacactgtg aaggtcccac 2160aagaattagt
ggatgaagaa caccctttaa tgtacaagcc ttttaagatg tctgaatata 2220ataaatatat
tatgttaggt gctaaaaatg gattgggtgt caagaattat tgtggtcttt 2280aaaaatttag
tagctatgaa aatttattta tgtattgttt tgatgaataa aatgtatcag 2340atggc
234543852DNAArtificial SequencecDNA of GAME31-like4of Solanum tuberosum
43atggcatcta ccaaagttac gattcccacc atagattttt gcgattctga gcttaaacca
60aacactccac aatgggaatc aacaaaagtt caagtttttg aagccttaca agaatttggt
120tgttttgaag caatatataa caaagttcca aatgaaatta gagagggcat gtttgatact
180ttaaaagaag tatttgattt tccactgccc aaattgatag aatatagaga gaaacccttt
240catatatatg atgggcaaat tccaagtgta ccactctttg gtagtgtgta ctctgctgat
300ttggtcctcc caaatagtgt tgaaacattt gccaatacct tttggtctca tggaaaccct
360aattttagca atgtggcaaa gtcctacttc aagcaactta tggaattgaa tgacatggtg
420gaaaagatgg ttttggagag tcttgggcta aaaaattaca ctgatgaatt cttgaattcc
480aatgtttata tgtcaagatt tactaattac aaggtaatta aaggtgaaaa tgagaataaa
540tcagcattac cttcacacac agatagttcc tacttgacca taattaaaca aaatcaaaat
600ggattgcaag catggacaaa tgatagattg acatctgctc aacacagggt tgtaacaaca
660ggagacaaag atagattctc tgttcaatta ttttccctcc taaatccaga ttatactgtg
720aaggtcccaa aagaattagt ggatgaagaa caccctttaa tgtacaagcc ttttaagatg
780cctgaatata ataaatatct tatgttaggt gctaaaaatg gattgggtgt caagaattat
840tgtggtcttt aa
85244168PRTSolanum tuberosum 44Met Ile Ser Cys Ser Gly Leu Lys Asn Tyr
Ile Asp Glu Phe Leu Asn1 5 10
15Ser Asn Val Phe Met Ser Arg Phe Thr Asn Tyr Arg Val Ile Lys Gly
20 25 30Glu Asn Glu Asn Lys Ser
Ala Leu Pro Ser His Thr Asp Ser Ser Tyr 35 40
45Leu Thr Ile Ile Lys Gln Asn Gln Asn Gly Leu Gln Val Leu
Tyr Lys 50 55 60Asn Gly Glu Trp Ile
Glu Leu Asn His Thr Ser Pro Asn Ser Tyr Ile65 70
75 80Val Leu Ser Glu Asp Val Phe Met Ala Trp
Thr Asn Asp Arg Leu Thr 85 90
95Ser Ala Gln His Arg Val Val Thr Thr Gly Asp Lys Asp Arg Phe Ser
100 105 110Ile Gln Val Phe Ser
Phe Pro Asn Pro Asp Tyr Thr Val Lys Val Pro 115
120 125Gln Glu Leu Val Asp Glu Glu His Pro Leu Met Phe
Lys Pro Phe Lys 130 135 140Leu Pro Glu
Phe Asn Lys Tyr Ile Lys Leu Gly Ala Lys Asn Gly Pro145
150 155 160Gly Leu Lys Asn Tyr Cys Gly
Phe 165452345DNASolanum tuberosum 45gaaactttga agtctttctt
gtttcctaaa tattcctcaa atggcatcta ccaaagttac 60gattcccacc atagattttt
gcgattctga gcttaaacca aacactccac aatgggaatc 120aacaaaagtt caagtttttg
aagccttaca agaatttggt tgttttgaag caatatataa 180caaagttcca aatgaaatta
gagagggcat gtttgatact ttaaaagaag tatttgattt 240tccactgccc aaattgatag
aatatagaga gaaacccttt catatatatg atgggcaaat 300tccaagtgta ccactctttg
gtagtgtgta ctctgctgat ttggtcctcc caaatagtgt 360tgaaacattt gccaatacct
tttggtctca tggaaaccct aattttaggt atgcattact 420tctttttcat taattatagg
gagtcacgat agtgtaagat gcattaaaag gagaaacgtt 480tcctagtaga attgtttcta
ttcctagggc tagaatcagg aacctttagt taaattaata 540gagataatat tcattccatc
actaaaggtg aaaattaagt atcttatatt gtccataaat 600tttatataga agagatgtga
gaattaataa aataaaaatt aaaaactcac gagtaaacaa 660aataattata tctaatttat
attaataaag aagagtattt gattattata ttaagtcaaa 720tgataagcta ataaatcaat
attaacaatc taatcacatg atttatataa aattggttat 780gggtatggga agggagggag
ggaagtacat ttcattgagg aacaatgcaa tagttagaca 840ggatttaaca tacttgaaca
agatatcata atctaaaatg attaaaaata attttttaat 900attatctaca catcgcgcga
atatatatat atatatatat taagtgtatt tcttaaataa 960tattgtatta ctatttatat
aaattttgta tgttttaatt ttgcagcaat gtggcaaagt 1020cctacttcaa gcaacttatg
gaattaaatg acatggttaa aaagatggtt ttggagagtc 1080ttgggctaaa aaattacatt
gatgaattct tgaattccaa tgtttatatg tcaagattta 1140ctaattacaa ggtaattaaa
ggtgaaaatg agaataaatc aggattacct tcccacacag 1200atagttccta cttgaccata
attaaacaaa atcaaaatgg attgcaagtt ctctacaaaa 1260atggagagtg gattgagctc
aatcgtcaaa atggactgca agttctctac aaaaatggag 1320agtggattga gctcaatcat
acttcaccaa attcctatat tgttttatca gaagatgttt 1380ttatggtaag ttattattta
ttttttatta cagaagtcaa aaatacacct aaacttttta 1440tttatatgta tttttgacgc
ttaactcttt atttttttgt gtgtaggggt ggtttgttgc 1500tatagtagag gagaataaaa
gaaatagatt ttttttgtat gattgattat tcaagcccaa 1560ctagaagcta agattagagg
agttttgaag caacgaaaaa aaatgttgtg tgtgatttat 1620agatattgat gcaggctcga
tccgtgaaag aaatcactaa tatttatatt agattagatc 1680gtttacctaa ctaaacatcc
cttgaagtac tgccctttct ccaaaccata tgtgaacgtc 1740aaatatttta tgcatcaacc
tgtctttttt tatttggccc caactaactt caatccacat 1800aaattattaa atcttgatat
tagttggaat aacatatctc ttttctgaga aattgaaaat 1860aatgccagaa ctatcataat
ctttttttaa aaaaattgtc ttgttattat cttattaatt 1920taaaattttc tttcttcaga
ggaaatttaa gtcaatcttt ttgttcctta attattaatt 1980aaacaaataa attcttatac
atacttttta tgtgttgatg ctatgaatta attatacagg 2040catggacaaa tgatagattg
acatctgctc aacacagggt tgtaacaaca ggagacaaag 2100aaagattctc tattcaagtt
ttttcctttc caaatccaga ttacactgtg aaggtcccac 2160aagaattagt ggatgaagaa
caccctttaa tgtacaagcc ttttaagatg tctgaatata 2220ataaatatat tatgttaggt
gctaaaaatg gattgggtgt caagaattat tgtggtcttt 2280aaaaatttag tagctatgaa
aatttattta tgtattgttt tgatgaataa aatgtatcag 2340atggc
234546507DNAArtificial
SequencecDNA of GAME31-like5of Solanum tuberosum 46atgatatctt gttctgggct
aaaaaattac attgatgaat tcttgaattc caatgttttt 60atgtcaagat ttactaatta
cagggtaatt aaaggtgaaa atgagaataa atcagcacta 120ccttcccaca cagatagttc
ctacttgacc ataattaaac aaaatcaaaa tggattgcaa 180gttctctaca aaaatggaga
gtggattgag ctcaatcata cttcaccaaa ttcctatatt 240gttttatcag aagatgtttt
tatggcatgg acaaatgata gattgacatc tgctcaacac 300agggttgtaa caacaggaga
caaagataga ttctctattc aagttttttc ctttccaaat 360ccagattaca ctgtgaaggt
cccacaagaa ttagtggatg aagaacaccc tttaatgttc 420aagcctttta agttgcctga
atttaataaa tatattaagt taggtgctaa aaatggaccg 480ggtctcaaga attattgtgg
tttttaa 50747168PRTSolanum
tuberosum 47Met Ile Ser Cys Ser Gly Leu Lys Asn Tyr Ile Asp Glu Phe Leu
Asn1 5 10 15Ser Asn Val
Phe Met Ser Arg Phe Thr Asn Tyr Arg Val Ile Lys Gly 20
25 30Glu Asn Glu Asn Lys Ser Ala Leu Pro Ser
His Thr Asp Ser Ser Tyr 35 40
45Leu Thr Ile Ile Lys Gln Asn Gln Asn Gly Leu Gln Val Leu Tyr Lys 50
55 60Asn Gly Glu Trp Ile Glu Leu Asn His
Thr Ser Pro Asn Ser Tyr Ile65 70 75
80Val Leu Ser Glu Asp Val Phe Met Ala Trp Thr Asn Asp Arg
Leu Thr 85 90 95Ser Ala
Gln His Arg Val Val Thr Thr Gly Asp Lys Asp Arg Phe Ser 100
105 110Ile Gln Val Phe Ser Phe Pro Asn Pro
Asp Tyr Thr Val Lys Val Pro 115 120
125Gln Glu Leu Val Asp Glu Glu His Pro Leu Met Phe Lys Pro Phe Lys
130 135 140Leu Pro Glu Phe Asn Lys Tyr
Ile Lys Leu Gly Ala Lys Asn Gly Pro145 150
155 160Gly Leu Lys Asn Tyr Cys Gly Phe
165482762DNASolanum tuberosum 48cactaatata tttttaataa aaacaataca
gtacaataca ttacaataca acgcaacaca 60acacaataca atacgttatg aaatcatatg
caataaccac acaaatataa attttcaacc 120acccatgcat acgatacatt gtattcataa
agaaaataca cataaataaa taccctacta 180aatttttaaa gaccacaata attcttgaga
ttaattcaat ttttattacc tgacatagtt 240tatttatgaa attcaagcaa gttaaaaggc
ttgaagagta agggtggtct tcatccacta 300attattttgg ggccttcaca gcaaaatctt
gatttgggaa aggaaaataa ttgaatagat 360agtctatctt tgtctcctgt tgttactact
ctgtgttcag cagatgtcaa actatcattt 420gtccatgcct gtataaatcc acaacatcga
cacataaaaa gtattagtga tttcttttca 480cagagaaagg gcaacacctc aagggatgtt
aggaaaacaa tctaatctaa tacaaaatat 540tagtgatttt ttctcgatca agcccgcatc
gtaatctata aatcacatac aaacaatctt 600atcgttactt caaaactgct ctgatcttag
cttctagttg ggcttgaata atcaaccata 660caaaaaaatc tctatttctt ttattctcct
cttctatagc atcaacccac cccctcacac 720acaaaataat aaagagttaa gcgtcaaaaa
tacacataaa taaataattt aggtgtattt 780tttaccttga tactcaaaaa taaataataa
cttaccctga aagcatctgc tgataaaaca 840atataggaat ttggtgttgt attattgagc
tctatccact ctccattttt gtagagaact 900tgcaatccat tttgattttg tttaattata
gtcaagtagc cactatctgt gtggggaggt 960aattctgatc tattctcatc ttcaccttta
attaccttgt aattagtaaa tcttgacaca 1020aaaacattgg aattcaagat ttcatcaatg
taatttgttt tcccaagact ctccaaaacc 1080attttttcca ccatgtcatt caattccata
agttgcttga agtaggactt tgccacattg 1140ctgccaaatt aaaacataca aaacttatat
aatggtaatg caatattgtg atattactca 1200aaattatgta agaaatacac ttagggtgtg
tttggtacga aggaaaatat tttctagaaa 1260atgtttttta atttcccatg tttggttgac
tttaatgatt tggaaaatgt tttccaaatc 1320aacttatttt cctcaaattt aaggaaaatg
attatcctaa aagttatttt cctaaagagt 1380attttctagt cttaagtgaa aaataagtta
gaaatccact tgttttccaa gaaaacattt 1440tccttcatac caaacacacc cttaatatat
aatgtatata tacctagtat acatactcgc 1500gcgatgtgtg aaaaatattt aaatgttatt
ttaatcattt tagattgtga tatcttgttc 1560gagcatgtta aatcatgtcc aactattgca
ttgttactca atgaaatgta ctcccctcca 1620tcccttcaca tacccgtaac caattctata
tgaatagcga tgtgtgaaaa atatttaaat 1680gttattttta atcattttag attgtgatat
cttgttcgag catgttaaat catgtccaac 1740tattgcattg ttactcaatg aaatgtactc
ccctccatcc cttcacatac ccgtaaccaa 1800ttctatatga atagcgacaa tgaatcatgt
gattagattg ttaatattga ttttattagc 1860ttatcacttg gatataatta ttaaatactc
ttctaattaa tataaattag atatatttat 1920tttgtttact cgtgagttct taatttttat
tttattaatg atcacatctc ttttatataa 1980aatgtatgga caataagata cttaattttc
acctttagtg atggaatgaa tattatctct 2040ataatttaac taaagattcc tgattctagc
cttaggaata aaaacaattc tagtaggaaa 2100cgtttctcct tttaatgtgt cttacactat
cgtgactcca tattattaaa tctgaaatcc 2160caaaaataaa taccgaatac ataatgaaaa
aaaaaaaatc tcctacaaaa tatatgagca 2220agaataattg gtgtactaac atgactaaac
taaatgatat cacctacata aatcttattc 2280tttcaaatat cattaatgaa aaataacttt
cataataccg aacacattat atataattaa 2340aagaagtaat acatacctaa agttagggtt
tccatcagac caaaaggtat tggcaaatgt 2400ttcaacacta tttgggagga ccaaatcagc
agagctcaca ctaccataga gtggtatact 2460tggaatttgc ccatcatata aatggggttt
ttctctatat tctatcaatt tggacactgg 2520aaaatcaaat acttctttta aagtatcaaa
catgccctct ctaatttcat ttggaacttt 2580gtcatatatt gcttcaaaac aaccaaattc
ttttaaggct tcaaaaactt gaacttttgt 2640tgattcccat tgtggagtgt ttggttttag
ctcaagattg caaaaatcta tggtgggaat 2700cttaactttg gtagatgcca ttgatgaata
aattaaatag agaggaaata gaaagaaata 2760aa
276249828DNAArtificial SequencecDNA of
GAME31-like6 of Solanum tuberosum 49atggcatcta ccaaagttaa gattcccacc
atagattttt gcaatcttga gctaaaacca 60aacactccac aatgggaatc aacaaaagtt
caagtttttg aagccttaaa agaatttggt 120tgttttgaag caatatatga caaagttcca
aatgaaatta gagagggcat gtttgatact 180ttaaaagaag tatttgattt tccagtgtcc
aaattgatag aatatagaga aaaaccccat 240ttatatgatg ggcaaattcc aagtatacca
ctctatggta gtgtgagctc tgctgatttg 300gtcctcccaa atagtgttga aacatttgcc
aatacctttt ggtctgatgg aaaccctaac 360tttagcaatg tggcaaagtc ctacttcaag
caacttatgg aattgaatga catggtggaa 420aaaatggttt tggagagtct tgggaaaaca
aattacattg atgaaatctt gaattccaat 480gtttttgtgt caagatttac taattacaag
gtaattaaag gtgaagatga gaatagatca 540gaattacctc cccacacaga tagtggctac
ttgactataa ttaaacaaaa tcaaaatgga 600ttgcaagttc tctacaaaaa tggagagtgg
atagagctca ataatacaac accaaattcc 660tatattgttt tatcagcaga tgctttcagg
gcatggacaa atgatagttt gacatctgct 720gaacacagag tagtaacaac aggagacaaa
gatagactat ctattcaatt attttccttt 780cccaaatcaa gattttgctg tgaaggcccc
aaaataatta gtggatga 82850275PRTSolanum tuberosum 50Met
Ala Ser Thr Lys Val Lys Ile Pro Thr Ile Asp Phe Cys Asn Leu1
5 10 15Glu Leu Lys Pro Asn Thr Pro
Gln Trp Glu Ser Thr Lys Val Gln Val 20 25
30Phe Glu Ala Leu Lys Glu Phe Gly Cys Phe Glu Ala Ile Tyr
Asp Lys 35 40 45Val Pro Asn Glu
Ile Arg Glu Gly Met Phe Asp Thr Leu Lys Glu Val 50 55
60Phe Asp Phe Pro Val Ser Lys Leu Ile Glu Tyr Arg Glu
Lys Pro His65 70 75
80Leu Tyr Asp Gly Gln Ile Pro Ser Ile Pro Leu Tyr Gly Ser Val Ser
85 90 95Ser Ala Asp Leu Val Leu
Pro Asn Ser Val Glu Thr Phe Ala Asn Thr 100
105 110Phe Trp Ser Asp Gly Asn Pro Asn Phe Ser Asn Val
Ala Lys Ser Tyr 115 120 125Phe Lys
Gln Leu Met Glu Leu Asn Asp Met Val Glu Lys Met Val Leu 130
135 140Glu Ser Leu Gly Lys Thr Asn Tyr Ile Asp Glu
Ile Leu Asn Ser Asn145 150 155
160Val Phe Val Ser Arg Phe Thr Asn Tyr Lys Val Ile Lys Gly Glu Asp
165 170 175Glu Asn Arg Ser
Glu Leu Pro Pro His Thr Asp Ser Gly Tyr Leu Thr 180
185 190Ile Ile Lys Gln Asn Gln Asn Gly Leu Gln Val
Leu Tyr Lys Asn Gly 195 200 205Glu
Trp Ile Glu Leu Asn Asn Thr Thr Pro Asn Ser Tyr Ile Val Leu 210
215 220Ser Ala Asp Ala Phe Arg Ala Trp Thr Asn
Asp Ser Leu Thr Ser Ala225 230 235
240Glu His Arg Val Val Thr Thr Gly Asp Lys Asp Arg Leu Ser Ile
Gln 245 250 255Leu Phe Ser
Phe Pro Lys Ser Arg Phe Cys Cys Glu Gly Pro Lys Ile 260
265 270Ile Ser Gly 275511429DNASolanum
tuberosum 51gcagcaatgt ggcaaagtcc tacttcaagc aacttatgga attgaatggc
atggtggaaa 60agatggtttt ggagagtctt gggctaaaaa attacattga tgaattcttg
aattccaatg 120tttatatgtc aagatttact aattacaagg taattaaagg tgaaaatgag
aataaatcag 180gattaccttc ccacacagat agttcctact tgaccataat taaacaaaat
caaaatggat 240tgcaagttct tctacaaaaa tggagagtgg attgagctca atcatacctc
accaaattcc 300tatattgttt tatcagcaga tgctcttatg gtaagttatt atttattttt
gattacagca 360gtcaaaaata cgcctaaact tctaatttat atgtattttt gacgctttaa
ctcattatta 420ttttttgtgt gtggggtggt ttgttgctat agtagaggag aataaaagaa
atagagattt 480tttttgtatg attgattatt caagcccaac tagaagctaa gattagagga
gttttcaacc 540aacgaaaaaa atgtttgtgt gtgatttata tatcatgatg caggctcaat
ccgtaaaaga 600aatcactaat atttgtatta gattagattg tttacctaac taacatccct
tgaagtgttg 660ccctttctcc aaaccctatg tgaacgtcaa atattttatg catcaacctg
tcttatttta 720tttgacctca actaacttca atccacaaaa aatattaaat cttgatatta
tttggaataa 780cgtatctctt tttctggaaa attgaaaatg ataccagaac tatcataata
attttttaaa 840ttgtcttgtt attatcttat taatttaaaa ttttcattct ccataggaaa
tttaagtcaa 900tctttttgtt ccttaattat taattaaaca aataaattct tatacatact
ttttatgtgt 960tgatgatatg aattaattat acaggcatgg acaaatgata gattgacatc
tgctcaacat 1020agggttgtaa caacaggaga caaagataga ttctctgttc aattattttc
cctcgtaaat 1080ccagattata ctttgaaggt cccaaaagaa ttagtggatg aagaacaccc
tttaatgtac 1140aagcctttta agatgcctga atataataaa tatcttatgt taggtgctaa
aaatggattg 1200ggtgtcaaga attattgtgg tctttaaaaa tttagtagct atgaaaattt
atttatgtat 1260tgttttgatg aataaaatgt atcagatggc tggttgaata ctttgaattt
atatttggat 1320ggttattacg tatgattgcg taaagtattg tattgtattt tattttgttg
tgttgttttg 1380tattgtgttg cgttgtatat attgttttga tgaataaaat atatgagtg
142952339DNAArtificial SequencecDNA of GAME31-like7 of Solanum
tuberosum 52atggattgca agttcttcta caaaaatgga gagtggattg agctcaatca
tacctcacca 60aattcctata ttgttttatc agcagatgct cttatggcat ggacaaatga
tagattgaca 120tctgctcaac atagggttgt aacaacagga gacaaagata gattctctgt
tcaattattt 180tccctcgtaa atccagatta tactttgaag gtcccaaaag aattagtgga
tgaagaacac 240cctttaatgt acaagccttt taagatgcct gaatataata aatatcttat
gttaggtgct 300aaaaatggat tgggtgtcaa gaattattgt ggtctttaa
33953112PRTSolanum tuberosum 53Met Asp Cys Lys Phe Phe Tyr
Lys Asn Gly Glu Trp Ile Glu Leu Asn1 5 10
15His Thr Ser Pro Asn Ser Tyr Ile Val Leu Ser Ala Asp
Ala Leu Met 20 25 30Ala Trp
Thr Asn Asp Arg Leu Thr Ser Ala Gln His Arg Val Val Thr 35
40 45Thr Gly Asp Lys Asp Arg Phe Ser Val Gln
Leu Phe Ser Leu Val Asn 50 55 60Pro
Asp Tyr Thr Leu Lys Val Pro Lys Glu Leu Val Asp Glu Glu His65
70 75 80Pro Leu Met Tyr Lys Pro
Phe Lys Met Pro Glu Tyr Asn Lys Tyr Leu 85
90 95Met Leu Gly Ala Lys Asn Gly Leu Gly Val Lys Asn
Tyr Cys Gly Leu 100 105
1105455DNAArtificial SequenceRF-Tomato-GAME31-Forward Primer 54tccgcgggtg
aaaacctgta cttccagggt gcatctatca aatcagttaa agttc
555557DNAArtificial SequenceRF-Tomato-GAME31-Reverse Primer 55gtggtggtgc
tcgagtgcgg ccgcaagctt tcaaacacca caataaatct tgaaaag
575655DNAArtificial SequenceRF-Eggplant-GAME31-Forward Primer
56tccgcgggtg aaaacctgta cttccagggt ggatctacca aatcaattaa agttc
555751DNAArtificial SequenceRF-Eggplant-GAME31-Reverse Primer
57gtggtggtgc tcgagtgcgg ccgcaagctt tcaaacacca caataagcct t
5158149DNAArtificial SequenceSlGAME31-RNAi 58gggtttcgtt ggaaattcgt
cttgtttttt tttttcaagt agtgtacatc ttatttttgg 60attgttgatg ttgagcgcta
atgtttaatt tgtttgtgtt ttgaagagga tgattatact 120ctttaagagg attcaccgta
atcttttag 14959966DNAArtificial
SequenceSlGAME31-Cosup 59atggcatcta tcaaatcagt taaagttcct actatagatt
tttccaatta tcaagagcta 60aaaccaaaca ctccactatg ggaatccaca aaaattcaag
tttttgaagc tttacaagaa 120tatggttgtt ttgaagcaat atatgataaa gtttcaaagg
aaattagaga ggaaacattt 180gatatgtcaa aagaaatatt tgaatttcct ttagagacta
aagtgaaaaa tatctcagaa 240aaaccaatgc atggctatat ggggatgatt ccacaattgc
cattgtatga gagtttgtgt 300attcctgatt tgcttaatcc tcaaagtctt gaaaaatttt
ctaatatctt ttggcctcag 360ggtaatcaac atttctgcaa tttgataaaa tcttattcta
atccacttgt ggaattggat 420gggatgttga aaaggatgat ttcggagaat ttgggattga
aaaatcacat tgatgaatta 480ttgaatgcca attacttcct atttagattt acacattata
agggatcatc aattgctagt 540ggagatgaaa ataataaagc tgctggattg ggtggccaca
cggatggtaa cttcttgact 600tttatatcgc aaaatcaagt taatggattg caaatcaaca
aaaatggaga atggattgat 660gtgattattt caccaaattc ttacgttgtt ttggccggtg
attccttcaa agcttggaca 720aatggtcgat tgcattcacc tctccacaga gtaacaatgt
ccggacaaaa tgatagactc 780tccattcaat tgttttcatt atcaaagcca ggtcacttca
tccaggcacc aaaagaacta 840gtagatgaag aacacccatt actcttcaag ccatttgaaa
ttcttgaatt attcaagtat 900ggtaccacag aagctggcta tacagctcct ccaagtgatc
ttttcaagat ttattgtggt 960gtttga
9666029DNAArtificial SequenceqRT-PCR forward
primer 60agtacaagta atcacgttgg ttcctatga
296134DNAArtificial SequenceqRT-PCR reverse primer 61cactagaaag
ttttttactt tataggtgag gaaa
346235DNAArtificial SequenceCloning SlGAME31 for RNAi forward primer
62aaaaagcggc cgcgggtttc gttggaaatt cgtct
356338DNAArtificial SequenceCloning SlGAME31 for RNAi reverse primer
63aaaaaggcgc gccctaaaag attacggtga atcctctt
386455DNAArtificial SequenceCloning SlGAME31 for Cosupression forward
primer 64ggggacaagt ttgtacaaaa aagcaggcta tggcatctat caaatcagtt aaagt
556554DNAArtificial SequenceCloning SlGAME31 for Cosupression
reverse primer 65ggggaccact ttgtacaaga aagctgggtt caaacaccac
aataaatctt gaaa 5466259PRTS. lycopersicum 66Met Ala Ser Lys Leu
Arg Leu Glu Gly Lys Val Ala Ile Ile Thr Gly1 5
10 15Gly Ala Ser Gly Ile Gly Glu Ala Ser Ala Arg
Leu Phe Val Gln His 20 25
30Gly Ala Arg Val Val Val Ala Asp Ile Gln Asp Glu Leu Gly Leu Gln
35 40 45Val Val Gln Ser Ile Gly Ile His
Lys Ala Thr Tyr Arg His Cys Asp 50 55
60Val Thr Asp Glu Lys Gln Val Glu Asp Thr Val Ala Tyr Ala Val Gln65
70 75 80Lys Tyr Ala Thr Leu
Asp Ile Met Phe Ser Asn Val Gly Thr Leu Asn 85
90 95Phe Cys Ser Val Leu Asp Met Asp Met Thr Ala
Phe Asp Glu Thr Met 100 105
110Thr Val Asn Val Arg Gly Ser Ala Leu Ala Val Lys His Ala Ala Arg
115 120 125Val Met Val Asp Lys Lys Ile
Arg Gly Ser Ile Ile Cys Asn Val Ser 130 135
140Leu Glu Gly Ile Leu Ala Gly Ala Ala Ser Leu Ala Tyr Ile Ala
Ser145 150 155 160Lys His
Ala Val Val Gly Ile Val Lys Ala Ala Ala Arg Glu Leu Gly
165 170 175Pro Tyr Gly Ile Arg Val Asn
Gly Val Ser Pro Tyr Gly Ile Ala Thr 180 185
190Pro Leu Val Cys Lys Ala Tyr Gly Leu Asp Ala Ala Pro Leu
Glu Ala 195 200 205Ala Ile Asn Gly
Asn Ala Asn Leu Lys Gly Val Thr Leu Ser Thr Met 210
215 220His Val Ala Gln Ser Ala Leu Phe Leu Ala Ser Asp
Glu Ser Ala Tyr225 230 235
240Thr Ser Gly Gln Asn Leu Ala Val Asp Gly Gly Leu Ser Ser Ile Leu
245 250 255Lys Leu Gln67259PRTS.
pennellii 67Met Ala Ser Lys Leu Arg Leu Glu Gly Lys Val Ala Ile Ile Thr
Gly1 5 10 15Gly Ala Ser
Gly Ile Gly Glu Ala Ser Ala Arg Leu Phe Val Gln His 20
25 30Gly Ala Arg Val Val Val Ala Asp Ile Gln
Asp Glu Leu Gly Leu Gln 35 40
45Val Val Gln Ser Ile Gly Ile His Lys Ala Thr Tyr Arg His Cys Asp 50
55 60Val Thr Asp Glu Lys Gln Val Glu Asp
Thr Val Ala Tyr Ala Val Gln65 70 75
80Lys Tyr Ala Thr Leu Asp Val Met Phe Ser Asn Val Gly Thr
Leu Asn 85 90 95Phe Cys
Ser Val Leu Asp Met Asp Met Thr Ala Phe Asp Glu Thr Met 100
105 110Thr Val Asn Val Arg Gly Ser Ala Leu
Ala Val Lys His Ala Ala Arg 115 120
125Val Met Val Asp Lys Lys Ile Arg Gly Ser Ile Ile Cys Asn Val Ser
130 135 140Leu Glu Gly Ile Leu Ala Gly
Ala Ala Ser Leu Ala Tyr Ile Ala Ser145 150
155 160Lys His Ala Val Val Gly Ile Val Lys Ala Ala Ala
Arg Glu Leu Gly 165 170
175Pro Tyr Gly Ile Arg Val Asn Gly Val Ser Pro Tyr Gly Ile Ala Thr
180 185 190Pro Leu Val Cys Lys Ala
Tyr Gly Leu Asp Ala Ala Pro Leu Glu Ala 195 200
205Ala Ile Asn Gly Asn Ala Asn Leu Lys Gly Val Thr Leu Ser
Thr Met 210 215 220His Val Ala Gln Ser
Ala Leu Phe Leu Ala Ser Asp Glu Ser Ala Tyr225 230
235 240Thr Ser Gly Gln Asn Leu Ala Val Asp Gly
Gly Leu Ser Ser Ile Leu 245 250
255Lys Leu Gln68236PRTC. annuum 68Leu Glu Gly Lys Val Ala Val Ile
Thr Gly Ala Ala Ser Gly Ile Gly1 5 10
15Glu Ala Ser Ala Arg Leu Phe Val Glu His Gly Ala Arg Val
Val Ile 20 25 30Ala Asp Ile
Gln Asp Glu Leu Gly Leu Gln Ile Ala Ala Ser Ile Gly 35
40 45Thr Asp Lys Ala Ser Tyr Ile His Cys Asp Val
Thr Asp Glu Lys Gln 50 55 60Val Glu
Glu Ala Val Ala Tyr Ala Val Glu Asn Ser Val Leu Asp Leu65
70 75 80Asp Val Lys Ala Phe Asp Glu
Thr Met Val Ile Asn Ala Arg Gly Ser 85 90
95Ala Val Ala Val Lys His Ala Ala Arg Val Met Val Glu
Lys Lys Ile 100 105 110Arg Gly
Ser Ile Ile Cys Thr Ala Ser Leu Glu Gly Ile Leu Ala Gly 115
120 125Ala Ala Ser Leu Ala Tyr Val Ser Ser Lys
His Ala Val Val Gly Leu 130 135 140Val
Lys Ala Ala Ala Arg Glu Leu Gly Val His Gly Ile Arg Val Asn145
150 155 160Gly Val Ser Pro Tyr Gly
Ile Ala Thr Pro Leu Val Cys Lys Ala Tyr 165
170 175Gly Leu Asp Ala Gly Pro Leu Glu Thr Ala Ile Tyr
Gly Asn Ala His 180 185 190Leu
Lys Gly Val Thr Leu Ser Thr Met His Val Ala Gln Ala Ala Leu 195
200 205Phe Leu Ala Ser Asp Glu Ser Ala Tyr
Ile Ser Gly Gln Asn Leu Ala 210 215
220Val Asp Gly Gly Leu Ser Ser Ile Leu Lys Leu Glu225 230
23569261PRTN. benthamiana 69Met Ala Asn Lys Leu Arg Leu
Glu Gly Lys Val Ala Val Ile Thr Gly1 5 10
15Gly Ala Ser Gly Ile Gly Glu Ala Thr Ala Arg Leu Phe
Val Glu His 20 25 30Gly Ala
Arg Val Val Ile Ala Asp Ile Gln Asp Glu Leu Gly Leu Gln 35
40 45Val Val Ala Ser Ile Gly Thr Asp Lys Ala
Ser Tyr Arg His Cys Asp 50 55 60Val
Thr Asp Glu Asn Lys Val Glu Glu Thr Val Ala Tyr Ala Val Glu65
70 75 80Lys Tyr Gly Thr Leu Asp
Ile Met Phe Ser Asn Val Gly Thr Leu Asn 85
90 95Phe Cys Ser Val Leu Asp Ile Asp Val Thr Ala Phe
Asp Lys Thr Met 100 105 110Ala
Leu Asn Val Arg Gly Thr Ala Leu Ala Val Lys His Ala Ala Arg 115
120 125Val Met Val Ala Lys Gln Val Lys Gly
Ser Ile Ile Cys Asn Ala Ser 130 135
140Ile Glu Ala Ile Leu Ala Gly Ala Ala Ser Leu Ala Tyr Val Ala Ser145
150 155 160Lys His Ala Val
Val Gly Ile Val Lys Ala Ala Ala Arg Glu Leu Gly 165
170 175Leu His Gly Ile Arg Val Asn Gly Val Ser
Pro Tyr Gly Ile Ala Thr 180 185
190Pro Leu Val Cys Lys Ala Tyr Gly Cys Glu Asp Ala Ala Ser Leu Glu
195 200 205Ala Gly Ile Ser Val Asn Ala
His Leu Lys Gly Val Thr Leu Ser Thr 210 215
220Glu His Ile Ala Gln Ala Ala Leu Phe Leu Ala Ser Asp Glu Ser
Ala225 230 235 240Tyr Ile
Ser Gly His Asn Leu Ala Val Asp Gly Gly Leu Thr Ser Met
245 250 255Leu Lys Leu Ser Tyr
26070258PRTS. melongena 70Met Ala Asn Lys Leu Lys Leu Glu Gly Lys Val Ala
Val Ile Thr Gly1 5 10
15Gly Ala Ser Gly Ile Gly Glu Glu Ser Ala Arg Leu Phe Val Glu His
20 25 30Gly Ala Arg Val Val Ile Ala
Asp Ile Gln Asp Asp Leu Gly Leu Glu 35 40
45Val Val Thr Ser Ile Gly Ala Asp Lys Ala Cys Tyr Arg His Cys
Asp 50 55 60Val Ser Glu Glu Lys Gln
Val Lys Glu Thr Val Ala Tyr Ala Val Glu65 70
75 80Lys Tyr Gly Thr Leu Asp Ile Met Phe Ser Asn
Ala Gly Thr Leu Gly 85 90
95Thr Leu Gly Ser Val Leu Glu Met Asp Met Thr Ala Phe Asp Met Thr
100 105 110Met Ala Val Asn Met Arg
Gly Ser Ala Leu Ala Val Lys His Ala Ala 115 120
125Arg Val Met Val Ala Asn Lys Ile Arg Gly Ser Ile Ile Cys
Thr Ala 130 135 140Ser Val Glu Ala Ile
Leu Ala Gly Ala Ala Pro Leu Ala Tyr Val Ala145 150
155 160Ser Lys His Ala Ile Leu Gly Val Met Lys
Ala Ala Ala Arg Glu Leu 165 170
175Gly Gln Tyr Gly Ile Arg Val Asn Cys Val Ser Pro Tyr Gly Ile Ala
180 185 190Thr Pro Leu Val Cys
Lys Ala Tyr His Ser Asp Ala Gly Ser Leu Glu 195
200 205Ala Ser Ile Tyr Glu Arg Ala His Leu Lys Gly Ile
Thr Leu Ser Thr 210 215 220Lys His Ile
Ala Asn Ala Ser Leu Phe Leu Ala Ser Asp Glu Ser Ala225
230 235 240Tyr Val Ser Gly His Asn Leu
Ala Val Asp Gly Ala Leu Ser Ser Ile 245
250 255Met Ser71263PRTC. annuum 71Met Ile Phe Phe Phe Cys
Gly Thr Arg Leu Glu Gly Lys Ile Ala Ile1 5
10 15Ile Thr Gly Ala Ala Ser Gly Ile Gly Glu Ala Ser
Ala Arg Leu Phe 20 25 30Val
Glu His Gly Ala His Val Ile Ile Ala Asp Ile Gln Asp Glu Leu 35
40 45Gly Leu Gln Val Val Ser Ser Ile Gly
Thr Asp Lys Ala Cys Tyr Arg 50 55
60His Cys Asp Val Thr Asp Glu Lys Gln Val Glu Glu Thr Val Ala Tyr65
70 75 80Ala Val Glu Lys Tyr
Gly Thr Leu Asp Ile Met Phe Ser Asn Ala Gly 85
90 95Met Leu Gly Thr Phe Gly Ser Leu Leu Asp Met
Asp Val Lys Glu Phe 100 105
110Asp Leu Thr Ile Ala Val Asn Thr Arg Gly Ala Ala Leu Ala Val Lys
115 120 125His Ala Ala Arg Val Met Val
Ala Lys Asn Ile Arg Gly Ser Ile Ile 130 135
140Cys Thr Ala Ser Val Glu Ser Ile Leu Ala Gly Ala Ala Pro Leu
Ala145 150 155 160Tyr Ile
Ala Ser Lys His Gly Ile Leu Gly Val Val Lys Ala Ala Ala
165 170 175Arg Glu Leu Gly Lys Asn Gly
Ile Arg Val Asn Cys Val Ser Pro Phe 180 185
190Gly Ile Ala Thr Pro Met Val Cys Lys Ser Tyr Gly Ala Glu
Ala Ser 195 200 205Tyr Ile Glu Thr
Ser Val Gly Gly His Ala Asn Leu Lys Gly Val Ser 210
215 220Leu Thr Thr Lys His Ile Ala Glu Ala Ala Leu Phe
Leu Ala Ser Glu225 230 235
240Glu Ser Ala Tyr Ile Ser Gly Gln Asn Leu Ala Val Asp Gly Gly Leu
245 250 255Ser Ala Ile Met Arg
Leu Asp 26072260PRTS. melongena 72Met Ala Asn Lys Leu Arg Leu
Glu Gly Lys Val Ala Val Ile Thr Gly1 5 10
15Gly Ala Ser Gly Ile Gly Glu Ala Ser Ala Arg Leu Phe
Val Glu His 20 25 30Gly Ala
Arg Val Val Ile Ala Asp Ile Gln Asp Glu Leu Ser Leu Gln 35
40 45Val Val Ser Ser Ile Gly Gly Asp Lys Ala
Cys Tyr Arg Arg Cys Asp 50 55 60Val
Ser Asp Glu Lys Gln Val Glu Glu Thr Val Ala Tyr Ala Val Glu65
70 75 80Lys Tyr Gly Thr Leu Asp
Ile Met Phe Ser Asn Ala Gly Ile Leu Gly 85
90 95Ser Phe Gly Ser Leu Leu Glu Met Asp Met Thr Ala
Phe Asp Arg Ile 100 105 110Met
Ala Val Asn Thr Arg Gly Ala Ala Leu Ala Val Lys His Ala Ala 115
120 125Arg Val Met Val Ala Asn Lys Ile Arg
Gly Ser Ile Ile Cys Thr Ala 130 135
140Ser Val Glu Ala Ile Leu Ala Gly Glu Ala Ser Leu Ala Tyr Ile Ala145
150 155 160Ser Lys His Ala
Ile Leu Gly Val Val Lys Ala Ala Ala Arg Asp Leu 165
170 175Gly Gln Tyr Gly Ile Arg Val Asn Cys Val
Ser Pro Tyr Gly Ile Ala 180 185
190Thr Pro Met Val Cys Lys Ser Ile Gly Ala Asp Ala Ala Thr Ile Glu
195 200 205Ala Arg Ile Cys Gly Asn Ala
Asn Leu Lys Gly Val Ser Leu Asn Thr 210 215
220Lys His Ile Ala Glu Ala Ala Leu Phe Leu Gly Ser Asp Glu Ser
Ala225 230 235 240Tyr Val
Ser Ala His Asn Leu Ala Val Asp Gly Gly Leu Ser Ser Ile
245 250 255Met Lys Leu Asn
26073262PRTS. tuberosum 73Met Ala Asn Lys Leu Arg Leu Glu Gly Lys Val Ala
Val Ile Thr Gly1 5 10
15Gly Ala Ser Gly Ile Gly Glu Ala Thr Ala Arg Leu Phe Val Glu His
20 25 30Gly Ala His Val Val Ile Ala
Asp Ile Gln Asp Glu Leu Ala Leu Gln 35 40
45Val Val Ser Ser Ile Gly Ser Asp Asn Val Cys Tyr Arg Arg Cys
Asp 50 55 60Val Thr Asp Glu Lys Gln
Val Asp Glu Thr Val Ala Phe Ala Val Gln65 70
75 80Lys Tyr Gly Thr Leu Asp Ile Met Phe Ser Asn
Ala Gly Ile Leu Gly 85 90
95Ser Ser Gly Ser Leu Leu Glu Met Asp Met Ala Val Phe Asp Arg Thr
100 105 110Met Ala Val Asn Thr Arg
Gly Ala Ala Leu Ala Val Lys His Ala Ala 115 120
125Lys Val Met Val Ala Lys Lys Ile Arg Gly Ser Ile Ile Cys
Thr Ala 130 135 140Ser Val Glu Ser Ile
Leu Ala Gly Ala Ala Ser Leu Ala Tyr Ile Ala145 150
155 160Ser Lys His Ala Val Leu Gly Val Val Lys
Ala Ala Ala Arg Glu Leu 165 170
175Gly Gln His Gly Ile Arg Val Asn Cys Val Ser Pro Phe Gly Val Ala
180 185 190Thr Pro Met Val Cys
Lys Ser Phe Gly Ala Asp Ala Ala Ala Met Glu 195
200 205Ala Thr Ile Arg Gly Asn Ala Asn Leu Lys Gly Val
Ser Leu Thr Thr 210 215 220Met His Ile
Ala Glu Ala Ala Leu Phe Leu Ala Ser Asp Glu Ser Ala225
230 235 240Tyr Ile Ser Ala His Asn Leu
Ala Ile Asp Gly Gly Leu Ser Ser Ile 245
250 255Met Lys Ile Asn Val Asn 26074260PRTS.
lycopersicum 74Met Ala Asn Lys Leu Arg Leu Glu Gly Lys Val Ala Val Ile
Thr Gly1 5 10 15Gly Ala
Ser Gly Ile Gly Glu Ala Ala Ala Arg Leu Phe Val Glu His 20
25 30Gly Ala Arg Val Val Ile Ala Asp Ile
Gln Asp Glu Leu Ala Leu Gln 35 40
45Val Ala Ser Ser Ile Gly Ser Asp Asn Val Cys Tyr Gln Arg Cys Asp 50
55 60Val Ser Asp Glu Lys Gln Val Asn Glu
Thr Val Ala Phe Ala Val Glu65 70 75
80Lys Tyr Gly Thr Leu Asp Ile Met Phe Ser Asn Ala Gly Ile
Leu Asn 85 90 95Pro Phe
Glu Ser Ile Leu Glu Met Asp Met Thr Val Phe Asp Arg Thr 100
105 110Ile Ala Val Asn Ala Arg Gly Ala Ala
Leu Ala Val Lys His Ala Ala 115 120
125Arg Val Met Val Ala Asn Lys Ile Arg Gly Ser Ile Ile Cys Thr Ala
130 135 140Ser Val Glu Ser Ile Leu Ala
Gly Ala Ala Pro Leu Ala Tyr Ile Ala145 150
155 160Ser Lys His Ala Val Leu Gly Val Val Lys Ala Ala
Ala Arg Glu Leu 165 170
175Gly Gln His Gly Ile Arg Val Asn Cys Val Ser Pro Phe Gly Ile Ala
180 185 190Thr Pro Met Val Cys Lys
Ser Phe Gly Ala Asp Ala Ala Ala Ile Glu 195 200
205Ala Lys Ile Cys Gly Asn Ala Asn Leu Lys Gly Val Ser Leu
Thr Thr 210 215 220Met His Ile Ala Glu
Ala Ala Leu Phe Leu Ala Ser Asp Glu Ser Ala225 230
235 240Tyr Ile Ser Ala Gln Asn Leu Ala Val Asp
Gly Gly Leu Ser Ser Met 245 250
255Met Lys Leu Met 26075260PRTS. pennellii 75Met Ala Asn
Lys Leu Arg Leu Glu Gly Lys Val Ala Val Ile Thr Gly1 5
10 15Gly Ala Ser Gly Ile Gly Glu Ala Ala
Ala Arg Leu Phe Val Glu His 20 25
30Gly Ala Arg Val Val Ile Ala Asp Ile Gln Asp Glu Leu Ala Leu Gln
35 40 45Val Ala Ser Ser Ile Gly Ser
Val Asn Val Cys Cys Arg Arg Cys Asp 50 55
60Val Ser Asp Glu Lys Gln Val Asn Glu Thr Val Ala Phe Ala Val Glu65
70 75 80Lys Tyr Gly Thr
Leu Asp Ile Met Phe Ser Asn Ala Gly Ile Leu Asn 85
90 95Pro Phe Glu Ser Ile Leu Glu Met Asp Met
Thr Val Phe Asp Arg Thr 100 105
110Ile Ala Val Asn Ala Arg Gly Ala Ala Leu Ala Val Lys His Ala Ala
115 120 125Arg Val Met Val Ala Asn Lys
Ile Arg Gly Ser Ile Ile Cys Thr Ala 130 135
140Ser Val Glu Ser Ile Leu Ala Gly Ala Ala Pro Leu Ala Tyr Ile
Ala145 150 155 160Ser Lys
His Ala Val Leu Gly Val Val Lys Ala Ala Ala Arg Glu Leu
165 170 175Gly Gln His Gly Ile Arg Val
Asn Cys Val Ser Pro Phe Gly Ile Ala 180 185
190Thr Pro Met Val Cys Lys Ser Phe Gly Ala Asp Ala Ala Ala
Ile Glu 195 200 205Ala Lys Ile Cys
Gly Asn Ala Asn Leu Lys Gly Val Ser Leu Thr Thr 210
215 220Met His Ile Ala Glu Ala Ala Leu Phe Leu Ala Ser
Asp Glu Ser Ala225 230 235
240Tyr Ile Ser Ala Gln Asn Leu Ala Val Asp Gly Gly Leu Ser Ser Met
245 250 255Met Lys Leu Met
26076260PRTN. benthamiana 76Met Ala Asn Lys Arg Arg Leu Glu Gly Lys
Val Ala Val Ile Thr Gly1 5 10
15Ala Ala Ser Gly Ile Gly Glu Ala Thr Ala Arg Leu Phe Val Glu His
20 25 30Gly Ala Arg Val Val Ile
Ala Asp Ile Gln Asp Glu Leu Gly His Gln 35 40
45Val Val Ala Ser Ile Gly Thr Asp Lys Ala Ser Tyr Arg His
Cys Asp 50 55 60Val Thr Asp Glu Lys
Gln Val Glu Asp Thr Val Val Tyr Thr Val Glu65 70
75 80Lys Tyr Gly Thr Leu Asp Ile Met Phe Ser
Asn Ala Gly Thr Ile Gly 85 90
95Thr Leu Gly Ser Ile Leu Asp Met Asp Met Thr Val Phe Asp Arg Thr
100 105 110Met Ala Ile Asn Ala
Arg Gly Ser Ala Leu Ala Val Lys His Ala Ala 115
120 125Arg Val Met Val Thr Lys Lys Ile Gln Gly Ser Ile
Ile Cys Thr Ala 130 135 140Ser Leu Glu
Ala Thr Leu Ala Gly Ala Ala Pro Leu Ala Tyr Val Thr145
150 155 160Ser Lys His Ala Ile Leu Gly
Val Val Lys Ala Ala Ala Arg Glu Leu 165
170 175Gly Gln His Gly Ile Arg Val Asn Cys Val Ser Pro
Tyr Gly Ile Ala 180 185 190Thr
Pro Met Val Cys Lys Thr Phe Gly Gly Asp Ala Ala Pro Ile Glu 195
200 205Ala Ser Ile Ser Gly Asn Ala Asn Leu
Lys Gly Ile Thr Leu Ser Thr 210 215
220Lys His Ile Ala Glu Ala Ala Leu Phe Leu Ala Ser Asp Glu Ser Ala225
230 235 240Tyr Val Ser Ala
His Asn Leu Ala Val Asp Gly Gly Leu Ser Ser Ile 245
250 255Met Lys Leu Asp 26077241PRTN.
benthamiana 77Met Ala Asn Lys Leu Arg Leu Glu Gly Lys Val Ala Val Ile Thr
Gly1 5 10 15Ala Ala Ser
Gly Ile Gly Glu Ala Thr Ala Arg Leu Phe Val Glu His 20
25 30Gly Ala Arg Val Val Ile Ala Asp Ile Gln
Asp Glu Leu Gly His Gln 35 40
45Val Val Ala Ser Ile Gly Thr Asp Lys Ala Ser Tyr Arg His Cys Asp 50
55 60Val Thr Asp Glu Lys Gln Val Glu Asp
Thr Val Val Tyr Ala Val Glu65 70 75
80Lys Tyr Gly Thr Leu Asp Ile Met Phe Ser Asn Ala Gly Thr
Ile Gly 85 90 95Thr Leu
Ser Ser Ile Leu Asp Met Asp Met Thr Val Phe Asp Arg Thr 100
105 110Met Ala Ile Asn Ala Arg Gly Ser Ala
Leu Ala Val Lys His Ala Ala 115 120
125Arg Ile Met Val Thr Lys Lys Ile Gln Gly Ser Ile Ile Cys Thr Ala
130 135 140Ser Leu Glu Ala Ile Leu Ala
Gly Ala Ala Pro Leu Ala Tyr Val Ala145 150
155 160Ser Lys His Ala Ile Leu Gly Val Val Lys Ala Ala
Ala Arg Glu Leu 165 170
175Gly Gln His Gly Ile Arg Val Asn Cys Val Ser Pro Tyr Gly Ile Ala
180 185 190Thr Pro Met Val Cys Lys
Thr Phe Gly Gly Asp Ala Ala Pro Ile Glu 195 200
205Ala Ser Ile Ser Gly Asn Ala Asn Leu Lys Gly Ile Thr Leu
Ser Thr 210 215 220Lys His Ile Ala Glu
Ala Ala Leu Phe Leu Ala Ser Asp Glu Ser Ala225 230
235 240Tyr78257PRTA. thaliana 78Met Ser Gly Lys
Arg Leu Asp Gly Lys Ile Val Ile Ile Thr Gly Gly1 5
10 15Ala Ser Gly Ile Gly Ala Glu Ser Val Arg
Leu Phe Thr Glu His Gly 20 25
30Ala Arg Val Val Ile Val Asp Val Gln Asp Glu Leu Gly Gln Asn Val
35 40 45Ala Val Ser Ile Gly Glu Asp Lys
Ala Ser Tyr Tyr His Cys Asp Val 50 55
60Thr Asn Glu Thr Glu Val Glu Asn Ala Val Lys Phe Thr Val Glu Lys65
70 75 80Tyr Gly Lys Leu Asp
Val Leu Phe Ser Asn Ala Gly Val Ile Glu Pro 85
90 95Phe Val Ser Ile Leu Asp Leu Asn Leu Asn Glu
Leu Asp Arg Thr Ile 100 105
110Ala Ile Asn Leu Arg Gly Thr Ala Ala Phe Ile Lys His Ala Ala Arg
115 120 125Ala Met Val Glu Lys Gly Ile
Arg Gly Ser Ile Val Cys Thr Thr Ser 130 135
140Val Ala Ala Glu Ile Ala Gly Thr Ala Pro His Gly Tyr Thr Thr
Ser145 150 155 160Lys His
Gly Leu Leu Gly Leu Ile Lys Ser Ala Ser Gly Gly Leu Gly
165 170 175Lys Tyr Gly Ile Arg Val Asn
Gly Val Ala Pro Phe Gly Val Ala Thr 180 185
190Pro Leu Val Cys Asn Gly Phe Lys Met Glu Pro Asn Val Val
Glu Gln 195 200 205Asn Thr Ser Ala
Ser Ala Asn Leu Lys Gly Ile Val Leu Lys Ala Arg 210
215 220His Val Ala Glu Ala Ala Leu Phe Leu Ala Ser Asp
Glu Ser Ala Tyr225 230 235
240Val Ser Gly Gln Asn Leu Ala Val Asp Gly Gly Tyr Ser Val Val Lys
245 250 255Pro79266PRTM.
truncatula 79Met Ser Arg Lys Arg Leu Glu Gly Lys Val Ala Ile Val Thr Gly
Gly1 5 10 15Ala Ser Gly
Ile Gly Ala Glu Thr Ala Lys Thr Phe Val Glu Asn Gly 20
25 30Ala Phe Val Val Ile Ala Asp Ile Asn Asp
Glu Leu Gly His Gln Val 35 40
45Ala Thr Ser Ile Gly Leu Asp Lys Val Ser Tyr His His Cys Asp Val 50
55 60Arg Asp Glu Lys Gln Val Glu Glu Thr
Val Ala Phe Ala Leu Glu Lys65 70 75
80Tyr Gly Thr Leu Asp Ile Met Phe Ser Asn Ala Gly Ile Glu
Gly Gly 85 90 95Met Ser
Ser Ser Ile Leu Glu Phe Asp Leu Asn Glu Phe Asp Asn Thr 100
105 110Met Ala Ile Asn Val Arg Gly Ser Leu
Ala Ala Ile Lys His Ala Ala 115 120
125Arg Phe Met Val Glu Arg Lys Ile Arg Gly Ser Ile Ile Cys Thr Ala
130 135 140Ser Val Ala Ala Ser Val Ala
Gly Asn Arg Gly His Asp Tyr Val Thr145 150
155 160Ser Lys His Gly Leu Leu Gly Leu Val Arg Ser Thr
Cys Gly Glu Leu 165 170
175Gly Ala Tyr Gly Ile Arg Val Asn Ser Ile Ser Pro Tyr Gly Val Ala
180 185 190Thr Pro Leu Ala Cys Arg
Ala Leu Asn Met Glu Met Ser Lys Val Glu 195 200
205Ala Asn Met Lys Asp Ser Ala Asn Leu Lys Gly Ile Thr Leu
Lys Ala 210 215 220Thr His Ile Ala Glu
Ala Ala Leu Phe Leu Ala Ser Glu Glu Ser Ala225 230
235 240Tyr Ile Ser Gly His Asn Leu Val Val Asp
Gly Gly Phe Ser Val Ile 245 250
255Asn Ser Cys Val Pro Thr Thr Ile Lys Lys 260
26580266PRTC. annuum 80Met Ala Val Val Met Gln Lys Leu Lys Gly Lys
Val Ala Ile Val Thr1 5 10
15Gly Gly Ala Ser Gly Ile Gly Glu Ala Thr Val Arg Leu Phe Ala Glu
20 25 30His Gly Ala Arg Ala Val Val
Ile Ala Asp Ile Gln Asp Glu Lys Gly 35 40
45Arg Ala Val Ala Glu Ser Ile Pro Leu Gln Val Cys Ser Tyr Val
His 50 55 60Cys Asp Val Ser Asp Glu
Asn Gln Val Lys Gly Leu Val Asp Trp Thr65 70
75 80Val Lys Lys Tyr Gly Gln Leu Asp Ile Met Phe
Ser Asn Ala Gly Thr 85 90
95Val Gly Asn Ser Gly Gln Lys Val Leu Asp Leu Asp Leu Ser Glu Phe
100 105 110Asp Arg Val Ile Arg Val
Asn Ala Arg Gly Met Ala Ala Cys Val Lys 115 120
125His Ala Ala Arg Ala Met Val Glu Gln Gly Gly Arg Gly Ser
Ile Ile 130 135 140Cys Thr Gly Ser Val
Gly Ala Ser Lys Gly Ala Ala Trp Arg Thr Asp145 150
155 160Tyr Thr Met Ser Lys His Ala Val Leu Gly
Leu Val Thr Ser Ala Ser 165 170
175Arg Gln Leu Gly Lys Tyr Gly Ile Arg Val Asn Ser Ile Ser Pro Ser
180 185 190Ala Val Met Thr Pro
Leu Met Ser Ser Ala Glu Ala Glu Thr Ser Met 195
200 205Lys Val Leu Lys Met Tyr Gly Pro Leu Thr Ser Leu
Lys Gly Ile Thr 210 215 220Leu Thr Val
Lys His Leu Ala Asp Ala Val Leu Phe Leu Ala Ser Asp225
230 235 240Asp Ser Ala Phe Val Asn Gly
His Asp Leu Leu Val Asp Gly Gly Leu 245
250 255Leu His Leu Pro Asp Pro Met Ser Ser Leu
260 26581266PRTS. tuberosum 81Met Ala Glu Val Thr Gln Lys
Leu Lys Gly Lys Val Ala Ile Val Thr1 5 10
15Gly Gly Ala Ser Gly Ile Gly Glu Ala Thr Ala Arg Leu
Phe Ala Gln 20 25 30His Gly
Ala Arg Ala Val Val Ile Ala Asp Ile Gln Asp Gly Lys Gly 35
40 45Arg Ala Val Ala Val Ser Ile Pro Ser Gln
Ile Cys Ser Tyr Val Gln 50 55 60Cys
Asp Val Ser Asp Glu Asn Gln Val Lys Ala Met Val Asp Trp Thr65
70 75 80Val Gln Lys Tyr Gly Gln
Leu Asp Ile Met Phe Ser Asn Ala Gly Val 85
90 95Val Gly Asn Ser Gly Gln Lys Val Leu Asp Leu Asp
Leu Ser Glu Phe 100 105 110Asp
Arg Val Met Asn Val Asn Ala Arg Gly Met Ala Ala Cys Val Lys 115
120 125His Ala Ala Arg Ala Met Val Asp Lys
Arg Val Arg Gly Ser Ile Ile 130 135
140Cys Thr Gly Ser Ile Gly Ala Ser Arg Gly Gly Ala Trp Arg Thr Asp145
150 155 160Tyr Ile Met Ser
Lys His Ala Val Leu Gly Leu Val Arg Ser Ala Cys 165
170 175Arg Gln Leu Gly Glu Tyr Gly Ile Arg Val
Asn Ser Ile Ser Pro Ser 180 185
190Ala Val Met Thr Pro Leu Met Ile Ser Ala Glu Pro Glu Val Ser Met
195 200 205Lys Ser Leu Lys Arg Tyr Gly
Pro Gln Thr Ser Leu Lys Gly Ile Thr 210 215
220Leu Thr Val Lys His Leu Ala Glu Ala Ala Leu Phe Leu Ala Ser
Asp225 230 235 240Asp Ser
Ala Phe Ser Ser Arg Ser Asn Glu Phe Ile Val Lys Gln Arg
245 250 255Glu Gln Pro Asn Leu Ser Leu
Phe Phe Phe 260 26582266PRTS. melongena 82Met
Ser Ala Ile Thr Gln Lys Leu Asn Gly Lys Val Ala Ile Val Thr1
5 10 15Gly Gly Ala Ser Gly Ile Gly
Glu Ala Thr Val Arg Leu Phe Ala Gln 20 25
30His Gly Ala Arg Ala Val Val Ile Ala Asp Ile Gln Asp Glu
Lys Gly 35 40 45Arg Ala Val Ala
Gln Ser Ile Pro Ser Gln Ile Cys Ile Tyr Val Lys 50 55
60Cys Asp Val Ser Asp Glu Asn Gln Val Lys Ser Met Val
Asp Trp Thr65 70 75
80Val Gln Gln Tyr Gly Gln Leu Asp Ile Met Phe Ser Asn Ala Gly Thr
85 90 95Val Gly Asn Ser Gly Gln
Lys Ile Leu Asp Leu Asp Leu Ser Glu Phe 100
105 110Asp Arg Val Met Asn Val Asn Ala Arg Gly Met Ala
Ala Cys Val Lys 115 120 125His Ala
Ala Arg Ala Met Val Glu Lys Arg Val Arg Gly Ser Ile Ile 130
135 140Cys Thr Gly Ser Ile Ala Ala Ser Arg Ala Gly
Ala Trp Arg Thr Asp145 150 155
160Tyr Ala Met Ser Lys His Ala Val Leu Gly Leu Met Arg Ser Ala Ser
165 170 175Arg Gln Leu Gly
Glu Tyr Gly Ile Arg Val Asn Ser Ile Ser Pro Ser 180
185 190Ala Val Met Thr Pro Leu Met Ile Ser Ala Glu
Ala Glu Ala Ser Met 195 200 205Arg
Val Leu Lys Met Tyr Gly Ser Val Thr Ser Leu Lys Gly Ile Thr 210
215 220Leu Thr Val Lys His Leu Ala Asp Ala Val
Leu Phe Leu Ala Ser Asp225 230 235
240Asp Ser Val Phe Val Ser Gly His Asp Leu Ala Val Asp Gly Gly
Leu 245 250 255Ile Ser Leu
Pro Asp Pro Met Ser Ser Leu 260 26583302PRTO.
sativa 83Met Phe Thr Ala Met His Arg Ile Leu Ser Arg Gly Arg Arg Thr Pro1
5 10 15Ala Ala Ser Ser
Ser Ser Val Thr Ala Phe Ala Thr Ala Ser Asp Ser 20
25 30Gln Arg Leu Ala Gly Lys Val Ala Val Ile Thr
Gly Gly Ala Ser Gly 35 40 45Ile
Gly Arg Ala Thr Ala Glu Glu Phe Val Arg Asn Gly Ala Lys Val 50
55 60Ile Leu Ala Asp Val Gln Asp Asp Leu Gly
His Ala Val Ala Ala Glu65 70 75
80Leu Gly Ala Asp Ala Ala Ser Tyr Ala Arg Cys Asp Val Thr Asp
Glu 85 90 95Ala Gln Val
Ala Ala Ala Val Asp Leu Ala Val Ala Arg His Gly Arg 100
105 110Leu Asp Val Val Phe Asn Asn Ala Gly Ile
Pro Gly Asp Leu Thr Pro 115 120
125Thr Pro Val Gly Ala Leu Asp Leu Ala Asp Phe Asp Arg Val Met Ala 130
135 140Val Asn Thr Arg Ala Val Val Ala
Gly Val Lys His Ala Ala Arg Val145 150
155 160Met Val Pro Arg Arg Arg Gly Ser Ile Ile Cys Thr
Ala Ser Thr Ala 165 170
175Gly Val Ile Gly Gly Val Ala Val Pro His Tyr Ser Val Ser Lys Ala
180 185 190Ala Val Leu Gly Leu Val
Arg Ala Val Ala Gly Glu Met Ala Arg Ser 195 200
205Gly Val Arg Val Asn Ala Ile Ser Pro Asn Tyr Ile Trp Thr
Pro Met 210 215 220Ala Ala Val Ala Phe
Ala Arg Trp Tyr Pro Ser Arg Ser Ala Asp Asp225 230
235 240His Arg Arg Ile Val Glu Asn Asp Ile Asn
Glu Met Asp Gly Val Thr 245 250
255Leu Glu Ala Glu Asp Val Ala Arg Ala Ala Val Phe Leu Ala Ser Asp
260 265 270Glu Ala Lys Tyr Val
Asn Gly His Asn Leu Val Val Asp Gly Gly Tyr 275
280 285Thr Val Gly Lys Val Pro Asn Met Pro Val Pro Asp
Gly His 290 295 30084300PRTO. sativa
84Met Phe Arg Ala Ala Gln Leu Leu Leu Arg Glu Thr Asn Arg Ala Leu1
5 10 15Gly Ala Ala Thr Ser Pro
Ala Gly Phe Val Ser Gly Phe Ser Thr Ala 20 25
30Ser Asn Ser Ala Gln Arg Leu Ala Gly Lys Val Ala Val
Ile Thr Gly 35 40 45Gly Ala Ser
Gly Ile Gly Lys Ala Thr Ala Lys Glu Phe Ile Glu Asn 50
55 60Gly Ala Lys Val Ile Met Ala Asp Val Gln Asp Asp
Leu Gly His Ser65 70 75
80Thr Ala Ala Glu Leu Gly Pro Asp Ala Ser Tyr Thr Arg Cys Asp Val
85 90 95Thr Asp Glu Ala Gln Val
Ala Ala Ala Val Asp Leu Ala Val Lys Arg 100
105 110His Gly His Leu Asp Ile Leu Tyr Asn Asn Ala Gly
Val Met Gly Ala 115 120 125Met Pro
Gln Asp Asp Met Ala Ser Val Asp Leu Ala Asn Phe Asp Arg 130
135 140Met Met Ala Ile Asn Ala Arg Ala Ala Leu Val
Gly Ile Lys His Ala145 150 155
160Ala Arg Val Met Ser Pro Arg Arg Ser Gly Val Ile Leu Cys Thr Ala
165 170 175Ser Asp Thr Gly
Val Met Pro Met Pro Asn Ile Ala Leu Tyr Ala Val 180
185 190Ser Lys Ala Thr Thr Ile Ala Ile Val Arg Ala
Ala Ala Glu Pro Leu 195 200 205Ser
Arg His Gly Leu Arg Val Asn Ala Ile Ser Pro His Gly Thr Arg 210
215 220Thr Pro Met Ala Met His Val Leu Ser Gln
Met Tyr Pro Gly Val Ser225 230 235
240Lys Asp Asp Leu Glu Lys Met Ala Asp Ala Ala Met Asp Ala Gly
Glu 245 250 255Val Met Glu
Pro Lys Tyr Val Ala Arg Ala Ala Leu Tyr Leu Ala Ser 260
265 270Asp Glu Ala Lys Tyr Val Asn Gly His Asn
Leu Val Val Asp Gly Gly 275 280
285Phe Thr Ser His Lys Gly Ser Asp Thr Arg Leu Asn 290
295 30085285PRTA. thaliana 85Met Ser Thr Asn Thr Glu Ser
Ser Ser Tyr Ser Ser Leu Pro Ser Gln1 5 10
15Arg Leu Leu Gly Lys Val Ala Leu Ile Thr Gly Gly Ala
Thr Gly Ile 20 25 30Gly Glu
Ser Ile Val Arg Leu Phe His Lys His Gly Ala Lys Val Cys 35
40 45Ile Val Asp Leu Gln Asp Asp Leu Gly Gly
Glu Val Cys Lys Ser Leu 50 55 60Leu
Arg Gly Glu Ser Lys Glu Thr Ala Phe Phe Ile His Gly Asp Val65
70 75 80Arg Val Glu Asp Asp Ile
Ser Asn Ala Val Asp Phe Ala Val Lys Asn 85
90 95Phe Gly Thr Leu Asp Ile Leu Ile Asn Asn Ala Gly
Leu Cys Gly Ala 100 105 110Pro
Cys Pro Asp Ile Arg Asn Tyr Ser Leu Ser Glu Phe Glu Met Thr 115
120 125Phe Asp Val Asn Val Lys Gly Ala Phe
Leu Ser Met Lys His Ala Ala 130 135
140Arg Val Met Ile Pro Glu Lys Lys Gly Ser Ile Val Ser Leu Cys Ser145
150 155 160Val Gly Gly Val
Val Gly Gly Val Gly Pro His Ser Tyr Val Gly Ser 165
170 175Lys His Ala Val Leu Gly Leu Thr Arg Ser
Val Ala Ala Glu Leu Gly 180 185
190Gln His Gly Ile Arg Val Asn Cys Val Ser Pro Tyr Ala Val Ala Thr
195 200 205Lys Leu Ala Leu Ala His Leu
Pro Glu Glu Glu Arg Thr Glu Asp Ala 210 215
220Phe Val Gly Phe Arg Asn Phe Ala Ala Ala Asn Ala Asn Leu Lys
Gly225 230 235 240Val Glu
Leu Thr Val Asp Asp Val Ala Asn Ala Val Leu Phe Leu Ala
245 250 255Ser Asp Asp Ser Arg Tyr Ile
Ser Gly Asp Asn Leu Met Ile Asp Gly 260 265
270Gly Phe Thr Cys Thr Asn His Ser Phe Lys Val Phe Arg
275 280 28586275PRTO. sativa 86Met Ala
Gly Ser Ser Tyr Gly Asp Val His Glu Ser Ala Arg Lys Leu1 5
10 15Val Gly Lys Val Ala Leu Ile Thr
Gly Gly Ala Ser Gly Ile Gly Glu 20 25
30Cys Thr Ala Arg Leu Phe Val Lys His Gly Ala Gln Val Val Val
Ala 35 40 45Asp Ile Gln Asp Glu
Ala Gly Ala Arg Leu Cys Ala Glu Leu Gly Ser 50 55
60Ala Thr Ala Ser Tyr Val Arg Cys Asp Val Thr Ser Glu Asp
Asp Val65 70 75 80Ala
Ala Ala Val Asp His Ala Val Ala Arg Tyr Gly Lys Leu Asp Val
85 90 95Met Phe Asn Asn Ala Gly Ile
Gly Gly Ala Ala Cys His Ser Ile Leu 100 105
110Glu Ser Thr Lys Ala Asp Phe Asp Arg Val Leu Ala Val Asn
Leu Thr 115 120 125Gly Pro Phe Leu
Gly Thr Lys His Ala Ala Arg Val Met Val Ala Ala 130
135 140Gly Arg Gly Gly Cys Ile Ile Gly Thr Ala Ser Leu
Ala Ser Ala Val145 150 155
160Ala Gly Thr Ala Ser His Ala Tyr Thr Cys Ala Lys Arg Ala Leu Val
165 170 175Gly Leu Thr Glu Asn
Ala Ala Ala Glu Leu Gly Arg His Gly Ile Arg 180
185 190Val Asn Cys Val Ser Pro Ala Ala Ala Ala Thr Pro
Leu Ala Thr Gly 195 200 205Tyr Val
Gly Leu Glu Gly Glu Ala Phe Glu Ala Ala Met Glu Ala Val 210
215 220Ala Asn Leu Lys Gly Val Arg Leu Arg Val Glu
Asp Ile Ala Ala Ala225 230 235
240Val Leu Phe Leu Ala Ser Asp Asp Ala Arg Tyr Val Ser Gly His Asn
245 250 255Leu Leu Ile Asp
Gly Gly Cys Ser Ile Val Asn Pro Ser Phe Gly Ile 260
265 270Phe Lys Asp 27587274PRTO. sativa 87Met
Ala Ala Gly Ser Ser His Val Ser Ala Asp Ala Arg Lys Leu Val1
5 10 15Gly Lys Val Ala Val Ile Thr
Gly Gly Ala Ser Gly Ile Gly Ala Cys 20 25
30Thr Ala Arg Leu Phe Val Lys His Gly Ala Arg Val Val Val
Ala Asp 35 40 45Ile Gln Asp Glu
Leu Gly Ala Ser Leu Val Ala Glu Leu Gly Pro Asp 50 55
60Ala Ser Ser Tyr Val His Cys Asp Val Thr Asn Glu Gly
Asp Val Ala65 70 75
80Ala Ala Val Asp His Ala Val Ala Arg Phe Gly Lys Leu Asp Val Met
85 90 95Phe Asn Asn Ala Gly Val
Ser Gly Pro Pro Cys Phe Arg Met Ser Glu 100
105 110Cys Thr Lys Glu Asp Phe Glu Arg Val Leu Ala Val
Asn Leu Val Gly 115 120 125Pro Phe
Leu Gly Thr Lys His Ala Ala Arg Val Met Ala Pro Ala Arg 130
135 140Arg Gly Ser Ile Ile Ser Thr Ala Ser Leu Ser
Ser Ser Val Ser Gly145 150 155
160Ala Ala Ser His Ala Tyr Thr Thr Ser Lys His Ala Leu Val Gly Phe
165 170 175Thr Glu Asn Ala
Ala Gly Glu Leu Gly Arg His Gly Ile Arg Val Asn 180
185 190Cys Val Ser Pro Ala Gly Val Ala Thr Pro Leu
Ala Arg Ala Ala Met 195 200 205Gly
Met Asp Asp Glu Ala Ile Glu Ala Ile Met Ala Asn Ser Ala Asn 210
215 220Leu Lys Gly Ala Gly Ala Leu Lys Ala Asp
Asp Ile Ala Ala Ala Ala225 230 235
240Leu Phe Leu Ala Ser Asp Asp Gly Arg Tyr Val Ser Gly Gln Asn
Leu 245 250 255Arg Val Asp
Gly Gly Leu Ser Val Val Asn Ser Ser Phe Gly Phe Phe 260
265 270Arg Asp88274PRTO. sativa 88Met Ala Gly
Ser Ser His Val Ser Ala Asp Ala Arg Lys Leu Val Gly1 5
10 15Lys Val Ala Val Ile Thr Gly Gly Ala
Ser Gly Ile Gly Ala Cys Thr 20 25
30Ala Arg Leu Phe Val Lys His Gly Ala Arg Val Val Val Ala Asp Ile
35 40 45Gln Asp Glu Leu Gly Ala Ser
Leu Val Ala Glu Leu Gly Pro Asp Ala 50 55
60Ser Ser Tyr Val His Cys Asp Val Thr Asn Glu Gly Asp Val Ala Ala65
70 75 80Ala Val Asp His
Ala Val Ala Thr Phe Gly Lys Leu Asp Val Met Phe 85
90 95Asn Asn Ala Gly Val Thr Gly Pro Pro Cys
Phe Arg Ile Thr Glu Ser 100 105
110Thr Lys Glu Asp Phe Glu Arg Val Leu Ala Val Asn Leu Ile Gly Pro
115 120 125Phe Leu Gly Thr Lys His Ala
Ala Arg Val Met Ala Pro Ala Arg Arg 130 135
140Gly Ser Ile Ile Ser Thr Ala Ser Leu Ser Ser Ser Val Ser Gly
Thr145 150 155 160Ala Ser
His Ala Tyr Thr Thr Ser Lys Arg Ala Leu Val Gly Phe Thr
165 170 175Glu Asn Ala Ala Gly Glu Leu
Gly Arg His Gly Ile Arg Val Asn Cys 180 185
190Val Ser Pro Ala Ala Val Ala Thr Pro Leu Ala Arg Ala Ala
Met Gly 195 200 205Met Asp Met Asp
Asp Glu Thr Ile Glu Ala Ile Met Glu Lys Ser Ala 210
215 220Asn Leu Lys Gly Val Gly Leu Lys Val Asp Asp Ile
Ala Ala Ala Ala225 230 235
240Leu Phe Leu Ala Ser Asp Asp Gly Arg Tyr Val Ser Gly Gln Asn Leu
245 250 255Arg Val Asp Gly Gly
Val Ser Val Val Asn Ser Ser Phe Gly Phe Phe 260
265 270Arg Asp89349PRTA. thaliana 89Met Glu Leu Ile Asn
Asp Phe Leu Asn Leu Thr Ala Pro Phe Phe Thr1 5
10 15Phe Phe Gly Leu Cys Phe Phe Leu Pro Pro Phe
Tyr Phe Phe Lys Phe 20 25
30Leu Gln Ser Ile Phe Ser Thr Ile Phe Ser Glu Asn Leu Tyr Gly Lys
35 40 45Val Val Leu Ile Thr Gly Ala Ser
Ser Gly Ile Gly Glu Gln Leu Ala 50 55
60Tyr Glu Tyr Ala Cys Arg Gly Ala Cys Leu Ala Leu Thr Ala Arg Arg65
70 75 80Lys Asn Arg Leu Glu
Glu Val Ala Glu Ile Ala Arg Glu Leu Gly Ser 85
90 95Pro Asn Val Val Thr Val His Ala Asp Val Ser
Lys Pro Asp Asp Cys 100 105
110Arg Arg Ile Val Asp Asp Thr Ile Thr His Phe Gly Arg Leu Asp His
115 120 125Leu Val Asn Asn Ala Gly Met
Thr Gln Ile Ser Met Phe Glu Asn Ile 130 135
140Glu Asp Ile Thr Arg Thr Lys Ala Val Leu Asp Thr Asn Phe Trp
Gly145 150 155 160Ser Val
Tyr Thr Thr Arg Ala Ala Leu Pro Tyr Leu Arg Gln Ser Asn
165 170 175Gly Lys Ile Val Ala Met Ser
Ser Ser Ala Ala Trp Leu Thr Ala Pro 180 185
190Arg Met Ser Phe Tyr Asn Ala Ser Lys Ala Ala Leu Leu Ser
Phe Phe 195 200 205Glu Thr Met Arg
Ile Glu Leu Gly Gly Asp Val His Ile Thr Ile Val 210
215 220Thr Pro Gly Tyr Ile Glu Ser Glu Leu Thr Gln Gly
Lys Tyr Phe Ser225 230 235
240Gly Glu Gly Glu Leu Ile Val Asn Gln Asp Met Arg Asp Val Gln Val
245 250 255Gly Pro Phe Pro Val
Ala Ser Ala Ser Gly Cys Ala Lys Ser Ile Val 260
265 270Asn Gly Val Cys Arg Lys Gln Arg Tyr Val Thr Glu
Pro Ser Trp Phe 275 280 285Lys Val
Thr Tyr Leu Trp Lys Val Leu Cys Pro Glu Leu Ile Glu Trp 290
295 300Gly Cys Arg Leu Leu Tyr Met Thr Gly Thr Gly
Met Ser Glu Asp Thr305 310 315
320Ala Leu Asn Lys Arg Ile Met Asp Ile Pro Gly Val Arg Ser Thr Leu
325 330 335Tyr Pro Glu Ser
Ile Arg Thr Pro Glu Ile Lys Ser Asp 340
34590264PRTA. thaliana 90Met Glu Thr Asp Lys Arg Trp Ser Leu Ala Gly Lys
Thr Ala Leu Val1 5 10
15Thr Gly Gly Thr Arg Gly Ile Gly Arg Ala Val Val Glu Glu Leu Ala
20 25 30Lys Phe Gly Ala Lys Val His
Thr Cys Ser Arg Asn Gln Glu Glu Leu 35 40
45Asn Ala Cys Leu Asn Asp Trp Lys Ala Asn Gly Leu Val Val Ser
Gly 50 55 60Ser Val Cys Asp Ala Ser
Val Arg Asp Gln Arg Glu Lys Leu Ile Gln65 70
75 80Glu Ala Ser Ser Ala Phe Ser Gly Lys Leu Asn
Ile Leu Ile Asn Asn 85 90
95Val Gly Thr Asn Val Arg Lys Pro Thr Val Glu Tyr Ser Ser Glu Glu
100 105 110Tyr Ala Lys Ile Met Ser
Thr Asn Leu Glu Ser Ala Phe His Leu Ser 115 120
125Gln Ile Ala His Pro Leu Leu Lys Ala Ser Gly Val Gly Ser
Ile Val 130 135 140Phe Ile Ser Ser Val
Ala Gly Leu Val His Leu Ser Ser Gly Ser Ile145 150
155 160Tyr Gly Ala Thr Lys Gly Ala Leu Asn Gln
Leu Thr Arg Asn Leu Ala 165 170
175Cys Glu Trp Ala Ser Asp Asn Ile Arg Thr Asn Cys Val Ala Pro Trp
180 185 190Tyr Ile Lys Thr Ser
Leu Val Glu Thr Leu Leu Glu Lys Lys Glu Phe 195
200 205Val Glu Ala Val Val Ser Arg Thr Pro Leu Gly Arg
Val Gly Glu Pro 210 215 220Glu Glu Val
Ser Ser Leu Val Ala Phe Leu Cys Leu Pro Ala Ser Ser225
230 235 240Tyr Ile Thr Gly Gln Val Ile
Ser Val Asp Gly Gly Phe Thr Val Asn 245
250 255Gly Phe Ser Tyr Ala Met Lys Pro
26091310PRTZ. mays 91Met Asp Ala Ala Ala Ala Ala Ala Ser Pro Thr Ser Lys
Arg Ile Ala1 5 10 15Leu
Val Thr Gly Gly Asn Lys Gly Ile Gly Leu Glu Thr Cys Arg Gln 20
25 30Leu Ala Ser Arg Gly Val Arg Val
Val Leu Thr Ala Arg Asn Glu Ala 35 40
45Arg Gly Leu Glu Ala Val Glu Arg Val Arg Cys Ala Arg Gly Asp Ala
50 55 60Glu Val Tyr Phe His Gln Leu Asp
Val Thr Asp Pro Cys Ser Ala Ala65 70 75
80Arg Leu Ala Asp Phe Val Arg Asp Gln Phe Gly Arg Leu
Asp Ile Leu 85 90 95Ile
Asn Asn Ala Gly Ile Ser Gly Val His Arg Asp Pro Val Leu Ser
100 105 110Ala Ala Val Lys Asp Lys Val
Asp Gly Met Asp Val Asn Gln Arg Val 115 120
125Glu Trp Met Lys Glu Asn Ser Lys Glu Thr Tyr Glu Glu Ala Val
Gln 130 135 140Cys Met Lys Thr Asn Tyr
Tyr Gly Ala Lys Leu Val Thr Glu Ala Leu145 150
155 160Leu Pro Leu Leu Gln Leu Ser Ser Ser Gly Arg
Ile Val Asn Val Ser 165 170
175Ser Gly Phe Gly Leu Leu Arg Asn Phe Asn Ser Glu Asp Leu Arg Lys
180 185 190Glu Phe Glu Asp Ile Asp
Asn Leu Thr Glu Ser Arg Leu Glu Glu Leu 195 200
205Met Asp Lys Phe Leu Glu Asp Phe Lys Ala Asn Leu Val Glu
Glu His 210 215 220Gly Trp Pro Thr Gly
Gly Ser Ser Ala Tyr Lys Val Val Lys Ala Ala225 230
235 240Leu Asn Ala Tyr Thr Arg Ile Leu Ala Lys
Lys Tyr Pro Thr Leu Arg 245 250
255Ile Asn Cys Leu Thr Pro Gly Tyr Val Lys Thr Asp Ile Ser Met His
260 265 270Met Gly Val Leu Thr
Leu Glu Glu Gly Ala Arg Asn Pro Val Lys Val 275
280 285Ala Leu Leu Pro Asp Asp Gly Pro Thr Gly Ala Tyr
Phe Asp Leu Asn 290 295 300Gly Glu Ala
Ser Phe Val305 31092303PRTA. thaliana 92Met Ala Glu Glu
Thr Pro Arg Leu Phe Asn Gly Phe Cys Arg Tyr Ala1 5
10 15Val Val Thr Gly Ala Asn Arg Gly Ile Gly
Phe Glu Ile Cys Arg Gln 20 25
30Leu Ala Ser Glu Gly Ile Arg Val Val Leu Thr Ser Arg Asp Glu Asn
35 40 45Arg Gly Leu Glu Ala Val Glu Thr
Leu Lys Lys Glu Leu Glu Ile Ser 50 55
60Asp Gln Ser Leu Leu Phe His Gln Leu Asp Val Ala Asp Pro Ala Ser65
70 75 80Ile Thr Ser Leu Ala
Glu Phe Val Lys Thr Gln Phe Gly Lys Leu Asp 85
90 95Ile Leu Val Asn Asn Ala Gly Ile Gly Gly Ile
Ile Thr Asp Ala Glu 100 105
110Ala Leu Arg Ala Gly Ala Gly Lys Glu Gly Phe Lys Trp Asp Glu Ile
115 120 125Ile Thr Glu Thr Tyr Glu Leu
Thr Glu Glu Cys Ile Lys Ile Asn Tyr 130 135
140Tyr Gly Pro Lys Arg Met Cys Glu Ala Phe Ile Pro Leu Leu Lys
Leu145 150 155 160Ser Asp
Ser Pro Arg Ile Val Asn Val Ser Ser Ser Met Gly Gln Leu
165 170 175Lys Asn Val Leu Asn Glu Trp
Ala Lys Gly Ile Leu Ser Asp Ala Glu 180 185
190Asn Leu Thr Glu Glu Arg Ile Asp Gln Val Ile Asn Gln Leu
Leu Asn 195 200 205Asp Phe Lys Glu
Gly Thr Val Lys Glu Lys Asn Trp Ala Lys Phe Met 210
215 220Ser Ala Tyr Val Val Ser Lys Ala Ser Leu Asn Gly
Tyr Thr Arg Val225 230 235
240Leu Ala Lys Lys His Pro Glu Phe Arg Val Asn Ala Val Cys Pro Gly
245 250 255Phe Val Lys Thr Asp
Met Asn Phe Lys Thr Gly Val Leu Ser Val Glu 260
265 270Glu Gly Ala Ser Ser Pro Val Arg Leu Ala Leu Leu
Pro His Gln Glu 275 280 285Thr Pro
Ser Gly Cys Phe Phe Ser Arg Lys Gln Val Ser Glu Phe 290
295 30093311PRTP. bracteatum 93Met Pro Glu Thr Cys Pro
Asn Thr Val Thr Lys Met Arg Cys Ala Val1 5
10 15Val Thr Gly Gly Asn Lys Gly Ile Gly Phe Glu Ile
Cys Lys Gln Leu 20 25 30Ser
Ser Ser Gly Ile Met Val Val Leu Thr Cys Arg Asp Val Thr Arg 35
40 45Gly Leu Glu Ala Val Glu Lys Leu Lys
Asn Ser Asn His Glu Asn Val 50 55
60Val Phe His Gln Leu Asp Val Thr Asp Pro Ile Thr Thr Met Ser Ser65
70 75 80Leu Ala Asp Phe Ile
Lys Ala Arg Phe Gly Lys Leu Asp Ile Leu Val 85
90 95Asn Asn Ala Gly Val Ala Gly Phe Ser Val Asp
Ala Asp Arg Phe Lys 100 105
110Ala Met Ile Ser Asp Ile Gly Glu Asp Ser Glu Glu Val Val Lys Ile
115 120 125Tyr Glu Lys Pro Glu Ala Gln
Glu Leu Met Ser Glu Thr Tyr Glu Leu 130 135
140Ala Glu Glu Cys Leu Lys Ile Asn Tyr Tyr Gly Val Lys Ser Val
Thr145 150 155 160Glu Val
Leu Leu Pro Leu Leu Gln Leu Ser Asp Ser Pro Arg Ile Val
165 170 175Asn Val Ser Ser Ser Thr Gly
Ser Leu Lys Tyr Val Ser Asn Glu Thr 180 185
190Ala Leu Glu Ile Leu Gly Asp Gly Asp Ala Leu Thr Glu Glu
Arg Ile 195 200 205Asp Met Val Val
Asn Met Leu Leu Lys Asp Phe Lys Glu Asn Leu Ile 210
215 220Glu Thr Asn Gly Trp Pro Ser Phe Gly Ala Ala Tyr
Thr Thr Ser Lys225 230 235
240Ala Cys Leu Asn Ala Tyr Thr Arg Val Leu Ala Lys Lys Ile Pro Lys
245 250 255Phe Gln Val Asn Cys
Val Cys Pro Gly Leu Val Lys Thr Glu Met Asn 260
265 270Tyr Gly Ile Gly Asn Tyr Thr Ala Asp Glu Gly Ala
Lys His Val Val 275 280 285Arg Ile
Ala Leu Phe Pro Asp Asp Gly Pro Ser Gly Phe Phe Tyr Asp 290
295 300Cys Ser Glu Leu Ser Ala Phe305
31094343PRTZ. mays 94Met Ser Thr Gly Gly Arg Lys Met Arg Thr Ala Cys Val
Thr Gly Gly1 5 10 15Asn
Gly Tyr Ile Ala Ser Ala Leu Ile Lys Val Leu Leu Glu Lys Gly 20
25 30Tyr Ala Val Lys Thr Thr Val Arg
Asn Pro Asp Asp Met Glu Lys Asn 35 40
45Ser His Leu Lys Asp Leu Gln Ala Leu Gly Ser Leu Glu Val Phe Arg
50 55 60Ala Asp Leu Asp Glu Asp Gly Ser
Phe Asp Asp Ala Val Ala Gly Cys65 70 75
80Asp Tyr Ala Phe Leu Val Ala Ala Pro Val Asn Leu His
Thr Lys Asn 85 90 95Pro
Glu Glu Glu Met Ile Glu Pro Ala Val Arg Gly Thr Leu Asn Val
100 105 110Met Arg Ser Cys Val Lys Ala
Gly Thr Val Arg Arg Val Val Leu Thr 115 120
125Ser Ser Ala Ala Ala Val Thr Thr Arg Pro Gln Leu Gln Gly Asp
Gly 130 135 140His Val Leu Asp Glu Glu
Ser Trp Ser Asp Val Glu Tyr Leu Arg Ala145 150
155 160His Lys Pro Ala Gly Pro Trp Gly Tyr Pro Val
Ser Lys Val Leu Leu 165 170
175Glu Lys Glu Ala Ser Arg Phe Ala Glu Glu His Gly Ile Gly Leu Val
180 185 190Thr Val Cys Pro Gly Leu
Thr Val Gly Ala Ala Pro Ala Pro Thr Ala 195 200
205Arg Thr Ser Val Pro Asn Cys Leu Ser Leu Leu Ser Gly Asp
Glu Ala 210 215 220Ala Phe Ala Val Leu
Asp Ala Ile Glu Ser Ala Thr Gly Cys Leu Pro225 230
235 240Leu Val His Val Asp Asp Val Cys Arg Ala
Glu Leu Phe Ala Ala Glu 245 250
255Glu Gly Ala Ala Ala Arg Arg Tyr Val Cys Cys Gly Leu Asn Thr Thr
260 265 270Val Ala Glu Leu Ala
Arg Phe Leu Ala Asp Lys Tyr Pro Gln Tyr Gly 275
280 285Val Lys Thr Asn Leu Leu Ser Gly Glu Arg Leu Glu
Lys Pro Arg Val 290 295 300Cys Leu Ser
Ser Ala Lys Leu Val Lys Glu Gly Phe Glu Phe Arg Tyr305
310 315 320Arg Thr Leu Asp Asp Ile Tyr
Asp Asp Met Val Glu Tyr Gly Lys Ala 325
330 335Leu Gly Ile Leu Pro Asp Leu
34095340PRTA. thaliana 95Met Asp Gln Thr Leu Thr His Thr Gly Ser Lys Lys
Ala Cys Val Ile1 5 10
15Gly Gly Thr Gly Asn Leu Ala Ser Ile Leu Ile Lys His Leu Leu Gln
20 25 30Ser Gly Tyr Lys Val Asn Thr
Thr Val Arg Asp Pro Glu Asn Glu Lys 35 40
45Lys Ile Ala His Leu Arg Lys Leu Gln Glu Leu Gly Asp Leu Lys
Ile 50 55 60Phe Lys Ala Asp Leu Thr
Asp Glu Asp Ser Phe Glu Ser Ser Phe Ser65 70
75 80Gly Cys Glu Tyr Ile Phe His Val Ala Thr Pro
Ile Asn Phe Lys Ser 85 90
95Glu Asp Pro Glu Lys Asp Met Ile Lys Pro Ala Ile Gln Gly Val Ile
100 105 110Asn Val Leu Lys Ser Cys
Leu Lys Ser Lys Ser Val Lys Arg Val Ile 115 120
125Tyr Thr Ser Ser Ala Ala Ala Val Ser Ile Asn Asn Leu Ser
Gly Thr 130 135 140Gly Ile Val Met Asn
Glu Glu Asn Trp Thr Asp Val Glu Phe Leu Thr145 150
155 160Glu Glu Lys Pro Phe Asn Trp Gly Tyr Pro
Ile Ser Lys Val Leu Ala 165 170
175Glu Lys Thr Ala Trp Glu Phe Ala Lys Glu Asn Lys Ile Asn Leu Val
180 185 190Thr Val Ile Pro Ala
Leu Ile Ala Gly Asn Ser Leu Leu Ser Asp Pro 195
200 205Pro Ser Ser Leu Ser Leu Ser Met Ser Phe Ile Thr
Gly Lys Glu Met 210 215 220His Val Thr
Gly Leu Lys Glu Met Gln Lys Leu Ser Gly Ser Ile Ser225
230 235 240Phe Val His Val Asp Asp Leu
Ala Arg Ala His Leu Phe Leu Ala Glu 245
250 255Lys Glu Thr Ala Ser Gly Arg Tyr Ile Cys Cys Ala
Tyr Asn Thr Ser 260 265 270Val
Pro Glu Ile Ala Asp Phe Leu Ile Gln Arg Tyr Pro Lys Tyr Asn 275
280 285Val Leu Ser Glu Phe Glu Glu Gly Leu
Ser Ile Pro Lys Leu Thr Leu 290 295
300Ser Ser Gln Lys Leu Ile Asn Glu Gly Phe Arg Phe Glu Tyr Gly Ile305
310 315 320Asn Glu Met Tyr
Asp Gln Met Ile Glu Tyr Phe Glu Ser Lys Gly Leu 325
330 335Ile Lys Ala Lys 34096348PRTP.
somniferum 96Met His Gly Gln Lys Asn Ile Ser Glu Arg Tyr Gln Lys Phe Lys
Glu1 5 10 15Met Glu Gly
Thr Gly Lys Ile Val Cys Val Thr Gly Gly Ala Gly Tyr 20
25 30Leu Ala Ser Trp Leu Ile Met Arg Leu Leu
Glu Arg Gly Tyr Ser Val 35 40
45Arg Thr Thr Val Arg Ser Asp Pro Lys Phe Arg Glu Asp Val Ser His 50
55 60Leu Lys Ala Leu Pro Glu Ala Thr Glu
Lys Leu Gln Ile Phe Glu Ala65 70 75
80Asp Leu Glu Asn Pro Glu Ser Phe Asp Asp Ala Ile Asn Gly
Cys Val 85 90 95Gly Val
Phe Leu Val Ala Gln Gly Met Asn Phe Ala Glu Glu Tyr Thr 100
105 110Leu Glu Lys Ile Ile Lys Thr Cys Val
Glu Gly Thr Leu Arg Ile Leu 115 120
125Gln Ser Cys Leu Lys Ser Lys Thr Val Lys Lys Val Val Tyr Thr Ser
130 135 140Ser Ala Asp Ala Ala Met Met
Ile Ser Asn Leu Lys Ala Val Lys Glu145 150
155 160Ile Asp Glu Thr Ile Trp Ser Glu Val Asp Asn Phe
Ile Ser Lys Pro 165 170
175Glu Gln Val Ile Pro Gly Leu Pro Ser Tyr Val Val Ser Lys Val Leu
180 185 190Thr Glu Arg Ala Cys Leu
Lys Phe Ser Glu Glu His Gly Leu Asp Val 195 200
205Val Thr Ile Leu Pro Pro Leu Val Val Gly Pro Phe Ile Thr
Pro His 210 215 220Pro Pro Pro Ser Val
Ser Ile Ala Leu Ser Ile Ile Ser Gly Asp Val225 230
235 240Ser Met Met Leu Gly Val Arg Leu Glu Asn
Ala Val His Ile Asp Asp 245 250
255Val Ala Leu Ala His Ile Phe Val Phe Glu Cys Glu Lys Ala Lys Gly
260 265 270Arg His Ile Cys Ser
Ser Val Asp Phe Pro Met His Asp Leu Pro Lys 275
280 285Phe Ile Ser Glu Asn Tyr Pro Glu Phe Asn Val Pro
Thr Asp Leu Leu 290 295 300Lys Asp Ile
Glu Glu Gln Glu Pro Val His Leu Ser Ser Asp Lys Leu305
310 315 320Leu Ser Met Gly Phe Gln Phe
Lys Tyr Asp Phe Ala Glu Ile Phe Gly 325
330 335Asp Ala Ile Arg Cys Ala Lys Glu Lys Gly Phe Leu
340 34597360PRTA. thaliana 97Met Val Arg Glu Glu
Glu Glu Asp Asp Asn Asn Gly Gly Gly Gly Glu1 5
10 15Arg Lys Leu Pro Val Ala Asp Glu Thr Val Pro
Ser Leu Leu Asp Gly 20 25
30Thr Gly Leu Val Cys Val Thr Gly Gly Thr Gly Phe Val Ala Ser Trp
35 40 45Leu Ile Met Arg Leu Leu Gln Arg
Gly Tyr Ser Val Arg Ala Thr Val 50 55
60Arg Thr Asn Pro Glu Gly Asn Lys Lys Asp Ile Ser Tyr Leu Thr Glu65
70 75 80Leu Pro Phe Ala Ser
Glu Arg Leu Gln Ile Phe Thr Ala Asp Leu Asn 85
90 95Glu Pro Glu Ser Phe Lys Pro Ala Ile Glu Gly
Cys Lys Ala Val Phe 100 105
110His Val Ala His Pro Met Asp Pro Asn Ser Asn Glu Thr Glu Glu Thr
115 120 125Val Thr Lys Arg Thr Val Gln
Gly Leu Met Gly Ile Leu Lys Ser Cys 130 135
140Leu Asp Ala Lys Thr Val Lys Arg Phe Phe Tyr Thr Ser Ser Ala
Val145 150 155 160Thr Val
Phe Tyr Ser Gly Lys Asn Gly Gly Gly Gly Gly Glu Val Asp
165 170 175Glu Ser Val Trp Ser Asp Val
Glu Val Phe Arg Asn Gln Lys Glu Lys 180 185
190Arg Val Ser Ser Ser Tyr Val Val Ser Lys Met Ala Ala Glu
Thr Ala 195 200 205Ala Leu Glu Phe
Gly Gly Lys Asn Gly Leu Glu Val Val Thr Leu Val 210
215 220Ile Pro Leu Val Val Gly Pro Phe Ile Ser Pro Ser
Leu Pro Ser Ser225 230 235
240Val Phe Ile Ser Leu Ala Met Leu Phe Gly Asn Tyr Lys Glu Lys Tyr
245 250 255Leu Phe Asp Thr Tyr
Asn Met Val His Ile Asp Asp Val Ala Arg Ala 260
265 270Met Ile Leu Leu Leu Glu Lys Pro Val Ala Lys Gly
Arg Tyr Ile Cys 275 280 285Ser Ser
Val Glu Met Lys Ile Asp Glu Val Phe Glu Phe Leu Ser Thr 290
295 300Lys Phe Pro Gln Phe Gln Leu Pro Ser Ile Asp
Leu Lys Asn Tyr Lys305 310 315
320Val Glu Lys Arg Met Ser Leu Ser Ser Lys Lys Leu Arg Ser Glu Gly
325 330 335Phe Glu Phe Lys
Tyr Gly Ala Glu Glu Ile Phe Gly Gly Ala Ile Arg 340
345 350Ser Cys Gln Ala Arg Gly Phe Leu 355
36098323PRTHomo sapiens 98Met Asp Pro Lys Tyr Gln Arg Val
Glu Leu Asn Asp Gly His Phe Met1 5 10
15Pro Val Leu Gly Phe Gly Thr Tyr Ala Pro Pro Glu Val Pro
Arg Asn 20 25 30Arg Ala Val
Glu Val Thr Lys Leu Ala Ile Glu Ala Gly Phe Arg His 35
40 45Ile Asp Ser Ala Tyr Leu Tyr Asn Asn Glu Glu
Gln Val Gly Leu Ala 50 55 60Ile Arg
Ser Lys Ile Ala Asp Gly Ser Val Lys Arg Glu Asp Ile Phe65
70 75 80Tyr Thr Ser Lys Leu Trp Cys
Thr Phe Phe Gln Pro Gln Met Val Gln 85 90
95Pro Ala Leu Glu Ser Ser Leu Lys Lys Leu Gln Leu Asp
Tyr Val Asp 100 105 110Leu Tyr
Leu Leu His Phe Pro Met Ala Leu Lys Pro Gly Glu Thr Pro 115
120 125Leu Pro Lys Asp Glu Asn Gly Lys Val Ile
Phe Asp Thr Val Asp Leu 130 135 140Ser
Ala Thr Trp Glu Val Met Glu Lys Cys Lys Asp Ala Gly Leu Ala145
150 155 160Lys Ser Ile Gly Val Ser
Asn Phe Asn Cys Arg Gln Leu Glu Met Ile 165
170 175Leu Asn Lys Pro Gly Leu Lys Tyr Lys Pro Val Cys
Asn Gln Val Glu 180 185 190Cys
His Pro Tyr Leu Asn Gln Ser Lys Leu Leu Asp Phe Cys Lys Ser 195
200 205Lys Asp Ile Val Leu Val Ala His Ser
Ala Leu Gly Thr Gln Arg His 210 215
220Lys Leu Trp Val Asp Pro Asn Ser Pro Val Leu Leu Glu Asp Pro Val225
230 235 240Leu Cys Ala Leu
Ala Lys Lys His Lys Arg Thr Pro Ala Leu Ile Ala 245
250 255Leu Arg Tyr Gln Leu Gln Arg Gly Val Val
Val Leu Ala Lys Ser Tyr 260 265
270Asn Glu Gln Arg Ile Arg Glu Asn Ile Gln Val Phe Glu Phe Gln Leu
275 280 285Thr Ser Glu Asp Met Lys Val
Leu Asp Gly Leu Asn Arg Asn Tyr Arg 290 295
300Tyr Val Val Met Asp Phe Leu Met Asp His Pro Asp Tyr Pro Phe
Ser305 310 315 320Asp Glu
Tyr99323PRTMus musculus 99Met Asp Ser Lys Gln Gln Thr Val Arg Leu Ser Asp
Gly His Phe Ile1 5 10
15Pro Ile Leu Gly Phe Gly Thr Tyr Ala Pro Gln Glu Val Pro Lys Ser
20 25 30Lys Ala Thr Glu Ala Thr Lys
Ile Ala Ile Asp Ala Gly Phe Arg His 35 40
45Ile Asp Ser Ala Ser Met Tyr Gln Asn Glu Lys Glu Val Gly Leu
Ala 50 55 60Ile Arg Ser Lys Ile Ala
Asp Gly Thr Val Lys Arg Glu Asp Ile Phe65 70
75 80Tyr Thr Ser Lys Val Trp Cys Thr Phe His Arg
Pro Glu Leu Val Arg 85 90
95Val Cys Leu Glu Gln Ser Leu Lys Gln Leu Gln Leu Asp Tyr Val Asp
100 105 110Leu Tyr Leu Ile His Phe
Pro Met Ala Met Lys Pro Gly Glu Asn Tyr 115 120
125Leu Pro Lys Asp Glu Asn Gly Lys Leu Ile Tyr Asp Ala Val
Asp Ile 130 135 140Cys Asp Thr Trp Glu
Ala Met Glu Lys Cys Lys Asp Ala Gly Leu Ala145 150
155 160Lys Ser Ile Gly Val Ser Asn Phe Asn Arg
Arg Gln Leu Glu Lys Ile 165 170
175Leu Lys Lys Pro Gly Leu Lys Tyr Lys Pro Val Cys Asn Gln Val Glu
180 185 190Cys His Pro Tyr Leu
Asn Gln Gly Lys Leu Leu Asp Phe Cys Arg Ser 195
200 205Lys Asp Ile Val Leu Val Ala Tyr Ser Ala Leu Gly
Ser His Arg Glu 210 215 220Lys Gln Trp
Val Asp Gln Ser Ser Pro Val Leu Leu Asp Asn Pro Val225
230 235 240Leu Gly Ser Met Ala Lys Lys
Tyr Asn Arg Thr Pro Ala Leu Ile Ala 245
250 255Leu Arg Tyr Gln Leu Gln Arg Gly Val Val Val Leu
Ala Lys Ser Phe 260 265 270Ser
Glu Lys Arg Ile Lys Glu Asn Met Gln Val Phe Glu Phe Gln Leu 275
280 285Thr Ser Glu Asp Met Lys Val Leu Asp
Asp Leu Asn Lys Asn Ile Arg 290 295
300Tyr Ile Ser Gly Ser Ser Phe Lys Asp His Pro Asp Phe Pro Phe Trp305
310 315 320Asp Glu
Tyr100317PRTS. lycopersicum 100Met Ala Glu Ala Thr Glu Met Pro Tyr Ile
Glu Leu Asn Thr Gly Phe1 5 10
15Ser Ile Pro Ala Val Gly Leu Gly Thr Trp Gln Ser Asp Pro Gly Val
20 25 30Val Gly Lys Ala Val Glu
Thr Ala Ile Lys Met Gly Tyr Arg His Ile 35 40
45Asp Cys Ala Gln Ile Tyr Lys Asn Glu Lys Glu Ile Gly Glu
Val Leu 50 55 60Ser Arg Leu Phe Lys
Asp Gly Val Val Lys Arg Arg Glu Leu Phe Ile65 70
75 80Thr Ser Lys Leu Trp Asn Thr Asn His Ala
Pro Glu Asp Val Pro Val 85 90
95Ala Leu Asp Lys Thr Leu Gln Asp Leu Gln Leu Glu Tyr Val Asp Leu
100 105 110Tyr Leu Ile His Trp
Pro Val Ser Met Lys Pro Gly Ser Val Asp Phe 115
120 125Lys Pro Glu Asn Leu Met Pro Thr Asn Ile Pro Arg
Ile Trp Glu Ala 130 135 140Met Glu Lys
Val Tyr Asp Ser Gly Lys Ala Arg Val Ile Gly Val Ser145
150 155 160Asn Phe Ser Thr Lys Lys Leu
Glu Asp Leu Leu Gln Val Ala Arg Thr 165
170 175Pro Pro Ala Val Asn Gln Val Glu Cys His Pro Ser
Trp Gln Gln Ala 180 185 190Lys
Leu Arg Glu Leu Cys Lys Ser Asn Asn Val His Leu Ser Ala Tyr 195
200 205Ser Pro Leu Gly Ser Pro Gly Thr Thr
Trp Leu Lys Ser Asp Val Leu 210 215
220Lys Gln Pro Ala Val Ile Ser Val Ala Glu Lys Leu Gly Lys Thr Pro225
230 235 240Ala Gln Val Cys
Leu Arg Trp Gly Ile Gln Met Gly Gln Ser Val Leu 245
250 255Pro Lys Ser Thr His Glu Ala Arg Ile Lys
Glu Asn Leu Asp Val Leu 260 265
270Asn Trp Ser Ile Pro Asp Asp Leu Leu Ala Lys Phe Ser Glu Ile Pro
275 280 285Gln Ala Arg Leu Leu Lys Gly
Ala Ser Phe Ala His Glu Thr His Gly 290 295
300Gln Tyr Arg Thr Leu Glu Glu Leu Trp Asp Gly Glu Ile305
310 315101331PRTS. lycopersicum 101Met Thr Met Asn
Leu Ile Lys Gln Met Leu Val Pro Asn Val Asn Leu1 5
10 15Asn Ser Gly His Lys Met Pro Leu Ile Gly
Met Gly Thr Ala Pro Ser 20 25
30Leu Pro Glu His Asp Gln Leu Val Ser Thr Leu Ile Asp Ala Ile Glu
35 40 45Ile Gly Tyr Arg His Phe Asp Thr
Ala Ala Val Tyr Gly Ser Glu Glu 50 55
60Ala Leu Gly Gln Ala Val Val Glu Ala Ile Gln Arg Gly Leu Ile Lys65
70 75 80Ser Arg Glu Gln Val
Phe Ile Thr Ser Lys Leu Trp Cys Thr Glu Thr 85
90 95His Arg His Leu Val Leu Pro Ala Leu Lys Arg
Thr Leu Gly Arg Leu 100 105
110Lys Met Asp Tyr Leu Asp Leu Tyr Leu Ile His Leu Pro Val Thr Met
115 120 125Lys Lys Lys Val Asn Ser Lys
Asp Asp Glu Met Arg Val Asp Lys Glu 130 135
140Asp Ile Ile Pro Phe Asp Met Arg Gly Thr Trp Glu Ala Met Glu
Glu145 150 155 160Cys Cys
Arg Leu Gly Leu Ala Lys Ser Ile Gly Val Ser Asn Phe Thr
165 170 175Cys Thr Lys Ile Ser Gln Ile
Leu His Tyr Ala Thr Ile Leu Pro Ala 180 185
190Val Asn Gln Val Glu Met His Val Ala Trp Arg Gln Glu Lys
Met Leu 195 200 205Glu Phe Cys Lys
Glu Lys Gly Ile His Val Ser Ala Trp Ser Pro Leu 210
215 220Gly Ala Asn Gly Leu Thr Pro Trp Gly Ile His Ser
Val Met Glu Ser225 230 235
240Pro Val Leu Lys Asp Ile Ala Ile His Lys Arg Lys Ser Val Ala Gln
245 250 255Val Ala Leu Arg Trp
Val Tyr Glu Gln Gly Ala Ser Val Ile Val Lys 260
265 270Ser Phe Asn Lys Glu Arg Met Lys Glu Asn Leu Gln
Ile Leu Asp Trp 275 280 285Glu Leu
Ser Asn Glu Glu Ile Ala Gln Ile Gln Glu Ile Pro Pro Cys 290
295 300Thr Gly Phe Asn Val Asp Met Val Leu Val His
Pro Asn Gly Pro Tyr305 310 315
320Lys Ser Ala Asn Gln Phe Trp Asp Gly Glu Ile 325
330102312PRTM. truncatula 102Met Gly Ser Val Glu Ile Pro Thr
Lys Val Leu Thr Asn Thr Ser Ser1 5 10
15Gln Leu Lys Met Pro Val Val Gly Met Gly Ser Ala Pro Asp
Phe Thr 20 25 30Cys Lys Lys
Asp Thr Lys Asp Ala Ile Ile Glu Ala Ile Lys Gln Gly 35
40 45Tyr Arg His Phe Asp Thr Ala Ala Ala Tyr Gly
Ser Glu Gln Ala Leu 50 55 60Gly Glu
Ala Leu Lys Glu Ala Ile Glu Leu Gly Leu Val Thr Arg Gln65
70 75 80Asp Leu Phe Val Thr Ser Lys
Leu Trp Val Thr Glu Asn His Pro His 85 90
95Leu Val Ile Pro Ala Leu Gln Lys Ser Leu Lys Thr Leu
Gln Leu Asp 100 105 110Tyr Leu
Asp Leu Tyr Leu Ile His Trp Pro Leu Ser Ser Gln Pro Gly 115
120 125Lys Phe Thr Phe Pro Ile Asp Val Ala Asp
Leu Leu Pro Phe Asp Val 130 135 140Lys
Gly Val Trp Glu Ser Met Glu Glu Gly Leu Lys Leu Gly Leu Thr145
150 155 160Lys Ala Ile Gly Val Ser
Asn Phe Ser Val Lys Lys Leu Glu Asn Leu 165
170 175Leu Ser Val Ala Thr Ile Leu Pro Ala Val Asn Gln
Val Glu Met Asn 180 185 190Leu
Ala Trp Gln Gln Lys Lys Leu Arg Glu Phe Cys Asn Ala Asn Gly 195
200 205Ile Val Leu Thr Ala Phe Ser Pro Leu
Arg Lys Gly Ala Ser Arg Gly 210 215
220Pro Asn Glu Val Met Glu Asn Asp Met Leu Lys Glu Ile Ala Asp Ala225
230 235 240His Gly Lys Ser
Val Ala Gln Ile Ser Leu Arg Trp Leu Tyr Glu Gln 245
250 255Gly Val Thr Phe Val Pro Lys Ser Tyr Asp
Lys Glu Arg Met Asn Gln 260 265
270Asn Leu Cys Ile Phe Asp Trp Ser Leu Thr Lys Glu Asp His Glu Lys
275 280 285Ile Asp Gln Ile Lys Gln Asn
Arg Leu Ile Pro Gly Pro Thr Lys Pro 290 295
300Gly Leu Asn Asp Leu Tyr Asp Asp305 310103321PRTP.
somniferum 103Met Glu Ser Asn Gly Val Pro Met Ile Thr Leu Ser Ser Gly Ile
Arg1 5 10 15Met Pro Ala
Leu Gly Met Gly Thr Ala Glu Thr Met Val Lys Gly Thr 20
25 30Glu Arg Glu Lys Leu Ala Phe Leu Lys Ala
Ile Glu Val Gly Tyr Arg 35 40
45His Phe Asp Thr Ala Ala Ala Tyr Gln Thr Glu Glu Cys Leu Gly Glu 50
55 60Ala Ile Ala Glu Ala Leu Gln Leu Gly
Leu Ile Lys Ser Arg Asp Glu65 70 75
80Leu Phe Ile Thr Ser Lys Leu Trp Cys Ala Asp Ala His Ala
Asp Leu 85 90 95Val Leu
Pro Ala Leu Gln Asn Ser Leu Arg Asn Leu Lys Leu Asp Tyr 100
105 110Leu Asp Leu Tyr Leu Ile His His Pro
Val Ser Leu Lys Pro Gly Lys 115 120
125Phe Val Asn Glu Ile Pro Lys Asp His Ile Leu Pro Met Asp Tyr Lys
130 135 140Ser Val Trp Ala Ala Met Glu
Glu Cys Gln Thr Leu Gly Phe Thr Arg145 150
155 160Ala Ile Gly Val Cys Asn Phe Ser Cys Lys Arg Leu
Gln Glu Leu Met 165 170
175Glu Thr Ala Asn Ser Pro Pro Val Val Asn Gln Val Glu Met Ser Pro
180 185 190Thr Leu His Gln Lys Asn
Leu Arg Glu Tyr Cys Lys Ala Asn Asn Ile 195 200
205Met Ile Thr Ala His Ser Val Leu Gly Ala Val Gly Ala Ala
Trp Gly 210 215 220Thr Asn Ala Val Met
His Ser Lys Val Leu His Gln Ile Ala Val Ala225 230
235 240Arg Gly Lys Ser Val Ala Gln Val Ser Met
Arg Trp Val Tyr Gln Gln 245 250
255Gly Ala Ser Leu Val Val Lys Ser Phe Asn Glu Ala Arg Met Lys Glu
260 265 270Asn Leu Lys Ile Phe
Asp Trp Glu Leu Thr Ala Glu Asp Met Glu Lys 275
280 285Ile Ser Glu Ile Pro Gln Ser Arg Thr Ser Ser Ala
Ala Phe Leu Leu 290 295 300Ser Pro Thr
Gly Pro Phe Lys Thr Glu Glu Glu Phe Trp Asp Glu Lys305
310 315 320Asp104320PRTA. thaliana 104Met
Ser Ala Leu Thr Phe Pro Ile Gly Ser Val His His Leu Met Pro1
5 10 15Val Leu Ala Leu Gly Thr Ala
Ala Ser Pro Pro Pro Glu Pro Ile Val 20 25
30Leu Lys Arg Thr Val Leu Glu Ala Ile Lys Leu Gly Tyr Arg
His Phe 35 40 45Asp Thr Ser Pro
Arg Tyr Gln Thr Glu Glu Pro Leu Gly Glu Ala Leu 50 55
60Ala Glu Ala Val Ser Leu Gly Leu Ile Gln Ser Arg Ser
Glu Leu Phe65 70 75
80Val Thr Ser Lys Leu Trp Cys Ala Asp Ala His Gly Gly Leu Val Val
85 90 95Pro Ala Ile Gln Arg Ser
Leu Glu Thr Leu Lys Leu Asp Tyr Leu Asp 100
105 110Leu Tyr Leu Ile His Trp Pro Val Ser Ser Lys Pro
Gly Lys Tyr Lys 115 120 125Phe Pro
Ile Glu Glu Asp Asp Phe Leu Pro Met Asp Tyr Glu Thr Val 130
135 140Trp Ser Glu Met Glu Glu Cys Gln Arg Leu Gly
Val Ala Lys Cys Ile145 150 155
160Gly Val Ser Asn Phe Ser Cys Lys Lys Leu Gln His Ile Leu Ser Ile
165 170 175Ala Lys Ile Pro
Pro Ser Val Asn Gln Val Glu Met Ser Pro Val Trp 180
185 190Gln Gln Arg Lys Leu Arg Glu Leu Cys Lys Ser
Lys Gly Ile Val Val 195 200 205Thr
Ala Tyr Ser Val Leu Gly Ser Arg Gly Ala Phe Trp Gly Thr His 210
215 220Lys Ile Met Glu Ser Asp Val Leu Lys Glu
Ile Ala Glu Ala Lys Gly225 230 235
240Lys Thr Val Ala Gln Val Ser Met Arg Trp Ala Tyr Glu Glu Gly
Val 245 250 255Ser Met Val
Val Lys Ser Phe Arg Lys Asp Arg Leu Glu Glu Asn Leu 260
265 270Lys Ile Phe Asp Trp Ser Leu Thr Glu Glu
Glu Lys Gln Arg Ile Ser 275 280
285Thr Glu Ile Ser Gln Ser Arg Ile Val Asp Gly Glu Val Tyr Ile Ser 290
295 300Glu Lys Gly Pro Ile Lys Ser Val
Thr Glu Met Trp Asp Gly Glu Ile305 310
315 320105259PRTD. lanata 105Met Ser Ser Lys Pro Arg Leu
Glu Gly Lys Val Ala Ile Ile Thr Gly1 5 10
15Ala Ala Ser Gly Ile Gly Glu Glu Thr Ala Arg Leu Phe
Val Glu His 20 25 30Gly Ala
Ser Val Val Val Ala Asp Val Gln Asp Glu Leu Gly Arg Gln 35
40 45Val Val Ala Ser Val Asn Ser Asp Asp Lys
Ile Ser Tyr Tyr His Cys 50 55 60Asp
Val Arg Asp Glu Lys Gln Val Ala Ala Thr Val Arg Tyr Ala Val65
70 75 80Glu Lys Tyr Gly Arg Leu
Asp Ile Met Leu Ser Asn Ala Gly Val Phe 85
90 95Gly Ala Leu Met Thr Asn Val Ile Asp Leu Asp Met
Val Asp Phe Glu 100 105 110Asn
Val Leu Ala Thr Asn Val Arg Gly Val Ala Asn Thr Ile Lys His 115
120 125Ala Ala Arg Ala Met Val Glu Gly Lys
Val Lys Gly Ser Ile Ile Cys 130 135
140Thr Ala Ser Val Ser Ala Ser Leu Gly Gly Met Gly Pro Pro Ala Tyr145
150 155 160Thr Ala Ser Lys
His Ala Val Leu Gly Leu Val Lys Gly Ala Cys Ala 165
170 175Glu Leu Gly Val His Gly Ile Arg Val Asn
Ser Val Ala Pro Tyr Gly 180 185
190Val Ala Thr Pro Met Pro Cys Ser Ala Tyr Gly Met Thr Pro Ser Gln
195 200 205Met Glu Glu Ala Asn Asn Ser
Arg Ala Asn Leu Lys Gly Val Val Leu 210 215
220Lys Ala Lys His Val Ala Glu Ala Ala Leu Phe Leu Ala Ser Asp
Glu225 230 235 240Ser Ala
Tyr Val Ser Gly Gln Asn Leu Ala Val Asp Gly Gly Phe Thr
245 250 255Val Val Arg10633DNAArtificial
SequenceGAME25 silencing construct for S. pennellii forward primer
106gcggccgcat tgtcactcta ttgtgttggc gtg
3310736DNAArtificial SequenceGAME25 silencing construct for S. pennellii
reverse primer 107ggcgcgccta aatttatatc ttttcaagtc acaatg
36
User Contributions:
Comment about this patent or add new information about this topic: